2FOHA

Structure of porcine pancreatic elastase in 40% trifluoroethanol
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
240
structure length
240
Chain Sequence
VVGGTEAQRNSWPSQISLQYRSGSSWAHTCGGTLIRQNWVMTAAHCVDRELTFRVVVGEHNLNQNNGTEQYVGVQKIVVHPYWNTDDVAAGYDIALLRLAQSVTLNSYVQLGVLPRAGTILANNSPCYITGWGLTRTNGQLAQTLQQAYLPTVDYAICSSSSYWGSTVKNSMVCAGGDGVRSGCQGDSGGPLHCLVNGQYAVHGVTSFVSRLGCNVTRKPTVFTRVSAYISWINNVIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords elastase-1
publication title Multiple solvent crystal structures: Probing binding sites, plasticity and hydration
pubmed doi rcsb
molecule tags Hydrolase
total genus 59
structure length 240
sequence length 240
ec nomenclature ec 3.4.21.36: Pancreatic elastase.
pdb deposition date 2006-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2fohA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2fohA01
1VCWA 1UVTH 2VIQA 3QK1A 2BLWA 3TGJE 3ZZ7A 1MTUA 2CV3A 3K2UA 1C5NH 1GHAG 3VGCB 2QY0B 1IQKA 1A5GH 1P0SH 5AFYH 7ESTE 3PMHB 4FUEA 4ABDA 3TNSA 4NIXA 1VGCC 4I8GA 4KKDA 1XUHA 2C3SA 4K8YA 1SGRE 1MTSA 3A84A 2J92A 2C8XB 2YNBA 3GYLB 2QXJA 2NU0E 4AG1A 4E7NA 1QFKH 2BTCE 4NG9H 1TOCB 3K6YA 1K1OA 4HFPB 4ZKOU 1E36B 5B6OA 1O35A 2NU3E 3C1KA 1K1NA 2QF3A 1YPLH 5HMAA 2OD3B 1OKXA 5A8ZA 1O32A 1S6HA 1TRNA 1WQSA 2WV5A 1GBHA 3SGAE 1HRTH 1O3MA 3QUMP 2BD4A 1MKWH 3KQEA 3U69H 1HJAB 1UHBA 2UWLA 1DXWA 3BTFE 2XCNA 4TWYA 2CF9H 4O03A 4Q2KA 1THRH 2IN2A 1Z1JA 3A86A 1ANEA 4NSVA 4UFFH 1SSXA 2EA3A 2ZU3A 2WPKS 3MI4A 1ZSJA 1IQGA 3SNCA 4Y10E 1O3CA 3LJJA 3O8BA 1TBRH 2C8ZB 3ZZ9A 1YPEH 1J16A 1V2PT 5JBCS 2QCYA 2GKVE 4IN2A 4IS5A 4MLFB 3A7YA 2W7UA 1Y5BT 3VB5A 4CHAC 1O2PA 1ZRBA 2FYQA 5BRRE 1OWJA 1IQMA 1UTKA 3OYPA 3ZVDA 1O2RA 1AE5A 1MKXK 1A46H 1IQFA 2F3CE 1NRQH 1UMAH 2CHAC 4INLA 5E8EH 1BHXB 1D9IA 1TFXA 5FHTA 4JZFH 3RU4D 1OSSA 1LHEH 1OWHA 1G2MA 4JYTA 2ZTZA 2XWAA 1W7GH 1NFXA 4DJZB 1XKBC 2FOMB 4FUJA 4XBCA 2AS9A 1P2OA 4MQAA 4ZROA 1O5DH 1QJ6B 1WYKA 4X6PA 2GMTC 2HNTC 2PHBA 1FI8A 3SJOA 5E2OA 1GHWH 2UUYA 2H9EH 3RMOH 1OP8A 3SNAA 1GGDB 3MH6A 3V7TA 3E90B 2FOFA 3RXSA 3GOVB 4IC5A 2IOTA 1QL9A 3SOSA 4CH2B 1A3BH 2P8OB 2BZ6H 5EXMA 1ELVA 1SGFG 2XW9A 3BTME 5FAHA 2G00A 2PV9B 1AU8A 4JYUH 2C8WB 1SLWB 1C5XB 1C2LA 4K3JA 4RKOB 2XBYA 1FAXA 2GCTB 4AYVB 1P57B 4DIIH 3TLOA 1K21H 1S6FA 5GCHG 5K7RA 1C4U2 3NXPA 1GBFA 1O2HA 1GI5A 4UFDH 4OS1A 4U30A 3BEFB 2FZZA 3EAJA 1YPKH 1XX9A 1JRSA 2Z7FE 1P01A 3K9XB 1DLKB 2ZIQH 2Z94A 4AFSA 3UR9A 3ZVGA 1V2VT 1XMNB 1BIOA 2OBQA 2I6SA 2ZCHP 2AERH 1GJAB 4SGBE 4K69A 3ZZ3A 1PPBH 2AGIX 1L0ZA 1GBCA 3TIUA 1TAWA 1O3FA 2ULLA 4OGYA 8GCHG 1IQEA 4AG2A 3VGCC 1GI0A 3TGIE 1XM1A 2PKSB 1EASA 4FUBA 4K1EA 4CREA 1P3CA 1SOTA 3RXFA 3A8CA 3M5OA 1CHGA 2AGEX 2ZFTA 1GI3A 4UD9H 3S7HB 2STAE 1LMWB 5DGJA 4ABJA 3RMLH 2FI4E 1JXPA 2D2DA 5FPTA 3N7OA 1G9IE 3P95A 1FY5A 1CGHA 1O3IA 3ZVFA 4Y8YA 1TQ0B 4DCDA 1BB0B 1DWCH 1QCPA 2ZWLH 3M5NA 2A32A 1YF4A 2JH5D 1GDNA 3M7TA 2FS8A 1V2OT 3ZV8A 2P3FH 2GGVB 2FODA 1ZJKA 3RXDA 3SUDA 3KNXA 4B76A 2PWXA 3PM3A 1IHTH 1NPMA 4INKA 1XXDA 4ISLA 2H9TH 1HJAC 1UVUH 4BOHA 1QB1A 5L2YH 5EGMA 4BANB 3ELAH 1HGTH 1BMNH 1YLCA 3BIUH 2LPRA 1TRMA 3SNDA 1C1NA 3SUEA 1BBRE 1DX5M 5HM2A 1W0YH 3TH2H 1TMUH 3O8DA 2ANYA 5GXPA 1BTWA 3GCHB 1YCPK 1GHVH 3SI3H 5GPIB 4AGKA 2Q1JA 2EI6A 4CRGA 1QY6A 1SVPA 3I78A 4TYDA 2H5CA 3TNTA 2W3KA 1H9IE 1YKTA 2VIOA 1O3PB 4FUFA 8LPRA 2OQ5A 2OQUA 3UQOA 2H2ZA 1C5MD 1G30B 1O30A 4CRFA 3RXGA 3TH4H 1P9SA 3LC3A 5FPSA 5LPFA 4AB9A 1AN1E 1K1LA 3BTDE 3H7TA 4GSOA 1TONA 3C27B 2W3IA 4BTTB 4D8NA 1GJDB 3CP7A 5IDKA 3RLYH 3NZIA 3EA7A 2B0FA 3UY9A 3RXJA 1UTNA 3HPTB 1GJ6A 2OBOA 2PSXA 1KDQA 3GY3A 4WF8A 3A8DA 1H9HE 1T7CA 1O3OA 3RXTA 3GICB 2ZKSA 3QTOH 3LGTA 2AFQB 3MH5A 1WU1A 2A4QA 1YPJH 3U9AH 1MCTA 1ZPZA 5ESBA 1NO9H 3UFAA 9LPRA 1PQAA 1GBBA 1AIXH 1LHGH 1AFQB 1ARBA 2F9OA 4OS2A 2O8WA 3TK9A 1GGDC 1RS0A 4Q7ZA 4LXBH 1F5KU 5DP9A 1S83A 1DFPA 2OTVA 2ZCLP 1ZTLA 1FPHH 1MUEB 2P8OC 5C1YA 1BBRK 1YPMH 2JETB 1O3NA 2Y6TA 2ZFPH 1TLDA 3SUFA 4MPXA 5A8XA 4TY6A 4WXVA 2BD8A 4JK5A 3TGKE 3D62A 3GCTF 1T31A 3BTKE 3LKWA 3MNCA 1EOJA 1EZXC 4BAMB 2BQ6B 2GCTC 1O2TA 1CHOG 1ZYOA 2GZ8A 2O8MA 3CS0A 1DLEA 1AD8H 4INHA 3A7TA 3D23A 1W10U 3PTBA 3T27A 3Q76A 2OC7A 2XBVA 2FX4A 1P04A 5DKMA 2HNTF 2A4GA 1DANH 1A61H 4JCNA 5EQQA 3SNBA 2FP7B 3ZZ6A 1SGYE 2XNIA 1KYNA 1UK4A 3S0NA 4WXIA 4X1QU 1P10A 5DP4A 3B8JA 1Z8IB 4XBBA 1TGBA 1BRBE 2XBXA 2BDIA 2ZI2H 3SNEA 2A5KA 2BDHA 1GDUA 3ZYEA 3ZZDA 2VNTA 1ELFA 1NROH 3FP6E 3GY6A 1O5FH 5CHAB 4MVNA 1ACBE 4F4OC 1E0FD 4B73A 3GY4A 1OXGA 2ZEBA 1Z8JB 3VXEH 2VIVA 2PKSC 1ELCA 1K1MA 2GD4B 3BTEE 1EB1H 5DP3A 2BVRH 1BTHH 1EAUA 2G51A 1DPOA 1YPHC 4K60A 3HK3B 1A0LA 1T8LA 5EXNA 1IQNA 3ZZ8A 1FUJA 1O2OA 2HALA 1ELDE 4KGAA 2TBSA 1Z71A 1ETTH 1CA0B 4IMZA 1GDQA 4YLQH 5F8TA 1ORFA 3URCA 1L1JA 3MO9A 1O3AA 3F68H 2OC1A 4I33A 1P2NA 2J2UA 1HB0B 1XUGA 3SN8A 1XUFA 1C5QA 1O2WA 3L33A 3SUGA 2BHGA 4FUCA 1B5GH 1C2HA 2BM2A 4NFFA 3U98H 3MMGA 1F0TA 1FMGA 5AFZH 1EJMA 1QB9A 3TJVA 1D3TB 1O2LA 3P8GA 1JBUH 3AAVA 3GCHC 2ZU2A 2RG3A 3HKJB 3UPEA 3BF6H 1UCYE 1EX3A 1P11E 2WPIS 3NKKA 1C2KA 2SGDE 4WWYA 3A7ZA 5IYTA 1NN6A 1MD8A 2CF8H 4K2YA 1OYQA 1YM0A 1G2LA 1SGNE 4MPVA 4D9QA 1DICA 1C2GA 1SBWA 2ZDNA 6LPRA 5JBTA 1EPTA 4I8JA 2ZECA 3S7KB 3W95A 1IQJA 1O3EA 3PYHA 3R3GB 1CGIE 3OX7U 3CENA 3EA8A 2ZZUH 1ZHRA 3U1IB 1C4V2 1KIGH 3G01A 1D3QB 1B7XB 3BTQE 4Y0ZE 2FOHA 4YESB 4A5TS 5C67A 1GCTB 3GY5A 5F03A 2PGBB 4AYYB 1T8NA 3VB3A 2WYJA 3SZNA 1S0QA 7KMEH 2ODYB 1BMMH 3RU4E 4HZHA 1TA6A 1C4Y2 1WQVH 1GJCB 1SR5C 2CXVA 1UTQA 3E16B 4GHTA 4ISIH 2ZDLA 1W3CA 5JB8S 1G3BA 1BT7A 1HBTH 1NFUA 1AFQC 2HLCA 1QHRB 4X8TH 5DP8A 3DFJA 4DW2U 3TPIZ 1BZXE 1T8MA 2FDAA 2H5DA 3A87A 3JZ2B 3MNXA 2A7HA 3M36A 1C2EA 1BHXF 1BITA 4ZXXH 1MZAA 2JETC 1V3XA 1NU7B 2AYWA 4LZ4B 3GDVA 1E34B 4FUGA 3UWJH 5JPMH 5HXFA 1UCYK 1QRWA 4B75A 5AHGH 1FNIA 2NU4E 1S85A 2RDLA 4NA7A 2ANKH 5LH8A 5DK1A 3AAUA 1FDPA 4B71A 5DG6A 2ZDMA 4TPIZ 2R3YA 1UTPA 2TRMA 2EEKA 1NC6A 4UEHH 2VWLA 1THPB 1VCQA 2FPZA 1YP9A 4MTBA 3VB4A 3PTNA 2I6QA 4QT8C 1O3GA 3QDZB 4TY7A 1TNKA 2Z9IA 3RC6A 1BTZA 3M5MA 3LC5A 3KEEA 5FX6A 5CHAC 1FAKH 4AB8A 1ABJH 3LPRA 1J17T 1QIXB 3ZVBA 1QBOA 2P94A 1IQLA 1DY9A 1ZJDA 3PWBA 1GJ7B 1SQTA 3MO3A 1LVOA 3UOUA 4NWKA 4GPGA 2B8OH 3M35A 4KP0A 5C2ZA 5GWZA 3MYWA 1H4WA 5CMXH 1HAYB 1NRRH 1LVBA 2DUCA 1GI9B 4AGJA 2SGFE 2QIQA 1O34A 2BLOA 3QLPH 2V3OH 2FI5E 5EW2H 3RXKA 1J9CH 1EJNA 1P09A 5EQSA 3AVZA 2PUQH 2ZHFH 1F7ZA 1C5ZB 1NU9A 2A7CA 2C4FH 1CA0C 3E91A 5FBEA 3UOPA 4WH6A 1B0EA 2VH0A 1HAOH 4X0WU 3SV8A 3DT0H 2ZGHA 4DIHH 1GJ4H 1ESBA 3L6PA 1UHBB 3KQDA 1KSNA 1XVOA 1LQDB 1O2NA 1HXFH 5A0CA 4WH8A 4LOYH 1TNJA 1FPCH 1QJ7B 3KF2A 1P2JA 3QWCH 1IQHA 3E1XB 2ZPQA 4BAHB 2R2WU 5L30H 1TALA 2G52A 2Q6GA 4IBLH 3V12A 5DO4H 1ZSLA 1Y3UA 3I77A 4JZ1A 3L3TA 3MU8A 1MAYA 2ZFSA 1TE0A 4A7IB 3A7VA 1E35B 3SU4A 1LVYA 1Z1IA 1IHSH 1T4VH 1L2EA 1TBQH 1SMFE 4MNXA 4ZXYH 2BXUH 2BDCA 4ABHA 1NRNH 1QA7A 1UTLM 1XUIA 3UWIA 3S9CA 3EA9A 3UREA 3EE0B 4XSKU 3ZVAA 1SGEE 2A2QH 4GAWA 4Z0KA 4LZ1H 4YZUA 1KTTB 2CGAA 4ABIA 3MH7A 1S0RA 2RA0A 2ZGXH 5PTPA 1HAGE 3D65E 1EZUC 1O36A 1EJAA 2XRCA 3GISB 1CT2E 1HPGA 2ZHWH 3SJKA 1B0FA 2F83A 2O8UA 1YLDA 1TIOA 2W5EA 4X8UH 1GCTC 5HYOA 5TJXA 1ZSKA 2P16A 4FU8A 4TPYA 3SV6A 1AI8H 1V2TT 3ODFA 3RXVA 4X2XA 3RXLA 2WPLS 1O3KA 1HJ9A 5F8XA 2KAIA 3RXBA 3ODDA 1NFWA 1DWBH 1NM6A 3QZRA 1PPCE 4ISNA 1C5LH 1HAHH 1XXFA 1V2UT 1KXBA 4BTIB 1DT2A 1DUEA 2V35A 1WSSH 2G81E 3GCTG 4OGXA 1HAIH 2Y80A 4O3UA 1KXDA 4HI3A 2ZP0H 4CBOA 1C2JA 5G4BA 3S9AA 3E0NB 1C1PA 2ZPSA 3K6ZA 3BG8A 2BB4A 1JOUB 1D6RA 5C5NA 1AQ7A 1E37B 2ZTXA 1AGJA 1J8AA 3RXAA 5C1UA 3B9FH 1LO6A 4ZHAA 1HUTH 2HNTE 2P3UB 1NRPH 1W12U 3Q3KA 2GT8A 1OPHB 1MTVA 1O33A 1KLIH 5AF9H 4NA8A 1SC8U 2QV1A 1BTXA 1FV9A 5EW1H 2BD2A 3HKIB 1HYLA 3LONA 5I25A 1HLTH 2ZFQH 2VH6A 3QZQA 3GCNA 3LIWA 1AMHA 1SL3A 2R0LA 3M3TA 1M9UA 1OS8A 2FTMA 3RC5A 2OXSA 2O8LA 3BIVH 4Y8ZA 1AWHB 5H4IB 2GVFA 3GDSA 1F0UA 4XE4A 2GCHF 4A6LA 3TH3H 2ZGJA 1O3JA 4UFEH 5C5OA 1K22H 5L6NH 3A82A 5JB9S 2BY9X 3MU5A 1TX6A 4JZIA 3RXUA 1FJSA 1ABIH 3KCGH 2SNVA 1O5EH 2P93A 1C5SA 2VIWA 4FXGH 1TGTA 3F9FA 5A0BA 4NIWA 3U8OH 1UVSH 1A0HB 1FY3A 1V2NT 1BJUA 4A1VA 1Q2WA 1RTKA 4R8TB 2G55A 2Z9JA 1VITH 4WVPE 3QGJA 3LH1A 2OC8A 4NGAH 1TYNA 1GHBF 1EP5A 2VIPA 1SGTA 4KTSA 4K8BA 3LDXH 3UIRA 1D3DB 2B5TB 2Q6DA 2PUXB 3PMAB 1ZGIA 3E8LA 4DURA 2G5NA 2C90B 4NIYA 1G3DA 1MAXA 2ILNA 1GI8B 2BD3A 1X7AC 1ZMLA 2VINA 3RXRA 1ZHPA 1F5RA 2ZO3H 1C1QA 4YOGA 3VB6A 1O5GH 1ZHMA 1W11U 4NSYA 2FOGA 1K9OE 8ESTE 1GVLA 2BDYA 5TCCA 1C2MA 2SGQE 3U8TH 4H6TA 2J95A 3FZZA 2J9NA 2AGGX 3UNRA 2TGDA 3SGQE 3GY7A 2R2MB 2WUBA 5T6GA 4OS6A 1OOKB 2QXIA 1QNJA 1A0JA 3F6UH 5JDUB 1QJ1B 3RXMA 4Y7AA 4JYVH 1GHYH 4MDSA 4B74A 1ANCA 1GBJA 2ZTYA 1F0SA 2BY8X 1GI6A 4CRBA 5T6FA 5GJ4B 3D49H 1MMJN 1CSOE 3OY6U 2ANWA 3UQVA 1HIAA 1ID5H 2XTTB 1HAXB 1QGFA 1SLVB 3ZZAA 4I31A 3KN2A 1P8VC 1OWKA 4ZAEA 1K1PA 3SV7A 1AWFH 5CE1A 1IQIA 3I29A 3STIA 3BEIB 1CE5A 1DM4B 4X6MA 1KDQB 2F9VA 2VVUA 1KLJH 1TPOA 4RSPA 1MKXH 4IC6A 3MH4A 2QXHA 3RXEA 3OY5U 2OC0A 2VGCB 1LHFH 2XCFA 1QA0A 3P92A 1MD7A 4X6NA 1EAIA 1TMTH 4YOJA 1C1RA 3LGUA 4NFEA 1KTSB 3A81A 1W7XH 1E38B 1NRSH 4IGDA 1G36A 3BV9B 5HGGA 2D8WA 3TITA 1OWDA 1P2MA 2A5AA 4KTCA 3MU1A 3LGWA 4UONA 1G3EA 1A5HA 1T4UH 1DVAH 2A1DB 2OINA 1AFEH 4Y8XA 1RGQA 2FXRA 4IMQA 4AFZA 1Y3VA 3U1JB 4I32A 1GI7B 4E7RG 5T6DA 3PB1E 3A7WA 1BQYA 2H1UA 1MU6B 4X1PU 1LDTT 3SGBE 3B23B 1DXPA 5A8YA 1P9UA 2ZG0H 3LGYA 1O2KA 3SU0A 1EXFA 5LPEA 2PGQB 4HTCH 1UTMA 4ZKRU 3MOCA 1CT0E 1GMHF 5C1XA 4J2YB 5JYIA 1D4PB 3OSYA 2ZCKP 4X2WA 1SGPE 3M7UA 3SU2A 1C1VH 1Z7KA 3QO6A 3LH3A 1EKBB 2BQ7B 9ESTA 4H6SB 1TGNA 2NU2E 5EXLA 3ATIA 4H42U 3KIDU 3A80A 1FZZA 3DUXH 2ANMH 2A2XH 2RCEA 3DHKH 1L1GA 2Z3CA 1T8OA 3T5FH 1MKWK 1GWAA 4BAKB 1TA2A 1C2IA 2TGPZ 4WMEA 4XDEA 4E05H 4YOIA 1UK2A 3SU1A 2ALPA 4YO9A 4YTAA 5A2MH 1O38A 1Z8GA 1ELEE 3AW1A 1DWDH 3Q3YA 1A5IA 1PFXC 1UJ1A 3Q3XA 1AVWA 2AMPA 2BYAX 3MU4A 4D9RA 1QBNA 1GJ5H 1TNHA 1J15A 1ZZZA 4ZHMU 1XVMA 3PV4A 2BD5A 1C2DA 5GIBA 1SGQE 1JIMA 3BTWE 3SO3A 4GCHF 1G37A 1PJPA 2F91A 3GYMA 3ZYDA 1JWTA 1W14U 4DG4A 3E3TA 2XC5A 2PLXA 3RM0H 1A1RA 5DP6A 1TRYA 1ESTA 3M3VA 2A45B 2FIRH 4O97A 3M7QA 3MO6A 1Q31A 4X2VA 2GZ9A 4Y0YE 1KXFA 1S81A 2O9QA 2ZHDA 5E2PA 4X1NU 1D6WA 1YPHE 4FU7A 3A8AA 1MH0A 5FXLA 3UTUH 5FBIA 2ZHQH 2HPQH 2NWNA 1LPKB 2F9BH 5AVDA 1P02A 5E0HA 2BDAA 1AHTH 1C5UA 1GCDA 2GTBA 1BMLA 3BEUA 3MU0A 3RXPA 2IJOB 2HVXA 6GCHF 3QTVH 1SGFA 5LGOA 1AVXA 1DSUA 5T3HA 1JRTA 4O9VA 2QN5T 3ZVCA 3FP7E 3UNQA 2FM2A 1ZTKA 3UUZA 1LCYA 2HOBA 3F9HA 1V2ST 1S5SA 4U01A 1YCPH 3UNSA 3IWMA 1EPTB 1VZQH 2BY6X 2QGRA 1ELAA 2GT7A 2VB0A 2F9NA 1VJ9U 4B2AA 1PQ5A 1Y3WA 4Y11E 4ABGA 1NS3A 3EGKH 1AZZA 1INCA 2CN0H 4I8KA 4ISHH 4NZQA 2Z9KA 2R3UA 3BTGE 7LPRA 3TJNA 1RFNA 2UUJB 1P05A 1ZLRA 2ZGBH 3P8OA 1BUIA 3HGNA 2VGCC 1DDJA 4FUDA 2JH6D 4A92A 3A7XA 1Z6JH 1FY4A 3TJOA 2QAAA 1GL1A 2UUFB 4AORA 5JBBS 3ZVEA 3PLBA 1GI2A 1GL0E 1O3HA 3SORA 2WPJS 3BN9A 3F1SB 1O2GH 3PLKA 1HAVA 3T2NA 1HFDA 4LK4A 4GLYA 4GUXA 5JBAS 2SFAA 1BRAA 3T28A 1O3DA 1AO5A 3ATLA 3F9EA 4HGCA 4BAOB 2ZPRA 4A1TA 2ASUB 4X6OA 1HAVB 2D1JA 2EI8A 3O8CA 2JH0D 1BRUP 1GBTA 2LNCA 2PW8H 1O2JA 3RXQA 4CRAA 3BG4B 3NCLA 1GI1A 1KXAA 4WMDA 2QC2A 1TABE 5DJ7A 1MZDA 3GCOA 3LJOA 1BBRH 5A0AE 1THSH 1XKAC 2Y82A 1HXEH 3PO1B 2GV7A 2A31A 4E06H 4FVDA 2GCHG 3FANA 2WV4A 3ATKA 3P8NA 4TWWA 4WY3A 2AMDA 4ABAA 1MBMA 1ZPBA 1G3CA 1LKBA 1LHDH 1FXYA 4JZEH 1P2QA 3MNSA 1RD3B 2BDBA 2B7DH 2FOBA 2FESH 4OS7A 2P3TB 4ZKSU 2FYRA 3DFLA 2H6MA 1A7SA 3GY2A 2Y5GA 1NFYA 1YGCH 6CHAB 4KTUA 4OS5A 2WINI 3ZZCA 1EP6A 2VJ1A 1O2MA 1S84A 2SGAA 1DITH 1L4DA 2QYIA 3EDXB 1SHYA 1ZRKA 3ZZBA 1GHBG 3A83A 1K28D 4AOQA 1BA8B 1XUKA 4WJG2 1MTNB 1ANDA 3E6PH 1BDAA 1GJ9B 4K1SA 3SU6A 4Y6DA 3VXFH 1HV7A 2JKHA 4YT7H 1PYTD 3RC4A 1FONA 3SQHE 3P70B 4H4FA 2W7SA 5EU8A 3U8RH 4ZUHA 2FO9A 1H9LB 3ESTA 4NWLA 1O2VA 2VWMA 4NA9H 3SHCH 1A2CH 3M37A 2WYGA 5DP5A 1V2RT 1GVZA 3SU3A 1BOQA 3A85A 2A5IA 3VPKA 1C1UH 5ESTE 2FTLE 3GDUA 5E0GA 1F2SE 1YYY1 3RU4T 1F0RA 1O2QA 2EI7A 1QB6A 1MU8B 4NCYA 1QRXA 1H8IH 1VR1H 1GMDF 2PSYA 4BXWA 1C2FA 4X8VH 3OU0A 4XFQA 1W0ZU 2AMQA 4DOQA 1EUFA 1LKAA 3E0PB 1GG6B 1UTJA 1EZQA 1AUJA 1TX8A 2ZU1A 5EPYA 3RUOA 1CBWB 3WY8A 5FX5A 4DY7B 2G8TA 2VU8E 3SU5A 3K65B 1FQ3A 4ZHLU 3M5LA 1FY8E 2XWBI 2STBE 4AZ2B 1EPTC 1J14A 5A09A 1JMOH 1QURH 5EPNA 2GDDA 4A1XA 1S82A 2VVCA 1LHCH 1TGCA 1LPZB 2BDGA 1O2YA 4MG3A 4CR5A 2PKAA 1NZQH 4FUHA 1KLTA 1YC0A 3S9BA 1TX7A 1VITF 3HATH 1WV7H 3SV9A 4Q80A 1NT1A 2YOLA 2Z9LA 3O8RA 3RMNH 3V13A 2PKAB 1ZGVA 3AASA 5J4SA 1LQEA 1O5AB 1CVWH 2O8TA 3TK5A 5ABWA 2XYAA 2ZGCA 2UWOA 2XXLA 1BJVA 4YM9A 2KAIB 1WTHD 3FP8E 2QA9E 1Y5AT 1O2IA 2DE8A 1SI5H 1QQUA 1V2QT 2ODPA 3MHWU 3V0XA 1GBMA 4AFUA 1ELGA 1SFQB 4FVBA 1HAPH 2HWLB 1F92A 1MQ6A 2AH4X 1GBDA 4BNRA 3FFGA 1SLXB 7GCHF 3S69A 5EOKA 2HRVA 3FVFB 1C5TA 1Y3XA 4B2CA 1V2JT 3ENSB 4J1YA 1DOJA 3AW0A 1FIZA 3V3MA 1GMHG 2BLVA 2TGTA 1RTLA 5GDSH 4UE7H 1Y5UT 2FLBH 1DWEH 1MQ5A 2BD9A 1WTGH 3SJ9A 3QGNB 1HAZB 3Q77A 4CRDA 3DA9B 4CRCA 3SI4H 3BG4C 2ZU4A 2V0BA 3KQCA 1HDTH 2YNAA 1RTFB 1GVKB 2VVVA 1MCVA 4UFGH 1C5OH 3PO1C 2PTCE 2TIOA 4ESTE 1GJ8B 5C20A 2Y7XA 4MNVA 3PWCA 1WUNH 1UCYH 1UTOA 3SQEE 2P59A 4K5ZA 4RKJB 1EATA 1ZOMA 2SNWA 5HM9A 1GHAF 4YT6H 1ZTJA 1WBGB 1QL8A 2NU1E 4U2WA 5J4QA 1KXCA 1SHHB 1OWEA 4I8HA 2Z6BD 1YCPM 3LU9B 3BTHE 4ASHA 1D3PB 1OWIA 1VJAU 2FOAA 1WOFA 2FOCA 1EAXA 2FOEA 1ELTA 5DPAA 6CHAC 1ETRH 3KHVA 1V2LT 1T32A 4GCHG 4X1SU 3MWIU 2SGPE 2ZQ1A 2BXTH 1O0DH 3W94A 2OLGA 3QX5H 1EQ9A 2BMGB 3R0FA 4I8LA 1V2MT 1MTNC 1C9TA 1UO6A 1N8OB 1C9PA 1GMCG 3Q00A 4DGJA 1C1TA 1LVMA 1CQQA 1PPFE 2Z9GA 4CH8B 1CGJE 1GBLA 5F8ZA 3TU7H 3STJA 1SOZA 2R0KA 1SPJA 1RIWB 2BVXH 3ITIA 3LT3A 1Y59T 3NK8A 1GBEA 4YLUA 3T62A 3ATMA 4UDWH 1TB6H 2ZNKH 2WPHS 2BQWB 1GBAA 1V2WT 2Y81A 4Q7XA 1A4WH 2A4RA 1C5WB 4U32A 2J4IA 1O3LA 5DP7A 4XBDA 1W2KH 6GCHG 1FIWA 3VFEA 2R9PA 1GHZA 1HCGA 4O3TA 1OX1A 1ELBA 3UR6A 2ZFRH 1UVOA 1RXPA 1TQ7B 1DUAA 2PTNA 1P2IA 1AKSA 1PQ8A 2V6NA 1ESAA 1CO7E 2GX4A 4X2YA 1SFIA 2FI3E 1GG6C 1UK3A 2J94A 3EQ0H 3TVJB 1CBWC 1Z6EA 1QL7A 2OP9A 1AKSB 4WMFA 2ZDVH 1VCPA 1HIAB 1O5BB 5FCKA 4ISOA 1AZ8A 5E0JA 1O39A 2UWPA 1TPSA 2BY5X 1GHXH 1OP2A 1JIRA 1FY1A 4ABEA 4MNWA 3TK6A 1DS2E 1O2ZA 1RRKA 3BTTE 4SGAE 5FCRA 1P03A 1C1SA 2GP9B 5EODA 1TNIA 4JK6A 1AB9B 2GV6A 1NESE 2C93B 3CS7A 3ATWA 6ESTA 4RN6A 4BTUB 3TJUA 2BX3A 2Y5FA 2EC9H 1TWXB 2PR3A 3M61U 3MTYA 2TGAA 1AUTC 2HPPH 2BX4A 3IG6B 3GY8A 2AIQA 2FWWA 2C8YB 1TGSZ 5LPRA 2GZ7A 2AEIH 1O2XA 1TNLA 3FZDA 2G5VA 3RLWH 1DSTA 2SGEE 4XOJA 4CR9A 2ZDAH 1P3EA 4VGCB 1BMAA 4D7GA 1SGCA 2ALVA 1SQAA 3RXCA 3H7OA 1PPEE 4ZKNU 4THNH 1EB2A 2FMJA 3PMJA 3RXOA 2XC0A 2Z3DA 2BOHB 1AY6H 4ABBA 4B2BA 2BD7A 1GI4A 4MPWA 2FS9A 2GDEH 1KY9A 1LPGB 1V6DA 1AVGH 5GCHF 3PROA 1FN6A 4ABFA 1BRCE 1NTPA 2Y5HA 3VEQB 2Z3EA 1WAYB 4D76A 2IPHA 3KQBA 1C5PA 3FAOA 4X1RU 1TNGA 1W13U 3ZZ4A 1GBIA 1PPZA 4PROA 4ZMAH 3HGPA 1PPHE 2ZF0H 1VGCB 1C5RA 2WUCA 1CT4E 1EOLA 2K1QA 2ZA5A 1K1JA 3KGPA 4IN1A 3SBKA 1ZMJA 1QR3E 2XC4A 8GCHF 2ZDKA 1N6YA 2B9LA 2P95A 1C1WH 4NZLA 1PYTC 2VIDA 3RM2H 4D7FA 4GHQA 1N6XA 1SG8B 2RA3A 2VWNA 4X8SH 4FUIA 2J34A 2A4OA 4JMYA 4DT7B 1QTFA 2A0QB 1TPAE 3NWUA 1PPGE 5C3NA 5K0HA 1BCUH 3SJ8A 1C1OA 1H8DH 1ZPCA 3P6ZB 3T29A 1FN8A 3DD2H 1QRZA 1TOMH 1A3EH 1N1LA 4IW4E 5ETXA 1BTUA 3T25A 2FX6A 5SGAE 1RJXB 2BLQA 3URDA 3OTJE 4Q7YA 1O31A 2THFB 4R0IA 2H9HA 5F6MA 1Q3XA 1P2KA 1GMCF 3T26A 1N8OC 1O37A 1V2KT 4NIVA 4AN7A 1C5YB 3QN7A 1IOEA 1K2I1 3RDZA 1Y8TA 1XUJA 1U6QA 1ETSH 2CMYA 3JZ1B 3VB7A 3H5CB 1RIWC 1C5VA 2A7JA 1GPZA 1P12E 3SV2H 5BPEA 2W26A 1GJBB 2ZQ2A 1ANBA 2OUAA 2G4UA 3NPSA 1H1BA 2G4TA 4CHAB 3ZV9A 1SB1H 2Y7ZA 1GMDG 3NUMA 3MNBA 1BTPA 1SLUB 3LGIA 2BVSH 5L2ZH 1YPGH 3F9GA 2F9PA 1HJ8A 3P17H 4Z6AH 3A88A 4Y76A 1UVPA 1BTYA 1L1NA 1O2SA 1Z8RA 2M5TA 4ZH8A 1DY8A 4MPUA 4AX9H 1ZR0A 3RMMH 2CHAB 3M3SA 3SJIA 1ZMNA 1EZSC 1EAWA 2QF0A 4B1TA 2PFEA 2BZAA 2FLRH 4JZDH 4K1TA 2F9UA 2TPIZ 1TPPA 1PQ7A 1G32B 1W8BH 1Y3YA 2OCVB 3RXIA 3PLPA 1OP0A 3BSQA 1C1MA 4Y79A 4Y71A 2ZFFH 3LGVA 1QBVH 1CA8B 5I46H 3HK6B 1O2UA 1VITG 1DE7H 1P06A 2ZHEH 3A8BA 1YBWA 4BAQB 2UUKB 1KXEA 3MFJA 2GMTB 4M7GA 4Y7BA 3ZZ5A 4GVUA 4FU9A 2HGTH 1AB9C 1LTOA 1SGDE 2ZC9H 3SW2B 2AIPA 2Q6FA 2J38A 4DVAU 1WCZA 2DE9A 1ARCA 2FEQH 1IAUA 7GCHG 5EG4A 1TMBH 2WPMS 4OS4A 4AFQA 3RP2A 2CJIA 2ZU5A 3SHAH 8KME2 3P8FA 3PMBB 1QQ4A 1GBKA 1L4ZA 1TBZH 3EYDA 1K1IA 1CU1A 2ESTE 2XBWA 1HNEE 2V3HH 5TCAA 4VGCC 4BXSA 1FLEE 2ODQA 2BOKA 5FPYA 4KELA 3RXHA 3A89A 5EQRA 1MTWA 1AE8H 3LOXA 1O5CB 2VWOA 3KL6A 2D26C 4CBNA 1SGIB 1OYTH 4MNYA 2QXGA 1O3BA 3IITA 1CHOF 1SQOA 1MBQA 2BY7X 4F49A 1F5LA 4I7YH 1NY22
chains in the Genus database with same CATH superfamily
1VCWA 1UVTH 2VIQA 3QK1A 2BLWA 3TGJE 3ZZ7A 1MTUA 2CV3A 3K2UA 1C5NH 1GHAG 3VGCB 3FN8A 2QY0B 1IQKA 1A5GH 1P0SH 5AFYH 7ESTE 3PMHB 4FUEA 4ABDA 3TNSA 4NIXA 1VGCC 4I8GA 4KKDA 1XUHA 2C3SA 4K8YA 1SGRE 5DN6D 1MTSA 3A84A 2J92A 2C8XB 2YNBA 3GYLB 2QXJA 2NU0E 4AG1A 4E7NA 2F4LA 1QFKH 2BTCE 4NG9H 1TOCB 3K6YA 1K1OA 4HFPB 4ZKOU 1E36B 4B6EA 3F2HA 5B6OA 1O35A 2NU3E 3C1KA 1K1NA 2QF3A 1YPLH 5HMAA 2OD3B 1OKXA 5A8ZA 1O32A 3KYGA 1S6HA 1TRNA 1WQSA 2WV5A 1GBHA 3SGAE 1HRTH 1O3MA 3QUMP 2BD4A 1MKWH 3KQEA 3U69H 1HJAB 1UHBA 2UWLA 1DXWA 3BTFE 2XCNA 4TWYA 2CF9H 4O03A 4Q2KA 1THRH 2IN2A 1Z1JA 3A86A 1ANEA 4NSVA 4UFFH 1SSXA 2EA3A 2ZU3A 2WPKS 3MI4A 1ZSJA 1IQGA 2IPQX 3SNCA 4Y10E 1O3CA 3LJJA 3O8BA 1TBRH 2C8ZB 3ZZ9A 1YPEH 1J16A 1V2PT 5JBCS 2QCYA 2GKVE 4IN2A 4IS5A 4MLFB 3GS9A 3A7YA 2W7UA 1Y5BT 3VB5A 4CHAC 1O2PA 1ZRBA 2FYQA 5BRRE 2WZQA 1OWJA 1IQMA 1UTKA 4ACAA 3OYPA 3ZVDA 1O2RA 1AE5A 1MKXK 5EJLA 1A46H 1IQFA 2F3CE 1NRQH 4ZCNA 1UMAH 4I86A 2CHAC 2V3MA 2KR7A 4INLA 5E8EH 1BHXB 1D9IA 1TFXA 5FHTA 4JZFH 3RU4D 1OSSA 1LHEH 1OWHA 1G2MA 4JYTA 3OEED 2ZTZA 2XWAA 1W7GH 1NFXA 4DJZB 1XKBC 3OAAD 2FOMB 4FUJA 4XBCA 2AS9A 1P2OA 4MQAA 4ZROA 1O5DH 1QJ6B 1WYKA 4X6PA 2GMTC 2HNTC 2PHBA 1FI8A 3SJOA 5E2OA 1GHWH 2UUYA 2H9EH 3RMOH 1OP8A 3SNAA 2L6OA 1GGDB 3MH6A 3V7TA 3E90B 2FOFA 2LELA 3RXSA 3GOVB 4IC5A 2IOTA 1QL9A 3SOSA 4CH2B 1A3BH 2P8OB 2BZ6H 5EXMA 1ELVA 1SGFG 2XW9A 3BTME 5FAHA 2G00A 2PV9B 1AU8A 4JYUH 1W0JD 2C8WB 1SLWB 1C5XB 1C2LA 4K3JA 4RKOB 2XBYA 1FAXA 2GCTB 4AYVB 1P57B 4DIIH 3TLOA 1K21H 1S6FA 5GCHG 5K7RA 1C4U2 3NXPA 1GBFA 1O2HA 3WWBA 1GI5A 4UFDH 4OS1A 4U30A 3BEFB 2FZZA 3EAJA 1YPKH 1XX9A 1JRSA 2Z7FE 1P01A 3K9XB 1DLKB 2ZIQH 2Z94A 4AFSA 3UR9A 3ZVGA 1V2VT 1XMNB 1BIOA 2OBQA 2I6SA 2ZCHP 2AERH 1GJAB 4SGBE 4K69A 3ZZ3A 1PPBH 2AGIX 1L0ZA 1GBCA 3TIUA 1TAWA 1O3FA 2ULLA 4OGYA 4TSFD 1IQEA 8GCHG 4AG2A 3VGCC 1GI0A 3TGIE 1XM1A 2PKSB 1EASA 4FUBA 4K1EA 4CREA 3VG8A 1P3CA 1SOTA 3RXFA 3A8CA 3M5OA 1CHGA 2AGEX 2ZFTA 1GI3A 4P02A 4UD9H 3S7HB 2STAE 1LMWB 5DGJA 4ABJA 3RMLH 2FI4E 1JXPA 2D2DA 5FPTA 3N7OA 1G9IE 3P95A 1FY5A 1CGHA 1O3IA 3ZVFA 4Y8YA 5C0UA 1TQ0B 4DCDA 1BB0B 2F43B 1DWCH 1QCPA 2ZWLH 3M5NA 2A32A 1YF4A 2JH5D 1GDNA 3M7TA 2FS8A 1V2OT 3ZV8A 2P3FH 2GGVB 2FODA 1ZJKA 3RXDA 3SUDA 3KNXA 4B76A 2PWXA 3PM3A 1IHTH 1NPMA 4INKA 1XXDA 4ISLA 2H9TH 1HJAC 1UVUH 4BOHA 1QB1A 5L2YH 5EGMA 4BANB 3ELAH 1HGTH 1BMNH 1YLCA 3BIUH 2LPRA 1TRMA 5FL7D 3SNDA 2WPDD 4F55A 1C1NA 3SUEA 1BBRE 1DX5M 5HM2A 1W0YH 3TH2H 1TMUH 3O8DA 2ANYA 5GXPA 1BTWA 3GCHB 1YCPK 2QF4A 1GHVH 3SI3H 5GPIB 4AGKA 2Q1JA 2EI6A 4OM9A 4CRGA 1QY6A 1SVPA 3I78A 4TYDA 2H5CA 3TNTA 2W3KA 1H9IE 1YKTA 2VIOA 1O3PB 4FUFA 8LPRA 2OQ5A 2OQUA 3UQOA 2H2ZA 1C5MD 1G30B 1O30A 4CRFA 3RXGA 3TH4H 1P9SA 3LC3A 5FPSA 5LPFA 4AB9A 1H8HD 1AN1E 1K1LA 3WWFA 3BTDE 3H7TA 4GSOA 1TONA 3C27B 2W3IA 4BTTB 4D8NA 1GJDB 3CP7A 5IDKA 3RLYH 3NZIA 3EA7A 2B0FA 2KM0A 2QF5A 3RXJA 3UY9A 1UTNA 3N7EA 3UB0A 3FOAA 3HPTB 4M9FA 1GJ6A 2OBOA 2PSXA 1KDQA 3GY3A 4WF8A 3A8DA 1H9HE 1T7CA 1O3OA 3RXTA 3GICB 2ZKSA 3QTOH 3LGTA 2AFQB 3MH5A 1WU1A 2A4QA 1YPJH 3U9AH 1MCTA 1ZPZA 5ESBA 1NO9H 3UFAA 9LPRA 1PQAA 1GBBA 1AIXH 1LHGH 1AFQB 1ARBA 2F9OA 4OS2A 2O8WA 3TK9A 1GGDC 1RS0A 4Q7ZA 4LXBH 1F5KU 4RT0A 5DP9A 1S83A 1DFPA 2OTVA 2ZCLP 1ZTLA 1FPHH 1MUEB 2P8OC 5C1YA 1BBRK 1YPMH 2JETB 1O3NA 2Y6TA 2ZFPH 1TLDA 3SUFA 4MPXA 5A8XA 4TY6A 4WXVA 2BD8A 4JK5A 3TGKE 3D62A 3GCTF 1T31A 3BTKE 3LKWA 3MNCA 1EOJA 1EZXC 4BAMB 2BQ6B 2GCTC 1O2TA 1CHOG 1ZYOA 2GZ8A 2O8MA 3CS0A 1DLEA 1AD8H 4INHA 3A7TA 3D23A 1W10U 3PTBA 3T27A 2KCYA 3Q76A 2OC7A 2XBVA 2FX4A 1P04A 5DKMA 2HNTF 2A4GA 1DANH 1A61H 4JCNA 5EQQA 3SNBA 2FP7B 3ZZ6A 1SGYE 2XNIA 1KYNA 1UK4A 3S0NA 4WXIA 4X1QU 1P10A 5DP4A 3B8JA 1Z8IB 4XBBA 1TGBA 1BRBE 1COWD 2XBXA 2BDIA 2ZI2H 3SNEA 2A5KA 2BDHA 1GDUA 3ZYEA 3ZZDA 2VNTA 1ELFA 1NROH 3FP6E 3GY6A 1O5FH 5CHAB 4MVNA 1ACBE 4F4OC 1E0FD 4B73A 3GY4A 1OXGA 2ZEBA 1Z8JB 3VXEH 2VIVA 2PKSC 1ELCA 1K1MA 4B6FA 2GD4B 3BTEE 1EB1H 5DP3A 2BVRH 1BTHH 1EAUA 1E1RD 2G51A 1DPOA 1YPHC 4K60A 3HK3B 1A0LA 1T8LA 5HIZA 5EXNA 1IQNA 3ZZ8A 1FUJA 1O2OA 2HALA 1ELDE 1SKYE 2TBSA 4KGAA 1Z71A 1ETTH 1UW7A 1CA0B 4IMZA 1GDQA 4YLQH 5F8TA 1ORFA 3URCA 1L1JA 3MO9A 1O3AA 3F68H 3F0OA 2OC1A 4I33A 1P2NA 3H09A 2J2UA 1HB0B 3F3BA 5T1VA 2YMSD 1XUGA 3SN8A 1XUFA 1C5QA 1O2WA 3L33A 3SUGA 2BHGA 4FUCA 1B5GH 1C2HA 2BM2A 4NFFA 3U98H 3MMGA 1F0TA 1FMGA 5AFZH 1EJMA 5KEDA 1QB9A 3TJVA 1D3TB 1O2LA 3P8GA 1JBUH 3AAVA 3GCHC 2ZU2A 2RG3A 3HKJB 3UPEA 3BF6H 1UCYE 1EX3A 1P11E 2QE7D 3DSGA 2WPIS 3NKKA 3UAIC 1C2KA 2SGDE 4WWYA 3A7ZA 5IYTA 1NN6A 1MD8A 2CF8H 4K2YA 1OYQA 1YM0A 1G2LA 1SGNE 4MPVA 4D9QA 1DICA 1C2GA 1SBWA 2ZDNA 6LPRA 5JBTA 1EPTA 4I8JA 2ZECA 3S7KB 3W95A 1IQJA 1O3EA 3PYHA 3R3GB 1CGIE 3OX7U 3CENA 3EA8A 2ZZUH 1ZHRA 3U1IB 1C4V2 1KIGH 3G01A 1D3QB 1B7XB 3BTQE 4Y0ZE 2FOHA 4YESB 4A5TS 5C67A 1GCTB 4ACBA 3GY5A 5F03A 2PGBB 4AYYB 1T8NA 3VB3A 2WYJA 3SZNA 1S0QA 7KMEH 2ODYB 1BMMH 3RU4E 4HZHA 1TA6A 1C4Y2 1WQVH 1GJCB 1SR5C 5EJZA 2CXVA 1UTQA 3E16B 4GHTA 4ISIH 2ZDLA 1W3CA 5JB8S 1G3BA 1BT7A 1HBTH 1NFUA 1AFQC 2HLCA 1QHRB 4X8TH 5DP8A 3DFJA 4DW2U 3TPIZ 1BZXE 1T8MA 5F53A 2FDAA 2H5DA 3A87A 3JZ2B 3MNXA 2A7HA 3M36A 1C2EA 1BHXF 1BITA 4ZXXH 1MZAA 2JETC 1V3XA 1NU7B 2AYWA 4F48B 4LZ4B 3GDVA 1E34B 4FUGA 3UWJH 5JPMH 3N99A 5HXFA 1UCYK 1QRWA 4B75A 5AHGH 1FNIA 2NU4E 1S85A 2RDLA 4NA7A 2ANKH 5LH8A 5DK1A 3AAUA 1FDPA 4B71A 5DG6A 2ZDMA 4TPIZ 2R3YA 1UTPA 2TRMA 2EEKA 1NC6A 4UEHH 2VWLA 1THPB 1VCQA 2W6JD 2FPZA 1YP9A 4MTBA 5C94A 3VB4A 3PTNA 2I6QA 4QT8C 1O3GA 3QDZB 4TY7A 1TNKA 2Z9IA 3RC6A 1BTZA 3M5MA 3LC5A 3KEEA 5FX6A 5CHAC 1FAKH 4AB8A 1ABJH 3LPRA 1J17T 1QIXB 3ZVBA 2LP6A 1QBOA 2P94A 1IQLA 1DY9A 1ZJDA 3PWBA 1GJ7B 1SQTA 2M2AA 3MO3A 1LVOA 3UOUA 4NWKA 4GPGA 2YMSB 2B8OH 3M35A 4KP0A 5C2ZA 5GWZA 3MYWA 1H4WA 5CMXH 1HAYB 1NRRH 1LVBA 2DUCA 1GI9B 4AGJA 2SGFE 2QIQA 1O34A 3AK5A 2BLOA 3QLPH 2V3OH 2FI5E 5EW2H 3RXKA 1J9CH 1EJNA 1P09A 5EQSA 1BMFD 3AVZA 2PUQH 2ZHFH 1F7ZA 1C5ZB 1NU9A 2A7CA 2C4FH 1CA0C 3E91A 3U28C 5FBEA 3UOPA 4WH6A 1B0EA 2VH0A 1HAOH 4X0WU 4ASUD 3SV8A 3DT0H 2ZGHA 4DIHH 1GJ4H 1ESBA 3L6PA 2K0QA 1UHBB 3KQDA 1KSNA 1XVOA 1LQDB 1O2NA 1HXFH 5A0CA 5CHBA 4WH8A 4LOYH 1TNJA 1FPCH 3F0PA 1QJ7B 3KF2A 1P2JA 3QWCH 1IQHA 2JIZD 3E1XB 2ZPQA 3PV5A 4BAHB 2R2WU 5L30H 1TALA 2G52A 2Q6GA 4IBLH 3V12A 1W0KD 5DO4H 1ZSLA 1Y3UA 3I77A 4JZ1A 3L3TA 3MU8A 1MAYA 2ZFSA 1TE0A 4A7IB 3A7VA 1E35B 3SU4A 1LVYA 1Z1IA 1IHSH 1T4VH 1L2EA 1TBQH 1SMFE 4MNXA 4ZXYH 2BXUH 2BDCA 4ABHA 1NRNH 1QA7A 1UTLM 1XUIA 3UWIA 3S9CA 3EA9A 3UREA 3EE0B 4XSKU 3ZIAD 3ZVAA 1SGEE 2A2QH 4GAWA 4Z0KA 4LZ1H 4YZUA 1KTTB 2CGAA 4ABIA 3MH7A 1S0RA 2RA0A 2ZGXH 5PTPA 1HAGE 3D65E 1EZUC 1O36A 1EJAA 2XRCA 3GISB 1CT2E 1HPGA 2ZHWH 3SJKA 1B0FA 2F83A 2O8UA 1YLDA 1TIOA 2W5EA 4X8UH 1GCTC 5HYOA 5TJXA 1ZSKA 2P16A 4FU8A 4TPYA 3SV6A 1AI8H 1V2TT 3ODFA 3RXVA 4X2XA 3RXLA 2WPLS 1O3KA 1HJ9A 5F8XA 2KAIA 3RXBA 3ODDA 1NFWA 1DWBH 1NM6A 3QZRA 3KQ5A 1PPCE 4ISNA 1C5LH 1HAHH 1XXFA 1V2UT 1KXBA 4BTIB 1DT2A 1DUEA 2V35A 1WSSH 2G81E 3GCTG 1NBMD 4OGXA 1HAIH 2Y80A 4O3UA 1KXDA 4HI3A 2ZP0H 4CBOA 1C2JA 5G4BA 3S9AA 3E0NB 3KYFA 1C1PA 2ZPSA 3K6ZA 3BG8A 2BB4A 1JOUB 1D6RA 5C5NA 4XD7D 1AQ7A 1E37B 2ZTXA 1AGJA 1J8AA 3RXAA 5C1UA 1E79D 3B9FH 1LO6A 4ZHAA 1HUTH 2HNTE 2P3UB 1NRPH 1W12U 3Q3KA 2GT8A 1OPHB 1MTVA 1O33A 1KLIH 5AF9H 4NA8A 1SC8U 2QV1A 1BTXA 1FV9A 5EW1H 2BD2A 3HKIB 1HYLA 3LONA 5HIYA 5I25A 1HLTH 2ZFQH 2VH6A 3QZQA 3GCNA 3LIWA 1AMHA 1SL3A 2R0LA 3M3TA 1M9UA 1OS8A 2FTMA 3RC5A 2OXSA 2O8LA 3BIVH 4Y8ZA 2J5UA 2XOKD 1AWHB 5H4IB 2GVFA 3GDSA 1F0UA 4XE4A 2GCHF 4A6LA 3TH3H 2ZGJA 1O3JA 4UFEH 5C5OA 1K22H 5L6NH 3A82A 5JB9S 2BY9X 3MU5A 1TX6A 4JZIA 3RXUA 1FJSA 1ABIH 3KCGH 2SNVA 1O5EH 2P93A 1C5SA 2VIWA 2YMSC 4FXGH 1TGTA 3F9FA 5A0BA 4NIWA 3U8OH 1UVSH 1A0HB 2J98A 1FY3A 1V2NT 1BJUA 4A1VA 1Q2WA 1RTKA 4R8TB 2G55A 2Z9JA 1VITH 4WVPE 3QGJA 3LH1A 2OC8A 4NGAH 1TYNA 1GHBF 1EP5A 2VIPA 1SGTA 4KTSA 4K8BA 3LDXH 3UIRA 1D3DB 2B5TB 2Q6DA 2PUXB 3PMAB 1ZGIA 3E8LA 4DURA 2G5NA 2C90B 4YXWD 4NIYA 1G3DA 1MAXA 2ILNA 1GI8B 2BD3A 1X7AC 1ZMLA 2VINA 2KCPA 3RXRA 1ZHPA 1F5RA 2ZO3H 1C1QA 4YOGA 3VB6A 1O5GH 1ZHMA 1W11U 2AHME 4NSYA 2FOGA 1K9OE 8ESTE 1GVLA 2BDYA 5TCCA 1C2MA 2SGQE 3U8TH 4H6TA 2J95A 3FZZA 2J9NA 2AGGX 3UNRA 2TGDA 3SGQE 3GY7A 2R2MB 2WUBA 5T6GA 2CK3D 4OS6A 1OOKB 2QXIA 1QNJA 1A0JA 3F6UH 3PV2A 5JDUB 1QJ1B 3RXMA 4Y7AA 4JYVH 1GHYH 4MDSA 4B74A 1ANCA 1GBJA 2ZTYA 1F0SA 2BY8X 1GI6A 4CRBA 5T6FA 5GJ4B 3D49H 1MMJN 1CSOE 3OY6U 2ANWA 2HLDD 3UQVA 1HIAA 1ID5H 2XTTB 1HAXB 1QGFA 1SLVB 3ZZAA 4I31A 3KN2A 1P8VC 1OWKA 4HG6A 4ZAEA 1K1PA 3SV7A 1AWFH 5CE1A 1IQIA 2JJ2D 3I29A 3STIA 3BEIB 1CE5A 1DM4B 4X6MA 1KDQB 2F9VA 2VVUA 1KLJH 1TPOA 5DSFA 4RSPA 1MKXH 3PRDA 4IC6A 3MH4A 2QXHA 3RXEA 3OY5U 2OC0A 2VGCB 1LHFH 2XCFA 1QA0A 3P92A 1MD7A 3EE7A 4X6NA 1EAIA 1TMTH 4YOJA 1C1RA 3LGUA 4NFEA 1KTSB 3A81A 1W7XH 1E38B 1NRSH 4IGDA 1G36A 3BV9B 5HGGA 2D8WA 3TITA 1OWDA 1P2MA 2A5AA 4KTCA 3MU1A 3LGWA 4UONA 1G3EA 1A5HA 1T4UH 1DVAH 2A1DB 2OINA 1AFEH 4Y8XA 3OFND 1RGQA 2FXRA 4IMQA 1KMHB 4AFZA 1Y3VA 3U1JB 4I32A 1GI7B 4E7RG 5T6DA 3OTPA 3A7WA 3PB1E 1BQYA 2H1UA 1MU6B 5EJ1A 4X1PU 1LDTT 3SGBE 3B23B 1DXPA 5A8YA 1P9UA 2ZG0H 3LGYA 1O2KA 3SU0A 1EXFA 5LPEA 2PGQB 4HTCH 3WW7A 1UTMA 2RFKC 4ZKRU 3MOCA 1CT0E 1GMHF 5C1XA 4J2YB 5JYIA 1D4PB 4TT3D 3OSYA 1QZ8A 2ZCKP 4X2WA 1SGPE 2KCOA 3M7UA 3SU2A 1C1VH 1Z7KA 3QO6A 3LH3A 1EKBB 2BQ7B 9ESTA 4H6SB 1TGNA 2NU2E 5EXLA 1K0HA 3ATIA 3DSPA 4H42U 3KIDU 3A80A 1FZZA 3DUXH 3F2GA 5B6LA 2ANMH 2A2XH 2RCEA 3DHKH 1L1GA 2Z3CA 1T8OA 3T5FH 1MKWK 1GWAA 4BAKB 1TA2A 1C2IA 2TGPZ 4WMEA 4XDEA 4E05H 4YOIA 1UK2A 3SU1A 2ALPA 4YO9A 4YTAA 5A2MH 1O38A 1Z8GA 1ELEE 3AW1A 1DWDH 3OE7D 3Q3YA 2GJGA 1A5IA 1PFXC 1UJ1A 3Q3XA 1AVWA 2AMPA 2BYAX 3MU4A 4D9RA 1QBNA 1GJ5H 1TNHA 1J15A 1ZZZA 4ZHMU 1XVMA 3PV4A 2BD5A 1C2DA 5GIBA 1SGQE 1JIMA 2L74A 3BTWE 3SO3A 4GCHF 1G37A 1PJPA 2F91A 3GYMA 3ZYDA 1JWTA 1W14U 4DG4A 3E3TA 2XC5A 2PLXA 3RM0H 1A1RA 5DP6A 1TRYA 1ESTA 3M3VA 2A45B 2FIRH 4O97A 3M7QA 3MO6A 1Q31A 4X2VA 2GZ9A 4Y0YE 1KXFA 1EFRD 1S81A 2O9QA 2ZHDA 5E2PA 4X1NU 1D6WA 1YPHE 1OHHD 4FU7A 3A8AA 1MH0A 5FXLA 3UTUH 5FBIA 2ZHQH 2HPQH 2NWNA 1LPKB 2F9BH 5AVDA 1P02A 5E0HA 2BDAA 1AHTH 1C5UA 1GCDA 2GTBA 1BMLA 3BEUA 3MU0A 3RXPA 2IJOB 2HVXA 6GCHF 3QTVH 1SGFA 2OK5A 5LGOA 1AVXA 1DSUA 5T3HA 1JRTA 4O9VA 2QN5T 3ZVCA 3FP7E 3UNQA 2FM2A 1ZTKA 3UUZA 1LCYA 2HOBA 3F9HA 1V2ST 1S5SA 4U01A 1YCPH 3UNSA 3IWMA 1EPTB 1VZQH 2BY6X 2QGRA 1ELAA 2GT7A 2VB0A 2F9NA 1VJ9U 4B2AA 4RT1A 1PQ5A 1Y3WA 4Y11E 4ABGA 1NS3A 3EGKH 1AZZA 1INCA 2CN0H 4I8KA 4ISHH 4Q63A 4NZQA 2Z9KA 2R3UA 3BTGE 7LPRA 3TJNA 2IJD1 1RFNA 2UUJB 2KFWA 1P05A 1ZLRA 2ZGBH 3P8OA 1BUIA 3HGNA 2VGCC 1DDJA 4FUDA 2JH6D 4A92A 3A7XA 1Z6JH 1FY4A 3TJOA 2QAAA 1GL1A 2UUFB 4AORA 5JBBS 3ZVEA 3PLBA 1GI2A 1GL0E 1O3HA 3SORA 2WPJS 3BN9A 3F1SB 1O2GH 3PLKA 1HAVA 3T2NA 1HFDA 4LK4A 4GLYA 4GUXA 5JBAS 4Q4LA 2SFAA 1BRAA 3T28A 1O3DA 1AO5A 2VBCA 3ATLA 3F9EA 4HGCA 4BAOB 2ZPRA 4A1TA 2ASUB 4X6OA 1HAVB 2D1JA 2EI8A 3O8CA 2JH0D 1BRUP 4DY7B 1GBTA 2LNCA 2PW8H 1O2JA 1NBME 3RXQA 4CRAA 3BG4B 3NCLA 1GI1A 1KXAA 4WMDA 2QC2A 1TABE 5DJ7A 1MZDA 3GCOA 3LJOA 1BBRH 2JDID 5A0AE 1THSH 1XKAC 2Y82A 1HXEH 3PO1B 2GV7A 2A31A 4E06H 4FVDA 2GCHG 3FANA 2WV4A 3ATKA 3P8NA 4TWWA 4WY3A 2AMDA 4ABAA 1MBMA 1ZPBA 1G3CA 1LKBA 1LHDH 1FXYA 4JZEH 1P2QA 3MNSA 1RD3B 2BDBA 2B7DH 2FOBA 2FESH 4OS7A 2P3TB 4ZKSU 2FYRA 2W6ID 3DFLA 2H6MA 1A7SA 3GY2A 2Y5GA 1WXRA 1NFYA 1YGCH 6CHAB 4KTUA 4OS5A 2WINI 3ZZCA 1EP6A 2VJ1A 1O2MA 1S84A 2SGAA 1DITH 1L4DA 2QYIA 3EDXB 1SHYA 1ZRKA 3ZZBA 1GHBG 3A83A 1K28D 4AOQA 1BA8B 1XUKA 4WJG2 1MTNB 1ANDA 3E6PH 1BDAA 1GJ9B 4K1SA 3SU6A 4Y6DA 3VXFH 4DT4A 1HV7A 2JKHA 4YT7H 1PYTD 3RC4A 2KX4A 1FONA 3SQHE 3P70B 2EY4C 4H4FA 2W7SA 5EU8A 3W1EA 3U8RH 2XNDD 4ZUHA 2FO9A 1H9LB 3ESTA 4NWLA 1O2VA 2VWMA 4NA9H 3SHCH 1A2CH 3M37A 1H8ED 2WYGA 5DP5A 1V2RT 1GVZA 3SU3A 1BOQA 3A85A 2A5IA 3VPKA 1C1UH 5ESTE 2FTLE 3GDUA 5E0GA 1F2SE 1YYY1 3RU4T 1F0RA 1O2QA 2EI7A 1QB6A 1MU8B 4NCYA 1QRXA 1H8IH 1VR1H 1GMDF 2PSYA 4BXWA 1C2FA 4X8VH 3OU0A 4XFQA 1W0ZU 2AMQA 4DOQA 1EUFA 1LKAA 3E0PB 1GG6B 1UTJA 1EZQA 1AUJA 1TX8A 2ZU1A 5EPYA 5KGOA 1CBWB 3RUOA 5FX5A 3WY8A 3DSOA 2G8TA 2VU8E 3SU5A 3K65B 1FQ3A 4ZHLU 3M5LA 1FY8E 2XWBI 2STBE 4AZ2B 1EPTC 1J14A 5A09A 1JMOH 1QURH 5EPNA 2GDDA 4A1XA 1S82A 2VVCA 1LHCH 1TGCA 1LPZB 2BDGA 1O2YA 1SQRA 4MG3A 4CR5A 2PKAA 1NZQH 4FUHA 1KLTA 1YC0A 3S9BA 1TX7A 1VITF 3HATH 1WV7H 3SV9A 4Q80A 1NT1A 2YOLA 2Z9LA 3O8RA 3RMNH 3NRLA 3V13A 2PKAB 1ZGVA 3AASA 5J4SA 1E1QD 1LQEA 1O5AB 1CVWH 2O8TA 3SYJA 1VKYA 3TK5A 5ABWA 2XYAA 2ZGCA 2UWOA 2XXLA 1BJVA 4YM9A 2KAIB 1WTHD 3FP8E 2QA9E 1Y5AT 1O2IA 2DE8A 1SI5H 1QQUA 1V2QT 2ODPA 3MHWU 2RDEA 1GBMA 3V0XA 4AFUA 1ELGA 1SFQB 4FVBA 1HAPH 2HWLB 1F92A 1MQ6A 2AH4X 1GBDA 4BNRA 2WSSD 1SLXB 3FFGA 7GCHF 3S69A 5EOKA 2HRVA 3FVFB 1C5TA 1Y3XA 4B2CA 1V2JT 3ENSB 4J1YA 1DOJA 3AW0A 1FIZA 3V3MA 1GMHG 2BLVA 4RI0A 2TGTA 1RTLA 5GDSH 4UE7H 1Y5UT 2FLBH 1DWEH 1MQ5A 2BD9A 5GNDA 1WTGH 3SJ9A 3QGNB 1HAZB 3Q77A 4CRDA 3DA9B 4CRCA 5HKKD 3SI4H 3BG4C 2WHXA 2ZU4A 2V0BA 3KQCA 1HDTH 3CNRA 2YNAA 1RTFB 1GVKB 2VVVA 1MCVA 4UFGH 1C5OH 3PO1C 2PTCE 2TIOA 4ESTE 1GJ8B 5C20A 2Y7XA 4MNVA 3PWCA 1WUNH 1UCYH 1UTOA 2KCAA 3SQEE 2P59A 4K5ZA 4RKJB 1EATA 1ZOMA 2SNWA 5HM9A 1GHAF 4YT6H 1ZTJA 1WBGB 1QL8A 2NU1E 4U2WA 5J4QA 1KXCA 1SHHB 1OWEA 4AC9A 4I8HA 2Z6BD 1YCPM 3LU9B 3BTHE 4ASHA 1D3PB 1OWIA 1VJAU 2FOAA 1WOFA 2FOCA 1EAXA 2FOEA 1ELTA 5DPAA 6CHAC 1ETRH 3KHVA 1V2LT 1T32A 4GCHG 4X1SU 3MWIU 2SGPE 2ZQ1A 2BXTH 1O0DH 1YWUA 3W94A 2OLGA 2J98B 3QX5H 1EQ9A 2BMGB 3R0FA 4I8LA 1V2MT 1MTNC 1C9TA 1UO6A 1N8OB 1C9PA 4Z1MD 1GMCG 3Q00A 4DGJA 1C1TA 1LVMA 1CQQA 1PPFE 2Z9GA 4CH8B 1CGJE 1GBLA 5F8ZA 3TU7H 3STJA 1SOZA 2R0KA 1SPJA 1RIWB 2BVXH 3ITIA 3LT3A 1Y59T 3NK8A 1GBEA 1WDIA 4YLUA 3T62A 3ATMA 4UDWH 1TB6H 2ZNKH 2WPHS 2BQWB 1GBAA 1V2WT 2Y81A 4Q7XA 1A4WH 2A4RA 1C5WB 4U32A 2J4IA 1O3LA 5DP7A 4XBDA 1W2KH 6GCHG 3DCLA 1FIWA 3VFEA 2R9PA 1GHZA 1HCGA 4O3TA 1OX1A 1ELBA 3UR6A 2ZFRH 1UVOA 2V7QD 1RXPA 1TQ7B 1DUAA 2PTNA 1P2IA 1FX0B 1AKSA 1PQ8A 2V6NA 1ESAA 1CO7E 2GX4A 4X2YA 4XRNA 1SFIA 2FI3E 2EQNA 2PP6A 4FETA 1GG6C 1UK3A 2J94A 3EQ0H 3TVJB 1CBWC 1Z6EA 1QL7A 2OP9A 1AKSB 4WMFA 2ZDVH 1VCPA 1HIAB 1O5BB 5FCKA 4ISOA 1AZ8A 5E0JA 1O39A 2UWPA 1TPSA 2BY5X 1GHXH 1OP2A 1JIRA 3N7DA 1FY1A 4ABEA 4MNWA 1S6LA 3TK6A 1DS2E 1O2ZA 1RRKA 3BTTE 4SGAE 5FCRA 1P03A 1C1SA 2GP9B 5EODA 1TNIA 4JK6A 1AB9B 2GV6A 1NESE 2C93B 3CS7A 3ATWA 6ESTA 4RN6A 4BTUB 3TJUA 2BX3A 2Y5FA 2EC9H 1TWXB 2PR3A 3M61U 3MTYA 2TGAA 1AUTC 2HPPH 2BX4A 3IG6B 3GY8A 2AIQA 2FWWA 2C8YB 1TGSZ 5LPRA 2GZ7A 2AEIH 1O2XA 1TNLA 3FZDA 2G5VA 3RLWH 1DSTA 2SGEE 4XOJA 4CR9A 2ZDAH 1P3EA 4VGCB 1BMAA 4D7GA 2K8IA 1SGCA 2ALVA 1SQAA 3RXCA 3H7OA 1PPEE 4ZKNU 5CDFE 4THNH 1EB2A 2FMJA 3PMJA 3RXOA 2XC0A 2Z3DA 2BOHB 1AY6H 4ABBA 4B2BA 2BD7A 1GI4A 4MPWA 2FS9A 2GDEH 1KY9A 1LPGB 1V6DA 1AVGH 5GCHF 3PROA 1FN6A 4ABFA 1BRCE 1NTPA 2Y5HA 3VEQB 1MABB 2Z3EA 1WAYB 4D76A 2IPHA 3KQBA 1C5PA 3FAOA 4X1RU 1TNGA 1W13U 5IK2D 3ZZ4A 1GBIA 1PPZA 4PROA 4ZMAH 3HGPA 1PPHE 5KECA 2ZF0H 1VGCB 1C5RA 2WUCA 1CT4E 1EOLA 2K1QA 2ZA5A 1K1JA 3KGPA 4IN1A 3SBKA 1ZMJA 1QR3E 2XC4A 2JJ1D 8GCHF 2ZDKA 1N6YA 2B9LA 2P95A 1C1WH 4NZLA 1PYTC 2VIDA 3RM2H 4D7FA 4GHQA 1N6XA 1SG8B 2RA3A 2VWNA 2HVYB 4X8SH 4FUIA 2J34A 2A4OA 4JMYA 4DT7B 1QTFA 2J97A 2A0QB 1TPAE 3NWUA 1PPGE 5C17A 3FO8D 5C3NA 5K0HA 1BCUH 3SJ8A 1C1OA 1H8DH 1ZPCA 3P6ZB 3T29A 1FN8A 3DD2H 1QRZA 1TOMH 1A3EH 1N1LA 4IW4E 5ETXA 1BTUA 2WV9A 3T25A 2FX6A 5SGAE 1RJXB 2BLQA 3URDA 3OTJE 4Q7YA 1O31A 2THFB 4R0IA 2H9HA 5F6MA 3F2FA 1Q3XA 1P2KA 1GMCF 3T26A 1N8OC 1O37A 1V2KT 4NIVA 4AN7A 1C5YB 3QN7A 1IOEA 3OEHD 1K2I1 3RDZA 1Y8TA 1XUJA 1U6QA 1ETSH 2CMYA 3JZ1B 3VB7A 3H5CB 1RIWC 1C5VA 2A7JA 1GPZA 1P12E 3SV2H 5BPEA 2W26A 1GJBB 2ZQ2A 1ANBA 2OUAA 2G4UA 3NPSA 1H1BA 2G4TA 4CHAB 3ZV9A 1SB1H 2Y7ZA 1GMDG 3NUMA 3MNBA 1BTPA 1SLUB 3LGIA 2BVSH 5L2ZH 1YPGH 3F9GA 3FKSD 2F9PA 5EIYA 1HJ8A 1YY3A 3P17H 2KZ4A 4Z6AH 3A88A 4Y76A 1UVPA 1BTYA 1L1NA 1O2SA 1Z8RA 2M5TA 4ZH8A 1DY8A 4MPUA 4AX9H 1ZR0A 3RMMH 2CHAB 3M3SA 3SJIA 1ZMNA 1EZSC 1EAWA 2QF0A 4B1TA 2PFEA 2BZAA 2FLRH 4JZDH 4K1TA 2F9UA 2TPIZ 1TPPA 1PQ7A 1G32B 1W8BH 4P00A 1Y3YA 2OCVB 1YLNA 3RXIA 3PLPA 1OP0A 3BSQA 1C1MA 4Y79A 4Y71A 2ZFFH 3LGVA 1QBVH 1CA8B 5I46H 4FOUC 3HK6B 1O2UA 1VITG 1DE7H 1P06A 2ZHEH 3A8BA 1YBWA 5C0TA 4BAQB 2UUKB 1KXEA 3MFJA 2GMTB 4M7GA 4Y7BA 3ZZ5A 4GVUA 4FU9A 2HGTH 1AB9C 1LTOA 1SGDE 2ZC9H 3SW2B 2AIPA 2Q6FA 2J38A 4DVAU 3PRBA 1WCZA 2DE9A 1ARCA 2FEQH 1IAUA 7GCHG 5EG4A 1TMBH 2WPMS 4OS4A 4AFQA 3RP2A 2CJIA 2ZU5A 3SHAH 8KME2 3SZEA 3P8FA 3PMBB 1QQ4A 1GBKA 1L4ZA 1TBZH 3EYDA 1K1IA 1CU1A 2ESTE 2XBWA 1HNEE 2V3HH 5TCAA 4VGCC 4BXSA 1FLEE 2ODQA 2BOKA 5FPYA 4KELA 3RXHA 3A89A 5EQRA 1MTWA 1AE8H 3LOXA 1O5CB 2VWOA 3KL6A 2D26C 4CBNA 1SGIB 1OYTH 4MNYA 2QXGA 1O3BA 3IITA 1CHOF 1SQOA 3MQKC 1MBQA 2BY7X 4F49A 1F5LA 4I7YH 1NY22
chains in the Genus database with same CATH topology
1VCWA 1UVTH 2VIQA 3QK1A 2BLWA 3TGJE 3ZZ7A 1MTUA 2CV3A 3K2UA 1C5NH 1GHAG 3VGCB 2QY0B 1IQKA 1A5GH 1P0SH 5AFYH 7ESTE 3PMHB 4FUEA 4ABDA 3TNSA 4NIXA 1VGCC 4I8GA 4KKDA 1XUHA 2C3SA 4K8YA 1SGRE 1MTSA 3A84A 2J92A 2C8XB 2YNBA 3GYLB 2QXJA 2NU0E 4AG1A 4E7NA 1QFKH 2BTCE 4NG9H 1TOCB 3K6YA 1K1OA 4HFPB 4ZKOU 1E36B 5B6OA 1O35A 2NU3E 3C1KA 1K1NA 2QF3A 1YPLH 5HMAA 2OD3B 1OKXA 5A8ZA 1O32A 1S6HA 1TRNA 1WQSA 2WV5A 1GBHA 3SGAE 1HRTH 1O3MA 3QUMP 2BD4A 1MKWH 3KQEA 3U69H 1HJAB 1UHBA 2UWLA 1DXWA 3BTFE 2XCNA 4TWYA 2CF9H 4O03A 4Q2KA 1THRH 2IN2A 1Z1JA 3A86A 1ANEA 4NSVA 4UFFH 1SSXA 2EA3A 2ZU3A 2WPKS 3MI4A 1ZSJA 1IQGA 3SNCA 4Y10E 1O3CA 3LJJA 3O8BA 1TBRH 2C8ZB 3ZZ9A 1YPEH 1J16A 1V2PT 5JBCS 2QCYA 2GKVE 4IN2A 4IS5A 4MLFB 3A7YA 2W7UA 1Y5BT 3VB5A 4CHAC 1O2PA 1ZRBA 2FYQA 5BRRE 1OWJA 1IQMA 1UTKA 3OYPA 3ZVDA 1O2RA 1AE5A 1MKXK 1A46H 1IQFA 2F3CE 1NRQH 1UMAH 2CHAC 4INLA 5E8EH 1BHXB 1D9IA 1TFXA 5FHTA 4JZFH 3RU4D 1OSSA 1LHEH 1OWHA 1G2MA 4JYTA 2ZTZA 2XWAA 1W7GH 1NFXA 4DJZB 1XKBC 2FOMB 4FUJA 4XBCA 2AS9A 1P2OA 4MQAA 4ZROA 1O5DH 1QJ6B 1WYKA 4X6PA 2GMTC 2HNTC 2PHBA 1FI8A 3SJOA 5E2OA 1GHWH 2UUYA 2H9EH 3RMOH 1OP8A 3SNAA 1GGDB 3MH6A 3V7TA 3E90B 2FOFA 3RXSA 3GOVB 4IC5A 2IOTA 1QL9A 3SOSA 4CH2B 1A3BH 2P8OB 2BZ6H 5EXMA 1ELVA 1SGFG 2XW9A 3BTME 5FAHA 2G00A 2PV9B 1AU8A 4JYUH 2C8WB 1SLWB 1C5XB 1C2LA 4K3JA 4RKOB 2XBYA 1FAXA 2GCTB 4AYVB 1P57B 4DIIH 3TLOA 1K21H 1S6FA 5GCHG 5K7RA 1C4U2 3NXPA 1GBFA 1O2HA 1GI5A 4UFDH 4OS1A 4U30A 3BEFB 2FZZA 3EAJA 1YPKH 1XX9A 1JRSA 2Z7FE 1P01A 3K9XB 1DLKB 2ZIQH 2Z94A 4AFSA 3UR9A 3ZVGA 1V2VT 1XMNB 1BIOA 2OBQA 2I6SA 2ZCHP 2AERH 1GJAB 4SGBE 4K69A 3ZZ3A 1PPBH 2AGIX 1L0ZA 1GBCA 3TIUA 1TAWA 1O3FA 2ULLA 4OGYA 8GCHG 1IQEA 4AG2A 3VGCC 1GI0A 3TGIE 1XM1A 2PKSB 1EASA 4FUBA 4K1EA 4CREA 1P3CA 1SOTA 3RXFA 3A8CA 3M5OA 1CHGA 2AGEX 2ZFTA 1GI3A 4UD9H 3S7HB 2STAE 1LMWB 5DGJA 4ABJA 3RMLH 2FI4E 1JXPA 2D2DA 5FPTA 3N7OA 1G9IE 3P95A 1FY5A 1CGHA 1O3IA 3ZVFA 4Y8YA 1TQ0B 4DCDA 1BB0B 1DWCH 1QCPA 2ZWLH 3M5NA 2A32A 1YF4A 2JH5D 1GDNA 3M7TA 2FS8A 1V2OT 3ZV8A 2P3FH 2GGVB 2FODA 1ZJKA 3RXDA 3SUDA 3KNXA 4B76A 2PWXA 3PM3A 1IHTH 1NPMA 4INKA 1XXDA 4ISLA 2H9TH 1HJAC 1UVUH 4BOHA 1QB1A 5L2YH 5EGMA 4BANB 3ELAH 1HGTH 1BMNH 1YLCA 3BIUH 2LPRA 1TRMA 3SNDA 1C1NA 3SUEA 1BBRE 1DX5M 5HM2A 1W0YH 3TH2H 1TMUH 3O8DA 2ANYA 5GXPA 1BTWA 3GCHB 1YCPK 1GHVH 3SI3H 5GPIB 4AGKA 2Q1JA 2EI6A 4CRGA 1QY6A 1SVPA 3I78A 4TYDA 2H5CA 3TNTA 2W3KA 1H9IE 1YKTA 2VIOA 1O3PB 4FUFA 8LPRA 2OQ5A 2OQUA 3UQOA 2H2ZA 1C5MD 1G30B 1O30A 4CRFA 3RXGA 3TH4H 1P9SA 3LC3A 5FPSA 5LPFA 4AB9A 1AN1E 1K1LA 3BTDE 3H7TA 4GSOA 1TONA 3C27B 2W3IA 4BTTB 4D8NA 1GJDB 3CP7A 5IDKA 3RLYH 3NZIA 3EA7A 2B0FA 3UY9A 3RXJA 1UTNA 3HPTB 1GJ6A 2OBOA 2PSXA 1KDQA 3GY3A 4WF8A 3A8DA 1H9HE 1T7CA 1O3OA 3RXTA 3GICB 2ZKSA 3QTOH 3LGTA 2AFQB 3MH5A 1WU1A 2A4QA 1YPJH 3U9AH 1MCTA 1ZPZA 5ESBA 1NO9H 3UFAA 9LPRA 1PQAA 1GBBA 1AIXH 1LHGH 1AFQB 1ARBA 2F9OA 4OS2A 2O8WA 3TK9A 1GGDC 1RS0A 4Q7ZA 4LXBH 1F5KU 5DP9A 1S83A 1DFPA 2OTVA 2ZCLP 1ZTLA 1FPHH 1MUEB 2P8OC 5C1YA 1BBRK 1YPMH 2JETB 1O3NA 2Y6TA 2ZFPH 1TLDA 3SUFA 4MPXA 5A8XA 4TY6A 4WXVA 2BD8A 4JK5A 3TGKE 3D62A 3GCTF 1T31A 3BTKE 3LKWA 3MNCA 1EOJA 1EZXC 4BAMB 2BQ6B 2GCTC 1O2TA 1CHOG 1ZYOA 2GZ8A 2O8MA 3CS0A 1DLEA 1AD8H 4INHA 3A7TA 3D23A 1W10U 3PTBA 3T27A 3Q76A 2OC7A 2XBVA 2FX4A 1P04A 5DKMA 2HNTF 2A4GA 1DANH 1A61H 4JCNA 5EQQA 3SNBA 2FP7B 3ZZ6A 1SGYE 2XNIA 1KYNA 1UK4A 3S0NA 4WXIA 4X1QU 1P10A 5DP4A 3B8JA 1Z8IB 4XBBA 1TGBA 1BRBE 2XBXA 2BDIA 2ZI2H 3SNEA 2A5KA 2BDHA 1GDUA 3ZYEA 3ZZDA 2VNTA 1ELFA 1NROH 3FP6E 3GY6A 1O5FH 5CHAB 4MVNA 1ACBE 4F4OC 1E0FD 4B73A 3GY4A 1OXGA 2ZEBA 1Z8JB 3VXEH 2VIVA 2PKSC 1ELCA 1K1MA 2GD4B 3BTEE 1EB1H 5DP3A 2BVRH 1BTHH 1EAUA 2G51A 1DPOA 1YPHC 4K60A 3HK3B 1A0LA 1T8LA 5EXNA 1IQNA 3ZZ8A 1FUJA 1O2OA 2HALA 1ELDE 4KGAA 2TBSA 1Z71A 1ETTH 1CA0B 4IMZA 1GDQA 4YLQH 5F8TA 1ORFA 3URCA 1L1JA 3MO9A 1O3AA 3F68H 2OC1A 4I33A 1P2NA 2J2UA 1HB0B 1XUGA 3SN8A 1XUFA 1C5QA 1O2WA 3L33A 3SUGA 2BHGA 4FUCA 1B5GH 1C2HA 2BM2A 4NFFA 3U98H 3MMGA 1F0TA 1FMGA 5AFZH 1EJMA 1QB9A 3TJVA 1D3TB 1O2LA 3P8GA 1JBUH 3AAVA 3GCHC 2ZU2A 2RG3A 3HKJB 3UPEA 3BF6H 1UCYE 1EX3A 1P11E 2WPIS 3NKKA 1C2KA 2SGDE 4WWYA 3A7ZA 5IYTA 1NN6A 1MD8A 2CF8H 4K2YA 1OYQA 1YM0A 1G2LA 1SGNE 4MPVA 4D9QA 1DICA 1C2GA 1SBWA 2ZDNA 6LPRA 5JBTA 1EPTA 4I8JA 2ZECA 3S7KB 3W95A 1IQJA 1O3EA 3PYHA 3R3GB 1CGIE 3OX7U 3CENA 3EA8A 2ZZUH 1ZHRA 3U1IB 1C4V2 1KIGH 3G01A 1D3QB 1B7XB 3BTQE 4Y0ZE 2FOHA 4YESB 4A5TS 5C67A 1GCTB 3GY5A 5F03A 2PGBB 4AYYB 1T8NA 3VB3A 2WYJA 3SZNA 1S0QA 7KMEH 2ODYB 1BMMH 3RU4E 4HZHA 1TA6A 1C4Y2 1WQVH 1GJCB 1SR5C 2CXVA 1UTQA 3E16B 4GHTA 4ISIH 2ZDLA 1W3CA 5JB8S 1G3BA 1BT7A 1HBTH 1NFUA 1AFQC 2HLCA 1QHRB 4X8TH 5DP8A 3DFJA 4DW2U 3TPIZ 1BZXE 1T8MA 2FDAA 2H5DA 3A87A 3JZ2B 3MNXA 2A7HA 3M36A 1C2EA 1BHXF 1BITA 4ZXXH 1MZAA 2JETC 1V3XA 1NU7B 2AYWA 4LZ4B 3GDVA 1E34B 4FUGA 3UWJH 5JPMH 5HXFA 1UCYK 1QRWA 4B75A 5AHGH 1FNIA 2NU4E 1S85A 2RDLA 4NA7A 2ANKH 5LH8A 5DK1A 3AAUA 1FDPA 4B71A 5DG6A 2ZDMA 4TPIZ 2R3YA 1UTPA 2TRMA 2EEKA 1NC6A 4UEHH 2VWLA 1THPB 1VCQA 2FPZA 1YP9A 4MTBA 3VB4A 3PTNA 2I6QA 4QT8C 1O3GA 3QDZB 4TY7A 1TNKA 2Z9IA 3RC6A 1BTZA 3M5MA 3LC5A 3KEEA 5FX6A 5CHAC 1FAKH 4AB8A 1ABJH 3LPRA 1J17T 1QIXB 3ZVBA 1QBOA 2P94A 1IQLA 1DY9A 1ZJDA 3PWBA 1GJ7B 1SQTA 3MO3A 1LVOA 3UOUA 4NWKA 4GPGA 2B8OH 3M35A 4KP0A 5C2ZA 5GWZA 3MYWA 1H4WA 5CMXH 1HAYB 1NRRH 1LVBA 2DUCA 1GI9B 4AGJA 2SGFE 2QIQA 1O34A 2BLOA 3QLPH 2V3OH 2FI5E 5EW2H 3RXKA 1J9CH 1EJNA 1P09A 5EQSA 3AVZA 2PUQH 2ZHFH 1F7ZA 1C5ZB 1NU9A 2A7CA 2C4FH 1CA0C 3E91A 5FBEA 3UOPA 4WH6A 1B0EA 2VH0A 1HAOH 4X0WU 3SV8A 3DT0H 2ZGHA 4DIHH 1GJ4H 1ESBA 3L6PA 1UHBB 3KQDA 1KSNA 1XVOA 1LQDB 1O2NA 1HXFH 5A0CA 4WH8A 4LOYH 1TNJA 1FPCH 1QJ7B 3KF2A 1P2JA 3QWCH 1IQHA 3E1XB 2ZPQA 4BAHB 2R2WU 5L30H 1TALA 2G52A 2Q6GA 4IBLH 3V12A 5DO4H 1ZSLA 1Y3UA 3I77A 4JZ1A 3L3TA 3MU8A 1MAYA 2ZFSA 1TE0A 4A7IB 3A7VA 1E35B 3SU4A 1LVYA 1Z1IA 1IHSH 1T4VH 1L2EA 1TBQH 1SMFE 4MNXA 4ZXYH 2BXUH 2BDCA 4ABHA 1NRNH 1QA7A 1UTLM 1XUIA 3UWIA 3S9CA 3EA9A 3UREA 3EE0B 4XSKU 3ZVAA 1SGEE 2A2QH 4GAWA 4Z0KA 4LZ1H 4YZUA 1KTTB 2CGAA 4ABIA 3MH7A 1S0RA 2RA0A 2ZGXH 5PTPA 1HAGE 3D65E 1EZUC 1O36A 1EJAA 2XRCA 3GISB 1CT2E 1HPGA 2ZHWH 3SJKA 1B0FA 2F83A 2O8UA 1YLDA 1TIOA 2W5EA 4X8UH 1GCTC 5HYOA 5TJXA 1ZSKA 2P16A 4FU8A 4TPYA 3SV6A 1AI8H 1V2TT 3ODFA 3RXVA 4X2XA 3RXLA 2WPLS 1O3KA 1HJ9A 5F8XA 2KAIA 3RXBA 3ODDA 1NFWA 1DWBH 1NM6A 3QZRA 1PPCE 4ISNA 1C5LH 1HAHH 1XXFA 1V2UT 1KXBA 4BTIB 1DT2A 1DUEA 2V35A 1WSSH 2G81E 3GCTG 4OGXA 1HAIH 2Y80A 4O3UA 1KXDA 4HI3A 2ZP0H 4CBOA 1C2JA 5G4BA 3S9AA 3E0NB 1C1PA 2ZPSA 3K6ZA 3BG8A 2BB4A 1JOUB 1D6RA 5C5NA 1AQ7A 1E37B 2ZTXA 1AGJA 1J8AA 3RXAA 5C1UA 3B9FH 1LO6A 4ZHAA 1HUTH 2HNTE 2P3UB 1NRPH 1W12U 3Q3KA 2GT8A 1OPHB 1MTVA 1O33A 1KLIH 5AF9H 4NA8A 1SC8U 2QV1A 1BTXA 1FV9A 5EW1H 2BD2A 3HKIB 1HYLA 3LONA 5I25A 1HLTH 2ZFQH 2VH6A 3QZQA 3GCNA 3LIWA 1AMHA 1SL3A 2R0LA 3M3TA 1M9UA 1OS8A 2FTMA 3RC5A 2OXSA 2O8LA 3BIVH 4Y8ZA 1AWHB 5H4IB 2GVFA 3GDSA 1F0UA 4XE4A 2GCHF 4A6LA 3TH3H 2ZGJA 1O3JA 4UFEH 5C5OA 1K22H 5L6NH 3A82A 5JB9S 2BY9X 3MU5A 1TX6A 4JZIA 3RXUA 1FJSA 1ABIH 3KCGH 2SNVA 1O5EH 2P93A 1C5SA 2VIWA 4FXGH 1TGTA 3F9FA 5A0BA 4NIWA 3U8OH 1UVSH 1A0HB 1FY3A 1V2NT 1BJUA 4A1VA 1Q2WA 1RTKA 4R8TB 2G55A 2Z9JA 1VITH 4WVPE 3QGJA 3LH1A 2OC8A 4NGAH 1TYNA 1GHBF 1EP5A 2VIPA 1SGTA 4KTSA 4K8BA 3LDXH 3UIRA 1D3DB 2B5TB 2Q6DA 2PUXB 3PMAB 1ZGIA 3E8LA 4DURA 2G5NA 2C90B 4NIYA 1G3DA 1MAXA 2ILNA 1GI8B 2BD3A 1X7AC 1ZMLA 2VINA 3RXRA 1ZHPA 1F5RA 2ZO3H 1C1QA 4YOGA 3VB6A 1O5GH 1ZHMA 1W11U 4NSYA 2FOGA 1K9OE 8ESTE 1GVLA 2BDYA 5TCCA 1C2MA 2SGQE 3U8TH 4H6TA 2J95A 3FZZA 2J9NA 2AGGX 3UNRA 2TGDA 3SGQE 3GY7A 2R2MB 2WUBA 5T6GA 4OS6A 1OOKB 2QXIA 1QNJA 1A0JA 3F6UH 5JDUB 1QJ1B 3RXMA 4Y7AA 4JYVH 1GHYH 4MDSA 4B74A 1ANCA 1GBJA 2ZTYA 1F0SA 2BY8X 1GI6A 4CRBA 5T6FA 5GJ4B 3D49H 1MMJN 1CSOE 3OY6U 2ANWA 3UQVA 1HIAA 1ID5H 2XTTB 1HAXB 1QGFA 1SLVB 3ZZAA 4I31A 3KN2A 1P8VC 1OWKA 4ZAEA 1K1PA 3SV7A 1AWFH 5CE1A 1IQIA 3I29A 3STIA 3BEIB 1CE5A 1DM4B