4Y10E

Trypsin in complex with with bpti mutant (2s)-2-amino-4,4-difluorobutanoic acid
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
223
structure length
223
Chain Sequence
b'IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cationic trypsin
publication title Fluorine teams up with water to restore inhibitor activity to mutant BPTI.
pubmed doi rcsb
molecule tags Hydrolase/hydrolase inhibitor
total genus 57
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2015-02-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4y10E01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4y10E02
1Z8RA 1GHWH 1GBTA 1P12E 1EQ9A 2AH4X 4GCHG 3VGCC 2XBWA 4B75A 1S83A 2WV5A 1BTXA 1LO6A 3MH6A 1GI4A 1MAXA 5L2YH 1EB1H 2SGQE 1A5GH 1IQIA 1BBRH 3M5MA 3SU5A 1GMHF 3PB1E 1EPTA 2A7JA 1DXPA 4FUDA 1O3BA 2JH6D 1FJSA 3A83A 1O2LA 3OSYA 1FY8E 1ZRBA 3VFEA 3P95A 1O2VA 4TY7A 1DT2A 4BAMB 1G30B 1UTJA 1TA6A 1W0ZU 1C1TA 3U98H 2J95A 1QL8A 1KXBA 3EQ0H 3PO1C 1BUIA 1HAVB 3UPEA 1ZPCA 4OS2A 1BMNH 1BRUP 4ABJA 1T4UH 3RXOA 4LK4A 1YPJH 1IQFA 2ZU5A 1GBBA 1QCPA 2HLCA 1C5SA 1K21H 3QX5H 1ZPBA 4X8SH 1RTFB 4AB9A 4K69A 4DURA 1XUKA 2XCFA 3QWCH 3PTBA 3L3TA 2PKSB 1GCDA 3FP7E 1EP6A 3EA7A 1AVXA 1LPKB 4FU8A 2HNTF 1ZTJA 1Z6JH 1C2MA 3VB4A 3IITA 4MPUA 3SJOA 1VITF 5DK1A 2AFQB 2SFAA 3B9FH 3GCOA 1YLCA 1XUHA 1HCGA 1V2WT 3LH1A 8ESTE 3UNQA 3PWCA 5EODA 2VJ1A 4INKA 1TAWA 3ELAH 2LNCA 1DXWA 1EZQA 1GHYH 4Q2KA 3GDVA 1G3DA 2GT8A 1GJAB 1TOCB 2A7CA 1AB9C 1SLXB 4J1YA 4ABEA 5EPNA 1A61H 1AKSB 1NRRH 3RM0H 2ZF0H 1ZJKA 4AG1A 2UUJB 5JB8S 1LKBA 1O3OA 1MTSA 3GY6A 2Q6DA 2VVCA 4K5ZA 4BOHA 1O2PA 1P3EA 3P8OA 3UIRA 3ZZ8A 1C1PA 2AYWA 3STIA 1O5AB 4I8GA 3AASA 1NN6A 1O2SA 1YPHC 4NIYA 5JBTA 5DP9A 1O2ZA 2P95A 4MG3A 1UK4A 1E37B 1TBQH 1C1UH 4ZKSU 3DT0H 5FX6A 1GVZA 4IS5A 4DIHH 3WY8A 5A8YA 4IN2A 1IAUA 2Z7FE 1NROH 1TNGA 2BDCA 4B2BA 5DP7A 1GBMA 4XE4A 5EOKA 1AFEH 1K1PA 2ZP0H 1DE7H 5FPSA 1QRWA 1A2CH 4IMZA 3MI4A 4MNVA 2QY0B 4NWLA 4K1EA 1OWEA 1C4U2 3A7XA 4HTCH 4WMDA 1IQNA 1YM0A 3SU6A 2PUQH 1DY8A 2ODQA 4WMEA 1YPGH 2CHAB 5DP8A 1RRKA 3P92A 2FMJA 3UFAA 1AE5A 2GCHF 1PPFE 1V2JT 4OS4A 3ZVBA 5LGOA 1TGNA 3GISB 1QBNA 5AFZH 4U30A 2PGQB 1TNIA 1WQVH 4Q80A 4Q7ZA 1H1BA 3A88A 1AI8H 1A0HB 1O5DH 1S81A 5DO4H 1P2OA 1ELFA 1BJUA 1SHYA 3F9FA 1TNKA 5TCAA 1D9IA 2BOKA 1O3AA 3UWIA 5CHAB 3M37A 4ABAA 4CHAC 1O3EA 2ZDVH 2A4RA 3KN2A 1OX1A 2SGEE 2C8ZB 5HXFA 5ESBA 5GIBA 1O2NA 3UNRA 4DY7B 2OC1A 1TQ0B 2FLRH 2TGTA 1MMJN 3HK3B 1FIWA 4MNWA 4UONA 3V13A 4NZQA 3SQHE 5ESTE 1S5SA 2UUFB 2HRVA 3BG4C 1WAYB 2TRMA 3SQEE 1EAUA 4JZFH 3QGNB 1AY6H 4NIXA 1O2TA 3LJOA 2C90B 4NSYA 1C1WH 1MTNC 3OTJE 2IJOB 1XXDA 1GI1A 5GCHF 1NFXA 1P10A 4IGDA 3PMBB 2ZCHP 3DHKH 4FU7A 4GAWA 4WH6A 4NIVA 3BTQE 5HM9A 3ESTA 4GVUA 1CT4E 3C1KA 2THFB 4XOJA 1K1LA 1XKAC 2AMQA 2ZFSA 2G5NA 1RJXB 1MD8A 2BD9A 3LKWA 1A5IA 2PSYA 3O8RA 2JETC 3MMGA 2ZKSA 2TGDA 1YP9A 1CO7E 3T28A 2ZA5A 4JYUH 1L0ZA 3R3GB 5AFYH 3U9AH 1KXFA 2HPPH 3AW0A 4OS1A 1SLUB 4B74A 2BX4A 3PMJA 3SU0A 4MVNA 5EPYA 3BEIB 1Y5UT 2FO9A 2ZNKH 3F9HA 2D8WA 1YGCH 5E2OA 3B8JA 4Y79A 2QIQA 1P2JA 4YOIA 1LHDH 3BEUA 3D23A 3NXPA 2P8OB 3SJKA 4Q7XA 2PKAB 1ANDA 1EXFA 1KTSB 2FOCA 4ABDA 6GCHG 1UVTH 1QR3E 4UDWH 3RXPA 4DCDA 1TONA 1UHBA 2AIQA 4WVPE 3T5FH 4R0IA 4MDSA 1B5GH 1THPB 4YTAA 2YNBA 1INCA 1DWBH 1QRXA 2RA3A 5J4QA 1V3XA 3DA9B 1C1RA 4JK6A 1C5QA 2XWAA 3S9CA 1WTHD 3SV2H 5E0HA 1FLEE 2BXTH 2BYAX 4B1TA 1QB9A 1K28D 2BY6X 2WPLS 1VZQH 1ESBA 4AX9H 1HUTH 1AD8H 1EZUC 5JB9S 1RIWC 1WOFA 2Q1JA 3RXUA 1EAXA 2R2WU 4NZLA 4ZXYH 1O3DA 5ABWA 1TBRH 1LVBA 1RTLA 2EEKA 3ATWA 3GCHB 1V2UT 4RKOB 1ZPZA 1TGTA 4YZUA 1OP0A 3G01A 1C2HA 4JZDH 4K8BA 4OS5A 3VB5A 2ALPA 7KMEH 5EXNA 4FU9A 1S84A 2OC0A 1J16A 1TNHA 2FX4A 4UFGH 3GDUA 1D3PB 1DUAA 1GMCF 1K22H 2VIWA 3MU1A 4D7FA 3VB3A 2JKHA 3E6PH 3D49H 1LQEA 4ZHMU 5C1YA 3SHAH 4GHTA 3PTNA 3FZDA 3M61U 4IW4E 2WPIS 2BY5X 2PGBB 3PYHA 5AHGH 3PM3A 2V0BA 3LGUA 2FX6A 1QFKH 2A5IA 2VIDA 1C2FA 4TWYA 1HYLA 1G37A 3CP7A 3ZV9A 1CE5A 1KXAA 3B23B 2C4FH 1GBFA 2ANMH 1HJ8A 1JRSA 1HDTH 3MFJA 1GG6B 2XCNA 3QLPH 3HGPA 5K0HA 4LOYH 3BN9A 3Q76A 1EPTB 2C3SA 4KTSA 1Z6EA 4YT6H 3KQBA 4BAQB 3N7OA 4MNXA 3A85A 2ZFRH 1UCYE 2ANWA 3GCTF 3SGQE 1PPBH 2CV3A 3A7VA 3MNSA 4ISNA 3RXSA 1CT2E 1FZZA 1LVYA 3P8NA 1TPPA 3URCA 1O2KA 2AEIH 2UWOA 3VXFH 1MTWA 1N6XA 5DP6A 1HJAC 2A32A 1C2LA 2FYQA 2B9LA 2H9TH 4B76A 3RXLA 5H4IB 5FCKA 4WXIA 1CGJE 4O97A 3TU7H 1H9LB 4GLYA 1TB6H 1ELEE 2F3CE 1PJPA 1VGCB 1GL0E 1NC6A 4LZ4B 1GBCA 1P01A 4Y7AA 4I8LA 1JWTA 5JBCS 1P3CA 3A84A 5EGMA 1MZDA 2ZECA 4Y71A 1D3TB 2SGDE 3ZYDA 1SHHB 1ELDE 1FY1A 1MBMA 1GHBF 2HVXA 2WYJA 2AMPA 1A1RA 1TALA 1OWDA 2VB0A 3VB7A 3MU0A 3RP2A 1FAKH 1GJBB 3SU1A 4WJG2 4HFPB 1MZAA 2Z3DA 3PROA 3M36A 1CHOF 3MU4A 3U1IB 3ZZDA 1GL1A 4CH8B 4NFEA 1UMAH 1YPMH 3UWJH 4JYVH 5BPEA 1A0JA 3ODFA 1SC8U 1LHFH 2GCTC 1FI8A 2Y5GA 1K1OA 3OY6U 2BDHA 2Z9GA 4MTBA 5EW2H 2A31A 1WUNH 1XUFA 1GGDC 2W26A 3P8GA 1J8AA 1LHCH 1FUJA 1GHAF 1BTYA 1VJAU 1FDPA 1MU6B 1N8OB 1NRSH 1XX9A 4CREA 1PPCE 3ZZ3A 3LOXA 4CRCA 4FUCA 3S69A 3ZVAA 3JZ2B 5J4SA 3SNCA 1D6WA 2ZTXA 2FOHA 1MKXK 3LGWA 4Y8YA 1HPGA 1BB0B 3MO6A 1T4VH 4I8KA 4X8UH 3A8BA 4CRFA 1GHZA 4I31A 4UFFH 2ZZUH 1DITH 3AAVA 2XBVA 5K7RA 1W3CA 2CN0H 2FXRA 3BTEE 2GZ9A 4X1RU 3U8TH 1P05A 3HATH 1O3KA 1XKBC 8GCHG 1YYY1 2H1UA 2G81E 2VGCC 1OYQA 3QO6A 1MQ6A 2BY9X 2CF9H 1CA0B 5EU8A 3BG8A 1TABE 1JBUH 4A92A 1NRPH 2QXJA 1V2TT 2WPHS 1UO6A 1GCTC 1FY3A 1HXEH 2ZEBA 3I78A 2IOTA 3Q00A 3U1JB 2M5TA 3I29A 1FY5A 1UJ1A 2GDEH 1FPHH 3RC4A 3A8DA 2SNWA 3P70B 2ZDNA 1QIXB 1ZZZA 4TY6A 1GBEA 1UTQA 4IMQA 3SUDA 1O2XA 1DVAH 1A7SA 2GTBA 1S85A 1D6RA 2BDIA 3FVFB 3BF6H 3RLWH 1W7XH 3EGKH 1V2QT 1ANEA 3SGBE 5HGGA 3RM2H 5T6GA 1CU1A 4BANB 1FONA 3TITA 4M7GA 4X1PU 3M5NA 1MH0A 4JZ1A 4BNRA 3TJNA 2OBQA 1GBDA 1MKWK 1T8LA 4AFUA 4BTUB 1O2YA 3PWBA 3QTVH 4ISOA 3E0PB 2SGFE 4FUEA 2JH0D 3M7UA 3A80A 4XBDA 5G4BA 3RMNH 1BDAA 4BTIB 1O39A 2HOBA 4X6PA 2OUAA 3SBKA 4B2AA 2BY7X 1BBRE 2ZU3A 1VCWA 3T62A 2ZTZA 1TGCA 1O2IA 1SL3A 1TYNA 4SGAE 3TGKE 3VGCB 3SW2B 1Z1JA 2BD3A 3U8OH 1V2OT 1XMNB 2W7SA 1BCUH 2GT7A 4DW2U 1TWXB 5DG6A 1TMUH 3QGJA 1NRQH 1ZMLA 1QJ6B 3MWIU 1GI0A 1MBQA 1SGDE 4GHQA 3SNBA 2ZQ1A 2XWBI 1DX5M 1IHTH 2ZDLA 3R0FA 3MU5A 1SMFE 3PO1B 3Q3XA 2WUCA 4X6NA 2EI7A 1OOKB 3UQOA 3O8BA 5JBBS 4D9RA 3SNEA 4K8YA 3E16B 1VJ9U 1AVWA 2TIOA 6CHAC 1L1JA 3ITIA 2V3HH 3M7QA 4LXBH 3GYMA 3SOSA 3RXQA 4ESTE 1P2NA 3E0NB 1DDJA 2PHBA 1HJ9A 9ESTA 2ZFTA 2GMTC 4A6LA 5GWZA 3KHVA 1NM6A 3GOVB 3F68H 1O3IA 1GBAA 2IN2A 4I8JA 3ZVGA 2QXHA 1CT0E 3UNSA 1TMTH 1SGQE 3KIDU 1Y3WA 2BLVA 3DFLA 4FUHA 4TWWA 1O37A 2G00A 3KQEA 1P0SH 1EAIA 1T31A 2XXLA 4NGAH 1UHBB 2PV9B 2PWXA 1O3NA 3ZYEA 1GI6A 1W12U 4ASHA 3LH3A 1FIZA 1W10U 4LZ1H 1NS3A 4AYVB 3CS7A 1CBWC 4WH8A 1QBVH 1AB9B 3QZRA 2ZIQH 3LC3A 2TBSA 3O8DA 1RD3B 4WY3A 1ANCA 2FM2A 1OWKA 1P11E 3C27B 4ZMAH 1O32A 2QF3A 3U8RH 3O8CA 2PLXA 5L30H 3LGTA 3STJA 3KQCA 1DSTA 1BBRK 1YKTA 1T7CA 4CRBA 3P6ZB 3RXIA 3FZZA 3MH4A 1YPEH 4ABIA 1AUJA 4DT7B 2F9BH 3A7WA 5IYTA 4CRDA 4CBNA 4TPYA 2PW8H 3K6ZA 5DP5A 4B73A 1ESTA 2F9OA 3T27A 1KLTA 1THSH 1CHGA 4ZH8A 3GY3A 4F49A 5A0CA 2ZFQH 2P94A 3A7YA 5F03A 2SGPE 1NU9A 4Z0KA 4AORA 1RFNA 1ELBA 1C5VA 1C4V2 2ZPQA 4CRGA 1IQLA 4DG4A 3PV4A 3RXGA 3T2NA 2FIRH 4RKJB 1SQOA 1ORFA 1O2HA 3RU4T 5L2ZH 2FOEA 1MU8B 2VVVA 3ZVFA 2F9UA 1YPHE 1ZSLA 2A4QA 1EJNA 4X2YA 1C5XB 2P3FH 4AOQA 3RC6A 4E06H 4Z6AH 1V2VT 4U32A 4DOQA 4BAOB 2A7HA 2A4OA 1GBIA 1QGFA 1J17T 1P9SA 1BTUA 2F9NA 3U69H 2SGAA 3EE0B 1HAPH 2BQ7B 2A5AA 2XW9A 2VU8E 1L4DA 4JYTA 4BTTB 4CR9A 4JCNA 3HKJB 3T26A 1ZMJA 1YCPK 2C93B 2DE8A 1G2LA 1LHGH 2RCEA 1FXYA 1O31A 3DUXH 2OD3B 4CH2B 1TFXA 1F0SA 2FTMA 1OS8A 2GZ7A 3SORA 3GICB 2G52A 5L6NH 4CHAB 1Z8IB 3GY5A 5IDKA 1HGTH 5AF9H 1Q3XA 5DP4A 3S9AA 3KQDA 2C8XB 2QAAA 4UFEH 1AFQC 1B0FA 3OX7U 1ZYOA 3F9GA 1XM1A 3EAJA 4KGAA 1XVMA 1QY6A 3RXCA 3NUMA 3MNBA 5C5NA 4ZKRU 2BQWB 3ZZCA 1IQEA 1G32B 4ZROA 4JMYA 7GCHG 3BG4B 5FPTA 4X8TH 1GBKA 5PTPA 2AGGX 2FYRA 1P8VC 4ZKOU 5DP3A 1ZR0A 4X2VA 3PMHB 4OGYA 1TGBA 3V0XA 1C5OH 1UVPA 1Z1IA 1BJVA 1C2DA 1MTNB 1HAXB 1THRH 3ZVCA 3ZZ9A 1U6QA 1ZGIA 1HIAB 2ILNA 4A1XA 5AVDA 1FPCH 1P2MA 5FAHA 4K1SA 1GDUA 1TPAE 3Q77A 2EC9H 1ZHRA 1ETTH 2D2DA 4B71A 1TRMA 4AFQA 2H2ZA 1GJ9B 3URDA 5JBAS 1RGQA 3F9EA 1O3MA 1E38B 3NKKA 4YM9A 1HAHH 2PUXB 5F8TA 1SOTA 1JIRA 1C1NA 2HALA 2JETB 1HAYB 4E05H 4X6OA 3RLYH 2EI8A 1QA0A 3PLBA 2FS9A 3EA9A 3TH3H 4WWYA 1S6FA 1HLTH 3ZZ4A 1IOEA 1GMDG 4F4OC 2XBYA 1EAWA 1XVOA 3A87A 3ZZAA 3P17H 1K1IA 1S0QA 1V2KT 1CA8B 4X2XA 4U01A 1AMHA 1J14A 1C5YB 2ZU4A 3ZZ7A 2ODYB 5ETXA 2ZHFH 1YPLH 2BHGA 2O8MA 2FI3E 2G8TA 1F0TA 2A2XH 1GMHG 3SV8A 1GI9B 2G55A 2WPKS 3RMOH 5EG4A 1AU8A 1KLJH 2F91A 1WCZA 7LPRA 3GY8A 1F2SE 1P57B 3RXEA 4Y0ZE 1GI3A 1AKSA 4ZUHA 2BDGA 3SZNA 4GCHF 1WU1A 4IC5A 4E7RG 4Y76A 2ZHQH 1G3CA 3SUFA 2FWWA 3E1XB 3AW1A 2O8TA 1LVMA 4YOGA 2ZWLH 4MNYA 3SJIA 1HNEE 1QJ1B 2VNTA 1P06A 4AN7A 1EKBB 1WSSH 1Y3VA 4Y6DA 1Z8GA 3VB6A 3W94A 4SGBE 4KKDA 5E2PA 4O3TA 1XXFA 1AUTC 1NT1A 3BTKE 1RIWB 3KNXA 2P93A 3EA8A 2ZDAH 1T8OA 1SOZA 2FODA 2B0FA 2Y81A 2HPQH 2ZDKA 1A46H 1ELCA 1PQ5A 1F5KU 2BD5A 2TGAA 3ZV8A 3LIWA 4GUXA 4AGKA 1UVUH 1V2LT 2G51A 5FPYA 1UTKA 2D1JA 2P16A 3KEEA 1QA7A 2ZGCA 2PFEA 1D3DB 1VITG 2Z9KA 4NFFA 1W13U 2A1DB 1P2KA 2GP9B 1C1SA 1OKXA 1SGFA 4HZHA 2FLBH 1EASA 2FESH 2CF8H 4INHA 2RDLA 2OP9A 3DFJA 3RU4E 1TOMH 3ATMA 2HNTC 3LDXH 4K60A 1UTOA 4WF8A 3K2UA 2BVXH 4AG2A 5A0AE 1ZMNA 2O8LA 3UQVA 3JZ1B 5E0GA 1A3EH 1PFXC 2I6SA 1SQTA 1J15A 1BA8B 3SI4H 5T6DA 3BIVH 3BEFB 2D26C 4I7YH 1MKXH 1KIGH 2A2QH 4X1NU 1AGJA 1C5RA 2Y5HA 3GDSA 4I32A 2DE9A 1Y3YA 4AYYB 4CBOA 3TPIZ 2SNVA 3D62A 1OWIA 2Y7XA 2R0LA 1GVLA 1CGIE 2BMGB 1MAYA 5FCRA 1HBTH 2BQ6B 2XNIA 2BLWA 1QQ4A 3UOPA 2GVFA 3LPRA 3V3MA 1MD7A 1YC0A 3HGNA 1WQSA 1JRTA 3M3TA 1VITH 1HJAB 2UWLA 3RXFA 3A89A 1BRAA 5C1XA 2ZGBH 3HK6B 2FI5E 1AWFH 1X7AC 2GCHG 1YLDA 1WTGH 1J9CH 5JYIA 1O5GH 5F8XA 2ZPRA 2STAE 1JIMA 1WBGB 2G4TA 3GY2A 3TGIE 4Y8XA 1PQ8A 4JK5A 2VIQA 4BAHB 3QK1A 1H9IE 3SN8A 4X8VH 2VWOA 2FS8A 1QURH 3V12A 4DGJA 1ARBA 1KDQA 1TX8A 3S7HB 1FNIA 3SHCH 1P04A 2P3UB 1FMGA 3ATIA 3Q3YA 1O3PB 1GHVH 1ELVA 3RXTA 1ZHPA 3ATKA 1HFDA 3M5LA 3I77A 1KSNA 1C5WB 5GJ4B 1O36A 2GCTB 1F5LA 2CXVA 1QL7A 3MHWU 5A2MH 3SU2A 1LQDB 1MKWH 3SUGA 2O9QA 1PYTC 1GGDB 2R3UA 3TNSA 1L1NA 1UCYK 2J34A 4NWKA 3ZZ6A 3LGIA 1JXPA 2DUCA 4NA8A 2QXIA 1WV7H 2ZGJA 2LPRA 4O9VA 5A0BA 4FUBA 1F7ZA 1K2I1 1F5RA 2NU2E 1YF4A 1UVOA 1G2MA 1BTWA 1IQGA 1P2IA 2Z6BD 4VGCC 5A8XA 4X1SU 2GZ8A 4J2YB 1SR5C 3BTFE 2PTCE 1A3BH 3FP6E 4YLQH 1FQ3A 3UUZA 2ZI2H 2Y7ZA 1GDQA 1C2JA 7ESTE 1PPGE 2Q6GA 1OSSA 3RXKA 3A7ZA 2VGCB 3TJUA 3LU9B 3MTYA 1C5LH 4AB8A 5LH8A 1GI5A 2R0KA 2BD4A 2QC2A 3CS0A 3IWMA 2BD7A 1N6YA 1LPZB 1MCTA 1DS2E 2QN5T 3V7TA 3BV9B 1LMWB 1H4WA 1GPZA 4CRAA 3FANA 1T8MA 1GCTB 1DY9A 5C1UA 1FV9A 2ZGHA 5GPIB 5I46H 4X6MA 1SLVB 3SO3A 1DM4B 1GJ5H 1OP2A 2BVRH 3OYPA 2NU0E 1HAGE 4O03A 1LKAA 5HYOA 4NIWA 3SJ8A 1G9IE 4YT7H 2XC5A 3K6YA 1F92A 3RXBA 1K1NA 1BRBE 5LPEA 2FOAA 1P2QA 1YCPM 4OS6A 1QNJA 1DWEH 1C5TA 2ZPSA 4MPVA 2ZC9H 4U2WA 1EJMA 1EZXC 1ANBA 1N1LA 4YOJA 2ODPA 2CGAA 4ABBA 2J92A 3E90B 1ELTA 4ISHH 1BT7A 1TX6A 3AAUA 1NFWA 1QBOA 5BRRE 4XFQA 8LPRA 1AHTH 5GDSH 1ZSKA 1PPHE 1ZOMA 2ZCKP 2XRCA 6GCHF 1BRCE 1C5NH 2ULLA 4RN6A 2PSXA 1SGRE 2AERH 1D3QB 4X2WA 4A7IB 4XDEA 1SGTA 2GGVB 1PYTD 3BTWE 1VR1H 5EQSA 1H8IH 1DLKB 1GJ4H 1Q2WA 1O3JA 1O2GH 2NU3E 5LPFA 1E35B 2WINI 1BMLA 1SGEE 4A5TS 2GX4A 1ETRH 4YO9A 2ZU1A 1SGCA 2EA3A 8KME2 1C5PA 1O3LA 1JOUB 1O5FH 3UY9A 2Y6TA 1O33A 2OBOA 4ZKNU 2W5EA 3RXDA 4BXSA 2PKSC 2PR3A 3RDZA 4MPWA 3PLPA 5DGJA 1ID5H 2A0QB 3MO9A 4WXVA 1CSOE 4DVAU 2UUYA 1O3CA 2QCYA 4NG9H 3UR9A 2FP7B 2F9VA 4IC6A 1ARCA 4KELA 3L6PA 1GMCG 3KCGH 1L2EA 2OC8A 2A5KA 1HXFH 2WUBA 1C2IA 2H5DA 6CHAB 2KAIA 5DJ7A 3S0NA 1BQYA 3ATLA 1M9UA 1GVKB 2BB4A 1GHXH 1BITA 2B7DH 2GMTB 2A45B 1T8NA 3SV6A 3QN7A 4INLA 2B8OH 5C20A 1C9TA 1BOQA 1YCPH 1DANH 1NRNH 2C8WB 2P3TB 1OWJA 2OXSA 2BY8X 1DFPA 1SGNE 1GJ7B 1EJAA 1ZSJA 1OYTH 3RXRA 1ELGA 2R9PA 4H6SB 1C1VH 3S9BA 2G4UA 3GCTG 4K3JA 2H5CA 2JH5D 3LGYA 4IBLH 4Y11E 4A1VA 2Y5FA 3ODDA 3DD2H 1CBWB 1Y59T 2OC7A 4NCYA 1GDNA 3EDXB 1C2KA 3VXEH 3BTTE 1MTUA 2FOMB 3H7TA 1GJ8B 1TRNA 1O0DH 1O2WA 2ESTE 4JZEH 1BTPA 3LJJA 5F8ZA 1SGFG 2BOHB 2ASUB 2BLOA 2GDDA 5EQRA 2FTLE 2GV7A 2J4IA 2I6QA 4MLFB 3MH7A 5I25A 1O2OA 1RTKA 5EW1H 3BTME 2O8UA 1AZZA 5CMXH 1BTZA 4ABFA 1EOJA 1KXCA 3ZZ5A 2UWPA 1NO9H 3D65E 1G3EA 2CHAC 4XSKU 3MNCA 3BTDE 1DPOA 5T6FA 3HKIB 4YESB 2C8YB 1SPJA 1GHBG 2YOLA 3OU0A 1YPKH 2CMYA 1KXEA 2ZDMA 4ZXXH 3TJOA 3L33A 1Z71A 2VH0A 3FP8E 2OCVB 2F83A 1CHOG 1PQ7A 3TK6A 3SJ9A 1O5BB 2VIPA 5CE1A 1O5CB 1O38A 4FXGH 2J94A 1S82A 2BZ6H 1GI8B 4CR5A 1SFQB 4Y10E 5CHAC 1ZJDA 4K1TA 3M5OA 3P8FA 1GHAG 1O3HA 1O34A 1P09A 3A7TA 2ZG0H 1E36B 3TIUA 4DIIH 1ESAA 1BMAA 2FDAA 1IQHA 6ESTA 1WYKA 1CQQA 2WV4A 5FHTA 1T32A 1QHRB 1KLIH 1V2MT 3TNTA 4R8TB 1C5UA 2ZQ2A 1B0EA 4D76A 1GJCB 4H42U 2YNAA 2VIVA 3M3VA 2VINA 3MO3A 1C4Y2 3BSQA 4JZIA 1IHSH 1W7GH 1ZRKA 5LPRA 1AIXH 1O5EH 1C2GA 1O2UA 3Q3KA 1GI7B 2ZFPH 1SFIA 2FOFA 3SGAE 4NA7A 1NU7B 1O2JA 2J9NA 4E7NA 1V2ST 1W2KH 1AFQB 2BDYA 3ZVEA 2XYAA 2FEQH 1D4PB 4QT8C 1Y5BT 3SUEA 3MH5A 1ABJH 1C9PA 4ZHAA 2CJIA 8GCHF 2H9HA 2ZHEH 1L4ZA 2FZZA 3RXAA 4KP0A 5E8EH 2BD8A 1HAVA 1XUJA 1LDTT 1AQ7A 1B7XB 5TJXA 2QV1A 1BTHH 2QYIA 4NSVA 2OQUA 1QL9A 3MU8A 3SU3A 1SBWA 2QA9E 1F0UA 4MQAA 1KDQB 2ZTYA 3F1SB 2BLQA 3NCLA 5FBEA 2GKVE 1GBLA 1TQ7B 1K1JA 2RA0A 4X1QU 1XUGA 5FX5A 4AFZA 2R3YA 3A81A 3VPKA 5C67A 2BTCE 4PROA 3HPTB 1C1MA 3GCNA 4D8NA 1BZXE 4HI3A 4XBCA 1FN6A 3K65B 1TPOA 1TMBH 1VCQA 2P8OC 2XC4A 4ZHLU 3FAOA 1QB1A 1RXPA 3RXJA 3F6UH 2Y80A 3QUMP 2Q6FA 3TK5A 4Y7BA 2F9PA 4WMFA 1AZ8A 1MQ5A 3PLKA 2O8WA 1BHXB 4NA9H 1EB2A 3RMMH 1AWHB 1C5ZB 1C1QA 2J38A 9LPRA 2NWNA 4H4FA 1XUIA 3A82A 1A0LA 3M35A 2HWLB 3KF2A 2BDBA 1W0YH 4I8HA 5DPAA 2IPHA 2OLGA 2Z9LA 4UE7H 3UTUH 2WPJS 1LTOA 1SI5H 4Q7YA 4FVBA 1NTPA 1Y8TA 2ZO3H 5JDUB 3GYLB 2BZAA 3UREA 3MYWA 2Z9IA 3GY7A 2AS9A 4O3UA 3MOCA 1HAIH 1NZQH 1SGIB 4D7GA 1UK3A 3GCHC 1JMOH 3S7KB 5HM2A 3SV9A 1UVSH 3OY5U 1IQJA 1HAOH 4ISIH 1S0RA 3QDZB 1LCYA 5A09A 3H5CB 1TNJA 3CENA 2TPIZ 2K1QA 1ZLRA 4KTUA 1QTFA 1HB0B 3LONA 1EZSC 3QZQA 1UTPA 1Y3UA 2BD2A 1DLEA 1G36A 3RUOA 3RXVA 2GV6A 2STBE 1P02A 2Z3EA 3TJVA 1LHEH 1S6HA 3RC5A 1SG8B 2QXGA 2FI4E 3NZIA 1EOLA 1C5MD 3T29A 3SV7A 3KGPA 1P9UA 4ABHA 1O30A 2WPMS 3NWUA 2OINA 3TLOA 1V2PT 1FN8A 1GG6C 3RXHA 1CGHA 2V3OH 5TCCA 1UTMA 5HMAA 1EPTC 1QQUA 2OTVA 1E0FD 6LPRA 3TK9A 1AN1E 3SNDA 4YLUA 3K9XB 1TX7A 2XTTB 2H9EH 3SI3H 1UTLM 2VWLA 1H8DH 3A86A 2Z3CA 2R2MB 2ANYA 1ELAA 3BIUH 2ZHDA 4TPIZ 1UTNA 3AVZA 3FFGA 1NESE 4BXWA 2ZHWH 1UCYH 1HRTH 1SVPA 2BM2A 2FOBA 3TH4H 1DSUA 4Y0YE 4AZ2B 3A8AA 1EP5A 2ALVA 2Z94A 1FY4A 2VH6A 1A4WH 3LGVA 5EXMA 1LVOA 3NK8A 4THNH 1SGPE 3H7OA 1ZTKA 5C3NA 2BDAA 1SLWB 2QF0A 2HNTE 4KTCA 1OWHA 1VGCC 2PTNA 1UK2A 2H6MA 3LC5A 4OGXA 4K2YA 3BTHE 5B6OA 4B2CA 1F0RA 3KL6A 1PPZA 3MNXA 1BMMH 3BTGE 1P03A 4UFDH 1V2NT 1Y3XA 2V6NA 1KXDA 4ISLA 1HAZB 4X0WU 1GJDB 1TNLA 1ZTLA 1MTVA 2OQ5A 1AO5A 2KAIB 5A8ZA 4DJZB 1DUEA 2VWNA 3EYDA 5T3HA 2W3IA 3GY4A 1EUFA 1OP8A 1DWCH 2RG3A 3SU4A 3RU4D 1Z8JB 4FUFA 1MCVA 1HIAA 1G3BA 2NU4E 1GBJA 1L1GA 3ENSB 1W8BH 1IQKA 4AFSA 2BXUH 3T25A 4HGCA 2B5TB 2VWMA 1NY22 5JPMH 1C2EA 3UOUA 2ZCLP 5EQQA 3UR6A 1NPMA 4UD9H 2P59A 1Z7KA 3E8LA 1N8OC 1CVWH 5FBIA 1EX3A 2TGPZ 1O35A 2EI6A 1SB1H 1ETSH 1E34B 1TA2A 5F6MA 5EXLA 4Y8ZA 1O2RA 1KY9A 1TBZH 4RSPA 1W14U 5GXPA 1ZGVA 2BVSH 3W95A 1H9HE 4IN1A 1QB6A 3TGJE 5GCHG 1EATA 2PKAA 1YBWA 2A4GA 2XBXA 1NFYA 5C2ZA 1TLDA 1MUEB 4AGJA 4UEHH 4GPGA 1CA0C 2W7UA 3A8CA 2QGRA 1HV7A 3TVJB 1DWDH 3ZZBA 2Z9JA 1DICA 1Y5AT 2BX3A 1O3GA 1TIOA 1GWAA 5E0JA 7GCHF 5SGAE 1GBHA 1PQAA 2VIOA 4VGCB 3E91A 2AMDA 2NU1E 1GJ6A 4FUJA 3E3TA 1ZHMA 2WYGA 5C5OA 4D9QA 3IG6B 2ANKH 4GSOA 1TGSZ 4OS7A 1C1OA 1O2QA 5DKMA 1ACBE 2AIPA 1W11U 4A1TA 4ABGA 2V35A 1NFUA 1TE0A 2G5VA 1GI2A 1KTTB 1QJ7B 3M3SA 1VCPA 1SGYE 1FAXA 4FUGA 3TH2H 1KYNA 1A5HA 3SNAA 3QTOH 1O2MA 2VVUA 2J2UA 4XBBA 1K9OE 2GD4B 4H6TA 2HGTH 1AE8H 1V2RT 4ZAEA 2ZFFH 3RXMA 1BHXF 1Q31A 1OXGA 3M7TA 1V6DA 4MPXA 2ZU2A 1IQMA 1QRZA 1BIOA 3NPSA 2UUKB 3LT3A 2ZGXH 2XC0A 4FVDA 1RS0A 1SQAA 1LPGB 1ABIH 4BAKB 5FXLA 1K1MA 4FUIA 2AGEX 2AGIX 3PMAB 1SSXA 3VEQB 1O3FA 1DOJA 3ZVDA 2W3KA 3RMLH 1PPEE 1TPSA 1TRYA 2FOGA 1GMDF 1AVGH 1OPHB 2FPZA 2Y82A 4I33A 4TYDA
chains in the Genus database with same CATH superfamily
1Z8RA 1GHWH 1GBTA 1P12E 1EQ9A 2AH4X 3OTPA 4GCHG 3VGCC 2XBWA 4B75A 1S83A 2WV5A 1BTXA 1LO6A 3MH6A 1GI4A 1MAXA 5L2YH 1EB1H 2SGQE 1A5GH 1IQIA 1BBRH 3M5MA 3SU5A 1GMHF 3PB1E 1EPTA 2A7JA 1DXPA 4FUDA 1O3BA 2JH6D 1FJSA 3A83A 1O2LA 3OSYA 1FY8E 1ZRBA 3VFEA 3P95A 1O2VA 4TY7A 1DT2A 4BAMB 1G30B 1UTJA 1TA6A 1W0ZU 1C1TA 3U98H 2J95A 1QL8A 1KXBA 3EQ0H 5EJLA 3PO1C 1BUIA 1HAVB 3UPEA 1ZPCA 4OS2A 5DN6D 4TSFD 1BMNH 1BRUP 4ABJA 1T4UH 3RXOA 4LK4A 1YPJH 1IQFA 2ZU5A 1GBBA 1QCPA 2HLCA 1C5SA 1K21H 3QX5H 4YXWD 1ZPBA 4X8SH 1RTFB 4AB9A 4K69A 4DURA 1XUKA 2XCFA 3QWCH 3PTBA 3L3TA 2PKSB 1GCDA 3FP7E 1EP6A 3EA7A 1AVXA 1LPKB 3F0OA 4FU8A 1FX0B 2HNTF 1ZTJA 1Z6JH 1BMFD 1C2MA 3VB4A 3IITA 4MPUA 3SJOA 1VITF 5DK1A 2AFQB 2SFAA 3B9FH 3GCOA 1YLCA 1XUHA 1HCGA 1V2WT 3LH1A 8ESTE 3UNQA 3PWCA 1E1QD 5EODA 2VJ1A 4INKA 1TAWA 3ELAH 2LNCA 1DXWA 1EZQA 1GHYH 4Q2KA 3GDVA 1G3DA 2GT8A 1GJAB 1TOCB 2A7CA 1AB9C 1SLXB 4J1YA 4ABEA 2QF5A 5EPNA 1A61H 1AKSB 1NRRH 3RM0H 2ZF0H 1ZJKA 4AG1A 2UUJB 2WZQA 1LKBA 5JB8S 1O3OA 1MTSA 3GY6A 2Q6DA 2VVCA 4K5ZA 4BOHA 1O2PA 4RI0A 1P3EA 3P8OA 3UIRA 3EE7A 3ZZ8A 1C1PA 2AYWA 3STIA 1O5AB 4I8GA 1MABB 1NN6A 3AASA 1O2SA 1YPHC 4NIYA 5JBTA 5DP9A 1O2ZA 3FOAA 2P95A 4MG3A 1UK4A 1E37B 1TBQH 1C1UH 4ZKSU 3DT0H 5FX6A 1GVZA 4IS5A 4DIHH 3WY8A 5A8YA 4IN2A 1IAUA 2Z7FE 4ACAA 1NROH 1TNGA 2BDCA 4B2BA 5DP7A 1GBMA 4XE4A 5EOKA 1AFEH 1K1PA 2ZP0H 1DE7H 5FPSA 1QRWA 1A2CH 4IMZA 3MI4A 4MNVA 2QY0B 2WHXA 4K1EA 4NWLA 5FL7D 1OWEA 1C4U2 3A7XA 4HTCH 4WMDA 2F4LA 1IQNA 1YM0A 3SU6A 2PUQH 1DY8A 2ODQA 4WMEA 1YPGH 2KX4A 2CHAB 5DP8A 5KGOA 1RRKA 3P92A 2FMJA 3UFAA 1AE5A 2GCHF 1PPFE 3PV5A 2OK5A 1V2JT 4OS4A 3ZVBA 5LGOA 1TGNA 3GISB 1QBNA 5AFZH 1YWUA 4U30A 2PGQB 1TNIA 1WQVH 4Q80A 4Q7ZA 1H1BA 3A88A 1AI8H 1A0HB 1O5DH 1S81A 5DO4H 1P2OA 1ELFA 1BJUA 1SHYA 3F9FA 1TNKA 5TCAA 1D9IA 2BOKA 1O3AA 3UWIA 5CHAB 3M37A 4ABAA 4CHAC 1O3EA 2ZDVH 2A4RA 3KN2A 1OX1A 2SGEE 2C8ZB 2IJD1 5HXFA 5ESBA 5GIBA 1O2NA 3UNRA 4DY7B 2OC1A 1TQ0B 2FLRH 2TGTA 1MMJN 3HK3B 1FIWA 4MNWA 4UONA 3V13A 4NZQA 3SQHE 5ESTE 1S5SA 2UUFB 1VKYA 2HRVA 2K0QA 3BG4C 1WAYB 2TRMA 3SQEE 1EAUA 4JZFH 5EIYA 3QGNB 1AY6H 2KR7A 4NIXA 1O2TA 3LJOA 2C90B 4NSYA 1C1WH 1MTNC 3OTJE 2IJOB 1XXDA 1GI1A 5GCHF 1NFXA 1P10A 4IGDA 3PMBB 4ASUD 2ZCHP 3DHKH 4FU7A 4GAWA 4WH6A 4NIVA 3BTQE 5HM9A 3ESTA 4GVUA 1CT4E 3C1KA 2THFB 4XOJA 1K1LA 1XKAC 1UW7A 2AMQA 2XNDD 2ZFSA 2G5NA 1RJXB 1MD8A 2BD9A 3LKWA 1A5IA 2PSYA 3O8RA 2V3MA 2JETC 3MMGA 2ZKSA 4HG6A 2TGDA 1YP9A 1CO7E 3T28A 2ZA5A 2EQNA 4JYUH 1L0ZA 3R3GB 3FO8D 5AFYH 3U9AH 1KXFA 2HPPH 3AW0A 4OS1A 1SLUB 4B74A 2BX4A 3PMJA 3SU0A 4MVNA 5EPYA 3BEIB 1Y5UT 2FO9A 2ZNKH 3F9HA 2D8WA 1YGCH 5E2OA 2WV9A 3B8JA 4Y79A 2QIQA 1P2JA 4YOIA 1LHDH 3BEUA 3D23A 3NXPA 2P8OB 3SJKA 4Q7XA 2RFKC 2PKAB 1ANDA 1EXFA 1KTSB 2FOCA 4ABDA 6GCHG 1UVTH 1QR3E 4UDWH 3RXPA 4DCDA 1TONA 1UHBA 2AIQA 1COWD 4WVPE 3T5FH 4R0IA 4MDSA 1B5GH 4RT0A 1THPB 4YTAA 2YNBA 1INCA 1DWBH 1QRXA 2RA3A 5J4QA 1V3XA 3DA9B 1C1RA 4JK6A 1C5QA 2XWAA 3S9CA 1WTHD 3SV2H 5E0HA 1FLEE 2BXTH 2BYAX 4B1TA 1QB9A 1K28D 2BY6X 2WPLS 1VZQH 1ESBA 4AX9H 1HUTH 1AD8H 1EZUC 5JB9S 1RIWC 1WOFA 2Q1JA 3RXUA 2JJ1D 1EAXA 2R2WU 4NZLA 4ZXYH 1O3DA 5ABWA 1TBRH 1LVBA 1RTLA 2EEKA 3ATWA 3GCHB 1V2UT 4RKOB 1ZPZA 1TGTA 4YZUA 1OP0A 3G01A 1C2HA 4JZDH 4K8BA 4OS5A 3VB5A 2ALPA 7KMEH 5EXNA 4FU9A 1S84A 2OC0A 5F53A 1J16A 1TNHA 2FX4A 4UFGH 3GDUA 1D3PB 1DUAA 1GMCF 1K22H 2VIWA 3MU1A 4D7FA 2W6JD 3VB3A 2JKHA 3E6PH 3D49H 1LQEA 4ZHMU 5C1YA 3SHAH 4GHTA 3PTNA 4DT4A 3FZDA 3M61U 4IW4E 2WPIS 2BY5X 2PGBB 3PYHA 5AHGH 3PM3A 2V0BA 3LGUA 2FX6A 1QFKH 2A5IA 2VIDA 1C2FA 4TWYA 1HYLA 1G37A 3CP7A 3SZEA 3ZV9A 1CE5A 1KXAA 3B23B 2C4FH 1GBFA 2ANMH 1HJ8A 1JRSA 1HDTH 3MFJA 1GG6B 2XCNA 3QLPH 3HGPA 5K0HA 4LOYH 3BN9A 3Q76A 1EPTB 2C3SA 4KTSA 1Z6EA 4YT6H 3KQBA 4BAQB 3N7OA 4MNXA 3A85A 2ZFRH 1UCYE 2ANWA 3GCTF 3SGQE 1PPBH 2CV3A 3A7VA 3MNSA 4ISNA 3RXSA 1CT2E 2VBCA 1FZZA 1LVYA 3P8NA 1TPPA 3URCA 1O2KA 2AEIH 2UWOA 3VXFH 2KCYA 1MTWA 1N6XA 5DP6A 1HJAC 2A32A 1C2LA 2FYQA 2B9LA 2H9TH 4B76A 3RXLA 5H4IB 5FCKA 4WXIA 1CGJE 4O97A 2YMSC 3TU7H 1H9LB 4GLYA 5C0UA 1TB6H 1ELEE 2F3CE 5B6LA 1PJPA 1VGCB 1GL0E 1NC6A 4LZ4B 1GBCA 1P01A 4Y7AA 3KQ5A 4I8LA 1JWTA 5JBCS 1P3CA 3A84A 5EGMA 1MZDA 2ZECA 4Y71A 1D3TB 2SGDE 3ZYDA 1SHHB 1ELDE 1FY1A 1MBMA 1GHBF 2HVXA 2WYJA 2AMPA 1A1RA 1TALA 1OWDA 2VB0A 3VB7A 3MU0A 3RP2A 1FAKH 1GJBB 3SU1A 4WJG2 4HFPB 1MZAA 2Z3DA 3PROA 3M36A 1CHOF 3MU4A 4I86A 3U1IB 1GL1A 3ZZDA 4CH8B 4NFEA 1UMAH 1YPMH 3UWJH 4JYVH 5BPEA 1A0JA 3ODFA 1SC8U 1LHFH 2GCTC 1FI8A 2Y5GA 1K1OA 3OY6U 2BDHA 2Z9GA 4MTBA 5EW2H 2A31A 1WUNH 1XUFA 1GGDC 2W26A 3P8GA 1J8AA 1LHCH 1FUJA 1SKYE 1GHAF 1BTYA 1VJAU 1FDPA 1MU6B 1N8OB 1NRSH 1XX9A 4CREA 1PPCE 3ZZ3A 3LOXA 4CRCA 4FUCA 3S69A 3ZVAA 3JZ2B 5J4SA 3SNCA 1D6WA 2ZTXA 2FOHA 2HLDD 1MKXK 3LGWA 4Y8YA 1HPGA 1BB0B 3MO6A 1T4VH 4I8KA 4X8UH 3A8BA 4CRFA 1GHZA 4I31A 4UFFH 2ZZUH 1DITH 3AAVA 2XBVA 5K7RA 1W3CA 2CN0H 2FXRA 3BTEE 2GZ9A 4X1RU 3U8TH 1P05A 3HATH 1O3KA 1XKBC 8GCHG 1YYY1 1NBME 2H1UA 2G81E 2VGCC 1W0JD 1OYQA 3QO6A 1MQ6A 2BY9X 2CF9H 1CA0B 5EU8A 3BG8A 1TABE 1JBUH 4A92A 1NRPH 2QXJA 1V2TT 2WPHS 1UO6A 1GCTC 1FY3A 1HXEH 2ZEBA 3I78A 2IOTA 3Q00A 3U1JB 2M5TA 3I29A 2YMSD 1FY5A 1UJ1A 2GDEH 1FPHH 3RC4A 3A8DA 2SNWA 3P70B 2ZDNA 1QIXB 1ZZZA 4TY6A 1GBEA 1UTQA 4IMQA 3SUDA 1O2XA 5C17A 1DVAH 1A7SA 2GTBA 1S85A 1D6RA 2BDIA 2KCOA 3FVFB 3BF6H 3RLWH 1W7XH 3EGKH 1V2QT 1ANEA 3SGBE 5HGGA 3RM2H 5T6GA 1CU1A 4BANB 1EFRD 1FONA 3TITA 4M7GA 4X1PU 3M5NA 1MH0A 4JZ1A 4BNRA 3TJNA 2OBQA 1GBDA 1MKWK 1T8LA 4AFUA 4BTUB 1O2YA 3PWBA 3QTVH 4ISOA 3E0PB 2SGFE 5C94A 4FUEA 2JH0D 3M7UA 3A80A 4XBDA 5G4BA 3RMNH 1BDAA 4BTIB 1O39A 2HOBA 4X6PA 2OUAA 1YY3A 3SBKA 4B2AA 2BY7X 1BBRE 2ZU3A 1VCWA 3T62A 2ZTZA 1TGCA 1O2IA 1SL3A 1TYNA 4SGAE 3TGKE 3CNRA 3VGCB 3SW2B 1Z1JA 2BD3A 3U8OH 1V2OT 1XMNB 2W7SA 1BCUH 2GT7A 4DW2U 1TWXB 5DG6A 1TMUH 3QGJA 1NRQH 1ZMLA 1QJ6B 3MWIU 1GI0A 1MBQA 1SGDE 4GHQA 3SNBA 2ZQ1A 4B6FA 2XWBI 2F43B 1DX5M 1IHTH 2ZDLA 3R0FA 3MU5A 1SMFE 3PO1B 3Q3XA 3KYGA 2WUCA 4X6NA 2EI7A 1OOKB 3UQOA 3O8BA 5JBBS 4D9RA 3SNEA 4K8YA 3E16B 1VJ9U 1AVWA 2TIOA 6CHAC 1L1JA 3ITIA 2V3HH 3M7QA 4LXBH 3GYMA 3SOSA 3RXQA 4ESTE 1P2NA 3E0NB 1DDJA 2PHBA 1HJ9A 9ESTA 2ZFTA 2GMTC 4A6LA 5GWZA 3KHVA 1NM6A 3GOVB 3F68H 1O3IA 1GBAA 2IN2A 4I8JA 3ZVGA 2QXHA 1CT0E 2JJ2D 3W1EA 3UNSA 1TMTH 1SGQE 3KIDU 1Y3WA 2BLVA 3DFLA 4FUHA 4TWWA 1O37A 2G00A 3KQEA 1P0SH 1EAIA 1T31A 2XXLA 4NGAH 2W6ID 1UHBB 2PV9B 2PWXA 1O3NA 3ZYEA 1GI6A 1W12U 4ASHA 3LH3A 1FIZA 1W10U 4LZ1H 1NS3A 4AYVB 3CS7A 1CBWC 4WH8A 3PV2A 1QBVH 1YLNA 1AB9B 3QZRA 2ZIQH 4FOUC 3LC3A 2TBSA 3O8DA 1RD3B 2QE7D 2KM0A 4WY3A 1ANCA 2FM2A 1OWKA 1P11E 3C27B 4ZMAH 1O32A 2QF3A 3U8RH 3O8CA 2PLXA 5L30H 3LGTA 3STJA 3KQCA 1DSTA 1BBRK 1YKTA 4P00A 1T7CA 4CRBA 3P6ZB 3RXIA 3FZZA 3MH4A 1YPEH 4ABIA 1AUJA 4DT7B 2F9BH 3A7WA 5IYTA 4CRDA 4CBNA 4TPYA 4P02A 2PW8H 3K6ZA 5DP5A 4B73A 3OE7D 1ESTA 2F9OA 3T27A 1KLTA 1THSH 1CHGA 4ZH8A 3GY3A 4F49A 5A0CA 2ZFQH 2P94A 3A7YA 5F03A 2SGPE 1NU9A 4Z0KA 4AORA 1RFNA 3DCLA 1ELBA 1C5VA 1C4V2 2ZPQA 4CRGA 1IQLA 4DG4A 2CK3D 3PV4A 3RXGA 3T2NA 2FIRH 4RKJB 1SQOA 1ORFA 1O2HA 3RU4T 5L2ZH 2FOEA 1MU8B 2VVVA 1QZ8A 2F9UA 3ZVFA 1YPHE 1ZSLA 2A4QA 1EJNA 4X2YA 1C5XB 2P3FH 4AOQA 3RC6A 4E06H 4Z6AH 1V2VT 4U32A 4DOQA 4BAOB 2A7HA 2A4OA 1GBIA 1QGFA 1J17T 1P9SA 1BTUA 2F9NA 3U69H 2SGAA 3EE0B 1HAPH 2BQ7B 2A5AA 2XW9A 2VU8E 1L4DA 4JYTA 4BTTB 4CR9A 4JCNA 3HKJB 3T26A 1ZMJA 1YCPK 2C93B 2DE8A 1G2LA 1LHGH 2RCEA 1FXYA 1O31A 3DUXH 2OD3B 4CH2B 1TFXA 1F0SA 4Q4LA 2FTMA 1OS8A 2GZ7A 3SORA 3GICB 2G52A 5L6NH 4CHAB 1Z8IB 3GY5A 5IDKA 1HGTH 5AF9H 1Q3XA 5DP4A 3S9AA 3KQDA 2C8XB 2QAAA 4UFEH 1AFQC 1B0FA 3OX7U 1ZYOA 3F9GA 1XM1A 3EAJA 4KGAA 1XVMA 1QY6A 3RXCA 3NUMA 3MNBA 5C5NA 4ZKRU 5EJZA 2BQWB 3ZZCA 1IQEA 1G32B 4ZROA 4JMYA 5DSFA 7GCHG 3BG4B 5FPTA 4X8TH 1GBKA 5PTPA 2AGGX 2FYRA 1P8VC 4ZKOU 5DP3A 1ZR0A 4X2VA 3PMHB 4OGYA 1TGBA 3V0XA 1C5OH 1UVPA 5KEDA 1Z1IA 1BJVA 1C2DA 1MTNB 1HAXB 1THRH 3ZVCA 3ZZ9A 1U6QA 1ZGIA 3WWFA 1HIAB 2ILNA 4A1XA 2LELA 3UB0A 5AVDA 1FPCH 1P2MA 5FAHA 4K1SA 1GDUA 1TPAE 3Q77A 2EC9H 1ZHRA 1ETTH 2D2DA 3KYFA 2KZ4A 4B71A 1TRMA 4AFQA 3MQKC 2H2ZA 1GJ9B 3URDA 5JBAS 1RGQA 5HIYA 3F9EA 1O3MA 1E38B 3NKKA 4YM9A 1HAHH 2PUXB 5F8TA 1SOTA 1JIRA 1C1NA 2HALA 3VG8A 2JETB 1HAYB 4E05H 4X6OA 3RLYH 2EI8A 1QA0A 3PLBA 2FS9A 3EA9A 3TH3H 4WWYA 1S6FA 1HLTH 1SQRA 1IOEA 3ZZ4A 1GMDG 4F4OC 2XBYA 1EAWA 1XVOA 3A87A 3ZZAA 3P17H 1K1IA 1S0QA 1V2KT 1CA8B 4X2XA 4U01A 1AMHA 1J14A 1C5YB 2ZU4A 3ZZ7A 2ODYB 5ETXA 2ZHFH 1YPLH 2AHME 3OEHD 4F55A 2BHGA 2O8MA 2FI3E 2G8TA 1F0TA 2A2XH 1GMHG 3SV8A 1GI9B 2G55A 2WPKS 3RMOH 5EG4A 1AU8A 1KLJH 2F91A 1WCZA 7LPRA 3GY8A 1F2SE 1P57B 3RXEA 4Y0ZE 1GI3A 1AKSA 4ZUHA 2BDGA 3SZNA 4GCHF 3FKSD 1WU1A 4IC5A 4E7RG 4Y76A 2ZHQH 1G3CA 3SUFA 3NRLA 2FWWA 3E1XB 3AW1A 2O8TA 2L74A 1LVMA 4YOGA 2ZWLH 4MNYA 3SJIA 4AC9A 1HNEE 1QJ1B 2VNTA 1P06A 2GJGA 4AN7A 1EKBB 1WSSH 1Y3VA 4Y6DA 1Z8GA 3VB6A 4XRNA 3W94A 4SGBE 4KKDA 5E2PA 4O3TA 1XXFA 1AUTC 2KFWA 1NT1A 3BTKE 1RIWB 3KNXA 2P93A 3EA8A 2ZDAH 1T8OA 1SOZA 2FODA 2B0FA 2Y81A 2HPQH 2ZDKA 1A46H 1ELCA 1PQ5A 1F5KU 2BD5A 2TGAA 3ZV8A 3LIWA 4GUXA 4AGKA 1UVUH 1V2LT 2G51A 5FPYA 1UTKA 2D1JA 2P16A 3KEEA 1QA7A 2ZGCA 2PFEA 1E1RD 1D3DB 1VITG 2Z9KA 4NFFA 1W13U 2A1DB 1P2KA 2GP9B 1C1SA 1OKXA 1SGFA 4HZHA 2EY4C 2FLBH 1EASA 2FESH 2CF8H 4INHA 2RDLA 3WW7A 2OP9A 3DFJA 3SYJA 3RU4E 1TOMH 3ATMA 2HNTC 3LDXH 4K60A 1UTOA 4WF8A 3K2UA 2BVXH 4AG2A 5A0AE 1ZMNA 2O8LA 3UQVA 3JZ1B 5HKKD 5E0GA 1A3EH 5HIZA 1PFXC 2I6SA 3OAAD 1SQTA 1J15A 1BA8B 3SI4H 5T6DA 2QF4A 2L6OA 3BIVH 3BEFB 2D26C 4I7YH 1MKXH 1KIGH 2A2QH 4X1NU 1AGJA 1C5RA 2Y5HA 3GDSA 4I32A 2DE9A 1Y3YA 4AYYB 4CBOA 3TPIZ 2SNVA 3D62A 1OWIA 2Y7XA 2R0LA 1GVLA 1CGIE 2BMGB 1MAYA 5FCRA 1HBTH 2BQ6B 2XNIA 2BLWA 1QQ4A 3UOPA 2GVFA 3LPRA 3V3MA 1MD7A 1YC0A 3HGNA 1WQSA 5GNDA 1JRTA 3M3TA 1VITH 1HJAB 2UWLA 3PRDA 3RXFA 3F2HA 3A89A 1BRAA 5C1XA 2ZGBH 2YMSB 2FI5E 3HK6B 1AWFH 1X7AC 2GCHG 1YLDA 1WTGH 1J9CH 5JYIA 1O5GH 5F8XA 2ZPRA 2STAE 1JIMA 1WBGB 2G4TA 3GY2A 3TGIE 4Y8XA 1PQ8A 4JK5A 2VIQA 4BAHB 3QK1A 1H9IE 3SN8A 4X8VH 2VWOA 2FS8A 1QURH 3V12A 4DGJA 1ARBA 1KDQA 1TX8A 3S7HB 1FNIA 3SHCH 1P04A 2P3UB 1FMGA 3ATIA 3Q3YA 1O3PB 1GHVH 1S6LA 2J98A 3N7EA 1ELVA 3RXTA 1ZHPA 3ATKA 1HFDA 3M5LA 3I77A 1KSNA 1C5WB 5GJ4B 1O36A 2GCTB 1F5LA 2CXVA 1QL7A 3MHWU 5A2MH 3SU2A 1LQDB 1MKWH 3SUGA 2O9QA 1PYTC 1GGDB 2R3UA 3TNSA 1L1NA 1UCYK 2J34A 4NWKA 3ZZ6A 3LGIA 1JXPA 2DUCA 4NA8A 2QXIA 1WV7H 2ZGJA 2LPRA 4O9VA 5A0BA 4FUBA 1F7ZA 1K2I1 1F5RA 2NU2E 1YF4A 1UVOA 1G2MA 1BTWA 1IQGA 1P2IA 2K8IA 2Z6BD 4VGCC 5A8XA 5C0TA 4X1SU 2GZ8A 4J2YB 1SR5C 3BTFE 2PTCE 1A3BH 3FP6E 4YLQH 1FQ3A 3UUZA 2ZI2H 2Y7ZA 1GDQA 3OFND 1C2JA 7ESTE 1PPGE 2Q6GA 1OSSA 3RXKA 3A7ZA 2VGCB 3TJUA 3LU9B 3MTYA 1C5LH 4AB8A 5LH8A 1GI5A 2R0KA 2BD4A 2QC2A 3CS0A 3IWMA 2BD7A 1N6YA 1LPZB 1MCTA 1DS2E 2QN5T 3V7TA 3BV9B 1LMWB 1H4WA 1GPZA 4CRAA 3FANA 1T8MA 1GCTB 1DY9A 5C1UA 1FV9A 2ZGHA 5GPIB 5I46H 4X6MA 1SLVB 3SO3A 1DM4B 1GJ5H 1OP2A 2BVRH 3OYPA 2NU0E 1HAGE 3H09A 4O03A 1LKAA 5HYOA 4NIWA 3SJ8A 1G9IE 4YT7H 2XC5A 3K6YA 1F92A 3RXBA 1K1NA 1BRBE 5LPEA 1H8ED 2FOAA 1P2QA 1YCPM 2XOKD 4OS6A 1QNJA 1DWEH 1C5TA 2ZPSA 4MPVA 2ZC9H 4U2WA 4ACBA 1EJMA 1EZXC 1ANBA 1N1LA 4YOJA 2ODPA 2CGAA 4ABBA 2J92A 3E90B 1ELTA 4ISHH 1BT7A 1TX6A 3AAUA 1NFWA 1QBOA 5BRRE 4XFQA 8LPRA 1AHTH 5GDSH 1ZSKA 1PPHE 1ZOMA 2ZCKP 2XRCA 6GCHF 3F2FA 1BRCE 1C5NH 2ULLA 4RN6A 2PSXA 1SGRE 2AERH 1D3QB 4X2WA 3DSGA 4A7IB 4XDEA 1SGTA 3WWBA 2GGVB 1PYTD 3BTWE 1VR1H 5EQSA 1H8IH 1DLKB 1GJ4H 1Q2WA 1O3JA 1O2GH 2NU3E 5LPFA 1E35B 2WINI 1BMLA 1SGEE 4A5TS 5EJ1A 2GX4A 4M9FA 4B6EA 1ETRH 4YO9A 2ZU1A 1SGCA 2EA3A 8KME2 1C5PA 1O3LA 1JOUB 1O5FH 3UY9A 2Y6TA 1O33A 2OBOA 4ZKNU 2W5EA 3RXDA 4BXSA 2PKSC 2PR3A 3RDZA 4MPWA 3PLPA 5DGJA 1ID5H 2A0QB 3MO9A 4WXVA 1CSOE 3OEED 4DVAU 2UUYA 1O3CA 2QCYA 4NG9H 3UR9A 2FP7B 2F9VA 4IC6A 1ARCA 4KELA 3L6PA 1GMCG 3KCGH 4XD7D 1L2EA 2OC8A 2A5KA 1HXFH 2WUBA 1C2IA 2H5DA 6CHAB 2KAIA 3PRBA 5DJ7A 3S0NA 1BQYA 3ATLA 1M9UA 1GVKB 2BB4A 1GHXH 1BITA 2B7DH 2GMTB 2A45B 1T8NA 3SV6A 3QN7A 4INLA 2B8OH 2KCPA 5C20A 3DSOA 1C9TA 1BOQA 1YCPH 1DANH 1NRNH 2C8WB 2P3TB 1OWJA 2OXSA 2BY8X 1DFPA 1SGNE 1GJ7B 1EJAA 1ZSJA 1OYTH 3RXRA 1ELGA 2R9PA 4H6SB 1C1VH 3S9BA 2G4UA 3GCTG 4K3JA 2H5CA 2JH5D 3LGYA 4IBLH 4Y11E 4A1VA 2Y5FA 3ODDA 3DD2H 1CBWB 1Y59T 2OC7A 4NCYA 1GDNA 3EDXB 1C2KA 3VXEH 3BTTE 1MTUA 2FOMB 4RT1A 3H7TA 1GJ8B 1TRNA 1O0DH 1O2WA 2ESTE 4JZEH 1BTPA 3LJJA 5F8ZA 1SGFG 2BOHB 2ASUB 2BLOA 2GDDA 5EQRA 2FTLE 2GV7A 2J4IA 2I6QA 2IPQX 4MLFB 3MH7A 5I25A 1O2OA 1RTKA 5EW1H 3BTME 2O8UA 1AZZA 5CMXH 1BTZA 4ABFA 1EOJA 1KXCA 3DSPA 3ZZ5A 2UWPA 1NO9H 3D65E 1G3EA 2CHAC 2WPDD 4XSKU 3MNCA 3BTDE 1DPOA 5T6FA 3HKIB 4YESB 2C8YB 1SPJA 1GHBG 2YOLA 3OU0A 1YPKH 2CMYA 1KXEA 2ZDMA 4ZXXH 3TJOA 3L33A 1Z71A 2VH0A 3FP8E 2OCVB 2F83A 1CHOG 1PQ7A 3TK6A 3SJ9A 1O5BB 2VIPA 4OM9A 5CE1A 1K0HA 1O5CB 1O38A 4FXGH 2J94A 1S82A 2BZ6H 1GI8B 4CR5A 4FETA 1SFQB 4Y10E 5CHAC 1ZJDA 4K1TA 3M5OA 3P8FA 1GHAG 1O3HA 1O34A 1P09A 3A7TA 2ZG0H 1E36B 3TIUA 4DIIH 1ESAA 1BMAA 2FDAA 1IQHA 6ESTA 1WYKA 1CQQA 2WV4A 5FHTA 1T32A 1QHRB 1KLIH 1V2MT 3TNTA 4R8TB 1C5UA 2ZQ2A 1B0EA 4D76A 1GJCB 4H42U 2YNAA 2VIVA 3M3VA 2VINA 3MO3A 1C4Y2 3BSQA 4JZIA 1IHSH 1W7GH 1ZRKA 5LPRA 1AIXH 1O5EH 1C2GA 1O2UA 3GS9A 3Q3KA 1GI7B 2ZFPH 1SFIA 2FOFA 3SGAE 4NA7A 1NU7B 1O2JA 2J97A 2J9NA 4E7NA 1V2ST 1W2KH 1AFQB 4TT3D 2BDYA 3F3BA 3ZVEA 2XYAA 2FEQH 1D4PB 4QT8C 1Y5BT 3SUEA 3MH5A 1ABJH 1C9PA 4ZHAA 2CJIA 8GCHF 4ZCNA 2H9HA 2ZHEH 1L4ZA 2FZZA 3RXAA 2KCAA 4KP0A 5E8EH 2BD8A 1HAVA 1XUJA 1LDTT 1AQ7A 1B7XB 5TJXA 2QV1A 1BTHH 2QYIA 4NSVA 2OQUA 5CHBA 1QL9A 3MU8A 3SU3A 1SBWA 2QA9E 1F0UA 4MQAA 1KDQB 2ZTYA 3F1SB 2BLQA 3NCLA 5FBEA 2GKVE 1GBLA 1TQ7B 1K1JA 2RA0A 4X1QU 1XUGA 5FX5A 4AFZA 2R3YA 3A81A 1H8HD 2J98B 3VPKA 5C67A 2BTCE 4PROA 3HPTB 1C1MA 3GCNA 4D8NA 1BZXE 4HI3A 4XBCA 1FN6A 3ZIAD 3K65B 1TPOA 1TMBH 1VCQA 2P8OC 2XC4A 4ZHLU 3FAOA 1QB1A 1RXPA 3RXJA 3F6UH 1KMHB 2Y80A 3QUMP 2Q6FA 3TK5A 4Y7BA 2F9PA 4WMFA 1AZ8A 1MQ5A 3PLKA 2O8WA 1BHXB 4NA9H 1EB2A 3RMMH 1AWHB 1C5ZB 1C1QA 2J38A 9LPRA 2NWNA 4H4FA 1XUIA 3A82A 1A0LA 2WSSD 3M35A 2HWLB 3KF2A 2BDBA 1W0YH 4I8HA 5DPAA 2IPHA 2OLGA 2Z9LA 4UE7H 3UTUH 2WPJS 1LTOA 1SI5H 2V7QD 3F0PA 5IK2D 4Q7YA 4FVBA 1NTPA 1Y8TA 2ZO3H 5JDUB 3GYLB 2BZAA 3UREA 3MYWA 2Z9IA 3GY7A 2AS9A 4Q63A 4O3UA 3U28C 3MOCA 1HAIH 1NZQH 1SGIB 4D7GA 1UK3A 3GCHC 1JMOH 3S7KB 5HM2A 3SV9A 1UVSH 3OY5U 1IQJA 1HAOH 4ISIH 1S0RA 1WXRA 3QDZB 1LCYA 5T1VA 5A09A 3H5CB 1TNJA 3CENA 2TPIZ 2K1QA 1ZLRA 4KTUA 1QTFA 2J5UA 1HB0B 3LONA 1OHHD 1EZSC 3QZQA 1UTPA 1Y3UA 2BD2A 1DLEA 1G36A 3RUOA 3RXVA 2GV6A 2STBE 1P02A 2Z3EA 3TJVA 1LHEH 1S6HA 3RC5A 1SG8B 2QXGA 2FI4E 3NZIA 1EOLA 1C5MD 3T29A 3SV7A 3KGPA 2LP6A 1P9UA 4ABHA 1O30A 2WPMS 5CDFE 3NWUA 2OINA 3TLOA 1V2PT 1FN8A 1GG6C 3RXHA 1CGHA 2V3OH 5TCCA 1UTMA 5HMAA 1EPTC 1QQUA 2OTVA 1E0FD 6LPRA 3TK9A 1AN1E 1W0KD 4YLUA 3SNDA 3K9XB 1TX7A 2XTTB 2H9EH 3SI3H 1UTLM 2VWLA 1H8DH 5KECA 2HVYB 3A86A 2Z3CA 2R2MB 2ANYA 1ELAA 3BIUH 2ZHDA 4TPIZ 1UTNA 3AVZA 3FFGA 1NESE 4BXWA 2ZHWH 1UCYH 1HRTH 1SVPA 2BM2A 2FOBA 3TH4H 1DSUA 4Y0YE 4AZ2B 3A8AA 1EP5A 3UAIC 2ALVA 2Z94A 1FY4A 2VH6A 1A4WH 3LGVA 5EXMA 1LVOA 3NK8A 4THNH 1SGPE 3H7OA 1ZTKA 5C3NA 2BDAA 1SLWB 4F48B 2QF0A 2HNTE 2PP6A 4KTCA 1OWHA 3AK5A 1VGCC 2PTNA 1UK2A 2H6MA 3LC5A 4OGXA 4K2YA 3BTHE 5B6OA 2JIZD 4B2CA 1F0RA 3KL6A 1PPZA 3MNXA 1BMMH 3BTGE 1P03A 4UFDH 1V2NT 1Y3XA 2V6NA 1KXDA 4ISLA 1HAZB 4X0WU 1GJDB 2RDEA 1TNLA 1ZTLA 1MTVA 1AO5A 2OQ5A 1WDIA 2KAIB 5A8ZA 4DJZB 1DUEA 2VWNA 3EYDA 5T3HA 2W3IA 3GY4A 1EUFA 1OP8A 1DWCH 2RG3A 3SU4A 3RU4D 1Z8JB 4FUFA 1MCVA 1HIAA 1G3BA 2NU4E 1GBJA 1L1GA 3ENSB 1W8BH 1IQKA 4AFSA 2BXUH 3T25A 4HGCA 2B5TB 2M2AA 2VWMA 1NY22 5JPMH 1C2EA 3UOUA 2ZCLP 5EQQA 3UR6A 1NPMA 4UD9H 2P59A 1Z7KA 3E8LA 1N8OC 1CVWH 5FBIA 1EX3A 2TGPZ 1O35A 2EI6A 1SB1H 1ETSH 1E34B 1TA2A 5F6MA 5EXLA 4Y8ZA 1O2RA 1KY9A 1TBZH 4RSPA 1W14U 5GXPA 1ZGVA 2BVSH 3W95A 1H9HE 4IN1A 1QB6A 3TGJE 5GCHG 2JDID 1EATA 2PKAA 1YBWA 2A4GA 2XBXA 1NFYA 5C2ZA 1TLDA 1MUEB 4AGJA 3FN8A 4UEHH 4GPGA 1CA0C 2W7UA 1E79D 3A8CA 2QGRA 1HV7A 3TVJB 1DWDH 3ZZBA 2Z9JA 1DICA 1Y5AT 2BX3A 1O3GA 1TIOA 1GWAA 5E0JA 7GCHF 5SGAE 1GBHA 1PQAA 3N7DA 2VIOA 4VGCB 3E91A 2AMDA 2NU1E 1GJ6A 4FUJA 3E3TA 1ZHMA 2WYGA 5C5OA 4D9QA 3IG6B 2ANKH 4GSOA 1TGSZ 4OS7A 1C1OA 1O2QA 5DKMA 1ACBE 2AIPA 1W11U 4A1TA 4ABGA 2V35A 1NFUA 1TE0A 2G5VA 1GI2A 1KTTB 1QJ7B 3M3SA 1VCPA 1SGYE 1FAXA 4FUGA 3TH2H 1KYNA 1A5HA 3SNAA 3QTOH 4Z1MD 1O2MA 2VVUA 2J2UA 4XBBA 1K9OE 2GD4B 4H6TA 2HGTH 1AE8H 1V2RT 4ZAEA 2ZFFH 3RXMA 1BHXF 1Q31A 1OXGA 3M7TA 1V6DA 4MPXA 2ZU2A 1IQMA 1QRZA 1BIOA 3NPSA 2UUKB 3LT3A 2ZGXH 2XC0A 4FVDA 1RS0A 1SQAA 1LPGB 1ABIH 4BAKB 5FXLA 1K1MA 4FUIA 2AGEX 2AGIX 3PMAB 3N99A 1SSXA 3VEQB 1O3FA 1DOJA 3ZVDA 2W3KA 3RMLH 1PPEE 1TPSA 1TRYA 2FOGA 1GMDF 1AVGH 1OPHB 3F2GA 2FPZA 2Y82A 4I33A 4TYDA 1NBMD
chains in the Genus database with same CATH topology
1Z8RA 1GHWH 1GBTA 1P12E 1EQ9A 2AH4X 4GCHG 3VGCC 2XBWA 4B75A 1S83A 2WV5A 1BTXA 1LO6A 3MH6A 1GI4A 1MAXA 5L2YH 1EB1H 2SGQE 1A5GH 1IQIA 1BBRH 3M5MA 3SU5A 1GMHF 3PB1E 1EPTA 2A7JA 1DXPA 4FUDA 1O3BA 2JH6D 1FJSA 3A83A 1O2LA 3OSYA 1FY8E 1ZRBA 3VFEA 3P95A 1O2VA 4TY7A 1DT2A 4BAMB 1G30B 1UTJA 1TA6A 1W0ZU 1C1TA 3U98H 2J95A 1QL8A 1KXBA 3EQ0H 3PO1C 1BUIA 1HAVB 3UPEA 1ZPCA 4OS2A 1BMNH 1BRUP 4ABJA 1T4UH 3RXOA 4LK4A 1YPJH 1IQFA 2ZU5A 1GBBA 1QCPA 2HLCA 1C5SA 1K21H 3QX5H 1ZPBA 4X8SH 1RTFB 4AB9A 4K69A 4DURA 1XUKA 2XCFA 3QWCH 3PTBA 3L3TA 2PKSB 1GCDA 3FP7E 1EP6A 3EA7A 1AVXA 1LPKB 4FU8A 2HNTF 1ZTJA 1Z6JH 1C2MA 3VB4A 3IITA 4MPUA 3SJOA 1VITF 5DK1A 2AFQB 2SFAA 3B9FH 3GCOA 1YLCA 1XUHA 1HCGA 1V2WT 3LH1A 8ESTE 3UNQA 3PWCA 5EODA 2VJ1A 4INKA 1TAWA 3ELAH 2LNCA 1DXWA 1EZQA 1GHYH 4Q2KA 3GDVA 1G3DA 2GT8A 1GJAB 1TOCB 2A7CA 1AB9C 1SLXB 4J1YA 4ABEA 5EPNA 1A61H 1AKSB 1NRRH 3RM0H 2ZF0H 1ZJKA 4AG1A 2UUJB 5JB8S 1LKBA 1O3OA 1MTSA 3GY6A 2Q6DA 2VVCA 4K5ZA 4BOHA 1O2PA 1P3EA 3P8OA 3UIRA 3ZZ8A 1C1PA 2AYWA 3STIA 1O5AB 4I8GA 3AASA 1NN6A 1O2SA 1YPHC 4NIYA 5JBTA 5DP9A 1O2ZA 2P95A 4MG3A 1UK4A 1E37B 1TBQH 1C1UH 4ZKSU 3DT0H 5FX6A 1GVZA 4IS5A 4DIHH 3WY8A 5A8YA 4IN2A 1IAUA 2Z7FE 1NROH 1TNGA 2BDCA 4B2BA 5DP7A 1GBMA 4XE4A 5EOKA 1AFEH 1K1PA 2ZP0H 1DE7H 5FPSA 1QRWA 1A2CH 4IMZA 3MI4A 4MNVA 2QY0B 4NWLA 4K1EA 1OWEA 1C4U2 3A7XA 4HTCH 4WMDA 1IQNA 1YM0A 3SU6A 2PUQH 1DY8A 2ODQA 4WMEA 1YPGH 2CHAB 5DP8A 1RRKA 3P92A 2FMJA 3UFAA 1AE5A 2GCHF 1PPFE 1V2JT 4OS4A 3ZVBA 5LGOA 1TGNA 3GISB 1QBNA 5AFZH 4U30A 2PGQB 1TNIA 1WQVH 4Q80A 4Q7ZA 1H1BA 3A88A 1AI8H 1A0HB 1O5DH 1S81A 5DO4H 1P2OA 1ELFA 1BJUA 1SHYA 3F9FA 1TNKA 5TCAA 1D9IA 2BOKA 1O3AA 3UWIA 5CHAB 3M37A 4ABAA 4CHAC 1O3EA 2ZDVH 2A4RA 3KN2A 1OX1A 2SGEE 2C8ZB 5HXFA 5ESBA 5GIBA 1O2NA 3UNRA 4DY7B 2OC1A 1TQ0B 2FLRH 2TGTA 1MMJN 3HK3B 1FIWA 4MNWA 4UONA 3V13A 4NZQA 3SQHE 5ESTE 1S5SA 2UUFB 2HRVA 3BG4C 1WAYB 2TRMA 3SQEE 1EAUA 4JZFH 3QGNB 1AY6H 4NIXA 1O2TA 3LJOA 2C90B 4NSYA 1C1WH 1MTNC 3OTJE 2IJOB 1XXDA 1GI1A 5GCHF 1NFXA 1P10A 4IGDA 3PMBB 2ZCHP 3DHKH 4FU7A 4GAWA 4WH6A 4NIVA 3BTQE 5HM9A 3ESTA 4GVUA 1CT4E 3C1KA 2THFB 4XOJA 1K1LA 1XKAC 2AMQA 2ZFSA 2G5NA 1RJXB 1MD8A 2BD9A 3LKWA 1A5IA 2PSYA 3O8RA 2JETC 3MMGA 2ZKSA 2TGDA 1YP9A 1CO7E 3T28A 2ZA5A 4JYUH 1L0ZA 3R3GB 5AFYH 3U9AH 1KXFA 2HPPH 3AW0A 4OS1A 1SLUB 4B74A 2BX4A 3PMJA 3SU0A 4MVNA 5EPYA 3BEIB 1Y5UT 2FO9A 2ZNKH 3F9HA 2D8WA 1YGCH 5E2OA 3B8JA 4Y79A 2QIQA 1P2JA 4YOIA 1LHDH 3BEUA 3D23A 3NXPA 2P8OB 3SJKA 4Q7XA 2PKAB 1ANDA 1EXFA 1KTSB 2FOCA 4ABDA 6GCHG 1UVTH 1QR3E 4UDWH 3RXPA 4DCDA 1TONA 1UHBA 2AIQA 4WVPE 3T5FH 4R0IA 4MDSA 1B5GH 1THPB 4YTAA 2YNBA 1INCA 1DWBH 1QRXA 2RA3A 5J4QA 1V3XA 3DA9B 1C1RA 4JK6A 1C5QA 2XWAA 3S9CA 1WTHD 3SV2H 5E0HA 1FLEE 2BXTH 2BYAX 4B1TA 1QB9A 1K28D 2BY6X 2WPLS 1VZQH 1ESBA 4AX9H 1HUTH 1AD8H 1EZUC 5JB9S 1RIWC 1WOFA 2Q1JA 3RXUA 1EAXA 2R2WU 4NZLA 4ZXYH 1O3DA 5ABWA 1TBRH 1LVBA 1RTLA 2EEKA 3ATWA 3GCHB 1V2UT 4RKOB 1ZPZA 1TGTA 4YZUA 1OP0A 3G01A 1C2HA 4JZDH 4K8BA 4OS5A 3VB5A 2ALPA 7KMEH 5EXNA 4FU9A 1S84A 2OC0A 1J16A 1TNHA 2FX4A 4UFGH 3GDUA 1D3PB 1DUAA 1GMCF 1K22H 2VIWA 3MU1A 4D7FA 3VB3A 2JKHA 3E6PH 3D49H 1LQEA 4ZHMU 5C1YA 3SHAH 4GHTA 3PTNA 3FZDA 3M61U 4IW4E 2WPIS 2BY5X 2PGBB 3PYHA 5AHGH 3PM3A 2V0BA 3LGUA 2FX6A 1QFKH 2A5IA 2VIDA 1C2FA 4TWYA 1HYLA 1G37A 3CP7A 3ZV9A 1CE5A 1KXAA 3B23B 2C4FH 1GBFA 2ANMH 1HJ8A 1JRSA 1HDTH 3MFJA 1GG6B 2XCNA 3QLPH 3HGPA 5K0HA 4LOYH 3BN9A 3Q76A 1EPTB 2C3SA 4KTSA 1Z6EA 4YT6H 3KQBA 4BAQB 3N7OA 4MNXA 3A85A 2ZFRH 1UCYE 2ANWA 3GCTF 3SGQE 1PPBH 2CV3A 3A7VA 3MNSA 4ISNA 3RXSA 1CT2E 1FZZA 1LVYA 3P8NA 1TPPA 3URCA 1O2KA 2AEIH 2UWOA 3VXFH 1MTWA 1N6XA 5DP6A 1HJAC 2A32A 1C2LA 2FYQA 2B9LA 2H9TH 4B76A 3RXLA 5H4IB 5FCKA 4WXIA 1CGJE 4O97A 3TU7H 1H9LB 4GLYA 1TB6H 1ELEE 2F3CE 1PJPA 1VGCB 1GL0E 1NC6A 4LZ4B 1GBCA 1P01A 4Y7AA 4I8LA 1JWTA 5JBCS 1P3CA 3A84A 5EGMA 1MZDA 2ZECA 4Y71A 1D3TB 2SGDE 3ZYDA 1SHHB 1ELDE 1FY1A 1MBMA 1GHBF 2HVXA 2WYJA 2AMPA 1A1RA 1TALA 1OWDA 2VB0A 3VB7A 3MU0A 3RP2A 1FAKH 1GJBB 3SU1A 4WJG2 4HFPB 1MZAA 2Z3DA 3PROA 3M36A 1CHOF 3MU4A 3U1IB 3ZZDA 1GL1A 4CH8B 4NFEA 1UMAH 1YPMH 3UWJH 4JYVH 5BPEA 1A0JA 3ODFA 1SC8U 1LHFH 2GCTC 1FI8A 2Y5GA 1K1OA 3OY6U 2BDHA 2Z9GA 4MTBA 5EW2H 2A31A 1WUNH 1XUFA 1GGDC 2W26A 3P8GA 1J8AA 1LHCH 1FUJA 1GHAF 1BTYA 1VJAU 1FDPA 1MU6B 1N8OB 1NRSH 1XX9A 4CREA 1PPCE 3ZZ3A 3LOXA 4CRCA 4FUCA 3S69A 3ZVAA 3JZ2B 5J4SA 3SNCA 1D6WA 2ZTXA 2FOHA 1MKXK 3LGWA 4Y8YA 1HPGA 1BB0B 3MO6A 1T4VH 4I8KA 4X8UH 3A8BA 4CRFA 1GHZA 4I31A 4UFFH 2ZZUH 1DITH 3AAVA 2XBVA 5K7RA 1W3CA 2CN0H 2FXRA 3BTEE 2GZ9A 4X1RU 3U8TH 1P05A 3HATH 1O3KA 1XKBC 8GCHG 1YYY1 2H1UA 2G81E 2VGCC 1OYQA 3QO6A 1MQ6A 2BY9X 2CF9H 1CA0B 5EU8A 3BG8A 1TABE 1JBUH 4A92A 1NRPH 2QXJA 1V2TT 2WPHS 1UO6A 1GCTC 1FY3A 1HXEH 2ZEBA 3I78A 2IOTA 3Q00A 3U1JB 2M5TA 3I29A 1FY5A 1UJ1A 2GDEH 1FPHH 3RC4A 3A8DA 2SNWA 3P70B 2ZDNA 1QIXB 1ZZZA 4TY6A 1GBEA 1UTQA 4IMQA 3SUDA 1O2XA 1DVAH 1A7SA 2GTBA 1S85A 1D6RA 2BDIA 3FVFB 3BF6H 3RLWH 1W7XH 3EGKH 1V2QT 1ANEA 3SGBE 5HGGA 3RM2H 5T6GA 1CU1A 4BANB 1FONA 3TITA 4M7GA 4X1PU 3M5NA 1MH0A 4JZ1A 4BNRA 3TJNA 2OBQA 1GBDA 1MKWK 1T8LA 4AFUA 4BTUB 1O2YA 3PWBA 3QTVH 4ISOA 3E0PB 2SGFE 4FUEA 2JH0D 3M7UA 3A80A 4XBDA 5G4BA 3RMNH 1BDAA 4BTIB 1O39A 2HOBA 4X6PA 2OUAA 3SBKA 4B2AA 2BY7X 1BBRE 2ZU3A 1VCWA 3T62A 2ZTZA 1TGCA 1O2IA 1SL3A 1TYNA 4SGAE 3TGKE 3VGCB 3SW2B 1Z1JA 2BD3A 3U8OH 1V2OT 1XMNB 2W7SA 1BCUH 2GT7A 4DW2U 1TWXB 5DG6A 1TMUH 3QGJA 1NRQH 1ZMLA 1QJ6B 3MWIU 1GI0A 1MBQA 1SGDE 4GHQA 3SNBA 2ZQ1A 2XWBI 1DX5M 1IHTH 2ZDLA 3R0FA 3MU5A 1SMFE 3PO1B 3Q3XA 2WUCA 4X6NA 2EI7A 1OOKB 3UQOA 3O8BA 5JBBS 4D9RA 3SNEA 4K8YA 3E16B 1VJ9U 1AVWA 2TIOA 6CHAC 1L1JA 3ITIA 2V3HH 3M7QA 4LXBH 3GYMA 3SOSA 3RXQA 4ESTE 1P2NA 3E0NB 1DDJA 2PHBA 1HJ9A 9ESTA 2ZFTA 2GMTC 4A6LA 5GWZA 3KHVA 1NM6A 3GOVB 3F68H 1O3IA 1GBAA 2IN2A 4I8JA 3ZVGA 2QXHA 1CT0E 3UNSA 1TMTH 1SGQE 3KIDU 1Y3WA 2BLVA 3DFLA 4FUHA 4TWWA 1O37A 2G00A 3KQEA 1P0SH 1EAIA 1T31A 2XXLA 4NGAH 1UHBB 2PV9B 2PWXA 1O3NA 3ZYEA 1GI6A 1W12U 4ASHA 3LH3A 1FIZA 1W10U 4LZ1H 1NS3A 4AYVB 3CS7A 1CBWC 4WH8A 1QBVH 1AB9B 3QZRA 2ZIQH 3LC3A 2TBSA 3O8DA 1RD3B 4WY3A 1ANCA 2FM2A 1OWKA 1P11E 3C27B 4ZMAH 1O32A 2QF3A 3U8RH 3O8CA 2PLXA 5L30H 3LGTA 3STJA 3KQCA 1DSTA 1BBRK 1YKTA 1T7CA 4CRBA 3P6ZB 3RXIA 3FZZA 3MH4A 1YPEH 4ABIA 1AUJA 4DT7B 2F9BH 3A7WA 5IYTA 4CRDA 4CBNA 4TPYA 2PW8H 3K6ZA 5DP5A 4B73A 1ESTA 2F9OA 3T27A 1KLTA 1THSH 1CHGA 4ZH8A 3GY3A 4F49A 5A0CA 2ZFQH 2P94A 3A7YA 5F03A 2SGPE 1NU9A 4Z0KA 4AORA 1RFNA 1ELBA 1C5VA 1C4V2 2ZPQA 4CRGA 1IQLA 4DG4A 3PV4A 3RXGA 3T2NA 2FIRH 4RKJB 1SQOA 1ORFA 1O2HA 3RU4T 5L2ZH 2FOEA 1MU8B 2VVVA 3ZVFA 2F9UA 1YPHE 1ZSLA 2A4QA 1EJNA 4X2YA 1C5XB 2P3FH 4AOQA 3RC6A 4E06H 4Z6AH 1V2VT 4U32A 4DOQA 4BAOB 2A7HA 2A4OA 1GBIA 1QGFA 1J17T 1P9SA 1BTUA 2F9NA 3U69H 2SGAA 3EE0B 1HAPH 2BQ7B 2A5AA 2XW9A 2VU8E 1L4DA 4JYTA 4BTTB 4CR9A 4JCNA 3HKJB 3T26A 1ZMJA 1YCPK 2C93B 2DE8A 1G2LA 1LHGH 2RCEA 1FXYA 1O31A 3DUXH 2OD3B 4CH2B 1TFXA 1F0SA 2FTMA 1OS8A 2GZ7A 3SORA 3GICB 2G52A 5L6NH 4CHAB 1Z8IB 3GY5A 5IDKA 1HGTH 5AF9H 1Q3XA 5DP4A 3S9AA 3KQDA 2C8XB 2QAAA 4UFEH 1AFQC 1B0FA 3OX7U 1ZYOA 3F9GA 1XM1A 3EAJA 4KGAA 1XVMA 1QY6A 3RXCA 3NUMA 3MNBA 5C5NA 4ZKRU 2BQWB 3ZZCA 1IQEA 1G32B 4ZROA 4JMYA 7GCHG 3BG4B 5FPTA 4X8TH 1GBKA 5PTPA 2AGGX 2FYRA 1P8VC 4ZKOU 5DP3A 1ZR0A 4X2VA 3PMHB 4OGYA 1TGBA 3V0XA 1C5OH 1UVPA 1Z1IA 1BJVA 1C2DA 1MTNB 1HAXB 1THRH 3ZVCA 3ZZ9A 1U6QA 1ZGIA 1HIAB 2ILNA 4A1XA 5AVDA 1FPCH 1P2MA 5FAHA 4K1SA 1GDUA 1TPAE 3Q77A 2EC9H 1ZHRA 1ETTH 2D2DA 4B71A 1TRMA 4AFQA 2H2ZA 1GJ9B 3URDA 5JBAS 1RGQA 3F9EA 1O3MA 1E38B 3NKKA 4YM9A 1HAHH 2PUXB 5F8TA 1SOTA 1JIRA 1C1NA 2HALA 2JETB 1HAYB 4E05H 4X6OA 3RLYH 2EI8A 1QA0A 3PLBA 2FS9A 3EA9A 3TH3H 4WWYA 1S6FA 1HLTH 3ZZ4A 1IOEA 1GMDG 4F4OC 2XBYA 1EAWA 1XVOA 3A87A 3ZZAA 3P17H 1K1IA 1S0QA 1V2KT 1CA8B 4X2XA 4U01A 1AMHA 1J14A 1C5YB 2ZU4A 3ZZ7A 2ODYB 5ETXA 2ZHFH 1YPLH 2BHGA 2O8MA 2FI3E 2G8TA 1F0TA 2A2XH 1GMHG 3SV8A 1GI9B 2G55A 2WPKS 3RMOH 5EG4A 1AU8A 1KLJH 2F91A