4ESTE

Crystal structure of the covalent complex formed by a peptidyl alpha,alpha-difluoro-beta-keto amide with porcine pancreatic elastase at 1.78-angstroms resolution
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
240
structure length
240
Chain Sequence
VVGGTEAQRNSWPSQISLQYRSGSSWAHTCGGTLIRQNWVMTAAHCVDRELTFRVVVGEHNLNQNNGTEQYVGVQKIVVHPYWNTDDVAAGYDIALLRLAQSVTLNSYVQLGVLPRAGTILANNSPCYITGWGLTRTNGQLAQTLQQAYLPTVDYAICSSSSYWGSTVKNSMVCAGGDGVRSGCQGDSGGPLHCLVNGQYAVHGVTSFVSRLGCNVTRKPTVFTRVSAYISWINNVIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords ELASTASE
publication title Crystal Structure of the Covalent Complex Formed by a Peptidyl Alpha,Alpha-Difluoro-Beta-Keto Amide with Porcine Pancreatic Elastase at 1.78-Angstroms Resolution
pubmed rcsb
source organism Sus scrofa
total genus 59
structure length 240
sequence length 240
ec nomenclature ec 3.4.21.36: Pancreatic elastase.
pdb deposition date 1989-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4estE02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4estE01
4D8NA 3SGQE 2OBOA 3JZ2B 4ZUHA 4E7NA 4K8BA 4AZ2B 2ZPQA 4MDSA 1CGIE 2AMQA 1NC6A 2FOFA 1GI1A 4X2VA 4B73A 1LHEH 2QY0B 2FWWA 4HGCA 2OP9A 3ATMA 5DGJA 3LH1A 1HNEE 3SUEA 1O2XA 2NU3E 4OS7A 3SJ9A 4ISHH 1NRNH 1UVSH 3A8AA 4ISIH 2ZC9H 8KME2 1WSSH 1AN1E 1GVLA 1EZUC 3WY8A 2B9LA 3URDA 3MNCA 3P92A 1O2HA 4DG4A 1GGDB 3CENA 4IGDA 2H5DA 1Z7KA 3QWCH 2QF0A 1SMFE 4I8LA 2FS9A 4JZ1A 5IDKA 3DA9B 1V2WT 3ENSB 4U01A 2UWLA 3KIDU 1GBMA 3RLYH 5E0HA 3IITA 3TGKE 2JETB 5JBBS 3GCHC 1MCVA 1PQ5A 1TWXB 1GG6C 2A5IA 3MU0A 5IYTA 1O3NA 1SGFA 4X1NU 1F5LA 3NZIA 1GBDA 1YP9A 2VWMA 1DSUA 1BTUA 4YO9A 1J17T 2PLXA 1E37B 3W95A 1YPHE 1A5IA 1BRAA 3SV7A 1NFWA 1AFEH 1AZZA 1O2QA 1RGQA 2C3SA 1TYNA 3A7TA 4TYDA 2ASUB 1O2PA 2ZNKH 1F0TA 1DPOA 2KAIA 1IQNA 2GT8A 3NXPA 4FXGH 1D9IA 5A2MH 2TRMA 1LHGH 2A5AA 1FONA 2FS8A 1KXFA 1D6WA 2FI4E 1C1PA 1FJSA 1BTZA 1TGTA 1W10U 2Q6DA 1PPCE 3OX7U 1DUAA 4JZFH 2NU0E 2LPRA 5F8ZA 1C5LH 4X1QU 1BRUP 5C20A 1QL7A 3P6ZB 2IN2A 2WPKS 3RXKA 4NIYA 1MKXK 3RC5A 1O3OA 3M5NA 1TX6A 2G51A 3OSYA 4Y8YA 5F8TA 3RC4A 2FTMA 4I32A 1C1TA 3H5CB 1IQKA 2BD3A 3A8BA 1SQOA 3EGKH 1LHDH 2WUBA 3R0FA 1ETRH 2Y5FA 4PROA 4I8GA 5CHAB 1QIXB 1DWBH 2QA9E 4NGAH 3NKKA 4WWYA 4O3TA 1P2OA 1TGNA 4JYUH 5GCHG 1HCGA 1OS8A 4JZIA 3MNXA 3A7WA 3M5OA 2H6MA 1MD8A 1MTSA 1CT0E 1W0YH 1P2QA 2ZDNA 3TK9A 4IN2A 1AO5A 1RS0A 5GWZA 1K1NA 1V2LT 2OC7A 5HYOA 2ZI2H 4ISNA 1ELTA 1C2GA 1GBKA 2VWNA 1EPTA 1NRPH 2OBQA 1ZRKA 1Y5BT 2W7UA 1TLDA 1UHBB 3QZRA 2XC4A 4J2YB 2AGIX 1MKWK 4ZKNU 1MCTA 2VIOA 1GBAA 5C2ZA 2ZU2A 1QR3E 2UWPA 1EJAA 9LPRA 5C5OA 2G4UA 2PFEA 7ESTE 1C2KA 3MO9A 1ZOMA 4AYYB 1ELEE 4R8TB 2TGDA 3DHKH 5B6OA 3ZVCA 3U8TH 3Q3KA 2GP9B 3VB3A 2ZIQH 1XM1A 3SUFA 1YF4A 3GISB 3SV2H 1KIGH 1ZPBA 2A4QA 1FNIA 2O8LA 4OS4A 2VIQA 4D9QA 4Y79A 1CA0B 2GCHG 4WMEA 2PTNA 1EXFA 1CSOE 3E91A 3GCTF 1PJPA 4D9RA 2GZ8A 1FY8E 1K1MA 1WU1A 3QK1A 2P95A 1WOFA 1Y5AT 5EODA 3SJOA 2ANMH 1SHYA 1YPLH 3GICB 1O31A 1V2OT 1T8LA 3PROA 3F9FA 3A84A 1FY4A 2BLWA 1C5WB 3SUGA 1T31A 2F91A 4AFSA 1QL8A 4Q7ZA 3UY9A 3ODDA 5C1UA 3TH3H 2BY8X 4Y7BA 2XCNA 3BIUH 1D3TB 1P2NA 1GCDA 1GHAF 3AASA 1HUTH 2C4FH 2CHAC 1JWTA 1QURH 4NA7A 1ZZZA 1GBLA 3STIA 1NPMA 1K22H 1VITH 3P8GA 3B23B 3I29A 5FHTA 2BLOA 4OGXA 2R3YA 2OQUA 3A8DA 3SW2B 1P3EA 4UFFH 4TPIZ 1HAIH 1TBRH 1W13U 1W8BH 3ESTA 4NA9H 1AGJA 4FUCA 2FPZA 4D7GA 2VVVA 3PB1E 3P95A 4JZEH 1HAVB 1EASA 3F9EA 3BN9A 3D23A 1AVWA 3GY8A 1LKBA 1E34B 1MTVA 1ZLRA 3EYDA 4NSYA 4F4OC 2ZFQH 2P16A 1FAKH 2YNAA 3QUMP 8LPRA 3VB5A 1XUGA 3KF2A 5T3HA 3MFJA 3QZQA 3ZZ8A 5EU8A 2BD4A 1QQUA 2P8OC 1O5EH 3LONA 1C5VA 1MKXH 2HPQH 1AI8H 4AB9A 2ZU1A 1ESTA 1LVBA 4K1EA 1O3GA 4X6MA 1K1PA 2VNTA 2ZDVH 2ZEBA 4H42U 3PLKA 1O37A 3SGBE 4NZLA 1VZQH 1VJAU 6CHAB 4MVNA 1HLTH 3MH7A 4H6TA 4X8VH 4H6SB 3A88A 1F5KU 3BEIB 5FPSA 1KXCA 3MI4A 1Y3UA 1RRKA 1GMDG 2Q1JA 3ATIA 1P04A 1EB1H 1ZHRA 1C9PA 1OP0A 1BZXE 3T62A 1P9SA 3T2NA 1GJCB 5FCKA 4TWYA 3A7ZA 1B7XB 2VIDA 3RDZA 1ZSKA 1HJAC 1YPHC 4UFGH 4Y7AA 1QHRB 1UK2A 3EA9A 2TGPZ 4FVDA 4A1VA 2FIRH 1WUNH 1SI5H 1TMBH 2J9NA 3RU4D 2RA0A 1QA0A 3Q00A 3RXEA 1WQVH 1TBQH 1EQ9A 3TPIZ 3TNSA 1KDQA 2H9TH 2ZF0H 2OCVB 2ZFFH 2XBVA 4YTAA 1MKWH 3PLPA 4DVAU 4AFZA 3KQCA 2QV1A 3VPKA 2Y82A 2H9HA 2R0KA 4Y8ZA 2QIQA 3TITA 3BTTE 2BQWB 5C3NA 3SV6A 4WF8A 5A0CA 1DX5M 1F2SE 2A4GA 5C5NA 1THRH 4AG1A 4CRFA 1V2RT 4YT6H 2BOHB 4ZXYH 9ESTA 3LIWA 3GCOA 1V2KT 4BTUB 5PTPA 3GCNA 1KXEA 1JXPA 3OTJE 1AVGH 3OY5U 1QFKH 1L2EA 3SHCH 4ZKOU 1XXDA 3SNDA 3VB7A 3M7UA 1C5SA 4Y76A 1BHXF 5I25A 1JIMA 4HTCH 1GCTC 1TALA 2JKHA 3PMJA 1C2JA 5BRRE 1E38B 1V2QT 2BOKA 1TB6H 1T8MA 1LO6A 2HWLB 1VGCC 4DGJA 1O3DA 1VJ9U 1BJUA 1C5ZB 1K1IA 1K9OE 2GV6A 4MG3A 4TWWA 1MD7A 1Y5UT 1XUIA 4WXVA 2FTLE 1TGBA 3SJKA 3ZVAA 2FOAA 4B76A 2CGAA 3GCHB 1SGPE 4MTBA 4JYVH 1GJ6A 3VGCB 1IHSH 3ZVBA 1L4DA 1ZPZA 1C2EA 4K60A 1HDTH 2BDYA 3TIUA 2F9NA 2WINI 4DY7B 1THPB 1ZMJA 2PGBB 5DK1A 2VH6A 1BMMH 1P02A 1ZMLA 1AY6H 1ZR0A 3K6ZA 5AVDA 3VXFH 1UTMA 2K1QA 5FX6A 5A0AE 6GCHG 5EQRA 2GCTC 1GPZA 2NWNA 3ZYDA 5LGOA 1NRSH 4RSPA 4ZHLU 2BDCA 1SOZA 5GCHF 1OX1A 1EZQA 1GL0E 2ZHWH 5FPTA 2H1UA 3V13A 1HRTH 1SLVB 2BD2A 3T28A 1LHCH 1O2JA 3SU3A 2ZU3A 1ANDA 4I33A 3RXVA 3ZVEA 1QJ6B 2CF9H 2ZQ1A 1BIOA 1V2NT 3SNEA 1CGHA 2R9PA 1Y8TA 1GBIA 1AMHA 3RM0H 3SU5A 4CHAC 2VGCC 1O5CB 1S85A 4ABDA 1HB0B 1DY9A 3KGPA 2BDGA 2Z9JA 4IW4E 3EA7A 5K7RA 3M3SA 3L3TA 1DFPA 2FOBA 4LZ4B 1GHXH 1NS3A 2YOLA 1O3BA 2FYRA 1BTXA 3LJJA 4DW2U 2ZCHP 1P8VC 2WPJS 4Y0ZE 6ESTA 1BBRE 1HFDA 1RFNA 3UIRA 1LVYA 1N8OB 1UK3A 2O8WA 2SFAA 5E2OA 3BTEE 3IWMA 1SGTA 1HAOH 1ARCA 2BVXH 2STBE 3HATH 1G30B 5JB8S 4A1XA 1VITG 3TJUA 3RXTA 1A3EH 4DCDA 3STJA 1NU7B 1WQSA 2GVFA 4R0IA 4ZKSU 1HXFH 3UREA 1FN6A 1F0UA 2XBYA 4INKA 2F9PA 1NU9A 2Z3CA 4ABFA 5DP5A 1GHYH 3HGNA 1BOQA 1G3BA 1NRQH 3L6PA 2GCHF 1S83A 3SV8A 2F9VA 3LC5A 5EOKA 2BY5X 5F6MA 2HLCA 3QN7A 5LPEA 2TGTA 2WPHS 1ZHPA 1UTQA 3GDSA 2BYAX 1EOJA 1GVKB 5CMXH 4E06H 4XSKU 1O3CA 1IQIA 1FV9A 1KLIH 4OS2A 2QCYA 1PQ8A 1C5UA 1BQYA 2FX6A 2NU2E 1PYTD 2A7CA 1C1MA 1L1NA 1C1SA 2WPIS 1HBTH 3KQBA 3PYHA 1BITA 4LZ1H 4DJZB 1CBWB 1B0EA 1MTUA 3T25A 5T6FA 1WBGB 1EP5A 1Z1IA 4CRAA 3C27B 3PV4A 1YCPM 3AVZA 2J38A 1GBFA 1NRRH 4K69A 3GY4A 1MTWA 4MQAA 1DXWA 1TNIA 3SU0A 1KSNA 1C5RA 1ZMNA 2UWOA 1CE5A 1OWIA 1DITH 2ALPA 2F9UA 3KCGH 1SPJA 3FZDA 5L2YH 3E16B 1K2I1 4WY3A 2XWAA 2ZHQH 1C5YB 5AF9H 1NO9H 3U8OH 2XBXA 5E2PA 4A6LA 1IQEA 1OP2A 5FBIA 1ZTLA 4GPGA 2CHAB 2PUQH 3BTFE 4YESB 1EJMA 5ESTE 4ABIA 7LPRA 5F8XA 4DIHH 1N6YA 1P3CA 2JH5D 2XYAA 3PMBB 1HPGA 1QCPA 1YBWA 2ZHEH 1C2MA 4ZMAH 1P01A 3SGAE 3VXEH 1GBCA 2UUYA 3RXBA 2ZTXA 2R2MB 1A0HB 1V2JT 4B2BA 3RC6A 5SGAE 5E8EH 1AIXH 4KKDA 1XUKA 2G4TA 1XKAC 4XOJA 1P9UA 1Z8GA 1C1VH 1P03A 3UNQA 1W7GH 5I46H 2R2WU 1TPPA 5LPFA 4E7RG 3K2UA 2A0QB 1GMDF 2HVXA 1TAWA 3U1JB 5T6DA 1TNKA 8GCHG 3U8RH 3BTHE 2XW9A 3TJNA 4B2CA 1CT4E 2AFQB 3ATWA 1P12E 3BG4C 1ORFA 2GV7A 4X2XA 1EPTC 5DP8A 4GVUA 4H4FA 4KTSA 2UUKB 1S0QA 1N1LA 3UNRA 1TRMA 1AB9C 3RP2A 3F1SB 3BTDE 3MU4A 4VGCC 3ZZAA 1MU8B 1P06A 1TRNA 4GSOA 1O3JA 3TGJE 2OD3B 2BZ6H 5EGMA 1K1JA 4X6OA 2GMTB 4AORA 3UTUH 3RMLH 1DANH 1QBOA 3FP6E 2FXRA 1JBUH 1V2PT 1SLXB 1S82A 1GMCG 2JH0D 4FVBA 3SU1A 2FYQA 3UQOA 1EZXC 5FPYA 1XXFA 1SQTA 3UR9A 3F6UH 5DP9A 5JYIA 1O2ZA 2YNBA 2BHGA 3M5MA 4UDWH 2XRCA 3NK8A 3LDXH 4X6NA 1SB1H 4Y10E 2BZAA 1ID5H 4CH8B 1T4VH 2HRVA 3SNCA 2Y7ZA 1S0RA 2W7SA 2BXUH 3RXMA 3PMHB 3RLWH 6LPRA 1UO6A 2FM2A 5F03A 1AU8A 2B8OH 2C93B 2QXIA 2VIPA 3G01A 1D3PB 2PSXA 1PPGE 2EEKA 3O8DA 1C1RA 3MO3A 4B1TA 1P0SH 1MZDA 4OGYA 4X1SU 2VVUA 4K1SA 4XFQA 2ZGBH 1UTOA 3TJOA 2Z94A 5EPYA 4BTIB 3HK6B 1A5HA 1P57B 2FEQH 4ASHA 1EAIA 1TPOA 1HAPH 1GBJA 1O2UA 2Y6TA 1ZSJA 1EATA 2G52A 3Q3XA 4FUGA 1UTNA 1SLWB 2GKVE 4IC6A 4ABHA 1ELFA 3TGIE 1HAGE 2OTVA 1ESAA 1MUEB 4K8YA 3LKWA 3KQEA 1GJ4H 1TNLA 1D4PB 3T27A 1TPSA 5FX5A 1BB0B 2RCEA 3LGWA 1A3BH 3QGNB 1HV7A 3GYLB 3H7TA 3TJVA 3A83A 4FU7A 5DP7A 6GCHF 3P17H 1BCUH 1T32A 2C8XB 4AOQA 3A82A 1PQAA 2A31A 1CA8B 3MNBA 3ITIA 1OWHA 1O3MA 5A8XA 4NIVA 3LT3A 1MTNB 2A32A 1KYNA 2V35A 1A0LA 2A4RA 2ZA5A 1KXDA 1ELAA 2Z6BD 3MOCA 1DS2E 1FPHH 1C4Y2 3SBKA 3FZZA 2OINA 4XBDA 3A81A 1AE5A 1NN6A 4WJG2 3ZVDA 1W14U 1Z8JB 4KELA 4Y71A 3T5FH 4BXSA 4UONA 1Z8RA 1DLEA 2OUAA 3QLPH 3PMAB 1ZSLA 1DWCH 1G9IE 2H5CA 4DOQA 2XC0A 1J8AA 2V3OH 2ZPRA 2HALA 1JRSA 1DSTA 3UUZA 4YLUA 3AW1A 2AEIH 3CS7A 1UJ1A 3FVFB 1QRZA 1LPGB 4NZQA 5JBAS 3Q76A 2ZCLP 1DE7H 1MMJN 3FP7E 1EUFA 1GGDC 5EXNA 4IBLH 2ILNA 4DIIH 1CHOG 1BT7A 1UTJA 4ABAA 3D65E 1GI9B 1QRXA 4AB8A 1TQ7B 3ATLA 2HNTF 4UEHH 1ETTH 4LOYH 1O0DH 2AIPA 1SLUB 1G3DA 1C2DA 1SSXA 5DPAA 1O3AA 1VITF 2AMDA 1A4WH 2JETC 2VINA 1GDQA 4IMZA 1J15A 4CRBA 1PPFE 2GT7A 4ABBA 1C2HA 2PKAB 3VFEA 2HGTH 1VCPA 3E0NB 2ZGJA 2QGRA 3S0NA 1ZRBA 3LGUA 3UNSA 3SV9A 5HGGA 2ZGHA 3UFAA 4I8KA 1GI6A 1OP8A 3BTGE 1YPEH 1EJNA 1AKSB 3GDVA 2R3UA 1C4V2 1THSH 1UVUH 1AFQC 1TPAE 1S84A 2FMJA 2O8TA 4NWLA 1LMWB 4CBNA 1G32B 3E8LA 1G3EA 3B8JA 1XVOA 1O2YA 1IQJA 1Z8IB 2XBWA 2ZTYA 1HJ9A 2F9OA 1SGDE 3K65B 4AGJA 4FUIA 1JMOH 3F9GA 1HYLA 2Z9IA 3MU5A 1ZGIA 1FN8A 1QQ4A 2G5NA 1B5GH 2FOMB 3ZZ4A 3RXSA 1MQ6A 3ZYEA 1MH0A 2GTBA 4ZH8A 3GY3A 2C90B 2FP7B 3MU8A 3M5LA 2FX4A 2J4IA 2FESH 3KQDA 1BTPA 4XBBA 4AYVB 5CHAC 1EZSC 4U30A 3LOXA 1C1QA 2ZDMA 4BTTB 1RIWB 4A7IB 2VWLA 3UQVA 1DT2A 2ZGXH 4OS1A 5EG4A 1OWDA 1IQFA 2BLVA 1BRBE 4IN1A 3RXUA 4I7YH 1TGSZ 2IJOB 1WCZA 2ZZUH 1SR5C 1JOUB 3EDXB 1QB6A 4NSVA 3MMGA 1VR1H 2LNCA 4AX9H 3K6YA 1XUHA 1LDTT 5A0BA 1FUJA 3FP8E 2BDIA 3S7HB 1GVZA 2VU8E 4JK6A 5JB9S 4B71A 4E05H 1SGIB 1FAXA 2A4OA 3RXFA 1C9TA 3Q3YA 3BTME 4MNXA 1FPCH 1AHTH 2CJIA 1D3QB 1V2ST 1QJ7B 4KGAA 1T7CA 5DO4H 3BEFB 2THFB 3GYMA 3LU9B 2KAIB 2ALVA 3PLBA 3GY2A 3P8OA 3RU4E 4DT7B 4ABJA 3OY6U 2J95A 2H9EH 4SGBE 5C67A 3DFLA 2XTTB 1F92A 2GZ7A 4CRCA 2GD4B 1TX8A 2ANYA 3I77A 1XX9A 1C4U2 3M3VA 5E0JA 5HXFA 2OC0A 3SHAH 4WMFA 1XMNB 1GJBB 2ZQ2A 4TY6A 2BY6X 2ZU4A 2C8ZB 2BDHA 4BOHA 2BD5A 3BEUA 8GCHF 1Y3WA 1BBRK 4ABGA 1GI7B 3QO6A 5JBCS 5EW2H 1ELCA 4QT8C 3SJIA 1DXPA 1P05A 1TRYA 2Y5GA 3SJ8A 1OSSA 2I6QA 1CT2E 5EXLA 1GG6B 1UHBA 2PUXB 3RXAA 3NUMA 4U2WA 4CRDA 5LH8A 4FUBA 5DP3A 5EQSA 1NY22 1CA0C 1K1LA 2V3HH 3RXJA 4K2YA 4YZUA 2Q6GA 1L1JA 2SNVA 4ZKRU 3TNTA 3M61U 5GXPA 2GDDA 1DM4B 2BX3A 1BUIA 2CV3A 1ZPCA 4Q80A 1DICA 3P8NA 4AFQA 1IAUA 1TA2A 1E0FD 4XBCA 1GMCF 2BVRH 1EX3A 3SQEE 3OU0A 4K5ZA 1YPMH 2O8MA 3A7VA 5HMAA 1C5PA 1V2MT 1T4UH 3BV9B 1Q31A 2QAAA 1Z6EA 1GI8B 1WTGH 3RU4T 4IS5A 1O5DH 4TPYA 1AE8H 1IQMA 3DFJA 3BG8A 5LPRA 1UCYE 3RXLA 1NFUA 2BY9X 3SU2A 2B0FA 2AIQA 3ZZ3A 2OC1A 1RTFB 2ULLA 5GPIB 4NCYA 1ZTJA 3RXRA 2IPHA 1FXYA 1PQ7A 3W94A 1ZGVA 4DURA 1SGCA 1W0ZU 1ZJDA 4X0WU 4I8JA 1O5GH 2BTCE 3R3GB 1U6QA 4BXWA 1P09A 3ZZ5A 1Z6JH 4Q7XA 7KMEH 2PR3A 3BTKE 1NZQH 3D49H 1E36B 1TQ0B 1C5MD 1C5QA 1H9HE 3FAOA 3RXCA 3O8CA 3SZNA 1GHBG 2WYGA 1AWHB 1O32A 1PPEE 1IQLA 5J4QA 2P3TB 1V2UT 4B2AA 1O2LA 3MHWU 3MNSA 2ZGCA 1OPHB 1RTLA 2EA3A 3MO6A 1SBWA 3F68H 4ZHMU 4Q7YA 1O30A 1NESE 1ZHMA 1YM0A 2CN0H 2Z7FE 4CR5A 1DWDH 1UTLM 1SGYE 3ZZCA 4BANB 5H4IB 1FLEE 1SHHB 1D3DB 1EB2A 4A1TA 1ANBA 1UMAH 1SGRE 4ISLA 2JH6D 3RMMH 1QB9A 2VJ1A 1W12U 1P10A 2FI5E 2Y80A 2W5EA 3LJOA 1O35A 3TVJB 1QBNA 4GLYA 1J9CH 1O3LA 1GMHG 6CHAC 4O3UA 2DUCA 4NFEA 3RMOH 1LVOA 1FY5A 1QNJA 1HAVA 4NIWA 1GHVH 1DOJA 1UTKA 1UVTH 3SI4H 1ZTKA 3ELAH 1O2SA 1XUFA 3AAUA 1QL9A 1ANCA 1GJ5H 3V3MA 1GBTA 1G37A 5J4SA 2BDAA 1TIOA 2V0BA 7GCHG 1QGFA 2A2XH 2P94A 3GY5A 1INCA 2XXLA 2PSYA 1QBVH 1XKBC 1TBZH 2GDEH 1KTTB 1GJ8B 1BTHH 2AH4X 1L4ZA 2WPMS 1G3CA 1DDJA 4GHTA 1Z71A 2UUFB 4IC5A 2FOGA 1P2KA 3Q77A 1TONA 3EAJA 2PKSC 1P11E 3V12A 2WV4A 5TCCA 1ANEA 4CBOA 4ZROA 1FZZA 1CHOF 2ODYB 3ZVFA 1XVMA 1X7AC 3PM3A 3TK5A 1QTFA 1OWJA 2CXVA 5C1YA 3N7OA 4X2YA 1SVPA 2Q6FA 1K1OA 3DUXH 5DJ7A 3U98H 1NM6A 1O36A 2PWXA 3NPSA 3ATKA 1C5NH 1BMLA 1BBRH 1SQAA 2WV5A 4MPXA 2ZDAH 2A2QH 3GY7A 1FDPA 1KY9A 2A7JA 2BXTH 1TFXA 4CREA 1G2LA 2RG3A 4KTCA 1Q3XA 1BTWA 4AG2A 2IOTA 2R0LA 1FY1A 1FIZA 2WUCA 4CH2B 5TCAA 1W7XH 3M35A 3A86A 1H1BA 2PW8H 1BTYA 2VH0A 1P2JA 2ANWA 1O2TA 1RD3B 1HAXB 5DP6A 5GIBA 3O8RA 3VGCC 3NWUA 4D76A 1V6DA 3SN8A 1DWEH 3MH6A 1GI2A 1TOCB 4I8HA 2P8OB 1CVWH 1KDQB 2F9BH 3A85A 1KTSB 3D62A 1KXBA 2B5TB 3FANA 2FZZA 1O39A 3SQHE 1CU1A 1IQGA 3LC3A 4GCHG 4CRGA 4MNYA 5K0HA 1AFQB 3MYWA 1CGJE 1QRWA 3PO1C 3BTWE 2QXJA 1XUJA 4X2WA 1LHFH 1B0FA 2XCFA 3LH3A 5EXMA 1C1UH 4M7GA 2QXGA 1O2OA 2SGEE 2BMGB 4JCNA 1GJ7B 1DUEA 1SGFG 2ANKH 2FOCA 2BX4A 3HK3B 4MPVA 4U32A 1MQ5A 1HJAB 2D26C 1QA7A 5EW1H 4XE4A 3AAVA 3H7OA 3RXGA 5T6GA 3HKIB 1OKXA 1A46H 4Z6AH 1AVXA 3F9HA 5DG6A 4NWKA 1L0ZA 2P3UB 1O2NA 2O8UA 1VCQA 1ELVA 1QB1A 2F83A 2PV9B 3MTYA 1O2IA 1GI3A 1O5FH 1T8OA 2HNTE 1O38A 3HGPA 2QXHA 3LGIA 1O3KA 1L1GA 4OS6A 4YM9A 4HZHA 1AQ7A 4UD9H 1J16A 1OWEA 2ZFPH 1MBQA 1N8OC 5CE1A 1TOMH 4Y11E 1KLTA 1GWAA 4ABEA 4ZXXH 2SGDE 4YOGA 1BRCE 3S69A 1D6RA 3A87A 3VEQB 1ELBA 1V2VT 4FUEA 2EC9H 3NCLA 2G55A 5A09A 2O9QA 5JDUB 2ZDLA 4RKOB 3PTBA 2BM2A 1V3XA 1TNGA 1C5OH 2W26A 1TNHA 2P93A 1BMNH 5FXLA 3U1IB 1C2LA 1H8DH 1GCTB 1S6FA 1P2MA 4AFUA 3PWCA 1C2IA 3S9CA 1O2MA 3RXDA 4Y6DA 2EI8A 2ZCKP 4A5TS 1WV7H 1O2GH 1TMUH 1UVPA 4FU8A 1GJDB 4ZHAA 2XNIA 1C5TA 2FDAA 1VGCB 4X1RU 4AGKA 3EE0B 2F3CE 3KNXA 2FI3E 1W2KH 1O5BB 5TJXA 2J2UA 4B74A 1HAZB 3C1KA 3URCA 1VCWA 3SI3H 2VVCA 1K28D 3TU7H 3O8BA 1G36A 2QF3A 3A8CA 3LGVA 1NFYA 3U69H 1GJAB 2ZKSA 1J14A 1A0JA 1SFQB 4J1YA 1CBWC 1F5RA 4FUDA 1BA8B 4WXIA 8ESTE 2AGEX 2DE8A 1EKBB 2G00A 2PTCE 1ABJH 2FO9A 4NIXA 3SU4A 4YLQH 1C5XB 1TA6A 1GBHA 2AERH 2BDBA 2VWOA 4LXBH 3ZZDA 2GCTB 5ESBA 1EP6A 4YOIA 1HAYB 2PHBA 3DD2H 5EPNA 4HFPB 5ETXA 2TIOA 2Z9KA 1O2VA 1RXPA 4LK4A 2P59A 5AFYH 1OOKB 3P8FA 1GHBF 1GHWH 1SGQE 3TLOA 1AZ8A 3ZV8A 3RMNH 1GBEA 1NFXA 3E6PH 1DLKB 1LCYA 2H2ZA 3VB6A 1QY6A 2A45B 4CHAB 2TBSA 1HIAB 4UFEH 2BY7X 2VGCB 1WYKA 2BLQA 3B9FH 3CP7A 3KL6A 1O2WA 1C1OA 2ODQA 3T26A 4INHA 2RA3A 2SNWA 1LPKB 4K3JA 1W11U 1SOTA 3M37A 4X8SH 1GJ9B 1YGCH 4NFFA 4KTUA 3GOVB 3UWIA 1C1NA 3M3TA 1GMHF 4IMQA 1HJ8A 4BAKB 2SGAA 5L2ZH 1S6HA 1BJVA 1UVOA 2BVSH 2FOEA 1ZYOA 4MPWA 1PYTC 1EAXA 2Z3EA 2P3FH 3P70B 1F0SA 1A2CH 5AFZH 1A61H 3LGTA 4WMDA 1T8NA 1LVMA 5E0GA 7GCHF 5L30H 3PWBA 2AS9A 3E90B 1H8IH 3MH4A 4WH8A 4JZDH 2FOHA 3SNAA 2ZDKA 1MU6B 4D7FA 1Y3YA 3PTNA 1YCPK 3M7TA 3A89A 4WH6A 3AW0A 3SO3A 2BD9A 4MNWA 3RXQA 1O34A 3L33A 4NA8A 2ZECA 5FCRA 1BHXB 4O9VA 1UK4A 1AUTC 1NTPA 3LGYA 4JYTA 3VB4A 2VB0A 4X6PA 2G8TA 3TK6A 4INLA 5A8ZA 2GMTC 2NU1E 4F49A 1A5GH 2BD7A 3QGJA 5A8YA 2Y7XA 1FIWA 1MBMA 3QDZB 2HPPH 4GHQA 1H9LB 2C8WB 4ESTE 1EAUA 4GUXA 3EA8A 1K21H 3TH2H 1Z1JA 2G5VA 1DY8A 2VIVA 1HXEH 3RXIA 3SNBA 3SU6A 1OXGA 4FUJA 3RUOA 1GI5A 1MAYA 3U9AH 2WYJA 1BMAA 1H9IE 2VIWA 1YYY1 2GZ9A 3UPEA 1ARBA 1YPGH 2ESTE 5L6NH 1YKTA 1O3PB 1RJXB 2G81E 1UCYK 1LQEA 2PKSB 1MZAA 2ZFSA 3DT0H 2TPIZ 1CQQA 2M5TA 5C1XA 1F7ZA 4WVPE 3ZV9A 1IQHA 3OYPA 4GAWA 3BSQA 4MPUA 2D8WA 1SFIA 2W3IA 2GGVB 1MAXA 3LPRA 4K1TA 4O97A 1TMTH 4Y0YE 2ZP0H 1ETSH 2FLBH 1EAWA 3KEEA 4RN6A 1P2IA 2RDLA 3CS0A 2J92A 1JRTA 2EI6A 3UWJH 3BF6H 4FU9A 2HOBA 1GL1A 1Q2WA 1AD8H 4HI3A 3EQ0H 1ABIH 1GDUA 1SC8U 2ZWLH 1Y3XA 1OYQA 3MU1A 3UOPA 2HNTC 5FBEA 4ZAEA 3UR6A 1GI4A 2ZG0H 3TH4H 4BAQB 4GCHF 1HAHH 4YOJA 1O3IA 5DP4A 5G4BA 3E1XB 1DVAH 3MWIU 1WAYB 3KHVA 1ELDE 1NT1A 4CR9A 4BAOB 1NROH 1KXAA 2XWBI 3S9BA 1JIRA 1ACBE 1TGCA 1F0RA 5EQQA 1OWKA 3GY6A 2Z3DA 5FAHA 3FFGA 1MTNC 2SGFE 2PGQB 1UTPA 2FLRH 5GJ4B 2D2DA 2B7DH 5DKMA 4O03A 4I31A 2AMPA 1AWFH 1O3HA 2QC2A 4SGAE 2A1DB 1A7SA 4KP0A 4BAMB 1GI0A 2ZTZA 1GBBA 4Q2KA 1SG8B 1TNJA 1PPZA 3BG4B 2V6NA 1AUJA 1LQDB 1SGNE 2ZHFH 3ODFA 1EPTB 2ZFTA 4OS5A 2ZHDA 3E3TA 4FUFA 3K9XB 3M7QA 1O3FA 2EI7A 3RXPA 2OLGA 3S7KB 4THNH 3JZ1B 3PO1B 1AB9B 2D1JA 4Y8XA 1YLDA 4VGCB 2AGGX 1ESBA 1H4WA 1LTOA 3GCTG 3ZVGA 1YC0A 3E0PB 1O33A 1YPKH 5BPEA 3T29A 2BB4A 2Z9GA 1YLCA 3KN2A 2Y5HA 1O5AB 2NU4E 1FMGA 1ELGA 1FQ3A 4FUHA 5ABWA 3QX5H 5AHGH 3V0XA 4MNVA 5JPMH 1M9UA 2XC5A 1Y59T 3MH5A 1N6XA 1RTKA 1YPJH 2STAE 2TGAA 4X8TH 1ZJKA 1GHAG 1KLJH 2W3KA 3GDUA 4UE7H 3BIVH 1IOEA 2QN5T 1E35B 2A5KA 1C1WH 1PPHE 2ZU5A 4UFDH 1EOLA 1CO7E 2SGPE 4JK5A 1TABE 5HM2A 1FY3A 2OC8A 4MLFB 3V7TA 1GDNA 1HGTH 4A92A 2SGQE 1G2MA 2OQ5A 2Y81A 4TY7A 1TE0A 2J34A 1WTHD 1S5SA 1FI8A 2ODPA 1TX7A 1YCPH 5JBTA 4YT7H 2OXSA 2C8YB 2FODA 3BTQE 3QTVH 3HKJB 2BQ6B 4RKJB 1LPZB 3I78A 2UUJB 3RXHA 3HPTB 4NG9H 1LKAA 1BDAA 2I6SA 3M36A 1Y3VA 1HIAA 4BNRA 2BD8A 4ISOA 4AN7A 5HM9A 2GX4A 1SL3A 2AYWA 2PKAA 3RXOA 2Z9LA 3ZZ6A 3QTOH 2ZFRH 3SOSA 1C2FA 3SORA 2BQ7B 1O2KA 2QYIA 1S81A 2CMYA 2A7HA 2CF8H 1V2TT 1O3EA 4X1PU 3UOUA 1AKSA 1A1RA 1IHTH 3A7YA 4B75A 3A7XA 4JMYA 1RIWC 1SGEE 5GDSH 3ZZ9A 1UCYH 4XDEA 1CHGA 2WPLS 2ZO3H 3ZZBA 3IG6B 4X8UH 1PPBH 3S9AA 3RM2H 1W3CA 1PFXC 3ZZ7A 1O2RA 2DE9A 3SUDA 4BAHB 2ZPSA 2J94A 3A80A 4Z0KA 1OYTH 1QJ1B 1GHZA
chains in the Genus database with same CATH superfamily
4D8NA 3SGQE 2OBOA 3JZ2B 4ZUHA 4E7NA 4K8BA 4AZ2B 2ZPQA 2EY4C 4MDSA 1CGIE 2AMQA 1NC6A 2J5UA 3N7DA 2FOFA 1GI1A 4X2VA 4B73A 1LHEH 2QY0B 2FWWA 4HGCA 2OP9A 1SKYE 3ATMA 5DGJA 3LH1A 1HNEE 3SUEA 1O2XA 2NU3E 1MABB 4OS7A 3SJ9A 2XOKD 4ISHH 1NRNH 1UVSH 3A8AA 4ISIH 2ZC9H 8KME2 1WSSH 5C0TA 1AN1E 1GVLA 1EZUC 3WY8A 2B9LA 3URDA 3MNCA 3P92A 1O2HA 4DG4A 1GGDB 3CENA 4IGDA 2H5DA 1Z7KA 3QWCH 2QF0A 1SMFE 4I8LA 2FS9A 4JZ1A 5IDKA 1VKYA 3KYGA 3DA9B 1V2WT 4XRNA 3ENSB 4U01A 2UWLA 3KIDU 1GBMA 3RLYH 5E0HA 3IITA 3TGKE 1E1QD 2JETB 5JBBS 3GCHC 1MCVA 1PQ5A 1TWXB 1GG6C 2A5IA 3MU0A 5IYTA 1O3NA 1KMHB 1SGFA 4X1NU 1F5LA 3NZIA 1GBDA 1YP9A 2VWMA 1DSUA 1BTUA 4YO9A 1J17T 2PLXA 1E37B 4B6EA 3W95A 1YPHE 2LELA 1A5IA 1BRAA 3SV7A 1NFWA 1AFEH 1AZZA 1O2QA 1RGQA 2C3SA 1TYNA 3A7TA 4TYDA 2ASUB 1O2PA 2ZNKH 1F0TA 1DPOA 2KAIA 1IQNA 2GT8A 3NXPA 4FXGH 1D9IA 5A2MH 2TRMA 1LHGH 1NBME 2WZQA 2A5AA 1FONA 2FS8A 1KXFA 1D6WA 2FI4E 1C1PA 1FJSA 1BTZA 1TGTA 1W10U 2Q6DA 1PPCE 3OX7U 1DUAA 4JZFH 2NU0E 2V3MA 2LPRA 5F8ZA 1C5LH 4X1QU 1BRUP 5C20A 1QL7A 3P6ZB 4Z1MD 2IN2A 2WPKS 3RXKA 4NIYA 1MKXK 3RC5A 1O3OA 3M5NA 1TX6A 2G51A 3OSYA 4Y8YA 5F8TA 3RC4A 2FTMA 4I32A 1C1TA 3H5CB 1IQKA 2BD3A 3A8BA 1SQOA 3EGKH 1LHDH 3F2HA 2WUBA 3R0FA 4XD7D 1ETRH 2Y5FA 4PROA 3OFND 4I8GA 5CHAB 1QIXB 1DWBH 2QA9E 4NGAH 3NKKA 4WWYA 4O3TA 1P2OA 1TGNA 4JYUH 4RI0A 5GCHG 1HCGA 1OS8A 4JZIA 3MNXA 3A7WA 3M5OA 2H6MA 1MD8A 1MTSA 1CT0E 1W0YH 1P2QA 2ZDNA 3TK9A 4IN2A 1AO5A 1RS0A 5GWZA 1K1NA 1V2LT 2OC7A 5HYOA 2ZI2H 4ISNA 1ELTA 1C2GA 1GBKA 2VWNA 1EPTA 1NRPH 1ZRKA 2OBQA 1Y5BT 2KM0A 2W7UA 1TLDA 1UHBB 3QZRA 2XC4A 4J2YB 1WDIA 2AGIX 1MKWK 4ZKNU 1MCTA 2VIOA 1GBAA 5C2ZA 2ZU2A 1QR3E 2UWPA 1EJAA 9LPRA 5C5OA 2G4UA 2PFEA 7ESTE 1C2KA 3MO9A 1ZOMA 4AYYB 1ELEE 4R8TB 2TGDA 3DHKH 5B6OA 3ZVCA 1EFRD 3U8TH 3Q3KA 2GP9B 3VB3A 3H09A 2ZIQH 1XM1A 3SUFA 1YF4A 1WXRA 3GISB 4TSFD 3SV2H 1KIGH 1ZPBA 2A4QA 1FNIA 2O8LA 4OS4A 2VIQA 4D9QA 4Y79A 1CA0B 2GCHG 4WMEA 2PTNA 1EXFA 1CSOE 3E91A 3GCTF 1PJPA 4D9RA 2GZ8A 1FY8E 1K1MA 1WU1A 3QK1A 2P95A 1WOFA 1Y5AT 5EODA 3SJOA 2ANMH 1SHYA 1YPLH 3GICB 1O31A 1V2OT 1T8LA 3PROA 3F9FA 2QF4A 3A84A 1FY4A 2BLWA 1C5WB 3SUGA 4F55A 1T31A 2F91A 4AFSA 1QL8A 4Q7ZA 3UY9A 3ODDA 5C1UA 3TH3H 2BY8X 4Y7BA 2XCNA 3BIUH 1D3TB 1P2NA 1GCDA 1GHAF 3AASA 1HUTH 2C4FH 2CHAC 1JWTA 1QURH 4NA7A 1ZZZA 1GBLA 3STIA 1NPMA 1K22H 1VITH 3P8GA 3B23B 3I29A 5FHTA 2BLOA 4OGXA 2R3YA 2OQUA 3A8DA 3UAIC 3SW2B 1P3EA 4UFFH 4TPIZ 1HAIH 1TBRH 1W13U 1W8BH 3ESTA 4NA9H 1AGJA 4FUCA 2FPZA 3SZEA 4D7GA 2VVVA 3PB1E 3P95A 4JZEH 1HAVB 1EASA 3F9EA 3BN9A 3D23A 1AVWA 3GY8A 1LKBA 1E34B 1MTVA 1ZLRA 3EYDA 4NSYA 5GNDA 4F4OC 2ZFQH 2P16A 1FAKH 2YNAA 3QUMP 8LPRA 3VB5A 1XUGA 3KF2A 5T3HA 3MFJA 2K8IA 3QZQA 3ZZ8A 5DN6D 5EU8A 2BD4A 1QQUA 2P8OC 1O5EH 3LONA 1C5VA 1MKXH 2HPQH 1AI8H 4AB9A 2ZU1A 1ESTA 1LVBA 4K1EA 1O3GA 4X6MA 1K1PA 2VNTA 2ZDVH 2ZEBA 4H42U 3PLKA 1O37A 3SGBE 4NZLA 1VZQH 1VJAU 3KYFA 6CHAB 4MVNA 1HLTH 3MH7A 4H6TA 4X8VH 4H6SB 3A88A 1F5KU 3BEIB 5FPSA 3OEED 1KXCA 3MI4A 1Y3UA 2KR7A 1RRKA 1GMDG 2Q1JA 3ATIA 1P04A 1EB1H 1ZHRA 1C9PA 1OP0A 1BZXE 3T62A 1P9SA 3T2NA 1GJCB 5FCKA 4TWYA 3A7ZA 1B7XB 2VIDA 3RDZA 1ZSKA 1HJAC 1YPHC 4UFGH 4Y7AA 1QHRB 1UK2A 3EA9A 2TGPZ 2M2AA 4FVDA 4A1VA 2FIRH 1WUNH 1SI5H 1TMBH 2J9NA 3RU4D 2RA0A 1QA0A 3Q00A 3RXEA 1WQVH 2HVYB 1TBQH 1EQ9A 3TPIZ 3TNSA 1KDQA 2H9TH 2ZF0H 2OCVB 2ZFFH 2XBVA 4YTAA 1MKWH 3PLPA 4DVAU 4AFZA 3KQCA 2QV1A 3VPKA 2Y82A 2H9HA 2R0KA 4Y8ZA 2QIQA 3TITA 3BTTE 2BQWB 5C3NA 3SV6A 4WF8A 5A0CA 1DX5M 1F2SE 2A4GA 5C5NA 1THRH 4AG1A 4CRFA 1V2RT 4YT6H 2BOHB 4ZXYH 9ESTA 3LIWA 3PRDA 3GCOA 1V2KT 4BTUB 5PTPA 3GCNA 1KXEA 1JXPA 3OTJE 1AVGH 3OY5U 1QFKH 1L2EA 3SHCH 4ZKOU 1XXDA 3SNDA 3VB7A 3M7UA 1C5SA 4Y76A 2YMSB 1BHXF 5I25A 1JIMA 4HTCH 1GCTC 1TALA 2F43B 2JKHA 3PMJA 1C2JA 5BRRE 1E38B 1V2QT 2BOKA 1UW7A 1TB6H 1T8MA 1LO6A 2HWLB 1VGCC 4DGJA 1O3DA 1VJ9U 1BJUA 1C5ZB 1K1IA 1K9OE 2GV6A 4MG3A 4TWWA 1MD7A 1Y5UT 1XUIA 4WXVA 2EQNA 2FTLE 1TGBA 3SJKA 3ZVAA 2FOAA 4B76A 2CGAA 3GCHB 1SGPE 4MTBA 4JYVH 1GJ6A 3VGCB 1IHSH 3ZVBA 1L4DA 1ZPZA 1C2EA 4K60A 1HDTH 2BDYA 3TIUA 2F9NA 2WINI 4DY7B 1THPB 1ZMJA 2PGBB 5DK1A 2VH6A 1BMMH 1P02A 1FX0B 3GS9A 1ZMLA 1AY6H 1ZR0A 3K6ZA 5AVDA 3VXFH 1UTMA 2K1QA 5FX6A 3PRBA 5A0AE 6GCHG 5EQRA 2GCTC 1GPZA 2NWNA 5EJZA 3ZYDA 5LGOA 1NRSH 4RSPA 4ZHLU 2BDCA 1SOZA 5GCHF 1OX1A 1EZQA 1GL0E 2ZHWH 5FPTA 2H1UA 3V13A 1HRTH 1SLVB 2BD2A 3T28A 1LHCH 1O2JA 3SU3A 2ZU3A 1ANDA 4I33A 3RXVA 3ZVEA 1QJ6B 2CF9H 2ZQ1A 1BIOA 1V2NT 3SNEA 1CGHA 2R9PA 1Y8TA 3W1EA 1GBIA 1AMHA 3RM0H 3SU5A 4CHAC 2VGCC 1O5CB 1S85A 4ABDA 1HB0B 1DY9A 3KGPA 2BDGA 2Z9JA 4IW4E 3EA7A 5K7RA 3M3SA 3L3TA 1DFPA 2FOBA 4LZ4B 1GHXH 1NS3A 5CHBA 2YOLA 1O3BA 2FYRA 1BTXA 4Q63A 3LJJA 4DW2U 2ZCHP 1P8VC 2WPJS 4Y0ZE 6ESTA 1BBRE 1S6LA 1HFDA 1RFNA 3UIRA 1LVYA 1N8OB 1UK3A 2O8WA 2SFAA 5E2OA 3BTEE 3IWMA 1SGTA 1HAOH 1ARCA 2BVXH 2STBE 3HATH 1G30B 5JB8S 4A1XA 1VITG 3TJUA 3RXTA 1A3EH 4DCDA 3STJA 1NU7B 1WQSA 2GVFA 4R0IA 4ZKSU 1HXFH 3UREA 1FN6A 1F0UA 2XBYA 4INKA 2F9PA 1NU9A 2Z3CA 4ABFA 5DP5A 1GHYH 3HGNA 1BOQA 1G3BA 1NRQH 3L6PA 2GCHF 1S83A 3SV8A 2F9VA 3LC5A 5EOKA 2BY5X 5F6MA 2HLCA 3QN7A 5LPEA 2TGTA 2WPHS 1ZHPA 1UTQA 2QF5A 3GDSA 2BYAX 1EOJA 1GVKB 5CMXH 2LP6A 4E06H 4XSKU 1O3CA 1IQIA 1FV9A 1KLIH 4OS2A 2QCYA 1PQ8A 1C5UA 1BQYA 2FX6A 2NU2E 2JJ1D 1PYTD 2A7CA 1C1MA 1L1NA 1C1SA 2WPIS 1HBTH 3KQBA 3PYHA 1BITA 4LZ1H 4DJZB 1CBWB 1B0EA 1MTUA 3T25A 5T6FA 1WBGB 1EP5A 1Z1IA 4CRAA 3C27B 3PV4A 1YCPM 3AVZA 2J38A 1GBFA 1NRRH 4K69A 3GY4A 5HIZA 1MTWA 4MQAA 1DXWA 1TNIA 3SU0A 1KSNA 1C5RA 1ZMNA 2UWOA 1CE5A 2PP6A 1OWIA 1DITH 2ALPA 2F9UA 3KCGH 1SPJA 3FZDA 5L2YH 3E16B 1K2I1 4WY3A 2XWAA 2ZHQH 1C5YB 5AF9H 1NO9H 3U8OH 2XBXA 5E2PA 4A6LA 1IQEA 1OP2A 5FBIA 1ZTLA 4GPGA 2CHAB 2PUQH 3BTFE 4YESB 1EJMA 5ESTE 4ABIA 7LPRA 5F8XA 4DIHH 1N6YA 1P3CA 2JH5D 2XYAA 3PMBB 1NBMD 1HPGA 1QCPA 1YBWA 2ZHEH 5C94A 1C2MA 4ZMAH 1P01A 3SGAE 3VXEH 1GBCA 2UUYA 1QZ8A 3RXBA 2ZTXA 2R2MB 1A0HB 1V2JT 4B2BA 3RC6A 5SGAE 5E8EH 1AIXH 2J97A 4KKDA 1XUKA 2G4TA 1XKAC 4XOJA 1P9UA 1Z8GA 1C1VH 1P03A 3UNQA 1W7GH 5I46H 2R2WU 1TPPA 5LPFA 4E7RG 3K2UA 2A0QB 1GMDF 2HVXA 5CDFE 5EJ1A 1TAWA 3U1JB 5T6DA 1TNKA 2CK3D 8GCHG 3U8RH 3BTHE 2XW9A 3TJNA 4B2CA 4ASUD 1CT4E 2AFQB 3ATWA 1P12E 3BG4C 1ORFA 2GV7A 4X2XA 1EPTC 5DP8A 4GVUA 4H4FA 4KTSA 2UUKB 1S0QA 1N1LA 3UNRA 1TRMA 1AB9C 3RP2A 3F1SB 3BTDE 3MU4A 1YY3A 4VGCC 3ZZAA 2W6ID 1MU8B 1P06A 1TRNA 4GSOA 1O3JA 3TGJE 2OD3B 5B6LA 2BZ6H 5EGMA 1K1JA 2WPDD 2VBCA 4X6OA 2GMTB 4AORA 3UTUH 3RMLH 1DANH 1QBOA 3FP6E 2FXRA 1JBUH 1V2PT 1SLXB 1S82A 1GMCG 2JH0D 4FVBA 3SU1A 2FYQA 3UQOA 1EZXC 5FPYA 1XXFA 1SQTA 3UR9A 3F6UH 5DP9A 5JYIA 1O2ZA 2YNBA 2BHGA 3M5MA 4UDWH 2XRCA 3NK8A 2L74A 3LDXH 4X6NA 1SB1H 4Y10E 1E1RD 2BZAA 1ID5H 4CH8B 1T4VH 2HRVA 3SNCA 2Y7ZA 1S0RA 2W7SA 2BXUH 3RXMA 3PMHB 3RLWH 6LPRA 1UO6A 4DT4A 2FM2A 5F03A 1AU8A 2B8OH 2C93B 2QXIA 2VIPA 3G01A 1D3PB 2PSXA 1PPGE 2EEKA 3O8DA 1C1RA 3MO3A 4B1TA 1P0SH 1MZDA 4OGYA 4X1SU 2VVUA 4K1SA 4XFQA 2ZGBH 1UTOA 3TJOA 2Z94A 3U28C 5EPYA 4BTIB 3HK6B 1A5HA 1P57B 2FEQH 4ASHA 1EAIA 1TPOA 1HAPH 1GBJA 1O2UA 2Y6TA 1ZSJA 1EATA 2G52A 3Q3XA 4FUGA 1UTNA 1SLWB 2GKVE 4IC6A 4ABHA 1ELFA 3TGIE 1OHHD 1HAGE 2OTVA 1ESAA 1MUEB 4K8YA 3LKWA 3KQEA 1GJ4H 1TNLA 1D4PB 3T27A 1TPSA 5FX5A 1BB0B 2RCEA 1YWUA 3LGWA 1A3BH 3QGNB 5EIYA 1HV7A 3GYLB 3H7TA 3TJVA 3A83A 4FU7A 5DP7A 6GCHF 3P17H 1BCUH 1T32A 2C8XB 4AOQA 3A82A 1PQAA 2A31A 1CA8B 3OEHD 3MNBA 3ITIA 4HG6A 1OWHA 1O3MA 5A8XA 4NIVA 3LT3A 1MTNB 2A32A 1KYNA 2V35A 1A0LA 2A4RA 2ZA5A 1KXDA 1ELAA 2Z6BD 3MOCA 1DS2E 1FPHH 1C4Y2 3SBKA 4ZCNA 3FZZA 2OINA 4XBDA 3A81A 1AE5A 1NN6A 4WJG2 3ZVDA 1W14U 1Z8JB 4KELA 4Y71A 3T5FH 4BXSA 4UONA 1Z8RA 1DLEA 2OUAA 3QLPH 3PMAB 1ZSLA 1DWCH 1G9IE 2H5CA 4DOQA 2XC0A 1J8AA 2V3OH 2ZPRA 2HALA 1JRSA 1DSTA 3UUZA 1K0HA 4YLUA 3AW1A 2AEIH 3CS7A 1UJ1A 3FVFB 1QRZA 1LPGB 4NZQA 5JBAS 3Q76A 2ZCLP 1DE7H 1MMJN 3FP7E 1EUFA 1GGDC 5EXNA 4IBLH 2ILNA 4DIIH 1CHOG 1BT7A 1UTJA 2IJD1 2RDEA 4ABAA 3D65E 1GI9B 1QRXA 4AB8A 1TQ7B 3ATLA 2HNTF 3F0OA 4UEHH 1ETTH 4LOYH 1O0DH 2AIPA 1SLUB 1G3DA 1C2DA 1SSXA 5DPAA 1O3AA 1VITF 2AMDA 1A4WH 2HLDD 2JETC 2VINA 1GDQA 4IMZA 1J15A 5FL7D 4CRBA 1PPFE 2GT7A 4ABBA 1C2HA 2PKAB 3VFEA 2HGTH 1VCPA 3E0NB 2ZGJA 2QGRA 3S0NA 1ZRBA 3LGUA 3UNSA 3SV9A 5HGGA 2ZGHA 3UFAA 4I8KA 1GI6A 1OP8A 3BTGE 1YPEH 2GJGA 1EJNA 1AKSB 3GDVA 2R3UA 1C4V2 1THSH 1UVUH 1AFQC 1TPAE 1S84A 2FMJA 2O8TA 4NWLA 1LMWB 4CBNA 1G32B 3E8LA 1G3EA 3B8JA 1XVOA 1O2YA 1IQJA 1Z8IB 2XBWA 2ZTYA 1HJ9A 2F9OA 1SGDE 3K65B 4AGJA 4FUIA 1JMOH 3F9GA 1HYLA 2Z9IA 3MU5A 1ZGIA 1FN8A 1QQ4A 2WHXA 2G5NA 1B5GH 2FOMB 3ZZ4A 3RXSA 1MQ6A 3ZYEA 1MH0A 2GTBA 4ZH8A 3GY3A 2C90B 2FP7B 3MU8A 3M5LA 2V7QD 2FX4A 2J4IA 2FESH 3KQDA 1BTPA 4XBBA 4AYVB 5CHAC 1EZSC 1W0JD 4U30A 3LOXA 1C1QA 2XNDD 2ZDMA 4BTTB 1RIWB 4A7IB 2VWLA 3UQVA 1DT2A 2ZGXH 4OS1A 5EG4A 2BLVA 1IQFA 1OWDA 1BRBE 4IN1A 3RXUA 4I7YH 1TGSZ 2IJOB 1WCZA 2ZZUH 1SR5C 1JOUB 3EDXB 1QB6A 4NSVA 3MMGA 1VR1H 2LNCA 4AX9H 3K6YA 1XUHA 1LDTT 5A0BA 1FUJA 3FP8E 2BDIA 3S7HB 1GVZA 2VU8E 4JK6A 5JB9S 4B71A 4E05H 1SGIB 1FAXA 2A4OA 3RXFA 1C9TA 3Q3YA 3BTME 4MNXA 1FPCH 1AHTH 2CJIA 1D3QB 1V2ST 1QJ7B 4KGAA 1T7CA 5DO4H 3BEFB 2THFB 3GYMA 3LU9B 2KAIB 2ALVA 3PLBA 3GY2A 3P8OA 3RU4E 4DT7B 4ABJA 3OY6U 2J95A 2H9EH 4SGBE 5C67A 3DFLA 2XTTB 1F92A 2GZ7A 4CRCA 2GD4B 1TX8A 2ANYA 3I77A 1XX9A 1C4U2 3M3VA 5E0JA 5HXFA 2OC0A 3SHAH 4WMFA 1XMNB 1GJBB 2ZQ2A 4TY6A 2BY6X 2ZU4A 2C8ZB 2BDHA 4BOHA 2BD5A 3BEUA 8GCHF 1Y3WA 1BBRK 4ABGA 1GI7B 3QO6A 5JBCS 5EW2H 1ELCA 4QT8C 3SJIA 1DXPA 1P05A 1TRYA 2Y5GA 3SJ8A 1OSSA 2I6QA 1CT2E 5EXLA 1GG6B 1UHBA 2PUXB 3RXAA 3NUMA 3DSOA 4B6FA 4U2WA 3FN8A 4CRDA 5LH8A 4FUBA 5DP3A 5EQSA 1NY22 1CA0C 1K1LA 2V3HH 3RXJA 4K2YA 4YZUA 2Q6GA 1L1JA 2SNVA 4ZKRU 3TNTA 3M61U 5GXPA 2GDDA 1DM4B 2BX3A 1BUIA 2CV3A 1ZPCA 3F3BA 4Q80A 1DICA 3P8NA 4AFQA 1IAUA 1TA2A 1E0FD 4XBCA 1GMCF 2BVRH 1EX3A 3SQEE 3OU0A 4K5ZA 1YPMH 4RT1A 2O8MA 2IPQX 3A7VA 5HMAA 1H8ED 1C5PA 1V2MT 1T4UH 3BV9B 1Q31A 2QAAA 1Z6EA 1GI8B 1WTGH 3RU4T 4IS5A 1O5DH 4TPYA 1AE8H 1IQMA 3DFJA 3BG8A 5LPRA 1UCYE 1H8HD 3RXLA 1NFUA 2BY9X 3SU2A 3FOAA 2B0FA 2AIQA 3ZZ3A 2OC1A 1RTFB 2J98B 2ULLA 5GPIB 4NCYA 1ZTJA 3RXRA 2IPHA 1FXYA 1PQ7A 3W94A 1ZGVA 4DURA 1SGCA 1W0ZU 1ZJDA 4X0WU 4I8JA 1O5GH 2BTCE 3R3GB 1U6QA 4BXWA 1P09A 3ZZ5A 1Z6JH 4Q7XA 7KMEH 2PR3A 3BTKE 4F48B 1NZQH 3D49H 1E36B 1TQ0B 1C5MD 1C5QA 1H9HE 3FAOA 3RXCA 3O8CA 3SZNA 1GHBG 2WYGA 1AWHB 1O32A 1PPEE 1IQLA 5J4QA 2P3TB 1V2UT 4B2AA 1O2LA 3MHWU 3MNSA 2ZGCA 1OPHB 1RTLA 2EA3A 3MO6A 1SBWA 3F68H 4ZHMU 4Q7YA 1O30A 1NESE 2F4LA 1ZHMA 1YM0A 2CN0H 2Z7FE 4CR5A 1DWDH 1UTLM 1SGYE 3FO8D 3ZZCA 4BANB 5H4IB 1FLEE 1SHHB 1D3DB 1EB2A 4A1TA 1ANBA 1UMAH 1SGRE 4ISLA 2JH6D 3RMMH 1QB9A 2VJ1A 1W12U 1P10A 2FI5E 2Y80A 2W5EA 3LJOA 1O35A 3TVJB 1QBNA 4GLYA 1J9CH 1O3LA 1GMHG 6CHAC 4O3UA 2DUCA 4NFEA 3RMOH 1LVOA 1FY5A 1QNJA 1HAVA 4NIWA 1GHVH 1DOJA 1UTKA 1UVTH 3SI4H 1ZTKA 3ELAH 1O2SA 1XUFA 4YXWD 3AAUA 1QL9A 3ZIAD 1ANCA 1GJ5H 3V3MA 1GBTA 1G37A 5J4SA 2BDAA 1TIOA 2V0BA 7GCHG 1QGFA 2A2XH 2P94A 3GY5A 1INCA 2XXLA 2PSYA 1QBVH 4P02A 1XKBC 1TBZH 3N7EA 2GDEH 4FETA 1KTTB 1GJ8B 1BTHH 3OAAD 2AH4X 1L4ZA 2WPMS 1G3CA 1DDJA 4GHTA 1Z71A 2UUFB 4IC5A 2FOGA 1P2KA 3Q77A 1TONA 3EAJA 2PKSC 1P11E 3V12A 2WV4A 2JIZD 5TCCA 1ANEA 4CBOA 4ZROA 1FZZA 5KGOA 1CHOF 2L6OA 2ODYB 3ZVFA 1XVMA 1X7AC 3PM3A 3UB0A 3TK5A 3WWBA 1QTFA 1OWJA 2CXVA 5C1YA 3N7OA 4X2YA 1SVPA 2Q6FA 1K1OA 3DUXH 5DJ7A 3U98H 1NM6A 1O36A 2PWXA 3NPSA 3ATKA 1C5NH 1BMLA 1BBRH 1SQAA 2WV5A 4MPXA 2ZDAH 2A2QH 3GY7A 2YMSC 1FDPA 1KY9A 2A7JA 2BXTH 1TFXA 4CREA 1G2LA 2RG3A 4KTCA 1Q3XA 1BTWA 4AG2A 2IOTA 2R0LA 1FY1A 1FIZA 2WUCA 4CH2B 5TCAA 1W7XH 3M35A 3A86A 1H1BA 2PW8H 1BTYA 2VH0A 1P2JA 2WV9A 2ANWA 1O2TA 5EJLA 1RD3B 1HAXB 4M9FA 5DP6A 5GIBA 3O8RA 3VGCC 3NWUA 4D76A 1V6DA 3SN8A 1DWEH 3MH6A 1GI2A 1TOCB 4I8HA 2P8OB 1CVWH 1KDQB 2F9BH 3A85A 1KTSB 3D62A 1KXBA 2B5TB 3FANA 2FZZA 1O39A 3SQHE 1CU1A 1IQGA 3LC3A 4GCHG 4CRGA 4MNYA 5K0HA 1AFQB 3MYWA 1CGJE 1QRWA 3PO1C 3BTWE 2QXJA 1XUJA 4X2WA 1LHFH 1B0FA 2XCFA 3LH3A 5EXMA 1C1UH 4M7GA 2QXGA 1O2OA 2SGEE 2BMGB 4JCNA 1GJ7B 1DUEA 1SGFG 2ANKH 2FOCA 2BX4A 3HK3B 4MPVA 4U32A 5T1VA 1MQ5A 1HJAB 2D26C 1QA7A 5EW1H 4XE4A 3AAVA 3H7OA 3RXGA 5T6GA 2KCOA 3HKIB 1OKXA 1A46H 4Z6AH 1AVXA 2KCPA 3F9HA 5DG6A 4NWKA 1L0ZA 2P3UB 1O2NA 2O8UA 1VCQA 3F2FA 3NRLA 1ELVA 1QB1A 2F83A 1SQRA 2PV9B 3MTYA 1O2IA 1GI3A 1O5FH 1T8OA 2HNTE 1O38A 3HGPA 2QXHA 3LGIA 1O3KA 1L1GA 4OS6A 4YM9A 4HZHA 1AQ7A 4UD9H 1J16A 1OWEA 2ZFPH 1MBQA 1N8OC 5CE1A 5DSFA 1TOMH 4Y11E 1KLTA 1GWAA 4ABEA 4ZXXH 2SGDE 4YOGA 1BRCE 3S69A 1D6RA 3A87A 3VEQB 1ELBA 1V2VT 1COWD 2EC9H 3NCLA 4FUEA 4AC9A 2G55A 5A09A 2O9QA 5JDUB 2ZDLA 4RKOB 3PTBA 2BM2A 1V3XA 1TNGA 1C5OH 2W26A 1TNHA 5IK2D 2P93A 2J98A 3WW7A 2OK5A 1BMNH 5FXLA 3U1IB 1C2LA 1H8DH 1GCTB 1S6FA 1P2MA 3F0PA 3PWCA 1C2IA 4AFUA 3S9CA 4TT3D 1O2MA 3RXDA 4Y6DA 2EI8A 2ZCKP 4A5TS 1WV7H 1O2GH 1TMUH 1UVPA 4FU8A 1GJDB 4ZHAA 2XNIA 1C5TA 2FDAA 1VGCB 4X1RU 4AGKA 3EE0B 2F3CE 3KNXA 2FI3E 1W2KH 1O5BB 5TJXA 2J2UA 3DSPA 4B74A 1HAZB 3C1KA 3URCA 1VCWA 3OE7D 3SI3H 2VVCA 1K28D 3TU7H 3O8BA 1G36A 2QF3A 3A8CA 3LGVA 1NFYA 3U69H 1GJAB 2ZKSA 1J14A 3EE7A 1A0JA 1SFQB 4J1YA 1CBWC 1F5RA 3DSGA 1BA8B 4FUDA 4WXIA 8ESTE 2AGEX 2DE8A 1EKBB 2G00A 2PTCE 1ABJH 2FO9A 2KZ4A 4NIXA 2KCAA 3SU4A 4YLQH 1C5XB 1TA6A 1GBHA 2AERH 2BDBA 2VWOA 4LXBH 3ZZDA 2GCTB 5ESBA 1EP6A 4YOIA 1HAYB 2PHBA 3DD2H 5EPNA 4HFPB 3KQ5A 5ETXA 2TIOA 2Z9KA 1O2VA 1RXPA 4LK4A 2P59A 5AFYH 1OOKB 3P8FA 1GHBF 1GHWH 4ACBA 2AHME 1SGQE 3F2GA 3TLOA 1AZ8A 3ZV8A 3RMNH 1GBEA 1NFXA 3E6PH 1DLKB 1LCYA 2H2ZA 3VB6A 1QY6A 2A45B 4CHAB 2TBSA 1HIAB 4UFEH 2BY7X 2VGCB 1WYKA 2BLQA 3B9FH 3CP7A 3KL6A 1O2WA 1C1OA 2ODQA 3T26A 4INHA 3DCLA 2RA3A 2SNWA 1LPKB 4K3JA 1W11U 1SOTA 3M37A 4X8SH 1GJ9B 1YGCH 4NFFA 2QE7D 4KTUA 3GOVB 3UWIA 1C1NA 3M3TA 1GMHF 4RT0A 3N99A 4IMQA 1HJ8A 5HKKD 4BAKB 2SGAA 5L2ZH 1S6HA 1BJVA 1UVOA 2BVSH 2FOEA 1ZYOA 4MPWA 1PYTC 1EAXA 2Z3EA 2P3FH 3P70B 1F0SA 1A2CH 5AFZH 1A61H 3LGTA 4WMDA 1T8NA 1LVMA 5E0GA 7GCHF 4I86A 5L30H 3AK5A 3VG8A 2YMSD 3PWBA 2AS9A 3E90B 1H8IH 3MH4A 4ACAA 4WH8A 4JZDH 2KX4A 2FOHA 3SNAA 2ZDKA 1MU6B 4D7FA 1Y3YA 3PTNA 1YCPK 3M7TA 3A89A 4WH6A 3AW0A 3SO3A 2BD9A 4MNWA 3RXQA 1O34A 3L33A 4NA8A 2ZECA 5FCRA 1BHXB 4O9VA 1UK4A 1AUTC 1NTPA 3LGYA 4JYTA 3VB4A 2VB0A 4X6PA 2G8TA 2K0QA 3TK6A 4INLA 5A8ZA 2GMTC 2NU1E 4F49A 1A5GH 2BD7A 3QGJA 5A8YA 2Y7XA 1FIWA 1MBMA 3QDZB 2HPPH 4GHQA 4P00A 1H9LB 2C8WB 4ESTE 1EAUA 1W0KD 4GUXA 3EA8A 5KEDA 1K21H 3TH2H 1Z1JA 2G5VA 1DY8A 2RFKC 2VIVA 1HXEH 3RXIA 3SNBA 3SU6A 1OXGA 4FUJA 3RUOA 1GI5A 1MAYA 3U9AH 2WYJA 1BMAA 1H9IE 2VIWA 1YYY1 2GZ9A 3UPEA 1ARBA 1YPGH 2ESTE 3PV5A 5L6NH 1YKTA 1O3PB 1RJXB 2G81E 1UCYK 1LQEA 2PKSB 1BMFD 1MZAA 2ZFSA 3DT0H 2TPIZ 1CQQA 2M5TA 5C1XA 1E79D 1F7ZA 4WVPE 1IQHA 3ZV9A 3OYPA 4GAWA 3BSQA 4MPUA 2D8WA 3PV2A 3OTPA 1SFIA 2W3IA 2GGVB 1MAXA 3LPRA 4K1TA 4O97A 1TMTH 4Y0YE 2ZP0H 1ETSH 2FLBH 1EAWA 3KEEA 4RN6A 1P2IA 2RDLA 3CS0A 2J92A 1JRTA 2EI6A 3UWJH 3BF6H 4FU9A 3CNRA 2HOBA 1GL1A 1Q2WA 1AD8H 4HI3A 3EQ0H 1ABIH 1GDUA 1SC8U 2ZWLH 1Y3XA 1OYQA 3MU1A 3UOPA 2HNTC 5FBEA 4ZAEA 3UR6A 1GI4A 2ZG0H 3TH4H 4BAQB 4GCHF 1HAHH 4YOJA 1O3IA 5DP4A 5G4BA 3E1XB 3FKSD 1DVAH 3MWIU 1WAYB 3KHVA 1ELDE 1NT1A 4CR9A 3SYJA 4BAOB 1NROH 1KXAA 2XWBI 3S9BA 1JIRA 1ACBE 1TGCA 1F0RA 5EQQA 1OWKA 3GY6A 2Z3DA 5FAHA 3FFGA 1MTNC 2SGFE 2PGQB 1UTPA 2FLRH 5GJ4B 2D2DA 2B7DH 5DKMA 4O03A 4I31A 4Q4LA 2AMPA 1AWFH 1O3HA 2KFWA 2QC2A 4SGAE 2A1DB 1A7SA 4KP0A 4BAMB 1GI0A 2ZTZA 1GBBA 4Q2KA 1SG8B 1TNJA 1PPZA 3BG4B 2V6NA 1AUJA 1LQDB 1SGNE 2ZHFH 3ODFA 1EPTB 2ZFTA 4OS5A 2ZHDA 3E3TA 4FUFA 3K9XB 3M7QA 1O3FA 2EI7A 3RXPA 2OLGA 3S7KB 4THNH 3JZ1B 3PO1B 1AB9B 2D1JA 4Y8XA 1YLDA 4VGCB 2AGGX 1ESBA 1H4WA 1LTOA 3GCTG 3ZVGA 1YC0A 3E0PB 1O33A 5C0UA 1YPKH 5BPEA 3T29A 3WWFA 2BB4A 2Z9GA 1YLCA 3KN2A 2Y5HA 1O5AB 2NU4E 1FMGA 1ELGA 1FQ3A 4FUHA 5ABWA 3QX5H 5AHGH 3V0XA 4MNVA 5JPMH 4OM9A 1M9UA 2XC5A 1Y59T 3MH5A 1N6XA 1RTKA 1YPJH 2STAE 2TGAA 4X8TH 5KECA 1ZJKA 1GHAG 1KLJH 2W3KA 3GDUA 4UE7H 3BIVH 1IOEA 2QN5T 1E35B 2A5KA 1C1WH 1PPHE 2ZU5A 4UFDH 1EOLA 1CO7E 2SGPE 4JK5A 1TABE 5HM2A 1FY3A 2OC8A 4MLFB 4FOUC 3V7TA 1GDNA 1HGTH 4A92A 2SGQE 1G2MA 2OQ5A 2Y81A 4TY7A 5F53A 2W6JD 1TE0A 2J34A 1WTHD 1S5SA 1FI8A 2ODPA 1TX7A 1YCPH 5JBTA 4YT7H 2OXSA 2C8YB 2FODA 3BTQE 3QTVH 5HIYA 3HKJB 2BQ6B 4RKJB 1LPZB 5C17A 3I78A 2UUJB 3RXHA 3HPTB 4NG9H 1LKAA 1BDAA 2I6SA 3M36A 1Y3VA 1HIAA 4BNRA 2BD8A 4ISOA 4AN7A 5HM9A 2GX4A 2WSSD 1SL3A 2AYWA 2PKAA 3RXOA 2Z9LA 3ZZ6A 3QTOH 2ZFRH 3SOSA 1C2FA 3MQKC 1YLNA 3SORA 2BQ7B 1O2KA 2QYIA 2JJ2D 1S81A 2CMYA 2A7HA 2KCYA 2CF8H 1V2TT 1O3EA 4X1PU 3UOUA 1AKSA 1A1RA 1IHTH 3A7YA 4B75A 3A7XA 4JMYA 1RIWC 1SGEE 5GDSH 3ZZ9A 1UCYH 4XDEA 1CHGA 2WPLS 2ZO3H 3ZZBA 3IG6B 4X8UH 1PPBH 3S9AA 3RM2H 1W3CA 1PFXC 3ZZ7A 1O2RA 2DE9A 3SUDA 4BAHB 2ZPSA 2J94A 3A80A 4Z0KA 1OYTH 2JDID 1QJ1B 1GHZA
chains in the Genus database with same CATH topology
4D8NA 3SGQE 2OBOA 3JZ2B 4ZUHA 4E7NA 4K8BA 4AZ2B 2ZPQA 4MDSA 1CGIE 2AMQA 1NC6A 2FOFA 1GI1A 4X2VA 4B73A 1LHEH 2QY0B 2FWWA 4HGCA 2OP9A 3ATMA 5DGJA 3LH1A 1HNEE 3SUEA 1O2XA 2NU3E 4OS7A 3SJ9A 4ISHH 1NRNH 1UVSH 3A8AA 4ISIH 2ZC9H 8KME2 1WSSH 1AN1E 1GVLA 1EZUC 3WY8A 2B9LA 3URDA 3MNCA 3P92A 1O2HA 4DG4A 1GGDB 3CENA 4IGDA 2H5DA 1Z7KA 3QWCH 2QF0A 1SMFE 4I8LA 2FS9A 4JZ1A 5IDKA 3DA9B 1V2WT 3ENSB 4U01A 2UWLA 3KIDU 1GBMA 3RLYH 5E0HA 3IITA 3TGKE 2JETB 5JBBS 3GCHC 1MCVA 1PQ5A 1TWXB 1GG6C 2A5IA 3MU0A 5IYTA 1O3NA 1SGFA 4X1NU 1F5LA 3NZIA 1GBDA 1YP9A 2VWMA 1DSUA 1BTUA 4YO9A 1J17T 2PLXA 1E37B 3W95A 1YPHE 1A5IA 1BRAA 3SV7A 1NFWA 1AFEH 1AZZA 1O2QA 1RGQA 2C3SA 1TYNA 3A7TA 4TYDA 2ASUB 1O2PA 2ZNKH 1F0TA 1DPOA 2KAIA 1IQNA 2GT8A 3NXPA 4FXGH 1D9IA 5A2MH 2TRMA 1LHGH 2A5AA 1FONA 2FS8A 1KXFA 1D6WA 2FI4E 1C1PA 1FJSA 1BTZA 1TGTA 1W10U 2Q6DA 1PPCE 3OX7U 1DUAA 4JZFH 2NU0E 2LPRA 5F8ZA 1C5LH 4X1QU 1BRUP 5C20A 1QL7A 3P6ZB 2IN2A 2WPKS 3RXKA 4NIYA 1MKXK 3RC5A 1O3OA 3M5NA 1TX6A 2G51A 3OSYA 4Y8YA 5F8TA 3RC4A 2FTMA 4I32A 1C1TA 3H5CB 1IQKA 2BD3A 3A8BA 1SQOA 3EGKH 1LHDH 2WUBA 3R0FA 1ETRH 2Y5FA 4PROA 4I8GA 5CHAB 1QIXB 1DWBH 2QA9E 4NGAH 3NKKA 4WWYA 4O3TA 1P2OA 1TGNA 4JYUH 5GCHG 1HCGA 1OS8A 4JZIA 3MNXA 3A7WA 3M5OA 2H6MA 1MD8A 1MTSA 1CT0E 1W0YH 1P2QA 2ZDNA 3TK9A 4IN2A 1AO5A 1RS0A 5GWZA 1K1NA 1V2LT 2OC7A 5HYOA 2ZI2H 4ISNA 1ELTA 1C2GA 1GBKA 2VWNA 1EPTA 1NRPH 2OBQA 1ZRKA 1Y5BT 2W7UA 1TLDA 1UHBB 3QZRA 2XC4A 4J2YB 2AGIX 1MKWK 4ZKNU 1MCTA 2VIOA 1GBAA 5C2ZA 2ZU2A 1QR3E 2UWPA 1EJAA 9LPRA 5C5OA 2G4UA 2PFEA 7ESTE 1C2KA 3MO9A 1ZOMA 4AYYB 1ELEE 4R8TB 2TGDA 3DHKH 5B6OA 3ZVCA 3U8TH 3Q3KA 2GP9B 3VB3A 2ZIQH 1XM1A 3SUFA 1YF4A 3GISB 3SV2H 1KIGH 1ZPBA 2A4QA 1FNIA 2O8LA 4OS4A 2VIQA 4D9QA 4Y79A 1CA0B 2GCHG 4WMEA 2PTNA 1EXFA 1CSOE 3E91A 3GCTF 1PJPA 4D9RA 2GZ8A 1FY8E 1K1MA 1WU1A 3QK1A 2P95A 1WOFA 1Y5AT 5EODA 3SJOA 2ANMH 1SHYA 1YPLH 3GICB 1O31A 1V2OT 1T8LA 3PROA 3F9FA 3A84A 1FY4A 2BLWA 1C5WB 3SUGA 1T31A 2F91A 4AFSA 1QL8A 4Q7ZA 3UY9A 3ODDA 5C1UA 3TH3H 2BY8X 4Y7BA 2XCNA 3BIUH 1D3TB 1P2NA 1GCDA 1GHAF 3AASA 1HUTH 2C4FH 2CHAC 1JWTA 1QURH 4NA7A 1ZZZA 1GBLA 3STIA 1NPMA 1K22H 1VITH 3P8GA 3B23B 3I29A 5FHTA 2BLOA 4OGXA 2R3YA 2OQUA 3A8DA 3SW2B 1P3EA 4UFFH 4TPIZ 1HAIH 1TBRH 1W13U 1W8BH 3ESTA 4NA9H 1AGJA 4FUCA 2FPZA 4D7GA 2VVVA 3PB1E 3P95A 4JZEH 1HAVB 1EASA 3F9EA 3BN9A 3D23A 1AVWA 3GY8A 1LKBA 1E34B 1MTVA 1ZLRA 3EYDA 4NSYA 4F4OC 2ZFQH 2P16A 1FAKH 2YNAA 3QUMP 8LPRA 3VB5A 1XUGA 3KF2A 5T3HA 3MFJA 3QZQA 3ZZ8A 5EU8A 2BD4A 1QQUA 2P8OC 1O5EH 3LONA 1C5VA 1MKXH 2HPQH 1AI8H 4AB9A 2ZU1A 1ESTA 1LVBA 4K1EA 1O3GA 4X6MA 1K1PA 2VNTA 2ZDVH 2ZEBA 4H42U 3PLKA 1O37A 3SGBE 4NZLA 1VZQH 1VJAU 6CHAB 4MVNA 1HLTH 3MH7A 4H6TA 4X8VH 4H6SB 3A88A 1F5KU 3BEIB 5FPSA 1KXCA 3MI4A 1Y3UA 1RRKA 1GMDG 2Q1JA 3ATIA 1P04A 1EB1H 1ZHRA 1C9PA 1OP0A 1BZXE 3T62A 1P9SA 3T2NA 1GJCB 5FCKA 4TWYA 3A7ZA 1B7XB 2VIDA 3RDZA 1ZSKA 1HJAC 1YPHC 4UFGH 4Y7AA 1QHRB 1UK2A 3EA9A 2TGPZ 4FVDA 4A1VA 2FIRH 1WUNH 1SI5H 1TMBH 2J9NA 3RU4D 2RA0A 1QA0A 3Q00A 3RXEA 1WQVH 1TBQH 1EQ9A 3TPIZ 3TNSA 1KDQA 2H9TH 2ZF0H 2OCVB 2ZFFH 2XBVA 4YTAA 1MKWH 3PLPA 4DVAU 4AFZA 3KQCA 2QV1A 3VPKA 2Y82A 2H9HA 2R0KA 4Y8ZA 2QIQA 3TITA 3BTTE 2BQWB 5C3NA 3SV6A 4WF8A 5A0CA 1DX5M 1F2SE 2A4GA 5C5NA 1THRH 4AG1A 4CRFA 1V2RT 4YT6H 2BOHB 4ZXYH 9ESTA 3LIWA 3GCOA 1V2KT 4BTUB 5PTPA 3GCNA 1KXEA 1JXPA 3OTJE 1AVGH 3OY5U 1QFKH 1L2EA 3SHCH 4ZKOU 1XXDA 3SNDA 3VB7A 3M7UA 1C5SA 4Y76A 1BHXF 5I25A 1JIMA 4HTCH 1GCTC 1TALA 2JKHA 3PMJA 1C2JA 5BRRE 1E38B 1V2QT 2BOKA 1TB6H 1T8MA 1LO6A 2HWLB 1VGCC 4DGJA 1O3DA 1VJ9U 1BJUA 1C5ZB 1K1IA 1K9OE 2GV6A 4MG3A 4TWWA 1MD7A 1Y5UT 1XUIA 4WXVA 2FTLE 1TGBA 3SJKA 3ZVAA 2FOAA 4B76A 2CGAA 3GCHB 1SGPE 4MTBA 4JYVH 1GJ6A 3VGCB 1IHSH 3ZVBA 1L4DA 1ZPZA 1C2EA 4K60A 1HDTH 2BDYA 3TIUA 2F9NA 2WINI 4DY7B 1THPB 1ZMJA 2PGBB 5DK1A 2VH6A 1BMMH 1P02A 1ZMLA 1AY6H 1ZR0A 3K6ZA 5AVDA 3VXFH 1UTMA 2K1QA 5FX6A 5A0AE 6GCHG 5EQRA 2GCTC 1GPZA 2NWNA 3ZYDA 5LGOA 1NRSH 4RSPA 4ZHLU 2BDCA 1SOZA 5GCHF 1OX1A 1EZQA 1GL0E 2ZHWH 5FPTA 2H1UA 3V13A 1HRTH 1SLVB 2BD2A 3T28A 1LHCH 1O2JA 3SU3A 2ZU3A 1ANDA 4I33A 3RXVA 3ZVEA 1QJ6B 2CF9H 2ZQ1A 1BIOA 1V2NT 3SNEA 1CGHA 2R9PA 1Y8TA 1GBIA 1AMHA 3RM0H 3SU5A 4CHAC 2VGCC 1O5CB 1S85A 4ABDA 1HB0B 1DY9A 3KGPA 2BDGA 2Z9JA 4IW4E 3EA7A 5K7RA 3M3SA 3L3TA 1DFPA 2FOBA 4LZ4B 1GHXH 1NS3A 2YOLA 1O3BA 2FYRA 1BTXA 3LJJA 4DW2U 2ZCHP 1P8VC 2WPJS 4Y0ZE 6ESTA 1BBRE 1HFDA 1RFNA 3UIRA 1LVYA 1N8OB 1UK3A 2O8WA 2SFAA 5E2OA 3BTEE 3IWMA 1SGTA 1HAOH 1ARCA 2BVXH 2STBE 3HATH 1G30B 5JB8S 4A1XA 1VITG 3TJUA 3RXTA 1A3EH 4DCDA 3STJA 1NU7B 1WQSA 2GVFA 4R0IA 4ZKSU 1HXFH 3UREA 1FN6A 1F0UA 2XBYA 4INKA 2F9PA 1NU9A 2Z3CA 4ABFA 5DP5A 1GHYH 3HGNA 1BOQA 1G3BA 1NRQH 3L6PA 2GCHF 1S83A 3SV8A 2F9VA 3LC5A 5EOKA 2BY5X 5F6MA 2HLCA 3QN7A 5LPEA 2TGTA 2WPHS 1ZHPA 1UTQA 3GDSA 2BYAX 1EOJA 1GVKB 5CMXH 4E06H 4XSKU 1O3CA 1IQIA 1FV9A 1KLIH 4OS2A 2QCYA 1PQ8A 1C5UA 1BQYA 2FX6A 2NU2E 1PYTD 2A7CA 1C1MA 1L1NA 1C1SA 2WPIS 1HBTH 3KQBA 3PYHA 1BITA 4LZ1H 4DJZB 1CBWB 1B0EA 1MTUA 3T25A 5T6FA 1WBGB 1EP5A 1Z1IA 4CRAA 3C27B 3PV4A 1YCPM 3AVZA 2J38A 1GBFA 1NRRH 4K69A 3GY4A 1MTWA 4MQAA 1DXWA 1TNIA 3SU0A 1KSNA 1C5RA 1ZMNA 2UWOA 1CE5A 1OWIA 1DITH 2ALPA 2F9UA 3KCGH 1SPJA 3FZDA 5L2YH 3E16B 1K2I1 4WY3A 2XWAA 2ZHQH 1C5YB 5AF9H 1NO9H 3U8OH 2XBXA 5E2PA 4A6LA 1IQEA 1OP2A 5FBIA 1ZTLA 4GPGA 2CHAB 2PUQH 3BTFE 4YESB 1EJMA 5ESTE 4ABIA 7LPRA 5F8XA 4DIHH 1N6YA 1P3CA 2JH5D 2XYAA 3PMBB 1HPGA 1QCPA 1YBWA 2ZHEH 1C2MA 4ZMAH 1P01A 3SGAE 3VXEH 1GBCA 2UUYA 3RXBA 2ZTXA 2R2MB 1A0HB 1V2JT 4B2BA 3RC6A 5SGAE 5E8EH 1AIXH 4KKDA 1XUKA 2G4TA 1XKAC 4XOJA 1P9UA 1Z8GA 1C1VH 1P03A 3UNQA 1W7GH 5I46H 2R2WU 1TPPA 5LPFA 4E7RG 3K2UA 2A0QB 1GMDF 2HVXA 1TAWA 3U1JB 5T6DA 1TNKA 8GCHG 3U8RH 3BTHE 2XW9A 3TJNA 4B2CA 1CT4E 2AFQB 3ATWA 1P12E 3BG4C 1ORFA 2GV7A 4X2XA 1EPTC 5DP8A 4GVUA 4H4FA 4KTSA 2UUKB 1S0QA 1N1LA 3UNRA 1TRMA 1AB9C 3RP2A 3F1SB 3BTDE 3MU4A 4VGCC 3ZZAA 1MU8B 1P06A 1TRNA 4GSOA 1O3JA 3TGJE 2OD3B 2BZ6H 5EGMA 1K1JA 4X6OA 2GMTB 4AORA 3UTUH 3RMLH 1DANH 1QBOA 3FP6E 2FXRA 1JBUH 1V2PT 1SLXB 1S82A 1GMCG 2JH0D 4FVBA 3SU1A 2FYQA 3UQOA 1EZXC 5FPYA 1XXFA 1SQTA 3UR9A 3F6UH 5DP9A 5JYIA 1O2ZA 2YNBA 2BHGA 3M5MA 4UDWH 2XRCA 3NK8A 3LDXH 4X6NA 1SB1H 4Y10E 2BZAA 1ID5H 4CH8B 1T4VH 2HRVA 3SNCA 2Y7ZA 1S0RA 2W7SA 2BXUH 3RXMA 3PMHB 3RLWH 6LPRA 1UO6A 2FM2A 5F03A 1AU8A 2B8OH 2C93B 2QXIA 2VIPA 3G01A 1D3PB 2PSXA 1PPGE 2EEKA 3O8DA 1C1RA 3MO3A 4B1TA 1P0SH 1MZDA 4OGYA 4X1SU 2VVUA 4K1SA 4XFQA 2ZGBH 1UTOA 3TJOA 2Z94A 5EPYA 4BTIB 3HK6B 1A5HA 1P57B 2FEQH 4ASHA 1EAIA 1TPOA 1HAPH 1GBJA 1O2UA 2Y6TA 1ZSJA 1EATA 2G52A 3Q3XA 4FUGA 1UTNA 1SLWB 2GKVE 4IC6A 4ABHA 1ELFA 3TGIE 1HAGE 2OTVA 1ESAA 1MUEB 4K8YA 3LKWA 3KQEA 1GJ4H 1TNLA 1D4PB 3T27A 1TPSA 5FX5A 1BB0B 2RCEA 3LGWA 1A3BH 3QGNB 1HV7A 3GYLB 3H7TA 3TJVA 3A83A 4FU7A 5DP7A 6GCHF 3P17H 1BCUH 1T32A 2C8XB 4AOQA 3A82A 1PQAA 2A31A 1CA8B 3MNBA 3ITIA 1OWHA 1O3MA 5A8XA 4NIVA 3LT3A 1MTNB 2A32A 1KYNA 2V35A 1A0LA 2A4RA 2ZA5A 1KXDA 1ELAA 2Z6BD 3MOCA 1DS2E 1FPHH 1C4Y2 3SBKA 3FZZA 2OINA 4XBDA 3A81A 1AE5A 1NN6A 4WJG2 3ZVDA 1W14U 1Z8JB 4KELA 4Y71A 3T5FH 4BXSA 4UONA 1Z8RA 1DLEA 2OUAA 3QLPH 3PMAB 1ZSLA 1DWCH 1G9IE 2H5CA 4DOQA 2XC0A 1J8AA 2V3OH 2ZPRA 2HALA 1JRSA 1DSTA 3UUZA 4YLUA 3AW1A 2AEIH 3CS7A 1UJ1A 3FVFB 1QRZA 1LPGB 4NZQA 5JBAS 3Q76A 2ZCLP 1DE7H 1MMJN 3FP7E 1EUFA 1GGDC 5EXNA 4IBLH 2ILNA 4DIIH 1CHOG 1BT7A 1UTJA 4ABAA 3D65E 1GI9B 1QRXA 4AB8A 1TQ7B 3ATLA 2HNTF 4UEHH 1ETTH 4LOYH 1O0DH 2AIPA 1SLUB 1G3DA 1C2DA 1SSXA 5DPAA 1O3AA 1VITF 2AMDA 1A4WH 2JETC 2VINA 1GDQA 4IMZA 1J15A 4CRBA 1PPFE 2GT7A 4ABBA 1C2HA 2PKAB 3VFEA 2HGTH 1VCPA 3E0NB 2ZGJA 2QGRA 3S0NA 1ZRBA 3LGUA 3UNSA 3SV9A 5HGGA 2ZGHA 3UFAA 4I8KA 1GI6A 1OP8A 3BTGE 1YPEH 1EJNA 1AKSB 3GDVA 2R3UA 1C4V2 1THSH 1UVUH 1AFQC 1TPAE 1S84A 2FMJA 2O8TA 4NWLA 1LMWB 4CBNA 1G32B 3E8LA 1G3EA 3B8JA 1XVOA 1O2YA 1IQJA 1Z8IB 2XBWA 2ZTYA 1HJ9A 2F9OA 1SGDE 3K65B 4AGJA 4FUIA 1JMOH 3F9GA 1HYLA 2Z9IA 3MU5A 1ZGIA 1FN8A 1QQ4A 2G5NA