2FOHA

Structure of porcine pancreatic elastase in 40% trifluoroethanol
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
240
structure length
240
Chain Sequence
VVGGTEAQRNSWPSQISLQYRSGSSWAHTCGGTLIRQNWVMTAAHCVDRELTFRVVVGEHNLNQNNGTEQYVGVQKIVVHPYWNTDDVAAGYDIALLRLAQSVTLNSYVQLGVLPRAGTILANNSPCYITGWGLTRTNGQLAQTLQQAYLPTVDYAICSSSSYWGSTVKNSMVCAGGDGVRSGCQGDSGGPLHCLVNGQYAVHGVTSFVSRLGCNVTRKPTVFTRVSAYISWINNVIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords elastase-1
publication title Multiple solvent crystal structures: Probing binding sites, plasticity and hydration
pubmed doi rcsb
total genus 59
structure length 240
sequence length 240
ec nomenclature ec 3.4.21.36: Pancreatic elastase.
pdb deposition date 2006-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2fohA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2fohA01
3MWIU 1FPCH 1QL7A 2Q6FA 3IITA 1U6QA 1UK2A 3IG6B 3L33A 1O2XA 4NGAH 1GHYH 3QZRA 4I8KA 1LQEA 2FLBH 2BX4A 1F92A 4NA9H 3KN2A 3UFAA 1V2TT 1IQKA 1WTGH 1BQYA 4ZMAH 3HKJB 4OGXA 2F9NA 2PGBB 4GHQA 1GJCB 3MYWA 2R3UA 5HXFA 1S83A 2GVFA 2F9VA 2J9NA 1BT7A 1NY22 4PROA 1QCPA 3RXIA 1UCYE 1O5CB 5G4BA 1CGHA 3GY6A 1F0SA 3Q3YA 1CU1A 1DUEA 1FJSA 1WYKA 5DKMA 1YPHC 2G55A 2C93B 2NU0E 3UUZA 1XKAC 4UFFH 2GV6A 3RXHA 2CXVA 4CBNA 2CHAC 1YM0A 1QRXA 2VWOA 3LDXH 1GGDC 1GMHF 1TX8A 2GKVE 3T62A 5GCHF 1ETSH 1EASA 3RXLA 1O2PA 1TMTH 2JKHA 1DITH 1G3CA 3SV8A 4CH8B 2Z6BD 3E1XB 1TONA 3SHAH 2D8WA 1CBWC 2BY7X 3JZ1B 2Y5GA 1W7XH 2HNTF 4R8TB 1LPGB 1K1LA 4B2BA 2QY0B 1C5YB 2PKSB 3PMJA 2PW8H 1GDQA 3U8TH 4YZUA 2ZU4A 3FP8E 1O3JA 2ZDKA 1C5UA 1IQMA 2ANYA 1UO6A 2CN0H 2C8ZB 3F9HA 1LHGH 5EXMA 2UWPA 1TNGA 1KIGH 1O3NA 1ZMNA 3ZVFA 2ASUB 8GCHF 1P2QA 2GCTC 4BAHB 2VWNA 2ZECA 1GBAA 1RS0A 2G4UA 4FUDA 2BD2A 3BG4B 2FIRH 1ELCA 5C3NA 1TNIA 1DWCH 1OOKB 2BY6X 1L1NA 3VB5A 2HGTH 1YGCH 1VJ9U 3QTVH 1YC0A 3HATH 2JETC 1O33A 1P10A 1PQ7A 1IHTH 1P02A 4XE4A 1GJ6A 2QV1A 3BTFE 5GDSH 1UTMA 1UCYH 1VCPA 1IQNA 3ZVCA 4NSVA 2Z9IA 5K7RA 3TH4H 2Y5FA 1YP9A 1O30A 2PUQH 1MTWA 2BXTH 4GCHF 5A09A 3TVJB 1SGCA 1QNJA 4AORA 1O2HA 1NRSH 3VPKA 1HRTH 4R0IA 3ZYDA 4TWYA 2WYJA 2RG3A 4ZKOU 3E3TA 3RXUA 3W95A 1LQDB 1GPZA 1ELEE 4XBDA 1LPKB 4INKA 4K1SA 3QZQA 3HKIB 1DX5M 3ZVEA 3A85A 1NFXA 1SGIB 1O2YA 1O5GH 2NU1E 4ZKRU 3T2NA 4F49A 1OKXA 2VH6A 3VEQB 4WWYA 4LK4A 5LGOA 3W94A 1ELAA 2ZU2A 2J34A 5F6MA 2Y82A 4YT6H 3RU4E 1BBRK 2AH4X 5DK1A 4CRAA 3VXFH 1WCZA 3F9GA 3ATKA 5GIBA 2WPIS 2F9OA 1SGTA 1S82A 2OTVA 1AFQB 1OWIA 1LVOA 1WU1A 1RTKA 3ITIA 1JBUH 3P8GA 4D9RA 4Q7YA 1RJXB 3BTWE 1K1MA 2XCNA 1W12U 5SGAE 5DG6A 1GMDG 3MO6A 1HYLA 4HFPB 2BVRH 3M35A 4ZH8A 1OSSA 1OYTH 1SOZA 2BDIA 2STBE 2QF3A 2BD7A 1O3BA 1NFYA 4ZXXH 1T8MA 2P8OB 3ZZ6A 6CHAC 5GJ4B 3ZZAA 1W14U 2OC8A 2VU8E 1ZGVA 1AU8A 3UQVA 2XXLA 3MU4A 3LPRA 4AFUA 1TPSA 1AD8H 1ZGIA 5CMXH 1F0UA 1HJ9A 3E16B 3GDUA 3RXSA 4B74A 3EGKH 3UIRA 1LMWB 2ZTXA 1L2EA 3LT3A 3TU7H 2BXUH 3OX7U 3ZV9A 5EW2H 1FI8A 1NU7B 2ZQ2A 1GCTB 1SBWA 1AUTC 1MZAA 1UJ1A 5FX6A 3RLYH 2ZCHP 3A87A 2W7UA 4GPGA 2ANMH 2CJIA 1EPTB 4X2WA 1EAUA 2Z94A 2VIPA 4DVAU 7LPRA 1C5OH 1FONA 2ZZUH 2VB0A 1GJ5H 4I31A 2G5VA 1FV9A 1O2QA 1PPZA 2O9QA 2ZFTA 2QAAA 4NWKA 1W0YH 1GJ4H 3NCLA 4Y76A 3FP7E 2WPJS 4GVUA 1AMHA 1MZDA 1GHWH 2BLWA 4ZROA 1DICA 1O5AB 4WVPE 3UR9A 1JRSA 1D3DB 3I78A 1K28D 5JB8S 4GHTA 1UK3A 2Y7ZA 1ESTA 1BOQA 4E06H 4O9VA 1GI9B 3ATLA 1Y3WA 2FXRA 2R0KA 4IBLH 1OWHA 4B75A 1GJ8B 4IW4E 3Q76A 4AB8A 1A46H 2BY9X 3PWCA 3ATMA 4FUCA 5IYTA 1LDTT 4K1TA 1TQ0B 2BQ6B 2BZ6H 2BMGB 2SGQE 3VB6A 5JBTA 1AVXA 1GHZA 1O37A 1EAIA 1MU6B 2PSXA 4AYVB 1YPKH 1JMOH 1QBOA 2OXSA 2BD8A 3A80A 4X2XA 1C5XB 4BANB 2QA9E 2ODQA 1ZLRA 2FYRA 4X0WU 1Y59T 4E7RG 1UHBA 2EI8A 4ABJA 1HJAB 1D3TB 4WJG2 3UTUH 1GBHA 2AS9A 4WXVA 5AFZH 1O3KA 4MNVA 2BYAX 1Q2WA 4FUJA 1XX9A 2PKSC 3TJUA 4OS1A 3SNCA 2TGAA 3E0PB 1P3CA 1TA6A 1UMAH 3RXJA 1XXFA 4MNWA 1GBIA 3TH3H 2TGPZ 3U1IB 2ZKSA 1B0FA 1V2JT 3UREA 1O35A 1F5LA 2FX6A 2A32A 3BTQE 1DWBH 2XBYA 2SFAA 2A45B 1TGNA 3ELAH 2ZHFH 3M37A 4MPUA 5DP3A 2H9EH 2R3YA 1GL1A 1HIAA 2A4GA 3O8RA 1NC6A 1L4DA 1O2RA 4ABBA 1BRAA 2WPMS 3SNDA 1K1OA 1HCGA 2V6NA 3PV4A 5DP7A 1AIXH 1THSH 3D49H 3TK9A 3GCOA 1EZSC 2G4TA 2GDDA 2H6MA 2IOTA 1N1LA 2V3OH 2ZU5A 3Q3KA 1HFDA 1LO6A 2ZPQA 4WH8A 2FOBA 1D3QB 1G2MA 3AAVA 3T25A 3S9AA 1MCVA 4BOHA 4YOJA 2FOGA 1TNKA 3ODDA 3RXRA 1PFXC 2WUCA 1VCWA 1SPJA 5T6DA 1N6YA 3VB7A 1MU8B 1ELBA 1GI6A 4BTIB 2C8XB 2CGAA 1FY1A 1C9PA 2XCFA 2P59A 1TWXB 3RU4T 1A3EH 2J4IA 3V3MA 2BDAA 4NFEA 3OU0A 4X1NU 1GJBB 2F9BH 1RXPA 4UFDH 1C1OA 1NN6A 1EP5A 1ZPBA 1S0RA 1P0SH 5K0HA 2G51A 3VFEA 2EI6A 2OINA 3QX5H 2XBWA 2FODA 2AGEX 3SJIA 2FZZA 5DP5A 2FTMA 1D4PB 2PFEA 2A4RA 1N8OB 3LONA 1TRYA 4FU8A 5FCKA 1TBZH 2P94A 1HAZB 1PJPA 1MBQA 5EXLA 1AFQC 1NS3A 1TNLA 2XRCA 2QXJA 4XFQA 1ELFA 3SI3H 3SORA 1Z1JA 2A5IA 2BD9A 3OYPA 4MNXA 2FTLE 1C1SA 1FLEE 2OC1A 1H8DH 1OWKA 1XXDA 1Z8JB 1O2VA 3GDVA 1S0QA 1KXAA 4ABAA 1D3PB 1QURH 4FVBA 1QB9A 4X2VA 3TIUA 1FY5A 1LKBA 1ZRKA 1Z71A 2HPPH 3PWBA 5GXPA 3L6PA 2Y6TA 2GX4A 2AIQA 1GJDB 5BPEA 1HBTH 2UWOA 3DHKH 1TAWA 3SGAE 1K1NA 1HPGA 2ZI2H 2AMDA 3LJOA 3ZV8A 3P92A 1BHXF 2BLVA 3S69A 4TY6A 5HMAA 3M7TA 1CT4E 1VR1H 3H5CB 1KLJH 2ZHWH 2P3UB 1ANCA 1EZQA 2BTCE 4UEHH 2Z3EA 1ANEA 5TCAA 1O2GH 3RMNH 1QGFA 1LHDH 2ANKH 1GCTC 2FX4A 2QXGA 2GMTB 1D9IA 1LVBA 1O3OA 1ZHPA 3U69H 5EQQA 1CVWH 4RKOB 1NU9A 5GWZA 2F9PA 3FANA 1ZTLA 4ABEA 3SUGA 1DY8A 2STAE 2A31A 3U8OH 3PTNA 1CA0C 4X6OA 3SU1A 4JYTA 2GDEH 3CS7A 5F8ZA 4OS6A 3GCNA 3ENSB 3A86A 3P95A 5C1XA 1C1QA 2XWBI 1AVGH 2OUAA 1QB1A 4O03A 1SI5H 3KF2A 3D62A 4LXBH 1Z8GA 1EB1H 4I7YH 2HRVA 2H5DA 2B0FA 1FY3A 4ESTE 1GMDF 1W2KH 1ZOMA 5EG4A 1ELDE 1W8BH 2H5CA 3PMAB 1MTVA 1EZUC 3R3GB 4A1TA 1DWDH 4LZ1H 3BTEE 4CRDA 1PPCE 3K6ZA 2PV9B 1XUGA 4CREA 1SGFA 5EXNA 3HK3B 1FIZA 1FMGA 2VINA 5C5OA 1C1NA 4Y7AA 3A88A 3K65B 2VIVA 3B23B 1T31A 4JZIA 1JXPA 4YO9A 1SMFE 5F03A 2GCHG 3RXMA 4M7GA 1ABJH 2ZDVH 3VGCC 1J17T 2BDYA 1BIOA 3ZZ3A 2ZTZA 5C2ZA 2ZGJA 3STJA 1C2EA 5E2OA 4A7IB 5HYOA 1P11E 5T6FA 1GBKA 4F4OC 1YCPM 2J2UA 1NRPH 2ESTE 2SGAA 4DW2U 1SGYE 5FX5A 1F0TA 4X1RU 2W5EA 3S9CA 3RP2A 1L0ZA 4MLFB 1GJ7B 4X1PU 1BRCE 1WV7H 4HTCH 4BAKB 3SJKA 2NU3E 1AI8H 1THRH 2THFB 1TOCB 4Z6AH 1BUIA 1WQSA 3F6UH 4ABFA 1WOFA 3MH4A 4FUHA 1Z6EA 1Z8IB 8KME2 1ZMJA 3CENA 3BN9A 1Y5AT 3SBKA 4Y0ZE 1DDJA 1V2OT 3A89A 5J4SA 1EP6A 4HZHA 4Y7BA 3GY3A 2LNCA 3RDZA 1XVMA 2BDBA 2J94A 1F2SE 4AFQA 1AB9B 2AGIX 3MU0A 1SGPE 3TJNA 1PPGE 1CGIE 4CHAB 2V3HH 4MDSA 4Z0KA 3SQHE 1TRNA 1QL9A 1MCTA 3BIVH 3BV9B 3IWMA 4KELA 4VGCB 3SQEE 3LC5A 1BBRE 1F7ZA 1G9IE 2G00A 2Z7FE 1GBFA 3Q77A 2Z9KA 1IOEA 4ISIH 3HGNA 1GHBG 1KXDA 4IGDA 3RXQA 1INCA 4GUXA 1OYQA 5JDUB 1EX3A 1V2RT 3PMHB 1BMLA 3A7WA 3E91A 3SGBE 1TQ7B 4JZDH 4KKDA 2OQUA 5FCRA 1EPTA 4H6TA 1PQ5A 4IS5A 1ACBE 3SV7A 4ZHLU 1PYTD 1ELVA 2JH0D 1SVPA 2WYGA 1A0HB 1K1IA 1VITG 2W3KA 5I25A 2C8WB 2NU4E 5T3HA 2HNTE 2XBXA 3E6PH 4OS4A 3ZZ7A 1UVPA 3EDXB 2FI3E 1FQ3A 3A7XA 4Q80A 3KIDU 3CS0A 1A5HA 1D6RA 1O31A 3GYLB 5EU8A 2ODPA 1A0LA 2WPHS 2VWMA 1QHRB 3FFGA 5J4QA 1AKSB 3A8BA 4ZHAA 4AN7A 2Z9JA 1C5NH 1G30B 1QB6A 1ZHRA 1IQEA 3SU3A 4ZAEA 3BF6H 4Q7XA 1S6HA 2Y5HA 3K2UA 2BVSH 1C2MA 1S85A 3E90B 4DJZB 3P17H 1GBEA 2BOKA 3UNQA 1MTNB 1DT2A 5JYIA 1O3IA 2R2WU 3Q3XA 1HAIH 1GI7B 1UTQA 2PHBA 2TPIZ 4JYVH 3ZYEA 4O3TA 3SUEA 1QBVH 3ZVGA 3RMMH 4JZFH 4O97A 2AFQB 3EA7A 4GSOA 4NA7A 1BBRH 2ZHDA 2B8OH 4ISHH 1O5FH 1C5VA 3KQBA 1GVLA 1T8NA 2W26A 3RXEA 4CR5A 1G3BA 3ODFA 4O3UA 1O2KA 2P3TB 4OS2A 1ELTA 1QJ6B 1ZJDA 3M3TA 1P04A 1C4V2 3RLWH 2ZPRA 2YOLA 1ZJKA 4D76A 3M7QA 1BCUH 3GY4A 1FIWA 3GY8A 4FXGH 1KXFA 2RA0A 1G2LA 3TK6A 3AW0A 4NZLA 1G3EA 2ZHQH 3BIUH 1KTTB 2XC0A 1ESBA 2DE9A 1O36A 3U1JB 4JYUH 3F68H 3RXCA 2VIDA 1DFPA 1RIWC 1P8VC 1PPFE 3MU1A 1O3AA 4NWLA 3U98H 1GBMA 2OD3B 4X1QU 5BRRE 1TE0A 1GDNA 1XUFA 1K9OE 1Y8TA 1EB2A 3CP7A 4Q7ZA 3V12A 1OP2A 2GTBA 1W0ZU 2CF9H 1YLCA 1H1BA 1LHEH 4NZQA 1QY6A 3KQDA 1EJMA 3MNCA 3BEFB 3QO6A 4YT7H 2P93A 3E8LA 4TY7A 2QF0A 5GPIB 2JH6D 1EAXA 3LGVA 4A5TS 4MTBA 2GGVB 1KLIH 2UUJB 1QRZA 3GCHB 1UTJA 1G3DA 3JZ2B 1L1JA 2FI5E 4H42U 1ETTH 5DP9A 2ALPA 1VGCB 1TALA 1MMJN 1Y3UA 1YPLH 5A0AE 2BD5A 1TBQH 1TOMH 3T5FH 2HOBA 3ZZ8A 1Z7KA 5AFYH 4TPIZ 2VIOA 3LJJA 4JK6A 1LHFH 5CHAB 3RM2H 1C1PA 1HDTH 2R0LA 3GCTG 2VJ1A 3BTDE 1PQAA 1YPJH 2BB4A 3RXKA 2FWWA 1TLDA 2FEQH 2QXHA 1XUJA 3UNRA 1FZZA 1SHHB 1AB9C 7GCHG 1JWTA 4AX9H 1BHXB 3TGIE 4UFEH 2ANWA 3MO9A 2PKAB 1OS8A 3MH5A 1ANDA 2AIPA 1BRUP 1JRTA 1LVYA 1THPB 4CRGA 5DGJA 4IN2A 3GICB 4VGCC 5C1YA 2W7SA 4BAOB 1JIRA 5L2YH 1ARCA 1HAVB 1ZSKA 4K69A 3RMOH 1RRKA 1W3CA 3P70B 2ZNKH 4I32A 3SJOA 1FY8E 1T32A 1CT2E 2GCHF 2ZU3A 1SLVB 4NIWA 5CE1A 4X1SU 1LTOA 2FDAA 4FUGA 3PYHA 3ZVBA 2ILNA 2OP9A 3URCA 1ZR0A 2ODYB 4X8SH 4CBOA 1NZQH 5L6NH 1GDUA 4K8YA 4U32A 3P8FA 1C1UH 3NUMA 1ZTJA 3SUFA 2P3FH 5LPEA 1O2ZA 1A3BH 2W3IA 2QYIA 1C2HA 2CV3A 4D7FA 2GT7A 1A1RA 4JK5A 3A8CA 5I46H 2Z3DA 1NESE 4ABHA 2VGCB 1GMHG 1MKWK 1IQFA 4D9QA 1UVOA 1P3EA 2QC2A 2UUKB 4CR9A 2VVVA 4Y0YE 2IJOB 1GVKB 2D1JA 1BDAA 3BTGE 3GISB 4MVNA 2D2DA 2AYWA 3M5MA 3V7TA 3M5NA 3BG4C 1G36A 1OX1A 3RU4D 1EXFA 3EA8A 5EPYA 2WV5A 2ZF0H 1TYNA 4KTUA 1GG6B 3F1SB 1BTHH 1T4UH 2PUXB 3T28A 1E34B 1T8LA 3T27A 3H7TA 1V2WT 1CA8B 5LPFA 4X6PA 1A2CH 1O39A 4Y8XA 2XTTB 1C2KA 1QQUA 3O8DA 5PTPA 4LZ4B 3ATIA 2XC5A 1ZPCA 4MG3A 3OY6U 8GCHG 5JBAS 3RXGA 5AHGH 3LOXA 2UWLA 1FY4A 3O8BA 2B9LA 4B2AA 1WAYB 3TITA 1K22H 1GHBF 1KY9A 1EUFA 2EEKA 1C2GA 1WQVH 1GI4A 1HXEH 1V2MT 3UNSA 1C9TA 1CSOE 1OXGA 2XWAA 2ZDAH 3I29A 2PTCE 1W13U 1O38A 4MQAA 4XSKU 5E0HA 1GI1A 3KHVA 1J16A 4A92A 4BNRA 4IC6A 2K1QA 1YLDA 3RXAA 1ZYOA 1AHTH 2BOHB 1VITF 2C8YB 1V2NT 4Y11E 4ASHA 4THNH 4RKJB 3TH2H 2CHAB 3SU0A 3TK5A 3K9XB 4AGJA 2V35A 4U30A 1RD3B 4K5ZA 2XYAA 2OBOA 2BQWB 3RUOA 3SOSA 4BAQB 2GV7A 3OSYA 5JB9S 1M9UA 2GT8A 1CBWB 6GCHG 1QL8A 2XW9A 3PLBA 4FUFA 2BHGA 1OPHB 3RC4A 1E36B 3QDZB 1CQQA 2ZFQH 3TGJE 2ZGCA 3QGNB 5FAHA 2GZ8A 4YTAA 4DT7B 5C1UA 2P8OC 3C1KA 3GY2A 4X6NA 1C5ZB 4BTUB 1B0EA 1Q31A 1EOLA 2BZAA 4MPXA 1SOTA 1GHXH 4J2YB 1L4ZA 1W7GH 1BJVA 1TFXA 5AVDA 1LKAA 1O34A 2HPQH 1SGNE 2GCTB 3PMBB 1MTUA 1BJUA 1SFQB 1VGCC 3BSQA 1C1TA 1NFUA 4JZ1A 3A8AA 1BTXA 3LGUA 3DFJA 4TPYA 3SI4H 1BITA 1YCPH 1MBMA 3QWCH 1TNHA 1W11U 3RC6A 1GHVH 2R9PA 2JETB 5CHAC 1EPTC 3TLOA 5E2PA 1EQ9A 1O0DH 3KNXA 3SJ9A 4I8LA 4YLUA 1KSNA 3T29A 1XM1A 2QCYA 3LH1A 3WY8A 4XBCA 1P2MA 1V3XA 4X6MA 4WY3A 1TX6A 4DCDA 1ZMLA 1MD7A 1P57B 3UY9A 1AKSA 4BXSA 2C90B 3AASA 3BTHE 2BM2A 1O3DA 5FBEA 3MOCA 4DURA 1IQHA 3A7YA 1E35B 1YCPK 1NO9H 1C2LA 1NTPA 2FO9A 3LH3A 1GBJA 1HAOH 3F9FA 1DXWA 1VJAU 5E0JA 2VVUA 3TNTA 5EGMA 2A1DB 4CRCA 3LU9B 5JBCS 3P8NA 1TBRH 2YNBA 1SGDE 5B6OA 1MAYA 1HAPH 1X7AC 1SL3A 2H9HA 1QTFA 5A0CA 2ZA5A 2ZFPH 4GLYA 1SGRE 4XDEA 2F9UA 2ZHEH 1PPBH 4FUIA 3P8OA 5C20A 3VB3A 1GMCG 1XVOA 2ZFFH 2FS8A 1RTLA 4ZKSU 2HWLB 6ESTA 2FS9A 3GY7A 2XBVA 1SG8B 1C1MA 8LPRA 1O3FA 2J38A 1ABIH 1HJAC 5FPTA 4JCNA 1UTOA 1QA0A 1GHAG 4NIYA 1JIMA 1ORFA 2YNAA 1C5MD 2FMJA 3SGQE 2PTNA 1MQ5A 2ZQ1A 4AB9A 2Q6DA 1TMUH 1E37B 2KAIB 3KL6A 2J95A 2OC7A 5C5NA 2FYQA 6CHAB 1CHGA 2SGPE 1YBWA 1C1RA 2A4OA 1XKBC 3FP6E 1AO5A 2FOFA 2QXIA 1FAKH 4Q2KA 1H4WA 2UUFB 1NROH 1UVUH 1C5WB 1FNIA 3GCTF 4HI3A 1UVTH 3EQ0H 3AVZA 4ABDA 3TNSA 1ID5H 4ISLA 4BTTB 1DLKB 1ZPZA 4RN6A 1Z1IA 1HGTH 5TCCA 2FOAA 7GCHF 2ZCLP 1C1VH 2D26C 3DD2H 3QN7A 1OWJA 5A0BA 2C3SA 1A7SA 1Y3YA 4AGKA 1BRBE 4I33A 1J15A 1SLWB 4JMYA 1A5GH 1QA7A 1SGFG 2OBQA 1ZRBA 1TGBA 2FP7B 1KXCA 1QJ7B 3NK8A 4XOJA 3S7HB 3G01A 1YPHE 1MQ6A 3BEUA 3OY5U 9ESTA 2WUBA 1O5EH 2P16A 3L3TA 1P9UA 1NPMA 1P05A 5DPAA 1KDQB 1SC8U 4FU9A 1DY9A 1EJNA 1ZTKA 1ESAA 1C4Y2 1HV7A 2FOCA 4NA8A 5FHTA 1LPZB 3ZZDA 4AG2A 3E0NB 4MPVA 2I6SA 1O2MA 1SQTA 3QGJA 1TPOA 2V0BA 1SGQE 1FN6A 1AFEH 2XC4A 1GL0E 1QIXB 1TMBH 1OP8A 1MKXH 1LHCH 3TGKE 3GDSA 2A0QB 3DT0H 3HPTB 2AEIH 4UDWH 1K1PA 1N8OC 1YYY1 1SSXA 2SNWA 1TRMA 2SGEE 1O3CA 4SGBE 1Q3XA 1WUNH 3H7OA 3A81A 3M61U 4I8JA 2IPHA 5A8YA 1F0RA 3PTBA 1A0JA 1AQ7A 1SHYA 2CMYA 2HALA 1OP0A 1O2WA 1V6DA 4OS5A 2PKAA 2ZTYA 2A7HA 2I6QA 3ZZ5A 1LVMA 5LH8A 1PQ8A 4FUBA 1FXYA 1MKXK 1AWFH 2BY5X 2QIQA 3KCGH 1A61H 2TIOA 4QT8C 2C4FH 2FOMB 4ABIA 2O8LA 3FVFB 3U8RH 1HAVA 1YF4A 1AGJA 2H2ZA 1RGQA 3LGYA 3MFJA 5E0GA 1CHOG 1AN1E 1H9IE 4X2YA 1P2NA 2Q6GA 1IQIA 3UWIA 1K21H 1O3PB 3PROA 4ISNA 2HNTC 1DSTA 1TABE 5AF9H 4ZKNU 3VXEH 1O2UA 1FDPA 4XBBA 3F9EA 1F5RA 2A2QH 1EATA 5FBIA 3HK6B 1FUJA 4A1XA 4WF8A 5HGGA 1BTWA 1DS2E 4K2YA 1QR3E 2IN2A 1SLXB 1G37A 5DP6A 1P2OA 1ELGA 1SLUB 1V2QT 2GMTC 3RMLH 4D7GA 2AMPA 3SNAA 2RA3A 1GJAB 4WMDA 3BG8A 2Y80A 3SJ8A 4KTCA 3AW1A 1O2OA 2ZDLA 4DY7B 4MNYA 3K6YA 3BEIB 1P06A 3PO1B 2NWNA 2BVXH 2AERH 5FXLA 1NM6A 4AZ2B 1UTLM 4X8VH 1ANBA 4B2CA 3ZVDA 2BDCA 1B5GH 9LPRA 1O2TA 2ZGHA 4FUEA 1C2JA 4Y6DA 4SGAE 1DXPA 3RXPA 3UOPA 4UE7H 5L30H 3ZZCA 6GCHF 1L1GA 1T8OA 1GBLA 1MH0A 5EOKA 2QGRA 2DUCA 1TX7A 3LKWA 1SR5C 1YPGH 1AE8H 1UCYK 4J1YA 1AUJA 1H9LB 2J92A 4NFFA 3SU2A 4B76A 1HUTH 1HAHH 1BTZA 1O2SA 2P95A 1P12E 4B1TA 1GJ9B 3BTTE 1MAXA 4B71A 1G32B 1EKBB 1V2ST 3ZVAA 2EI7A 1C5TA 4I8HA 2WV4A 5EODA 3SO3A 6LPRA 2AMQA 5LPRA 4DGJA 3UOUA 3MMGA 1V2PT 4YOGA 3M3VA 3MU5A 5ABWA 4IMZA 2EC9H 3PLPA 3A83A 3MO3A 1C2FA 1A5IA 1TPAE 2G8TA 1AY6H 2BD3A 2TBSA 5A8XA 4DOQA 4Y79A 1P9SA 3URDA 1GVZA 2TGTA 1O32A 1AWHB 1GBDA 1ARBA 3I77A 1HJ8A 2ALVA 4ISOA 1IHSH 4NIVA 2A5AA 3GYMA 4B73A 3ZZ9A 4FVDA 5JPMH 5F8XA 1BTPA 5E8EH 3UQOA 1QRWA 3A82A 3SW2B 3EA9A 3NPSA 2SGFE 4U01A 4X8TH 2ZCKP 5HM2A 4MPWA 3ZZBA 1O2JA 1C4U2 1O3GA 2ZGBH 1GI0A 4Y8ZA 1SGEE 1Z8RA 4U2WA 3NKKA 2VWLA 1TGTA 1WBGB 2ZDNA 1ZHMA 1ZSLA 2WINI 3KGPA 4IN1A 2SNVA 3O8CA 2GD4B 3NWUA 5DO4H 1V2UT 3QTOH 3VB4A 4K60A 1EOJA 4CHAC 1S84A 2RDLA 1UK4A 2ZFRH 5FPSA 1QBNA 1E0FD 4YM9A 3UR6A 2ZFSA 4WMEA 5T6GA 1DPOA 2B5TB 1AVWA 1CA0B 5EQSA 2PLXA 2G81E 1TB6H 3BTME 1GMCF 4WMFA 1YPMH 1DE7H 3V13A 4YLQH 3QLPH 1GI5A 2ZU1A 1P03A 2FI4E 1QFKH 2VH0A 3TJOA 4AG1A 1Y5UT 1QQ4A 1T4VH 3M36A 2NU2E 1MKWH 1SQOA 1HAYB 1GHAF 1C2IA 4I8GA 4NG9H 1V2VT 1KYNA 3EYDA 3MH6A 4ZXYH 2BDHA 3A84A 1KTSB 3A7VA 1C5RA 1XUKA 2FM2A 2F3CE 1YPEH 3LIWA 1P2KA 3MU8A 3GOVB 5HM9A 1K2I1 3LGIA 1VZQH 3FZZA 1EJAA 1EZXC 3U9AH 5IDKA 3ESTA 2FPZA 3M5LA 8ESTE 4UFGH 3MTYA 1GBBA 3SN8A 3D65E 4LOYH 1OWDA 5GCHG 1CT0E 5DJ7A 3SV6A 3B8JA 3PM3A 3UWJH 3VGCB 1YKTA 2VNTA 1DOJA 2ZWLH 2A7CA 3RXDA 3NXPA 2H9TH 2Z9GA 1OWEA 3SV9A 2HLCA 1H9HE 4A6LA 1DVAH 4CH2B 4RSPA 3MH7A 4DG4A 3NZIA 1O2IA 4JZEH 3TPIZ 3C27B 3LGTA 1HAGE 1NFWA 4OGYA 1MTNC 1IQLA 3STIA 2BLQA 1C5SA 2BLOA 1BA8B 2EA3A 5EQRA 2WPLS 3DFLA 1TIOA 2CF8H 1FN8A 1EAWA 3V0XA 5ESBA 3P6ZB 2R2MB 3RXOA 2ZO3H 3SV2H 5F8TA 1KLTA 3S7KB 4CRBA 3GY5A 1MD8A 3Q00A 1DANH 2FOHA 1BMAA 2KAIA 4IC5A 4NCYA 5EW1H 3MHWU 5A2MH 1C5LH 1NRQH 1IQGA 2OQ5A 2TRMA 3EAJA 1O3LA 4CRFA 3PO1C 1P2IA 2Z3CA 1E38B 3MNXA 3SU6A 3KEEA 4YESB 1BTUA 1XUHA 3TJVA 3PB1E 3KQEA 1NRRH 3PLKA 4H4FA 2WPKS 1GCDA 1TA2A 4UONA 2ZGXH 1BTYA 4IMQA 2Y7XA 2ZG0H 1GI3A 1ZSJA 4WXIA 3N7OA 1GI8B 4GCHG 1VCQA 1GWAA 3QK1A 3RXBA 1C1WH 1GGDB 2DE8A 2ZEBA 1HAXB 2LPRA 4INLA 1O5BB 3A8DA 3BTKE 1H8IH 1TNJA 1J8AA 5DP8A 5DP4A 1HLTH 3ZZ4A 1WTHD 5ESTE 3MNBA 3ATWA 3RXTA 3RM0H 1CHOF 4KTSA 1C2DA 2FLRH 1IQJA 2BX3A 1J14A 1KDQA 1CO7E 5H4IB 1D6WA 4AFZA 1BB0B 2BY8X 3FZDA 4Y71A 4Y8YA 1O3HA 1F5KU 3FAOA 2RCEA 7ESTE 3OTJE 2GZ9A 1LCYA 3GCHC 2VIWA 3A7TA 1O2LA 4K3JA 1TPPA 1Y5BT 1O5DH 3T26A 1UVSH 2Z9LA 1K1JA 1O3MA 1DM4B 5ETXA 4ABGA 2ZP0H 1S5SA 2OLGA 2SGDE 1T7CA 1V2KT 7KMEH 3SNBA 3SU5A 2ZIQH 4AOQA 3R0FA 2JH5D 4D8NA 1HNEE 2TGDA 2O8MA 3M5OA 1QJ1B 4AFSA 4UD9H 3RC5A 1BMNH 1TGCA 2PGQB 4K1EA 2VIQA 2O8TA 2F91A 1B7XB 4KP0A 3M7UA 5EPNA 3SU4A 3A7ZA 2ULLA 1ETRH 4OS7A 2A7JA 2ZPSA 2ZC9H 2ZDMA 1UHBB 2GZ7A 1FAXA 1BMMH 2Q1JA 5A8ZA 1VITH 4TWWA 1AZ8A 2HVXA 1HXFH 3UPEA 1S6FA 1UTKA 3M3SA 3LGWA 1N6XA 1O3EA 3SUDA 4AYYB 5JBBS 1RFNA 1SFIA 3QUMP 1CGJE 1Z6JH 4GAWA 5TJXA 4KGAA 2FESH 1TGSZ 1BZXE 1PPHE 1GI2A 1W10U 5L2ZH 1PYTC 2G5NA 1RTFB 3HGPA 2O8WA 1XMNB 5FPYA 2OCVB 4BAMB 1DLEA 3MNSA 4WH6A 1KXBA 2O8UA 2XNIA 1DUAA 4BXWA 5C67A 1UTNA 3SZNA 3SNEA 1Y3XA 1C5PA 1HIAB 1RIWB 1Y3VA 1GBTA 2OC0A 1IAUA 1NT1A 4NIXA 1JOUB 2BD4A 1NRNH 2UUYA 1MTSA 1V2LT 2BQ7B 2GP9B 4Y10E 2PR3A 1KXEA 1AZZA 1P01A 2M5TA 4HGCA 3KQCA 4E7NA 2FOEA 2Y81A 4YOIA 1UTPA 3SHCH 1A4WH 3S9BA 1SB1H 1ZZZA 1DSUA 1XUIA 2VGCC 1PPEE 4H6SB 3RXVA 1P09A 3S0NA 3AAUA 2A2XH 2VVCA 3DA9B 1DWEH 1O2NA 2G52A 4FU7A 2F83A 4A1VA 1HB0B 4DIHH 4ZHMU 2A4QA 3DUXH 2B7DH 1C5QA 3MI4A 1J9CH 2BDGA 3D23A 4DIIH 1FPHH 1GG6C 1GBCA 3RXFA 1S81A 3EE0B 4ZUHA 2H1UA 4K8BA 1WSSH 4INHA 1MUEB 4X8UH 2AGGX 4E05H 1CE5A 1P2JA 3LC3A 2A5KA 2PSYA 4NSYA 1AE5A 2QN5T 1SQAA 2PWXA 4TYDA 3B9FH
chains in the Genus database with same CATH superfamily
3MWIU 1FPCH 1QL7A 2Q6FA 3IITA 1U6QA 1UK2A 3IG6B 3L33A 1O2XA 4NGAH 1GHYH 3QZRA 4I8KA 1LQEA 2FLBH 2BX4A 1F92A 4NA9H 3KN2A 3UFAA 2WPDD 1V2TT 1IQKA 1WTGH 1BQYA 4ZMAH 3HKJB 4OGXA 2F9NA 2PGBB 2GJGA 4GHQA 1GJCB 3MYWA 2R3UA 5HXFA 1S83A 2GVFA 2F9VA 2J9NA 1BT7A 1NY22 4PROA 1QCPA 3RXIA 1UCYE 1O5CB 5G4BA 1CGHA 3GY6A 1F0SA 3Q3YA 1CU1A 1DUEA 1FJSA 1WYKA 5DKMA 1YPHC 2G55A 2C93B 2NU0E 3UUZA 1XKAC 4UFFH 2GV6A 3RXHA 2CXVA 4CBNA 2CHAC 1YM0A 1QRXA 2VWOA 3LDXH 1GGDC 1GMHF 1TX8A 2GKVE 3T62A 5GCHF 1ETSH 1EASA 3RXLA 1O2PA 1TMTH 2JKHA 1DITH 1G3CA 3SV8A 4CH8B 2Z6BD 2XOKD 3E1XB 1TONA 3SHAH 2D8WA 1CBWC 2BY7X 3JZ1B 5C94A 2Y5GA 1W7XH 2HNTF 4FOUC 4R8TB 2WSSD 1LPGB 1K1LA 4B2BA 2QY0B 1C5YB 2PKSB 3PMJA 2PW8H 1GDQA 3U8TH 4YZUA 2ZU4A 3FP8E 1O3JA 2LELA 2ZDKA 1C5UA 1IQMA 2ANYA 1UO6A 2CN0H 2C8ZB 3F9HA 1LHGH 5EXMA 2UWPA 1TNGA 1KIGH 1O3NA 1ZMNA 3ZVFA 2ASUB 4XD7D 8GCHF 1P2QA 2GCTC 4BAHB 5C0UA 2VWNA 2ZECA 1GBAA 1RS0A 2G4UA 4FUDA 2BD2A 3BG4B 2FIRH 1ELCA 5C3NA 1TNIA 1DWCH 1OOKB 2BY6X 1L1NA 1YLNA 3VB5A 3PV2A 2HGTH 1YGCH 1VJ9U 3QTVH 1YC0A 3HATH 2JETC 1O33A 1P10A 1PQ7A 1IHTH 1P02A 4XE4A 1GJ6A 2QV1A 3BTFE 5GDSH 1UTMA 1UCYH 1VCPA 1IQNA 3ZVCA 4NSVA 2Z9IA 5K7RA 3TH4H 2Y5FA 1YP9A 1O30A 2PUQH 1MTWA 2BXTH 4GCHF 4TSFD 5A09A 3TVJB 1SGCA 1QNJA 4AORA 1O2HA 1NRSH 3VPKA 1HRTH 4R0IA 3GS9A 3ZYDA 4TWYA 2WYJA 2RG3A 4ZKOU 3E3TA 3RXUA 3W95A 2RFKC 1LQDB 4HG6A 1GPZA 1ELEE 4XBDA 1LPKB 4INKA 4K1SA 3QZQA 3N99A 3HKIB 1DX5M 3ZVEA 3A85A 1NBMD 1NFXA 1SGIB 1O2YA 1O5GH 2NU1E 4ZKRU 3T2NA 4F49A 1OKXA 2VH6A 3VEQB 4WWYA 4LK4A 5LGOA 3W94A 1ELAA 2ZU2A 2J34A 5F6MA 2Y82A 4YT6H 5DSFA 3RU4E 1BBRK 2AH4X 5DK1A 4CRAA 3VXFH 1WCZA 2KCOA 3F9GA 3ATKA 5GIBA 2WPIS 2F9OA 1SGTA 1S82A 2OTVA 1AFQB 4M9FA 1OWIA 1LVOA 1WU1A 1RTKA 3ITIA 1JBUH 3P8GA 2HLDD 1FX0B 4D9RA 4Q7YA 1RJXB 3BTWE 1K1MA 2XCNA 1W12U 5SGAE 5DG6A 1GMDG 3MO6A 1HYLA 4HFPB 2BVRH 3M35A 4ZH8A 1OSSA 1OYTH 1SOZA 2BDIA 2STBE 2QF3A 2BD7A 1O3BA 1NFYA 4ZXXH 1T8MA 2P8OB 3ZZ6A 6CHAC 5GJ4B 3ZZAA 1W14U 2OC8A 2VU8E 1ZGVA 1AU8A 3UQVA 2XXLA 3MU4A 3LPRA 4RI0A 4AFUA 1TPSA 1AD8H 1ZGIA 5CMXH 1F0UA 1HJ9A 3E16B 3GDUA 3RXSA 4B74A 3EGKH 3UIRA 1LMWB 2ZTXA 1L2EA 3LT3A 3TU7H 2BXUH 5HIZA 3OX7U 3ZV9A 5EW2H 1FI8A 1NU7B 2ZQ2A 1GCTB 1SBWA 1AUTC 1MZAA 1UJ1A 5FX6A 3RLYH 3KYFA 2ZCHP 3A87A 2W7UA 4GPGA 2ANMH 2CJIA 1EPTB 4X2WA 1EAUA 2Z94A 2VIPA 4DVAU 7LPRA 1C5OH 1FONA 2ZZUH 2VB0A 1GJ5H 2VBCA 4I31A 3SZEA 2G5VA 1FV9A 1O2QA 1MABB 1PPZA 2O9QA 2ZFTA 2QAAA 4NWKA 1W0YH 1GJ4H 3NCLA 4Y76A 3FP7E 2WPJS 4GVUA 1AMHA 1MZDA 1GHWH 2BLWA 4ZROA 1DICA 1O5AB 4WVPE 3UR9A 1JRSA 1D3DB 3I78A 1K28D 5JB8S 4GHTA 1UK3A 2Y7ZA 1ESTA 1BOQA 4E06H 4O9VA 1GI9B 3ATLA 1Y3WA 2FXRA 2R0KA 4IBLH 1OWHA 4B75A 1GJ8B 4IW4E 2YMSD 3Q76A 2L6OA 1A46H 4AB8A 2BY9X 3PWCA 3ATMA 4FUCA 5IYTA 1LDTT 4K1TA 1TQ0B 2BQ6B 2BZ6H 2BMGB 2SGQE 3VB6A 5JBTA 1AVXA 1GHZA 1O37A 1EAIA 1MU6B 2PSXA 4AYVB 1YPKH 1JMOH 1QBOA 2OXSA 2BD8A 3A80A 4X2XA 1C5XB 4BANB 2QA9E 2ODQA 1ZLRA 2FYRA 4X0WU 1Y59T 4E7RG 1UHBA 2EI8A 4ABJA 1HJAB 1D3TB 4WJG2 3UTUH 1GBHA 2AS9A 4WXVA 5AFZH 1O3KA 4MNVA 2BYAX 1Q2WA 2KFWA 4FUJA 1XX9A 3PRDA 2PKSC 3TJUA 4OS1A 3SNCA 2TGAA 3E0PB 1P3CA 3N7EA 1TA6A 1UMAH 3RXJA 1XXFA 4MNWA 1GBIA 3TH3H 2TGPZ 3U1IB 2ZKSA 1B0FA 1V2JT 3UREA 1O35A 1F5LA 2FX6A 2A32A 3BTQE 1DWBH 2XBYA 2M2AA 2A45B 1TGNA 2SFAA 3ELAH 2ZHFH 3M37A 4MPUA 5DP3A 2H9EH 2R3YA 1GL1A 1QZ8A 1HIAA 2A4GA 3O8RA 1NC6A 1L4DA 1O2RA 4ABBA 1BRAA 2WPMS 3SNDA 1K1OA 3KQ5A 1HCGA 2V6NA 3PV4A 5DP7A 1AIXH 1THSH 3D49H 3TK9A 3GCOA 1EZSC 2G4TA 3FN8A 2GDDA 2H6MA 2IOTA 1N1LA 2V3OH 2ZU5A 3Q3KA 1HFDA 1LO6A 2ZPQA 4WH8A 2FOBA 1D3QB 1G2MA 3AAVA 3T25A 3S9AA 1MCVA 4BOHA 4YOJA 2FOGA 1TNKA 3ODDA 3RXRA 5CHBA 1PFXC 2WUCA 1VCWA 1SPJA 3PRBA 5T6DA 1N6YA 3VB7A 1MU8B 1ELBA 1GI6A 4BTIB 2C8XB 2CGAA 1FY1A 1C9PA 2XCFA 2P59A 1TWXB 3RU4T 1A3EH 2J4IA 3V3MA 2BDAA 4NFEA 3OU0A 4X1NU 1GJBB 4AC9A 2F9BH 1RXPA 4UFDH 1C1OA 1NN6A 1EP5A 1ZPBA 1S0RA 1P0SH 5K0HA 2G51A 3VFEA 1K0HA 2EI6A 2OINA 3QX5H 2XBWA 2FODA 2AGEX 3SJIA 2FZZA 5DP5A 2FTMA 1D4PB 2PFEA 2A4RA 1N8OB 3CNRA 3LONA 1TRYA 4FU8A 5FCKA 3NRLA 1TBZH 2P94A 1HAZB 1PJPA 1MBQA 5EXLA 1AFQC 1NS3A 1TNLA 2XRCA 2JJ2D 1YY3A 2QXJA 4XFQA 1ELFA 3SI3H 3SORA 1Z1JA 2A5IA 2BD9A 3OYPA 4MNXA 2FTLE 4FETA 1C1SA 1FLEE 1H8DH 1OWKA 1XXDA 2OC1A 1Z8JB 1O2VA 3GDVA 1S0QA 1KXAA 4ABAA 3F3BA 1D3PB 1QURH 4FVBA 1QB9A 4X2VA 3TIUA 1FY5A 1LKBA 1ZRKA 1Z71A 2HPPH 3PWBA 5GXPA 3L6PA 2Y6TA 2GX4A 2AIQA 1GJDB 5BPEA 1HBTH 2UWOA 1VKYA 3DHKH 1TAWA 3SGAE 1K1NA 1HPGA 2ZI2H 2AMDA 3LJOA 3ZV8A 3P92A 1BHXF 2BLVA 3S69A 4TY6A 3FOAA 5HMAA 3M7TA 1CT4E 1VR1H 3H5CB 1KLJH 2ZHWH 2P3UB 1ANCA 1EZQA 2BTCE 4UEHH 2Z3EA 1ANEA 5TCAA 1O2GH 3RMNH 1QGFA 1LHDH 2ANKH 1GCTC 2FX4A 2QXGA 2GMTB 1D9IA 1LVBA 1O3OA 1ZHPA 3U69H 5EQQA 1CVWH 4RKOB 1NU9A 4Q4LA 5GWZA 2F9PA 3FANA 1ZTLA 4ABEA 3SUGA 1DY8A 2STAE 2A31A 3U8OH 3PTNA 1CA0C 4X6OA 3SU1A 4JYTA 2GDEH 3CS7A 5F8ZA 4OS6A 2IJD1 3GCNA 1KMHB 3ENSB 3A86A 3P95A 5C1XA 1C1QA 2XWBI 1AVGH 2YMSB 2OUAA 1QB1A 4O03A 1SI5H 3KF2A 3D62A 4LXBH 1Z8GA 1EB1H 2JDID 4I7YH 2HRVA 2H5DA 2B0FA 1FY3A 4ESTE 1GMDF 1W2KH 1ZOMA 3OAAD 4TT3D 5EG4A 1ELDE 1W8BH 2H5CA 3PMAB 1MTVA 1EZUC 3R3GB 4A1TA 1DWDH 4LZ1H 3BTEE 4CRDA 1PPCE 3K6ZA 2PV9B 1XUGA 4CREA 1SGFA 5EXNA 3HK3B 1FIZA 1FMGA 2VINA 5C5OA 1C1NA 4Y7AA 3A88A 3K65B 2VIVA 3B23B 1T31A 4JZIA 1JXPA 4YO9A 1SMFE 5F03A 2GCHG 3RXMA 4M7GA 2L74A 1ABJH 2ZDVH 3VGCC 1J17T 2BDYA 1BIOA 3ZZ3A 2ZTZA 5C2ZA 2ZGJA 3STJA 1C2EA 5E2OA 4A7IB 5HYOA 1P11E 5T6FA 1GBKA 4F4OC 1YCPM 2J2UA 1NRPH 2ESTE 4ZCNA 2SGAA 4DW2U 1SGYE 5FX5A 1F0TA 4X1RU 2W5EA 3S9CA 3RP2A 1L0ZA 3F2FA 4MLFB 1GJ7B 4X1PU 1BRCE 1WV7H 4HTCH 4BAKB 3SJKA 2NU3E 1AI8H 1THRH 2THFB 1TOCB 4Z6AH 1BUIA 1WQSA 2XNDD 5IK2D 3F6UH 4ABFA 1WOFA 3MH4A 4FUHA 1Z6EA 1Z8IB 8KME2 1ZMJA 3CENA 3BN9A 1Y5AT 3SBKA 4Y0ZE 1DDJA 1NBME 1V2OT 3A89A 5J4SA 1EP6A 4HZHA 4Y7BA 3GY3A 2LNCA 5DN6D 3RDZA 1XVMA 2BDBA 1WDIA 1F2SE 2J94A 1AB9B 4AFQA 2AGIX 3MU0A 3F2GA 1SGPE 3TJNA 1PPGE 2IPQX 1CGIE 4CHAB 2V3HH 4MDSA 4Z0KA 2RDEA 3OEED 3SQHE 1TRNA 1QL9A 1MCTA 3BIVH 3BV9B 3IWMA 4KELA 4VGCB 3SQEE 3LC5A 1BBRE 1F7ZA 1G9IE 2G00A 2Z7FE 1GBFA 3Q77A 2Z9KA 1IOEA 4ISIH 3HGNA 1GHBG 1KXDA 2K0QA 1COWD 2CK3D 4IGDA 3RXQA 1INCA 2KCYA 4GUXA 1OYQA 4P02A 5JDUB 1EX3A 1V2RT 3DCLA 3PMHB 1BMLA 3A7WA 3E91A 3SGBE 1TQ7B 4JZDH 4KKDA 2OQUA 5FCRA 1EPTA 4H6TA 1PQ5A 4IS5A 1ACBE 3SV7A 4ZHLU 1PYTD 1ELVA 2JH0D 1SVPA 2WYGA 1A0HB 1K1IA 1VITG 2W3KA 5I25A 2C8WB 2NU4E 5T3HA 2HNTE 2XBXA 3E6PH 4OS4A 3ZZ7A 1UVPA 3EDXB 2FI3E 1FQ3A 3A7XA 4Q80A 3KIDU 3CS0A 1A5HA 1D6RA 1O31A 3GYLB 5EU8A 2ODPA 1A0LA 2WPHS 2VWMA 1QHRB 3FFGA 5J4QA 1AKSB 3A8BA 4ZHAA 4AN7A 2Z9JA 1C5NH 1G30B 1QB6A 1ZHRA 1IQEA 3SU3A 4ZAEA 3BF6H 4P00A 2EQNA 4Q7XA 1S6HA 2Y5HA 3K2UA 2BVSH 1C2MA 1S85A 3E90B 4DJZB 3P17H 1GBEA 2BOKA 3UNQA 1MTNB 1DT2A 5JYIA 1O3IA 2R2WU 3Q3XA 1HAIH 1GI7B 1UTQA 2PHBA 4F55A 2TPIZ 4JYVH 3ZYEA 4O3TA 3SUEA 1QBVH 3ZVGA 3RMMH 4JZFH 4O97A 2AFQB 3EA7A 4GSOA 4NA7A 1BBRH 2ZHDA 2B8OH 4ISHH 1O5FH 1C5VA 3KQBA 1GVLA 1T8NA 2W26A 4I86A 3RXEA 4CR5A 1G3BA 3ODFA 4O3UA 1O2KA 2P3TB 4OS2A 1ELTA 1QJ6B 1ZJDA 3M3TA 1P04A 1C4V2 3RLWH 2ZPRA 2YOLA 1ZJKA 4D76A 3M7QA 1BCUH 3GY4A 1FIWA 3GY8A 4FXGH 1KXFA 2RA0A 1G2LA 3TK6A 3AW0A 4NZLA 1G3EA 2ZHQH 3BIUH 1KTTB 4Q63A 2XC0A 1ESBA 2DE9A 1O36A 3U1JB 4JYUH 3F68H 2QF5A 3RXCA 2VIDA 1DFPA 1RIWC 1P8VC 1PPFE 3MU1A 1O3AA 4NWLA 3U98H 1GBMA 2LP6A 2OD3B 4X1QU 5BRRE 1TE0A 1GDNA 1XUFA 1K9OE 1Y8TA 1EB2A 3CP7A 4Q7ZA 3V12A 1OP2A 2GTBA 1W0ZU 2CF9H 1YLCA 1H1BA 1LHEH 4NZQA 1QY6A 3KQDA 1EJMA 3MNCA 3BEFB 3QO6A 4YT7H 2P93A 3E8LA 4TY7A 3OEHD 5T1VA 2QF0A 5GPIB 2JH6D 1EAXA 3LGVA 4A5TS 4MTBA 2GGVB 1KLIH 2UUJB 1QRZA 3GCHB 1UTJA 1G3DA 3JZ2B 1L1JA 2FI5E 4H42U 1ETTH 5DP9A 2ALPA 1VGCB 1TALA 1MMJN 3PV5A 1Y3UA 1YPLH 5A0AE 2BD5A 1TBQH 1TOMH 5F53A 3T5FH 2HOBA 3ZZ8A 1Z7KA 5AFYH 1OHHD 4TPIZ 2VIOA 3LJJA 4JK6A 1LHFH 5CHAB 3RM2H 1C1PA 1HDTH 2R0LA 3GCTG 2VJ1A 3BTDE 1PQAA 1YPJH 2BB4A 3RXKA 2FWWA 1TLDA 2FEQH 2QXHA 1XUJA 3UNRA 1FZZA 1SHHB 1AB9C 7GCHG 1JWTA 4AX9H 1BHXB 3TGIE 4UFEH 2ANWA 3MO9A 2PKAB 1OS8A 3MH5A 1ANDA 2AIPA 1BRUP 1JRTA 1LVYA 1THPB 4CRGA 5DGJA 4IN2A 3GICB 4VGCC 5C1YA 2W7SA 4BAOB 1JIRA 5L2YH 1ARCA 1HAVB 1ZSKA 4K69A 3RMOH 1RRKA 1W3CA 3P70B 2ZNKH 4I32A 3SJOA 1FY8E 1T32A 1CT2E 2GCHF 2ZU3A 1SLVB 4NIWA 5CE1A 4X1SU 2QE7D 1LTOA 2FDAA 4FUGA 1E79D 3PYHA 2HVYB 3WW7A 3ZVBA 2ILNA 2OP9A 3URCA 1ZR0A 2ODYB 4X8SH 4CBOA 1NZQH 5L6NH 1GDUA 3DSOA 3FKSD 4K8YA 4U32A 3P8FA 1C1UH 3NUMA 1ZTJA 3SUFA 2P3FH 5LPEA 1O2ZA 1A3BH 2W3IA 2QYIA 1C2HA 2CV3A 4B6EA 4D7FA 2GT7A 1A1RA 4JK5A 3A8CA 5I46H 2Z3DA 1NESE 4ABHA 2VGCB 1GMHG 3FO8D 1MKWK 1IQFA 4D9QA 1UVOA 1P3EA 2QC2A 5B6LA 2UUKB 4CR9A 2VVVA 2W6JD 4Y0YE 2IJOB 1GVKB 2D1JA 1BDAA 3BTGE 3GISB 4MVNA 2D2DA 2AYWA 3M5MA 3V7TA 3M5NA 3BG4C 1G36A 4DT4A 1OX1A 3RU4D 1EXFA 3EA8A 5EPYA 2WV5A 2ZF0H 1TYNA 2QF4A 1GG6B 4KTUA 3F1SB 1BTHH 1T4UH 2PUXB 5FL7D 3T28A 1E34B 1T8LA 3T27A 3H7TA 1V2WT 1CA8B 5LPFA 5EJ1A 4X6PA 1A2CH 1O39A 4Y8XA 2XTTB 1C2KA 1QQUA 3O8DA 5PTPA 4LZ4B 3ATIA 2XC5A 1ZPCA 4MG3A 3OY6U 8GCHG 5JBAS 3RXGA 5AHGH 3LOXA 2UWLA 5C0TA 1FY4A 3O8BA 2B9LA 4B2AA 1WAYB 3TITA 1K22H 1GHBF 1KY9A 1EUFA 2EEKA 1C2GA 1WQVH 1GI4A 1HXEH 1V2MT 3UNSA 1C9TA 1CSOE 1OXGA 2XWAA 2ZDAH 3I29A 2PTCE 2WHXA 4XRNA 1W13U 1O38A 4MQAA 4XSKU 5E0HA 1GI1A 3KHVA 1J16A 1UW7A 4A92A 4IC6A 4BNRA 2K1QA 2K8IA 1YLDA 3RXAA 1ZYOA 1AHTH 2BOHB 1VITF 2C8YB 1V2NT 3W1EA 4Y11E 4ASHA 4THNH 4RKJB 3TH2H 2CHAB 3SU0A 3TK5A 3K9XB 4AGJA 2V35A 4U30A 1RD3B 2WV9A 4K5ZA 2XYAA 2OBOA 2BQWB 3RUOA 3SOSA 4BAQB 2GV7A 3OSYA 5JB9S 1M9UA 2GT8A 1CBWB 6GCHG 1QL8A 2XW9A 3PLBA 4FUFA 2BHGA 1OPHB 3RC4A 1E36B 3QDZB 1CQQA 2ZFQH 3TGJE 2ZGCA 3QGNB 5FAHA 2GZ8A 4YTAA 4DT7B 5C1UA 2P8OC 3C1KA 3GY2A 4X6NA 1C5ZB 4BTUB 1B0EA 1Q31A 1EOLA 2BZAA 4MPXA 1SOTA 1GHXH 4J2YB 1L4ZA 1W7GH 1BJVA 1TFXA 5AVDA 1LKAA 1O34A 2HPQH 1SGNE 2GCTB 3PMBB 1MTUA 1BJUA 3OE7D 1SFQB 1VGCC 3BSQA 1C1TA 3F2HA 1NFUA 4JZ1A 3A8AA 1BTXA 3LGUA 3DFJA 4TPYA 3SI4H 1BITA 1YCPH 3H09A 1MBMA 3QWCH 1TNHA 1W11U 3RC6A 1GHVH 2R9PA 2OK5A 2JETB 5CHAC 1EPTC 2V3MA 3TLOA 5E2PA 1EQ9A 1O0DH 3KNXA 3SJ9A 4I8LA 4YLUA 1KSNA 3T29A 1XM1A 2QCYA 3LH1A 3WY8A 4XBCA 1P2MA 1V3XA 4X6MA 4WY3A 1TX6A 4DCDA 1ZMLA 1MD7A 1P57B 3UY9A 1AKSA 4BXSA 2C90B 3AASA 3BTHE 2BM2A 1O3DA 5FBEA 3MOCA 4DURA 1IQHA 3A7YA 1E35B 1YCPK 1NO9H 1C2LA 3OFND 1NTPA 2FO9A 3LH3A 1GBJA 1HAOH 3F9FA 1DXWA 1VJAU 5E0JA 2VVUA 3TNTA 5EGMA 2A1DB 4CRCA 3LU9B 5JBCS 3P8NA 1TBRH 2YNBA 1SGDE 5B6OA 1MAYA 1HAPH 1X7AC 1SL3A 2H9HA 1QTFA 5A0CA 2ZA5A 2ZFPH 4GLYA 1SGRE 4XDEA 2F9UA 2ZHEH 3N7DA 1PPBH 4FUIA 3P8OA 5C20A 3VB3A 1GMCG 1XVOA 2ZFFH 2FS8A 1RTLA 4ZKSU 2HWLB 6ESTA 2FS9A 3GY7A 4ASUD 2V7QD 2XBVA 1SG8B 1C1MA 8LPRA 1O3FA 2J38A 1ABIH 1HJAC 5FPTA 4JCNA 1UTOA 1QA0A 1GHAG 4NIYA 1JIMA 1ORFA 2YNAA 1C5MD 3AK5A 2FMJA 3SGQE 2PTNA 1MQ5A 2ZQ1A 4AB9A 2Q6DA 1TMUH 1E37B 2KAIB 3KL6A 2J95A 2OC7A 5C5NA 2FYQA 6CHAB 1CHGA 5KECA 2SGPE 1YBWA 1C1RA 2A4OA 1XKBC 3FP6E 1AO5A 2FOFA 2QXIA 1FAKH 4Q2KA 1H4WA 2UUFB 1NROH 1UVUH 1C5WB 1FNIA 3GCTF 4HI3A 1UVTH 3EQ0H 3AVZA 4ABDA 3TNSA 1ID5H 4ISLA 4BTTB 1DLKB 1ZPZA 4RN6A 1Z1IA 1HGTH 5TCCA 2FOAA 7GCHF 2ZCLP 1C1VH 2D26C 3DD2H 3QN7A 1OWJA 5A0BA 2C3SA 1A7SA 1Y3YA 4AGKA 1BRBE 4I33A 1J15A 1SLWB 4JMYA 1A5GH 1QA7A 1SGFG 2OBQA 4ACBA 1ZRBA 1TGBA 2FP7B 1KXCA 1QJ7B 3NK8A 4XOJA 3S7HB 3G01A 3WWBA 1YPHE 1MQ6A 2KZ4A 3BEUA 3OY5U 9ESTA 2WUBA 1O5EH 2P16A 3L3TA 1P9UA 1NPMA 1P05A 5DPAA 1KDQB 1SC8U 4FU9A 1DY9A 1EJNA 1ZTKA 1ESAA 1C4Y2 1HV7A 2FOCA 4NA8A 5FHTA 1LPZB 3ZZDA 4AG2A 3E0NB 4MPVA 2I6SA 1O2MA 1SQTA 3QGJA 1TPOA 2V0BA 1SGQE 1FN6A 1AFEH 2XC4A 1GL0E 1QIXB 1TMBH 3EE7A 1OP8A 1MKXH 1LHCH 3TGKE 3GDSA 2A0QB 3DT0H 3HPTB 2AEIH 4UDWH 3OTPA 1K1PA 1N8OC 1YYY1 1SSXA 4Z1MD 2SNWA 1TRMA 2SGEE 1O3CA 4SGBE 1Q3XA 1WUNH 3H7OA 2PP6A 3A81A 3M61U 4I8JA 2IPHA 5A8YA 1F0RA 3PTBA 1A0JA 1AQ7A 1SHYA 2CMYA 2HALA 1OP0A 1O2WA 1V6DA 4OS5A 2PKAA 2ZTYA 2A7HA 2I6QA 3ZZ5A 1LVMA 5LH8A 1PQ8A 4FUBA 1FXYA 1MKXK 1AWFH 2BY5X 2QIQA 1EFRD 3KCGH 1A61H 2JJ1D 2TIOA 4QT8C 2C4FH 2FOMB 4ABIA 2O8LA 3FVFB 3U8RH 1HAVA 1YF4A 1AGJA 2H2ZA 1RGQA 3LGYA 3MFJA 5E0GA 1CHOG 1AN1E 1H9IE 4X2YA 1P2NA 2Q6GA 1IQIA 3UWIA 1K21H 1O3PB 3PROA 4ISNA 2HNTC 1DSTA 1TABE 5AF9H 4ZKNU 3MQKC 3VXEH 1O2UA 1FDPA 4XBBA 3F9EA 1F5RA 2A2QH 1EATA 5FBIA 3HK6B 1FUJA 4A1XA 4WF8A 5HGGA 1BTWA 1DS2E 1E1RD 4YXWD 4K2YA 3VG8A 1QR3E 2IN2A 1SLXB 1G37A 5DP6A 1P2OA 1ELGA 1SLUB 1V2QT 2GMTC 3RMLH 4D7GA 2AMPA 3SNAA 2RA3A 1GJAB 4WMDA 5EJLA 2J98B 3BG8A 2Y80A 3SJ8A 4KTCA 3AW1A 1O2OA 2ZDLA 4DY7B 4MNYA 3K6YA 3BEIB 1P06A 3PO1B 2NWNA 2BVXH 2KX4A 2AERH 5FXLA 1NM6A 4AZ2B 1UTLM 4X8VH 1ANBA 4B2CA 3ZVDA 2BDCA 1B5GH 9LPRA 1O2TA 2ZGHA 4FUEA 1C2JA 4Y6DA 4SGAE 2YMSC 1DXPA 3RXPA 3UOPA 4UE7H 5L30H 3ZZCA 6GCHF 1L1GA 1T8OA 1GBLA 1MH0A 5EOKA 2QGRA 5EIYA 2DUCA 1TX7A 3LKWA 1SR5C 1YPGH 1AE8H 1UCYK 4J1YA 1AUJA 1H9LB 2J92A 4NFFA 3SU2A 4B76A 1HUTH 1HAHH 1BTZA 1O2SA 4B6FA 2P95A 1P12E 4B1TA 1GJ9B 3BTTE 1MAXA 4B71A 1G32B 1EKBB 1V2ST 3ZVAA 2EI7A 1C5TA 4I8HA 2WV4A 5EODA 3SO3A 6LPRA 2AMQA 5LPRA 4DGJA 3UOUA 3MMGA 1V2PT 2J5UA 4YOGA 3M3VA 3MU5A 5ABWA 4IMZA 2EC9H 3PLPA 3A83A 3MO3A 1C2FA 1A5IA 1TPAE 2G8TA 1AY6H 2BD3A 2TBSA 5A8XA 4DOQA 4Y79A 1P9SA 3URDA 1GVZA 2TGTA 1O32A 1AWHB 1GBDA 1ARBA 3I77A 1HJ8A 2ALVA 4ISOA 1IHSH 4NIVA 2A5AA 3GYMA 4B73A 3ZZ9A 4FVDA 4ACAA 5JPMH 1WXRA 5F8XA 1BTPA 5E8EH 3UQOA 1QRWA 3A82A 2KCPA 3SW2B 3EA9A 3NPSA 2SGFE 4U01A 4X8TH 2ZCKP 5HM2A 4MPWA 3ZZBA 1O2JA 1C4U2 1O3GA 2ZGBH 3KYGA 1GI0A 4Y8ZA 1SGEE 1Z8RA 4U2WA 3NKKA 2VWLA 1TGTA 1WBGB 2ZDNA 1ZHMA 1ZSLA 2WINI 3KGPA 3DSGA 4IN1A 2SNVA 3O8CA 2GD4B 3NWUA 5DO4H 1V2UT 1W0KD 3QTOH 4K60A 1EOJA 3VB4A 1S84A 4CHAC 2RDLA 1UK4A 2ZFRH 5FPSA 1QBNA 1E0FD 4YM9A 3UR6A 2ZFSA 4WMEA 5T6GA 1DPOA 2B5TB 1AVWA 1CA0B 5EQSA 2PLXA 2G81E 1TB6H 3BTME 1GMCF 4WMFA 1YPMH 1DE7H 3V13A 4YLQH 3QLPH 3ZIAD 1GI5A 2ZU1A 1P03A 2FI4E 1QFKH 2VH0A 3TJOA 2W6ID 4AG1A 1Y5UT 1QQ4A 1T4VH 3M36A 2NU2E 1MKWH 1SQOA 1HAYB 1GHAF 1C2IA 4I8GA 4NG9H 3WWFA 1V2VT 1KYNA 3EYDA 3MH6A 4ZXYH 2BDHA 3A84A 1KTSB 3A7VA 1C5RA 1XUKA 2FM2A 2F3CE 1YPEH 3LIWA 1P2KA 3MU8A 3GOVB 5HM9A 5KGOA 1K2I1 3LGIA 1VZQH 3FZZA 1EJAA 1EZXC 3U9AH 5IDKA 3ESTA 2FPZA 3M5LA 8ESTE 1H8HD 4UFGH 3MTYA 1GBBA 3SN8A 3D65E 4LOYH 1OWDA 5GCHG 1CT0E 5DJ7A 3SV6A 3B8JA 3PM3A 3UWJH 3VGCB 1YKTA 2VNTA 1DOJA 2J97A 2ZWLH 2A7CA 3RXDA 3NXPA 2H9TH 2Z9GA 1OWEA 3SV9A 2HLCA 1H9HE 4A6LA 1DVAH 4CH2B 4RSPA 3MH7A 2KCAA 4DG4A 3NZIA 1O2IA 4JZEH 3TPIZ 3C27B 3LGTA 1HAGE 1NFWA 1E1QD 4OGYA 1MTNC 1S6LA 1IQLA 3STIA 4RT0A 2BLQA 1C5SA 2BLOA 1BA8B 2EA3A 5EQRA 1H8ED 2WPLS 3DFLA 1TIOA 2CF8H 1FN8A 1EAWA 3V0XA 5ESBA 1YWUA 3P6ZB 2R2MB 3RXOA 2ZO3H 2F4LA 3SV2H 5F8TA 3DSPA 1KLTA 3S7KB 4CRBA 5EJZA 3GY5A 1MD8A 3Q00A 1DANH 2FOHA 1BMAA 2KAIA 4IC5A 4NCYA 5EW1H 3MHWU 5A2MH 1C5LH 1NRQH 1IQGA 2OQ5A 2TRMA 3EAJA 1O3LA 4CRFA 3PO1C 1P2IA 2Z3CA 1E38B 3MNXA 3SU6A 3KEEA 4YESB 1BTUA 1XUHA 3TJVA 3PB1E 3KQEA 1NRRH 3PLKA 4H4FA 5C17A 2WPKS 1GCDA 1TA2A 4UONA 2ZGXH 1BTYA 4IMQA 2Y7XA 2ZG0H 1GI3A 4F48B 1ZSJA 4WXIA 3N7OA 1GI8B 4GCHG 1VCQA 1GWAA 3QK1A 3RXBA 1C1WH 1GGDB 2DE8A 2ZEBA 1HAXB 2LPRA 4INLA 1O5BB 3A8DA 3BTKE 1H8IH 1TNJA 1J8AA 5DP8A 5DP4A 2KR7A 1HLTH 2F43B 3ZZ4A 1WTHD 3SYJA 5ESTE 1SQRA 4OM9A 3MNBA 3ATWA 1SKYE 3RXTA 3RM0H 1CHOF 4KTSA 1C2DA 2FLRH 1IQJA 2BX3A 1J14A 1KDQA 1CO7E 5H4IB 1D6WA 4AFZA 5HKKD 1BB0B 2BY8X 3FZDA 4Y71A 4Y8YA 1O3HA 1F5KU 3FAOA 2RCEA 7ESTE 3OTJE 2GZ9A 1LCYA 3GCHC 2VIWA 3A7TA 1O2LA 4K3JA 1TPPA 1Y5BT 1O5DH 5GNDA 3T26A 1UVSH 2Z9LA 2EY4C 1K1JA 1O3MA 1DM4B 5ETXA 4ABGA 2ZP0H 1S5SA 2OLGA 2SGDE 1T7CA 1V2KT 7KMEH 3SNBA 3SU5A 2ZIQH 3F0OA 4AOQA 3R0FA 3UAIC 2JH5D 4D8NA 1HNEE 2TGDA 2O8MA 3M5OA 1QJ1B 4AFSA 4UD9H 4RT1A 1BMNH 3RC5A 1TGCA 2PGQB 4K1EA 2VIQA 2O8TA 5KEDA 2F91A 1B7XB 4KP0A 3M7UA 5EPNA 3SU4A 2AHME 3A7ZA 2ULLA 1ETRH 4OS7A 2A7JA 2ZPSA 2ZC9H 2ZDMA 1UHBB 2GZ7A 2WZQA 1FAXA 1BMMH 2Q1JA 5A8ZA 1VITH 4TWWA 1AZ8A 2HVXA 1HXFH 3UPEA 1S6FA 2KM0A 1UTKA 3M3SA 3LGWA 1N6XA 1O3EA 3SUDA 4AYYB 5JBBS 1RFNA 1SFIA 3QUMP 1CGJE 5HIYA 1Z6JH 4GAWA 5TJXA 4KGAA 2FESH 1TGSZ 1BZXE 1PPHE 1GI2A 2JIZD 1W10U 5L2ZH 1PYTC 2G5NA 1RTFB 3HGPA 2O8WA 1XMNB 5FPYA 2OCVB 4BAMB 1DLEA 3MNSA 2J98A 1KXBA 2O8UA 2XNIA 1DUAA 4WH6A 3F0PA 4BXWA 5C67A 1UTNA 3SZNA 3SNEA 1Y3XA 1C5PA 1HIAB 1RIWB 1Y3VA 1GBTA 2OC0A 1IAUA 1NT1A 4NIXA 1JOUB 2BD4A 1NRNH 2UUYA 1MTSA 1V2LT 2BQ7B 2GP9B 4Y10E 2PR3A 1KXEA 1AZZA 1P01A 2M5TA 4HGCA 3KQCA 3UB0A 4E7NA 5CDFE 2FOEA 2Y81A 4YOIA 1UTPA 3SHCH 1A4WH 3S9BA 1SB1H 1ZZZA 1DSUA 1XUIA 2VGCC 1PPEE 4H6SB 3RXVA 1P09A 3S0NA 1BMFD 2A2XH 2VVCA 3AAUA 3DA9B 1DWEH 1O2NA 2G52A 4FU7A 2F83A 4A1VA 1HB0B 4DIHH 4ZHMU 2A4QA 3DUXH 2B7DH 1C5QA 3MI4A 1J9CH 2BDGA 3D23A 4DIIH 1FPHH 1GG6C 1GBCA 1W0JD 3RXFA 1S81A 3U28C 3EE0B 4ZUHA 2H1UA 4K8BA 1WSSH 4INHA 1MUEB 4X8UH 2AGGX 4E05H 1CE5A 1P2JA 3LC3A 2A5KA 2PSYA 4NSYA 1AE5A 2QN5T 1SQAA 2PWXA 4TYDA 3B9FH
chains in the Genus database with same CATH topology
3MWIU 1FPCH 1QL7A 2Q6FA 3IITA 1U6QA 1UK2A 3IG6B 3L33A 1O2XA 4NGAH 1GHYH 3QZRA 4I8KA 1LQEA 2FLBH 2BX4A 1F92A 4NA9H 3KN2A 3UFAA 1V2TT 1IQKA 1WTGH 1BQYA 4ZMAH 3HKJB 4OGXA 2F9NA 2PGBB 4GHQA 1GJCB 3MYWA 2R3UA 5HXFA 1S83A 2GVFA 2F9VA 2J9NA 1BT7A 1NY22 4PROA 1QCPA 3RXIA 1UCYE 1O5CB 5G4BA 1CGHA 3GY6A 1F0SA 3Q3YA 1CU1A 1DUEA 1FJSA 1WYKA 5DKMA 1YPHC 2G55A 2C93B 2NU0E 3UUZA 1XKAC 4UFFH 2GV6A 3RXHA 2CXVA 4CBNA 2CHAC 1YM0A 1QRXA 2VWOA 3LDXH 1GGDC 1GMHF 1TX8A 2GKVE 3T62A 5GCHF 1ETSH 1EASA 3RXLA 1O2PA 1TMTH 2JKHA 1DITH 1G3CA 3SV8A 4CH8B 2Z6BD 3E1XB 1TONA 3SHAH 2D8WA 1CBWC 2BY7X 3JZ1B 2Y5GA 1W7XH 2HNTF 4R8TB 1LPGB 1K1LA 4B2BA 2QY0B 1C5YB 2PKSB 3PMJA 2PW8H 1GDQA 3U8TH 4YZUA 2ZU4A 3FP8E 1O3JA 2ZDKA 1C5UA 1IQMA 2ANYA 1UO6A 2CN0H 2C8ZB 3F9HA 1LHGH 5EXMA 2UWPA 1TNGA 1KIGH 1O3NA 1ZMNA 3ZVFA 2ASUB 8GCHF 1P2QA 2GCTC 4BAHB 2VWNA 2ZECA 1GBAA 1RS0A 2G4UA 4FUDA 2BD2A 3BG4B 2FIRH 1ELCA 5C3NA 1TNIA 1DWCH 1OOKB 2BY6X 1L1NA 3VB5A 2HGTH 1YGCH 1VJ9U 3QTVH 1YC0A 3HATH 2JETC 1O33A 1P10A 1PQ7A 1IHTH 1P02A 4XE4A 1GJ6A 2QV1A 3BTFE 5GDSH 1UTMA 1UCYH 1VCPA 1IQNA 3ZVCA 4NSVA 2Z9IA 5K7RA 3TH4H 2Y5FA 1YP9A 1O30A 2PUQH 1MTWA 2BXTH 4GCHF 5A09A 3TVJB 1SGCA 1QNJA 4AORA 1O2HA 1NRSH 3VPKA 1HRTH 4R0IA 3ZYDA 4TWYA 2WYJA 2RG3A 4ZKOU 3E3TA 3RXUA 3W95A 1LQDB 1GPZA 1ELEE 4XBDA 1LPKB 4INKA 4K1SA 3QZQA 3HKIB 1DX5M 3ZVEA 3A85A 1NFXA 1SGIB 1O2YA 1O5GH 2NU1E 4ZKRU 3T2NA 4F49A 1OKXA 2VH6A 3VEQB 4WWYA 4LK4A 5LGOA 3W94A 1ELAA 2ZU2A 2J34A 5F6MA 2Y82A 4YT6H 3RU4E 1BBRK 2AH4X 5DK1A 4CRAA 3VXFH 1WCZA 3F9GA 3ATKA 5GIBA 2WPIS 2F9OA 1SGTA 1S82A 2OTVA 1AFQB 1OWIA 1LVOA 1WU1A 1RTKA 3ITIA 1JBUH 3P8GA 4D9RA 4Q7YA 1RJXB 3BTWE 1K1MA 2XCNA 1W12U 5SGAE 5DG6A 1GMDG 3MO6A 1HYLA 4HFPB 2BVRH 3M35A 4ZH8A 1OSSA 1OYTH 1SOZA 2BDIA 2STBE 2QF3A 2BD7A 1O3BA 1NFYA 4ZXXH 1T8MA 2P8OB 3ZZ6A 6CHAC 5GJ4B 3ZZAA 1W14U 2OC8A 2VU8E 1ZGVA 1AU8A 3UQVA 2XXLA 3MU4A 3LPRA 4AFUA 1TPSA 1AD8H 1ZGIA 5CMXH 1F0UA 1HJ9A 3E16B 3GDUA 3RXSA 4B74A 3EGKH 3UIRA 1LMWB 2ZTXA 1L2EA 3LT3A 3TU7H 2BXUH 3OX7U 3ZV9A 5EW2H 1FI8A 1NU7B 2ZQ2A 1GCTB 1SBWA 1AUTC 1MZAA 1UJ1A 5FX6A 3RLYH 2ZCHP 3A87A 2W7UA 4GPGA 2ANMH 2CJIA 1EPTB 4X2WA 1EAUA 2Z94A 2VIPA 4DVAU 7LPRA 1C5OH 1FONA 2ZZUH 2VB0A 1GJ5H 4I31A 2G5VA 1FV9A 1O2QA 1PPZA 2O9QA 2ZFTA 2QAAA 4NWKA 1W0YH 1GJ4H 3NCLA 4Y76A 3FP7E 2WPJS 4GVUA 1AMHA 1MZDA 1GHWH 2BLWA 4ZROA 1DICA 1O5AB 4WVPE 3UR9A 1JRSA 1D3DB 3I78A 1K28D 5JB8S 4GHTA 1UK3A 2Y7ZA 1ESTA 1BOQA 4E06H 4O9VA 1GI9B 3ATLA 1Y3WA 2FXRA 2R0KA 4IBLH 1OWHA 4B75A 1GJ8B 4IW4E 3Q76A 4AB8A 1A46H 2BY9X 3PWCA 3ATMA 4FUCA 5IYTA 1LDTT 4K1TA 1TQ0B 2BQ6B 2BZ6H 2BMGB 2SGQE 3VB6A 5JBTA 1AVXA 1GHZA 1O37A 1EAIA 1MU6B 2PSXA 4AYVB 1YPKH 1JMOH 1QBOA 2OXSA 2BD8A 3A80A 4X2XA 1C5XB 4BANB 2QA9E 2ODQA 1ZLRA 2FYRA 4X0WU 1Y59T 4E7RG 1UHBA 2EI8A 4ABJA 1HJAB 1D3TB 4WJG2 3UTUH 1GBHA 2AS9A 4WXVA 5AFZH 1O3KA 4MNVA 2BYAX 1Q2WA 4FUJA 1XX9A 2PKSC 3TJUA 4OS1A 3SNCA 2TGAA 3E0PB 1P3CA 1TA6A 1UMAH 3RXJA 1XXFA 4MNWA 1GBIA 3TH3H 2TGPZ 3U1IB 2ZKSA 1B0FA 1V2JT 3UREA 1O35A 1F5LA 2FX6A 2A32A 3BTQE 1DWBH 2XBYA 2SFAA 2A45B 1TGNA 3ELAH 2ZHFH 3M37A 4MPUA 5DP3A 2H9EH 2R3YA 1GL1A 1HIAA 2A4GA 3O8RA 1NC6A 1L4DA 1O2RA 4ABBA 1BRAA 2WPMS 3SNDA 1K1OA 1HCGA 2V6NA 3PV4A 5DP7A 1AIXH 1THSH 3D49H 3TK9A 3GCOA 1EZSC 2G4TA 2GDDA 2H6MA 2IOTA 1N1LA 2V3OH 2ZU5A 3Q3KA 1HFDA 1LO6A 2ZPQA 4WH8A 2FOBA 1D3QB 1G2MA 3AAVA 3T25A 3S9AA 1MCVA 4BOHA 4YOJA 2FOGA 1TNKA 3ODDA 3RXRA 1PFXC 2WUCA 1VCWA 1SPJA 5T6DA 1N6YA 3VB7A 1MU8B 1ELBA 1GI6A 4BTIB 2C8XB 2CGAA 1FY1A 1C9PA 2XCFA 2P59A 1TWXB 3RU4T 1A3EH 2J4IA 3V3MA 2BDAA 4NFEA 3OU0A 4X1NU 1GJBB 2F9BH 1RXPA 4UFDH 1C1OA 1NN6A 1EP5A 1ZPBA 1S0RA 1P0SH 5K0HA 2G51A 3VFEA 2EI6A 2OINA 3QX5H 2XBWA 2FODA 2AGEX 3SJIA 2FZZA 5DP5A 2FTMA 1D4PB 2PFEA 2A4RA 1N8OB 3LONA 1TRYA 4FU8A 5FCKA 1TBZH 2P94A 1HAZB 1PJPA 1MBQA 5EXLA 1AFQC 1NS3A 1TNLA 2XRCA 2QXJA 4XFQA 1ELFA 3SI3H 3SORA 1Z1JA 2A5IA 2BD9A 3OYPA 4MNXA 2FTLE 1C1SA 1FLEE 2OC1A 1H8DH 1OWKA 1XXDA 1Z8JB 1O2VA 3GDVA 1S0QA 1KXAA 4ABAA 1D3PB 1QURH 4FVBA 1QB9A 4X2VA 3TIUA 1FY5A 1LKBA 1ZRKA 1Z71A 2HPPH 3PWBA 5GXPA 3L6PA 2Y6TA 2GX4A 2AIQA 1GJDB 5BPEA 1HBTH 2UWOA 3DHKH 1TAWA 3SGAE 1K1NA 1HPGA 2ZI2H 2AMDA 3LJOA 3ZV8A 3P92A 1BHXF 2BLVA 3S69A 4TY6A 5HMAA 3M7TA 1CT4E 1VR1H 3H5CB 1KLJH 2ZHWH 2P3UB 1ANCA 1EZQA 2BTCE 4UEHH 2Z3EA 1ANEA 5TCAA 1O2GH 3RMNH 1QGFA 1LHDH 2ANKH 1GCTC 2FX4A 2QXGA 2GMTB 1D9IA 1LVBA 1O3OA 1ZHPA 3U69H 5EQQA 1CVWH 4RKOB 1NU9A 5GWZA 2F9PA 3FANA 1ZTLA 4ABEA 3SUGA 1DY8A 2STAE 2A31A 3U8OH 3PTNA 1CA0C 4X6OA 3SU1A 4JYTA 2GDEH 3CS7A 5F8ZA 4OS6A 3GCNA 3ENSB 3A86A 3P95A 5C1XA 1C1QA 2XWBI 1AVGH 2OUAA 1QB1A 4O03A 1SI5H 3KF2A 3D62A 4LXBH 1Z8GA 1EB1H 4I7YH 2HRVA 2H5DA 2B0FA 1FY3A 4ESTE 1GMDF 1W2KH 1ZOMA 5EG4A 1ELDE 1W8BH 2H5CA 3PMAB 1MTVA 1EZUC 3R3GB 4A1TA 1DWDH 4LZ1H 3BTEE 4CRDA 1PPCE 3K6ZA 2PV9B 1XUGA 4CREA 1SGFA 5EXNA 3HK3B 1FIZA 1FMGA 2VINA 5C5OA 1C1NA 4Y7AA 3A88A 3K65B 2VIVA 3B23B 1T31A 4JZIA 1JXPA 4YO9A 1SMFE 5F03A 2GCHG 3RXMA 4M7GA 1ABJH 2ZDVH 3VGCC 1J17T 2BDYA 1BIOA 3ZZ3A 2ZTZA 5C2ZA 2ZGJA 3STJA 1C2EA 5E2OA 4A7IB 5HYOA 1P11E 5T6FA 1GBKA 4F4OC 1YCPM 2J2UA 1NRPH 2ESTE 2SGAA 4DW2U 1SGYE 5FX5A 1F0TA 4X1RU 2W5EA 3S9CA 3RP2A 1L0ZA 4MLFB 1GJ7B 4X1PU 1BRCE 1WV7H 4HTCH 4BAKB 3SJKA 2NU3E 1AI8H 1THRH 2THFB 1TOCB 4Z6AH 1BUIA 1WQSA 3F6UH 4ABFA 1WOFA 3MH4A 4FUHA 1Z6EA 1Z8IB 8KME2 1ZMJA 3CENA 3BN9A 1Y5AT 3SBKA 4Y0ZE 1DDJA 1V2OT 3A89A 5J4SA 1EP6A 4HZHA 4Y7BA 3GY3A 2LNCA 3RDZA 1XVMA 2BDBA 2J94A 1F2SE 4AFQA 1AB9B 2AGIX 3MU0A 1SGPE 3TJNA 1PPGE 1CGIE 4CHAB 2V3HH 4MDSA 4Z0KA 3SQHE 1TRNA 1QL9A 1MCTA 3BIVH 3BV9B 3IWMA 4KELA 4VGCB 3SQEE 3LC5A 1BBRE 1F7ZA 1G9IE 2G00A 2Z7FE 1GBFA 3Q77A 2Z9KA 1IOEA 4ISIH 3HGNA 1GHBG 1KXDA 4IGDA 3RXQA 1INCA 4GUXA 1OYQA 5JDUB 1EX3A 1V2RT 3PMHB 1BMLA 3A7WA 3E91A 3SGBE 1TQ7B 4JZDH 4KKDA 2OQUA 5FCRA 1EPTA 4H6TA 1PQ5A 4IS5A 1ACBE 3SV7A 4ZHLU 1PYTD 1ELVA 2JH0D 1SVPA 2WYGA 1A0HB 1K1IA 1VITG 2W3KA 5I25A 2C8WB 2NU4E 5T3HA 2HNTE 2XBXA 3E6PH 4OS4A 3ZZ7A 1UVPA 3EDXB 2FI3E 1FQ3A 3A7XA 4Q80A 3KIDU 3CS0A 1A5HA 1D6RA 1O31A 3GYLB 5EU8A 2ODPA 1A0LA 2WPHS 2VWMA 1QHRB 3FFGA 5J4QA 1AKSB 3A8BA 4ZHAA 4AN7A 2Z9JA 1C5NH 1G30B 1QB6A 1ZHRA 1IQEA 3SU3A 4ZAEA 3BF6H 4Q7XA 1S6HA 2Y5HA 3K2UA 2BVSH 1C2MA 1S85A 3E90B 4DJZB 3P17H 1GBEA 2BOKA 3UNQA 1MTNB 1DT2A 5JYIA 1O3IA 2R2WU 3Q3XA 1HAIH 1GI7B 1UTQA 2PHBA 2TPIZ 4JYVH 3ZYEA 4O3TA 3SUEA 1QBVH 3ZVGA 3RMMH 4JZFH 4O97A 2AFQB 3EA7A 4GSOA 4NA7A 1BBRH 2ZHDA 2B8OH 4ISHH 1O5FH 1C5VA 3KQBA 1GVLA 1T8NA 2W26A 3RXEA 4CR5A 1G3BA 3ODFA 4O3UA 1O2KA 2P3TB 4OS2A 1ELTA 1QJ6B 1ZJDA 3M3TA 1P04A 1C4V2 3RLWH 2ZPRA 2YOLA 1ZJKA 4D76A 3M7QA 1BCUH 3GY4A 1FIWA 3GY8A 4FXGH 1KXFA 2RA0A 1G2LA 3TK6A 3AW0A 4NZLA 1G3EA 2ZHQH 3BIUH 1KTTB 2XC0A 1ESBA 2DE9A 1O36A 3U1JB 4JYUH 3F68H 3RXCA 2VIDA 1DFPA 1RIWC 1P8VC 1PPFE 3MU1A 1O3AA 4NWLA 3U98H 1GBMA 2OD3B 4X1QU 5BRRE 1TE0A 1GDNA 1XUFA 1K9OE 1Y8TA 1EB2A 3CP7A 4Q7ZA 3V12A 1OP2A 2GTBA 1W0ZU 2CF9H 1YLCA 1H1BA 1LHEH 4NZQA 1QY6A 3KQDA 1EJMA 3MNCA 3BEFB 3QO6A 4YT7H 2P93A 3E8LA 4TY7A 2QF0A 5GPIB 2JH6D 1EAXA 3LGVA 4A5TS 4MTBA 2GGVB 1KLIH 2UUJB 1QRZA 3GCHB 1UTJA 1G3DA 3JZ2B 1L1JA 2FI5E 4H42U 1ETTH 5DP9A 2ALPA 1VGCB 1TALA 1MMJN 1Y3UA 1YPLH 5A0AE 2BD5A 1TBQH 1TOMH 3T5FH 2HOBA 3ZZ8A 1Z7KA 5AFYH 4TPIZ 2VIOA 3LJJA 4JK6A 1LHFH 5CHAB 3RM2H 1C1PA 1HDTH 2R0LA 3GCTG 2VJ1A 3BTDE 1PQAA 1YPJH 2BB4A 3RXKA 2FWWA 1TLDA 2FEQH 2QXHA 1XUJA 3UNRA 1FZZA 1SHHB 1AB9C 7GCHG 1JWTA 4AX9H 1BHXB 3TGIE 4UFEH 2ANWA 3MO9A 2PKAB 1OS8A 3MH5A 1ANDA 2AIPA 1BRUP 1JRTA 1LVYA 1THPB 4CRGA 5DGJA 4IN2A 3GICB 4VGCC 5C1YA 2W7SA 4BAOB 1JIRA 5L2YH 1ARCA 1HAVB 1ZSKA 4K69A 3RMOH 1RRKA 1W3CA 3P70B 2ZNKH 4I32A 3SJOA 1FY8E 1T32A 1CT2E 2GCHF 2ZU3A 1SLVB 4NIWA 5CE1A 4X1SU 1LTOA 2FDAA 4FUGA 3PYHA 3ZVBA 2ILNA 2OP9A 3URCA 1ZR0A 2ODYB 4X8SH 4CBOA 1NZQH 5L6NH 1GDUA 4K8YA 4U32A 3P8FA 1C1UH 3NUMA 1ZTJA 3SUFA 2P3FH 5LPEA 1O2ZA 1A3BH 2W3IA 2QYIA 1C2HA 2CV3A 4D7FA 2GT7A 1A1RA 4JK5A 3A8CA 5I46H 2Z3DA 1NESE 4ABHA 2VGCB 1GMHG 1MKWK 1IQFA