2FOHA

Structure of porcine pancreatic elastase in 40% trifluoroethanol
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
240
structure length
240
Chain Sequence
b'VVGGTEAQRNSWPSQISLQYRSGSSWAHTCGGTLIRQNWVMTAAHCVDRELTFRVVVGEHNLNQNNGTEQYVGVQKIVVHPYWNTDDVAAGYDIALLRLAQSVTLNSYVQLGVLPRAGTILANNSPCYITGWGLTRTNGQLAQTLQQAYLPTVDYAICSSSSYWGSTVKNSMVCAGGDGVRSGCQGDSGGPLHCLVNGQYAVHGVTSFVSRLGCNVTRKPTVFTRVSAYISWINNVIASN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords elastase-1
publication title Multiple solvent crystal structures: Probing binding sites, plasticity and hydration
pubmed doi rcsb
molecule tags Hydrolase
total genus 59
structure length 240
sequence length 240
ec nomenclature ec 3.4.21.36: Pancreatic elastase.
pdb deposition date 2006-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2fohA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2fohA01
3SU1A 2GVFA 2GZ9A 1ZPZA 1W13U 2XTTB 1AVGH 3B8JA 4JK6A 3IG6B 1AFEH 1PPCE 4X0WU 1C1MA 3LJOA 4TY6A 1Z8GA 2P59A 3K6YA 1UTMA 2FO9A 3C1KA 3MYWA 1O2UA 3QWCH 4AZ2B 1O5EH 4K2YA 1GHXH 1O2VA 3A82A 1CT0E 1UTLM 5FHTA 4THNH 1Y3UA 2D8WA 2P3FH 2Z94A 2ANMH 2ZGHA 5EXNA 2EC9H 2WINI 1C1OA 4RSPA 3NWUA 2AH4X 5FAHA 1PQ7A 1ZRBA 1SGEE 2ULLA 3DHKH 3NPSA 3ATMA 1P9SA 1RRKA 3RU4D 1KXBA 1HDTH 1GJ9B 2QXHA 1CA0B 5T6GA 1AVXA 2A7CA 1BT7A 3RLYH 2C3SA 1L4DA 3BTGE 1JMOH 1MQ5A 2SGAA 4YM9A 1DWEH 3E6PH 3KQEA 2GTBA 3OSYA 3RXIA 4UFFH 1G2MA 1YPLH 3SNCA 1JXPA 1GHYH 5T6DA 5C1XA 1MTNC 3RU4T 3PROA 4KKDA 3VPKA 4MNWA 4JMYA 5GXPA 1F2SE 2G4UA 2Q1JA 2GGVB 4SGBE 2K1QA 2BMGB 2H1UA 1SQOA 2F91A 1G32B 1T31A 3DFLA 3HKJB 3OX7U 5HXFA 1MAXA 1O3CA 3SNEA 4ASHA 1OKXA 2RCEA 5EQQA 3VB7A 3RDZA 1UTNA 3CS0A 3H5CB 2G8TA 5TCAA 1GHZA 1O5FH 1OYTH 1YCPK 2B8OH 1KDQA 3GY5A 5L2ZH 2GDDA 4WH6A 4JK5A 1VITG 1RD3B 2AIPA 4TWYA 1J14A 2GKVE 1AVWA 3QLPH 4B73A 1AMHA 1SHHB 4I8HA 1BB0B 1FLEE 1GI3A 1TIOA 1YPGH 3RXCA 3MNCA 4CHAC 3UUZA 2BVSH 3OY6U 4RN6A 4OS7A 2ANWA 4Y76A 1ZPCA 2F9VA 4CR9A 4GSOA 3RXPA 2R3YA 1EOJA 2G55A 2VH6A 1RIWB 2FOEA 4O97A 4ABBA 2WPHS 1AGJA 1NFXA 3KNXA 2UUFB 4WVPE 2H9TH 2HNTE 2F9PA 1ELVA 2QXGA 5A8ZA 1UMAH 1TBRH 3ZZ9A 5EODA 2BDAA 1QTFA 1EQ9A 5GCHF 1KDQB 2A2QH 4K69A 1IQKA 4DW2U 3MNXA 1TPOA 1H1BA 5C1YA 4DOQA 1ELCA 3M5MA 1GBBA 1Z8IB 2SNWA 2ZHEH 3RXLA 2R2MB 4ESTE 2Y6TA 2BQ6B 1O31A 4UONA 4ISHH 1O2NA 1WUNH 1EP6A 1HCGA 4VGCC 3M5LA 1VJ9U 4OS4A 5AVDA 2BD2A 4BOHA 2HALA 1EUFA 4ZXXH 2FTLE 4UDWH 2G51A 3LIWA 1XMNB 1H4WA 2BTCE 2Y80A 2Y7XA 3M3VA 2AYWA 1TLDA 5C5NA 2FOHA 3BTHE 2PR3A 4FUHA 1YKTA 4ABEA 1CE5A 4IGDA 1C5MD 1MKXK 1TA2A 1GI7B 1Z71A 2IJOB 4AGJA 3F9HA 1UVOA 2GT8A 1SOTA 1TQ7B 3UWJH 2V6NA 4OS2A 2PHBA 1A61H 1C1WH 1JBUH 4INKA 2TRMA 3LDXH 2H9EH 1QQ4A 1ZHRA 3AW0A 4BAOB 1GCTC 1C2JA 5E8EH 2ZNKH 3PMJA 1FPCH 1T8OA 1V2ST 4Y8ZA 1V2VT 2J2UA 3KQBA 4ZKOU 4E05H 3T62A 1LO6A 1O2MA 1LKBA 3RXBA 4A7IB 3U8OH 2C90B 1FNIA 1QB6A 5G4BA 4X2VA 3MFJA 2ZG0H 1O3LA 1ZJKA 1MKWH 4XFQA 4K60A 4ZXYH 2PKAA 2J9NA 1BA8B 2Z3EA 1C5PA 1VCWA 4DURA 1P11E 1ORFA 1X7AC 2OQ5A 4U30A 4XBDA 4AFSA 1C2DA 2RG3A 2XC4A 3FP6E 4D8NA 1NRRH 5JDUB 3SW2B 2PWXA 2CF8H 5SGAE 3EE0B 5T3HA 1T7CA 1GHBF 4NSVA 2XBYA 2QXJA 2J38A 3H7OA 4TWWA 2BOKA 1C1UH 4YESB 2O8TA 1BCUH 2BQ7B 5TJXA 1H8IH 2QF0A 3UNSA 2KAIB 3RM2H 1DXPA 1P2JA 1FV9A 1VCQA 3UY9A 2ZU3A 5LPRA 2QY0B 3BTDE 1Y5UT 3SJOA 1O2QA 1UJ1A 2VWMA 1EZUC 4X8SH 1ZPBA 4H6TA 3SV9A 1HJ9A 2QIQA 1HPGA 4GPGA 3TJOA 4YOGA 2IOTA 1EAUA 3LONA 5EQSA 1F0SA 1GCDA 1L1JA 1RIWC 1WQSA 3LKWA 1OWIA 2TGTA 4ABGA 3JZ1B 3VGCC 1DSUA 1EPTB 1UVPA 4GVUA 3TH4H 1GHVH 5EW2H 1EAIA 3SORA 1C9PA 1XXFA 2PKSB 3I78A 2FI4E 4AN7A 1GMHG 2BX4A 1K1NA 1ZSKA 2Y5HA 5DGJA 4MNYA 3Q76A 2OP9A 2ZPSA 3UREA 1QL7A 2JH0D 4TPIZ 1OYQA 1EB1H 4X1NU 4MVNA 1HRTH 3HK6B 2Z3DA 5C3NA 1AD8H 2XW9A 1SB1H 2Z3CA 4JZDH 4XE4A 1UTPA 5HM2A 2G00A 1QRXA 1C2MA 1GHWH 2EI7A 3F9GA 1BTHH 1TGSZ 4Y8XA 4YT6H 1WCZA 1TPPA 5JBBS 1C2HA 4JYTA 1NFUA 2ZFSA 2ZFFH 1YF4A 1NESE 1VGCB 3AAUA 2BD8A 2BZ6H 3SN8A 2BYAX 3LH3A 4YOIA 1SC8U 1TAWA 1W7GH 2VH0A 3BV9B 3SUEA 1SGTA 4K1TA 1INCA 1IQIA 5F8XA 2FESH 1AQ7A 2XRCA 1QHRB 1VZQH 2FOFA 2O9QA 1EZQA 1K2I1 3EDXB 2O8UA 4WJG2 2ZU5A 1WOFA 2EA3A 1P3CA 1QY6A 2ZF0H 3P92A 1N6YA 1AZZA 2ZI2H 3TH2H 2ZKSA 2A5AA 1U6QA 3EGKH 4XSKU 2UUJB 3EA7A 2DE8A 2GCHG 3GY7A 4Z6AH 3D65E 3MOCA 1LHDH 3BSQA 1DFPA 1HAVB 3BTKE 3TK5A 2Z9KA 4GHTA 4BAKB 2TGDA 4NWLA 1BTYA 4F49A 3ZVBA 1O3EA 2GV6A 3LJJA 1P2KA 1NROH 1TNHA 3GCTF 3A85A 2J92A 9ESTA 3U98H 1T4UH 2VIPA 4D9QA 1O33A 1C1SA 1FY5A 3SJ9A 2JKHA 2ZDAH 4J1YA 2ZCHP 1BRCE 1TMTH 3M7UA 1EJAA 4IBLH 1Q3XA 4BTIB 4NGAH 4R0IA 1LPKB 1OWDA 2QGRA 1OWHA 2ZDVH 3F9FA 2BDYA 3SQEE 2XC5A 2QYIA 1TABE 3A83A 1XXDA 3S69A 2Y5GA 4KTUA 6ESTA 3ITIA 4ISLA 1GBJA 1DVAH 2AERH 3Q77A 1C5VA 3T25A 1O2IA 1SI5H 1IHTH 2OQUA 3ZZCA 1ZGVA 4CRCA 2FS8A 1P2OA 3MTYA 1YLCA 2A2XH 2ZQ1A 3F68H 1O3PB 1PJPA 4NZQA 1W11U 1K1OA 1O36A 1OP2A 1TA6A 1PFXC 1V2OT 1GHAF 1CO7E 1QL9A 2ZU4A 1CSOE 2A1DB 3NXPA 4X6MA 2FWWA 2VVVA 4I8KA 2Z9JA 2Y7ZA 4Y0YE 1GDQA 2SGEE 1QJ7B 1QL8A 1HAZB 3KL6A 4FVBA 2VINA 1BITA 2BDIA 3W94A 1EX3A 4ABIA 4JZFH 5DKMA 4D76A 2XC0A 2BDBA 5A0AE 3Q3XA 5E0HA 3EA9A 4A92A 4X8UH 3ZZBA 2R0LA 3UR6A 4TY7A 1MMJN 4OGXA 3MH5A 2B5TB 2FXRA 1MH0A 3FP8E 2A7JA 2G5VA 2ALVA 4TYDA 1G37A 1Q31A 5A2MH 4LOYH 3SJKA 1DWCH 2W5EA 5FCKA 1XKAC 1G3CA 1HJAB 1NZQH 2AEIH 3SI3H 1CU1A 1C5RA 1C5TA 4B1TA 5IYTA 1BMLA 1QCPA 1VITF 3H7TA 3ZVDA 2NU2E 1NC6A 4CH2B 1GI5A 4KP0A 1B0FA 1CVWH 5C5OA 1F0TA 1LTOA 1QQUA 1TRYA 1FN6A 1EJMA 2Z9LA 3RC4A 1GI9B 1OX1A 1C5YB 1SQAA 1D3QB 1WTHD 1UK2A 4YZUA 1DE7H 2HVXA 4HGCA 4NIWA 5AHGH 3IWMA 2A45B 3RP2A 1NTPA 1RTKA 2TGAA 6LPRA 4DVAU 3TGKE 1SGCA 3A87A 1NRSH 3SU2A 1ABIH 1ANBA 1O2GH 3O8BA 1EP5A 2GT7A 3A7XA 1O35A 2FI5E 4FU8A 1KIGH 3GCHC 1L4ZA 2BY8X 1A3EH 1MTSA 3TGJE 4X8TH 1DT2A 3S7HB 3A8DA 1C2EA 4B2AA 1QA0A 1AKSB 3T2NA 1SHYA 4BNRA 1IQLA 3VB6A 4X2XA 1BTUA 2XYAA 1P01A 1MTUA 4X2YA 1ELBA 1Z8RA 3URCA 1BBRE 5FBIA 1OWEA 1SLXB 1O38A 2ZA5A 5JB9S 4DJZB 2BDHA 3FANA 3S7KB 1K9OE 3GY6A 1KLJH 1MTVA 1PYTD 1V6DA 3R3GB 4GUXA 2ODPA 2UWPA 5EU8A 2GCTC 2OUAA 3SV8A 1MQ6A 1SGYE 4YO9A 2JETB 4X1RU 3DUXH 5EXMA 1BJVA 2FM2A 5I25A 1D6RA 3SHCH 2ZTZA 1F5KU 1IQFA 1IOEA 1OS8A 2OCVB 3ZV9A 5JBTA 2ODYB 5E0GA 2SGPE 1E34B 3I29A 2C8ZB 2Y5FA 1C1RA 1KY9A 5C1UA 1ELGA 3DA9B 1BRBE 1TPSA 3ZVEA 1PPHE 4NIYA 2VGCC 1H9IE 6CHAB 1T8LA 3VB5A 2B7DH 5EGMA 2CV3A 1IQEA 1GG6B 4B76A 1LMWB 1WU1A 1DOJA 1YPHC 5L30H 2FOMB 3SHAH 1CGHA 5EW1H 1NPMA 1DITH 3I77A 2FX6A 2P3UB 4GCHG 3RC5A 3B9FH 3U1JB 1GGDC 1D4PB 1Z6JH 2OC7A 2ZU2A 2QA9E 3QZRA 3S0NA 4MPXA 1RS0A 4MQAA 4K3JA 2WYJA 4BAMB 4AORA 3AVZA 2ZTYA 4HFPB 1ZLRA 1TNLA 2VNTA 5DPAA 1GMCG 4A1VA 2XWBI 2AGEX 1OWJA 1H9HE 3D49H 3URDA 1GL0E 2ZTXA 4Z0KA 1EKBB 1P06A 2BDCA 2J95A 3L3TA 1HXEH 5AFYH 2H5CA 1FJSA 3SJIA 4WMFA 4CRAA 2F3CE 1F0UA 1P8VC 2ZFTA 4RKJB 1AU8A 2P94A 2BXUH 2W7UA 1A0HB 2ZHFH 3LGYA 4I31A 1GBIA 4WXIA 3T28A 2SGDE 1TBQH 1YBWA 3OYPA 3VXFH 4ZMAH 4LXBH 1EATA 5EPNA 5BRRE 2A5KA 1GVKB 1S0QA 1O39A 1O3GA 1ELAA 1ELFA 1QRWA 1F5LA 1GBDA 4XBBA 2ZHQH 3LH1A 3ZVAA 2QN5T 2XCNA 2BQWB 5JB8S 1V2PT 3A81A 1F7ZA 3ZZ6A 2ZU1A 1AN1E 4MDSA 3BN9A 2BM2A 3M3TA 3HKIB 1KXEA 5DO4H 1A2CH 4WF8A 1FAKH 1FAXA 2Y82A 4IN2A 1GMHF 1V2UT 4NZLA 4INHA 3KEEA 4A1XA 1C5LH 3LGVA 3SJ8A 1ARCA 3SNDA 2AMDA 4NG9H 1O34A 4QT8C 5DP6A 1O5BB 2UWOA 2ZC9H 2XCFA 5FX5A 3UQOA 1GBAA 1XUHA 1HUTH 1UTQA 4NFFA 1M9UA 1MCTA 1XUGA 2O8LA 1MD8A 1BIOA 1THRH 3E0PB 2OD3B 3RXRA 2ZO3H 4FUJA 1O5GH 1SGDE 1J15A 1NT1A 4I8GA 1WSSH 4BXSA 3KGPA 1IAUA 2FZZA 2WPJS 1IQJA 4MTBA 4YLQH 1ESAA 4IMZA 3SNAA 1T4VH 2C8YB 1HAHH 1HB0B 4OS6A 1HAOH 2NWNA 2PLXA 1TQ0B 3M61U 4HI3A 3L33A 3RXDA 2FLBH 1YCPH 2P8OB 2ZWLH 4X8VH 4KTSA 3RXQA 1C2IA 1MUEB 3A7TA 4UD9H 1EB2A 2JH6D 1HAPH 3MU1A 1YC0A 1YP9A 3P8NA 2XBWA 2G5NA 4CRBA 1GG6C 3NKKA 2GZ8A 2B0FA 1K22H 2ALPA 2WPKS 4UE7H 1EXFA 3RXUA 1V2WT 2DE9A 4Y71A 5A8XA 1HIAB 3QN7A 1F5RA 2SFAA 1FXYA 4IS5A 4TPYA 4U01A 3RXJA 4BTUB 2KAIA 1CGJE 1CHOG 2HPPH 2CHAB 2GCHF 1CA0C 1TE0A 1W2KH 2PV9B 3RC6A 1DS2E 4ABHA 1GI6A 2F9NA 4NIXA 1UTOA 1KTSB 7GCHG 2TPIZ 2ZP0H 4DIIH 4MPWA 1LCYA 3LGIA 1D9IA 1C4V2 5JYIA 5DP4A 5C2ZA 2VIQA 3A8AA 3CP7A 4MNXA 1QJ6B 2Z9GA 3ZZ8A 1O5CB 3JZ2B 1K1IA 3RUOA 1YPEH 5AF9H 2VJ1A 4AG1A 3A7WA 3FVFB 1WYKA 1EPTA 2OC0A 1GBFA 3HPTB 2AIQA 2BD4A 3TITA 4AFZA 3SUGA 1UHBB 1ANCA 1S5SA 1CT4E 1BJUA 1N8OB 1MU6B 1SVPA 1FONA 3S9BA 1SGRE 2W26A 1ANDA 1AIXH 3ATWA 2C4FH 1SOZA 1ZHPA 1KSNA 2PUQH 3LGTA 1AFQB 1ZMLA 1MKXH 1PPZA 3VB3A 1O2YA 2ZFQH 4ABDA 3F1SB 1S82A 2M5TA 1MAYA 1ZJDA 1ETSH 1ACBE 3LOXA 2ZDKA 3TVJB 1XKBC 5EQRA 1G9IE 1P57B 2I6SA 3SZNA 3RXTA 8GCHG 1ARBA 3GYMA 1P2IA 3TPIZ 2FLRH 4A1TA 1O2XA 3RMMH 1D3DB 1FY4A 1G3DA 1CBWB 3HGNA 1ELDE 1KLIH 2XNIA 4IMQA 5C20A 2TGPZ 1IQNA 1TFXA 5FPTA 1GJ6A 3EA8A 1OSSA 1ELEE 5FXLA 3GY2A 1ZMNA 2OBQA 1GJ4H 2CJIA 2C8WB 5PTPA 1O2TA 1XVMA 3EYDA 3HGPA 3TNTA 2A32A 3MNBA 4GLYA 4K5ZA 3TU7H 1MCVA 1GVLA 1C1QA 1GI0A 3A7ZA 4Q80A 1P3EA 1XVOA 1W7XH 2WUCA 1W3CA 1CT2E 1TBZH 3QGNB 4FUFA 2WUBA 1GBKA 4BAHB 1J16A 1IQMA 1MZAA 1V2TT 4YTAA 2HLCA 1KXDA 1O2KA 3UR9A 1P12E 2XXLA 2HGTH 1CHGA 1V2MT 1FIZA 1EAXA 2VVUA 1JIMA 1GI1A 1FI8A 4O3TA 1HAVA 1K28D 2V3HH 1HNEE 5HMAA 4A5TS 1LVMA 1OPHB 1AWHB 3BTWE 1QBNA 3T5FH 2GDEH 3SV2H 1H8DH 1PYTC 3F9EA 2ZPRA 2BY9X 4XOJA 1ZRKA 1TRNA 2HWLB 5FCRA 7ESTE 2OLGA 3UWIA 3QX5H 4CRFA 5L6NH 1TX8A 1EOLA 2QCYA 1DICA 3ODFA 2BXTH 3QDZB 4O3UA 2ANKH 3RU4E 8ESTE 3UNQA 2A4RA 2ZQ2A 1DX5M 3GYLB 2R0KA 3RXHA 1BBRK 1DPOA 5E2PA 3NZIA 1B7XB 2ZEBA 4NWKA 4Q2KA 3RXSA 1YYY1 4RKOB 5GWZA 3KQDA 3M7TA 1ZR0A 3SOSA 5ABWA 4D7GA 1O2SA 4NFEA 1BUIA 2P95A 3SI4H 2OINA 1A7SA 1Z1JA 5JPMH 4ZUHA 1T8MA 2FOCA 1J9CH 2D1JA 4FU7A 1HFDA 2GZ7A 5FX6A 3O8DA 1SR5C 2OXSA 2A0QB 5F8TA 1XUFA 4WY3A 3GDVA 1MBMA 1JRTA 1P2MA 4IN1A 1C1NA 1IHSH 1TOMH 1AE5A 3F6UH 1K1LA 5CMXH 1TNIA 4K1EA 1ZTLA 3S9CA 1LHFH 5EXLA 1NU7B 5F8ZA 3BTTE 3STIA 2BLWA 4KELA 4WMDA 3Q3YA 1HYLA 2FMJA 1G3EA 3A80A 1MD7A 1N8OC 2W3KA 4SGAE 2NU3E 1Z6EA 3TJVA 1G2LA 2A7HA 4Y8YA 3EAJA 3SU0A 1WQVH 4AGKA 3O8RA 5JBCS 5DK1A 3OTJE 3E3TA 2WYGA 3QUMP 3FAOA 1LHCH 3C27B 1HAIH 1O3JA 1O37A 3RXAA 4F4OC 3KQCA 1FY8E 1UO6A 2A5IA 3PO1B 1G36A 1SGPE 1C9TA 1CBWC 1EPTC 2BHGA 3E16B 4Y7AA 1F92A 1YPJH 4GCHF 5J4QA 1THSH 5DP8A 2PKSC 1C5OH 1C2KA 1BBRH 1HBTH 5K7RA 4CR5A 4FUDA 2V35A 3TLOA 4OS1A 2ZECA 4X6NA 4I8LA 4JZ1A 2J94A 4X6OA 4WWYA 3FZDA 1Y3XA 2CF9H 1AO5A 1TONA 2GX4A 1A0JA 5AFZH 1OP0A 1GMCF 1O3HA 2VIOA 2PFEA 4O03A 5HGGA 1J8AA 1SMFE 3V0XA 1A5GH 2Q6DA 2ESTE 5JBAS 2AMQA 3QK1A 2AS9A 1D3TB 1O2RA 2XBXA 2FX4A 3MWIU 4BXWA 4K8BA 2XWAA 3MO3A 1ZOMA 1VGCC 1FMGA 1MTNB 3E8LA 3AW1A 1AKSA 1LQDB 2FOGA 1O3IA 1NM6A 1C5QA 1C2LA 3K9XB 1L1GA 5EPYA 1LVBA 5DP5A 1SLUB 3PMHB 3U9AH 4ZHLU 1OP8A 4I7YH 2YOLA 1G30B 1TNKA 1W0ZU 4MLFB 2WPLS 2Q6GA 4Y79A 1TWXB 5GJ4B 5EG4A 2BZAA 4DCDA 1EASA 1GPZA 3M5NA 1N6XA 1PPGE 3V13A 3ZZ7A 1O32A 1GVZA 2P16A 1A4WH 2FPZA 1QA7A 3O8CA 2WPMS 2AGIX 2ZIQH 3KN2A 1V2LT 4CHAB 1ZHMA 1UK4A 4AB8A 4MG3A 1DXWA 1W12U 3ELAH 1S0RA 4DT7B 3ZVCA 2FOBA 2FYQA 2DUCA 2NU0E 2P3TB 9LPRA 1GI4A 3SUFA 3LGWA 2PGBB 3GY3A 3W95A 1TRMA 3A88A 1TPAE 4DY7B 1SL3A 2OC8A 3T26A 3ZZDA 3LC5A 3ZYEA 3LC3A 2BD7A 1O3BA 1V2RT 3RXVA 3QGJA 2ASUB 1NFYA 3U8RH 4NIVA 3UOPA 1GMDG 3E1XB 1AY6H 2FS9A 1ZYOA 3MI4A 1GDUA 1CA8B 3RLWH 1OOKB 4AX9H 3SU5A 3ZVGA 3GICB 1YPHE 2ZGCA 3PTNA 4UFDH 5J4SA 3PWCA 1PQ5A 3STJA 3Q00A 4IC6A 3A89A 1TNJA 3SNBA 1PPFE 1SGFG 3PMAB 1VCPA 3U69H 2ZGXH 5BPEA 3ESTA 1GJBB 2STBE 1O2OA 1Y8TA 1S81A 1HXFH 2JH5D 2G52A 1UCYE 5F6MA 3PO1C 4B75A 4ZHMU 1BOQA 1D6WA 1BMMH 2R9PA 1BDAA 3RXMA 3M7QA 2HOBA 1CHOF 5K0HA 4BAQB 1BTWA 3SGAE 2VIVA 5B6OA 3PWBA 5CHAB 2G81E 4KTCA 1L2EA 5CE1A 7GCHF 3BEFB 4JZEH 3SU3A 1GBLA 2BD3A 5I46H 1UK3A 3PV4A 1GHAG 3KHVA 4X1SU 1GCTB 3MU5A 1SGNE 1DUEA 1GBMA 3ZZ4A 7LPRA 4DG4A 2WV5A 3ATLA 3HK3B 1GI2A 1GJDB 2ZFRH 3A8BA 3LPRA 3A8CA 5LH8A 2ZCLP 4DGJA 1SGFA 1B5GH 3UTUH 1O2JA 3B23B 2W3IA 5EOKA 1Z1IA 1Z7KA 4CRGA 1HJAC 6GCHG 3KCGH 3GDUA 1NRNH 2ZDLA 3MH6A 1NY22 1XX9A 1GBCA 3UIRA 3GISB 4Y6DA 1DY9A 1ESBA 3R0FA 4Y0ZE 5DP3A 2XBVA 2EEKA 5FBEA 1FDPA 3TH3H 1W8BH 1L0ZA 3KIDU 1KLTA 1O5AB 1W14U 1QBVH 1DDJA 1E0FD 1AB9B 2TIOA 4AFUA 2LPRA 3QO6A 5HYOA 4I33A 1DWBH 1HGTH 2GMTB 3MMGA 3T27A 1FZZA 4J2YB 1O2ZA 4ZKNU 1AZ8A 3BEIB 8GCHF 1KTTB 1JOUB 2PTNA 2WPIS 1DSTA 5H4IB 3BTEE 3V7TA 4HTCH 4ISNA 2A4OA 1SLVB 2Z7FE 3EQ0H 1TGCA 2TBSA 3UNRA 3G01A 1P2NA 3E0NB 4ZAEA 3GY4A 3M5OA 4E7RG 2IN2A 4UEHH 2BLOA 1DLEA 1P02A 1QB1A 2B9LA 1WTGH 1S84A 3PLBA 4Y10E 3UFAA 4CRDA 1V2NT 2BOHB 4X1PU 4ISIH 1LVOA 2IPHA 1TMBH 1MKWK 1TGNA 3FZZA 2AGGX 1P04A 4UFEH 4UFGH 1IQGA 1SPJA 3VGCB 4FUEA 2CXVA 1K1MA 1AHTH 2QF3A 3MNSA 2ZGBH 4XBCA 3AAVA 3DD2H 1T8NA 1OXGA 1HIAA 1VR1H 4B74A 1O2LA 1ABJH 1Y3YA 3SO3A 3ZZ5A 2JETC 3MU4A 2SGFE 1SFIA 3S9AA 4X2WA 3UPEA 3NUMA 5LPFA 1C5WB 1O2PA 2H6MA 4AYYB 1EZSC 1BMNH 4I8JA 4D9RA 2FP7B 4KGAA 1LPZB 2BY5X 2WV4A 2HNTC 4OS5A 4ZH8A 1WAYB 1V3XA 3SV6A 1GBHA 2NU1E 4OGYA 2ZDNA 3RXKA 1DM4B 4B71A 1PPEE 1FY3A 2P93A 2V0BA 1CGIE 6CHAC 1P9UA 1TMUH 2VVCA 1P2QA 1SG8B 3LT3A 3DT0H 3D23A 5F03A 2BY6X 3BTME 1HJ8A 2D26C 3OY5U 1JRSA 2STAE 4DIHH 4GHQA 1NO9H 3SGBE 4MPVA 4FUCA 1QGFA 1W0YH 5CHAC 1UHBA 2A4GA 3P8OA 2Q6FA 1SFQB 1VITH 2O8MA 5A0CA 1BHXB 1Y59T 1KXCA 2ZGJA 3AASA 2BVRH 8KME2 2ZPQA 1S6HA 5ESTE 5E2OA 1QBOA 1DLKB 4NA9H 2PSYA 5GPIB 3SU4A 1G3BA 2OBOA 5A0BA 2AMPA 1FY1A 3IITA 4ZKSU 1O3AA 4MNVA 2J4IA 2SGQE 4D7FA 1GJCB 1YLDA 3ZZAA 2R3UA 4O9VA 4X6PA 2NU4E 2C93B 3E91A 3PLPA 2VWLA 1QURH 4MPUA 1DWDH 5FPYA 4CBNA 4M7GA 3ZV8A 2BLVA 1K21H 4AFQA 1ZMJA 1BTPA 1HLTH 2CN0H 2RA3A 2YNAA 2F9UA 1E38B 1MTWA 3RM0H 1C1TA 1RTFB 1RTLA 3GCOA 3MH7A 1LKAA 1LPGB 3V12A 1FQ3A 2PW8H 3PTBA 3BG4B 2UWLA 1AB9C 1GDNA 1QB9A 2A31A 3U1IB 5GDSH 3RMLH 1FPHH 2V3OH 2HPQH 2J34A 1L1NA 2GMTC 2FIRH 1MZDA 4ZROA 1BTZA 2VB0A 3P95A 1EZXC 1DY8A 4YOJA 3M37A 1WV7H 2FOAA 1ANEA 1A46H 1V2JT 1T32A 2PKAB 4NCYA 1QR3E 3K6ZA 2F83A 1MBQA 1PQAA 4WH8A 2UUYA 1YGCH 4B2BA 2AFQB 3TNSA 1NFWA 3BTQE 1GJ7B 1AE8H 4U32A 2VU8E 3MO9A 3U8TH 1C5ZB 1TX6A 4FUIA 1YPKH 3FP7E 3P6ZB 1ETRH 2W7SA 1GJ5H 1ZGIA 1GL1A 4FUGA 1JIRA 2QC2A 1RJXB 1CQQA 4AOQA 2FEQH 1A1RA 2ZHWH 4HZHA 3ODDA 1FN8A 5GCHG 2FI3E 3VEQB 1O3KA 3FFGA 4IC5A 1TALA 3CENA 3M35A 3D62A 1DANH 3MU8A 1BRUP 3BEUA 3PM3A 1BQYA 2ILNA 3P8GA 2HNTF 3UOUA 3RMOH 2PGQB 1GBEA 2A4QA 2P8OC 3MH4A 3ENSB 1QRZA 5HM9A 5IDKA 1SGQE 1QJ1B 2ODQA 2BX3A 1JWTA 2BY7X 4K1SA 2H9HA 1ZTKA 2BD5A 2O8WA 2FODA 1LHGH 1B0EA 4ZKRU 1O3FA 1LVYA 1QFKH 1P0SH 2F9BH 2H2ZA 1Y3VA 2OTVA 1YPMH 1C5SA 3WY8A 4B2CA 2FYRA 1OWKA 1XUKA 2OC1A 2BB4A 3P70B 4YT7H 1AUJA 2UUKB 3RXEA 2CHAC 2ZCKP 1E35B 1LHEH 3SU6A 3BIUH 3PYHA 2RA0A 4AG2A 2QV1A 3ATKA 1V2KT 2QAAA 8LPRA 3QTVH 1FIWA 1J17T 1A5IA 1W10U 1O2HA 3SQHE 3PMBB 1C5XB 1E36B 3SGQE 3VXEH 1A5HA 1TX7A 1ETTH 1QNJA 1ZTJA 5LGOA 1WBGB 2BLQA 4ABJA 5ETXA 3GCHB 3SV7A 1PPBH 3GCNA 1O3MA 1LQEA 3BIVH 3K2UA 2Z6BD 1C5UA 1C2FA 1GMDF 1C1PA 2VWOA 1P03A 1Y5BT 2D2DA 3DFJA 3SUDA 1AI8H 1TOCB 1UCYK 4X1QU 4ZHAA 3A86A 2ZZUH 1GJAB 1RGQA 2QXIA 2GV7A 2PTCE 3BG8A 4Y11E 4BTTB 3Q3KA 2R2WU 2ZDMA 3K65B 3BG4C 1O30A 5DJ7A 1BRAA 1GHBG 1AFQC 3VFEA 5L2YH 1GWAA 1C4Y2 1NN6A 4FXGH 4JCNA 3TJNA 2BVXH 2C8XB 1EJNA 5TCCA 1FUJA 3TJUA 1Y5AT 4ABAA 1TGBA 4ABFA 3A84A 2GCTB 4GAWA 4IW4E 4E7NA 2VWNA 3HATH 4H4FA 1GI8B 3NK8A 2GP9B 4NA8A 3KF2A 1H9LB 1UTJA 4JZIA 1K1JA 3MHWU 1ZZZA 1GBTA 2HRVA 1C1VH 1D3PB 1AWFH 3BF6H 2SNVA 1F0RA 4U2WA 1KXFA 1O0DH 3SBKA 1AUTC 1TYNA 4A6LA 2ANYA 1UTKA 5A09A 1E37B 1RXPA 3P17H 1Z8JB 1HAYB 2PSXA 2VGCB 3PB1E 4FVDA 4JYUH 5DP7A 4YLUA 1O2WA 4LZ4B 1GJ8B 2BD9A 2H5DA 1XM1A 4AYVB 1S83A 1BMAA 1SLWB 1QIXB 1P05A 1O3OA 5A8YA 3TK6A 3TIUA 1C4U2 4NA7A 1P09A 4R8TB 5DG6A 1Q2WA 2F9OA 1GGDB 1V2QT 6GCHF 1TB6H 3RXFA 3CS7A 4ISOA 2I6QA 3QZQA 1K1PA 4Q7XA 2G4TA 1A0LA 3T29A 2Z9IA 1PQ8A 2FDAA 2EI8A 4K8YA 3ZYDA 1YCPM 1Y3WA 1YM0A 4BANB 4WMEA 3MO6A 3RMNH 1UCYH 1ZSLA 1N1LA 2PUXB 4E06H 1KXAA 1O3NA 1VJAU 2VIDA 1ELTA 1EAWA 1HAXB 2CMYA 2GD4B 2EI6A 1XUJA 1KYNA 4FU9A 4CBOA 5ESBA 1SQTA 1S6FA 5LPEA 3LU9B 1NU9A 3ZVFA 4NSYA 4H6SB 2FTMA 3BTFE 3V3MA 4H42U 1NRQH 3GDSA 1BHXF 3GY8A 1TGTA 2VIWA 2Y81A 4Y7BA 1THPB 3M3SA 3PLKA 3RXOA 4INLA 3QTOH 1ID5H 1ESTA 4XDEA 3GOVB 1IQHA 1MU8B 1ZSJA 3TGIE 3TK9A 1UVTH 4Q7ZA 3NCLA 2YNBA 3M36A 2RDLA 1S85A 1SGIB 1NS3A 7KMEH 3VB4A 1A3BH 1SBWA 3UQVA 1BZXE 2ZFPH 5T6FA 3E90B 4FUBA 4AB9A 3N7OA 1O5DH 4LK4A 4WXVA 1RFNA 1UVUH 4LZ1H 2CGAA 3LGUA 1UVSH 2THFB 4PROA 3A7VA 5DP9A 1SSXA 1XUIA 3P8FA 4JYVH 3ZZ3A 2ZHDA 3RXGA 1C5NH 5GIBA 2LNCA 3A7YA 1DUAA 3GCTG 1C2GA 5E0JA 4Q7YA 3OU0A 5C67A 1BTXA 1P10A 3L6PA 1O3DA 3MU0A 1LDTT 2BDGA 3ATIA 4VGCB 4CH8B 4I32A 1TNGA 1HAGE 5FPSA 4CREA 1NRPH 1HV7A
chains in the Genus database with same CATH superfamily
3SU1A 2GVFA 2GZ9A 1ZPZA 1W13U 2XTTB 1AVGH 3B8JA 4JK6A 3IG6B 1AFEH 1PPCE 3SZEA 4X0WU 1C1MA 3LJOA 4TY6A 1Z8GA 2P59A 3K6YA 1UTMA 2FO9A 3C1KA 3MYWA 1O2UA 3QWCH 4AZ2B 1O5EH 2F43B 4K2YA 1GHXH 1O2VA 3A82A 1CT0E 1UTLM 5FHTA 4THNH 1Y3UA 2D8WA 2P3FH 2Z94A 2ANMH 2ZGHA 5EXNA 2EC9H 2WINI 1C1OA 4RSPA 3NWUA 2AH4X 5FAHA 1PQ7A 1ZRBA 1SGEE 2ULLA 3DHKH 3NPSA 2WSSD 3ATMA 1P9SA 1RRKA 5KECA 3RU4D 1KXBA 1HDTH 1GJ9B 1VKYA 1CA0B 2QXHA 1AVXA 2A7CA 5T6GA 1BT7A 3RLYH 2C3SA 1L4DA 3BTGE 1JMOH 1MQ5A 2SGAA 4YM9A 1DWEH 3E6PH 3KQEA 2GTBA 3OSYA 3RXIA 4UFFH 1G2MA 1YPLH 3SNCA 1JXPA 1GHYH 4AC9A 5T6DA 5C1XA 1MTNC 3RU4T 3PROA 4KKDA 3VPKA 4MNWA 4JMYA 5GXPA 1F2SE 2G4UA 2Q1JA 2GGVB 4SGBE 2K1QA 2BMGB 2H1UA 1SQOA 2F91A 1G32B 1T31A 3DFLA 3HKJB 3OX7U 5HXFA 1MAXA 1O3CA 3SNEA 4ASHA 1OKXA 2RCEA 5EQQA 3VB7A 3RDZA 1UTNA 3CS0A 3H5CB 2G8TA 5TCAA 1GHZA 2IPQX 1O5FH 1OYTH 1YCPK 2B8OH 2KX4A 1KDQA 3GY5A 5L2ZH 2GDDA 2KZ4A 4WH6A 4JK5A 1VITG 1RD3B 2AIPA 4TWYA 1J14A 2GKVE 1AVWA 3QLPH 4B73A 1AMHA 1SHHB 4I8HA 1BB0B 1FLEE 1GI3A 1TIOA 1YPGH 3RXCA 3MNCA 4CHAC 3UUZA 2BVSH 3OY6U 4RN6A 4OS7A 2ANWA 4Y76A 1ZPCA 2F9VA 4CR9A 4GSOA 3RXPA 2R3YA 1EOJA 2G55A 2VH6A 1RIWB 2FOEA 4O97A 4ABBA 4FOUC 2WPHS 1AGJA 1NFXA 3KNXA 2UUFB 4WVPE 2H9TH 2HNTE 2F9PA 1ELVA 2QXGA 5A8ZA 2J97A 1UMAH 1TBRH 3ZZ9A 5EODA 2BDAA 1QTFA 1EQ9A 5GCHF 1KDQB 2A2QH 4K69A 1IQKA 4DW2U 3MNXA 1TPOA 1H1BA 1W0KD 5C1YA 2GJGA 4DOQA 1ELCA 3M5MA 1GBBA 1Z8IB 2SNWA 2ZHEH 3RXLA 4F55A 2R2MB 4ESTE 2Y6TA 2BQ6B 1O31A 4UONA 2F4LA 4ISHH 1O2NA 1WUNH 1EP6A 1HCGA 4VGCC 3M5LA 1VJ9U 4OS4A 5AVDA 2BD2A 4BOHA 2HALA 1EUFA 4ZXXH 2FTLE 4UDWH 2G51A 3LIWA 1XMNB 1H4WA 2BTCE 2Y80A 2Y7XA 3M3VA 2AYWA 1MABB 1TLDA 5C5NA 2FOHA 3BTHE 2PR3A 4FUHA 1YKTA 5T1VA 4ABEA 1CE5A 4IGDA 3GS9A 1C5MD 1MKXK 1TA2A 1GI7B 1Z71A 2IJOB 4AGJA 3F9HA 3F2HA 1UVOA 2GT8A 2WHXA 1SOTA 1TQ7B 3UWJH 2V6NA 4OS2A 2PHBA 1A61H 1C1WH 1JBUH 4INKA 2TRMA 3LDXH 2H9EH 3F0OA 1QQ4A 1ZHRA 3AW0A 4BAOB 1GCTC 1C2JA 5E8EH 2ZNKH 3PMJA 1FPCH 1T8OA 1V2ST 4Y8ZA 1V2VT 2J2UA 3KQBA 4ZKOU 4E05H 3T62A 1LO6A 1O2MA 1LKBA 3RXBA 4A7IB 3U8OH 2C90B 1FNIA 4F48B 1QB6A 5G4BA 3U28C 4X2VA 3MFJA 2ZG0H 1O3LA 1ZJKA 1MKWH 4RT1A 4XFQA 4K60A 1WXRA 4ZXYH 2PKAA 3F2GA 2J9NA 1BA8B 2Z3EA 1C5PA 1VCWA 4DURA 1P11E 1ORFA 1X7AC 2OQ5A 2EY4C 3F0PA 1NBMD 4U30A 4XBDA 2L74A 4AFSA 1W0JD 5EIYA 1C2DA 2RG3A 1E79D 2XC4A 3FP6E 1NRRH 4D8NA 5JDUB 3SW2B 2PWXA 3ZIAD 2CF8H 5SGAE 3EE0B 5T3HA 1T7CA 1SQRA 1GHBF 4NSVA 2XBYA 2QXJA 2J38A 3H7OA 4TWWA 2BOKA 4XRNA 1C1UH 4YESB 2O8TA 1BCUH 2BQ7B 5TJXA 1H8IH 2QF0A 3UNSA 2KAIB 3RM2H 1DXPA 1P2JA 1FV9A 1VCQA 3UY9A 2ZU3A 4ACBA 5LPRA 4TSFD 2QY0B 3BTDE 1Y5UT 3SJOA 1O2QA 1UJ1A 2VWMA 1EZUC 4X8SH 1ZPBA 4H6TA 3SV9A 1HJ9A 2QIQA 1HPGA 4GPGA 3TJOA 4YOGA 2IOTA 1EAUA 3LONA 5EQSA 1F0SA 1GCDA 1L1JA 1RIWC 1WQSA 3LKWA 1OWIA 2TGTA 4ABGA 3JZ1B 3VGCC 1DSUA 1EPTB 1UVPA 4GVUA 3TH4H 1GHVH 5EW2H 1EAIA 3SORA 1C9PA 1XXFA 2PKSB 3I78A 2FI4E 4AN7A 1GMHG 2BX4A 1K1NA 1ZSKA 2Y5HA 5DGJA 4MNYA 3Q76A 2OP9A 2ZPSA 1SKYE 3UREA 1QL7A 2JH0D 4TPIZ 1OYQA 2KCYA 1EB1H 4X1NU 4MVNA 1HRTH 3HK6B 2Z3DA 5C3NA 1AD8H 2XW9A 1SB1H 2Z3CA 4JZDH 4XE4A 1UTPA 5HM2A 2G00A 1QRXA 1C2MA 1GHWH 2EI7A 3F9GA 1BTHH 1TGSZ 4Y8XA 4YT6H 1WCZA 1TPPA 5JBBS 1C2HA 4JYTA 1NFUA 2ZFSA 2ZFFH 4RT0A 2EQNA 1YF4A 1NESE 1VGCB 3AAUA 2BD8A 2BZ6H 3SN8A 2BYAX 3LH3A 4YOIA 1SC8U 1TAWA 1W7GH 2VH0A 3BV9B 3SUEA 1SGTA 4K1TA 1INCA 1IQIA 5F8XA 2FESH 1AQ7A 2XRCA 1QHRB 1VZQH 2FOFA 3PV2A 3WWFA 2O9QA 1EZQA 1K2I1 3EDXB 2O8UA 4WJG2 2ZU5A 1WOFA 2EA3A 1P3CA 1QY6A 2ZF0H 3P92A 1N6YA 1AZZA 2ZI2H 3TH2H 2ZKSA 2A5AA 1U6QA 3EGKH 4XSKU 2UUJB 3EA7A 2DE8A 2GCHG 3GY7A 4Z6AH 3D65E 3MOCA 1LHDH 3BSQA 1DFPA 1HAVB 3BTKE 3TK5A 2Z9KA 4GHTA 4BAKB 2TGDA 4NWLA 1BTYA 4F49A 3ZVBA 1O3EA 2GV6A 3LJJA 1P2KA 1NROH 1TNHA 3GCTF 3A85A 2J92A 9ESTA 3U98H 1T4UH 2VIPA 4D9QA 1O33A 1C1SA 1FY5A 3SJ9A 2JKHA 2ZDAH 4J1YA 2ZCHP 1BRCE 1TMTH 3M7UA 1EJAA 4IBLH 1Q3XA 4BTIB 4NGAH 4R0IA 1LPKB 1OWDA 3OEED 2QGRA 1OWHA 2ZDVH 3F9FA 2BDYA 3SQEE 2XC5A 2QYIA 1TABE 3A83A 1XXDA 3S69A 2Y5GA 4KTUA 6ESTA 3ITIA 4ISLA 1GBJA 1DVAH 2AERH 4YXWD 3Q77A 1C5VA 3T25A 1O2IA 1SI5H 5HIZA 1IHTH 2OQUA 3ZZCA 1ZGVA 4CRCA 2FS8A 1P2OA 3MTYA 1YLCA 2A2XH 2ZQ1A 3F68H 1O3PB 1PJPA 4NZQA 1W11U 1K1OA 5C0TA 1O36A 1OP2A 1TA6A 1PFXC 1V2OT 1GHAF 1CO7E 1QL9A 2ZU4A 1CSOE 2A1DB 3NXPA 4X6MA 2FWWA 2VVVA 4I8KA 2Z9JA 2Y7ZA 4Y0YE 1GDQA 2SGEE 1QJ7B 1QL8A 1HAZB 1K0HA 3KL6A 4FVBA 2VINA 1BITA 2BDIA 3W94A 1EX3A 4ABIA 5DSFA 4JZFH 5DKMA 4D76A 2XC0A 2BDBA 5A0AE 3Q3XA 5E0HA 3EA9A 4A92A 4X8UH 3ZZBA 2R0LA 3UR6A 4TY7A 1MMJN 4OGXA 3MH5A 2B5TB 2FXRA 1MH0A 3FP8E 5IK2D 2A7JA 2G5VA 2ALVA 4TYDA 2V7QD 1G37A 1Q31A 5A2MH 4LOYH 3SJKA 1DWCH 2W5EA 5FCKA 1XKAC 1G3CA 1HJAB 1NZQH 2AEIH 3SI3H 1CU1A 5CDFE 1C5RA 1C5TA 4B1TA 5IYTA 1BMLA 1QCPA 1VITF 3MQKC 3H7TA 3ZVDA 2NU2E 1NC6A 4CH2B 1GI5A 4KP0A 1B0FA 1CVWH 5C5OA 1F0TA 1LTOA 1QQUA 2HLDD 1TRYA 1FN6A 1EJMA 2Z9LA 3RC4A 1GI9B 2QF5A 1OX1A 1C5YB 1SQAA 1D3QB 1WTHD 1UK2A 4YZUA 1DE7H 2HVXA 2KCPA 4HGCA 4NIWA 5AHGH 3IWMA 2A45B 3RP2A 1NTPA 1RTKA 2TGAA 6LPRA 4DVAU 3TGKE 1SGCA 3A87A 1NRSH 3SU2A 1ABIH 1ANBA 1O2GH 3O8BA 1EP5A 2GT7A 3A7XA 1O35A 2FI5E 4FU8A 1KIGH 3GCHC 1L4ZA 2BY8X 1A3EH 1MTSA 3TGJE 4X8TH 1DT2A 3S7HB 3A8DA 1C2EA 4B2AA 1QA0A 1AKSB 3T2NA 1SHYA 4BNRA 1IQLA 3VB6A 4X2XA 4ACAA 1BTUA 2XYAA 1P01A 3WW7A 1MTUA 1H8HD 4X2YA 1ELBA 1Z8RA 3URCA 1BBRE 5FBIA 1OWEA 1SLXB 1O38A 2ZA5A 5JB9S 4DJZB 2BDHA 3FANA 3S7KB 2HVYB 1K9OE 3GY6A 1KLJH 1MTVA 3DSPA 1PYTD 1V6DA 3R3GB 4GUXA 2ODPA 2UWPA 5EU8A 2GCTC 2OUAA 3SV8A 1MQ6A 1SGYE 4YO9A 2JETB 4X1RU 3DUXH 5EXMA 1BJVA 2FM2A 5I25A 1D6RA 3SHCH 2ZTZA 1F5KU 1IQFA 1IOEA 3CNRA 1OS8A 2OCVB 3ZV9A 5JBTA 2ODYB 5E0GA 2SGPE 1E34B 2K0QA 3I29A 2C8ZB 2Y5FA 1C1RA 1KY9A 5C1UA 1ELGA 3DA9B 5C17A 1BRBE 1TPSA 3ZVEA 1PPHE 3PRDA 2VGCC 4NIYA 1H9IE 3PV5A 6CHAB 1T8LA 3VB5A 2B7DH 5EGMA 2CV3A 1IQEA 1GG6B 4B76A 1LMWB 1WU1A 1DOJA 1YPHC 5L30H 2FOMB 3SHAH 1CGHA 5EW1H 1NPMA 1DITH 3I77A 1BMFD 2FX6A 2P3UB 4GCHG 3RC5A 3B9FH 3U1JB 5B6LA 1GGDC 1D4PB 1Z6JH 2OC7A 2ZU2A 2QA9E 3QZRA 3S0NA 4MPXA 1RS0A 4MQAA 4K3JA 2WYJA 4BAMB 4AORA 3AVZA 2ZTYA 4HFPB 1ZLRA 1TNLA 2VNTA 5DPAA 1GMCG 4A1VA 2XWBI 2AGEX 1OWJA 1H9HE 3D49H 3URDA 1GL0E 2ZTXA 4Z0KA 1EKBB 1P06A 2BDCA 2J95A 2KFWA 3L3TA 1HXEH 5AFYH 2H5CA 1FJSA 3SJIA 4WMFA 4CRAA 2F3CE 1F0UA 1P8VC 2ZFTA 4RKJB 3NRLA 1AU8A 2P94A 2BXUH 2W7UA 1A0HB 2ZHFH 3LGYA 4I31A 1GBIA 4WXIA 3T28A 2SGDE 1TBQH 1YBWA 3OYPA 3VXFH 4ZMAH 4LXBH 3FKSD 4FETA 1EATA 5EPNA 5BRRE 2A5KA 1GVKB 1S0QA 1O39A 5EJZA 1O3GA 1ELAA 1ELFA 1QRWA 1F5LA 1GBDA 4XBBA 2ZHQH 3LH1A 3ZVAA 2QN5T 5C94A 2XCNA 2BQWB 5JB8S 1V2PT 3A81A 1F7ZA 3ZZ6A 2ZU1A 1AN1E 1EFRD 4MDSA 3BN9A 4B6EA 2BM2A 3M3TA 3HKIB 3WWBA 1KXEA 5DO4H 1A2CH 4WF8A 1FAKH 3KYFA 1FAXA 2Y82A 4IN2A 1GMHF 1V2UT 4NZLA 4INHA 3KEEA 4A1XA 1C5LH 3LGVA 3SJ8A 1ARCA 3SNDA 2AMDA 4NG9H 1O34A 4Q4LA 1QZ8A 4QT8C 1O5BB 2UWOA 2ZC9H 2XCFA 5DP6A 5FX5A 3UQOA 1GBAA 4Z1MD 1XUHA 1HUTH 1UTQA 4NFFA 1M9UA 1MCTA 1XUGA 2O8LA 1MD8A 1BIOA 2JDID 2K8IA 1THRH 3KQ5A 3E0PB 2OD3B 3RXRA 2ZO3H 4FUJA 1O5GH 1SGDE 1J15A 1NT1A 4I8GA 1WSSH 4BXSA 3KGPA 1IAUA 2FZZA 2J5UA 2WPJS 1IQJA 4MTBA 4YLQH 1ESAA 4IMZA 3SNAA 1T4VH 2C8YB 1HAHH 1HB0B 4OS6A 2JIZD 1HAOH 2NWNA 2PLXA 1TQ0B 3M61U 5GNDA 4HI3A 3L33A 3RXDA 2FLBH 1YCPH 2P8OB 2ZWLH 4X8VH 4KTSA 2M2AA 3RXQA 1C2IA 1MUEB 3A7TA 4UD9H 1EB2A 2JH6D 1HAPH 3MU1A 1YC0A 1YP9A 3P8NA 2XBWA 3F2FA 2G5NA 3OFND 4CRBA 1GG6C 3NKKA 2GZ8A 2B0FA 1K22H 2ALPA 2WPKS 2YMSD 4UE7H 1EXFA 3RXUA 1V2WT 2DE9A 4Y71A 5A8XA 2XOKD 1HIAB 3QN7A 1F5RA 1YY3A 2SFAA 1FXYA 4IS5A 4TPYA 4U01A 3RXJA 4BTUB 2KAIA 1CGJE 1CHOG 2HPPH 2CHAB 2GCHF 1CA0C 1TE0A 1W2KH 2PV9B 3RC6A 1DS2E 4ABHA 1GI6A 2F9NA 4NIXA 1UTOA 1KTSB 7GCHG 2TPIZ 5CHBA 2ZP0H 4DIIH 4MPWA 1LCYA 3LGIA 2JJ1D 1D9IA 1C4V2 5JYIA 5DP4A 5C2ZA 2VIQA 3A8AA 3CP7A 4MNXA 1QJ6B 2Z9GA 3ZZ8A 1O5CB 3JZ2B 1K1IA 3RUOA 5EJLA 1YPEH 5AF9H 2VJ1A 4AG1A 3A7WA 3FVFB 1WYKA 1EPTA 2OC0A 1GBFA 3HPTB 2AIQA 1WDIA 2BD4A 3TITA 4AFZA 3SUGA 1UHBB 1ANCA 1S5SA 1CT4E 1BJUA 1N8OB 1MU6B 1SVPA 1FONA 3S9BA 1SGRE 3KYGA 2W26A 1ANDA 1AIXH 3ATWA 2C4FH 1SOZA 1ZHPA 1KSNA 3DCLA 2PUQH 3LGTA 1AFQB 1ZMLA 1MKXH 1PPZA 3VB3A 1O2YA 2ZFQH 4ABDA 3F1SB 1S82A 2M5TA 1MAYA 1ZJDA 1ETSH 1ACBE 2J98B 3LOXA 2ZDKA 3TVJB 1XKBC 5EQRA 1G9IE 1P57B 2I6SA 3SZNA 3RXTA 8GCHG 1ARBA 3GYMA 1P2IA 3TPIZ 2FLRH 4A1TA 1O2XA 3DSGA 3RMMH 1D3DB 1S6LA 1FY4A 1G3DA 1CBWB 3HGNA 1ELDE 1KLIH 2XNIA 4IMQA 5C20A 2TGPZ 1IQNA 1TFXA 5FPTA 1GJ6A 3EA8A 1OSSA 1ELEE 3EE7A 5FXLA 3GY2A 1ZMNA 2OBQA 1GJ4H 2CJIA 2C8WB 5PTPA 1O2TA 1XVMA 3EYDA 3HGPA 3TNTA 2A32A 3MNBA 4GLYA 4K5ZA 3TU7H 1MCVA 1GVLA 1C1QA 1GI0A 3A7ZA 4Q80A 1P3EA 1XVOA 1W7XH 2WUCA 1W3CA 1CT2E 1TBZH 3QGNB 4FUFA 4TT3D 2WUBA 1GBKA 4BAHB 1J16A 1IQMA 1MZAA 1V2TT 4YTAA 2HLCA 1KXDA 1O2KA 3UR9A 1P12E 2XXLA 2HGTH 1CHGA 1V2MT 1FIZA 1EAXA 2VVUA 1JIMA 1GI1A 1FI8A 4O3TA 1HAVA 1K28D 2V3HH 1HNEE 5HMAA 4A5TS 1LVMA 1OPHB 1AWHB 3BTWE 1QBNA 3T5FH 2GDEH 3SV2H 1H8DH 1PYTC 3F9EA 2ZPRA 2BY9X 4XOJA 1ZRKA 1TRNA 2HWLB 5FCRA 7ESTE 2OLGA 3UWIA 3QX5H 4CRFA 5L6NH 1TX8A 1EOLA 2QCYA 1DICA 3ODFA 2BXTH 3QDZB 4O3UA 2ANKH 3RU4E 8ESTE 3UNQA 2A4RA 2ZQ2A 1DX5M 3GYLB 2R0KA 3RXHA 1BBRK 1DPOA 5E2PA 3NZIA 1B7XB 1E1RD 2ZEBA 4NWKA 4Q2KA 3RXSA 1YYY1 4RKOB 5F53A 5GWZA 3KQDA 3M7TA 1ZR0A 3SOSA 5ABWA 4D7GA 1O2SA 4NFEA 1BUIA 2P95A 3SI4H 2OINA 1A7SA 1Z1JA 5JPMH 4ZUHA 1T8MA 2FOCA 1J9CH 2YMSB 3OAAD 2D1JA 4FU7A 1HFDA 2GZ7A 5FX6A 3O8DA 1SR5C 2OXSA 2RDEA 2A0QB 5F8TA 1XUFA 4WY3A 3GDVA 1MBMA 1JRTA 1P2MA 4IN1A 1C1NA 1IHSH 1TOMH 1AE5A 3F6UH 1K1LA 5CMXH 1TNIA 4K1EA 1ZTLA 3S9CA 1LHFH 5EXLA 1NU7B 5F8ZA 3BTTE 3STIA 2BLWA 4KELA 4WMDA 3Q3YA 1HYLA 2FMJA 1G3EA 3A80A 1MD7A 1N8OC 2W3KA 4SGAE 2NU3E 1Z6EA 3TJVA 1G2LA 2A7HA 4Y8YA 3EAJA 3SU0A 1WQVH 4AGKA 3O8RA 5JBCS 5DK1A 3OTJE 1FX0B 3E3TA 2WYGA 3QUMP 3FAOA 1LHCH 3C27B 1HAIH 1O3JA 1O37A 3RXAA 4I86A 4F4OC 3KQCA 1FY8E 1UO6A 2A5IA 3PO1B 1G36A 1SGPE 1C9TA 1CBWC 1EPTC 2JJ2D 2BHGA 3E16B 4Y7AA 1F92A 1YPJH 4GCHF 5J4QA 1THSH 5DP8A 2PKSC 1C5OH 1C2KA 1BBRH 1HBTH 5K7RA 4CR5A 4FUDA 2V35A 3TLOA 4OS1A 2ZECA 4X6NA 4I8LA 1YLNA 4JZ1A 2J94A 4X6OA 4WWYA 3FZDA 1Y3XA 2CF9H 1AO5A 1TONA 2GX4A 1A0JA 5AFZH 1OP0A 1GMCF 1O3HA 2VIOA 2PFEA 4O03A 3SYJA 2CK3D 5HGGA 1J8AA 1SMFE 3V0XA 1A5GH 2Q6DA 2ESTE 5JBAS 2AMQA 3QK1A 2AS9A 1D3TB 1O2RA 2XBXA 2FX4A 3MWIU 4BXWA 4ASUD 4K8BA 2XWAA 3MO3A 1ZOMA 1VGCC 1FMGA 1MTNB 3E8LA 3AW1A 3PRBA 1AKSA 1LQDB 2FOGA 1O3IA 1NM6A 1C5QA 1C2LA 3K9XB 1L1GA 5EPYA 1LVBA 5DP5A 1SLUB 3PMHB 3U9AH 4ZHLU 1OP8A 4I7YH 2YOLA 1G30B 1TNKA 1W0ZU 4MLFB 2WPLS 2Q6GA 4Y79A 1TWXB 5GJ4B 5EG4A 2BZAA 4DCDA 1EASA 1GPZA 3M5NA 1N6XA 1PPGE 3V13A 3ZZ7A 1O32A 1GVZA 2P16A 1A4WH 2FPZA 1COWD 1QA7A 3O8CA 2WPMS 2AGIX 2ZIQH 3KN2A 1NBME 1V2LT 4CHAB 1ZHMA 1UK4A 4AB8A 4MG3A 1DXWA 1W12U 3ELAH 1S0RA 4DT7B 3ZVCA 2FOBA 2FYQA 2DUCA 2NU0E 2P3TB 9LPRA 1GI4A 3SUFA 3LGWA 2PGBB 3GY3A 3W95A 1TRMA 3A88A 1TPAE 4DY7B 1SL3A 2OC8A 3T26A 3ZZDA 2RFKC 3LC5A 3ZYEA 3LC3A 2BD7A 1O3BA 1V2RT 3RXVA 1E1QD 3QGJA 2ASUB 1NFYA 3U8RH 4NIVA 3UOPA 1GMDG 3E1XB 1AY6H 2FS9A 1ZYOA 3MI4A 1GDUA 1CA8B 3RLWH 1OOKB 4AX9H 3SU5A 3ZVGA 3GICB 1YPHE 2ZGCA 3PTNA 2W6ID 4UFDH 5J4SA 3PWCA 1PQ5A 3W1EA 3STJA 3Q00A 4IC6A 3A89A 1TNJA 3SNBA 1PPFE 1SGFG 3PMAB 1VCPA 3U69H 2ZGXH 5BPEA 3ESTA 1KMHB 1GJBB 2STBE 1O2OA 1Y8TA 1S81A 1HXFH 2JH5D 2G52A 1UCYE 5F6MA 3PO1C 4B75A 4ZHMU 1BOQA 1D6WA 1BMMH 2R9PA 1BDAA 3RXMA 3M7QA 2HOBA 1CHOF 5K0HA 4BAQB 1BTWA 3SGAE 2VIVA 5B6OA 3PWBA 5CHAB 5HKKD 2G81E 4KTCA 1L2EA 3N7DA 5CE1A 7GCHF 3BEFB 4JZEH 3SU3A 1GBLA 2BD3A 5I46H 1UK3A 3PV4A 1GHAG 3KHVA 4X1SU 3FOAA 1GCTB 3MU5A 1SGNE 1DUEA 1GBMA 3ZZ4A 7LPRA 4DG4A 2WV5A 3ATLA 3HK3B 1GI2A 1GJDB 2ZFRH 3A8BA 3LPRA 3A8CA 2OK5A 5LH8A 2ZCLP 4DGJA 1SGFA 1B5GH 3UTUH 1O2JA 3B23B 2W3IA 5EOKA 1Z1IA 1Z7KA 4CRGA 1HJAC 6GCHG 3KCGH 3GDUA 1NRNH 2ZDLA 3MH6A 1NY22 1XX9A 1GBCA 3UIRA 3GISB 4Y6DA 1DY9A 1ESBA 3R0FA 4Y0ZE 5DP3A 2XBVA 2EEKA 5FBEA 2WZQA 1FDPA 3TH3H 1W8BH 1L0ZA 3KIDU 1KLTA 1O5AB 1W14U 1QBVH 5KGOA 1DDJA 1E0FD 1AB9B 2TIOA 4AFUA 2LPRA 3QO6A 5HYOA 4I33A 1DWBH 1HGTH 2GMTB 3MMGA 3T27A 1FZZA 4J2YB 1O2ZA 4ZKNU 1AZ8A 3BEIB 8GCHF 1KTTB 1JOUB 2PTNA 2WPIS 1DSTA 4RI0A 5H4IB 3BTEE 3V7TA 4HTCH 4ISNA 2A4OA 1SLVB 2Z7FE 3EQ0H 1TGCA 2TBSA 3UNRA 3G01A 1P2NA 3E0NB 4ZAEA 3GY4A 3M5OA 4E7RG 2IN2A 4UEHH 2BLOA 1DLEA 1P02A 1QB1A 2B9LA 1WTGH 1S84A 3PLBA 4Y10E 3UFAA 4P00A 4CRDA 1V2NT 2BOHB 4X1PU 4ISIH 1LVOA 2IPHA 1TMBH 1MKWK 1TGNA 3FZZA 2AGGX 1P04A 4UFEH 4UFGH 1IQGA 1SPJA 3VGCB 4FUEA 2CXVA 1K1MA 1AHTH 2QF3A 2KCOA 3MNSA 2ZGBH 4XBCA 3AAVA 3DD2H 1T8NA 1OXGA 1HIAA 1VR1H 4B74A 1O2LA 1ABJH 1Y3YA 4XD7D 3SO3A 3ZZ5A 2JETC 3MU4A 2SGFE 1SFIA 3S9AA 4X2WA 1UW7A 3UPEA 3NUMA 5LPFA 1C5WB 1O2PA 2H6MA 4AYYB 1EZSC 1BMNH 4I8JA 4D9RA 2FP7B 4KGAA 1LPZB 2BY5X 2WV4A 2HNTC 4OS5A 4ZH8A 1WAYB 1V3XA 3SV6A 2QF4A 1GBHA 2NU1E 4OGYA 2ZDNA 3RXKA 1DM4B 4B71A 1PPEE 1FY3A 2P93A 2V0BA 1CGIE 3UB0A 6CHAC 2L6OA 1P9UA 1TMUH 2VVCA 1P2QA 1SG8B 3LT3A 3DT0H 3D23A 5F03A 2BY6X 3BTME 1HJ8A 2D26C 3OY5U 1JRSA 2STAE 4DIHH 4GHQA 1NO9H 3SGBE 4MPVA 4FUCA 1QGFA 1W0YH 5CHAC 1UHBA 2A4GA 3P8OA 2Q6FA 1SFQB 1VITH 2O8MA 5A0CA 1BHXB 1Y59T 1KXCA 2ZGJA 3AASA 3OTPA 2BVRH 8KME2 2ZPQA 1S6HA 5ESTE 5E2OA 1QBOA 1DLKB 4NA9H 2PSYA 5GPIB 3SU4A 1G3BA 2OBOA 5A0BA 2AMPA 5DN6D 1FY1A 3IITA 4ZKSU 1O3AA 3FO8D 2J4IA 4MNVA 2SGQE 4D7FA 1GJCB 1YLDA 2J98A 3ZZAA 2R3UA 4O9VA 4X6PA 2NU4E 2C93B 3E91A 3PLPA 2VWLA 1QURH 4HG6A 4MPUA 1DWDH 5FPYA 4CBNA 4M7GA 3ZV8A 2BLVA 1K21H 4AFQA 1ZMJA 1BTPA 1HLTH 2CN0H 2RA3A 2YNAA 2F9UA 1E38B 1MTWA 3RM0H 1C1TA 1RTFB 1RTLA 3GCOA 3MH7A 1LKAA 1LPGB 3V12A 1FQ3A 2PW8H 3PTBA 2KCAA 3BG4B 5KEDA 2UWLA 1AB9C 1GDNA 1QB9A 2A31A 3U1IB 5GDSH 3RMLH 1FPHH 2V3OH 2HPQH 2J34A 1L1NA 2GMTC 2FIRH 1MZDA 4ZROA 1BTZA 2VB0A 3P95A 1EZXC 1DY8A 4YOJA 3M37A 1WV7H 2WV9A 2FOAA 1ANEA 1A46H 1V2JT 1T32A 2PKAB 4NCYA 1QR3E 3K6ZA 2F83A 1MBQA 1PQAA 4WH8A 2UUYA 1YGCH 4B2BA 2AFQB 3TNSA 3F3BA 2PP6A 1NFWA 3BTQE 1GJ7B 1AE8H 4U32A 2VU8E 2XNDD 3MO9A 3U8TH 1C5ZB 1TX6A 3N99A 4FUIA 1YPKH 3FP7E 3P6ZB 1ETRH 2W7SA 5FL7D 1GJ5H 1ZGIA 1GL1A 4FUGA 1JIRA 2QC2A 1RJXB 1CQQA 4AOQA 2FEQH 1A1RA 2ZHWH 4HZHA 3ODDA 1FN8A 5GCHG 2FI3E 3VEQB 1O3KA 3FFGA 4IC5A 1TALA 3CENA 3M35A 3D62A 1DANH 3MU8A 1BRUP 3BEUA 3PM3A 1BQYA 2ILNA 3P8GA 2HNTF 3UOUA 3RMOH 2PGQB 1GBEA 2A4QA 2P8OC 3MH4A 3ENSB 1QRZA 5HM9A 5IDKA 1SGQE 1QJ1B 2ODQA 2BX3A 1JWTA 2BY7X 4K1SA 2H9HA 1ZTKA 2BD5A 2O8WA 1OHHD 2FODA 1LHGH 1B0EA 4ZKRU 2LELA 1O3FA 1LVYA 1QFKH 1P0SH 2F9BH 2H2ZA 1Y3VA 2OTVA 1YPMH 1C5SA 3WY8A 4B2CA 2FYRA 1OWKA 1XUKA 2OC1A 2BB4A 3P70B 4YT7H 1AUJA 2UUKB 3RXEA 2CHAC 2ZCKP 1E35B 1LHEH 3SU6A 3BIUH 3PYHA 2RA0A 4AG2A 2QV1A 3ATKA 1V2KT 2QAAA 8LPRA 3QTVH 1FIWA 1J17T 1A5IA 1W10U 1O2HA 3SQHE 3PMBB 1C5XB 1E36B 3SGQE 3VXEH 1A5HA 2WPDD 2AHME 1TX7A 2QE7D 1ETTH 1QNJA 1ZTJA 5LGOA 1WBGB 2VBCA 2BLQA 4ABJA 5ETXA 3GCHB 3SV7A 1PPBH 3GCNA 1O3MA 1LQEA 3BIVH 3K2UA 2Z6BD 1C5UA 1C2FA 1GMDF 1C1PA 2VWOA 1P03A 1Y5BT 2D2DA 3DFJA 3SUDA 5EJ1A 1AI8H 1TOCB 1UCYK 4X1QU 4ZHAA 3A86A 2ZZUH 1GJAB 1RGQA 2QXIA 2GV7A 2PTCE 3BG8A 4Y11E 4BTTB 3Q3KA 2R2WU 2ZDMA 3K65B 3BG4C 1O30A 5DJ7A 1BRAA 1GHBG 1AFQC 3VFEA 5L2YH 1GWAA 4ZCNA 1C4Y2 1NN6A 4FXGH 4JCNA 3TJNA 2BVXH 2C8XB 1EJNA 1YWUA 5TCCA 1FUJA 3TJUA 3DSOA 1Y5AT 4ABAA 1TGBA 4ABFA 3A84A 2GCTB 4GAWA 4IW4E 4E7NA 2VWNA 3HATH 4H4FA 1GI8B 3NK8A 2GP9B 4NA8A 3KF2A 1H9LB 1UTJA 4JZIA 1K1JA 3MHWU 3OE7D 1ZZZA 1GBTA 2HRVA 1C1VH 1D3PB 1AWFH 3BF6H 2SNVA 1F0RA 4M9FA 4U2WA 3AK5A 1KXFA 1O0DH 3SBKA 1AUTC 1TYNA 4A6LA 2ANYA 1UTKA 2KM0A 5A09A 1E37B 1RXPA 3P17H 1Z8JB 1HAYB 2PSXA 2VGCB 3PB1E 4FVDA 4JYUH 5DP7A 4YLUA 1O2WA 4LZ4B 4Q63A 1GJ8B 2BD9A 2H5DA 1XM1A 4AYVB 1S83A 1BMAA 1SLWB 1QIXB 1P05A 1O3OA 5A8YA 3TK6A 3TIUA 1C4U2 4NA7A 1P09A 4R8TB 5DG6A 1Q2WA 2F9OA 1GGDB 3OEHD 1V2QT 6GCHF 1TB6H 3RXFA 3CS7A 4ISOA 2I6QA 3QZQA 1K1PA 4Q7XA 2G4TA 1A0LA 3T29A 2Z9IA 1PQ8A 2IJD1 2FDAA 2EI8A 4K8YA 3ZYDA 1YCPM 1Y3WA 1YM0A 4BANB 4WMEA 3MO6A 3RMNH 1UCYH 1ZSLA 1N1LA 2PUXB 4E06H 1KXAA 1O3NA 1VJAU 2KR7A 1ELTA 2VIDA 1EAWA 1HAXB 2CMYA 2GD4B 2EI6A 1XUJA 5C0UA 1KYNA 4FU9A 4CBOA 5ESBA 1SQTA 1S6FA 5LPEA 3UAIC 3LU9B 1NU9A 3ZVFA 4NSYA 3N7EA 3VG8A 4H6SB 4P02A 2FTMA 3BTFE 3V3MA 4H42U 1NRQH 3GDSA 1BHXF 3GY8A 1TGTA 2W6JD 2VIWA 2Y81A 4Y7BA 1THPB 3M3SA 3PLKA 3RXOA 4INLA 3QTOH 1ID5H 1ESTA 4XDEA 3GOVB 1IQHA 1MU8B 1ZSJA 3TGIE 3TK9A 1UVTH 4Q7ZA 3NCLA 2YNBA 2YMSC 3M36A 2RDLA 1S85A 1SGIB 1NS3A 7KMEH 3VB4A 1A3BH 1SBWA 3UQVA 4B6FA 1BZXE 2ZFPH 5T6FA 3E90B 4FUBA 4AB9A 3N7OA 1O5DH 4LK4A 4DT4A 3H09A 1RFNA 4WXVA 1UVUH 4LZ1H 2CGAA 3LGUA 1UVSH 3FN8A 2THFB 4PROA 3A7VA 5DP9A 1SSXA 1XUIA 2LP6A 3P8FA 4JYVH 3ZZ3A 2ZHDA 4OM9A 3RXGA 1H8ED 1C5NH 5GIBA 2LNCA 2V3MA 1DUAA 3A7YA 3GCTG 1C2GA 5E0JA 4Q7YA 3OU0A 5C67A 1BTXA 1P10A 3L6PA 5HIYA 1O3DA 3MU0A 1LDTT 2BDGA 3ATIA 4VGCB 4CH8B 4I32A 1TNGA 1HAGE 5FPSA 4CREA 1NRPH 1HV7A
chains in the Genus database with same CATH topology
3SU1A 2GVFA 2GZ9A 1ZPZA 1W13U 2XTTB 1AVGH 3B8JA 4JK6A 3IG6B 1AFEH 1PPCE 4X0WU 1C1MA 3LJOA 4TY6A 1Z8GA 2P59A 3K6YA 1UTMA 2FO9A 3C1KA 3MYWA 1O2UA 3QWCH 4AZ2B 1O5EH 4K2YA 1GHXH 1O2VA 3A82A 1CT0E 1UTLM 5FHTA 4THNH 1Y3UA 2D8WA 2P3FH 2Z94A 2ANMH 2ZGHA 5EXNA 2EC9H 2WINI 1C1OA 4RSPA 3NWUA 2AH4X 5FAHA 1PQ7A 1ZRBA 1SGEE 2ULLA 3DHKH 3NPSA 3ATMA 1P9SA 1RRKA 3RU4D 1KXBA 1HDTH 1GJ9B 2QXHA 1CA0B 5T6GA 1AVXA 2A7CA 1BT7A 3RLYH 2C3SA 1L4DA 3BTGE 1JMOH 1MQ5A 2SGAA 4YM9A 1DWEH 3E6PH 3KQEA 2GTBA 3OSYA 3RXIA 4UFFH 1G2MA 1YPLH 3SNCA 1JXPA 1GHYH 5T6DA 5C1XA 1MTNC 3RU4T 3PROA 4KKDA 3VPKA 4MNWA 4JMYA 5GXPA 1F2SE 2G4UA 2Q1JA 2GGVB 4SGBE 2K1QA 2BMGB 2H1UA 1SQOA 2F91A 1G32B 1T31A 3DFLA 3HKJB 3OX7U 5HXFA 1MAXA 1O3CA 3SNEA 4ASHA 1OKXA 2RCEA 5EQQA 3VB7A 3RDZA 1UTNA 3CS0A 3H5CB 2G8TA 5TCAA 1GHZA 1O5FH 1OYTH 1YCPK 2B8OH 1KDQA 3GY5A 5L2ZH 2GDDA 4WH6A 4JK5A 1VITG 1RD3B 2AIPA 4TWYA 1J14A 2GKVE 1AVWA 3QLPH 4B73A 1AMHA 1SHHB 4I8HA 1BB0B 1FLEE 1GI3A 1TIOA 1YPGH 3RXCA 3MNCA 4CHAC 3UUZA 2BVSH 3OY6U 4RN6A 4OS7A 2ANWA 4Y76A 1ZPCA 2F9VA 4CR9A 4GSOA 3RXPA 2R3YA 1EOJA 2G55A 2VH6A 1RIWB 2FOEA 4O97A 4ABBA 2WPHS 1AGJA 1NFXA 3KNXA 2UUFB 4WVPE 2H9TH 2HNTE 2F9PA 1ELVA 2QXGA 5A8ZA 1UMAH 1TBRH 3ZZ9A 5EODA 2BDAA 1QTFA 1EQ9A 5GCHF 1KDQB 2A2QH 4K69A 1IQKA 4DW2U 3MNXA 1TPOA 1H1BA 5C1YA 4DOQA 1ELCA 3M5MA 1GBBA 1Z8IB 2SNWA 2ZHEH 3RXLA 2R2MB 4ESTE 2Y6TA 2BQ6B 1O31A 4UONA 4ISHH 1O2NA 1WUNH 1EP6A 1HCGA 4VGCC 3M5LA 1VJ9U 4OS4A 5AVDA 2BD2A 4BOHA 2HALA 1EUFA 4ZXXH 2FTLE 4UDWH 2G51A 3LIWA 1XMNB 1H4WA 2BTCE 2Y80A 2Y7XA 3M3VA 2AYWA 1TLDA 5C5NA 2FOHA 3BTHE 2PR3A 4FUHA 1YKTA 4ABEA 1CE5A 4IGDA 1C5MD 1MKXK 1TA2A 1GI7B 1Z71A 2IJOB 4AGJA 3F9HA 1UVOA 2GT8A 1SOTA 1TQ7B 3UWJH 2V6NA 4OS2A 2PHBA 1A61H 1C1WH 1JBUH 4INKA 2TRMA 3LDXH 2H9EH 1QQ4A 1ZHRA 3AW0A 4BAOB 1GCTC 1C2JA 5E8EH 2ZNKH 3PMJA 1FPCH 1T8OA 1V2ST 4Y8ZA 1V2VT 2J2UA 3KQBA 4ZKOU 4E05H 3T62A 1LO6A 1O2MA 1LKBA 3RXBA 4A7IB 3U8OH 2C90B 1FNIA 1QB6A 5G4BA 4X2VA 3MFJA 2ZG0H 1O3LA 1ZJKA 1MKWH 4XFQA 4K60A 4ZXYH 2PKAA 2J9NA 1BA8B 2Z3EA 1C5PA 1VCWA 4DURA 1P11E 1ORFA 1X7AC 2OQ5A 4U30A 4XBDA 4AFSA 1C2DA 2RG3A 2XC4A 3FP6E 4D8NA 1NRRH 5JDUB 3SW2B 2PWXA 2CF8H 5SGAE 3EE0B 5T3HA 1T7CA 1GHBF 4NSVA 2XBYA 2QXJA 2J38A 3H7OA 4TWWA 2BOKA 1C1UH 4YESB 2O8TA 1BCUH 2BQ7B 5TJXA 1H8IH 2QF0A 3UNSA 2KAIB 3RM2H 1DXPA 1P2JA 1FV9A 1VCQA 3UY9A 2ZU3A 5LPRA 2QY0B 3BTDE 1Y5UT 3SJOA 1O2QA 1UJ1A 2VWMA 1EZUC 4X8SH 1ZPBA 4H6TA 3SV9A 1HJ9A 2QIQA 1HPGA 4GPGA 3TJOA 4YOGA 2IOTA 1EAUA 3LONA 5EQSA 1F0SA 1GCDA 1L1JA 1RIWC 1WQSA 3LKWA 1OWIA 2TGTA 4ABGA 3JZ1B 3VGCC 1DSUA 1EPTB 1UVPA 4GVUA 3TH4H 1GHVH 5EW2H 1EAIA 3SORA 1C9PA 1XXFA 2PKSB 3I78A 2FI4E 4AN7A 1GMHG 2BX4A 1K1NA 1ZSKA 2Y5HA 5DGJA 4MNYA 3Q76A 2OP9A 2ZPSA 3UREA 1QL7A 2JH0D 4TPIZ 1OYQA 1EB1H 4X1NU 4MVNA 1HRTH 3HK6B 2Z3DA 5C3NA 1AD8H 2XW9A 1SB1H 2Z3CA 4JZDH 4XE4A 1UTPA 5HM2A 2G00A 1QRXA 1C2MA 1GHWH 2EI7A 3F9GA 1BTHH 1TGSZ 4Y8XA 4YT6H 1WCZA 1TPPA 5JBBS 1C2HA 4JYTA 1NFUA 2ZFSA 2ZFFH 1YF4A 1NESE 1VGCB 3AAUA 2BD8A 2BZ6H 3SN8A 2BYAX 3LH3A 4YOIA 1SC8U 1TAWA 1W7GH 2VH0A 3BV9B 3SUEA 1SGTA 4K1TA 1INCA 1IQIA 5F8XA 2FESH 1AQ7A 2XRCA 1QHRB 1VZQH 2FOFA 2O9QA 1EZQA 1K2I1 3EDXB 2O8UA 4WJG2 2ZU5A 1WOFA 2EA3A 1P3CA 1QY6A 2ZF0H 3P92A 1N6YA 1AZZA 2ZI2H 3TH2H 2ZKSA 2A5AA 1U6QA 3EGKH 4XSKU 2UUJB 3EA7A 2DE8A 2GCHG 3GY7A 4Z6AH 3D65E 3MOCA 1LHDH 3BSQA 1DFPA 1HAVB 3BTKE 3TK5A 2Z9KA 4GHTA 4BAKB 2TGDA 4NWLA 1BTYA 4F49A 3ZVBA 1O3EA 2GV6A 3LJJA 1P2KA 1NROH 1TNHA 3GCTF 3A85A 2J92A 9ESTA 3U98H 1T4UH 2VIPA 4D9QA 1O33A 1C1SA 1FY5A 3SJ9A 2JKHA 2ZDAH 4J1YA 2ZCHP 1BRCE 1TMTH 3M7UA 1EJAA 4IBLH 1Q3XA 4BTIB 4NGAH 4R0IA 1LPKB 1OWDA 2QGRA 1OWHA 2ZDVH 3F9FA 2BDYA 3SQEE 2XC5A 2QYIA 1TABE 3A83A 1XXDA 3S69A 2Y5GA 4KTUA 6ESTA 3ITIA 4ISLA 1GBJA 1DVAH 2AERH 3Q77A 1C5VA 3T25A 1O2IA 1SI5H 1IHTH 2OQUA 3ZZCA 1ZGVA 4CRCA 2FS8A 1P2OA 3MTYA 1YLCA 2A2XH 2ZQ1A 3F68H 1O3PB 1PJPA 4NZQA 1W11U 1K1OA 1O36A 1OP2A 1TA6A 1PFXC 1V2OT 1GHAF 1CO7E 1QL9A 2ZU4A 1CSOE 2A1DB 3NXPA 4X6MA 2FWWA 2VVVA 4I8KA 2Z9JA 2Y7ZA 4Y0YE 1GDQA 2SGEE 1QJ7B 1QL8A 1HAZB 3KL6A 4FVBA 2VINA 1BITA 2BDIA 3W94A 1EX3A 4ABIA 4JZFH 5DKMA 4D76A 2XC0A 2BDBA 5A0AE 3Q3XA 5E0HA 3EA9A 4A92A 4X8UH 3ZZBA 2R0LA 3UR6A 4TY7A 1MMJN 4OGXA 3MH5A 2B5TB 2FXRA 1MH0A 3FP8E 2A7JA 2G5VA 2ALVA 4TYDA 1G37A 1Q31A 5A2MH 4LOYH 3SJKA 1DWCH 2W5EA 5FCKA 1XKAC 1G3CA 1HJAB 1NZQH 2AEIH 3SI3H 1CU1A 1C5RA 1C5TA 4B1TA 5IYTA 1BMLA 1QCPA 1VITF 3H7TA 3ZVDA 2NU2E 1NC6A 4CH2B 1GI5A 4KP0A 1B0FA 1CVWH 5C5OA 1F0TA 1LTOA 1QQUA 1TRYA 1FN6A 1EJMA 2Z9LA 3RC4A 1GI9B 1OX1A 1C5YB 1SQAA 1D3QB 1WTHD 1UK2A 4YZUA 1DE7H 2HVXA 4HGCA 4NIWA 5AHGH 3IWMA 2A45B 3RP2A 1NTPA 1RTKA 2TGAA 6LPRA 4DVAU 3TGKE 1SGCA 3A87A 1NRSH 3SU2A 1ABIH 1ANBA 1O2GH 3O8BA 1EP5A 2GT7A 3A7XA 1O35A 2FI5E 4FU8A 1KIGH 3GCHC 1L4ZA 2BY8X 1A3EH 1MTSA 3TGJE 4X8TH 1DT2A 3S7HB 3A8DA 1C2EA 4B2AA 1QA0A 1AKSB 3T2NA 1SHYA 4BNRA 1IQLA 3VB6A 4X2XA 1BTUA 2XYAA 1P01A 1MTUA 4X2YA 1ELBA 1Z8RA 3URCA 1BBRE 5FBIA 1OWEA 1SLXB 1O38A 2ZA5A 5JB9S 4DJZB 2BDHA 3FANA 3S7KB 1K9OE 3GY6A 1KLJH 1MTVA 1PYTD 1V6DA 3R3GB 4GUXA 2ODPA 2UWPA 5EU8A 2GCTC 2OUAA 3SV8A 1MQ6A 1SGYE 4YO9A 2JETB 4X1RU 3DUXH 5EXMA 1BJVA 2FM2A 5I25A 1D6RA 3SHCH 2ZTZA 1F5KU 1IQFA 1IOEA 1OS8A 2OCVB 3ZV9A 5JBTA 2ODYB 5E0GA 2SGPE 1E34B 3I29A 2C8ZB 2Y5FA 1C1RA 1KY9A 5C1UA 1ELGA 3DA9B 1BRBE 1TPSA 3ZVEA 1PPHE 4NIYA 2VGCC 1H9IE 6CHAB 1T8LA 3VB5A 2B7DH 5EGMA 2CV3A 1IQEA 1GG6B 4B76A 1LMWB 1WU1A 1DOJA 1YPHC 5L30H 2FOMB 3SHAH 1CGHA 5EW1H 1NPMA 1DITH 3I77A 2FX6A 2P3UB 4GCHG 3RC5A 3B9FH 3U1JB 1GGDC 1D4PB 1Z6JH 2OC7A 2ZU2A 2QA9E 3QZRA 3S0NA 4MPXA 1RS0A 4MQAA 4K3JA 2WYJA 4BAMB 4AORA 3AVZA 2ZTYA 4HFPB 1ZLRA 1TNLA 2VNTA 5DPAA 1GMCG 4A1VA 2XWBI 2AGEX 1OWJA 1H9HE 3D49H 3URDA 1GL0E 2ZTXA 4Z0KA 1EKBB 1P06A 2BDCA 2J95A 3L3TA 1HXEH 5AFYH 2H5CA 1FJSA 3SJIA 4WMFA 4CRAA 2F3CE 1F0UA 1P8VC 2ZFTA 4RKJB 1AU8A 2P94A 2BXUH 2W7UA 1A0HB 2ZHFH 3LGYA 4I31A 1GBIA 4WXIA 3T28A 2SGDE 1TBQH 1YBWA 3OYPA 3VXFH 4ZMAH 4LXBH 1EATA 5EPNA 5BRRE 2A5KA 1GVKB 1S0QA 1O39A 1O3GA 1ELAA 1ELFA 1QRWA 1F5LA 1GBDA 4XBBA 2ZHQH 3LH1A 3ZVAA 2QN5T 2XCNA 2BQWB 5JB8S 1V2PT 3A81A 1F7ZA 3ZZ6A 2ZU1A 1AN1E 4MDSA 3BN9A 2BM2A 3M3TA 3HKIB 1KXEA 5DO4H 1A2CH 4WF8A 1FAKH 1FAXA 2Y82A 4IN2A 1GMHF 1V2UT 4NZLA 4INHA 3KEEA 4A1XA 1C5LH 3LGVA 3SJ8A 1ARCA 3SNDA 2AMDA 4NG9H 1O34A 4QT8C 5DP6A 1O5BB 2UWOA 2ZC9H 2XCFA 5FX5A 3UQOA 1GBAA 1XUHA 1HUTH 1UTQA 4NFFA 1M9UA 1MCTA 1XUGA 2O8LA 1MD8A 1BIOA 1THRH 3E0PB 2OD3B 3RXRA 2ZO3H 4FUJA 1O5GH 1SGDE 1J15A 1NT1A 4I8GA 1WSSH 4BXSA 3KGPA 1IAUA 2FZZA 2WPJS 1IQJA 4MTBA 4YLQH 1ESAA 4IMZA 3SNAA 1T4VH 2C8YB 1HAHH 1HB0B 4OS6A 1HAOH 2NWNA 2PLXA 1TQ0B 3M61U 4HI3A 3L33A 3RXDA 2FLBH 1YCPH 2P8OB 2ZWLH 4X8VH 4KTSA 3RXQA 1C2IA 1MUEB 3A7TA 4UD9H 1EB2A 2JH6D 1HAPH 3MU1A 1YC0A 1YP9A 3P8NA 2XBWA 2G5NA 4CRBA 1GG6C 3NKKA 2GZ8A 2B0FA 1K22H 2ALPA 2WPKS 4UE7H 1EXFA 3RXUA 1V2WT 2DE9A 4Y71A 5A8XA 1HIAB 3QN7A 1F5RA 2SFAA 1FXYA 4IS5A 4TPYA 4U01A 3RXJA 4BTUB 2KAIA 1CGJE 1CHOG 2HPPH 2CHAB 2GCHF 1CA0C 1TE0A 1W2KH 2PV9B 3RC6A 1DS2E 4ABHA 1GI6A 2F9NA 4NIXA 1UTOA 1KTSB 7GCHG 2TPIZ 2ZP0H 4DIIH 4MPWA 1LCYA 3LGIA 1D9IA 1C4V2 5JYIA 5DP4A 5C2ZA 2VIQA 3A8AA 3CP7A 4MNXA 1QJ6B 2Z9GA 3ZZ8A 1O5CB 3JZ2B 1K1IA 3RUOA 1YPEH 5AF9H 2VJ1A 4AG1A 3A7WA 3FVFB 1WYKA 1EPTA 2OC0A 1GBFA 3HPTB 2AIQA 2BD4A 3TITA 4AFZA 3SUGA 1UHBB 1ANCA 1S5SA 1CT4E 1BJUA 1N8OB 1MU6B 1SVPA 1FONA 3S9BA 1SGRE 2W26A 1ANDA 1AIXH 3ATWA 2C4FH 1SOZA 1ZHPA 1KSNA 2PUQH 3LGTA 1AFQB 1ZMLA 1MKXH 1PPZA 3VB3A 1O2YA 2ZFQH 4ABDA 3F1SB 1S82A 2M5TA 1MAYA 1ZJDA 1ETSH 1ACBE 3LOXA 2ZDKA 3TVJB 1XKBC 5EQRA 1G9IE 1P57B 2I6SA 3SZNA 3RXTA 8GCHG 1ARBA 3GYMA 1P2IA 3TPIZ 2FLRH 4A1TA 1O2XA 3RMMH 1D3DB 1FY4A 1G3DA 1CBWB 3HGNA 1ELDE 1KLIH 2XNIA 4IMQA 5C20A 2TGPZ 1IQNA 1TFXA 5FPTA 1GJ6A 3EA8A 1OSSA 1ELEE 5FXLA 3GY2A 1ZMNA 2OBQA 1GJ4H 2CJIA 2C8WB 5PTPA 1O2TA 1XVMA 3EYDA 3HGPA 3TNTA 2A32A 3MNBA 4GLYA 4K5ZA 3TU7H 1MCVA 1GVLA 1C1QA 1GI0A 3A7ZA 4Q80A 1P3EA 1XVOA 1W7XH 2WUCA 1W3CA 1CT2E