4Y10E

Trypsin in complex with with bpti mutant (2s)-2-amino-4,4-difluorobutanoic acid
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Cationic trypsin
publication title Fluorine teams up with water to restore inhibitor activity to mutant BPTI.
pubmed doi rcsb
total genus 57
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2015-02-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4y10E01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4y10E02
1W8BH 2W7SA 4B76A 1ZTKA 1O3FA 1C2MA 4BAQB 1INCA 3O8BA 1FLEE 1GBKA 1MKXK 3RMMH 1F5RA 1O2IA 1NRRH 3SORA 1YPHC 1KIGH 2FLRH 7LPRA 2WV5A 2ZU3A 2VU8E 1GMCG 1P06A 3GY8A 2O8UA 1O2UA 3TH3H 5IYTA 1O3CA 3P8OA 1W13U 3RXFA 5GCHF 1CBWC 2Q6GA 1TBRH 1AHTH 3LC3A 4U2WA 4CRBA 3TITA 1H8DH 4XBCA 2SGAA 3OY5U 5ETXA 2A31A 1JIRA 2VVCA 3S9AA 3EQ0H 1FJSA 2BDHA 5CHAC 1YLDA 2THFB 1GI5A 3VPKA 1K1LA 1CT4E 1QBOA 2FOCA 2Y81A 1QCPA 1P10A 1EP6A 1TGTA 1VCQA 1RXPA 6CHAC 1J17T 1OWJA 2BDCA 1LO6A 1LHCH 2ODYB 3F68H 1CBWB 1NC6A 3SJIA 2DUCA 2G52A 2NU1E 1MKWK 2GKVE 1D3PB 3PV4A 4A1XA 2G55A 3TU7H 3A81A 1BJUA 1FN8A 1YP9A 1EAXA 2AFQB 1ABIH 3S7KB 3LGVA 3VB5A 2Q6FA 2VIWA 2GCTC 1J16A 5C2ZA 1O3BA 1P09A 1SFQB 3PMJA 2HPPH 2BDBA 1O2GH 1FY8E 7ESTE 1KDQA 2GV7A 1O39A 1EOLA 6CHAB 1C2EA 3PROA 1KTSB 4O97A 1IQNA 1O2JA 3RXQA 1K2I1 4A6LA 1ELCA 1YPEH 2D26C 2BQWB 4D7GA 3PMHB 1Q31A 1EPTC 1MQ5A 1P2IA 1V2KT 1QFKH 2UUJB 4SGBE 3ENSB 1SLUB 2F9NA 1ESBA 3MU0A 4OS4A 3UR9A 2AGEX 1OWIA 4WXVA 2ALVA 2GCTB 2ZC9H 1D9IA 4D8NA 4WMFA 1AKSB 3L33A 3BEFB 4NWLA 3HGNA 8LPRA 2FZZA 3SNEA 1SGDE 4FUFA 2WPKS 1GL1A 1WQSA 3A7XA 1ZHPA 1UVSH 3BG8A 1TONA 5EU8A 1O5FH 1T8LA 4A5TS 4LZ4B 2ZCHP 1O2PA 5CMXH 1TPOA 1A3BH 2JH0D 4JCNA 1EPTB 1P05A 1MTUA 1SQTA 3K6YA 3KCGH 1CA0C 4RN6A 1NROH 2BY8X 1BDAA 1DSUA 2WPHS 3RUOA 1SI5H 2P59A 4OGXA 5C1UA 2BZ6H 4X2VA 3ZZCA 3EE0B 1NM6A 1OKXA 3G01A 1OPHB 1O2NA 4Y8YA 1EB1H 4H42U 3T27A 4E7RG 2UUKB 1FMGA 2D2DA 2DE9A 2OD3B 4WMEA 4ABDA 3BTDE 5BPEA 2FYQA 2QN5T 4B71A 3Q77A 1HAIH 1HYLA 2GZ7A 3RXIA 2F91A 1BBRE 3P92A 3HK3B 3SU5A 5LPFA 1CA0B 1NO9H 1CHOG 4DIIH 2BX4A 1YC0A 2BLVA 3NKKA 4LZ1H 3V13A 4CR5A 1O3JA 2QXGA 5DP6A 5C3NA 2XWAA 4DW2U 1GBMA 2HPQH 2P95A 5GXPA 1MTNC 1D3DB 1EOJA 1WV7H 3BIVH 1AN1E 3DT0H 1WQVH 4AB9A 1C1MA 1K1MA 2W3KA 1L1JA 2YNAA 2ZGHA 3ATLA 5PTPA 3RXKA 5JB9S 5JYIA 1UCYK 3TH2H 2A4QA 2O9QA 1ESTA 3KQEA 4NIWA 3SJOA 2PGBB 1BB0B 1NRSH 1UHBB 3A7ZA 1XM1A 4CRGA 4DGJA 2O8TA 1QRXA 1TNGA 3D65E 2EEKA 4SGAE 1X7AC 3ZZ8A 1EZSC 1BHXF 3OSYA 1G32B 1B0FA 2FOBA 1TOMH 1Y5UT 3K65B 3OYPA 4FUJA 3STIA 1MTNB 1DT2A 1BTXA 1N1LA 5JBTA 1PPBH 1ELDE 3SJ9A 2IOTA 3IG6B 2ZHQH 1AIXH 5LGOA 1T4VH 1MTSA 1BMMH 2ZU1A 1PQAA 4XBDA 5GWZA 3AVZA 1UTPA 4FU9A 1QY6A 3LGTA 5AFYH 3M7UA 2Z6BD 4MLFB 3ATMA 4NSYA 4OS1A 4NWKA 1FAKH 1BMNH 2FODA 4AYYB 1S85A 1GHBF 1GDNA 1N8OC 1E34B 1S0RA 3LJJA 1GHZA 1ELBA 1MBMA 1ZMJA 1CT0E 1UO6A 1NPMA 3PMAB 1OP2A 3A89A 3DD2H 3NCLA 1O2TA 3RP2A 2OP9A 1SFIA 1ESAA 2F9VA 1HAHH 3AW0A 5K7RA 1P2NA 4ISHH 1WU1A 2P3TB 3A82A 3LIWA 4Y7AA 4CRAA 3LU9B 3M3SA 2J92A 5ABWA 4U01A 1FY3A 2O8LA 3N7OA 1N8OB 2R0LA 4WWYA 4AGKA 1ZPCA 2J4IA 1G37A 1S6FA 1PPHE 1O37A 2QAAA 3MTYA 2BM2A 2ZFSA 2AYWA 4IGDA 5E2PA 5JBAS 1P12E 4RSPA 2ZNKH 2UUFB 3QZQA 1RFNA 3GY5A 4INLA 2PV9B 3Q00A 5GIBA 3SN8A 2SNWA 2V0BA 2V35A 6LPRA 1C1WH 4I8LA 2G5NA 3BF6H 2SGFE 3O8RA 3MNBA 4LOYH 5FCRA 4R0IA 1GBLA 3P95A 4XSKU 2TIOA 1AFQC 5JBBS 4ZKRU 1QIXB 3PLBA 1TALA 4F4OC 5DJ7A 3MFJA 1O2LA 1ZPZA 4BOHA 1ARCA 1ZRKA 2RA0A 2Z3DA 8ESTE 1CU1A 4B1TA 1ANEA 1DY8A 3RXVA 1NFWA 1K1JA 3T26A 2BDIA 1TAWA 3BTME 4K8BA 1O2WA 4X1PU 3QTVH 1O32A 4KGAA 1GI2A 3MH6A 1A1RA 1BJVA 2VIVA 4X6OA 4GAWA 1HIAB 4NZLA 1L4DA 1OX1A 2PTCE 1V2JT 1SSXA 1AVGH 5F8XA 1MCVA 3EAJA 1IHSH 2BOHB 4IC5A 1DXPA 2VIPA 2NU2E 3AAUA 3SNCA 1S82A 4OS2A 3BTFE 3GICB 1AWHB 4ZUHA 4CRFA 1BTHH 2XC0A 3T28A 4JZEH 5AHGH 4K2YA 4Y71A 4F49A 5JBCS 2B0FA 2AMPA 5ESTE 1GJ7B 3QTOH 3PLKA 1GI0A 1O2YA 3Q76A 3LGYA 2FS9A 1XVMA 2ZTZA 2AMQA 2GT8A 2OLGA 2QF3A 1O5CB 1PYTD 3NZIA 1NN6A 2FM2A 1O2HA 4IBLH 1V2UT 1E37B 1FXYA 1AQ7A 4MDSA 1V6DA 2Q6DA 4DY7B 1LVMA 1GVZA 1UK4A 1KTTB 1QHRB 1TWXB 2SGEE 4NFEA 4A1VA 5EPNA 2BQ6B 4ABJA 3KQCA 2ZGCA 4X8VH 3SU4A 1CQQA 3TJOA 3LH3A 2HLCA 4X8TH 2UUYA 4BAHB 2AH4X 1TMTH 3NK8A 4Y8ZA 3ZZ4A 5C1XA 3BTQE 3RXTA 1DLKB 1GBAA 4INKA 1Z7KA 5L2YH 1RRKA 2ZTXA 1U6QA 5A09A 3KQBA 1Y3VA 2Y80A 1P11E 4QT8C 3GY2A 2ALPA 3C1KA 4ZKSU 2XTTB 1PJPA 2SGDE 4AG1A 2P16A 1OWKA 1EB2A 1C1PA 1GHXH 1H9HE 5TJXA 1YPLH 1GBFA 4K1SA 3UPEA 6GCHG 2R9PA 1V2VT 3U8OH 1YKTA 1TOCB 3V3MA 1Z8RA 1F0RA 5HYOA 3FP7E 1H9IE 2BHGA 1DWDH 2XCFA 1P2QA 5C20A 1OWDA 3BTEE 3T2NA 4UFEH 5EQQA 4IN1A 1F7ZA 1WOFA 1JBUH 3GCTG 2XBYA 4BTUB 1T31A 4ZAEA 4O9VA 4AZ2B 1TMUH 5EXNA 2WPIS 3MMGA 2PKSC 3DFJA 5EXMA 2A7CA 2BD9A 3DHKH 3F1SB 4ABAA 2ANYA 2ZO3H 3RXRA 1S81A 5SGAE 3RM2H 1GBDA 3EGKH 1W10U 1DX5M 3LONA 1D6RA 2WUBA 2ZEBA 5T6FA 2G51A 4X2YA 3RXLA 4CREA 3P17H 1H1BA 1GHAG 4NA7A 1HAOH 5A0BA 1YM0A 1TX7A 2NU4E 3F9GA 4MPWA 1KYNA 2ZDAH 3EA9A 1HAPH 2F9UA 3R0FA 2PKSB 4DJZB 1O2SA 3TVJB 3SJ8A 1HAVA 1HXEH 2F9BH 1GJ5H 1VR1H 2EI7A 1WUNH 4GSOA 1EAUA 2TRMA 1CHOF 1KXDA 1ID5H 4NZQA 1ZMLA 3SHCH 4AFSA 2GD4B 1E35B 1Z6JH 1O3HA 1LQEA 3GDUA 4FUBA 1DSTA 2Z9IA 3QDZB 4YT6H 1AVWA 2AIPA 3LOXA 2QYIA 1RTFB 5DGJA 2H9EH 5L2ZH 3SO3A 1A5IA 4FVDA 1WBGB 3TIUA 1D6WA 1G2LA 4H6TA 2H9TH 3HATH 5EODA 5FPTA 2ZFFH 4K69A 2ZF0H 1ZGVA 2FOAA 1XUGA 1TRNA 2A4RA 1SC8U 1C2JA 2VH6A 7GCHG 1DVAH 2B9LA 1SGRE 3HPTB 2ZECA 3VXFH 2WINI 4YESB 2NU3E 1T8NA 3TJUA 1GCDA 3E90B 3VEQB 3LT3A 5F8ZA 2Y82A 2EA3A 1BUIA 2TGPZ 4MPUA 2ZDVH 1H4WA 4I8JA 1KXBA 2FI5E 1C1RA 1A7SA 1V2WT 1NU9A 3VXEH 4Y6DA 3VB3A 4OGYA 1GJ6A 3KF2A 4NG9H 1MBQA 1IQLA 1D3QB 1GVLA 1YCPH 4IW4E 4B74A 2QCYA 2Y7ZA 3LKWA 4I32A 3P70B 4ZMAH 1Q3XA 3BG4C 2FOEA 3UREA 4BTIB 1HAZB 2P8OC 4J2YB 4MG3A 2OCVB 1SMFE 4MTBA 2EC9H 3Q3KA 1LHFH 3RU4D 1V2RT 1NRNH 3FFGA 5A8YA 2BD2A 1VZQH 2VH0A 1IQGA 1SLVB 1MH0A 1GI7B 1QGFA 1OWHA 5GPIB 2ZPQA 3BG4B 1UVOA 2J95A 1PPCE 1SGQE 5T6GA 1Z8JB 2P8OB 3K6ZA 3TK6A 2PW8H 1FV9A 4AYVB 1O35A 2HNTE 1QJ1B 1FN6A 3ZVGA 3M5NA 2GCHG 5EOKA 1HAXB 2BLOA 2I6QA 5FPSA 3QZRA 4BNRA 2Z9GA 1UK2A 4DG4A 1BCUH 1EPTA 1QBNA 4Y79A 4Q7ZA 3S7HB 1ZZZA 1RTKA 2A4GA 1SVPA 1C5PA 2ZDKA 3ZZDA 2QIQA 1LHEH 3MNSA 3HK6B 3BTWE 2GT7A 2R3YA 1KXAA 3JZ2B 3RXOA 4NFFA 1QB9A 1ETSH 2WPJS 4OS7A 2BY7X 2A5AA 1GVKB 2BTCE 4GLYA 1WTGH 4JMYA 3A8BA 3QK1A 4CRDA 5HMAA 1HCGA 2ANKH 1NFUA 2Q1JA 1GMHF 3A7TA 2BQ7B 2JETC 1O33A 1Y5AT 2B8OH 1MKXH 2F3CE 5H4IB 1IQHA 2FDAA 1GI1A 3ZZ5A 1O0DH 4OS5A 4X6MA 4X2WA 2G4UA 3RMOH 5FPYA 1HRTH 3U9AH 2ZFRH 1EUFA 4AB8A 3F9EA 2Z9JA 1RIWC 1QA7A 2BDAA 1AVXA 1SQAA 1FY1A 4WVPE 1RD3B 5A2MH 1SGTA 1KY9A 1MD7A 3LGIA 1TPSA 1ZRBA 3TNTA 1BOQA 2BY6X 1TNIA 4YOJA 2BVRH 3M3TA 1UCYE 2FESH 2Z94A 1QRWA 1MTWA 2JETB 2R2WU 2A2QH 1YPGH 2ILNA 5LPEA 3GCNA 1MCTA 4ISNA 3BSQA 1T7CA 1WAYB 2ZPSA 3M36A 1FIZA 5J4QA 1AD8H 1RIWB 2A5KA 1EAIA 3AW1A 3M5LA 3M7TA 4I8GA 2XBXA 1YPMH 1J15A 3SUFA 4AFUA 2WPLS 5T6DA 1LPZB 1AUTC 5FX5A 1TGSZ 3E0NB 4MPXA 3D62A 1O2VA 2YNBA 1DY9A 1Z6EA 1A0JA 1N6YA 1THRH 5DP3A 1IOEA 1LPKB 1SGIB 1C2KA 1VGCC 1OS8A 3T62A 1KDQB 1A0LA 2EI8A 2F9OA 1THPB 3U1JB 2XBWA 3S0NA 1ANDA 5EGMA 1DANH 4H4FA 2CF9H 2JH6D 3F6UH 3SZNA 4DOQA 1SPJA 3LH1A 2B7DH 3PTNA 4B2AA 1GJCB 4R8TB 1FNIA 1GBCA 4D76A 5DP4A 3ESTA 3KGPA 1V2TT 1QL7A 4DURA 1B5GH 4AOQA 2VIQA 3ZVCA 5A8ZA 3TK9A 3ZVFA 5L6NH 1SGCA 4X2XA 2PGQB 3T5FH 1VGCB 4O03A 2QC2A 2HGTH 2ANMH 1TLDA 2WV4A 3ATKA 1YPJH 1O2MA 4MNYA 3SU2A 1QQ4A 4NIVA 3URCA 2P3UB 5J4SA 1SHHB 1QA0A 3SV8A 1VJ9U 1SB1H 3P6ZB 1DXWA 5E2OA 1TRYA 3LGUA 5E0HA 3PWCA 2OBQA 1AE8H 2ODQA 1TRMA 1HB0B 1TPAE 3CP7A 3RM0H 4JZDH 2ZGBH 4YT7H 2FP7B 1HLTH 5C67A 5G4BA 1ZOMA 2TGAA 1DUAA 1O3AA 2WYJA 3RDZA 1Y8TA 3GCTF 1ZGIA 3SW2B 2AMDA 2IN2A 1C1SA 1FY5A 1ZLRA 1EX3A 3DA9B 3A80A 2BLWA 3GDSA 3TGIE 3UIRA 4UFFH 3W95A 1V2NT 3H5CB 3D49H 4AN7A 1YF4A 1F0SA 2AS9A 4ISOA 4Q7XA 1OSSA 2ZHFH 1TB6H 2OBOA 2ZCKP 1A2CH 5AFZH 3GOVB 2ZDNA 1H9LB 4DCDA 1OWEA 2SNVA 4K1TA 3A86A 1W3CA 1NZQH 5E0JA 1LKAA 1JMOH 1AB9C 5GCHG 1BTZA 1HJAC 1SBWA 1L2EA 1W0ZU 1Z8GA 4K3JA 1O3IA 4B2CA 2ZTYA 1K21H 3R3GB 1LKBA 3S69A 4MNWA 2LPRA 1N6XA 1F5KU 2BVXH 1YLCA 3VFEA 1D4PB 1BITA 1HAGE 3EA7A 1O3KA 1SHYA 3SI4H 1OOKB 5BRRE 1T32A 1G9IE 3TPIZ 2XNIA 1O3GA 2ZGJA 3PM3A 3QLPH 1SL3A 1IQFA 1AB9B 1AFEH 1C5LH 1LVBA 1HJAB 4AG2A 5I25A 1C5VA 1XKBC 2G81E 2HNTF 5A0CA 3H7OA 4ABFA 3RXSA 1Y5BT 1O31A 3RXJA 3SU1A 4KTCA 2HALA 1JWTA 2FO9A 4Q2KA 3FZDA 2BD7A 1O2RA 1A46H 3A8DA 3TK5A 2J38A 2Z9KA 1TBQH 3PB1E 7GCHF 4XBBA 3UWJH 1Y3YA 1BBRH 4UDWH 5JDUB 5A8XA 2H6MA 1UVPA 3I77A 2QXHA 1P9UA 2BMGB 1HFDA 3ZZ9A 2WPMS 2PSYA 5EXLA 2FS8A 4ISIH 5FX6A 1KXCA 1BZXE 5L30H 1MTVA 1CA8B 3RXHA 1FAXA 3A7YA 3U1IB 1RGQA 3M7QA 2ZGXH 4WH8A 4BAOB 1UTMA 1BTYA 3MO6A 4INHA 3EDXB 1MUEB 2ZHDA 5EW1H 2QGRA 4ABBA 2UWLA 2FOMB 1GI4A 1Z1JA 1Y3WA 2OC0A 1XUFA 2BYAX 3PTBA 2FPZA 1GDQA 2FXRA 4K5ZA 1WYKA 1TABE 3MH4A 3BTKE 1GMCF 1P3EA 3VGCC 4WY3A 4X6NA 1C4U2 1TIOA 2VNTA 1C5ZB 2BDYA 1F5LA 2C4FH 1BIOA 1GHWH 9ESTA 1C5MD 1ETRH 1LHDH 3ATWA 1S6HA 4CBOA 3P8GA 1IQKA 3RU4E 1TX8A 2XXLA 1V2ST 1XUJA 2ULLA 3SQEE 2CHAC 1ORFA 2F9PA 2VWMA 3ZVEA 1G3BA 3NUMA 3SGBE 1SGFA 3GY3A 3PYHA 1Y59T 4WMDA 3U69H 3BTGE 1S5SA 4ABIA 1UTLM 2ZHEH 2ZHWH 3GDVA 4VGCC 4HFPB 3A83A 3IITA 1QJ6B 3M5OA 4UD9H 3K9XB 4X1QU 4X8SH 2OTVA 1C1NA 1EQ9A 2H1UA 1T4UH 3VGCB 2BXUH 3MU4A 3ZYEA 3AAVA 2GCHF 3ELAH 4Q7YA 1NRPH 3SU6A 2C8WB 2KAIB 2PKAA 8GCHG 2BOKA 1S83A 1P01A 1M9UA 3Q3XA 2CHAB 1JRTA 2AEIH 1RS0A 2R2MB 1P2MA 4ZROA 1ZTLA 1W7XH 2OQ5A 1DM4B 1TBZH 1ZYOA 1OXGA 4VGCB 1BTUA 3RU4T 3RLYH 3OTJE 1IAUA 3JZ1B 1ELGA 1UTOA 2QXIA 3ODDA 3GY7A 1NY22 1C9PA 2Y6TA 3BN9A 2HNTC 1C1VH 4E7NA 1BRUP 1YYY1 5IDKA 3MH7A 1ZJKA 1UTJA 1Y3XA 1MZAA 2Z9LA 3ATIA 1EZUC 1NFXA 1NESE 3E91A 5ESBA 4X6PA 2J94A 2A5IA 1SLXB 1SGNE 3B23B 4HI3A 1TMBH 2BD8A 4JYTA 5AVDA 3TJVA 3GCHC 1O3EA 1E36B 1IQIA 1BTWA 2ZKSA 1ZJDA 4TY7A 1KSNA 2BDGA 2ZWLH 1A5GH 1ARBA 4ASHA 7KMEH 2GP9B 1A5HA 3UUZA 1C5UA 1VCPA 3SHAH 1OYQA 4K8YA 1EATA 3T25A 2TGTA 1K22H 2P93A 5DP8A 1C5YB 1C5QA 1O5GH 3UWIA 5GDSH 2XCNA 2UWPA 4A1TA 1LVOA 2GX4A 1GWAA 1O3LA 2FTMA 4IMZA 1ELFA 1GBIA 1HGTH 1GMDG 4DIHH 3A85A 2IPHA 2WUCA 5HM2A 3GCHB 2H2ZA 1DUEA 1MMJN 3AASA 3U98H 1GDUA 1SLWB 1IHTH 1G36A 1O5DH 1H8IH 1EXFA 1FY4A 3LDXH 5FAHA 1C2HA 3MU5A 3UTUH 1C4V2 1GI6A 5JPMH 1T8MA 1ETTH 2PTNA 1YCPK 3L6PA 1ELEE 4JYVH 2A32A 1ELTA 1AE5A 2CMYA 1DE7H 1C1UH 2XYAA 1SG8B 2FTLE 4YLQH 3CS0A 2PLXA 4X0WU 1GJDB 1BMLA 2GZ8A 1K9OE 3EA8A 1V2PT 4X1NU 4ZXYH 4IC6A 4FUHA 4Y0YE 3BEUA 2IJOB 1DDJA 3SV9A 3STJA 1CSOE 4ABHA 2PHBA 1GI9B 1SOTA 3M5MA 1T8OA 2BB4A 1V2OT 1FPHH 3TH4H 1UJ1A 1XKAC 5DK1A 1E38B 2G5VA 3A8CA 2PUQH 3A7WA 1CGJE 3BTTE 1PYTC 1MQ6A 1UTNA 1EJMA 3MI4A 1FONA 1CVWH 2SGQE 5FBIA 4ZKNU 1V3XA 1DLEA 1PPGE 1LCYA 1LVYA 3NXPA 4OS6A 3OU0A 4WJG2 1BRBE 3A87A 1GBHA 2ODPA 1CT2E 2PR3A 1O5EH 1MAXA 3EYDA 3P8NA 1YGCH 1NRQH 1NT1A 1QURH 3ODFA 3KL6A 4FVBA 5B6OA 4YTAA 4NSVA 1O34A 5DP9A 2GV6A 3W94A 1XUHA 1FZZA 1OP0A 3UNRA 1WSSH 1QBVH 4NIYA 2V3HH 1HXFH 2ZFQH 2ZP0H 5HM9A 1HAVB 2ZQ1A 5DP7A 2CJIA 2OXSA 1FDPA 1A3EH 4GHQA 3KNXA 2BVSH 2A7JA 4BAKB 3B8JA 5TCAA 3KEEA 1SGPE 3HKIB 1EJNA 4WH6A 5EQSA 3KN2A 2F83A 2V3OH 5EW2H 1C5TA 1ZHRA 2XRCA 1MU6B 3V0XA 1CGHA 2G00A 1OP8A 1Z8IB 3M3VA 2ZFPH 2NWNA 1AKSA 1GI3A 4BXWA 1AZ8A 4GCHG 1HPGA 4TWWA 1TQ0B 4HGCA 2HOBA 3VB7A 2A4OA 3MOCA 2VIDA 4NCYA 3TNSA 3GCOA 2VWOA 1P04A 3RMNH 2VWLA 5CE1A 1ZSJA 2A0QB 3SJKA 2Z3EA 1XMNB 4X1SU 4NIXA 1RJXB 1VITG 1C1TA 1FIWA 4JK5A 1VCWA 3MNXA 1BA8B 1EAWA 1F0TA 1ANCA 4ESTE 3TJNA 1KXEA 3A7VA 4UE7H 2A1DB 1W7GH 1S84A 1BRAA 3RXDA 2YOLA 2ZCLP 5T3HA 4TWYA 4AGJA 2EI6A 3BIUH 3RXUA 1DOJA 4Z0KA 1TGBA 2ZU5A 3BV9B 2HRVA 3TGKE 3RC5A 1O3MA 4ZXXH 1SQOA 1O2QA 1QB6A 3QGJA 3QUMP 5CHAB 1GI8B 4Y11E 4A92A 2P94A 1B7XB 2FMJA 1V2QT 3SNBA 3ZZ3A 1ZSKA 1PPFE 2M5TA 3UQVA 5C5OA 1C1QA 1K28D 1QR3E 4AX9H 2VJ1A 3M35A 2CXVA 1F92A 4ZKOU 2G4TA 2A45B 4GHTA 2Y5FA 1PPEE 2OC8A 5LH8A 2J34A 2TGDA 3WY8A 1C2GA 3FP8E 2FOHA 4DT7B 4CHAC 1YBWA 1ANBA 2SFAA 1SGEE 4I33A 1O2OA 1P02A 1UHBA 5DKMA 2HVXA 1C9TA 1EP5A 3HKJB 2G8TA 2W7UA 1AUJA 5DPAA 3ZVDA 1VJAU 3SGAE 4K1EA 2RA3A 3OX7U 2BY9X 1C2FA 3RLWH 3UOUA 2GTBA 1F0UA 3E3TA 2C8ZB 1QB1A 4CR9A 5LPRA 2FX6A 4ABEA 4ZHLU 2J9NA 2GDDA 3RC6A 1WCZA 1BQYA 3B9FH 2RG3A 2W3IA 1CHGA 2GZ9A 4JZFH 4XFQA 2ZZUH 1HDTH 1MKWH 3SUGA 1YCPM 4CHAB 4KTUA 1DWBH 1LDTT 4IMQA 4MVNA 3MYWA 4ZH8A 4E06H 3H7TA 4ISLA 3SU3A 1O5BB 2CGAA 4LXBH 3O8CA 4JK6A 1WTHD 1ZMNA 1XX9A 3CS7A 3OY6U 1TA6A 5C5NA 1L0ZA 1YPKH 1QQUA 1EKBB 3D23A 4FXGH 1UVUH 8GCHF 1HNEE 1MAYA 2PFEA 5GJ4B 3GYLB 3LGWA 1HV7A 3RXCA 3FVFB 3M37A 3UNSA 2BD5A 2C90B 1AU8A 4CH2B 1AY6H 2O8MA 1C2DA 4U30A 1SGYE 1QJ7B 1XXFA 4MPVA 3TLOA 3MWIU 4IN2A 2CV3A 3NPSA 3QO6A 1LQDB 3TGJE 3QN7A 5DG6A 3DUXH 1G3EA 4UFGH 5FCKA 6GCHF 2BZAA 3SNDA 1PQ5A 1JXPA 1O38A 5DO4H 2GVFA 2QV1A 1YPHE 1UTQA 2NU0E 3PWBA 1TX6A 4B2BA 1DS2E 1XXDA 2OQUA 1NTPA 2C93B 1PQ8A 1TNKA 8KME2 5F6MA 3FANA 2XWBI 1ZSLA 1P03A 4FU8A 2P3FH 1E0FD 1ELVA 2AIQA 1O3NA 2PUXB 2J2UA 1SR5C 1GJ4H 1ELAA 1P2KA 1P2JA 2RDLA 1BBRK 1FPCH 1AWFH 3C27B 1JRSA 1UK3A 4KTSA 4O3TA 1JIMA 4IS5A 1KXFA 1DWEH 5FBEA 1QRZA 1GMDF 2ZI2H 4YOIA 4HZHA 2ZQ2A 4Y76A 1G3DA 2QY0B 4K60A 4I8KA 1V2MT 3SGQE 3DFLA 1HIAA 1FUJA 5FHTA 1GHAF 1GCTC 1P0SH 3L3TA 2Z7FE 1OYTH 4KKDA 2H5CA 4RKJB 4YO9A 1C4Y2 5F03A 1UCYH 4AFQA 1EZXC 1J9CH 1C1OA 3ZZAA 3RXPA 3QGNB 4THNH 3URDA 1ZR0A 2BXTH 1J8AA 3ZZ7A 4BTTB 1C5OH 1KLJH 1GPZA 1HJ9A 3RXEA 5EG4A 3UNQA 2DE8A 1IQEA 1ZPBA 2ZA5A 4XDEA 3UFAA 4D9QA 2Y5GA 2W26A 1GJ9B 3MHWU 1GHVH 1NS3A 1GCTB 1FQ3A 4NA9H 4A7IB 4XE4A 1C5NH 4FUEA 1AMHA 4GVUA 1DICA 2ZFTA 1TNJA 3V12A 3FZZA 2O8WA 5E8EH 2H9HA 3F9HA 1P9SA 1UTKA 3ZZ6A 1NU7B 1AI8H 1VITH 1XUIA 3T29A 2Y7XA 4NGAH 3E1XB 2QA9E 1A61H 1W14U 4ZHAA 3E0PB 3UY9A 5DP5A 2STAE 4AFZA 1L4ZA 3GY4A 4D7FA 2OUAA 3RMLH 2R3UA 4PROA 1O2XA 4FUDA 4NA8A 3ZYDA 1GMHG 1ZHMA 4XOJA 3PLPA 2KAIA 5HGGA 1THSH 2QXJA 3F9FA 4FUIA 1KLIH 5C1YA 3ZVAA 1O2ZA 1GJAB 2FEQH 3M61U 4YZUA 1QL8A 1QNJA 1W0YH 3ITIA 3UR6A 1RTLA 1DFPA 2H5DA 1G2MA 1HAYB 2FLBH 5EQRA 1Z1IA 1AFQB 2GMTC 1JOUB 3HGPA 4JZIA 3S9BA 2OC1A 3BEIB 3GYMA 4E05H 2STBE 1PFXC 2FX4A 1W2KH 1C5XB 4BXSA 1KLTA 4KP0A 4RKOB 1HBTH 3QWCH 4TY6A 2BD4A 1MU8B 4WF8A 1Z71A 3FAOA 5JB8S 2AGIX 3V7TA 2ZU4A 4X1RU 3CENA 3UQOA 2FI3E 1QL9A 1DITH 5EPYA 3O8DA 3U8TH 1S0QA 4X8UH 3MH5A 1GGDC 1UVTH 1BHXB 4ABGA 1G3CA 2VVUA 2GMTB 1K1OA 4GCHF 1TFXA 3IWMA 4O3UA 1ACBE 2A2XH 1GBJA 2Z3CA 3BTHE 5K0HA 2WYGA 3P8FA 2A7HA 4AORA 2ZPRA 2VWNA 4TYDA 4WXIA 1P3CA 3SU0A 2AERH 1FI8A 2FWWA 2LNCA 2ZU2A 2UWOA 1VITF 2TBSA 4LK4A 1C5SA 1K1NA 2W5EA 1NFYA 2V6NA 1O2KA 1TNLA 1L1NA 1TPPA 1G30B 4JZ1A 3MNCA 2QF0A 1CE5A 1TYNA 2HWLB 4U32A 1GGDB 3PO1C 1AO5A 2FI4E 1BT7A 1GL0E 4Y0ZE 1GG6C 1XVOA 3NWUA 3MO9A 3RXMA 1GBEA 2FOGA 1C5RA 2D8WA 3E6PH 4BAMB 2RCEA 3SOSA 2XC5A 2XW9A 4UEHH 4Y8XA 1UMAH 4GUXA 1AZZA 1TGCA 1Q2WA 1W11U 3MU8A 1IQJA 2OC7A 3Q3YA 3SQHE 2VVVA 4ZHMU 3E8LA 2ZDMA 3UOPA 2ESTE 1BMAA 1LHGH 1P57B 2I6SA 4MNVA 4I7YH 4Y7BA 3PMBB 2C8YB 2K1QA 1EJAA 9LPRA 3PO1B 1V2LT 3RXGA 2JH5D 4Q80A 1GG6B 4FUGA 4TPIZ 1O30A 2VGCC 4KELA 1CGIE 1QTFA 3SUDA 2VIOA 1LPGB 3RXBA 2PWXA 3MU1A 1A4WH 1O3DA 4CRCA 1P2OA 1CO7E 1O3PB 3I78A 3A88A 3GY6A 2ZG0H 1C2IA 1GJBB 1GBBA 2FOFA 2ANWA 3SV6A 1O3OA 2BLQA 2XC4A 4YLUA 5A0AE 2PSXA 5F8TA 4UONA 5I46H 1O36A 3KHVA 1F2SE 3FP6E 3U8RH 1B0EA 1EASA 4I8HA 2CF8H 2BX3A 1GHBG 4B73A 2C8XB 1TE0A 4B75A 1LMWB 2VGCB 2R0KA 1SOZA 1D3TB 1LTOA 4DVAU 2VB0A 1EZQA 1GJ8B 1HJ8A 2PKAB 5HXFA 3RC4A 3ZZBA 4Y10E 2AGGX 1K1PA 4MNXA 3GISB 3E16B 1HUTH 1IQMA 2FIRH 4TPYA 5E0GA 4Z6AH 1PQ7A 3VB6A 1BRCE 1A0HB 1AGJA 2ASUB 1DWCH 2BY5X 1XUKA 2BD3A 4CH8B 4D9RA 3SBKA 2TPIZ 2ZIQH 4YOGA 4BANB 3RXAA 6ESTA 4JYUH 4FUCA 1ZTJA 5FXLA 3S9CA 2FYRA 1L1GA 3SV2H 1P8VC 2GGVB 2XBVA 4HTCH 3VB4A 3A84A 1SGFG 3SUEA 1C2LA 2GDEH 3K2UA 3A8AA 3SI3H 3SNAA 1ABJH 1J14A 1PPZA 1W12U 4UFDH 1TQ7B 2JKHA 2ZDLA 1MD8A 3SV7A 4I31A 3MO3A 2CN0H 5TCCA 3ZVBA 2SGPE 3QX5H 1GBTA 2OINA 3KQDA 1TA2A 3LJOA 4J1YA 4YM9A 2D1JA 3ZV9A 2Y5HA 3I29A 3LC5A 3KIDU 4M7GA 1O5AB 1K1IA 1Y3UA 1DPOA 1TGNA 1TNHA 3LPRA 5AF9H 4FU7A 2B5TB 1C5WB 4H6SB 4MQAA 3ZV8A 4CBNA 1BTPA 2C3SA 2VINA 1GHYH 1MZDA 4GPGA
chains in the Genus database with same CATH superfamily
1W8BH 2W7SA 4B76A 1ZTKA 1O3FA 1C2MA 4BAQB 1INCA 3O8BA 1FLEE 1GBKA 4Z1MD 1MKXK 3RMMH 1F5RA 1O2IA 1NRRH 3SORA 1YPHC 1KIGH 2FLRH 7LPRA 2WV5A 2ZU3A 2VU8E 1GMCG 1P06A 3GY8A 2O8UA 1O2UA 3TH3H 5IYTA 4XRNA 1O3CA 3P8OA 1W13U 3RXFA 5GCHF 1CBWC 2Q6GA 1TBRH 1AHTH 3LC3A 4U2WA 4CRBA 3TITA 1H8DH 4XBCA 2SGAA 3OY5U 5ETXA 2A31A 1JIRA 2VVCA 5IK2D 3S9AA 3EQ0H 1FJSA 2BDHA 5CHAC 1YLDA 2THFB 1GI5A 3VPKA 1K1LA 1CT4E 1QBOA 2FOCA 2Y81A 1QCPA 1P10A 1EP6A 1TGTA 1VCQA 1RXPA 6CHAC 1J17T 1OWJA 2BDCA 1LO6A 5CDFE 1LHCH 2ODYB 3F68H 2L6OA 1CBWB 1NC6A 3SJIA 2DUCA 2G52A 2NU1E 1MKWK 2GKVE 1D3PB 3PV4A 4A1XA 2G55A 3TU7H 3A81A 1BJUA 1FN8A 4YXWD 1YP9A 1EAXA 2AFQB 3DSOA 1ABIH 3S7KB 3LGVA 3VB5A 2Q6FA 2VIWA 2GCTC 1J16A 4RI0A 5C2ZA 1O3BA 1P09A 1SFQB 3PMJA 2HPPH 2BDBA 1O2GH 1FY8E 7ESTE 1KDQA 2GV7A 1O39A 1EOLA 6CHAB 1C2EA 3PROA 1KTSB 4O97A 1IQNA 1O2JA 3RXQA 1K2I1 4A6LA 1ELCA 1YPEH 2D26C 2BQWB 4D7GA 3PMHB 1Q31A 1EPTC 1MQ5A 1P2IA 1V2KT 1QFKH 2UUJB 4SGBE 3ENSB 1SLUB 2F9NA 1ESBA 3MU0A 2F4LA 4OS4A 3UR9A 2AGEX 1OWIA 4WXVA 2ALVA 2GCTB 2ZC9H 1D9IA 4D8NA 4WMFA 1AKSB 3L33A 3BEFB 4NWLA 3HGNA 8LPRA 2FZZA 3SNEA 1SGDE 4FUFA 2WPKS 1GL1A 1WQSA 3A7XA 1ZHPA 1UVSH 3BG8A 1TONA 5EU8A 1O5FH 1T8LA 4A5TS 4LZ4B 2ZCHP 3UB0A 1O2PA 5CMXH 1TPOA 1A3BH 2JH0D 4JCNA 1EPTB 1P05A 1MTUA 1SQTA 3K6YA 3KCGH 1CA0C 4RN6A 1NROH 2BY8X 1BDAA 1DSUA 1E79D 2WPHS 3RUOA 1SI5H 2P59A 4OGXA 5C1UA 2BZ6H 4X2VA 3ZZCA 3EE0B 1NM6A 1OKXA 3G01A 1OPHB 1O2NA 4Y8YA 1EB1H 4H42U 3T27A 4E7RG 2UUKB 1FMGA 2D2DA 2DE9A 2OD3B 4WMEA 4ABDA 3BTDE 5BPEA 2FYQA 2QN5T 3WWFA 3PRBA 3Q77A 4B71A 1HAIH 2EQNA 4XD7D 1HYLA 4F55A 2GZ7A 3RXIA 2F91A 1BBRE 3P92A 3HK3B 3SU5A 5LPFA 1CA0B 1NO9H 2EY4C 2IPQX 1CHOG 4DIIH 2BX4A 1YC0A 2BLVA 3NKKA 4LZ1H 3V13A 4CR5A 1O3JA 2QXGA 5DP6A 5C3NA 2XWAA 4DW2U 1GBMA 2HPQH 2P95A 5GXPA 1MTNC 1D3DB 1EOJA 1WV7H 3BIVH 1AN1E 3DT0H 1WQVH 4AB9A 1C1MA 1K1MA 2W3KA 1L1JA 2YNAA 2ZGHA 3ATLA 5PTPA 3RXKA 5JB9S 5JYIA 1UCYK 3TH2H 2A4QA 2O9QA 1ESTA 3KQEA 4NIWA 3SJOA 2PGBB 1BB0B 1NRSH 1UHBB 3A7ZA 1XM1A 4CRGA 4DGJA 1QRXA 1TNGA 1COWD 2O8TA 3D65E 2EEKA 4SGAE 1X7AC 3ZZ8A 1EZSC 1BHXF 3OSYA 1G32B 1B0FA 2FOBA 1TOMH 1Y5UT 3K65B 3OYPA 4FUJA 3STIA 1MTNB 1DT2A 1BTXA 1N1LA 5JBTA 2HLDD 1PPBH 1ELDE 3SJ9A 2IOTA 3IG6B 2ZHQH 1AIXH 5LGOA 1T4VH 1MTSA 1BMMH 2ZU1A 1PQAA 4XBDA 5GWZA 3AVZA 1UTPA 4FU9A 1QY6A 3LGTA 5AFYH 3M7UA 2Z6BD 4MLFB 3ATMA 4NSYA 4OS1A 4NWKA 2XNDD 1FAKH 1BMNH 5GNDA 2FODA 4AYYB 1S85A 1GHBF 1GDNA 1N8OC 1E34B 1S0RA 3LJJA 1GHZA 1ELBA 1MBMA 1ZMJA 1CT0E 1UO6A 1NPMA 3PMAB 1OP2A 3A89A 3DD2H 3NCLA 1O2TA 3RP2A 2OP9A 1SFIA 1ESAA 2F9VA 1HAHH 3AW0A 4OM9A 5K7RA 3FOAA 1P2NA 4ISHH 1WU1A 2P3TB 3A82A 3LIWA 4Y7AA 4CRAA 3LU9B 3M3SA 2J92A 1E1QD 5ABWA 4U01A 1FY3A 2O8LA 3N7OA 2K8IA 1N8OB 2R0LA 4WWYA 4AGKA 1ZPCA 2J4IA 1G37A 1S6FA 1PPHE 1O37A 2QAAA 3MTYA 2BM2A 2ZFSA 2AYWA 4IGDA 5E2PA 5JBAS 1P12E 4RSPA 2ZNKH 2UUFB 3QZQA 1RFNA 3GY5A 4INLA 2PV9B 3Q00A 5GIBA 3SN8A 2SNWA 2V0BA 2V35A 6LPRA 1C1WH 4I8LA 2G5NA 3BF6H 2SGFE 3O8RA 3MNBA 4LOYH 5FCRA 4R0IA 1GBLA 3P95A 4XSKU 2TIOA 1AFQC 5JBBS 3W1EA 4ZKRU 1QIXB 3PLBA 1TALA 4F4OC 5DJ7A 3MFJA 1O2LA 1ZPZA 1NBMD 4BOHA 1ARCA 1ZRKA 2J98A 2RA0A 2KM0A 2Z3DA 3OTPA 8ESTE 5F53A 1CU1A 4B1TA 1FX0B 1ANEA 1DY8A 3RXVA 1NFWA 1K1JA 3T26A 2BDIA 1TAWA 3BTME 4K8BA 1O2WA 4X1PU 3KQ5A 3QTVH 1O32A 4KGAA 1GI2A 2WV9A 3MH6A 1A1RA 1BJVA 2VIVA 2WPDD 4X6OA 4GAWA 1HIAB 4NZLA 1L4DA 1OX1A 2PTCE 1V2JT 1SSXA 1AVGH 5F8XA 1MCVA 3EAJA 2W6JD 1IHSH 2BOHB 4IC5A 1DXPA 2VIPA 2NU2E 3AAUA 3SNCA 1S82A 2YMSC 4OS2A 3BTFE 3GICB 1AWHB 4ZUHA 4CRFA 1BTHH 2XC0A 3T28A 4JZEH 5AHGH 4K2YA 4Y71A 4F49A 5JBCS 2B0FA 2AMPA 5ESTE 4Q63A 1GJ7B 3QTOH 3PLKA 1GI0A 4TT3D 1O2YA 3Q76A 3LGYA 2FS9A 1XVMA 2ZTZA 2AMQA 2GT8A 2OLGA 2QF3A 1O5CB 1PYTD 3NZIA 1NN6A 2FM2A 1O2HA 4IBLH 1V2UT 2YMSB 1E37B 1FXYA 5EJ1A 1AQ7A 4MDSA 1V6DA 2Q6DA 4M9FA 4DY7B 1LVMA 1GVZA 1UK4A 1KTTB 1QHRB 1TWXB 2SGEE 4NFEA 4A1VA 5EPNA 2XOKD 2BQ6B 4ABJA 3KQCA 2ZGCA 4X8VH 3SU4A 1CQQA 3TJOA 3LH3A 2HLCA 4X8TH 2UUYA 4BAHB 2AH4X 1TMTH 2JJ2D 3NK8A 4Y8ZA 3ZZ4A 5C1XA 3BTQE 3RXTA 1DLKB 1GBAA 4INKA 1Z7KA 3H09A 1RRKA 2ZTXA 1U6QA 5A09A 3KQBA 5L2YH 1Y3VA 2Y80A 1P11E 4QT8C 3GY2A 2ALPA 3C1KA 4ZKSU 2XTTB 1PJPA 2SGDE 4AG1A 2P16A 1OWKA 1EB2A 1C1PA 1GHXH 1H9HE 5TJXA 1YPLH 1GBFA 4K1SA 3UPEA 4B6FA 6GCHG 2R9PA 1V2VT 3U8OH 1YKTA 1TOCB 3V3MA 1Z8RA 1F0RA 5DN6D 5HYOA 3FP7E 1H9IE 2BHGA 1DWDH 2XCFA 1P2QA 5C20A 1OWDA 3BTEE 3T2NA 4UFEH 5EQQA 4IN1A 1F7ZA 1WOFA 1JBUH 3GCTG 2XBYA 4BTUB 1T31A 2JIZD 4ZAEA 4O9VA 4AZ2B 1TMUH 5EXNA 2WPIS 3MMGA 2PKSC 5C94A 3DFJA 5EXMA 2A7CA 2BD9A 3DHKH 3F1SB 4ABAA 1S6LA 2ANYA 2ZO3H 3RXRA 1S81A 5SGAE 3RM2H 2AHME 2V3MA 1GBDA 3EGKH 2WHXA 1W10U 1DX5M 3LONA 1D6RA 2WUBA 2ZEBA 5T6FA 2G51A 4X2YA 3RXLA 4CREA 3P17H 1H1BA 1GHAG 4NA7A 1HAOH 2WSSD 5A0BA 1YM0A 1TX7A 2NU4E 3F9GA 4MPWA 1KYNA 2ZDAH 3EA9A 1HAPH 2F9UA 3R0FA 2PKSB 4DJZB 1O2SA 3TVJB 3SJ8A 3F0PA 1HAVA 1HXEH 2F9BH 1GJ5H 1VR1H 2EI7A 1WUNH 4GSOA 1EAUA 2TRMA 1CHOF 1KXDA 1ID5H 4NZQA 1ZMLA 3SHCH 4AFSA 2GD4B 1E35B 1Z6JH 1O3HA 1LQEA 3GDUA 4FUBA 1DSTA 2Z9IA 3QDZB 4YT6H 1AVWA 2AIPA 3LOXA 2QYIA 1RTFB 5DGJA 2H9EH 5L2ZH 3SO3A 1A5IA 4FVDA 1WBGB 3TIUA 1D6WA 5FL7D 1G2LA 4H6TA 2H9TH 3HATH 5EODA 5FPTA 2ZFFH 4K69A 2ZF0H 1ZGVA 2FOAA 1XUGA 1TRNA 2A4RA 1SC8U 1C2JA 2RFKC 2VH6A 7GCHG 1DVAH 2B9LA 1SGRE 3HPTB 2ZECA 3VXFH 2WINI 4YESB 2NU3E 1T8NA 3TJUA 1GCDA 3E90B 3VEQB 3LT3A 5F8ZA 2Y82A 2EA3A 1BUIA 2TGPZ 4MPUA 2ZDVH 1H4WA 4I8JA 1KXBA 2FI5E 1C1RA 1A7SA 1V2WT 3F2HA 1NU9A 3VXEH 4Y6DA 3VB3A 4OGYA 1GJ6A 3KF2A 4NG9H 1MBQA 1IQLA 1D3QB 1GVLA 1YCPH 4IW4E 4B74A 2QCYA 2Y7ZA 3LKWA 4I32A 3P70B 4ZMAH 1Q3XA 3BG4C 2FOEA 3FKSD 3UREA 4BTIB 1HAZB 2P8OC 4J2YB 4MG3A 1SQRA 2OCVB 1SMFE 4MTBA 2EC9H 3Q3KA 1LHFH 3RU4D 1V2RT 1BMFD 1NRNH 3FFGA 5A8YA 2BD2A 1VZQH 2VH0A 1IQGA 1SLVB 1MH0A 1GI7B 1QGFA 1OWHA 5GPIB 2ZPQA 3BG4B 1UVOA 2J95A 1PPCE 1SGQE 5T6GA 1Z8JB 2P8OB 3K6ZA 3TK6A 2PW8H 1FV9A 4AYVB 1O35A 2HNTE 3ZIAD 1QJ1B 1FN6A 5T1VA 3ZVGA 1W0JD 2GCHG 3M5NA 1HAXB 2BLOA 2I6QA 5EOKA 3QZRA 5FPSA 5EJLA 4BNRA 2Z9GA 1UK2A 4DG4A 1BCUH 1EPTA 1QBNA 4Y79A 4Q7ZA 3S7HB 1ZZZA 1RTKA 2A4GA 1SVPA 1C5PA 2ZDKA 3ZZDA 2QIQA 1LHEH 3MNSA 3HK6B 5KGOA 3KYFA 3BTWE 2GT7A 2R3YA 1KXAA 3JZ2B 3RXOA 4NFFA 1QB9A 1ETSH 2WPJS 4OS7A 2BY7X 2A5AA 1GVKB 2BTCE 3GS9A 4GLYA 1WTGH 4JMYA 3A8BA 3QK1A 4CRDA 5HMAA 1HCGA 1NBME 2ANKH 3CNRA 1NFUA 2Q1JA 1GMHF 1MABB 3A7TA 2BQ7B 2JETC 5C0TA 1O33A 1Y5AT 2B8OH 1MKXH 2F3CE 5H4IB 1IQHA 2FDAA 1GI1A 3ZZ5A 1O0DH 4OS5A 4X6MA 4X2WA 2G4UA 3RMOH 5FPYA 1HRTH 3U9AH 2ZFRH 1EUFA 4AB8A 3F9EA 2Z9JA 1RIWC 1QA7A 2BDAA 1AVXA 1SQAA 1FY1A 4WVPE 1RD3B 5A2MH 3OAAD 1SGTA 1KY9A 1MD7A 3LGIA 1TPSA 1ZRBA 3TNTA 1BOQA 2BY6X 1TNIA 4YOJA 2BVRH 3M3TA 1UCYE 2FESH 2Z94A 2KZ4A 2KCOA 1QRWA 4ACAA 1MTWA 2JETB 2R2WU 3UAIC 2A2QH 1YPGH 2ILNA 5LPEA 3GCNA 1MCTA 4ISNA 3BSQA 1T7CA 1WAYB 2ZPSA 3DSGA 3M36A 1FIZA 5J4QA 1AD8H 1RIWB 2A5KA 1EAIA 3AW1A 3M5LA 3M7TA 4I8GA 2XBXA 5HIYA 1YPMH 1J15A 3SUFA 4AFUA 5C17A 5C0UA 2WPLS 5T6DA 1LPZB 1AUTC 5FX5A 1TGSZ 3E0NB 4MPXA 3D62A 1O2VA 2YNBA 1DY9A 1Z6EA 1A0JA 1N6YA 1THRH 5DP3A 1IOEA 1LPKB 1SGIB 3UOPA 1WXRA 1C2KA 1VGCC 1OS8A 3T62A 1KDQB 1A0LA 2EI8A 2LELA 2F9OA 1THPB 2WZQA 3U1JB 2XBWA 3S0NA 1ANDA 5EGMA 1DANH 4H4FA 2CF9H 2JH6D 3F6UH 3SZNA 4DOQA 1SPJA 3LH1A 2B7DH 3PTNA 4B2AA 1GJCB 4R8TB 1FNIA 1GBCA 4D76A 5DP4A 3ESTA 3KGPA 1V2TT 1QL7A 4DURA 1B5GH 4AOQA 2VIQA 3PV5A 3ZVCA 5A8ZA 3TK9A 3ZVFA 5L6NH 1SGCA 3F0OA 4X2XA 2PGQB 3T5FH 1VGCB 4O03A 2QC2A 2HGTH 2ANMH 1TLDA 2WV4A 3ATKA 1YPJH 1O2MA 4MNYA 3SU2A 1QQ4A 4NIVA 3URCA 2P3UB 1H8ED 1SHHB 1QA0A 5J4SA 3SV8A 1VJ9U 1SB1H 3P6ZB 1DXWA 5E2OA 1TRYA 3LGUA 5E0HA 5EJZA 3PWCA 2OBQA 1AE8H 2ODQA 1TRMA 1HB0B 1TPAE 3CP7A 3RM0H 4JZDH 2ZGBH 3DCLA 4YT7H 2FP7B 2KR7A 1HLTH 5C67A 5G4BA 1ZOMA 2TGAA 3OEED 1DUAA 1O3AA 2WYJA 3RDZA 1Y8TA 3GCTF 1ZGIA 3SW2B 2AMDA 2IN2A 1C1SA 1FY5A 1ZLRA 1EX3A 3DA9B 3A80A 2BLWA 3GDSA 3TGIE 3UIRA 4UFFH 3W95A 2QE7D 1V2NT 3H5CB 3D49H 4AN7A 1YF4A 1F0SA 2AS9A 4ISOA 1WDIA 4Q7XA 1OSSA 2ZHFH 1E1RD 1TB6H 2OBOA 2ZCKP 1A2CH 5AFZH 3GOVB 2ZDNA 1H9LB 4DCDA 1OWEA 2SNVA 3N7EA 4K1TA 3OEHD 3A86A 1W3CA 1NZQH 5E0JA 1LKAA 1JMOH 1AB9C 5GCHG 1BTZA 1HJAC 1SBWA 1L2EA 1W0ZU 1Z8GA 4K3JA 1O3IA 4B2CA 1EFRD 2ZTYA 1K21H 3R3GB 1LKBA 3S69A 4MNWA 2LPRA 1N6XA 1F5KU 2BVXH 1YLCA 3VFEA 1D4PB 1BITA 1HAGE 3EA7A 1O3KA 1SHYA 3SI4H 2KX4A 1OOKB 5BRRE 1T32A 1G9IE 3TPIZ 2XNIA 1O3GA 2ZGJA 3PM3A 3QLPH 1SL3A 5CHBA 1IQFA 1AB9B 1AFEH 1C5LH 1LVBA 1HJAB 4AG2A 5I25A 1C5VA 1XKBC 2G81E 2HNTF 5A0CA 3H7OA 4ABFA 3RXSA 1Y5BT 1O31A 3RXJA 3SU1A 4KTCA 2HALA 1JWTA 2FO9A 4Q2KA 3FZDA 2BD7A 1O2RA 1A46H 3A8DA 3TK5A 2J38A 2Z9KA 1TBQH 3PB1E 7GCHF 4XBBA 3NRLA 3UWJH 1Y3YA 1BBRH 4UDWH 5JDUB 5A8XA 2H6MA 1UVPA 3I77A 2QXHA 1P9UA 2BMGB 2PP6A 1HFDA 3ZZ9A 2WPMS 2PSYA 5EXLA 2FS8A 4ISIH 5FX6A 1KXCA 1BZXE 5L30H 1MTVA 1CA8B 3RXHA 1FAXA 3A7YA 3U1IB 1RGQA 3M7QA 1VKYA 2ZGXH 4WH8A 4BAOB 1UTMA 1BTYA 3MO6A 4INHA 3EDXB 1MUEB 2ZHDA 5EW1H 2QGRA 4ABBA 2UWLA 2FOMB 1GI4A 4FETA 1Z1JA 1Y3WA 2OC0A 1XUFA 2BYAX 3PTBA 3WW7A 2FPZA 1GDQA 2FXRA 4K5ZA 1WYKA 2CK3D 1TABE 3MH4A 3BTKE 1GMCF 1P3EA 3VGCC 4WY3A 4X6NA 1C4U2 1TIOA 2VNTA 1C5ZB 2BDYA 1F5LA 2C4FH 1BIOA 1GHWH 9ESTA 1C5MD 1ETRH 1LHDH 3ATWA 1S6HA 4CBOA 3P8GA 1IQKA 3RU4E 1TX8A 2XXLA 1V2ST 1XUJA 3EE7A 2ULLA 3SQEE 2CHAC 1ORFA 2F9PA 2VWMA 3ZVEA 1G3BA 3NUMA 3SGBE 1SGFA 3GY3A 1SKYE 5HKKD 3PYHA 1Y59T 4WMDA 3U69H 3BTGE 1S5SA 4ABIA 1UTLM 2ZHEH 2ZHWH 3GDVA 4VGCC 4HFPB 5EIYA 3A83A 3IITA 1QJ6B 3M5OA 4UD9H 3K9XB 4X1QU 4X8SH 2OTVA 1C1NA 1EQ9A 2H1UA 1T4UH 3VGCB 2BXUH 3MU4A 3ZYEA 3AAVA 2J98B 2GCHF 3ELAH 4Q7YA 1NRPH 1UW7A 3SU6A 2C8WB 2KAIB 2PKAA 8GCHG 2BOKA 1S83A 3OFND 1P01A 1M9UA 3Q3XA 2CHAB 1JRTA 2AEIH 1RS0A 2R2MB 1P2MA 4ZROA 1ZTLA 1W7XH 2OQ5A 1DM4B 1TBZH 1ZYOA 1OXGA 4VGCB 1BTUA 3RU4T 3RLYH 3OTJE 1IAUA 3JZ1B 1ELGA 1UTOA 2QXIA 3ODDA 3GY7A 1NY22 1C9PA 2Y6TA 3BN9A 2HNTC 1C1VH 4E7NA 1BRUP 1YYY1 5IDKA 3MH7A 1ZJKA 1UTJA 1Y3XA 1MZAA 2Z9LA 3ATIA 1EZUC 1NFXA 1NESE 3E91A 5ESBA 4X6PA 2J94A 2A5IA 1SLXB 1SGNE 3B23B 4HI3A 1TMBH 2BD8A 4JYTA 5AVDA 3TJVA 3GCHC 1O3EA 1E36B 1IQIA 1BTWA 2ZKSA 1ZJDA 4TY7A 1KSNA 2BDGA 1K0HA 2ZWLH 1A5GH 1ARBA 4ASHA 7KMEH 2GP9B 1A5HA 3UUZA 1C5UA 1VCPA 3SHAH 1OYQA 4K8YA 1EATA 3T25A 2TGTA 1K22H 2P93A 5DP8A 1C5YB 1C5QA 1O5GH 3UWIA 5GDSH 2XCNA 2UWPA 4A1TA 1LVOA 2GX4A 1GWAA 1O3LA 2FTMA 4IMZA 1ELFA 1GBIA 1HGTH 1GMDG 4DIHH 3A85A 2IPHA 2W6ID 2WUCA 5HM2A 3GCHB 2H2ZA 1DUEA 1MMJN 3AASA 2KCPA 3U98H 1GDUA 1SLWB 1IHTH 1G36A 2JDID 1O5DH 1H8IH 1EXFA 1FY4A 3LDXH 5FAHA 1C2HA 2IJD1 3MU5A 3UTUH 1C4V2 1GI6A 5JPMH 1T8MA 1ETTH 2PTNA 1YCPK 3L6PA 1ELEE 4JYVH 3PRDA 2A32A 2K0QA 1ELTA 1AE5A 1QZ8A 2CMYA 1DE7H 1C1UH 2XYAA 1SG8B 2FTLE 4YLQH 3CS0A 2PLXA 4X0WU 4ZCNA 1GJDB 1BMLA 2GZ8A 1K9OE 3EA8A 1V2PT 4X1NU 4ZXYH 4IC6A 4FUHA 4Y0YE 3BEUA 2IJOB 1DDJA 3SV9A 4FOUC 3STJA 1CSOE 4ABHA 2PHBA 1GI9B 1SOTA 3M5MA 1T8OA 2BB4A 1V2OT 1FPHH 3TH4H 1UJ1A 1XKAC 5DK1A 1E38B 2G5VA 3A8CA 2PUQH 3A7WA 1CGJE 3BTTE 5HIZA 1PYTC 1MQ6A 1UTNA 4B6EA 1EJMA 3MI4A 1FONA 1CVWH 2SGQE 5FBIA 4ZKNU 1V3XA 1DLEA 1PPGE 1LCYA 1LVYA 3NXPA 4OS6A 3OU0A 4WJG2 1BRBE 3A87A 1GBHA 2ODPA 1CT2E 2KCYA 2PR3A 1O5EH 1MAXA 3EYDA 3P8NA 1YGCH 1NRQH 1NT1A 1QURH 3ODFA 3KL6A 4FVBA 5B6OA 4YTAA 4NSVA 1O34A 5DP9A 2GV6A 3W94A 1XUHA 1FZZA 1OP0A 3UNRA 1WSSH 1QBVH 4NIYA 2V3HH 1HXFH 2ZFQH 2ZP0H 5HM9A 1HAVB 2ZQ1A 5DP7A 2CJIA 2OXSA 1FDPA 1A3EH 4GHQA 3KNXA 2BVSH 2A7JA 4BAKB 3B8JA 5TCAA 3KEEA 1SGPE 3HKIB 1EJNA 4WH6A 5EQSA 3KN2A 2F83A 2V3OH 5EW2H 1C5TA 1ZHRA 2XRCA 1MU6B 3V0XA 1CGHA 2G00A 1OP8A 1Z8IB 3M3VA 2ZFPH 2NWNA 1AKSA 1GI3A 4BXWA 1AZ8A 4GCHG 1HPGA 4TWWA 1TQ0B 2RDEA 4HGCA 2HOBA 3VB7A 2A4OA 3MOCA 2VIDA 3F2FA 4NCYA 3TNSA 3GCOA 2VWOA 3AK5A 1P04A 3RMNH 2VWLA 4F48B 5CE1A 1ZSJA 2A0QB 3SJKA 2Z3EA 1XMNB 4X1SU 4NIXA 1RJXB 1VITG 5DSFA 1C1TA 1FIWA 4JK5A 1VCWA 3MNXA 1BA8B 1EAWA 1F0TA 1ANCA 4ESTE 3TJNA 1KXEA 3A7VA 4UE7H 2A1DB 1W7GH 1S84A 1BRAA 4P00A 3RXDA 2YOLA 2ZCLP 5T3HA 4TWYA 4AGJA 2KCAA 2EI6A 3BIUH 3RXUA 1DOJA 4Z0KA 2QF5A 1TGBA 2ZU5A 3BV9B 2HRVA 3TGKE 3RC5A 1H8HD 1O3MA 4ZXXH 1SQOA 1O2QA 1QB6A 3QGJA 3QUMP 5CHAB 1GI8B 3F2GA 3WWBA 4Y11E 4A92A 2P94A 1B7XB 2FMJA 1V2QT 3SNBA 3ZZ3A 1ZSKA 1PPFE 2M5TA 3UQVA 5C5OA 1C1QA 1K28D 1QR3E 4AX9H 2VJ1A 3M35A 2CXVA 1F92A 4ZKOU 2G4TA 2A45B 4GHTA 2Y5FA 1PPEE 2OC8A 5LH8A 2J34A 2TGDA 3WY8A 1C2GA 3FP8E 2FOHA 4DT7B 4CHAC 1YBWA 1ANBA 2SFAA 1SGEE 4I33A 1O2OA 1P02A 1UHBA 5DKMA 5B6LA 2HVXA 1C9TA 1EP5A 3HKJB 2G8TA 2W7UA 1AUJA 5DPAA 3ZVDA 1VJAU 3SGAE 4K1EA 2RA3A 3OX7U 2BY9X 1C2FA 3RLWH 3UOUA 2GTBA 1F0UA 3E3TA 2C8ZB 1QB1A 4CR9A 5LPRA 2FX6A 4ABEA 4ZHLU 2J9NA 2GDDA 3RC6A 1WCZA 1BQYA 3B9FH 2RG3A 2W3IA 1CHGA 2GZ9A 4JZFH 4XFQA 2ZZUH 1HDTH 1MKWH 3SUGA 1YCPM 4CHAB 4KTUA 1DWBH 1LDTT 4IMQA 4MVNA 3MYWA 3DSPA 4ACBA 4ZH8A 4E06H 3H7TA 4ISLA 3SU3A 1O5BB 2CGAA 4LXBH 3O8CA 4JK6A 1WTHD 3U28C 1ZMNA 1XX9A 4P02A 3PV2A 3CS7A 3OY6U 1TA6A 4HG6A 5C5NA 1L0ZA 1YPKH 1QQUA 1EKBB 3D23A 4FXGH 1UVUH 8GCHF 1HNEE 1MAYA 2PFEA 5GJ4B 3GYLB 3LGWA 1HV7A 3RXCA 3FVFB 3M37A 3UNSA 2BD5A 2C90B 1AU8A 1YLNA 4CH2B 1AY6H 2O8MA 1C2DA 4U30A 1SGYE 1QJ7B 1XXFA 4MPVA 3TLOA 3MWIU 4IN2A 2CV3A 3NPSA 3QO6A 1LQDB 3TGJE 3QN7A 5DG6A 3DUXH 1G3EA 4UFGH 5FCKA 6GCHF 2BZAA 3SNDA 1PQ5A 1JXPA 3MQKC 1O38A 2YMSD 2GVFA 2QV1A 5DO4H 1YPHE 1UTQA 2NU0E 3PWBA 1TX6A 4B2BA 1DS2E 1XXDA 2OQUA 1NTPA 2C93B 1PQ8A 1TNKA 8KME2 5F6MA 3FANA 2XWBI 1ZSLA 1P03A 4FU8A 2P3FH 1E0FD 1ELVA 2AIQA 2OK5A 1O3NA 2PUXB 2J2UA 1SR5C 1GJ4H 1ELAA 1P2KA 1P2JA 2RDLA 1BBRK 1FPCH 1AWFH 3C27B 1JRSA 1UK3A 4KTSA 4O3TA 3F3BA 2VBCA 1JIMA 4IS5A 1KXFA 1DWEH 5FBEA 1QRZA 1GMDF 2ZI2H 4YOIA 4HZHA 2ZQ2A 4Y76A 1G3DA 2QY0B 4K60A 4I8KA 1V2MT 3SGQE 3DFLA 1HIAA 1FUJA 5FHTA 1GHAF 1GCTC 3N7DA 1P0SH 3L3TA 2Z7FE 1OYTH 4KKDA 2H5CA 4RKJB 4YO9A 1C4Y2 5F03A 1UCYH 4AFQA 1EZXC 1J9CH 1C1OA 5KEDA 3ZZAA 3RXPA 3QGNB 4THNH 3URDA 1ZR0A 2BXTH 1J8AA 3ZZ7A 4BTTB 4RT1A 1C5OH 1KLJH 1YWUA 1GPZA 1HJ9A 3RXEA 5EG4A 3UNQA 2DE8A 1IQEA 1ZPBA 2ZA5A 4XDEA 3UFAA 4D9QA 2Y5GA 2W26A 1GJ9B 3MHWU 1GHVH 1NS3A 1GCTB 1FQ3A 4NA9H 2L74A 4A7IB 4XE4A 1C5NH 4FUEA 2J5UA 1AMHA 4GVUA 2J97A 1DICA 2ZFTA 1TNJA 3V12A 3FZZA 2O8WA 5E8EH 2H9HA 3F9HA 1P9SA 1UTKA 3ZZ6A 1NU7B 1AI8H 1VITH 1XUIA 3T29A 2Y7XA 2QF4A 4NGAH 3E1XB 2QA9E 1A61H 1W14U 4ZHAA 3E0PB 3UY9A 5DP5A 1KMHB 2STAE 4AFZA 1L4ZA 3GY4A 4D7FA 2OUAA 3RMLH 2R3UA 4PROA 1O2XA 4FUDA 4NA8A 3ZYDA 1GMHG 1ZHMA 4XOJA 3PLPA 2KAIA 5HGGA 1THSH 2QXJA 3F9FA 4FUIA 1KLIH 5C1YA 3ZVAA 1O2ZA 1GJAB 2FEQH 3FO8D 3M61U 4YZUA 1QL8A 1QNJA 1W0YH 3ITIA 3UR6A 1RTLA 1DFPA 2H5DA 1G2MA 1HAYB 2FLBH 5EQRA 1Z1IA 1AFQB 2GMTC 1JOUB 3HGPA 4JZIA 3S9BA 2OC1A 3BEIB 3GYMA 4E05H 2STBE 1PFXC 1YY3A 2FX4A 1W2KH 1C5XB 4BXSA 1KLTA 4KP0A 2M2AA 4RKOB 1HBTH 3QWCH 4TSFD 4TY6A 2BD4A 1MU8B 4WF8A 1Z71A 3FAOA 5JB8S 2AGIX 3V7TA 2ZU4A 4X1RU 3CENA 3UQOA 2FI3E 1QL9A 1DITH 5EPYA 3O8DA 3U8TH 1S0QA 2GJGA 4X8UH 3MH5A 1GGDC 1UVTH 1BHXB 4ABGA 1G3CA 2VVUA 2GMTB 1K1OA 4GCHF 1TFXA 3IWMA 4O3UA 5KECA 1ACBE 2A2XH 1GBJA 2Z3CA 3BTHE 5K0HA 2WYGA 3P8FA 2A7HA 4AORA 2ZPRA 2VWNA 4TYDA 4WXIA 1P3CA 3SU0A 2AERH 1FI8A 2FWWA 3FN8A 2LNCA 2ZU2A 2UWOA 1VITF 2TBSA 4LK4A 1C5SA 1K1NA 2W5EA 1NFYA 2V6NA 1O2KA 1TNLA 1L1NA 1TPPA 1G30B 4JZ1A 3MNCA 2QF0A 1CE5A 1TYNA 2HWLB 4U32A 1GGDB 3PO1C 1AO5A 2FI4E 1BT7A 1GL0E 4Y0ZE 1GG6C 4AC9A 1XVOA 3NWUA 3MO9A 3RXMA 1GBEA 2FOGA 1C5RA 2D8WA 3E6PH 4BAMB 4Q4LA 2RCEA 3SOSA 2XC5A 2XW9A 4UEHH 4Y8XA 1UMAH 4GUXA 1AZZA 1TGCA 1Q2WA 1W11U 3MU8A 1OHHD 3SZEA 1IQJA 2OC7A 3Q3YA 3SQHE 2VVVA 4ZHMU 3E8LA 2ZDMA 4RT0A 2ESTE 1BMAA 1LHGH 1P57B 2I6SA 2V7QD 4MNVA 4I7YH 4Y7BA 3PMBB 2C8YB 2K1QA 1EJAA 9LPRA 3PO1B 1V2LT 3RXGA 2JH5D 4Q80A 1GG6B 4FUGA 4TPIZ 1O30A 2VGCC 4KELA 1CGIE 1QTFA 3SUDA 2VIOA 1LPGB 3RXBA 2PWXA 3MU1A 1A4WH 1O3DA 4CRCA 1P2OA 1CO7E 1O3PB 3I78A 3A88A 3GY6A 2ZG0H 1C2IA 1GJBB 1GBBA 2FOFA 2ANWA 3SV6A 1O3OA 2BLQA 2XC4A 4YLUA 5A0AE 2PSXA 5F8TA 4UONA 5I46H 1O36A 3KHVA 3N99A 1F2SE 3FP6E 3U8RH 1B0EA 1EASA 4I8HA 2CF8H 2BX3A 1GHBG 4B73A 2C8XB 1TE0A 4B75A 1LMWB 2VGCB 2R0KA 1SOZA 1D3TB 1LTOA 4DVAU 2VB0A 1EZQA 1GJ8B 1HJ8A 2PKAB 5HXFA 3RC4A 3ZZBA 4Y10E 2AGGX 1K1PA 4MNXA 3GISB 3E16B 1HUTH 1IQMA 2FIRH 4TPYA 5E0GA 4Z6AH 1PQ7A 3VB6A 1BRCE 1A0HB 1AGJA 2ASUB 2HVYB 1DWCH 2F43B 2BY5X 1XUKA 2BD3A 4CH8B 4D9RA 3SBKA 2TPIZ 2ZIQH 4YOGA 4BANB 3RXAA 6ESTA 4JYUH 4FUCA 1ZTJA 3OE7D 5FXLA 3S9CA 2KFWA 2FYRA 1L1GA 2JJ1D 3SV2H 1P8VC 2GGVB 2XBVA 4HTCH 3VB4A 3A84A 1SGFG 3SUEA 1C2LA 2GDEH 3K2UA 3A8AA 4DT4A 3SI3H 3SNAA 1ABJH 1J14A 1PPZA 1W12U 4UFDH 1TQ7B 1W0KD 2JKHA 2ZDLA 1MD8A 3VG8A 3SV7A 4I31A 3MO3A 2CN0H 5TCCA 3ZVBA 2SGPE 3QX5H 1GBTA 2OINA 3KQDA 1TA2A 3SYJA 3LJOA 4ASUD 4J1YA 4YM9A 2D1JA 3ZV9A 2Y5HA 3I29A 3LC5A 3KIDU 4M7GA 1O5AB 1K1IA 1Y3UA 1DPOA 1TGNA 1TNHA 3LPRA 5AF9H 4FU7A 2B5TB 1C5WB 4I86A 4H6SB 2LP6A 4MQAA 3ZV8A 3KYGA 4CBNA 1BTPA 2C3SA 2VINA 1GHYH 1MZDA 4GPGA
chains in the Genus database with same CATH topology
1W8BH 2W7SA 4B76A 1ZTKA 1O3FA 1C2MA 4BAQB 1INCA 3O8BA 1FLEE 1GBKA 1MKXK 3RMMH 1F5RA 1O2IA 1NRRH 3SORA 1YPHC 1KIGH 2FLRH 7LPRA 2WV5A 2ZU3A 2VU8E 1GMCG 1P06A 3GY8A 2O8UA 1O2UA 3TH3H 5IYTA 1O3CA 3P8OA 1W13U 3RXFA 5GCHF 1CBWC 2Q6GA 1TBRH 1AHTH 3LC3A 4U2WA 4CRBA 3TITA 1H8DH 4XBCA 2SGAA 3OY5U 5ETXA 2A31A 1JIRA 2VVCA 3S9AA 3EQ0H 1FJSA 2BDHA 5CHAC 1YLDA 2THFB 1GI5A 3VPKA 1K1LA 1CT4E 1QBOA 2FOCA 2Y81A 1QCPA 1P10A 1EP6A 1TGTA 1VCQA 1RXPA 6CHAC 1J17T 1OWJA 2BDCA 1LO6A 1LHCH 2ODYB 3F68H 1CBWB 1NC6A 3SJIA 2DUCA 2G52A 2NU1E 1MKWK 2GKVE 1D3PB 3PV4A 4A1XA 2G55A 3TU7H 3A81A 1BJUA 1FN8A 1YP9A 1EAXA 2AFQB 1ABIH 3S7KB 3LGVA 3VB5A 2Q6FA 2VIWA 2GCTC 1J16A 5C2ZA 1O3BA 1P09A 1SFQB 3PMJA 2HPPH 2BDBA 1O2GH 1FY8E 7ESTE 1KDQA 2GV7A 1O39A 1EOLA 6CHAB 1C2EA 3PROA 1KTSB 4O97A 1IQNA 1O2JA 3RXQA 1K2I1 4A6LA 1ELCA 1YPEH 2D26C 2BQWB 4D7GA 3PMHB 1Q31A 1EPTC 1MQ5A 1P2IA 1V2KT 1QFKH 2UUJB 4SGBE 3ENSB 1SLUB 2F9NA 1ESBA 3MU0A 4OS4A 3UR9A 2AGEX 1OWIA 4WXVA 2ALVA 2GCTB 2ZC9H 1D9IA 4D8NA 4WMFA 1AKSB 3L33A 3BEFB 4NWLA 3HGNA 8LPRA 2FZZA 3SNEA 1SGDE 4FUFA 2WPKS 1GL1A 1WQSA 3A7XA 1ZHPA 1UVSH 3BG8A 1TONA 5EU8A 1O5FH 1T8LA 4A5TS 4LZ4B 2ZCHP 1O2PA 5CMXH 1TPOA 1A3BH 2JH0D 4JCNA 1EPTB 1P05A 1MTUA 1SQTA 3K6YA 3KCGH 1CA0C 4RN6A 1NROH 2BY8X 1BDAA 1DSUA 2WPHS 3RUOA 1SI5H 2P59A 4OGXA 5C1UA 2BZ6H 4X2VA 3ZZCA 3EE0B 1NM6A 1OKXA 3G01A 1OPHB 1O2NA 4Y8YA 1EB1H 4H42U 3T27A 4E7RG 2UUKB 1FMGA 2D2DA 2DE9A 2OD3B 4WMEA 4ABDA 3BTDE 5BPEA 2FYQA 2QN5T 4B71A 3Q77A 1HAIH 1HYLA 2GZ7A 3RXIA 2F91A 1BBRE 3P92A 3HK3B 3SU5A 5LPFA 1CA0B 1NO9H 1CHOG 4DIIH 2BX4A 1YC0A 2BLVA 3NKKA 4LZ1H 3V13A 4CR5A 1O3JA 2QXGA 5DP6A 5C3NA 2XWAA 4DW2U 1GBMA 2HPQH 2P95A 5GXPA 1MTNC 1D3DB 1EOJA 1WV7H 3BIVH 1AN1E 3DT0H 1WQVH 4AB9A 1C1MA 1K1MA 2W3KA 1L1JA 2YNAA 2ZGHA 3ATLA 5PTPA 3RXKA 5JB9S 5JYIA 1UCYK 3TH2H 2A4QA 2O9QA 1ESTA 3KQEA 4NIWA 3SJOA 2PGBB 1BB0B 1NRSH 1UHBB 3A7ZA 1XM1A 4CRGA 4DGJA 2O8TA 1QRXA 1TNGA 3D65E 2EEKA 4SGAE 1X7AC 3ZZ8A 1EZSC 1BHXF 3OSYA 1G32B 1B0FA 2FOBA 1TOMH 1Y5UT 3K65B 3OYPA 4FUJA 3STIA 1MTNB 1DT2A 1BTXA 1N1LA 5JBTA 1PPBH 1ELDE 3SJ9A 2IOTA 3IG6B 2ZHQH 1AIXH 5LGOA 1T4VH 1MTSA 1BMMH 2ZU1A 1PQAA 4XBDA 5GWZA 3AVZA 1UTPA 4FU9A 1QY6A 3LGTA 5AFYH 3M7UA 2Z6BD 4MLFB 3ATMA 4NSYA 4OS1A 4NWKA 1FAKH 1BMNH 2FODA 4AYYB 1S85A 1GHBF 1GDNA 1N8OC 1E34B 1S0RA 3LJJA 1GHZA 1ELBA 1MBMA 1ZMJA 1CT0E 1UO6A 1NPMA 3PMAB 1OP2A 3A89A 3DD2H 3NCLA 1O2TA 3RP2A 2OP9A 1SFIA 1ESAA 2F9VA 1HAHH 3AW0A 5K7RA 1P2NA 4ISHH 1WU1A 2P3TB 3A82A 3LIWA 4Y7AA 4CRAA 3LU9B 3M3SA 2J92A 5ABWA 4U01A 1FY3A 2O8LA 3N7OA 1N8OB 2R0LA 4WWYA 4AGKA 1ZPCA 2J4IA 1G37A 1S6FA 1PPHE 1O37A 2QAAA 3MTYA 2BM2A 2ZFSA 2AYWA 4IGDA 5E2PA 5JBAS 1P12E 4RSPA 2ZNKH 2UUFB 3QZQA 1RFNA 3GY5A 4INLA 2PV9B 3Q00A 5GIBA 3SN8A 2SNWA 2V0BA 2V35A 6LPRA 1C1WH 4I8LA 2G5NA 3BF6H 2SGFE 3O8RA 3MNBA 4LOYH 5FCRA 4R0IA 1GBLA 3P95A 4XSKU 2TIOA 1AFQC 5JBBS 4ZKRU 1QIXB 3PLBA 1TALA 4F4OC 5DJ7A 3MFJA 1O2LA 1ZPZA 4BOHA 1ARCA 1ZRKA 2RA0A 2Z3DA 8ESTE 1CU1A 4B1TA 1ANEA 1DY8A 3RXVA 1NFWA 1K1JA 3T26A 2BDIA 1TAWA 3BTME 4K8BA 1O2WA 4X1PU 3QTVH 1O32A 4KGAA 1GI2A 3MH6A 1A1RA 1BJVA 2VIVA 4X6OA 4GAWA 1HIAB 4NZLA 1L4DA 1OX1A 2PTCE 1V2JT 1SSXA 1AVGH 5F8XA 1MCVA 3EAJA 1IHSH 2BOHB 4IC5A 1DXPA 2VIPA 2NU2E 3AAUA 3SNCA 1S82A 4OS2A 3BTFE 3GICB 1AWHB 4ZUHA 4CRFA 1BTHH 2XC0A 3T28A 4JZEH 5AHGH 4K2YA 4Y71A 4F49A 5JBCS 2B0FA 2AMPA 5ESTE 1GJ7B 3QTOH 3PLKA 1GI0A 1O2YA 3Q76A 3LGYA 2FS9A 1XVMA 2ZTZA 2AMQA 2GT8A 2OLGA 2QF3A 1O5CB 1PYTD 3NZIA 1NN6A 2FM2A 1O2HA 4IBLH 1V2UT 1E37B 1FXYA 1AQ7A 4MDSA 1V6DA 2Q6DA 4DY7B 1LVMA 1GVZA 1UK4A 1KTTB 1QHRB 1TWXB 2SGEE 4NFEA 4A1VA 5EPNA 2BQ6B 4ABJA 3KQCA 2ZGCA 4X8VH 3SU4A 1CQQA 3TJOA 3LH3A 2HLCA 4X8TH 2UUYA 4BAHB 2AH4X 1TMTH 3NK8A 4Y8ZA 3ZZ4A 5C1XA 3BTQE 3RXTA 1DLKB 1GBAA 4INKA 1Z7KA 5L2YH 1RRKA 2ZTXA 1U6QA 5A09A 3KQBA 1Y3VA 2Y80A 1P11E 4QT8C 3GY2A 2ALPA 3C1KA 4ZKSU 2XTTB 1PJPA 2SGDE 4AG1A 2P16A 1OWKA 1EB2A 1C1PA 1GHXH 1H9HE 5TJXA 1YPLH 1GBFA 4K1SA 3UPEA 6GCHG 2R9PA 1V2VT 3U8OH 1YKTA 1TOCB 3V3MA 1Z8RA 1F0RA 5HYOA 3FP7E 1H9IE 2BHGA 1DWDH 2XCFA 1P2QA 5C20A 1OWDA 3BTEE 3T2NA 4UFEH 5EQQA 4IN1A 1F7ZA 1WOFA 1JBUH 3GCTG 2XBYA 4BTUB 1T31A 4ZAEA 4O9VA 4AZ2B 1TMUH 5EXNA 2WPIS 3MMGA 2PKSC 3DFJA 5EXMA 2A7CA 2BD9A 3DHKH 3F1SB 4ABAA 2ANYA 2ZO3H 3RXRA 1S81A 5SGAE 3RM2H 1GBDA 3EGKH 1W10U 1DX5M 3LONA 1D6RA 2WUBA 2ZEBA 5T6FA 2G51A 4X2YA 3RXLA 4CREA 3P17H 1H1BA 1GHAG 4NA7A 1HAOH 5A0BA 1YM0A 1TX7A 2NU4E 3F9GA 4MPWA 1KYNA 2ZDAH 3EA9A 1HAPH 2F9UA 3R0FA 2PKSB 4DJZB 1O2SA 3TVJB 3SJ8A 1HAVA 1HXEH 2F9BH 1GJ5H 1VR1H 2EI7A 1WUNH 4GSOA 1EAUA 2TRMA 1CHOF 1KXDA 1ID5H 4NZQA 1ZMLA 3SHCH 4AFSA 2GD4B 1E35B 1Z6JH 1O3HA 1LQEA 3GDUA 4FUBA 1DSTA 2Z9IA 3QDZB 4YT6H 1AVWA 2AIPA 3LOXA 2QYIA 1RTFB 5DGJA 2H9EH 5L2ZH 3SO3A 1A5IA 4FVDA 1WBGB 3TIUA 1D6WA 1G2LA 4H6TA 2H9TH 3HATH 5EODA 5FPTA 2ZFFH 4K69A 2ZF0H 1ZGVA 2FOAA 1XUGA 1TRNA 2A4RA 1SC8U 1C2JA 2VH6A 7GCHG 1DVAH 2B9LA 1SGRE 3HPTB 2ZECA 3VXFH 2WINI 4YESB 2NU3E 1T8NA 3TJUA 1GCDA 3E90B 3VEQB 3LT3A 5F8ZA 2Y82A 2EA3A 1BUIA 2TGPZ 4MPUA 2ZDVH 1H4WA 4I8JA 1KXBA 2FI5E 1C1RA 1A7SA 1V2WT 1NU9A 3VXEH 4Y6DA 3VB3A 4OGYA 1GJ6A 3KF2A 4NG9H 1MBQA 1IQLA 1D3QB 1GVLA 1YCPH 4IW4E 4B74A 2QCYA 2Y7ZA 3LKWA 4I32A 3P70B 4ZMAH 1Q3XA 3BG4C 2FOEA 3UREA 4BTIB 1HAZB 2P8OC 4J2YB 4MG3A 2OCVB 1SMFE 4MTBA 2EC9H 3Q3KA 1LHFH 3RU4D 1V2RT 1NRNH 3FFGA 5A8YA 2BD2A 1VZQH 2VH0A 1IQGA 1SLVB 1MH0A 1GI7B 1QGFA 1OWHA 5GPIB 2ZPQA 3BG4B 1UVOA 2J95A 1PPCE 1SGQE 5T6GA 1Z8JB 2P8OB 3K6ZA 3TK6A 2PW8H 1FV9A 4AYVB 1O35A 2HNTE 1QJ1B 1FN6A 3ZVGA 3M5NA 2GCHG 5EOKA 1HAXB 2BLOA 2I6QA 5FPSA 3QZRA 4BNRA 2Z9GA 1UK2A 4DG4A 1BCUH 1EPTA 1QBNA 4Y79A 4Q7ZA 3S7HB 1ZZZA 1RTKA 2A4GA 1SVPA 1C5PA 2ZDKA 3ZZDA 2QIQA 1LHEH 3MNSA 3HK6B 3BTWE 2GT7A 2R3YA 1KXAA 3JZ2B 3RXOA 4NFFA 1QB9A 1ETSH 2WPJS 4OS7A 2BY7X 2A5AA 1GVKB 2BTCE 4GLYA 1WTGH 4JMYA 3A8BA 3QK1A 4CRDA 5HMAA 1HCGA 2ANKH 1NFUA 2Q1JA 1GMHF 3A7TA 2BQ7B 2JETC 1O33A 1Y5AT 2B8OH 1MKXH 2F3CE 5H4IB 1IQHA 2FDAA 1GI1A 3ZZ5A 1O0DH 4OS5A 4X6MA 4X2WA 2G4UA 3RMOH 5FPYA 1HRTH 3U9AH 2ZFRH 1EUFA 4AB8A 3F9EA 2Z9JA 1RIWC 1QA7A 2BDAA 1AVXA 1SQAA 1FY1A 4WVPE 1RD3B 5A2MH 1SGTA 1KY9A 1MD7A 3LGIA 1TPSA 1ZRBA 3TNTA 1BOQA 2BY6X 1TNIA 4YOJA 2BVRH 3M3TA 1UCYE 2FESH 2Z94A 1QRWA 1MTWA 2JETB 2R2WU 2A2QH 1YPGH 2ILNA 5LPEA 3GCNA 1MCTA 4ISNA 3BSQA 1T7CA 1WAYB 2ZPSA 3M36A 1FIZA 5J4QA 1AD8H 1RIWB 2A5KA 1EAIA 3AW1A 3M5LA 3M7TA 4I8GA 2XBXA 1YPMH 1J15A 3SUFA 4AFUA 2WPLS 5T6DA 1LPZB 1AUTC 5FX5A 1TGSZ 3E0NB 4MPXA 3D62A 1O2VA 2YNBA 1DY9A 1Z6EA 1A0JA 1N6YA 1THRH 5DP3A 1IOEA 1LPKB 1SGIB 1C2KA 1VGCC 1OS8A 3T62A 1KDQB 1A0LA 2EI8A 2F9OA 1THPB 3U1JB 2XBWA 3S0NA 1ANDA 5EGMA 1DANH 4H4FA 2CF9H 2JH6D 3F6UH 3SZNA 4DOQA 1SPJA 3LH1A 2B7DH 3PTNA 4B2AA 1GJCB 4R8TB 1FNIA 1GBCA 4D76A 5DP4A 3ESTA 3KGPA 1V2TT 1QL7A 4DURA 1B5GH 4AOQA 2VIQA 3ZVCA 5A8ZA 3TK9A 3ZVFA 5L6NH 1SGCA 4X2XA 2PGQB 3T5FH 1VGCB 4O03A 2QC2A 2HGTH 2ANMH 1TLDA 2WV4A 3ATKA 1YPJH 1O2MA 4MNYA 3SU2A 1QQ4A 4NIVA 3URCA 2P3UB 5J4SA 1SHHB 1QA0A 3SV8A 1VJ9U 1SB1H 3P6ZB 1DXWA 5E2OA 1TRYA 3LGUA 5E0HA 3PWCA 2OBQA 1AE8H 2ODQA 1TRMA 1HB0B 1TPAE 3CP7A 3RM0H 4JZDH 2ZGBH 4YT7H 2FP7B 1HLTH 5C67A 5G4BA 1ZOMA 2TGAA 1DUAA 1O3AA 2WYJA 3RDZA 1Y8TA 3GCTF 1ZGIA 3SW2B 2AMDA 2IN2A 1C1SA 1FY5A 1ZLRA 1EX3A 3DA9B 3A80A 2BLWA 3GDSA 3TGIE 3UIRA 4UFFH 3W95A 1V2NT 3H5CB 3D49H 4AN7A 1YF4A 1F0SA 2AS9A 4ISOA 4Q7XA 1OSSA 2ZHFH 1TB6H 2OBOA 2ZCKP 1A2CH 5AFZH 3GOVB 2ZDNA 1H9LB 4DCDA 1OWEA 2SNVA 4K1TA 3A86A 1W3CA 1NZQH 5E0JA 1LKAA 1JMOH 1AB9C 5GCHG 1BTZA 1HJAC 1SBWA 1L2EA 1W0ZU 1Z8GA 4K3JA 1O3IA 4B2CA 2ZTYA 1K21H 3R3GB 1LKBA 3S69A 4MNWA 2LPRA 1N6XA 1F5KU 2BVXH 1YLCA 3VFEA 1D4PB 1BITA 1HAGE 3EA7A 1O3KA 1SHYA 3SI4H 1OOKB 5BRRE 1T32A 1G9IE 3TPIZ 2XNIA 1O3GA 2ZGJA 3PM3A 3QLPH 1SL3A 1IQFA 1AB9B 1AFEH 1C5LH 1LVBA 1HJAB 4AG2A 5I25A 1C5VA 1XKBC 2G81E 2HNTF 5A0CA 3H7OA 4ABFA 3RXSA 1Y5BT 1O31A 3RXJA 3SU1A 4KTCA 2HALA 1JWTA 2FO9A 4Q2KA 3FZDA 2BD7A 1O2RA 1A46H 3A8DA 3TK5A 2J38A 2Z9KA 1TBQH 3PB1E 7GCHF