4ESTE

Crystal structure of the covalent complex formed by a peptidyl alpha,alpha-difluoro-beta-keto amide with porcine pancreatic elastase at 1.78-angstroms resolution
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
240
structure length
240
Chain Sequence
b'VVGGTEAQRNSWPSQISLQYRSGSSWAHTCGGTLIRQNWVMTAAHCVDRELTFRVVVGEHNLNQNNGTEQYVGVQKIVVHPYWNTDDVAAGYDIALLRLAQSVTLNSYVQLGVLPRAGTILANNSPCYITGWGLTRTNGQLAQTLQQAYLPTVDYAICSSSSYWGSTVKNSMVCAGGDGVRSGCQGDSGGPLHCLVNGQYAVHGVTSFVSRLGCNVTRKPTVFTRVSAYISWINNVIASN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ELASTASE
publication title Crystal Structure of the Covalent Complex Formed by a Peptidyl Alpha,Alpha-Difluoro-Beta-Keto Amide with Porcine Pancreatic Elastase at 1.78-Angstroms Resolution
pubmed rcsb
source organism Sus scrofa
molecule tags Hydrolase/hydrolase inhibitor
total genus 59
structure length 240
sequence length 240
ec nomenclature ec 3.4.21.36: Pancreatic elastase.
pdb deposition date 1989-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4estE02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4estE01
5FBIA 2LNCA 1A7SA 1QB6A 3ATKA 5C20A 2XCNA 1PQ7A 3A85A 1UVSH 2P94A 2WYJA 2ZGJA 1BT7A 1J8AA 2R0KA 4ZKOU 1BRBE 3ATWA 1UO6A 2CJIA 2GZ7A 4ABJA 1TGBA 2Y7XA 4U2WA 1J9CH 1L1JA 2FDAA 2H5CA 3H7TA 3GDUA 1O3DA 4NFEA 2UUFB 1P06A 3SJ8A 1OWEA 1GBMA 4CHAC 1CU1A 4HTCH 3SV2H 2P95A 2Z9JA 1WU1A 3E0PB 3P6ZB 1AB9B 3K2UA 1F0SA 3QLPH 2HNTC 1P9SA 1GDQA 1PQ5A 2ZEBA 2AMQA 1P2KA 3KIDU 9LPRA 3ZV9A 1Z8RA 4LZ1H 2FI3E 2RDLA 1O2TA 1CO7E 3A7ZA 3Q3XA 4KTSA 4BAOB 2ANWA 2Y7ZA 2FOBA 5F8XA 2W3IA 4WWYA 3ZZ5A 2YOLA 1RRKA 1ELBA 2P8OB 1A3BH 1KTSB 1OWIA 2QN5T 3ZYEA 1CSOE 1IQFA 1C5VA 1TNLA 1JRTA 1KXAA 1C5MD 1BA8B 1C1WH 1CA8B 2UWPA 3EAJA 1GJ5H 1O2IA 1VR1H 1V2VT 1NESE 5C1UA 3UNRA 2BDIA 3PO1B 2XXLA 1UTJA 1E38B 1LO6A 1TMBH 4H6TA 4KGAA 2B0FA 4D76A 4YO9A 1AU8A 1YP9A 1BZXE 1V2TT 3MO3A 4E7RG 1P10A 1GJCB 2Z7FE 3BEUA 3VXEH 3RXKA 2NU1E 4Y79A 3FAOA 1KYNA 2H1UA 4XBDA 4I8HA 1AKSB 2FX6A 3SNCA 2A7CA 3SHCH 2G55A 2Z9LA 2ZFPH 1J16A 2G52A 5DJ7A 1F5LA 2C8ZB 1FAKH 3LH3A 1LPKB 5A09A 4BTIB 3IWMA 1W13U 3U8TH 3UTUH 1HGTH 2JH6D 1DUAA 1LVMA 2ZHQH 5AVDA 1MU8B 4U01A 2ZO3H 2G00A 4ZUHA 1BRCE 5EGMA 1ELTA 1GGDC 1IQIA 4JZEH 3ZVEA 1MCTA 1GBEA 1ZRKA 2SFAA 4K69A 4X6PA 1W0YH 4K3JA 4FUHA 2ZTYA 1AHTH 1XXDA 3GCNA 3SJ9A 1W0ZU 2ZQ1A 3M7TA 4DJZB 4CRAA 1GJ4H 1XVOA 3RXHA 1O2YA 1TLDA 2G81E 1DM4B 1C1MA 3MO6A 4NA8A 1O3GA 3BG4C 5E8EH 2TGPZ 3BEFB 1NU9A 2BQ6B 1DANH 1IQMA 1CBWC 2GCTC 2BLQA 5J4SA 1RD3B 1GBDA 1GDUA 1EP5A 1ZTKA 2Z9IA 1GHAF 1WTGH 2LPRA 1TALA 2GD4B 4ISOA 1BQYA 1UVUH 1MZAA 3QO6A 1AFQC 1C5NH 3GY7A 4NIYA 1QFKH 1TNHA 3SV8A 1IQLA 4B2AA 5EW1H 1KSNA 3ATLA 1O5AB 2QXHA 1KTTB 4ZHLU 1QJ7B 2V3OH 4K2YA 4FUFA 2A31A 4R8TB 4X2WA 2ZU1A 1AWFH 4Y0YE 3U8RH 4X8SH 1SGDE 1O3HA 1MQ6A 2XC5A 4WY3A 1V2KT 1ZMLA 1ZJKA 2F83A 3CS7A 1MKXK 2ZCHP 1DWCH 5L2YH 4AX9H 1ANEA 1DICA 3EYDA 4DIHH 1EZXC 1D3DB 1XKAC 1C4Y2 1K1MA 1O3PB 3ZVDA 1P2MA 1QBOA 4CRBA 2TGTA 2OC1A 1HJ9A 2BDAA 1TMTH 1A2CH 2ZPSA 1EZUC 4BTTB 5FX6A 1PPBH 3A86A 3SV9A 3FZDA 2Y82A 4OS1A 4ZHMU 2VVUA 3S7KB 1AVXA 6GCHG 4O3UA 1P3CA 2WPHS 1YLCA 3KNXA 1VITF 3A8AA 3E16B 2ZF0H 5C67A 1J17T 3UY9A 1TA6A 1K22H 2FM2A 2J2UA 3V13A 3IITA 4B75A 1C4V2 1G37A 3BSQA 2GMTC 3RC6A 4JMYA 3U8OH 4MNVA 1ZHMA 2P3FH 3B8JA 2A4RA 4FU7A 2HALA 3QUMP 1AIXH 3GY2A 2FOEA 1YCPM 4Y7AA 1GI3A 5DK1A 4CRCA 3ATMA 3BTDE 4OS2A 1HJAC 5E2PA 1MTSA 1C2KA 2VIQA 4IC6A 3PLKA 4UFFH 1CHOG 2ZHDA 1GBLA 2ZHEH 3F9EA 1ZJDA 1C1TA 1DY8A 3VGCB 2HLCA 2V35A 3A80A 1UTOA 1Y3YA 1OYTH 2VWMA 5JPMH 4YT7H 1H8IH 2ZG0H 2WUBA 3A81A 1L1NA 4IMQA 1AD8H 3UNSA 2NU4E 1AE8H 4I7YH 1RTFB 2WYGA 1P04A 3LGVA 4ABDA 1AZ8A 1QB1A 4IN1A 2FIRH 1O2NA 1IQHA 2A4GA 1SLVB 4NFFA 1MU6B 2QF0A 3H5CB 5EG4A 2PHBA 1TIOA 1THSH 2AIQA 3UQOA 1S5SA 5ETXA 5ABWA 3RXGA 1ELGA 2WPMS 1NRPH 3RU4T 1C9TA 1O2UA 2G4UA 1ANCA 1N6YA 3MFJA 1FUJA 3NWUA 5DP6A 1O2PA 4AOQA 3SU1A 4MNWA 1O3EA 3K6ZA 4MVNA 3S0NA 1V2LT 2JH0D 1UTNA 2ZFSA 2BMGB 3SJIA 2Q6GA 3RXRA 5JYIA 1WV7H 1CA0C 1QB9A 1FNIA 1O3MA 3MNSA 3PM3A 2JETB 5TCAA 1QURH 3M3VA 1NFYA 1DWEH 1V2PT 1MTUA 2D1JA 3AW1A 1C5WB 4Q2KA 5K7RA 3RXIA 1GMDG 2NU0E 3AAUA 4AB9A 1K2I1 1V2MT 1BDAA 3ZZ8A 5L2ZH 2J4IA 3T25A 5LH8A 4DW2U 1ZTLA 3SW2B 1SGEE 2XBVA 1O39A 1PYTC 3T5FH 3GY3A 1MKXH 5LPRA 1P12E 1LHEH 4X8TH 3HKJB 4B76A 6CHAB 1C5LH 2GZ8A 1DX5M 1YPJH 3SU4A 2A4OA 1WSSH 3KL6A 1A4WH 2SGDE 2O8MA 4AN7A 3LT3A 1BMMH 2XBYA 1OKXA 2BD8A 5TCCA 3ZZ6A 1C5PA 2XW9A 2Q6DA 4A1XA 4Z0KA 1FN8A 1O5BB 5EU8A 2O8UA 1SLWB 1P11E 4CRGA 2GDDA 1GHAG 1O3JA 2AGIX 3SNAA 1FPHH 3QGNB 1Q31A 4ABAA 4WF8A 5DG6A 1HCGA 4BAKB 4MLFB 1C2HA 4Y8XA 1EAXA 1MTNC 1C1NA 3TK9A 2J9NA 1AKSA 4ZKRU 2TGAA 4WXVA 3M61U 3NK8A 1EJNA 1IQNA 3H7OA 2G51A 1SGTA 1ELAA 1YGCH 4NZQA 5GCHG 1SFIA 3FP7E 2Z94A 4ZKSU 4CRFA 1L4DA 1CQQA 1TGSZ 1DOJA 1FY5A 3ZZ7A 4H4FA 1GI9B 4B2CA 1MBMA 4Y6DA 1TMUH 1FY3A 1O34A 7LPRA 2FYQA 1IQEA 2ULLA 4B71A 2ZP0H 5A8YA 4ZROA 1O2RA 2R3UA 1MH0A 1MAXA 3FVFB 2EA3A 1GMCG 5DP9A 1SOTA 5FPTA 3S9BA 4KELA 1HIAB 1H8DH 3A7XA 2RCEA 3GY4A 1Z71A 5FPSA 1QRZA 3LGUA 3RC5A 4Y7BA 3UUZA 5DGJA 3ESTA 2O9QA 1HUTH 3DUXH 4WMFA 2TPIZ 1LVBA 3A84A 4IBLH 2ALPA 1SQTA 5A0AE 3AW0A 4UONA 5AF9H 4OGXA 1FQ3A 3R0FA 1S83A 2THFB 4K1EA 1Y5BT 1QGFA 2C93B 1TPPA 4XFQA 2Z9KA 1D6RA 2A5AA 4ZXYH 2O8WA 2FS8A 5E2OA 1WYKA 3I78A 1ZYOA 2ZDVH 1GCTB 3TVJB 1LPGB 3SU2A 1DT2A 1F7ZA 2PKSB 2AIPA 4K1SA 1HAZB 1BJUA 3GCHB 3OY6U 2A2QH 1BIOA 5C2ZA 2FOHA 2AMPA 3RXBA 2ZU5A 1HLTH 1G30B 3TU7H 2AGGX 5FPYA 1NRRH 1G36A 1ID5H 4RKOB 3VEQB 1NFWA 5HM2A 1C5TA 1TX6A 4BAMB 1IAUA 2VNTA 4O03A 1GJ8B 1Z1IA 4BTUB 1OYQA 2BTCE 3LPRA 3V3MA 1XX9A 2ZTZA 4FXGH 2FYRA 3ZVAA 2H5DA 3DFJA 2AGEX 2ZPRA 2EEKA 4UEHH 3RMOH 1FJSA 2OQ5A 3P8NA 4PROA 4D9RA 2PGQB 1O5DH 2EI7A 2FODA 4SGAE 3GCOA 2IJOB 4ASHA 4IN2A 3MMGA 3L33A 3LGIA 1BMNH 2PW8H 5JBTA 3KGPA 1QHRB 2A4QA 4YOGA 1O5GH 2XC4A 3TGIE 1N1LA 3TK6A 3A89A 1N8OC 1O2SA 1UCYH 1ZPBA 1P3EA 1E34B 2C3SA 1PJPA 5C5NA 4NZLA 1GJ9B 1O3OA 6GCHF 2J94A 1EUFA 1AB9C 1ZGIA 1P2NA 1IOEA 4TY7A 2XYAA 4BXSA 4LZ4B 4X6MA 1T8LA 2FPZA 2G8TA 2VU8E 2WV5A 1TNKA 5FCRA 1XKBC 3SBKA 3MHWU 2ZFTA 4THNH 3DT0H 3SU6A 1H9LB 1SMFE 2FOMB 2V0BA 4HFPB 3RLYH 1QBNA 1O2GH 2P8OC 1P02A 5I25A 1C5YB 3MTYA 3GCTF 3B23B 1UTPA 2BM2A 2BY8X 3U9AH 1LVYA 5HMAA 3BTME 1H4WA 2BVSH 1NN6A 2CV3A 3RXJA 3URCA 1GBTA 2F9VA 1C9PA 4UFDH 1O35A 3IG6B 1Y3WA 1UK2A 1ANDA 3TLOA 4RN6A 2WV4A 3ZZ3A 1L2EA 2BOHB 2AEIH 2F9PA 1CHOF 2F9UA 2BD3A 1HXEH 2ZDLA 2XRCA 4I31A 3M37A 3LC3A 4Y11E 5DP5A 1IQKA 2J34A 2AYWA 1F92A 1BRUP 4D8NA 1HAPH 1WBGB 5JBBS 4ABEA 1K1IA 1YCPK 1K9OE 2OBOA 1IQJA 2ZWLH 1C2LA 4ISHH 3GY5A 1YPHE 5ESBA 3FP8E 2UWLA 3E3TA 3E0NB 4CH2B 3RP2A 5F6MA 3W95A 5ESTE 3VFEA 1AUJA 1DLKB 2A2XH 1YC0A 3RU4D 2YNAA 1P01A 2XTTB 2B5TB 4FUCA 3S69A 1GI0A 2RG3A 2DUCA 3MYWA 4SGBE 3FP6E 2UUJB 1GHZA 1G9IE 1ZGVA 4JCNA 4DVAU 1EPTC 1O2HA 2FI4E 1MTWA 1PPCE 1DE7H 1EKBB 3AAVA 2ESTE 3QTVH 1LDTT 2C8YB 2RA3A 4X0WU 5GWZA 1C5ZB 1YPGH 2BY6X 1C2JA 1CT4E 1SL3A 4TWWA 4ABIA 4E05H 1GBAA 1GMDF 2VH6A 2AFQB 4NWKA 1V6DA 1GBKA 1ZSKA 2Y6TA 3BTHE 1LKBA 3Q76A 4JZFH 3QN7A 3LJJA 3FZZA 2ZZUH 1EAWA 6LPRA 1EJAA 4B2BA 3EQ0H 5E0HA 1TAWA 3PMBB 1SOZA 1KDQA 1HNEE 1BJVA 2Z6BD 4MG3A 2ODQA 3E8LA 1FMGA 4RSPA 1C5RA 2GV6A 2VINA 4AYYB 8KME2 1AN1E 1FN6A 2VGCB 3E90B 3LC5A 3OU0A 3RMMH 1O30A 3NCLA 2BQWB 1MKWK 1O5EH 1ZZZA 5FHTA 9ESTA 2ILNA 3SGQE 2BDBA 2F3CE 2FS9A 1VJ9U 2FOAA 4QT8C 3SU5A 1UHBA 2D8WA 5BRRE 1SC8U 4IW4E 2Y5HA 5FCKA 2ODYB 2I6SA 1C2FA 4FUEA 3HK6B 4LXBH 1Y59T 1ZSJA 2OINA 1DWDH 2DE8A 2WPLS 1SLXB 2BD5A 4XE4A 2FESH 5GCHF 4ZMAH 4K5ZA 3ODFA 1G2LA 2ZGHA 2BDHA 3GICB 3TNSA 1SGRE 3ZV8A 4O97A 1RGQA 7ESTE 1HIAA 5GJ4B 4MTBA 1EX3A 3A7YA 4FVDA 1ELFA 3D65E 2J95A 4DT7B 1PPEE 3BTWE 3KCGH 1SGQE 3A8CA 1SGCA 3SU0A 1QJ1B 3BG4B 2BXUH 1A61H 2HRVA 2OCVB 1CBWB 2FWWA 3TJUA 1GMCF 2GCTB 4FU8A 1G3CA 5T3HA 4D7FA 1BTPA 3B9FH 2BYAX 1PPGE 1ANBA 3RLWH 1VCQA 1UMAH 1SGPE 3ZYDA 1GI2A 3A7WA 1NRNH 1AZZA 1PQAA 1VZQH 2VJ1A 1OWKA 2B9LA 1OPHB 3QK1A 2VIOA 3PLPA 1UJ1A 4R0IA 2GVFA 3MI4A 5L6NH 2BQ7B 2WPJS 1AFQB 1YCPH 4INLA 3GY6A 1XUGA 1GHVH 1ZLRA 5E0JA 1KXFA 2BD4A 1BB0B 5EPNA 1P2JA 1GJDB 1E37B 2ZQ2A 4DY7B 3VGCC 4IMZA 4BOHA 4WH8A 5HYOA 1T8NA 1ABJH 1O5FH 1CE5A 3UREA 1C5XB 3GDVA 4X1PU 4LOYH 8ESTE 3GCTG 1B7XB 1EASA 2HPQH 3D23A 3UWIA 4YZUA 5F8TA 5L30H 1F2SE 1GWAA 2QF3A 1MD7A 2C4FH 1C5OH 2BOKA 2STBE 3QDZB 4XOJA 3SNBA 4YTAA 3A8BA 1GL0E 1V2WT 1CGJE 2BVXH 3A7TA 2XBXA 4FUBA 5C1XA 2PWXA 3OTJE 1V2JT 2FOFA 1L4ZA 1V2OT 3M5LA 1W7GH 2FOCA 3I29A 3A87A 3P92A 3NZIA 1FZZA 3U69H 1SSXA 2VIDA 1O2QA 2Y5GA 5LPFA 1ETTH 1B0EA 3SNEA 3VPKA 1HXFH 1J15A 1JWTA 1FI8A 4JZIA 4VGCB 3RXCA 5LGOA 3VB4A 2K1QA 3PROA 3ZZ4A 1KLIH 3LONA 2AH4X 3PMJA 3N7OA 1GL1A 1PPZA 1O38A 1H1BA 3BTQE 1GCDA 2CHAB 2VVCA 2XC0A 3NPSA 1O3IA 1P09A 1T8MA 2ZFQH 1U6QA 3M36A 4JZ1A 1EB2A 4BNRA 2SGAA 4KP0A 2FI5E 1P2IA 1G2MA 1MKWH 3CENA 1FY4A 1Z8JB 2FZZA 4JYUH 4MPUA 1HBTH 1GHXH 2C8WB 2PUQH 1SQAA 5CHAB 5JB8S 1A46H 1GI4A 3NKKA 1ZR0A 2TGDA 1BMAA 3TJNA 3ZVGA 3VB6A 3S7HB 1HAHH 6CHAC 2HPPH 3LKWA 1HYLA 1QQ4A 2FO9A 3A7VA 4Q80A 4OS4A 4UFGH 1A0HB 1O3AA 2A5KA 3GDSA 1FPCH 1TQ0B 1NU7B 2Z3DA 1QY6A 3ZZ9A 2F91A 3E6PH 5AHGH 3R3GB 2F9OA 2XCFA 3MO9A 3E1XB 4I8JA 1EOJA 4Y71A 2BXTH 4J1YA 3DD2H 1D3TB 4A1TA 2FTMA 3LGTA 2BLVA 1EZQA 1CGHA 1DXPA 1HDTH 4Q7ZA 1PPFE 1OXGA 1V2UT 3MU8A 2J38A 4FUDA 1VJAU 1A0LA 2AMDA 2QXJA 2XWAA 1XUJA 4Y8ZA 1GJBB 4NIXA 1Y3UA 1H9IE 2QXIA 1EOLA 1CVWH 3PV4A 1T4VH 3M5MA 1DPOA 1HAVA 3LOXA 1YKTA 1ACBE 4X1QU 1OWDA 4NA7A 3OYPA 3T2NA 2H9HA 2R2MB 1C2EA 1KDQB 1QA7A 1MMJN 2TIOA 1UCYK 1CA0B 1TNJA 1KXEA 1BBRK 4MNYA 3A88A 3RXVA 5CMXH 1YPHC 1RS0A 1AGJA 4A1VA 7KMEH 1BITA 1LCYA 1V3XA 2ANMH 3F9GA 2D26C 3BEIB 2GV7A 3VB3A 4DURA 5EXNA 1V2ST 1GBFA 3U1IB 1W8BH 5B6OA 1T8OA 1WOFA 1P2OA 1LHGH 2BZAA 5E0GA 5EOKA 3SV7A 2ZU2A 4X1NU 2W5EA 3PWCA 2VWOA 3AVZA 1K28D 2ODPA 1ESTA 1UHBB 1QJ6B 1UTLM 3ENSB 1TGCA 2I6QA 5EXLA 2GT8A 1MD8A 1X7AC 1G3DA 1K1JA 1O2KA 1LMWB 2B7DH 1ETSH 1CGIE 3V0XA 3PYHA 1W14U 1QA0A 3ELAH 1EQ9A 1YPMH 1DFPA 1GBJA 2JH5D 3MH4A 1BHXB 3DFLA 4B1TA 1TFXA 1BTWA 1LHDH 3A82A 4NIWA 3GY8A 2OTVA 3GYMA 1MCVA 2PFEA 4U30A 2XNIA 3T27A 1P0SH 2PSYA 1BOQA 2Q6FA 3Q77A 1FV9A 4AFUA 1C2MA 1RJXB 3QX5H 1OOKB 1E36B 4J2YB 1XM1A 1SVPA 1H9HE 1RTLA 1AFEH 1AQ7A 1GCTC 1T31A 4X1SU 4GVUA 2QCYA 3K9XB 2PKSC 2GT7A 4D9QA 3P8OA 2Y81A 1MTNB 1S0RA 2EC9H 4INHA 3ZVBA 5A0BA 2Y5FA 4NGAH 1DVAH 3L3TA 2H9EH 3PLBA 1C1RA 3QZQA 4X1RU 2NU2E 1HAGE 5F03A 2ZKSA 2BX4A 1B0FA 5J4QA 1L0ZA 1INCA 1O3NA 3AASA 2KAIB 2WPIS 1OP2A 1WQSA 1C1SA 1O2MA 4YM9A 3LGWA 1W3CA 3D62A 3K65B 4X2VA 1O2LA 1YF4A 3TH4H 2P3TB 3PMAB 3PMHB 4ISLA 4X8VH 2ZI2H 2O8LA 3CS0A 1C1PA 3EGKH 3SUDA 1JIRA 2W7UA 3GYLB 2GDEH 3O8RA 2ZCLP 4X6OA 2OP9A 1SQOA 1GG6C 3BIVH 4NG9H 1QR3E 1Z1JA 3BF6H 1TNIA 5EXMA 3SJOA 4K8BA 2CF9H 2CGAA 1S0QA 1F5KU 1YPEH 3Q3YA 4Y76A 3VB5A 1K21H 3FFGA 1NFUA 1Z8GA 3EA8A 4DG4A 2QV1A 1GBIA 3O8BA 1KXDA 1XUFA 2OC7A 1OS8A 5F8ZA 4GLYA 2FOGA 1FAXA 5JDUB 1TE0A 3L6PA 1IHTH 1KLJH 1J14A 5C5OA 1PPHE 4JK5A 1D6WA 3ITIA 3RM0H 2ANYA 2VIVA 2C8XB 3RM2H 1DLEA 2QYIA 3RXLA 5A8XA 1FIZA 2BY7X 4JZDH 3WY8A 1FXYA 3U98H 3KQDA 2ZTXA 4YESB 5JBCS 1THRH 1SHYA 2VWNA 4XBBA 2SGQE 1AWHB 1SB1H 1K1PA 1TQ7B 1C1VH 1JXPA 1D4PB 1GJ7B 1KXCA 1AMHA 3TJOA 1Q2WA 1KIGH 1S81A 1BBRH 3S9CA 1P57B 2M5TA 3SUGA 1NROH 2G5NA 1QRXA 1EXFA 3UR6A 3TJVA 2AERH 4U32A 4A92A 1QBVH 2OQUA 3KEEA 1O32A 2PTNA 1XMNB 1GI7B 5GIBA 3EDXB 1BTUA 3LDXH 5DP3A 1NZQH 1S6FA 8GCHG 1VGCB 1BHXF 1ZOMA 4MNXA 1E35B 4OS6A 1TA2A 1CT0E 4NSYA 5TJXA 2A1DB 1RIWB 1HB0B 3RXAA 1XXFA 2HWLB 1ZPZA 2OC0A 2A32A 3BN9A 3ZVFA 2BDCA 1HPGA 3C27B 4BXWA 4BAHB 4CBOA 3PO1C 1TONA 2ZIQH 1XUIA 4AFQA 4H42U 1NO9H 2H2ZA 1A1RA 3KQEA 3Q3KA 5T6GA 5FAHA 2D2DA 1NT1A 1SGNE 1MUEB 1N8OB 2BVRH 4X2XA 3K6YA 1TOCB 3SI3H 1EJMA 2P16A 2ZFRH 2P59A 1SPJA 1UVOA 5AFYH 1FLEE 2A7HA 3F9HA 2QAAA 1PYTD 4DIIH 4JYVH 2ZNKH 1Y3VA 3RXTA 5G4BA 2PKAA 4I8KA 1HAIH 1D9IA 5T6DA 1VCWA 2A0QB 3HKIB 1ELDE 3P8GA 2CMYA 1O2VA 1ORFA 1TWXB 3HATH 4HI3A 2ZU3A 4ABGA 1DXWA 1AO5A 2ZGBH 3A83A 3M5NA 4JK6A 3DHKH 4D7GA 1UK3A 1HAVB 2WUCA 2P3UB 1RTKA 4Q7YA 4WMEA 2ZGXH 2FXRA 1MBQA 3T26A 1W7XH 4YLQH 1DY9A 3BTTE 1QL7A 3MNBA 2NU3E 3RXSA 4INKA 3LGYA 1E0FD 3RUOA 1W10U 1T7CA 3UFAA 5EQQA 3P8FA 2PV9B 1OWHA 2YNBA 1C1QA 4GCHG 3RU4E 4CHAB 1GDNA 1TPOA 2A45B 2AS9A 1SBWA 2ZHWH 2Y80A 1TYNA 4A5TS 1F5RA 1F0UA 4GUXA 3P70B 1NPMA 1XUHA 3VXFH 1AE5A 1EATA 2BHGA 1ARCA 1TBRH 2HVXA 2GP9B 1SFQB 4MPVA 1G3EA 1Y3XA 4YLUA 1GHBF 2Z9GA 1Y5AT 1BRAA 2BLWA 1O3KA 3G01A 4ZAEA 5JBAS 2STAE 2P93A 3SQEE 2UUKB 3RMNH 2PGBB 1GI6A 4RKJB 1BTZA 4I8LA 2VGCC 1A0JA 1ZMNA 1C4U2 4BAQB 1CT2E 1RXPA 3TITA 3OSYA 3KN2A 1GI5A 2ZA5A 1FDPA 4DCDA 3GOVB 2PUXB 2GCHG 2Z3CA 2ZFFH 1TOMH 1TPSA 4WMDA 1G32B 2H9TH 4DOQA 1P8VC 3E91A 1D3PB 3URDA 3TH2H 3F1SB 3UQVA 2IOTA 3M7QA 1LTOA 5DPAA 2SGPE 2GX4A 1WTHD 3MU0A 4YOJA 3M5OA 5EPYA 4X6NA 1OP0A 3T29A 3MU4A 1WAYB 1S6HA 4TWYA 4ZHAA 7GCHG 1KXBA 1O2ZA 1O37A 1NFXA 2VH0A 1EPTB 3UIRA 1AVGH 2QIQA 1F0TA 1ABIH 1SI5H 4FU9A 2ZECA 1YBWA 1XUKA 1ZRBA 4YOIA 4ABHA 2G4TA 4GPGA 1NTPA 1EAIA 1M9UA 4CBNA 2UWOA 1HV7A 3CP7A 1TBZH 4Y10E 4MPXA 1DWBH 2QXGA 1O3FA 1NS3A 4AFSA 4UE7H 4TPIZ 4IS5A 1DITH 1LQDB 1GBBA 1GGDB 3UOPA 2ANKH 1DSUA 4ZH8A 5SGAE 4UFEH 4K1TA 2HOBA 4Y8YA 1JRSA 4XDEA 3MH6A 5DO4H 2IPHA 2WPKS 3LU9B 1C5UA 1LPZB 1O31A 2SGFE 4AFZA 3V12A 3NUMA 1GI1A 2FMJA 3TGJE 1Y5UT 2WINI 1BTHH 3A8DA 1ZTJA 1SG8B 4AG2A 1HJ8A 1GMHG 3SNDA 1TRYA 5C1YA 2ZC9H 1S82A 4E7NA 3ZZBA 4ISIH 2QGRA 2VWLA 4Z6AH 1FIWA 1MAYA 1P2QA 1Z8IB 1NRQH 2QC2A 2ZDKA 2OBQA 4FUGA 1EAUA 2KAIA 1O3CA 1EB1H 5T6FA 4MDSA 4IC5A 1NM6A 3LIWA 3UNQA 1LVOA 4ISNA 1ZHRA 2CF8H 5LPEA 1Q3XA 3PWBA 3SOSA 1SGYE 5A2MH 1C5SA 2A7JA 4ZXXH 5A0CA 2HNTF 3MU1A 2EI8A 2W7SA 4Y0ZE 3GISB 3M3TA 4KKDA 1A5HA 3P95A 3BV9B 3DA9B 2BY9X 1L1GA 4FUJA 1ZPCA 1THPB 1GJAB 3ATIA 4OS7A 4VGCC 1DS2E 3HK3B 4WXIA 3HGNA 5FXLA 2SNWA 1G3BA 4NIVA 2PSXA 1WCZA 1YM0A 1ESAA 3TNTA 3BTKE 4AGKA 3RXMA 3SORA 1NY22 1SGFA 1AY6H 2TRMA 4A7IB 2CHAC 2A5IA 1LHFH 3EE0B 1Y8TA 1KY9A 5GDSH 2ASUB 4O3TA 3W94A 4B74A 3NXPA 2GTBA 5C3NA 1GHYH 4CH8B 1DSTA 1JBUH 1NC6A 5CHAC 3F9FA 3M7UA 3PB1E 2UUYA 1AUTC 4IGDA 2RA0A 3STJA 3KF2A 3UPEA 3SV6A 4E06H 4NCYA 2JETC 2HNTE 1A5GH 2GMTB 1SHHB 4HZHA 3TPIZ 1UVPA 2PLXA 3SJKA 5IDKA 1GVKB 2ZCKP 3SQHE 2O8TA 4WH6A 4X2YA 1QCPA 3PTNA 4I32A 3SUFA 1EZSC 2PKAB 2GKVE 1C2DA 1QRWA 1O2OA 1VITH 2H6MA 1TB6H 1DUEA 3SI4H 6ESTA 2BZ6H 2FP7B 1HJAB 3V7TA 5CE1A 3C1KA 3MOCA 3RXUA 1SR5C 3JZ2B 2VIPA 5BPEA 5DP8A 1PQ8A 1O2XA 1GHBG 1YPLH 1LHCH 4B73A 3SGAE 1ARBA 1OWJA 1F0RA 2HGTH 3T28A 1SGFG 1OP8A 1QIXB 2CXVA 4WVPE 1ELVA 2DE9A 1T32A 2V3HH 3EA7A 1P03A 5PTPA 1SGIB 5EQRA 5K0HA 4TPYA 8GCHF 3TGKE 3O8DA 3OX7U 4ZKNU 4GHQA 2OLGA 1S85A 4I33A 1HAXB 2BDGA 1T4UH 4K60A 1V2QT 1OX1A 2ZGCA 5HGGA 4CREA 1TRMA 1JMOH 5EQSA 4ABBA 4OS5A 3MH7A 1BCUH 3SO3A 3U1JB 1S84A 1GBCA 1BUIA 1P9UA 3I77A 3QZRA 2G5VA 1WQVH 4AGJA 1O33A 2FLRH 2OXSA 3SN8A 1HAYB 1LKAA 4TYDA 3SGBE 2VVVA 2W3KA 4XBCA 2ZU4A 1YPKH 2R2WU 4H6SB 1BMLA 1C1UH 2C90B 2GGVB 3ZVCA 3RXEA 1TGNA 1GJ6A 3KHVA 5AFZH 3RDZA 3ZZDA 3EA9A 2R9PA 1MQ5A 3LJOA 4HGCA 2V6NA 1Z7KA 1QL8A 1Z6EA 5DP7A 3KQCA 1W12U 3S9AA 1ELEE 3SHAH 2VB0A 3M35A 5FX5A 3MNCA 1GHWH 2JKHA 4GSOA 3MWIU 2ALVA 3UWJH 2QA9E 2OUAA 1K1LA 1D3QB 1DDJA 1YLDA 2F9NA 4GCHF 2BX3A 4ABFA 5HM9A 5IYTA 4MPWA 2BD7A 1IQGA 3JZ1B 4I8GA 4AORA 2BD2A 4CRDA 1LQEA 1ETRH 2IN2A 1PFXC 2FX4A 2BLOA 3HPTB 3RXOA 1FY1A 1UK4A 1O3LA 1YYY1 1GBHA 4NA9H 5JB9S 2R0LA 1P05A 3ODDA 3FANA 3STIA 4NWLA 4X8UH 1KLTA 1N6XA 1O36A 1W2KH 4CR9A 4YT6H 4DGJA 1C5QA 8LPRA 1UTKA 2EI6A 2PR3A 2XWBI 1BTYA 3SZNA 5GPIB 3RXPA 2SGEE 1FONA 4KTUA 4OGYA 3VB7A 1TX7A 3O8CA 1WUNH 3GCHC 2GCHF 4O9VA 3TK5A 4LK4A 1A3EH 4NSVA 1K1OA 4JYTA 1EPTA 2ZDNA 1B5GH 2FTLE 1HFDA 1V2RT 1GPZA 2F9BH 1O0DH 1FY8E 3HGPA 3MH5A 1TGTA 1MTVA 1TPAE 1UTMA 4FVBA 4MQAA 2CN0H 1XVMA 4BANB 1ESBA 3MNXA 4TY6A 1HAOH 3LH1A 1HRTH 7GCHF 3UOUA 4GHTA 1VITG 4UD9H 1O3BA 2FEQH 1C1OA 1SLUB 5EODA 2ZDMA 1ELCA 3SU3A 5I46H 2NWNA 2BD9A 5H4IB 3PTBA 1AVWA 5HXFA 1BTXA 4WJG2 3P17H 2BY5X 2TBSA 2BB4A 1K1NA 2VIWA 4Q7XA 1C2GA 3RC4A 3D49H 2ZDAH 2B8OH 2QY0B 4FUIA 4AB8A 2SNVA 1GVZA 1TBQH 1UVTH 1V2NT 1UTQA 1MZDA 1TABE 1GVLA 2W26A 2OC8A 2PTCE 3BTFE 3RXQA 1ZSLA 1RFNA 1C2IA 1O2JA 2ZHFH 3MU5A 3RXFA 5DKMA 3F6UH 1CHGA 3OY5U 3T62A 3BG8A 3QWCH 1JOUB 2BDYA 2GZ9A 1GMHF 1ZHPA 2Z3EA 4A6LA 1Z6JH 4KTCA 1OSSA 1QTFA 3QTOH 1GI8B 1EP6A 3M3SA 1VCPA 1W11U 4F4OC 3TH3H 3ZZCA 1VGCC 1QL9A 1UCYE 1BBRE 4CR5A 2R3YA 1RIWC 4K8YA 3RXDA 4M7GA 4UDWH 4XSKU 3ZZAA 2ZPQA 4GAWA 4AZ2B 1IHSH 5EW2H 1NRSH 3BTEE 3UR9A 4F49A 1GG6B 4ESTE 1JIMA 2J92A 3BTGE 3BIUH 3QGJA 1O2WA 3TIUA 3F68H 5GXPA 2Q1JA 1QQUA 1TX8A 3KQBA 2FLBH 5DP4A 2XBWA 3SUEA 2OD3B 1ZMJA 1A5IA 5A8ZA 1O5CB 1TRNA 1QNJA 4AYVB 1AI8H 3Q00A 5FBEA 4AG1A 3RMLH 1TNGA
chains in the Genus database with same CATH superfamily
5FBIA 2LNCA 1A7SA 1OHHD 1QB6A 3ATKA 5C20A 2XCNA 1PQ7A 3A85A 1UVSH 2P94A 2WYJA 2ZGJA 1BT7A 1J8AA 2R0KA 4ZKOU 1BRBE 3ATWA 1UO6A 2CJIA 2GZ7A 4ABJA 1TGBA 2Y7XA 4U2WA 1J9CH 1L1JA 2FDAA 2H5CA 3H7TA 3GDUA 1O3DA 4NFEA 2UUFB 1P06A 3SJ8A 1OWEA 1GBMA 4CHAC 1CU1A 4HTCH 3SV2H 2P95A 5KEDA 2Z9JA 1WU1A 3DCLA 3E0PB 3P6ZB 1AB9B 3K2UA 1F0SA 3QLPH 2HNTC 1P9SA 1GDQA 1PQ5A 2ZEBA 2AMQA 1P2KA 3KIDU 9LPRA 3ZV9A 1Z8RA 4LZ1H 2FI3E 2RDLA 1O2TA 1CO7E 3A7ZA 3Q3XA 4KTSA 4BAOB 2ANWA 2Y7ZA 2FOBA 5F8XA 2W3IA 4WWYA 5C0UA 3ZZ5A 2YOLA 1RRKA 4TSFD 1ELBA 2P8OB 1A3BH 1KTSB 1OWIA 2QN5T 3ZYEA 1CSOE 1IQFA 1C5VA 1TNLA 3ZIAD 1JRTA 1KXAA 1C5MD 1BA8B 1C1WH 1CA8B 2UWPA 2KCOA 1GJ5H 3EAJA 1O2IA 4F55A 1VR1H 1V2VT 1NESE 5C1UA 3UNRA 2BDIA 3PO1B 2XXLA 1UTJA 1E38B 1LO6A 2V7QD 1TMBH 4H6TA 3H09A 4KGAA 2B0FA 4D76A 4YO9A 1AU8A 1YP9A 1BZXE 1V2TT 3MO3A 4E7RG 1P10A 1GJCB 2Z7FE 3BEUA 3VXEH 3RXKA 2NU1E 4Y79A 3FAOA 1KYNA 2H1UA 4XBDA 4I8HA 1AKSB 2FX6A 3SNCA 2A7CA 3SHCH 2G55A 2Z9LA 2ZFPH 1J16A 2G52A 5DJ7A 1F5LA 2C8ZB 1FAKH 3LH3A 1LPKB 5A09A 4BTIB 3IWMA 1W13U 3U8TH 3OTPA 3UTUH 1HGTH 2JH6D 1DUAA 1LVMA 2ZHQH 5AVDA 1MU8B 2F4LA 4U01A 2ZO3H 2G00A 4ZUHA 1BRCE 5EGMA 1ELTA 1GGDC 1IQIA 4JZEH 3ZVEA 1MCTA 1GBEA 1ZRKA 2SFAA 4K69A 4X6PA 1W0YH 4K3JA 4FUHA 2ZTYA 1AHTH 1XXDA 3GCNA 3SJ9A 1W0ZU 2ZQ1A 3M7TA 4DJZB 4CRAA 1GJ4H 1XVOA 3RXHA 1O2YA 1TLDA 2G81E 1DM4B 1C1MA 3MO6A 4NA8A 1O3GA 3BG4C 5E8EH 2TGPZ 3BEFB 1NU9A 2BQ6B 1DANH 1IQMA 1CBWC 2GCTC 2BLQA 5J4SA 1RD3B 1GBDA 1GDUA 1EP5A 1ZTKA 2Z9IA 1GHAF 1WTGH 2LPRA 1TALA 2GD4B 2K0QA 1BQYA 4ISOA 1UVUH 1MZAA 3QO6A 1AFQC 1C5NH 3GY7A 4NIYA 1QFKH 3SYJA 1TNHA 3SV8A 1IQLA 4B2AA 5EW1H 1KSNA 3ATLA 1O5AB 2QXHA 1KTTB 4ZHLU 1QJ7B 2V3OH 4K2YA 4FUFA 2A31A 3F0PA 4R8TB 4X2WA 2ZU1A 1AWFH 4Y0YE 3U8RH 4X8SH 1SGDE 1O3HA 1MQ6A 2XC5A 4WY3A 1V2KT 1ZMLA 1ZJKA 2F83A 3CS7A 1MKXK 2ZCHP 1DWCH 5L2YH 4AX9H 1ANEA 1DICA 3EYDA 4DIHH 1EZXC 1D3DB 1XKAC 1EFRD 1C4Y2 1K1MA 1O3PB 2RFKC 1VKYA 3ZVDA 1P2MA 1QBOA 4CRBA 2TGTA 2OC1A 1HJ9A 2BDAA 1COWD 1TMTH 1A2CH 2ZPSA 1EZUC 4BTTB 5FX6A 1PPBH 3A86A 3SV9A 3FZDA 2Y82A 4OS1A 4ZHMU 2VVUA 3S7KB 1AVXA 6GCHG 4O3UA 1P3CA 2WPHS 1YLCA 3KNXA 1VITF 3A8AA 3E16B 2ZF0H 5C67A 1J17T 3UY9A 1TA6A 1K22H 2FM2A 2J2UA 3V13A 3IITA 4B75A 1C4V2 1G37A 3BSQA 2GMTC 1W0JD 3RC6A 4JMYA 3U8OH 4MNVA 1ZHMA 2KCAA 2P3FH 3B8JA 2A4RA 4FU7A 2HALA 3QUMP 1AIXH 3GY2A 2FOEA 1YCPM 4Y7AA 1GI3A 2AHME 5DK1A 4CRCA 3ATMA 3BTDE 4OS2A 1HJAC 5E2PA 1MTSA 1C2KA 2VIQA 4IC6A 3PLKA 4UFFH 1CHOG 2ZHDA 1GBLA 2ZHEH 3F9EA 1ZJDA 1C1TA 1DY8A 3VGCB 2HLCA 2V35A 3A80A 1UTOA 1Y3YA 1OYTH 2VWMA 5JPMH 4YT7H 1H8IH 2ZG0H 2WUBA 3A81A 1L1NA 4IMQA 1AD8H 3UNSA 2NU4E 1AE8H 4I7YH 1RTFB 2WYGA 1P04A 3LGVA 4ABDA 1AZ8A 1QB1A 4IN1A 2FIRH 1O2NA 1IQHA 2A4GA 1SLVB 4NFFA 1H8HD 1MU6B 2QF0A 3H5CB 5EG4A 2PHBA 1TIOA 1THSH 2AIQA 3UQOA 1S5SA 5ETXA 5ABWA 3RXGA 1ELGA 2WPMS 1NRPH 3RU4T 1C9TA 1O2UA 2G4UA 1ANCA 1N6YA 3MFJA 1FUJA 3NWUA 5DP6A 1O2PA 4AOQA 3SU1A 4MNWA 1O3EA 5C17A 3K6ZA 4MVNA 3S0NA 1V2LT 3FO8D 2JH0D 1UTNA 2ZFSA 2BMGB 3SJIA 2Q6GA 3RXRA 5JYIA 1WV7H 1CA0C 1QB9A 1FNIA 1O3MA 3MNSA 3PM3A 2JETB 5TCAA 1QURH 3M3VA 2KX4A 1NFYA 1DWEH 1V2PT 1MTUA 2D1JA 3AW1A 1C5WB 4B6EA 4Q2KA 5K7RA 3RXIA 2F43B 1GMDG 2NU0E 3AAUA 5C0TA 4AB9A 1K2I1 1V2MT 1BDAA 3ZZ8A 5L2ZH 2J4IA 3T25A 5LH8A 4DW2U 2XNDD 1ZTLA 3SW2B 1SGEE 2XBVA 1O39A 1PYTC 3T5FH 3GY3A 1MKXH 3F2FA 5LPRA 1P12E 1LHEH 4X8TH 2RDEA 3HKJB 4B76A 6CHAB 1C5LH 2GZ8A 1DX5M 1YPJH 3SU4A 2A4OA 1WSSH 3KL6A 1A4WH 2SGDE 2O8MA 4AN7A 3LT3A 1BMMH 2XBYA 1OKXA 2BD8A 5TCCA 3ZZ6A 1C5PA 2XW9A 2Q6DA 4A1XA 4Z0KA 1FN8A 1O5BB 2GJGA 5EU8A 1E1RD 2O8UA 1SLWB 1P11E 3PV5A 4CRGA 2GDDA 3FOAA 1GHAG 1O3JA 2AGIX 3SNAA 1FPHH 3QGNB 1Q31A 4ABAA 4WF8A 5DG6A 1HCGA 4BAKB 4MLFB 3UAIC 1C2HA 4Y8XA 1EAXA 1MTNC 1C1NA 1YLNA 3TK9A 2J9NA 1AKSA 4ZKRU 2KZ4A 2TGAA 4WXVA 3M61U 3NK8A 1EJNA 1IQNA 3H7OA 2G51A 1SGTA 1ELAA 1QZ8A 1YGCH 4NZQA 5GCHG 3EE7A 1SFIA 3FP7E 2Z94A 4ZKSU 4CRFA 1L4DA 1CQQA 1TGSZ 1DOJA 1FY5A 3ZZ7A 4H4FA 1GI9B 4B2CA 5GNDA 1MBMA 4Y6DA 1TMUH 1FY3A 1O34A 7LPRA 2FYQA 1IQEA 2ULLA 4B71A 2ZP0H 3KYGA 5A8YA 4ZROA 1O2RA 2R3UA 1MH0A 1MAXA 3FVFB 2EA3A 1GMCG 5DP9A 1SOTA 5FPTA 3S9BA 4KELA 1HIAB 1H8DH 4XD7D 3A7XA 2RCEA 3GY4A 1Z71A 5FPSA 4P02A 1QRZA 5KECA 3LGUA 5EIYA 3RC5A 4Y7BA 3UUZA 5DGJA 3ESTA 2O9QA 1HUTH 3DUXH 4WMFA 2TPIZ 1LVBA 3DSGA 3A84A 4IBLH 2ALPA 3PRBA 1SQTA 5A0AE 3AW0A 4ACAA 4UONA 5AF9H 4OGXA 1FQ3A 3R0FA 1S83A 2THFB 4K1EA 2KM0A 1Y5BT 1QGFA 2C93B 1FX0B 1TPPA 2Z9KA 1D6RA 2A5AA 4XFQA 4ZXYH 2O8WA 2FS8A 5E2OA 1WYKA 3I78A 1ZYOA 2ZDVH 1GCTB 3TVJB 1LPGB 3SU2A 1DT2A 1F7ZA 2PKSB 2AIPA 4K1SA 1HAZB 1BJUA 3GCHB 3OY6U 2A2QH 1BIOA 2IJD1 5C2ZA 2FOHA 2AMPA 3RXBA 2ZU5A 1HLTH 1G30B 3TU7H 5HIYA 1E79D 2AGGX 5FPYA 1NRRH 1G36A 1ID5H 4RKOB 3VEQB 1NFWA 5HM2A 1C5TA 1TX6A 4BAMB 1IAUA 2VNTA 4O03A 1GJ8B 1Z1IA 4BTUB 1OYQA 2BTCE 3LPRA 2K8IA 3V3MA 1XX9A 2ZTZA 4FXGH 2FYRA 2WSSD 3ZVAA 2H5DA 3DFJA 2AGEX 2ZPRA 2EEKA 4UEHH 3RMOH 1FJSA 2OQ5A 3P8NA 4PROA 4D9RA 2PGQB 1O5DH 2WV9A 2EI7A 2FODA 4SGAE 4M9FA 3GCOA 2IJOB 4ASHA 4IN2A 3MMGA 3L33A 3LGIA 1BMNH 2PW8H 5JBTA 3KGPA 1QHRB 5C94A 2A4QA 4YOGA 1O5GH 2XC4A 3TGIE 1N1LA 3TK6A 3A89A 2J5UA 1N8OC 5F53A 1O2SA 1UCYH 1ZPBA 1P3EA 1E34B 2C3SA 1PJPA 5C5NA 4NZLA 1GJ9B 1O3OA 6GCHF 2J94A 1EUFA 1AB9C 1ZGIA 1P2NA 1IOEA 4TY7A 2XYAA 4BXSA 4LZ4B 4X6MA 1T8LA 2FPZA 2G8TA 2VU8E 2WV5A 1TNKA 5FCRA 1XKBC 3SBKA 3MHWU 2ZFTA 4THNH 3DT0H 3SU6A 1H9LB 1SMFE 2FOMB 2V0BA 4HFPB 3RLYH 1QBNA 1O2GH 2P8OC 1P02A 5I25A 1C5YB 3MTYA 3GCTF 3B23B 1UTPA 2BM2A 2BY8X 3U9AH 1LVYA 5HMAA 3BTME 1H4WA 2BVSH 1NN6A 2CV3A 3RXJA 3URCA 1GBTA 2F9VA 1C9PA 4UFDH 1O35A 3IG6B 1Y3WA 1UK2A 1ANDA 3TLOA 4RN6A 2WV4A 3ZZ3A 1L2EA 2BOHB 2HLDD 2AEIH 2F9PA 1CHOF 2F9UA 1YY3A 5IK2D 2BD3A 1HXEH 2ZDLA 1WDIA 2XRCA 4I31A 3M37A 3LC3A 4Y11E 5DP5A 1IQKA 2J34A 2AYWA 1F92A 1BRUP 4D8NA 1HAPH 1WBGB 5JBBS 4ABEA 1K1IA 1YCPK 1K9OE 2OBOA 1IQJA 2ZWLH 3FKSD 1C2LA 4ISHH 3GY5A 1YPHE 5ESBA 2KR7A 3FP8E 2LELA 2UWLA 3E3TA 3E0NB 4CH2B 3RP2A 5F6MA 3W95A 5ESTE 3VFEA 1AUJA 4HG6A 1DLKB 2A2XH 1YC0A 3RU4D 2YNAA 1P01A 2XTTB 2B5TB 4FUCA 3S69A 1GI0A 2M2AA 2RG3A 2DUCA 3MYWA 4SGBE 3WWBA 3FP6E 2UUJB 1GHZA 1G9IE 1ZGVA 4JCNA 1K0HA 4DVAU 1EPTC 1O2HA 2FI4E 1H8ED 1MTWA 1PPCE 1DE7H 1EKBB 3AAVA 2ESTE 3QTVH 1LDTT 2C8YB 2RA3A 4X0WU 5GWZA 1C5ZB 1YPGH 2BY6X 1C2JA 1CT4E 1SL3A 4TWWA 4ABIA 4E05H 1GBAA 1GMDF 2W6JD 2VH6A 2AFQB 4NWKA 1V6DA 1GBKA 1ZSKA 2Y6TA 3BTHE 1LKBA 3Q76A 2JJ2D 4JZFH 3QN7A 3LJJA 3FZZA 2ZZUH 1EAWA 6LPRA 1EJAA 4B2BA 3EQ0H 5E0HA 1TAWA 3PMBB 1SOZA 1KDQA 1HNEE 1BJVA 2Z6BD 4MG3A 2ODQA 2V3MA 3E8LA 1FMGA 4RSPA 1C5RA 2GV6A 2VINA 4AYYB 8KME2 1AN1E 1FN6A 2VGCB 3E90B 3LC5A 3OU0A 3RMMH 1O30A 3NCLA 2BQWB 1MKWK 1O5EH 1ZZZA 5FHTA 9ESTA 2ILNA 3SGQE 2BDBA 2F3CE 2FS9A 1VJ9U 2FOAA 4QT8C 3SU5A 1UHBA 4F48B 2D8WA 5BRRE 1SC8U 5EJ1A 4IW4E 2Y5HA 5FCKA 2ODYB 2I6SA 1C2FA 4FUEA 3HK6B 4LXBH 1Y59T 1ZSJA 2OINA 1DWDH 2DE8A 2WPLS 1SLXB 2BD5A 4XE4A 2FESH 5GCHF 4ZMAH 4K5ZA 5DN6D 3ODFA 1G2LA 2ZGHA 2BDHA 3GICB 3TNSA 1SGRE 3ZV8A 4O97A 1RGQA 7ESTE 1HIAA 5GJ4B 4MTBA 1EX3A 3A7YA 4FVDA 2YMSC 1KMHB 1ELFA 4B6FA 3D65E 2J95A 4DT7B 1PPEE 3BTWE 3KCGH 1SGQE 3A8CA 1SGCA 3SU0A 1QJ1B 3BG4B 2BXUH 1A61H 2HRVA 2OCVB 1CBWB 2FWWA 3TJUA 1GMCF 2GCTB 4FU8A 1G3CA 3OFND 5T3HA 4D7FA 3N7DA 1BTPA 3B9FH 2BYAX 1PPGE 1ANBA 2KCYA 3RLWH 1VCQA 1UMAH 1SGPE 3ZYDA 1GI2A 3A7WA 1NRNH 1AZZA 1PQAA 1VZQH 2VJ1A 1OWKA 2B9LA 1OPHB 3QK1A 2VIOA 3PLPA 1UJ1A 4R0IA 2GVFA 3MI4A 5L6NH 5FL7D 2BQ7B 2WPJS 1AFQB 1YCPH 4INLA 3GY6A 1XUGA 1GHVH 1ZLRA 5E0JA 1KXFA 2BD4A 1BB0B 5EPNA 1P2JA 1GJDB 1E37B 2ZQ2A 4DY7B 3VGCC 4IMZA 4BOHA 4WH8A 5HYOA 1T8NA 1ABJH 1O5FH 1CE5A 3UREA 1C5XB 3GDVA 4X1PU 4LOYH 8ESTE 3GCTG 1UW7A 1B7XB 1EASA 2HPQH 3D23A 3UWIA 4YZUA 4Q4LA 5F8TA 1F2SE 1GWAA 2QF3A 5L30H 1MD7A 2C4FH 5EJLA 1C5OH 2BOKA 2STBE 3QDZB 4XOJA 3SNBA 4YTAA 3A8BA 1GL0E 1V2WT 1CGJE 2BVXH 3A7TA 2XBXA 4FUBA 5C1XA 2PWXA 3OTJE 1V2JT 2FOFA 1L4ZA 1V2OT 4RI0A 3M5LA 1W7GH 2FOCA 3I29A 1S6LA 2JJ1D 3A87A 3P92A 3NZIA 1FZZA 3U69H 1SSXA 2VIDA 1O2QA 2Y5GA 5LPFA 1ETTH 1B0EA 3SNEA 3VPKA 1HXFH 1J15A 1JWTA 1FI8A 4JZIA 4VGCB 3RXCA 5LGOA 5DSFA 3VB4A 2K1QA 3PROA 3ZZ4A 1KLIH 3LONA 2AH4X 3PMJA 3N7OA 1GL1A 1PPZA 1O38A 1H1BA 3BTQE 1GCDA 2CHAB 2VVCA 2XC0A 3NPSA 1O3IA 1P09A 1T8MA 2ZFQH 1U6QA 1YWUA 3M36A 4JZ1A 1EB2A 5EJZA 2SGAA 4KP0A 4BNRA 2FI5E 1P2IA 1G2MA 1MKWH 3CENA 1FY4A 1Z8JB 2FZZA 4JYUH 4MPUA 1HBTH 1GHXH 2QF4A 2IPQX 2C8WB 2PUQH 1SQAA 5CHAB 5JB8S 1A46H 1GI4A 3NKKA 1ZR0A 2TGDA 1BMAA 3TJNA 3ZVGA 3VB6A 3S7HB 1HAHH 6CHAC 2HPPH 3LKWA 3NRLA 1HYLA 1QQ4A 1SQRA 2FO9A 3A7VA 4Q80A 4OS4A 4UFGH 1A0HB 4Q63A 1O3AA 2A5KA 3GDSA 1FPCH 1TQ0B 1NU7B 2Z3DA 1QY6A 3ZZ9A 2F91A 3E6PH 5AHGH 3R3GB 2F9OA 2XCFA 3MO9A 3E1XB 4I8JA 1EOJA 4Y71A 2BXTH 4J1YA 3DD2H 1D3TB 4A1TA 2FTMA 3LGTA 2BLVA 1EZQA 1CGHA 1DXPA 1HDTH 4Q7ZA 1PPFE 3SZEA 1OXGA 1V2UT 3MU8A 2J38A 4FUDA 1VJAU 1A0LA 2AMDA 2QXJA 2XWAA 1XUJA 4Y8ZA 1GJBB 4NIXA 1Y3UA 1H9IE 2QXIA 1EOLA 1CVWH 3PV4A 1T4VH 3M5MA 1DPOA 1HAVA 3LOXA 5KGOA 1YKTA 1ACBE 4X1QU 1OWDA 4NA7A 3OYPA 3T2NA 2H9HA 2R2MB 1C2EA 4P00A 1KDQB 1QA7A 1MMJN 2TIOA 1UCYK 1CA0B 1TNJA 1KXEA 1BBRK 4MNYA 3A88A 3RXVA 5CMXH 1YPHC 1RS0A 1AGJA 4A1VA 7KMEH 1BITA 1LCYA 1V3XA 2ANMH 3F9GA 2D26C 3BEIB 2GV7A 3VB3A 4DURA 5EXNA 1V2ST 1GBFA 3U1IB 1W8BH 5B6OA 1T8OA 1WOFA 1P2OA 1LHGH 5T1VA 2BZAA 5E0GA 5EOKA 3SV7A 2ZU2A 4X1NU 2W5EA 3PWCA 2VWOA 3AVZA 1K28D 3PRDA 2ODPA 1ESTA 1UHBB 1QJ6B 1UTLM 3ENSB 1TGCA 2I6QA 5EXLA 2GT8A 1MD8A 1X7AC 1G3DA 1K1JA 1O2KA 1LMWB 2B7DH 1ETSH 1CGIE 3V0XA 3PYHA 1W14U 1QA0A 3ELAH 1EQ9A 1YPMH 1DFPA 1GBJA 2JH5D 3MH4A 1BHXB 3DFLA 4B1TA 1TFXA 1BTWA 1LHDH 3A82A 4NIWA 3GY8A 2OTVA 3GYMA 1MCVA 2PFEA 4U30A 2XNIA 3T27A 2JDID 1P0SH 2PSYA 1BOQA 2Q6FA 3Q77A 1FV9A 4AFUA 1C2MA 1RJXB 3QX5H 1OOKB 1E36B 4J2YB 1XM1A 5HKKD 1SVPA 1H9HE 1RTLA 1AFEH 1AQ7A 1GCTC 1T31A 4X1SU 4GVUA 2QCYA 3K9XB 2PKSC 2GT7A 4D9QA 3P8OA 2Y81A 1MTNB 1S0RA 2EC9H 4TT3D 4INHA 3ZVBA 5A0BA 2Y5FA 4NGAH 1DVAH 3L3TA 2H9EH 3PLBA 1C1RA 3OE7D 3QZQA 4X1RU 2NU2E 1HAGE 5F03A 2ZKSA 2BX4A 1B0FA 5J4QA 1L0ZA 1INCA 1O3NA 3AASA 2KAIB 2WPIS 1OP2A 1WQSA 1C1SA 1O2MA 4YM9A 3WWFA 3LGWA 1W3CA 3D62A 3K65B 4X2VA 1O2LA 1YF4A 3TH4H 2P3TB 3PMAB 3PMHB 4ISLA 4X8VH 5B6LA 2JIZD 2ZI2H 2O8LA 3CS0A 1C1PA 3EGKH 3SUDA 3KYFA 1JIRA 2W7UA 3GYLB 2GDEH 3O8RA 2L74A 2ZCLP 4X6OA 2OP9A 1SQOA 1GG6C 3BIVH 4NG9H 1QR3E 1Z1JA 3BF6H 1TNIA 5EXMA 3SJOA 1SKYE 4K8BA 2CF9H 2CGAA 1S0QA 3W1EA 1F5KU 4ZCNA 1YPEH 3Q3YA 4Y76A 3VB5A 1K21H 3FFGA 2J98A 1NFUA 1Z8GA 3EA8A 4DG4A 2QV1A 1GBIA 3O8BA 1KXDA 1XUFA 2OC7A 1OS8A 3FN8A 5F8ZA 4GLYA 2FOGA 1FAXA 5JDUB 1TE0A 3L6PA 1IHTH 1KLJH 1J14A 5C5OA 1PPHE 4JK5A 1D6WA 3ITIA 3RM0H 2ANYA 2VIVA 2C8XB 3DSOA 3RM2H 1DLEA 3GS9A 2QYIA 3RXLA 5A8XA 1FIZA 2BY7X 2WHXA 4JZDH 3WY8A 1FXYA 3U98H 3KQDA 2ZTXA 4YESB 2QE7D 5JBCS 1THRH 1SHYA 3PV2A 2VWNA 4XBBA 2SGQE 1AWHB 1SB1H 1K1PA 1TQ7B 1C1VH 1JXPA 1D4PB 1GJ7B 1KXCA 1AMHA 3TJOA 1Q2WA 1KIGH 1S81A 1BBRH 3S9CA 1P57B 2M5TA 3SUGA 2L6OA 1NROH 2G5NA 1QRXA 1EXFA 4XRNA 3TJVA 3UR6A 2AERH 4U32A 4A92A 1QBVH 2OQUA 3KEEA 1O32A 2PTNA 1XMNB 1GI7B 5GIBA 3EDXB 1BTUA 3LDXH 2HVYB 5DP3A 1NZQH 1S6FA 8GCHG 1VGCB 1BHXF 1ZOMA 2WPDD 4MNXA 1E35B 4OS6A 1TA2A 1CT0E 4NSYA 5TJXA 2A1DB 1RIWB 1HB0B 3RXAA 1XXFA 2HWLB 1ZPZA 2OC0A 2A32A 2KCPA 3BN9A 2BDCA 1HPGA 3C27B 3ZVFA 4BAHB 4BXWA 4CBOA 1MABB 3PO1C 1TONA 2ZIQH 1XUIA 4AFQA 4H42U 1NO9H 2H2ZA 1A1RA 3KQEA 3Q3KA 5T6GA 5FAHA 2D2DA 1NT1A 1SGNE 1MUEB 1N8OB 2BVRH 4X2XA 4ASUD 3K6YA 1TOCB 3SI3H 1EJMA 2P16A 2ZFRH 2P59A 3MQKC 1SPJA 1UVOA 2KFWA 5AFYH 1FLEE 4RT0A 2A7HA 3F9HA 2QAAA 1PYTD 4DIIH 4JYVH 2ZNKH 1Y3VA 3RXTA 5G4BA 2PKAA 4I8KA 1HAIH 1D9IA 5T6DA 1VCWA 2A0QB 3HKIB 1ELDE 3P8GA 3U28C 2CMYA 1O2VA 1ORFA 1TWXB 3HATH 4HI3A 3F2HA 2ZU3A 4ABGA 1DXWA 1AO5A 2ZGBH 3A83A 3M5NA 4JK6A 3DHKH 4D7GA 1UK3A 1HAVB 2WUCA 2P3UB 1RTKA 4Q7YA 4WMEA 2ZGXH 2FXRA 1MBQA 3T26A 1W7XH 4YLQH 1DY9A 3BTTE 1QL7A 3MNBA 2NU3E 3RXSA 4INKA 3LGYA 1E0FD 3RUOA 1W10U 1T7CA 3UFAA 5EQQA 3P8FA 2J97A 2PV9B 1OWHA 2YNBA 1C1QA 4GCHG 3RU4E 4CHAB 4Z1MD 1GDNA 1TPOA 2A45B 2AS9A 1SBWA 2ZHWH 2Y80A 1TYNA 3N99A 1F5RA 4A5TS 1F0UA 4GUXA 3P70B 1NPMA 1XUHA 3VXFH 1AE5A 1EATA 2BHGA 1ARCA 1TBRH 2HVXA 2GP9B 1SFQB 4MPVA 1G3EA 1Y3XA 4YLUA 1GHBF 2Z9GA 1Y5AT 1BRAA 2BLWA 1O3KA 3G01A 4ZAEA 5JBAS 4ACBA 2STAE 2P93A 3SQEE 2UUKB 3RMNH 2PGBB 1GI6A 4RKJB 1BTZA 4FOUC 2VGCC 4I8LA 1A0JA 1ZMNA 3F3BA 1C4U2 4BAQB 1CT2E 1RXPA 3TITA 3OSYA 3KN2A 2CK3D 1GI5A 2ZA5A 1FDPA 4DCDA 3GOVB 2OK5A 2PUXB 2GCHG 2Z3CA 2ZFFH 1TOMH 1TPSA 4WMDA 1G32B 2H9TH 4DOQA 1P8VC 3E91A 1D3PB 3URDA 3TH2H 3F1SB 3UQVA 2IOTA 3M7QA 1LTOA 5DPAA 2SGPE 2GX4A 1WTHD 3MU0A 4YOJA 3M5OA 5EPYA 2VBCA 4X6NA 1OP0A 1E1QD 3T29A 3MU4A 1WAYB 1S6HA 4TWYA 4ZHAA 7GCHG 1KXBA 1O2ZA 1O37A 1NFXA 2WZQA 2VH0A 1EPTB 3UIRA 1AVGH 2QIQA 1F0TA 1ABIH 1SI5H 4FU9A 2ZECA 1YBWA 4RT1A 1XUKA 1ZRBA 4YOIA 4ABHA 2G4TA 4GPGA 1NTPA 1EAIA 1M9UA 4CBNA 2UWOA 1HV7A 3CP7A 1TBZH 3F0OA 4Y10E 4MPXA 1DWBH 2QXGA 1O3FA 1NS3A 4AFSA 4UE7H 3CNRA 4TPIZ 4IS5A 1DITH 1LQDB 1GBBA 1GGDB 3UOPA 2ANKH 1DSUA 4ZH8A 5SGAE 4UFEH 4AC9A 3OEHD 4K1TA 2HOBA 4Y8YA 1JRSA 4XDEA 2PP6A 3MH6A 5DO4H 2IPHA 2WPKS 3LU9B 1C5UA 1LPZB 1O31A 2SGFE 4AFZA 3V12A 3NUMA 1GI1A 2FMJA 3TGJE 4OM9A 1Y5UT 2WINI 1BTHH 3A8DA 1ZTJA 1SG8B 4AG2A 1HJ8A 1GMHG 3SNDA 1TRYA 5C1YA 2ZC9H 1S82A 4E7NA 3ZZBA 4ISIH 2J98B 2QGRA 2VWLA 4Z6AH 1FIWA 1MAYA 1P2QA 1Z8IB 1NRQH 2QC2A 2ZDKA 2OBQA 4FUGA 1EAUA 2KAIA 1O3CA 3AK5A 1EB1H 5T6FA 4MDSA 4IC5A 1NM6A 3LIWA 3UNQA 1LVOA 4ISNA 1ZHRA 2CF8H 5LPEA 1Q3XA 3PWBA 3SOSA 1SGYE 5A2MH 1C5SA 2A7JA 4ZXXH 5A0CA 3WW7A 2HNTF 3MU1A 2EI8A 2W7SA 4Y0ZE 3GISB 3M3TA 2YMSB 4KKDA 1A5HA 3P95A 3BV9B 3DA9B 2BY9X 1L1GA 4FUJA 1ZPCA 1THPB 1GJAB 3ATIA 4OS7A 4VGCC 1DS2E 3HK3B 4WXIA 3HGNA 5FXLA 2SNWA 1G3BA 4NIVA 2PSXA 1WCZA 1YM0A 1ESAA 3TNTA 3BTKE 4AGKA 2LP6A 3RXMA 3SORA 1NY22 1SGFA 1AY6H 2TRMA 4A7IB 2CHAC 2A5IA 1LHFH 3EE0B 1Y8TA 1KY9A 5GDSH 2ASUB 4O3TA 3W94A 4B74A 3NXPA 2GTBA 5C3NA 1GHYH 4CH8B 1DSTA 1JBUH 1NC6A 5CHAC 3F9FA 3M7UA 3PB1E 2UUYA 1AUTC 4IGDA 2RA0A 3OAAD 3STJA 3KF2A 3UPEA 3SV6A 4E06H 4NCYA 2JETC 2HNTE 1A5GH 2GMTB 1SHHB 4HZHA 3TPIZ 1UVPA 2PLXA 3SJKA 5IDKA 1GVKB 2ZCKP 3SQHE 2O8TA 4WH6A 4X2YA 1QCPA 3PTNA 4I32A 3SUFA 1EZSC 2PKAB 2GKVE 1C2DA 1QRWA 1O2OA 1VITH 2H6MA 1TB6H 1DUEA 3SI4H 6ESTA 2BZ6H 2FP7B 1HJAB 3V7TA 5CE1A 3C1KA 3MOCA 3RXUA 1SR5C 3JZ2B 2VIPA 5BPEA 5DP8A 1PQ8A 1O2XA 1GHBG 1YPLH 1LHCH 4B73A 3SGAE 1ARBA 1OWJA 1F0RA 2HGTH 3T28A 1SGFG 1OP8A 1QIXB 2CXVA 4WVPE 1ELVA 2DE9A 1T32A 2V3HH 3EA7A 1P03A 5PTPA 1SGIB 5EQRA 5K0HA 4TPYA 8GCHF 3TGKE 3O8DA 3OX7U 4ZKNU 4GHQA 2OLGA 1S85A 3DSPA 4I33A 1HAXB 2BDGA 1T4UH 4K60A 1V2QT 1OX1A 2ZGCA 5HGGA 4CREA 1TRMA 1JMOH 5EQSA 4ABBA 4OS5A 3MH7A 1BCUH 3SO3A 3U1JB 1S84A 1GBCA 1BUIA 1P9UA 3I77A 3QZRA 2G5VA 1WQVH 4AGJA 1O33A 2FLRH 2OXSA 3SN8A 1HAYB 1LKAA 4TYDA 3SGBE 2VVVA 2W3KA 4XBCA 3UB0A 2ZU4A 1YPKH 2R2WU 4H6SB 1BMLA 1C1UH 2C90B 2GGVB 3ZVCA 3RXEA 1TGNA 1GJ6A 3KHVA 5AFZH 3RDZA 3ZZDA 3EA9A 2R9PA 1MQ5A 3LJOA 4HGCA 2V6NA 1Z7KA 1QL8A 1Z6EA 5DP7A 3KQCA 1W12U 3S9AA 1ELEE 3SHAH 2VB0A 3M35A 5FX5A 3MNCA 1GHWH 2JKHA 4GSOA 3MWIU 2ALVA 3UWJH 2QA9E 2OUAA 1K1LA 1D3QB 1DDJA 1YLDA 2F9NA 4GCHF 2BX3A 4ABFA 5HM9A 5IYTA 4MPWA 2BD7A 1IQGA 3JZ1B 4I8GA 4AORA 2BD2A 4CRDA 1LQEA 1ETRH 2IN2A 1PFXC 2FX4A 2BLOA 3HPTB 3RXOA 1FY1A 1UK4A 1O3LA 1W0KD 1NBMD 1YYY1 1GBHA 4NA9H 5JB9S 2R0LA 1NBME 1P05A 3ODDA 3FANA 3STIA 4NWLA 4X8UH 1KLTA 1N6XA 1O36A 1W2KH 4CR9A 4YT6H 4DGJA 1C5QA 8LPRA 1UTKA 2EI6A 2PR3A 2XWBI 1BTYA 3SZNA 5GPIB 3RXPA 2SGEE 1FONA 4KTUA 4OGYA 3VB7A 1TX7A 3O8CA 2YMSD 1WUNH 3GCHC 2GCHF 5HIZA 4O9VA 3TK5A 4LK4A 1A3EH 4NSVA 4YXWD 2W6ID 1K1OA 4JYTA 2EY4C 1EPTA 3F2GA 2ZDNA 1B5GH 2FTLE 1HFDA 1V2RT 1GPZA 2F9BH 1O0DH 1FY8E 3HGPA 3MH5A 1TGTA 1MTVA 1TPAE 1UTMA 4FVBA 4MQAA 2CN0H 1XVMA 4BANB 1ESBA 3MNXA 4TY6A 3N7EA 1HAOH 3LH1A 3OEED 1HRTH 7GCHF 3UOUA 4GHTA 1VITG 4UD9H 1O3BA 2FEQH 1C1OA 1SLUB 5EODA 2ZDMA 1ELCA 3SU3A 5I46H 2NWNA 2BD9A 5H4IB 3PTBA 4DT4A 1AVWA 5HXFA 1BTXA 4WJG2 3P17H 2BY5X 2TBSA 2BB4A 1K1NA 2VIWA 4Q7XA 1C2GA 3RC4A 3D49H 2ZDAH 2B8OH 2QY0B 4FUIA 4AB8A 2SNVA 1GVZA 1TBQH 1UVTH 1V2NT 1UTQA 1MZDA 5CDFE 1TABE 1GVLA 2W26A 2OC8A 2PTCE 3BTFE 3RXQA 1WXRA 1ZSLA 1RFNA 1C2IA 1O2JA 2ZHFH 3MU5A 3RXFA 5DKMA 3F6UH 1CHGA 1BMFD 3OY5U 3T62A 3BG8A 3VG8A 3QWCH 1JOUB 2BDYA 2GZ9A 1GMHF 1ZHPA 2Z3EA 4A6LA 1Z6JH 4I86A 1OSSA 4KTCA 1QTFA 3QTOH 1GI8B 1EP6A 3M3SA 1VCPA 1W11U 4F4OC 3TH3H 3ZZCA 1VGCC 3KQ5A 1QL9A 1UCYE 1BBRE 4CR5A 2R3YA 1RIWC 4K8YA 3RXDA 4M7GA 4UDWH 4XSKU 3ZZAA 2ZPQA 4GAWA 4AZ2B 1IHSH 5EW2H 1NRSH 3BTEE 3UR9A 4F49A 1GG6B 4ESTE 1JIMA 2J92A 3BTGE 3BIUH 2XOKD 3QGJA 1O2WA 3TIUA 4FETA 3F68H 5GXPA 2EQNA 2Q1JA 1QQUA 1TX8A 3KQBA 2FLBH 5DP4A 5CHBA 2XBWA 3SUEA 2OD3B 1ZMJA 1A5IA 5A8ZA 1O5CB 1TRNA 1QNJA 4AYVB 1AI8H 2QF5A 3Q00A 5FBEA 4AG1A 3RMLH 1TNGA
chains in the Genus database with same CATH topology
5FBIA 2LNCA 1A7SA 1QB6A 3ATKA 5C20A 2XCNA 1PQ7A 3A85A 1UVSH 2P94A 2WYJA 2ZGJA 1BT7A 1J8AA 2R0KA 4ZKOU 1BRBE 3ATWA 1UO6A 2CJIA 2GZ7A 4ABJA 1TGBA 2Y7XA 4U2WA 1J9CH 1L1JA 2FDAA 2H5CA 3H7TA 3GDUA 1O3DA 4NFEA 2UUFB 1P06A 3SJ8A 1OWEA 1GBMA 4CHAC 1CU1A 4HTCH 3SV2H 2P95A 2Z9JA 1WU1A 3E0PB 3P6ZB 1AB9B 3K2UA 1F0SA 3QLPH 2HNTC 1P9SA 1GDQA 1PQ5A 2ZEBA 2AMQA 1P2KA 3KIDU 9LPRA 3ZV9A 1Z8RA 4LZ1H 2FI3E 2RDLA 1O2TA 1CO7E 3A7ZA 3Q3XA 4KTSA 4BAOB 2ANWA 2Y7ZA 2FOBA 5F8XA 2W3IA 4WWYA 3ZZ5A 2YOLA 1RRKA 1ELBA 2P8OB 1A3BH 1KTSB 1OWIA 2QN5T 3ZYEA 1CSOE 1IQFA 1C5VA 1TNLA 1JRTA 1KXAA 1C5MD 1BA8B 1C1WH 1CA8B 2UWPA 3EAJA 1GJ5H 1O2IA 1VR1H 1V2VT 1NESE 5C1UA 3UNRA 2BDIA 3PO1B 2XXLA 1UTJA 1E38B 1LO6A 1TMBH 4H6TA 4KGAA 2B0FA 4D76A 4YO9A 1AU8A 1YP9A 1BZXE 1V2TT 3MO3A 4E7RG 1P10A 1GJCB 2Z7FE 3BEUA 3VXEH 3RXKA 2NU1E 4Y79A 3FAOA 1KYNA 2H1UA 4XBDA 4I8HA 1AKSB 2FX6A 3SNCA 2A7CA 3SHCH 2G55A 2Z9LA 2ZFPH 1J16A 2G52A 5DJ7A 1F5LA 2C8ZB 1FAKH 3LH3A 1LPKB 5A09A 4BTIB 3IWMA 1W13U 3U8TH 3UTUH 1HGTH 2JH6D 1DUAA 1LVMA 2ZHQH 5AVDA 1MU8B 4U01A 2ZO3H 2G00A 4ZUHA 1BRCE 5EGMA 1ELTA 1GGDC 1IQIA 4JZEH 3ZVEA 1MCTA 1GBEA 1ZRKA 2SFAA 4K69A 4X6PA 1W0YH 4K3JA 4FUHA 2ZTYA 1AHTH 1XXDA 3GCNA 3SJ9A 1W0ZU 2ZQ1A 3M7TA 4DJZB 4CRAA 1GJ4H 1XVOA 3RXHA 1O2YA 1TLDA 2G81E 1DM4B 1C1MA 3MO6A 4NA8A 1O3GA 3BG4C 5E8EH 2TGPZ 3BEFB 1NU9A 2BQ6B 1DANH 1IQMA 1CBWC 2GCTC 2BLQA 5J4SA 1RD3B 1GBDA 1GDUA 1EP5A 1ZTKA 2Z9IA 1GHAF 1WTGH 2LPRA 1TALA 2GD4B 4ISOA 1BQYA 1UVUH 1MZAA 3QO6A 1AFQC 1C5NH 3GY7A 4NIYA 1QFKH 1TNHA 3SV8A 1IQLA 4B2AA 5EW1H 1KSNA 3ATLA 1O5AB 2QXHA 1KTTB 4ZHLU 1QJ7B 2V3OH 4K2YA 4FUFA 2A31A 4R8TB 4X2WA 2ZU1A 1AWFH 4Y0YE 3U8RH 4X8SH 1SGDE 1O3HA 1MQ6A 2XC5A 4WY3A 1V2KT 1ZMLA 1ZJKA 2F83A 3CS7A 1MKXK 2ZCHP 1DWCH 5L2YH 4AX9H 1ANEA 1DICA 3EYDA 4DIHH 1EZXC 1D3DB 1XKAC 1C4Y2 1K1MA 1O3PB 3ZVDA 1P2MA 1QBOA 4CRBA 2TGTA 2OC1A 1HJ9A 2BDAA 1TMTH 1A2CH 2ZPSA 1EZUC 4BTTB 5FX6A 1PPBH 3A86A 3SV9A 3FZDA 2Y82A 4OS1A 4ZHMU 2VVUA 3S7KB 1AVXA 6GCHG 4O3UA 1P3CA 2WPHS 1YLCA 3KNXA 1VITF 3A8AA 3E16B 2ZF0H 5C67A 1J17T 3UY9A 1TA6A 1K22H 2FM2A 2J2UA 3V13A 3IITA 4B75A 1C4V2 1G37A 3BSQA 2GMTC 3RC6A 4JMYA 3U8OH 4MNVA 1ZHMA 2P3FH 3B8JA 2A4RA 4FU7A 2HALA 3QUMP 1AIXH 3GY2A 2FOEA 1YCPM 4Y7AA 1GI3A 5DK1A 4CRCA 3ATMA 3BTDE 4OS2A 1HJAC 5E2PA 1MTSA 1C2KA 2VIQA 4IC6A 3PLKA 4UFFH 1CHOG 2ZHDA 1GBLA 2ZHEH 3F9EA 1ZJDA 1C1TA 1DY8A 3VGCB 2HLCA 2V35A 3A80A 1UTOA 1Y3YA 1OYTH 2VWMA 5JPMH 4YT7H 1H8IH 2ZG0H 2WUBA 3A81A 1L1NA 4IMQA 1AD8H 3UNSA 2NU4E 1AE8H 4I7YH 1RTFB 2WYGA 1P04A 3LGVA 4ABDA 1AZ8A 1QB1A 4IN1A 2FIRH 1O2NA 1IQHA 2A4GA 1SLVB 4NFFA 1MU6B 2QF0A 3H5CB 5EG4A 2PHBA 1TIOA 1THSH 2AIQA 3UQOA 1S5SA 5ETXA 5ABWA 3RXGA 1ELGA 2WPMS 1NRPH 3RU4T 1C9TA 1O2UA 2G4UA 1ANCA 1N6YA 3MFJA 1FUJA 3NWUA 5DP6A 1O2PA 4AOQA 3SU1A 4MNWA 1O3EA 3K6ZA 4MVNA 3S0NA 1V2LT 2JH0D 1UTNA 2ZFSA 2BMGB 3SJIA 2Q6GA 3RXRA 5JYIA 1WV7H 1CA0C 1QB9A 1FNIA 1O3MA 3MNSA 3PM3A 2JETB 5TCAA 1QURH 3M3VA 1NFYA 1DWEH 1V2PT 1MTUA 2D1JA 3AW1A 1C5WB 4Q2KA 5K7RA 3RXIA 1GMDG 2NU0E 3AAUA 4AB9A 1K2I1 1V2MT 1BDAA 3ZZ8A 5L2ZH 2J4IA 3T25A 5LH8A 4DW2U 1ZTLA 3SW2B 1SGEE 2XBVA 1O39A 1PYTC 3T5FH 3GY3A 1MKXH 5LPRA 1P12E 1LHEH 4X8TH 3HKJB 4B76A 6CHAB 1C5LH 2GZ8A 1DX5M 1YPJH 3SU4A 2A4OA 1WSSH 3KL6A 1A4WH 2SGDE 2O8MA 4AN7A 3LT3A 1BMMH 2XBYA 1OKXA 2BD8A 5TCCA 3ZZ6A 1C5PA 2XW9A 2Q6DA 4A1XA 4Z0KA 1FN8A 1O5BB 5EU8A 2O8UA 1SLWB 1P11E 4CRGA 2GDDA 1GHAG 1O3JA 2AGIX 3SNAA 1FPHH 3QGNB 1Q31A 4ABAA 4WF8A 5DG6A 1HCGA 4BAKB 4MLFB 1C2HA 4Y8XA 1EAXA 1MTNC 1C1NA 3TK9A 2J9NA 1AKSA 4ZKRU 2TGAA 4WXVA 3M61U 3NK8A 1EJNA 1IQNA 3H7OA 2G51A 1SGTA 1ELAA 1YGCH 4NZQA 5GCHG 1SFIA 3FP7E 2Z94A 4ZKSU 4CRFA 1L4DA 1CQQA 1TGSZ 1DOJA 1FY5A 3ZZ7A 4H4FA 1GI9B 4B2CA 1MBMA 4Y6DA 1TMUH 1FY3A 1O34A 7LPRA 2FYQA 1IQEA 2ULLA 4B71A 2ZP0H 5A8YA 4ZROA 1O2RA 2R3UA 1MH0A 1MAXA 3FVFB 2EA3A 1GMCG 5DP9A 1SOTA 5FPTA 3S9BA 4KELA 1HIAB 1H8DH 3A7XA 2RCEA 3GY4A 1Z71A 5FPSA 1QRZA 3LGUA 3RC5A 4Y7BA 3UUZA 5DGJA 3ESTA 2O9QA 1HUTH 3DUXH 4WMFA 2TPIZ 1LVBA 3A84A 4IBLH 2ALPA 1SQTA 5A0AE 3AW0A 4UONA 5AF9H 4OGXA 1FQ3A 3R0FA 1S83A 2THFB 4K1EA 1Y5BT 1QGFA 2C93B 1TPPA 4XFQA 2Z9KA 1D6RA 2A5AA 4ZXYH 2O8WA 2FS8A 5E2OA 1WYKA 3I78A 1ZYOA 2ZDVH 1GCTB 3TVJB 1LPGB 3SU2A 1DT2A 1F7ZA 2PKSB 2AIPA 4K1SA 1HAZB 1BJUA 3GCHB 3OY6U 2A2QH 1BIOA 5C2ZA 2FOHA 2AMPA 3RXBA 2ZU5A 1HLTH 1G30B 3TU7H 2AGGX 5FPYA 1NRRH 1G36A 1ID5H 4RKOB 3VEQB 1NFWA 5HM2A 1C5TA 1TX6A 4BAMB 1IAUA 2VNTA 4O03A 1GJ8B 1Z1IA 4BTUB 1OYQA 2BTCE 3LPRA 3V3MA 1XX9A 2ZTZA 4FXGH 2FYRA 3ZVAA 2H5DA 3DFJA 2AGEX 2ZPRA 2EEKA 4UEHH 3RMOH 1FJSA 2OQ5A 3P8NA 4PROA 4D9RA 2PGQB 1O5DH 2EI7A 2FODA 4SGAE 3GCOA 2IJOB 4ASHA 4IN2A 3MMGA 3L33A 3LGIA 1BMNH 2PW8H 5JBTA 3KGPA 1QHRB 2A4QA 4YOGA 1O5GH 2XC4A 3TGIE 1N1LA 3TK6A 3A89A 1N8OC 1O2SA 1UCYH 1ZPBA 1P3EA 1E34B 2C3SA 1PJPA 5C5NA 4NZLA 1GJ9B 1O3OA 6GCHF 2J94A 1EUFA 1AB9C 1ZGIA 1P2NA 1IOEA 4TY7A 2XYAA 4BXSA 4LZ4B 4X6MA 1T8LA 2FPZA 2G8TA 2VU8E 2WV5A 1TNKA 5FCRA 1XKBC 3SBKA 3MHWU 2ZFTA 4THNH 3DT0H 3SU6A 1H9LB 1SMFE 2FOMB 2V0BA 4HFPB 3RLYH 1QBNA 1O2GH 2P8OC 1P02A 5I25A 1C5YB 3MTYA 3GCTF 3B23B 1UTPA 2BM2A 2BY8X 3U9AH 1LVYA 5HMAA 3BTME 1H4WA 2BVSH 1NN6A 2CV3A 3RXJA 3URCA 1GBTA 2F9VA 1C9PA 4UFDH 1O35A 3IG6B 1Y3WA 1UK2A 1ANDA 3TLOA 4RN6A 2WV4A 3ZZ3A 1L2EA 2BOHB 2AEIH 2F9PA 1CHOF 2F9UA 2BD3A 1HXEH 2ZDLA 2XRCA 4I31A 3M37A 3LC3A 4Y11E 5DP5A 1IQKA 2J34A 2AYWA 1F92A 1BRUP 4D8NA 1HAPH 1WBGB 5JBBS 4ABEA 1K1IA 1YCPK 1K9OE 2OBOA 1IQJA 2ZWLH 1C2LA 4ISHH 3GY5A 1YPHE 5ESBA 3FP8E 2UWLA 3E3TA 3E0NB 4CH2B 3RP2A 5F6MA 3W95A 5ESTE 3VFEA 1AUJA 1DLKB 2A2XH 1YC0A 3RU4D 2YNAA 1P01A 2XTTB 2B5TB 4FUCA 3S69A 1GI0A 2RG3A 2DUCA 3MYWA 4SGBE 3FP6E 2UUJB 1GHZA 1G9IE 1ZGVA 4JCNA 4DVAU 1EPTC 1O2HA 2FI4E 1MTWA 1PPCE 1DE7H 1EKBB 3AAVA 2ESTE 3QTVH 1LDTT 2C8YB 2RA3A 4X0WU 5GWZA 1C5ZB 1YPGH 2BY6X 1C2JA 1CT4E 1SL3A 4TWWA 4ABIA 4E05H 1GBAA 1GMDF 2VH6A 2AFQB 4NWKA 1V6DA 1GBKA 1ZSKA 2Y6TA 3BTHE 1LKBA 3Q76A 4JZFH 3QN7A 3LJJA 3FZZA 2ZZUH 1EAWA 6LPRA 1EJAA 4B2BA 3EQ0H 5E0HA 1TAWA 3PMBB 1SOZA 1KDQA 1HNEE 1BJVA 2Z6BD 4MG3A 2ODQA 3E8LA 1FMGA 4RSPA 1C5RA 2GV6A 2VINA 4AYYB 8KME2 1AN1E 1FN6A 2VGCB 3E90B 3LC5A 3OU0A 3RMMH 1O30A 3NCLA 2BQWB 1MKWK 1O5EH 1ZZZA 5FHTA 9ESTA 2ILNA 3SGQE 2BDBA 2F3CE 2FS9A 1VJ9U 2FOAA 4QT8C 3SU5A 1UHBA 2D8WA 5BRRE 1SC8U 4IW4E 2Y5HA 5FCKA 2ODYB 2I6SA 1C2FA 4FUEA 3HK6B 4LXBH 1Y59T 1ZSJA 2OINA 1DWDH 2DE8A 2WPLS 1SLXB 2BD5A 4XE4A 2FESH 5GCHF 4ZMAH 4K5ZA 3ODFA 1G2LA 2ZGHA 2BDHA 3GICB 3TNSA 1SGRE 3ZV8A 4O97A 1RGQA 7ESTE 1HIAA 5GJ4B 4MTBA 1EX3A 3A7YA 4FVDA 1ELFA 3D65E 2J95A 4DT7B 1PPEE 3BTWE 3KCGH 1SGQE 3A8CA 1SGCA 3SU0A 1QJ1B 3BG4B 2BXUH 1A61H 2HRVA 2OCVB 1CBWB 2FWWA 3TJUA 1GMCF 2GCTB 4FU8A 1G3CA 5T3HA 4D7FA 1BTPA 3B9FH 2BYAX 1PPGE 1ANBA 3RLWH 1VCQA 1UMAH 1SGPE 3ZYDA 1GI2A 3A7WA 1NRNH 1AZZA 1PQAA 1VZQH 2VJ1A 1OWKA 2B9LA 1OPHB 3QK1A 2VIOA 3PLPA 1UJ1A 4R0IA 2GVFA 3MI4A 5L6NH 2BQ7B 2WPJS 1AFQB 1YCPH 4INLA 3GY6A 1XUGA 1GHVH 1ZLRA 5E0JA 1KXFA 2BD4A 1BB0B 5EPNA 1P2JA 1GJDB 1E37B 2ZQ2A 4DY7B 3VGCC 4IMZA 4BOHA 4WH8A 5HYOA 1T8NA 1ABJH 1O5FH 1CE5A 3UREA 1C5XB 3GDVA 4X1PU 4LOYH 8ESTE 3GCTG 1B7XB 1EASA 2HPQH 3D23A 3UWIA 4YZUA 5F8TA 5L30H 1F2SE 1GWAA 2QF3A 1MD7A 2C4FH 1C5OH 2BOKA 2STBE 3QDZB 4XOJA 3SNBA 4YTAA 3A8BA 1GL0E 1V2WT 1CGJE 2BVXH 3A7TA 2XBXA 4FUBA 5C1XA 2PWXA 3OTJE 1V2JT 2FOFA 1L4ZA 1V2OT 3M5LA 1W7GH 2FOCA 3I29A 3A87A 3P92A 3NZIA 1FZZA 3U69H 1SSXA 2VIDA 1O2QA 2Y5GA 5LPFA 1ETTH 1B0EA 3SNEA 3VPKA 1HXFH 1J15A 1JWTA 1FI8A 4JZIA 4VGCB 3RXCA 5LGOA 3VB4A 2K1QA 3PROA 3ZZ4A 1KLIH 3LONA 2AH4X 3PMJA 3N7OA 1GL1A 1PPZA 1O38A 1H1BA 3BTQE 1GCDA 2CHAB 2VVCA 2XC0A 3NPSA 1O3IA 1P09A 1T8MA 2ZFQH 1U6QA 3M36A 4JZ1A 1EB2A 4BNRA 2SGAA 4KP0A 2FI5E 1P2IA 1G2MA 1MKWH 3CENA 1FY4A 1Z8JB 2FZZA 4JYUH 4MPUA 1HBTH 1GHXH 2C8WB 2PUQH 1SQAA 5CHAB 5JB8S 1A46H 1GI4A 3NKKA 1ZR0A 2TGDA 1BMAA 3TJNA 3ZVGA 3VB6A 3S7HB 1HAHH 6CHAC 2HPPH 3LKWA 1HYLA 1QQ4A 2FO9A 3A7VA 4Q80A 4OS4A 4UFGH 1A0HB 1O3AA 2A5KA 3GDSA 1FPCH 1TQ0B