4Y10E

Trypsin in complex with with bpti mutant (2s)-2-amino-4,4-difluorobutanoic acid
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cationic trypsin
publication title Fluorine teams up with water to restore inhibitor activity to mutant BPTI.
pubmed doi rcsb
molecule tags Hydrolase/hydrolase inhibitor
total genus 57
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2015-02-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4y10E01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4y10E02
1JRTA 2PUXB 3LGIA 3CP7A 4OS6A 1EAWA 4FUGA 5EW2H 1HAHH 1GJ5H 4K5ZA 8KME2 1TMBH 5A0AE 1UTMA 1K9OE 2ZGXH 1SGTA 3RXCA 1K21H 1O2XA 3HKIB 3LH3A 3MU1A 4DOQA 7ESTE 1FY3A 4LZ4B 2Z3EA 2FTMA 1QR3E 1W2KH 4JK6A 3Q00A 3BG4C 5A8XA 1LTOA 2HOBA 1HJ8A 1NS3A 5K0HA 1QGFA 3STIA 4GCHF 1OYQA 4Y71A 1SOZA 5AF9H 3O8RA 1XMNB 1G3CA 1LHGH 4GCHG 3RU4T 3TGKE 4Y6DA 1C1TA 1ZTJA 2GCTC 1C5TA 2DE8A 3UNRA 5FBIA 1UTOA 1BQYA 5CMXH 3FVFB 3MH4A 2XCFA 4CRBA 4DT7B 1EP6A 2FM2A 1IQKA 4DURA 3URCA 3VFEA 3P8FA 2F9UA 1UCYK 3D49H 2XWAA 3VEQB 3MHWU 4CHAB 5L30H 1PPGE 1W0YH 1AE8H 1DSUA 5F6MA 3DD2H 1TPOA 2ZF0H 1AZZA 1FY1A 2NU0E 1UCYE 2BY7X 2GDEH 1P2IA 3F1SB 5GIBA 1GHBF 3AW1A 2SFAA 2XXLA 1DITH 1AMHA 1CGIE 4ABBA 1BRCE 1GJ8B 4KGAA 2UWOA 3ATKA 4Y76A 1FY5A 1TLDA 1GMCG 1Y5BT 5C1XA 5EW1H 1YM0A 1ACBE 3SGAE 1K1OA 2QXJA 2R3YA 2HNTC 1ESTA 1C5UA 2JETC 2B9LA 2AMPA 3F9GA 4CRCA 1NY22 1GJBB 1SHHB 4AX9H 2UUFB 3MH5A 1S6HA 1J9CH 4ZKNU 2RA3A 3A83A 1V2UT 2GZ7A 1P03A 2ZP0H 3TK9A 2H6MA 3VGCC 2AGGX 1TX8A 1OKXA 2J34A 3NUMA 4MPXA 3RDZA 3T62A 4H4FA 4B74A 4FU7A 2IJOB 1TQ0B 2ZGJA 1TRYA 3E0PB 1HAIH 2PGBB 3ODDA 1QRXA 2J92A 4K60A 1FIZA 1E0FD 2ZQ2A 1ELEE 4NSVA 1TOMH 1J17T 1O2UA 3HGPA 3QUMP 2W3KA 1BOQA 4IMZA 1ZGIA 2BD2A 1WQSA 3M3SA 1S5SA 4NZLA 3TNSA 1P2JA 1GMDF 2BD5A 2QN5T 1O5GH 1HNEE 1NZQH 4TY6A 1GMDG 4NIYA 1C9TA 1GHVH 3O8DA 4BTUB 2OC8A 2SGFE 1BBRK 1DOJA 2ZHDA 2WUCA 3DT0H 1SR5C 5CHAB 5JBBS 4CRAA 2D2DA 1LVMA 1MUEB 1P9UA 1YPGH 2G52A 3FP6E 1V2OT 2UUKB 3VPKA 1HXEH 3H5CB 1BBRE 1DT2A 1K22H 1T8LA 2ZFPH 4ABFA 1P01A 1ETSH 1ZRKA 1W7GH 3MTYA 4BTIB 2HGTH 1BTYA 2ZCLP 1TX7A 1ABJH 4JZFH 3RMNH 2SGAA 3QZRA 4XDEA 3RXLA 1LPZB 1O2LA 1HDTH 1O3DA 2VIOA 1AUJA 3KEEA 2AS9A 1Z1IA 4CRDA 3ZVFA 1UCYH 1C2MA 1G9IE 3Q3KA 5JB8S 1C2FA 1CBWC 5DP7A 1O32A 4Y8XA 1QURH 4CRFA 1P2QA 3ZV8A 3VXEH 1MTVA 1HAOH 1O3NA 2PWXA 2FOCA 1C1PA 4A1VA 1ESAA 4VGCC 3W94A 3Q76A 2ZHQH 5A09A 3OX7U 1ZJDA 1O34A 4AYYB 1KXEA 1SGPE 3LGTA 4XSKU 1D3PB 1CT2E 3PO1C 1BA8B 1RIWC 2RCEA 1GGDC 1HAZB 1XUHA 1IHTH 5DP4A 3ZVGA 2ODQA 1FJSA 4ZROA 2B7DH 2FX4A 1GJ4H 5GDSH 1O2TA 3MNXA 2ZC9H 1O2NA 1GJ7B 2BLVA 1D3TB 1ZMJA 3KQEA 2AGIX 1IQGA 1BDAA 1CA0C 1F0UA 1OOKB 3SJKA 3T5FH 3SNBA 1OS8A 2O8UA 4MPUA 4ZH8A 4INHA 1VCWA 2OC0A 1GJCB 1GDUA 3A7TA 3RXFA 1G37A 1MU6B 1YPHC 4JZ1A 5FCKA 1TE0A 3ZZ4A 7KMEH 5EG4A 4MDSA 1EAUA 1C5OH 3FAOA 3AAVA 1SLWB 2BHGA 3MO6A 1TBQH 2BD4A 3BG4B 5SGAE 3TJVA 2A7JA 1YPEH 3RU4E 2ZHEH 5T6GA 2F9PA 1O36A 4Q7ZA 2TGPZ 4D7GA 5I25A 3MFJA 5HM2A 2ZFRH 5C20A 3M3VA 4QT8C 1OXGA 4X1NU 4Y8ZA 1SGYE 2GKVE 1ZLRA 8LPRA 4ABIA 1W7XH 3A85A 4B75A 4X1RU 2GCTB 1GBAA 2FOFA 1A4WH 3Q77A 3M7TA 6GCHF 3U8OH 2XRCA 2ZHFH 4MNWA 2ZCKP 1DXPA 4GVUA 2FIRH 1A46H 3ATWA 1GHAG 2ULLA 1C2KA 3OU0A 4UFEH 2OTVA 3UTUH 1HPGA 4BANB 1BBRH 1ELAA 1BMLA 1W10U 3LGUA 2IOTA 3BEFB 1KTTB 2FEQH 3ZVEA 1DSTA 1O5EH 3DFLA 5FBEA 1WSSH 1S81A 1GI1A 2WYGA 2ZGHA 3S9AA 1LDTT 2BQ7B 4YLQH 1TGCA 2STBE 3SBKA 1FLEE 2FYQA 2Z7FE 4XFQA 3FZDA 1IQFA 3P17H 1YCPM 4UFFH 2ZPRA 5FXLA 3RXAA 1NTPA 1Y5UT 1HAVB 4MPVA 5EGMA 2WV4A 3SI4H 1FZZA 1O2IA 3MNBA 1G3DA 4GLYA 2Y7XA 4RSPA 1N6YA 3SGBE 3M5OA 4E7NA 3P8GA 4WMFA 1TQ7B 1P12E 2JETB 4B2BA 4LOYH 1JXPA 5DG6A 2R0LA 2H9HA 1AUTC 1AU8A 1J15A 1GMHF 5DGJA 3VGCB 1SQTA 1UMAH 5AVDA 3DUXH 1GMHG 3EA9A 1KLIH 4IMQA 4WH6A 3UPEA 4OS5A 1WBGB 2ZDLA 1F0RA 2BY9X 1L4ZA 1LKAA 2SGDE 3B9FH 1T4UH 3M36A 3BTFE 1LKBA 1FY8E 4Y79A 3A86A 5ETXA 2RA0A 2UWLA 1AY6H 2W7SA 2VVVA 5E0GA 1QBNA 3FANA 4NFEA 3SQHE 3MNSA 2HPQH 1YPLH 4FU9A 4Z6AH 1C1OA 1P3EA 1H4WA 5AFYH 2ZDMA 1P09A 1DDJA 1T8OA 2W5EA 3RXSA 1H8IH 1RXPA 4ISLA 4Y0ZE 2Y80A 4ABEA 1FN6A 1Z7KA 1ZMNA 4XOJA 1NRSH 1NRQH 3VB6A 2RDLA 2ZHWH 1AO5A 1GI4A 3KQCA 4K8BA 1ZTKA 5T3HA 2CF8H 2BDAA 1K28D 1OWIA 4X8TH 1BRAA 4AG2A 1OP2A 3ZYDA 5JBAS 1BHXF 3EGKH 5E0HA 2W26A 1YPJH 3SU4A 2C3SA 1V2WT 1AB9C 3SN8A 1O5CB 3UR6A 3UR9A 4B76A 2QGRA 3C1KA 3RXBA 1MZDA 4YZUA 4YO9A 1AVXA 3SJ8A 1DWDH 1T4VH 3RU4D 4F49A 2GMTC 4OS7A 1E38B 1W3CA 1DWEH 3S9BA 1PYTC 2H9EH 3Q3XA 1Y3WA 4Q7YA 1INCA 2PSYA 4I8GA 2C8XB 3ODFA 5JYIA 4AOQA 1W8BH 2DUCA 1ELBA 1THRH 3LKWA 1CE5A 3GY5A 3A87A 2AIQA 1ELDE 3RXDA 4E06H 3URDA 2PV9B 3M5MA 1CBWB 3LONA 1UHBA 3RMLH 2GTBA 1GJAB 2JH6D 2ZI2H 3LJJA 3SV6A 2BDGA 1P9SA 3BG8A 2HWLB 1GJ9B 5FHTA 1ANCA 1O31A 1DM4B 1O2VA 1Z8RA 1GBFA 1PQ5A 2PHBA 1O2MA 1SGFA 2BZ6H 4Y0YE 1W12U 1YLDA 5FCRA 5LGOA 2FI4E 1GCTC 2QC2A 2Z94A 5F8TA 2ODYB 1GBKA 1E37B 4VGCB 5DP6A 3RXRA 2Z3CA 6ESTA 4Q7XA 1N1LA 1PFXC 5C5NA 3O8CA 4BAHB 5JBCS 2AMQA 1DWBH 1MAYA 3RM2H 3PO1B 1FUJA 1BCUH 3SUGA 1RIWB 1IQNA 5JBTA 1K1PA 4AFZA 1GGDB 2CN0H 2XW9A 3UUZA 1C2DA 1YYY1 4CRGA 8ESTE 3ZVBA 2NU2E 1NN6A 2J94A 2AFQB 1BZXE 4THNH 3MMGA 3UIRA 1T8NA 1AGJA 1C5XB 2YOLA 4DW2U 4JZEH 1TGSZ 1WU1A 4GSOA 1BTPA 1H9LB 1TGBA 1CA0B 4O3TA 2BQ6B 1EZQA 2Z9GA 1L1JA 5TCCA 4YOJA 1S6FA 1MCTA 3GDUA 1ZZZA 2J9NA 3SHCH 1TBRH 3RC6A 1O2QA 1AFEH 2LPRA 2CHAC 4I8KA 4UFGH 3LGVA 1WOFA 3QK1A 2GCHG 1TBZH 3RXPA 5DPAA 4NIVA 2BY5X 1QY6A 4AYVB 4XBDA 2AIPA 1SQAA 1PPFE 1C2LA 1O3OA 3PTBA 1GHWH 1Z8IB 4FVDA 4MLFB 1C5VA 1XXDA 2CF9H 4ZHAA 1P57B 3UQVA 4RN6A 3SUDA 2WINI 5DP5A 2P3TB 2R3UA 2H1UA 2Z9IA 3GCTF 5HYOA 2BD8A 5EU8A 1GI3A 2ESTE 1A0HB 3A7WA 3GCTG 2J95A 1CU1A 1CGHA 1QA0A 4DIIH 3GCNA 5GJ4B 3BIUH 4ZUHA 1X7AC 2F83A 3S0NA 2HRVA 1QJ6B 1GI7B 1GWAA 1NC6A 2QA9E 3TITA 1QL8A 3KGPA 1V6DA 1EPTC 1AN1E 1BIOA 1GI0A 3K6ZA 4Q80A 1YCPK 1GG6C 1O3MA 1C5SA 2BZAA 1Y3XA 1ZGVA 5GPIB 2VH0A 1SOTA 3LU9B 3SJ9A 1TALA 1UTNA 2BDIA 2BDCA 2BM2A 2G5VA 2OBOA 1ELGA 1LO6A 2VIVA 1O5AB 4WWYA 3A89A 1GCDA 3MH6A 2A4OA 1THPB 4AFQA 1V3XA 2FOEA 1RRKA 1T7CA 1C2EA 4JYUH 3SV8A 1MTNC 3SNEA 5A2MH 1ELVA 2ANWA 2ZQ1A 3RXUA 2PR3A 1MAXA 2Z3DA 3VXFH 1SC8U 4K1SA 1KXFA 1SPJA 4CR9A 3D65E 2CJIA 3MO9A 1JWTA 2VVCA 3K9XB 1HAVA 3RC4A 1SHYA 1Y3YA 2WPIS 2A7CA 3ZYEA 2FZZA 4NGAH 1QNJA 2A1DB 4A1TA 2G81E 2FX6A 2BXTH 1TIOA 1L0ZA 2ZCHP 3ZZAA 2WV5A 1MCVA 2QAAA 5DJ7A 2F9VA 2NU4E 1P2MA 1HCGA 1UVOA 1S0RA 1TONA 2QXHA 3B8JA 1V2QT 5HM9A 4YOIA 2Y5HA 1F0SA 1HV7A 3F9FA 4BXSA 1ZHMA 3ZZDA 3E0NB 1ZHRA 1QRWA 3DFJA 4WJG2 4I8HA 1OPHB 3SZNA 3A7YA 1TABE 1G3EA 4ISHH 2ZWLH 1V2VT 3MU0A 3QZQA 1GMCF 3PB1E 1GBMA 4AORA 5DP9A 1DPOA 1K1IA 5LPEA 3CS0A 2V3OH 3R0FA 5E2OA 1SMFE 1EOLA 1ANEA 1AB9B 2BMGB 3BTHE 1D6WA 1HAXB 1QL7A 3MOCA 3KN2A 2BLOA 1SGQE 1ZSKA 2FI5E 3TLOA 1BRUP 3NXPA 2AERH 2V3HH 1LVOA 2O8LA 1UTPA 3KIDU 4DGJA 4ZKSU 2GMTB 1SGDE 1CHOG 3GY6A 3NK8A 3KCGH 1BTUA 1KXBA 1VCQA 1BMAA 1CT0E 4B71A 5GXPA 3RXHA 3A84A 2OXSA 5DP3A 4TY7A 1DVAH 1ZPCA 2V0BA 4UE7H 4MG3A 4JMYA 3K65B 5LPFA 1A61H 4ZAEA 4WH8A 1DUEA 3GDSA 3OYPA 3S9CA 3RC5A 1C1RA 2TRMA 1Q31A 2P94A 1XUGA 4X1SU 4HI3A 5JDUB 1P02A 1W11U 3A80A 1PPZA 3KHVA 1TYNA 3TU7H 4WF8A 5A8ZA 1GCTB 4BXWA 1KLTA 1IQLA 3ZZ5A 1YCPH 4U2WA 2CGAA 2LNCA 4ISNA 1TOCB 1BB0B 1RFNA 3B23B 1NFXA 3UOUA 3E16B 1P2NA 1Y59T 1Y3VA 4FXGH 4A92A 1D3DB 1MTWA 4X1QU 3ZV9A 4AN7A 7LPRA 1C2GA 4IBLH 5HMAA 1SLVB 2OQ5A 1HFDA 1NFWA 1G2MA 1C4Y2 2WPJS 4X0WU 1LCYA 3BN9A 3PLKA 3VB5A 1FNIA 3U8RH 1AI8H 1A7SA 2H5DA 3BTDE 2FLRH 4I32A 4Y7AA 5JPMH 2XBXA 5IYTA 2ILNA 4NIWA 3GDVA 1FAKH 4M7GA 1SGIB 4H42U 4AGKA 1HXFH 4AFUA 3RM0H 4ABAA 1XVOA 2VIWA 2CHAB 1UVSH 3UNQA 4XBCA 1OSSA 1TNIA 2ZTXA 1QB9A 2XC5A 1CGJE 4U30A 2BYAX 2BD7A 1WV7H 2SGQE 1YBWA 1AHTH 2FS9A 1GBBA 4U01A 1FXYA 2XTTB 4XE4A 5FX5A 1FV9A 1C1QA 1CO7E 1XKBC 2BY8X 4O3UA 5C67A 1O3LA 1EASA 1JRSA 2ANYA 1UO6A 1O5DH 2XC4A 3RXIA 4JK5A 1MTUA 2XNIA 3U1IB 4X6PA 5FPSA 1A1RA 5HGGA 3RUOA 3ZVCA 2XBYA 4Y8YA 3TVJB 2FOBA 2ZPSA 1GVLA 3FZZA 5C2ZA 1QRZA 1J14A 1ETTH 2VB0A 1EB1H 1O3KA 4IN2A 1IOEA 1L4DA 3BTGE 4LZ1H 1RTKA 4JYVH 3UWIA 1GI6A 1EPTB 1GHXH 1B0FA 2FP7B 1GG6B 2VJ1A 4IS5A 2OC7A 1Y8TA 1PPCE 1XUIA 3PTNA 2XWBI 4KKDA 3RXVA 4WMEA 1TNLA 2FYRA 5EPNA 1H9HE 1RD3B 2SNWA 3KQDA 1DY8A 3LJOA 3GCHC 1QBVH 2VIQA 3I78A 3QLPH 1QHRB 4GHQA 4O03A 1ABIH 1F92A 1MTNB 1GVZA 2BB4A 3ZVAA 3RXMA 3BEUA 1A3BH 4K1EA 4BAOB 1ZPBA 1C2IA 1ZSJA 4GUXA 2JKHA 2P3FH 2FMJA 1BMMH 3LGYA 4K3JA 2BLQA 4X2WA 4DY7B 3PMAB 4ABDA 1NFUA 1SGFG 2FOHA 4UONA 1KXCA 4A1XA 2W7UA 3EDXB 3BTME 3HPTB 4I8LA 1LHFH 1P06A 3BTWE 3MH7A 1GHAF 1DWCH 3UY9A 1Z6EA 1WTGH 2O8MA 4ABHA 4JZIA 1F5LA 1GDNA 3E8LA 2OP9A 3U8TH 4YESB 2ZU4A 2QF3A 2Y81A 5J4SA 1RTLA 2QYIA 5I46H 1V2KT 4BTTB 3SUEA 4NCYA 3K6YA 4U32A 1B0EA 2ANKH 3MO3A 4JZDH 4H6TA 1O39A 4CBOA 3TJUA 3LT3A 3C27B 1DXWA 1OWKA 4FUHA 1KDQB 2A4GA 1A5HA 3F9HA 1O3CA 3K2UA 1CT4E 1BHXB 3RXJA 2CV3A 4IGDA 1GBJA 2HNTE 1DE7H 3U98H 5L2YH 1XX9A 1JBUH 5AFZH 2A7HA 1P8VC 1YPKH 1P2KA 1G3BA 1SQOA 3GYLB 1XUJA 5EPYA 4NWLA 1BTXA 1TGNA 3ELAH 4D8NA 1ZR0A 2P93A 1N6XA 2ZZUH 3TJOA 1GI2A 2H9TH 2ALPA 1GDQA 1V2JT 1EAXA 2P16A 3BV9B 3HK3B 4ZHLU 4MTBA 4A6LA 2ZA5A 3BSQA 3U1JB 2ALVA 3CS7A 4ZMAH 2PFEA 2EEKA 3RLYH 4AZ2B 4RKJB 3SNCA 1O2KA 3PV4A 1EZXC 2H2ZA 2SGEE 1F7ZA 4CBNA 2G8TA 1C5QA 4HFPB 1TAWA 1TRNA 2BXUH 1SFQB 5A8YA 4ZXYH 5G4BA 2NU1E 2ZTYA 3ATMA 4D7FA 3S7HB 4WY3A 1VZQH 4X8UH 3F6UH 3KL6A 5PTPA 4ESTE 3IG6B 3A7XA 2VH6A 3TH4H 5TJXA 1AE5A 2GV7A 1EAIA 1TX6A 3TK6A 1Z71A 1O2SA 4F4OC 3LIWA 1FY4A 1LQEA 1GHYH 1C4V2 4NSYA 1IQIA 4GAWA 4MNXA 5EODA 5K7RA 4NA8A 1OP8A 1SVPA 3Q3YA 2UWPA 3LDXH 5JB9S 1BTWA 4YLUA 3LOXA 1O33A 1SL3A 3ZZ6A 1DUAA 2KAIB 2VGCC 1OWHA 1V2LT 3A8CA 1CSOE 1O0DH 3CENA 2R2WU 4KTSA 5GCHF 1ANDA 3EQ0H 1OWJA 1P2OA 3KF2A 1HAYB 1GI8B 4AFSA 1C1WH 1YC0A 5GCHG 1DICA 3S69A 3V7TA 3PLPA 4FU8A 1DFPA 1EXFA 1MKWK 2FPZA 3NKKA 4ASHA 2CMYA 4ZKOU 3UOPA 3E1XB 1KTSB 4YTAA 4J2YB 4PROA 1S0QA 3G01A 3F68H 3M5LA 2FOMB 2GGVB 1NPMA 2Q6GA 1W0ZU 3UNSA 7GCHF 2VVUA 5FPTA 4HTCH 3KQBA 7GCHG 1LVBA 3PLBA 2FDAA 1MMJN 1H8DH 1MTSA 3HGNA 3MU5A 2EI6A 2ZDVH 1TNHA 3E3TA 3RP2A 5DO4H 2TBSA 2VINA 3ESTA 1AWHB 1EZUC 1XVMA 1HJAC 1TA2A 3V13A 1C5MD 1F5RA 1L2EA 2DE9A 1O2WA 2V6NA 1C1SA 1MU8B 4Q2KA 3TIUA 1KSNA 5DP8A 5L2ZH 2AH4X 1TA6A 1Z6JH 2THFB 2ZKSA 1G2LA 3GY4A 1WUNH 3GCHB 1ID5H 2JH5D 1GI9B 5EXMA 3GICB 1SGEE 4DG4A 1YPHE 3A8DA 3RLWH 2GCHF 4NA9H 1YKTA 3GOVB 1HLTH 1TPSA 5C1YA 1B5GH 1HUTH 2PTCE 1EPTA 1AIXH 1ZMLA 1E35B 1NRRH 4D9RA 2PKSC 1O3GA 3BTKE 1NT1A 2BDHA 3V12A 1GBCA 3SGQE 1N8OC 3DHKH 4FUJA 2ZDNA 9ESTA 2BDBA 4BAMB 3D62A 1O2HA 5LPRA 1ANBA 1S82A 1HAGE 2XYAA 1MBQA 5FPYA 2RG3A 1BT7A 1O3FA 1PQAA 2D1JA 1K2I1 2A32A 2BD3A 3A8AA 1F5KU 1V2TT 2F9OA 2GT7A 3TH2H 1UVTH 1NESE 3JZ1B 4A7IB 2EA3A 5EQSA 2ZGCA 1QB6A 1HRTH 1NROH 2BLWA 1C5YB 3MYWA 1T8MA 3M37A 3SNDA 2A5AA 3FFGA 2BTCE 2Y5GA 2G4TA 2Q6DA 2VWLA 1P3CA 4FUIA 1G30B 1DANH 1SFIA 1H1BA 1MQ6A 1HIAB 1O30A 3HK6B 1G32B 1QTFA 4FUFA 5F8XA 3NCLA 3ZZ9A 2ASUB 2C93B 4UD9H 1C2HA 1OP0A 3SU5A 4A5TS 2PGQB 4R0IA 1S83A 4DVAU 1MKWH 4OGXA 2A5KA 5EXLA 1GBEA 1U6QA 4ZKRU 2ZDKA 4X8SH 2XCNA 1SGRE 5HXFA 3MU4A 4X1PU 1C1UH 2IPHA 5FAHA 1SBWA 1UVUH 5BPEA 1D4PB 1GBTA 1FONA 1KDQA 4OS1A 1C1MA 2O8WA 5GWZA 3MU8A 1RGQA 3GY3A 2GD4B 1FPHH 4K69A 4Y11E 3BIVH 2M5TA 4O9VA 3LC3A 3M61U 2ZPQA 1EUFA 4YT6H 4IN1A 3SW2B 1O3JA 3SI3H 1FI8A 3T29A 1ELFA 4GHTA 4YT7H 1PPEE 3QGNB 3RMOH 4XBBA 2BX3A 1MH0A 2ZEBA 2ZFSA 3A8BA 3F9EA 4I31A 2YNAA 3ZZ3A 4HGCA 1Z8GA 3TJNA 4ABJA 1W13U 3GCOA 1MQ5A 4LXBH 1DX5M 5T6FA 5A0BA 4IW4E 3V0XA 3OY6U 2Z9JA 3MNCA 4UFDH 2F3CE 1SG8B 3RXOA 1UTJA 3OTJE 3I29A 1IAUA 1VGCC 3RXGA 1Y5AT 3ATLA 3MWIU 3P8OA 3QTOH 1M9UA 2EI7A 3QO6A 2NU3E 2OQUA 1ESBA 4ZXXH 1CHOF 1O3IA 1HB0B 5DKMA 1DLKB 3NWUA 1RTFB 2OLGA 2OUAA 2C8WB 2A31A 2VGCB 2C8YB 2P8OC 5C1UA 1GHBG 1SLUB 3PWCA 2I6QA 1O2YA 2F9NA 3T26A 2FI3E 4ABGA 1YGCH 3PMBB 4NWKA 5TCAA 2FTLE 3GY7A 1IQMA 3GY8A 1VJ9U 1GPZA 3SORA 3NZIA 4WXVA 3T2NA 1AKSB 1CHGA 4AB9A 2OC1A 1V2PT 6CHAC 3ZZCA 1V2NT 4ISOA 5H4IB 1Z1JA 2KAIA 5ESTE 1TPPA 3O8BA 3SO3A 2WYJA 5E0JA 2GZ9A 3FP8E 1FDPA 4Y10E 1DS2E 1TRMA 3PM3A 1AVGH 1GL0E 1ZSLA 1NU9A 2EC9H 2F91A 4OS2A 1C4U2 2PW8H 2QXGA 3N7OA 2PLXA 3PWBA 1WTHD 1WCZA 3BEIB 2GDDA 1EB2A 2PTNA 2Z6BD 1KXAA 1J8AA 1VITF 1P04A 4X2XA 1HJAB 3PMHB 2G4UA 3EAJA 3EA7A 3VB4A 1VITG 5IDKA 1FPCH 1ETRH 2BDYA 1AQ7A 3E91A 2ZU3A 1C5PA 1EATA 1GVKB 1A5GH 1WAYB 2R9PA 4OS4A 4WXIA 3ZZBA 3W95A 1O5BB 1ORFA 2BOKA 5EQQA 3PYHA 2XBWA 3MI4A 1NM6A 2C90B 2OINA 3U9AH 1J16A 1EZSC 4NIXA 1AD8H 1VITH 3ITIA 4JYTA 1HBTH 3P8NA 3UREA 4BAQB 1NRNH 1UHBB 1LMWB 2CXVA 2PKSB 2OBQA 4BNRA 1KXDA 4CH8B 4NFFA 3TGIE 3I77A 1N8OB 3L6PA 4INKA 4UEHH 1FQ3A 1H9IE 9LPRA 1AVWA 4K2YA 2ZFFH 1P0SH 2ZIQH 2R0KA 1QJ1B 4O97A 1DY9A 2QIQA 5T6DA 5L6NH 1BMNH 2GZ8A 2IN2A 1T32A 1D3QB 2Y82A 4J1YA 2ZG0H 1D9IA 1MD8A 1ARBA 2A0QB 1K1NA 1TNKA 2QV1A 3IITA 3T28A 2J4IA 1QJ7B 2FLBH 2VWNA 1MD7A 1S84A 4KTUA 2P3UB 1C5LH 2TPIZ 1W14U 3RMMH 1P05A 1PPBH 1AZ8A 2Y5FA 1T31A 1LHDH 1TPAE 1E34B 1LQDB 1VJAU 4FVBA 2B5TB 3SUFA 3M35A 3TGJE 5F8ZA 1PYTD 3KNXA 1TNJA 2AMDA 2XBVA 2ZU5A 3SU1A 1PJPA 2BVSH 5A0CA 1ZYOA 2HALA 1O3PB 3AAUA 2G51A 3SHAH 2PKAB 2Z9KA 1OWDA 4FUDA 5E2PA 1E36B 1IHSH 1L1NA 2QXIA 2V35A 3BTEE 2AEIH 5J4QA 5FX6A 3A7VA 3D23A 1QQUA 1C5WB 1EKBB 3IWMA 5ABWA 3E90B 1ELTA 2GX4A 1S85A 1O2JA 1XXFA 2H5CA 1L1GA 4X2VA 1HIAA 3SU6A 4ISIH 3ZVDA 3QGJA 3SJOA 2GP9B 3HATH 4X6NA 4B2AA 1TGTA 2ZECA 1Q3XA 1ELCA 2TGAA 3HKJB 1O5FH 3TPIZ 3VB3A 1D6RA 2VU8E 1O3BA 4Y7BA 3TNTA 3M3TA 4D76A 2C8ZB 2O9QA 1UVPA 1BITA 1BTHH 1KYNA 4E05H 1EJNA 3QX5H 3QTVH 1QIXB 5CE1A 3AVZA 1AFQC 4DCDA 2A2XH 5ESBA 4B73A 3M7UA 2VIPA 1P11E 1YP9A 2A45B 1WYKA 2AGEX 1YPMH 1TFXA 6GCHG 1NO9H 1HYLA 1PQ7A 3STJA 3A81A 1VGCB 2HPPH 2FXRA 2W3IA 1KIGH 3RXTA 3A88A 2QF0A 2ODPA 3VB7A 1YF4A 3RXKA 4WVPE 1FIWA 2Z9LA 5B6OA 3SNAA 2UUJB 4HZHA 1TMUH 5EOKA 2PUQH 3OY5U 3U69H 2UUYA 2WPMS 4MVNA 1GI5A 1BJUA 2P8OB 2WPHS 1FMGA 1SGCA 1XUFA 2Q1JA 1TB6H 1TMTH 3EYDA 4I7YH 4TWWA 1JIMA 3GYMA 3BF6H 4GPGA 1MZAA 3GISB 2SGPE 3ZZ7A 1OYTH 4FUBA 1PPHE 1O2GH 4K8YA 1NRPH 1UTKA 2A4QA 1A0LA 1C1VH 4YM9A 3TK5A 6CHAB 1MKXK 2FOAA 3UWJH 1QL9A 1P10A 4X8VH 2JH0D 3AW0A 3P6ZB 3EE0B 1O3EA 3LGWA 2FESH 3L3TA 1VCPA 2AYWA 4DIHH 4TYDA 2HLCA 3M7QA 2QCYA 2ZNKH 3SV9A 1LHCH 2D8WA 3LC5A 2HVXA 1ZTLA 1RJXB 2BQWB 2NWNA 1SGNE 4NZQA 4TPYA 4OGYA 4AB8A 5BRRE 1Q2WA 1C2JA 2BD9A 3SV7A 2O8TA 3LPRA 8GCHF 1EJMA 2BVXH 1AKSA 3SQEE 1JOUB 2I6SA 8GCHG 1EJAA 1BRBE 1LHEH 3UFAA 4I33A 3T25A 4CH2B 4FUCA 1QQ4A 2EI8A 3AASA 3E6PH 4CHAC 2A5IA 1HAPH 1GBLA 1XUKA 1GBIA 1O38A 1G36A 1IQHA 2F9BH 1V2RT 4I8JA 1LPGB 3OSYA 2P59A 4K1TA 2BVRH 1GJ6A 2VWOA 5AHGH 2BY6X 1O2ZA 1A3EH 3A7ZA 2ZU2A 2GV6A 1ZHPA 1GBDA 1UK3A 2STAE 3RXQA 1UTQA 1YLCA 4NA7A 1XKAC 2HNTF 1BUIA 2WPLS 4YOGA 2TIOA 1NU7B 4SGAE 2BX4A 1K1MA 2GT8A 1DLEA 1EQ9A 1BJVA 3T27A 4X6MA 4KELA 2TGTA 3SU3A 1UJ1A 1EX3A 2ZFTA 1XM1A 1SI5H 2FS8A 4CR5A 3SOSA 1THSH 5EXNA 1B7XB 4R8TB 1CQQA 1O3HA 5DK1A 1A2CH 2G5NA 3SU2A 2P95A 2Y6TA 5C5OA 1ZPZA 2OCVB 1VR1H 4TPIZ 3SJIA 2C4FH 1FN8A 2B0FA 1C5NH 1O2PA 3UQOA 1GL1A 1QA7A 3GY2A 3TH3H 4SGBE 1C5RA 1K1LA 2Q6FA 2VNTA 3V3MA 4H6SB 4X2YA 5E8EH 2TGDA 1A5IA 3R3GB 4JCNA 3QWCH 4KP0A 1MBMA 3P70B 2ZDAH 2WPKS 5F03A 4MNYA 1MKXH 2FOGA 4B1TA 1O2OA 5CHAC 4ZHMU 3P92A 4LK4A 1C9PA 1O2RA 2OD3B 2A4RA 2ZGBH 1KLJH 3RXEA 3QN7A 4IC5A 1ZOMA 2SNVA 2ZO3H 1UK2A 4KTCA 1GHZA 1CVWH 1V2ST 3H7TA 1O35A 1SLXB 4B2CA 3S7KB 1NFYA 2WUBA 3ZZ8A 1IQEA 1QB1A 1O37A 2G55A 2FO9A 2ZTZA 3QDZB 1QCPA 1UTLM 2G00A 1WQVH 1OWEA 1JMOH 3ATIA 2Y7ZA 3PMJA 2K1QA 2D26C 2R2MB 1LPKB 3A82A 4D9QA 3BTTE 4MPWA 1TNGA 5EQRA 2PKAA 1F0TA 3H7OA 3M5NA 2A2QH 3ENSB 3PROA 1BTZA 2FODA 4DJZB 2XC0A 4IC6A 2FWWA 1RS0A 4BAKB 2BOHB 1PQ8A 3EA8A 1QFKH 1IQJA 1HJ9A 4E7RG 3P95A 1ZJKA 4MNVA 2ANMH 1AFQB 1EOJA 4CREA 3NPSA 1JIRA 4BOHA 1Z8JB 4X6OA 3BTQE 3FP7E 4RKOB 4INLA 1SB1H 1OX1A 6LPRA 4NG9H 2QY0B 2PSXA 1QBOA 3L33A 1ARCA 2VIDA 1K1JA 1LVYA 1ZRBA 1GJDB 3SU0A 1CA8B 3SV2H 1AWFH 2GVFA 4MQAA 4AGJA 5C3NA 1HGTH 1F2SE 1FAXA 3WY8A 4WMDA 4Z0KA 2B8OH 3LH1A 1A0JA 3JZ2B 2ZU1A 2ZFQH 2J2UA 1C1NA 1SSXA 1Y3UA 1GBHA 4TWYA 2VWMA 1UK4A 1C5ZB 2J38A 4UDWH 2YNBA 1KY9A 3DA9B 1O3AA 4AG1A 1EP5A 1V2MT 5LH8A 4FUEA 1TWXB
chains in the Genus database with same CATH superfamily
1JRTA 2PUXB 3LGIA 3CP7A 4OS6A 1EAWA 4FUGA 5EW2H 1HAHH 1GJ5H 4K5ZA 8KME2 3W1EA 1TMBH 5A0AE 1UTMA 1K9OE 2ZGXH 1SGTA 3RXCA 1K21H 1O2XA 3HKIB 3LH3A 3MU1A 4DOQA 3PRBA 7ESTE 1FY3A 4LZ4B 2Z3EA 2FTMA 1QR3E 1W2KH 4JK6A 3Q00A 3BG4C 5A8XA 1LTOA 2HOBA 1HJ8A 1NS3A 2IJD1 5K0HA 1QGFA 3STIA 4GCHF 1OYQA 4Y71A 1SOZA 5AF9H 3O8RA 1XMNB 1VKYA 1G3CA 1LHGH 4DT4A 3FKSD 4GCHG 3RU4T 3TGKE 4Y6DA 1C1TA 1ZTJA 2GCTC 1C5TA 2XNDD 2DE8A 3UNRA 5FBIA 1UTOA 1BQYA 5CMXH 3FVFB 3MH4A 2XCFA 4CRBA 4DT7B 1EP6A 2FM2A 1IQKA 4DURA 3URCA 3VFEA 3P8FA 2F9UA 1UCYK 2WPDD 3D49H 2XWAA 3VEQB 3MHWU 4CHAB 5L30H 1PPGE 1W0YH 1AE8H 1DSUA 5F6MA 3DD2H 1TPOA 2ZF0H 1AZZA 1FY1A 2NU0E 1UCYE 2BY7X 2GDEH 1P2IA 3F1SB 5GIBA 3NRLA 1GHBF 3AW1A 2SFAA 2XXLA 1DITH 1AMHA 1CGIE 4ABBA 1BRCE 1GJ8B 2KM0A 4KGAA 2UWOA 3ATKA 4Y76A 1FY5A 1TLDA 1GMCG 1Y5BT 5C1XA 5EW1H 1YM0A 1ACBE 3SGAE 1K1OA 2QXJA 2R3YA 2HNTC 1ESTA 1C5UA 2JETC 2B9LA 2AMPA 3F9GA 4CRCA 1NY22 1GJBB 1SHHB 4AX9H 2UUFB 3MH5A 1S6HA 1J9CH 4ZKNU 2RA3A 3A83A 1V2UT 2GZ7A 3N7DA 1P03A 2ZP0H 3TK9A 2H6MA 3VGCC 2AGGX 1TX8A 1OKXA 2J34A 3NUMA 4MPXA 2LP6A 3RDZA 3T62A 4H4FA 4B74A 2J5UA 4FU7A 2IJOB 1TQ0B 2ZGJA 1TRYA 3E0PB 5C17A 1HAIH 2PGBB 3ODDA 1QRXA 2J92A 4K60A 5FL7D 1FIZA 1E0FD 2ZQ2A 1ELEE 4NSVA 1COWD 1TOMH 1J17T 1O2UA 3HGPA 3QUMP 2W3KA 1BOQA 4IMZA 1ZGIA 2BD2A 1WQSA 3M3SA 1S5SA 4NZLA 3TNSA 1P2JA 1GMDF 2BD5A 2QN5T 1O5GH 1HNEE 1NZQH 4TY6A 1GMDG 4NIYA 1C9TA 1GHVH 3O8DA 4BTUB 2OC8A 2SGFE 1BBRK 1DOJA 2ZHDA 2WUCA 3DT0H 1SR5C 5CHAB 5JBBS 4CRAA 2D2DA 1LVMA 1MUEB 1P9UA 1YPGH 2G52A 3FP6E 2YMSD 1V2OT 2UUKB 3VPKA 1HXEH 3H5CB 1BBRE 1DT2A 1K22H 1T8LA 2ZFPH 4ABFA 1P01A 1ETSH 1ZRKA 1W7GH 3MTYA 4BTIB 2HGTH 1BTYA 2ZCLP 1TX7A 1ABJH 4JZFH 3RMNH 2SGAA 3QZRA 3U28C 4XDEA 3RXLA 1LPZB 1O2LA 1HDTH 5EJ1A 1O3DA 2J97A 2VIOA 1AUJA 3KEEA 2AS9A 1Z1IA 4CRDA 3ZVFA 1UCYH 1C2MA 1G9IE 3Q3KA 5JB8S 1C2FA 1CBWC 5DP7A 5CDFE 1O32A 4Y8XA 1QURH 4CRFA 1P2QA 1YWUA 3ZV8A 3VXEH 1MTVA 1HAOH 1O3NA 2PWXA 2FOCA 1C1PA 4A1VA 3FO8D 1ESAA 4VGCC 3W94A 3Q76A 2ZHQH 5A09A 3OX7U 1ZJDA 1O34A 4AYYB 1KXEA 1SGPE 3LGTA 4XSKU 1D3PB 1CT2E 3PO1C 1BA8B 1RIWC 2RCEA 1GGDC 1HAZB 1XUHA 1IHTH 5DP4A 3ZVGA 2ODQA 1FJSA 4ZROA 2B7DH 2FX4A 1GJ4H 5GDSH 1O2TA 3MNXA 2ZC9H 1O2NA 1GJ7B 2BLVA 1D3TB 1ZMJA 3KQEA 2AGIX 1IQGA 1BDAA 1CA0C 1F0UA 1OOKB 3SJKA 3T5FH 3SNBA 1OS8A 2O8UA 4MPUA 4ZH8A 4INHA 1VCWA 2OC0A 1GJCB 1GDUA 3A7TA 3RXFA 1G37A 1MU6B 1YPHC 4RT1A 4JZ1A 5FCKA 1TE0A 3ZZ4A 7KMEH 2JIZD 2QF4A 4MDSA 1EAUA 5EG4A 1C5OH 3FAOA 3AAVA 1SLWB 2BHGA 3MO6A 1TBQH 2BD4A 3BG4B 5SGAE 3TJVA 2A7JA 1YPEH 3RU4E 2ZHEH 5T6GA 2F9PA 1O36A 4Q7ZA 2TGPZ 4D7GA 5I25A 3MFJA 5HM2A 2ZFRH 5C20A 3M3VA 4QT8C 1OXGA 4X1NU 4Y8ZA 1SGYE 2GKVE 1ZLRA 8LPRA 4ABIA 1W7XH 3A85A 4B75A 4X1RU 2GCTB 4B6EA 1GBAA 2FOFA 1A4WH 3Q77A 2WZQA 3M7TA 6GCHF 3U8OH 2XRCA 2ZHFH 4MNWA 2ZCKP 1DXPA 4GVUA 2FIRH 1A46H 3ATWA 1GHAG 2ULLA 1C2KA 3OU0A 4UFEH 2OTVA 3UTUH 1HPGA 2QE7D 4BANB 1BBRH 1ELAA 1BMLA 1W10U 3LGUA 2IOTA 3BEFB 1KTTB 2FEQH 3ZVEA 1DSTA 1E1QD 1O5EH 2V7QD 3DFLA 5FBEA 1WSSH 2JJ2D 1S81A 1GI1A 2WYGA 2ZGHA 3S9AA 1LDTT 2BQ7B 4YLQH 1TGCA 2STBE 3SBKA 1FLEE 2FYQA 2Z7FE 4XFQA 3FZDA 1IQFA 3P17H 1YCPM 4UFFH 2ZPRA 5FXLA 3RXAA 1NTPA 1Y5UT 1HAVB 4MPVA 5EGMA 2WV4A 3SI4H 1FZZA 1O2IA 3MNBA 1G3DA 2IPQX 4GLYA 2Y7XA 4RSPA 1N6YA 3SGBE 3M5OA 4E7NA 3P8GA 4WMFA 1TQ7B 1P12E 2JETB 4B2BA 4LOYH 1JXPA 5DG6A 2R0LA 2H9HA 1AUTC 1AU8A 1J15A 2CK3D 1GMHF 5DGJA 2EY4C 3VGCB 1SQTA 1UMAH 5AVDA 3DUXH 4OM9A 1GMHG 3EA9A 1KLIH 3SYJA 4IMQA 4WH6A 3UPEA 4OS5A 1WBGB 2ZDLA 1F0RA 2BY9X 1L4ZA 1LKAA 2SGDE 3B9FH 1T4UH 3M36A 3BTFE 1LKBA 1FY8E 4Y79A 3A86A 5ETXA 2RA0A 2UWLA 1AY6H 2W7SA 2VVVA 2EQNA 5E0GA 1QBNA 3FANA 4NFEA 3SQHE 5B6LA 3MNSA 2HPQH 1YPLH 4FU9A 3KQ5A 4Z6AH 1C1OA 1P3EA 1H4WA 5AFYH 2ZDMA 1P09A 1DDJA 1T8OA 2W5EA 3RXSA 1H8IH 1RXPA 4ISLA 4Y0ZE 2Y80A 4ABEA 1FN6A 1Z7KA 1ZMNA 3FN8A 4XOJA 1NRSH 1NRQH 3VB6A 2RDLA 2ZHWH 1AO5A 3OE7D 1GI4A 3KQCA 4K8BA 5KECA 1ZTKA 5T3HA 2CF8H 2BDAA 1K28D 1OWIA 4X8TH 1BRAA 4AG2A 1OP2A 3ZYDA 5JBAS 4P00A 2W6JD 1BHXF 3EGKH 5E0HA 2W26A 1YPJH 3SU4A 2C3SA 1V2WT 1AB9C 3SN8A 1O5CB 3UR6A 3UR9A 4B76A 2QGRA 3C1KA 3RXBA 1MZDA 4YZUA 4YO9A 1AVXA 3SJ8A 2KZ4A 1DWDH 1T4VH 3RU4D 4F49A 2GMTC 4OS7A 1E38B 1W3CA 4YXWD 1DWEH 3S9BA 1PYTC 2H9EH 3Q3XA 1Y3WA 4Q7YA 1INCA 2PSYA 4I8GA 2C8XB 3ODFA 5JYIA 4AOQA 1W8BH 2DUCA 1ELBA 1THRH 3LKWA 1CE5A 3GY5A 3A87A 2AIQA 1ELDE 3RXDA 4E06H 3URDA 2PV9B 3M5MA 1MABB 1CBWB 3LONA 1UHBA 3RMLH 2GTBA 1GJAB 2JH6D 2ZI2H 3LJJA 3SV6A 2BDGA 3DSPA 1P9SA 3BG8A 2HWLB 1GJ9B 5FHTA 1ANCA 1O31A 1DM4B 1O2VA 1Z8RA 2KCYA 1GBFA 1PQ5A 2PHBA 1O2MA 1SGFA 2BZ6H 4Y0YE 1W12U 1YLDA 5FCRA 5LGOA 2FI4E 1GCTC 2QC2A 3FOAA 2Z94A 5F8TA 2ODYB 1GBKA 1E37B 4VGCB 5DP6A 3RXRA 2Z3CA 6ESTA 4Q7XA 1N1LA 1PFXC 5C5NA 3O8CA 4BAHB 5JBCS 2AMQA 1DWBH 1MAYA 3RM2H 3PO1B 1FUJA 1BCUH 3SUGA 1RIWB 1IQNA 5JBTA 1K1PA 4AFZA 1GGDB 2CN0H 2XW9A 3UUZA 2F4LA 1C2DA 1YYY1 3UB0A 4CRGA 8ESTE 3ZVBA 2NU2E 1NN6A 2J94A 2AFQB 1BZXE 4THNH 3MMGA 3UIRA 1T8NA 1AGJA 1C5XB 2YOLA 4DW2U 4JZEH 1TGSZ 1WU1A 4FOUC 4GSOA 1BTPA 1H9LB 1TGBA 1CA0B 4O3TA 2BQ6B 1EZQA 2V3MA 1L1JA 2Z9GA 5TCCA 4YOJA 1S6FA 1MCTA 3GDUA 1ZZZA 2J9NA 3SHCH 1TBRH 3RC6A 1O2QA 1AFEH 2LPRA 2CHAC 4I8KA 4UFGH 3LGVA 1WOFA 3QK1A 2GCHG 1TBZH 3RXPA 5DPAA 2J98B 4NIVA 2BY5X 1QY6A 4AYVB 4ASUD 4XBDA 2AIPA 1SQAA 1PPFE 1C2LA 1O3OA 3PTBA 1GHWH 1Z8IB 4FVDA 4MLFB 1C5VA 1XXDA 2WHXA 2CF9H 4ZHAA 1P57B 3UQVA 4RN6A 3SUDA 2WINI 5DP5A 2P3TB 2R3UA 2H1UA 2Z9IA 3GCTF 5HYOA 2BD8A 5EU8A 1GI3A 1S6LA 2ESTE 1A0HB 3A7WA 3GCTG 2J95A 1CU1A 1CGHA 1QA0A 4DIIH 3GCNA 5GJ4B 3BIUH 4ZUHA 1X7AC 2F83A 3S0NA 2HRVA 2K8IA 1QJ6B 1GI7B 1GWAA 1NC6A 2QA9E 3TITA 1QL8A 3KGPA 1V6DA 1NBME 1EPTC 1AN1E 1BIOA 1GI0A 3K6ZA 4Q80A 1YCPK 1GG6C 1O3MA 1C5SA 2BZAA 1Y3XA 1ZGVA 5GPIB 2VH0A 1SOTA 2KFWA 3LU9B 3SJ9A 1TALA 1UTNA 2BDIA 2BDCA 2BM2A 2G5VA 2OBOA 1ELGA 1LO6A 2VIVA 1O5AB 4WWYA 3A89A 1GCDA 3MH6A 2A4OA 1THPB 4AFQA 1V3XA 2FOEA 1RRKA 1T7CA 1C2EA 4JYUH 3SV8A 1MTNC 4XD7D 3SNEA 5A2MH 1ELVA 2ANWA 2ZQ1A 3RXUA 2PR3A 1MAXA 2Z3DA 3VXFH 1SC8U 4K1SA 1KXFA 1SPJA 4CR9A 3D65E 2CJIA 3MO9A 1JWTA 2VVCA 3K9XB 1HAVA 3RC4A 1SHYA 1Y3YA 2WPIS 2A7CA 1FX0B 3ZYEA 2FZZA 4NGAH 1QNJA 2A1DB 4A1TA 2G81E 2FX6A 2BXTH 1TIOA 1L0ZA 2ZCHP 3ZZAA 2RDEA 2WV5A 1MCVA 2QAAA 5DJ7A 2F9VA 1E79D 2NU4E 1P2MA 1HCGA 1UVOA 1S0RA 3GS9A 1TONA 2QXHA 3B8JA 1V2QT 5HM9A 4YOIA 2Y5HA 1F0SA 2F43B 1HV7A 3F9FA 4BXSA 1ZHMA 3ZZDA 3E0NB 1ZHRA 1QRWA 3DFJA 4WJG2 4I8HA 1OPHB 3SZNA 3A7YA 1TABE 1G3EA 4ISHH 2ZWLH 1V2VT 3MU0A 3QZQA 1GMCF 3PB1E 1GBMA 4AORA 5DP9A 1DPOA 1K1IA 5LPEA 3CS0A 2V3OH 3R0FA 5E2OA 1SMFE 1EOLA 1ANEA 1W0JD 1AB9B 1YLNA 4I86A 2BMGB 3BTHE 1D6WA 1HAXB 1QL7A 3MOCA 3KN2A 2BLOA 1SGQE 1ZSKA 2FI5E 3TLOA 1BRUP 3NXPA 2AERH 2V3HH 1LVOA 2O8LA 1UTPA 3KIDU 4DGJA 4ZKSU 2GMTB 1SGDE 1CHOG 3GY6A 3NK8A 3KCGH 1BTUA 1KXBA 1VCQA 1BMAA 1CT0E 4B71A 5GXPA 3RXHA 3A84A 5HKKD 2OXSA 5DP3A 4TY7A 4B6FA 1DVAH 3WW7A 1ZPCA 2V0BA 4UE7H 4MG3A 4JMYA 3K65B 5LPFA 1A61H 4ZAEA 4WH8A 1DUEA 3GDSA 3OYPA 3S9CA 5F53A 3RC5A 1C1RA 2TRMA 1Q31A 3OAAD 2P94A 1XUGA 4X1SU 4HI3A 5JDUB 1P02A 1W11U 3A80A 1PPZA 3KHVA 1TYNA 3TU7H 4WF8A 5A8ZA 1GCTB 4BXWA 1KLTA 1IQLA 3ZZ5A 1YCPH 4U2WA 2CGAA 2LNCA 4ISNA 1TOCB 5GNDA 1BB0B 1RFNA 3B23B 1NFXA 1NBMD 3UOUA 3E16B 1P2NA 1Y59T 1Y3VA 4FXGH 4A92A 1D3DB 1MTWA 4X1QU 3ZV9A 4AN7A 7LPRA 1C2GA 4IBLH 5HMAA 1BMFD 1SLVB 2OQ5A 1HFDA 1NFWA 1G2MA 1C4Y2 3KYFA 2WPJS 4X0WU 1LCYA 3BN9A 4TT3D 3PLKA 3VB5A 1FNIA 3U8RH 1AI8H 1A7SA 2H5DA 3BTDE 2GJGA 2FLRH 4ACAA 4I32A 4Y7AA 5JPMH 2XBXA 5IYTA 2ILNA 4NIWA 3GDVA 1FAKH 3AK5A 4M7GA 1SGIB 4H42U 4AGKA 1HXFH 4AFUA 3RM0H 4ABAA 1XVOA 2VIWA 4Z1MD 2CHAB 1UVSH 4F55A 3UNQA 4XBCA 1OSSA 1TNIA 2ZTXA 1QB9A 2XC5A 1CGJE 4U30A 2BYAX 2BD7A 1WV7H 2SGQE 1YBWA 1AHTH 2FS9A 1GBBA 4U01A 1FXYA 2XTTB 4XE4A 5FX5A 1FV9A 1C1QA 1CO7E 1XKBC 2BY8X 4HG6A 4O3UA 5C67A 1O3LA 3F0OA 1EASA 1JRSA 2ANYA 1UO6A 1O5DH 2XC4A 2HVYB 3SZEA 3RXIA 4JK5A 1MTUA 2XNIA 3U1IB 4X6PA 5FPSA 1A1RA 5HGGA 3RUOA 3ZVCA 2XBYA 4Y8YA 3TVJB 2FOBA 5EJLA 2ZPSA 1GVLA 3FZZA 5C2ZA 1QRZA 1J14A 1ETTH 2VB0A 1EB1H 1O3KA 2J98A 1IOEA 1L4DA 4IN2A 1K0HA 3BTGE 4LZ1H 1RTKA 4JYVH 3UWIA 1GI6A 1EPTB 1GHXH 1B0FA 2FP7B 1GG6B 2VJ1A 4IS5A 2OC7A 1Y8TA 1PPCE 1XUIA 3PTNA 2XWBI 4KKDA 3RXVA 4WMEA 1TNLA 2FYRA 5EPNA 1H9HE 1RD3B 2SNWA 3KQDA 3KYGA 1DY8A 3LJOA 3GCHC 1QBVH 2VIQA 3OFND 3I78A 3QLPH 1QHRB 5T1VA 4GHQA 4O03A 1ABIH 1F92A 1MTNB 1GVZA 2BB4A 3ZVAA 3RXMA 3BEUA 1A3BH 4K1EA 4BAOB 1ZPBA 1C2IA 1ZSJA 4GUXA 2JKHA 2P3FH 2FMJA 1BMMH 3LGYA 4K3JA 2BLQA 4X2WA 4DY7B 3PMAB 4ABDA 1NFUA 1SGFG 2FOHA 4UONA 1KXCA 4A1XA 2W7UA 3EDXB 3BTME 3HPTB 4I8LA 1LHFH 1P06A 3BTWE 3MH7A 1GHAF 1DWCH 3UY9A 1Z6EA 1WTGH 2O8MA 4ABHA 4JZIA 5C94A 1F5LA 1GDNA 3E8LA 2OP9A 3U8TH 4YESB 2ZU4A 3UAIC 2QF3A 2Y81A 5J4SA 1RTLA 2QYIA 5I46H 1V2KT 4BTTB 3SUEA 4NCYA 3K6YA 5HIYA 4U32A 1B0EA 2ANKH 3MO3A 4JZDH 4H6TA 1O39A 4CBOA 3TJUA 3LT3A 3C27B 1DXWA 1OWKA 4FUHA 1KDQB 2A4GA 1A5HA 3F9HA 1O3CA 3K2UA 1CT4E 1BHXB 3RXJA 2CV3A 2WV9A 1GBJA 4IGDA 2HNTE 1DE7H 3U98H 5C0UA 1XX9A 5L2YH 1JBUH 5AFZH 2A7HA 1P8VC 1YPKH 1P2KA 1G3BA 1SQOA 3GYLB 1XUJA 5EPYA 4NWLA 1BTXA 1TGNA 3ELAH 4D8NA 1ZR0A 2P93A 1N6XA 2ZZUH 3TJOA 1GI2A 2H9TH 2ALPA 1GDQA 1V2JT 1EAXA 2P16A 3BV9B 3HK3B 4ZHLU 4MTBA 4A6LA 1YY3A 2ZA5A 3BSQA 3U1JB 2ALVA 3CS7A 2YMSC 4ZMAH 2PFEA 2EEKA 3RLYH 4AZ2B 4RKJB 2OK5A 3SNCA 1O2KA 3PV4A 1EZXC 2H2ZA 2SGEE 1F7ZA 4CBNA 2G8TA 1C5QA 4HFPB 1TAWA 1TRNA 2BXUH 1SFQB 5A8YA 4ZXYH 5G4BA 2NU1E 2ZTYA 3ATMA 4D7FA 3S7HB 4WY3A 1VZQH 4X8UH 3F6UH 3KL6A 5PTPA 4ESTE 3IG6B 3A7XA 5DSFA 2VH6A 3TH4H 1UW7A 5TJXA 1AE5A 2GV7A 1EAIA 1TX6A 3TK6A 1Z71A 1O2SA 4F4OC 3LIWA 1FY4A 1LQEA 1GHYH 1C4V2 4NSYA 1IQIA 4GAWA 4MNXA 4P02A 5EODA 5K7RA 4NA8A 1OP8A 1SVPA 3Q3YA 2UWPA 3LDXH 5JB9S 1BTWA 4YLUA 3LOXA 1O33A 1SL3A 3ZZ6A 1DUAA 1SKYE 2KAIB 2VGCC 1OWHA 1V2LT 3A8CA 4ZCNA 1CSOE 1O0DH 3CENA 2R2WU 4KTSA 5GCHF 1ANDA 3EQ0H 1OWJA 1P2OA 3KF2A 1HAYB 1GI8B 4AFSA 1C1WH 1YC0A 5GCHG 1DICA 3S69A 3V7TA 3PLPA 4FU8A 1DFPA 1EXFA 1MKWK 3PRDA 2FPZA 3NKKA 4ASHA 2CMYA 4ZKOU 3UOPA 3E1XB 1KTSB 4YTAA 4J2YB 4PROA 1S0QA 3G01A 3F68H 5KGOA 3M5LA 2FOMB 2GGVB 1NPMA 2Q6GA 1W0ZU 3UNSA 7GCHF 2VVUA 5FPTA 4HTCH 3KQBA 7GCHG 1LVBA 3PLBA 2FDAA 1MMJN 3PV2A 1H8DH 1MTSA 3HGNA 3MU5A 2XOKD 2EI6A 2ZDVH 1TNHA 3E3TA 3RP2A 5DO4H 5CHBA 2TBSA 2VINA 3ESTA 1AWHB 1EZUC 1XVMA 1HJAC 1TA2A 3V13A 1C5MD 1F5RA 1L2EA 2DE9A 1O2WA 2V6NA 1C1SA 1MU8B 4Q2KA 3TIUA 1KSNA 5DP8A 5L2ZH 2AH4X 1TA6A 1W0KD 1Z6JH 2THFB 2VBCA 2ZKSA 1G2LA 3EE7A 3GY4A 1WUNH 3GCHB 1ID5H 2JH5D 1GI9B 5EXMA 3GICB 1SGEE 4DG4A 1YPHE 2KCPA 3A8DA 3RLWH 2GCHF 3F0PA 4NA9H 1YKTA 4M9FA 3GOVB 1HLTH 1TPSA 5C1YA 2AHME 1B5GH 1HUTH 2PTCE 1EPTA 1AIXH 1ZMLA 1E35B 1NRRH 4D9RA 2PKSC 1O3GA 3BTKE 1NT1A 2BDHA 3V12A 1GBCA 3SGQE 1N8OC 3DHKH 4FUJA 4ACBA 2ZDNA 9ESTA 2BDBA 4BAMB 3D62A 1O2HA 5LPRA 1ANBA 1S82A 1HAGE 2XYAA 1MBQA 5FPYA 2RG3A 5EIYA 1BT7A 1O3FA 1PQAA 2D1JA 1K2I1 2A32A 2BD3A 3A8AA 3F2GA 1F5KU 1V2TT 2F9OA 2GT7A 3TH2H 1UVTH 1NESE 3JZ1B 4A7IB 2EA3A 5EQSA 2ZGCA 1QB6A 1HRTH 1NROH 2BLWA 1C5YB 3MYWA 1T8MA 3M37A 1SQRA 3SNDA 2A5AA 2WSSD 3FFGA 3WWBA 2BTCE 3OEHD 2Y5GA 2G4TA 2Q6DA 2VWLA 1P3CA 4FUIA 1G30B 1DANH 2KR7A 1SFIA 1H1BA 1MQ6A 1HIAB 1O30A 3HK6B 1G32B 1QTFA 4FUFA 5F8XA 3NCLA 3ZZ9A 2ASUB 2C93B 4UD9H 1C2HA 1OP0A 3SU5A 4A5TS 2PGQB 4R0IA 1S83A 4DVAU 1MKWH 4OGXA 2A5KA 5EXLA 1GBEA 1U6QA 4ZKRU 2ZDKA 2KCAA 4X8SH 2XCNA 1SGRE 5HXFA 3MU4A 4X1PU 1C1UH 2IPHA 3N99A 5FAHA 3H09A 1SBWA 1UVUH 5BPEA 1D4PB 1GBTA 1FONA 1KDQA 4OS1A 1C1MA 2O8WA 5GWZA 3MU8A 1RGQA 3GY3A 2GD4B 1FPHH 4K69A 4Y11E 3BIVH 2M5TA 4O9VA 3LC3A 3M61U 2ZPQA 1EUFA 4YT6H 4IN1A 3SW2B 1O3JA 3SI3H 1FI8A 2YMSB 3T29A 1ELFA 4GHTA 4YT7H 1PPEE 3QGNB 3RMOH 4XBBA 2BX3A 3WWFA 1MH0A 2ZEBA 2ZFSA 3A8BA 3F9EA 4I31A 2YNAA 3ZZ3A 2L74A 4HGCA 2RFKC 1Z8GA 3TJNA 4ABJA 1W13U 3GCOA 1MQ5A 4LXBH 1DX5M 5T6FA 5A0BA 4IW4E 3V0XA 3OY6U 2Z9JA 3MNCA 4UFDH 2F3CE 1SG8B 2KCOA 3RXOA 4F48B 1UTJA 3OTJE 3I29A 1IAUA 1VGCC 3RXGA 1Y5AT 3ATLA 3MWIU 3P8OA 3QTOH 1M9UA 2EI7A 3QO6A 2NU3E 2OQUA 1ESBA 4ZXXH 5C0TA 1CHOF 1O3IA 1HB0B 5DKMA 1DLKB 3NWUA 1RTFB 2OLGA 2OUAA 2C8WB 2A31A 2VGCB 2C8YB 2P8OC 5C1UA 1GHBG 1SLUB 3PWCA 2I6QA 1O2YA 2F9NA 3T26A 2FI3E 4ABGA 1YGCH 3PMBB 4NWKA 3OEED 5TCAA 2FTLE 3GY7A 1IQMA 3F2FA 3GY8A 1VJ9U 1GPZA 3SORA 3NZIA 3OTPA 4WXVA 3T2NA 1AKSB 1CHGA 4AB9A 2OC1A 1V2PT 6CHAC 3ZZCA 1V2NT 4ISOA 5H4IB 1Z1JA 2KAIA 2PP6A 1TPPA 5ESTE 3O8BA 3SO3A 2WYJA 5E0JA 4XRNA 2GZ9A 3FP8E 1FDPA 4Y10E 1DS2E 1TRMA 3PM3A 1AVGH 1GL0E 1ZSLA 1NU9A 2EC9H 2F91A 4OS2A 1C4U2 4AC9A 2PW8H 2QXGA 3N7OA 2PLXA 3PWBA 1WTHD 1WCZA 3BEIB 2GDDA 1EB2A 2PTNA 2Z6BD 1KXAA 1J8AA 1VITF 1P04A 4X2XA 1HJAB 3PMHB 2G4UA 3EAJA 3EA7A 3VB4A 1VITG 5IDKA 1FPCH 1ETRH 2BDYA 1AQ7A 3E91A 2ZU3A 1C5PA 1EATA 1GVKB 1A5GH 1WAYB 2R9PA 4OS4A 4WXIA 3ZZBA 3W95A 1O5BB 1ORFA 2BOKA 5EQQA 3PYHA 2XBWA 3MI4A 1NM6A 2C90B 2OINA 3U9AH 1J16A 1EZSC 3F3BA 4NIXA 1AD8H 1VITH 3ITIA 4JYTA 1HBTH 3P8NA 3UREA 4BAQB 1NRNH 1UHBB 1LMWB 2CXVA 3CNRA 2PKSB 2OBQA 4BNRA 1KXDA 4CH8B 4NFFA 3TGIE 3I77A 1N8OB 4Q63A 3L6PA 4INKA 4UEHH 1FQ3A 1H9IE 9LPRA 1AVWA 4K2YA 2ZFFH 1P0SH 2ZIQH 4RI0A 2R0KA 1QJ1B 4O97A 1DY9A 2QIQA 5T6DA 5L6NH 4FETA 1BMNH 2GZ8A 2IN2A 1T32A 1D3QB 2Y82A 4J1YA 2ZG0H 1H8HD 1D9IA 1MD8A 1ARBA 2A0QB 1K1NA 1TNKA 2QV1A 3IITA 3T28A 2J4IA 1QJ7B 2FLBH 2VWNA 1MD7A 4TSFD 1S84A 4KTUA 2P3UB 1C5LH 2TPIZ 1W14U 3RMMH 1P05A 1PPBH 1AZ8A 2Y5FA 1T31A 1LHDH 1TPAE 1E34B 1LQDB 1VJAU 4FVBA 2B5TB 3SUFA 3M35A 3TGJE 5F8ZA 1PYTD 3KNXA 1TNJA 2AMDA 2XBVA 2ZU5A 3SU1A 1PJPA 2BVSH 5A0CA 1ZYOA 2HALA 1O3PB 3AAUA 1WDIA 2G51A 3SHAH 2PKAB 2Z9KA 1OWDA 4FUDA 5E2PA 1E36B 1IHSH 1L1NA 2QXIA 2V35A 3BTEE 2AEIH 3DSOA 5J4QA 5FX6A 3A7VA 3D23A 1QQUA 1C5WB 1EKBB 3IWMA 5ABWA 3E90B 1ELTA 2GX4A 1S85A 1O2JA 1XXFA 2H5CA 1L1GA 4X2VA 1HIAA 3SU6A 4ISIH 3ZVDA 3QGJA 3SJOA 2GP9B 3HATH 4X6NA 4B2AA 3N7EA 1TGTA 2ZECA 1Q3XA 1ELCA 2TGAA 3HKJB 1O5FH 3TPIZ 3VB3A 1D6RA 2VU8E 1O3BA 4Y7BA 3TNTA 3M3TA 4D76A 2C8ZB 2O9QA 1UVPA 1BITA 1BTHH 1KYNA 4E05H 1EJNA 3QX5H 3QTVH 1QIXB 5CE1A 3AVZA 1AFQC 4DCDA 2A2XH 5ESBA 4B73A 3M7UA 2VIPA 3ZIAD 1P11E 1YP9A 2A45B 1WYKA 2AGEX 1YPMH 3VG8A 1TFXA 6GCHG 5IK2D 1NO9H 1HYLA 1PQ7A 2M2AA 3STJA 3A81A 1VGCB 2HPPH 2FXRA 2W3IA 5KEDA 1KIGH 3RXTA 3A88A 5DN6D 2QF0A 2ODPA 3VB7A 1YF4A 3RXKA 4WVPE 1FIWA 2Z9LA 5B6OA 3SNAA 3DCLA 2UUJB 4HZHA 1TMUH 5EOKA 2PUQH 3OY5U 3U69H 2UUYA 2WPMS 4MVNA 1GI5A 1BJUA 5HIZA 2P8OB 2WPHS 1FMGA 1SGCA 1XUFA 2Q1JA 1TB6H 1TMTH 3EYDA 4I7YH 4TWWA 1JIMA 3GYMA 2KX4A 3BF6H 4GPGA 1MZAA 1KMHB 3GISB 2SGPE 4RT0A 3ZZ7A 1OYTH 4FUBA 1PPHE 1O2GH 4K8YA 1NRPH 1UTKA 2A4QA 1A0LA 1C1VH 4YM9A 3TK5A 6CHAB 1MKXK 2FOAA 3UWJH 1QL9A 1P10A 4X8VH 2JH0D 3AW0A 3P6ZB 3EE0B 1O3EA 3LGWA 2K0QA 2FESH 3L3TA 1VCPA 2JJ1D 2AYWA 4DIHH 4TYDA 2HLCA 3M7QA 2QCYA 3MQKC 2ZNKH 3SV9A 1LHCH 1EFRD 2D8WA 3LC5A 2HVXA 1ZTLA 2L6OA 1RJXB 2BQWB 2NWNA 1SGNE 4NZQA 4TPYA 4OGYA 4AB8A 5BRRE 1Q2WA 1C2JA 2BD9A 3SV7A 2O8TA 3LPRA 8GCHF 1EJMA 2BVXH 1AKSA 3SQEE 1JOUB 2I6SA 8GCHG 1EJAA 1BRBE 1LHEH 3UFAA 4I33A 3T25A 4CH2B 4FUCA 1QQ4A 2EI8A 3AASA 3E6PH 4CHAC 2A5IA 1HAPH 1GBLA 1XUKA 1GBIA 1OHHD 1O38A 1G36A 1IQHA 2F9BH 1V2RT 4I8JA 1LPGB 3OSYA 2P59A 4K1TA 2BVRH 1GJ6A 2VWOA 5AHGH 2BY6X 1O2ZA 1A3EH 3A7ZA 2ZU2A 5EJZA 2GV6A 1ZHPA 1GBDA 1UK3A 2STAE 3RXQA 1UTQA 1YLCA 3PV5A 4NA7A 1XKAC 2HNTF 1BUIA 2WPLS 4YOGA 2TIOA 1NU7B 4SGAE 2BX4A 1K1MA 2GT8A 1DLEA 1EQ9A 1BJVA 3T27A 4X6MA 4KELA 2TGTA 3SU3A 1UJ1A 1EX3A 1E1RD 2ZFTA 1XM1A 1SI5H 2FS8A 4CR5A 3SOSA 1THSH 5EXNA 1B7XB 4R8TB 1CQQA 1O3HA 5DK1A 1A2CH 2G5NA 3SU2A 2P95A 2Y6TA 5C5OA 1ZPZA 2OCVB 1VR1H 2W6ID 4TPIZ 3SJIA 2C4FH 1FN8A 3F2HA 2B0FA 1C5NH 1O2PA 3UQOA 1GL1A 1QA7A 3GY2A 3TH3H 4SGBE 1C5RA 1K1LA 2Q6FA 2LELA 2VNTA 3V3MA 2QF5A 4H6SB 4X2YA 5E8EH 2HLDD 2TGDA 1A5IA 3R3GB 4JCNA 3QWCH 4KP0A 1MBMA 3P70B 2ZDAH 2WPKS 5F03A 4MNYA 1MKXH 2FOGA 4B1TA 1O2OA 5CHAC 1QZ8A 4ZHMU 3P92A 4LK4A 1C9PA 1O2RA 2OD3B 2A4RA 2ZGBH 1KLJH 1WXRA 3RXEA 3QN7A 4IC5A 1ZOMA 2SNVA 2ZO3H 1UK2A 4KTCA 1GHZA 1CVWH 1V2ST 3H7TA 1O35A 1SLXB 4B2CA 3S7KB 3DSGA 1NFYA 2WUBA 3ZZ8A 1IQEA 1QB1A 1O37A 2G55A 2FO9A 2ZTZA 3QDZB 1QCPA 1UTLM 2G00A 1WQVH 1OWEA 1JMOH 3ATIA 2Y7ZA 3PMJA 2K1QA 2D26C 2R2MB 1LPKB 3A82A 4D9QA 3BTTE 4MPWA 1TNGA 5EQRA 2PKAA 1F0TA 2JDID 3H7OA 3M5NA 2A2QH 3ENSB 3PROA 1BTZA 2FODA 4DJZB 2XC0A 4IC6A 2FWWA 1RS0A 4BAKB 2BOHB 1PQ8A 3EA8A 1QFKH 1IQJA 1HJ9A 4E7RG 3P95A 1ZJKA 4MNVA 2ANMH 1AFQB 1EOJA 4CREA 4Q4LA 3NPSA 1JIRA 4BOHA 1Z8JB 4X6OA 3BTQE 3FP7E 4RKOB 4INLA 1SB1H 1OX1A 6LPRA 4NG9H 2QY0B 2PSXA 1QBOA 3L33A 1ARCA 2VIDA 1K1JA 1LVYA 1ZRBA 1GJDB 3SU0A 1CA8B 3SV2H 1AWFH 2GVFA 4MQAA 4AGJA 5C3NA 1HGTH 1F2SE 1FAXA 3WY8A 4WMDA 4Z0KA 2B8OH 3LH1A 1A0JA 3JZ2B 2ZU1A 2ZFQH 2J2UA 1C1NA 1SSXA 1H8ED 1Y3UA 1GBHA 4TWYA 2VWMA 1UK4A 1C5ZB 2J38A 4UDWH 2YNBA 1KY9A 3DA9B 1O3AA 4AG1A 1EP5A 1V2MT 5LH8A 4FUEA 1TWXB
chains in the Genus database with same CATH topology
1JRTA 2PUXB 3LGIA 3CP7A 4OS6A 1EAWA 4FUGA 5EW2H 1HAHH 1GJ5H 4K5ZA 8KME2 1TMBH 5A0AE 1UTMA 1K9OE 2ZGXH 1SGTA 3RXCA 1K21H 1O2XA 3HKIB 3LH3A 3MU1A 4DOQA 7ESTE 1FY3A 4LZ4B 2Z3EA 2FTMA 1QR3E 1W2KH 4JK6A 3Q00A 3BG4C 5A8XA 1LTOA 2HOBA 1HJ8A 1NS3A 5K0HA 1QGFA 3STIA 4GCHF 1OYQA 4Y71A 1SOZA 5AF9H 3O8RA 1XMNB 1G3CA 1LHGH 4GCHG 3RU4T 3TGKE 4Y6DA 1C1TA 1ZTJA 2GCTC 1C5TA 2DE8A 3UNRA 5FBIA 1UTOA 1BQYA 5CMXH 3FVFB 3MH4A 2XCFA 4CRBA 4DT7B 1EP6A 2FM2A 1IQKA 4DURA 3URCA 3VFEA 3P8FA 2F9UA 1UCYK 3D49H 2XWAA 3VEQB 3MHWU 4CHAB 5L30H 1PPGE 1W0YH 1AE8H 1DSUA 5F6MA 3DD2H 1TPOA 2ZF0H 1AZZA 1FY1A 2NU0E 1UCYE 2BY7X 2GDEH 1P2IA 3F1SB 5GIBA 1GHBF 3AW1A 2SFAA 2XXLA 1DITH 1AMHA 1CGIE 4ABBA 1BRCE 1GJ8B 4KGAA 2UWOA 3ATKA 4Y76A 1FY5A 1TLDA 1GMCG 1Y5BT 5C1XA 5EW1H 1YM0A 1ACBE 3SGAE 1K1OA 2QXJA 2R3YA 2HNTC 1ESTA 1C5UA 2JETC 2B9LA 2AMPA 3F9GA 4CRCA 1NY22 1GJBB 1SHHB 4AX9H 2UUFB 3MH5A 1S6HA 1J9CH 4ZKNU 2RA3A 3A83A 1V2UT 2GZ7A 1P03A 2ZP0H 3TK9A 2H6MA 3VGCC 2AGGX 1TX8A 1OKXA 2J34A 3NUMA 4MPXA 3RDZA 3T62A 4H4FA 4B74A 4FU7A 2IJOB 1TQ0B 2ZGJA 1TRYA 3E0PB 1HAIH 2PGBB 3ODDA 1QRXA 2J92A 4K60A 1FIZA 1E0FD 2ZQ2A 1ELEE 4NSVA 1TOMH 1J17T 1O2UA 3HGPA 3QUMP 2W3KA 1BOQA 4IMZA 1ZGIA 2BD2A 1WQSA 3M3SA 1S5SA 4NZLA 3TNSA 1P2JA 1GMDF 2BD5A 2QN5T 1O5GH 1HNEE 1NZQH 4TY6A 1GMDG 4NIYA 1C9TA 1GHVH 3O8DA 4BTUB 2OC8A 2SGFE 1BBRK 1DOJA 2ZHDA 2WUCA 3DT0H 1SR5C 5CHAB 5JBBS 4CRAA 2D2DA 1LVMA 1MUEB 1P9UA 1YPGH 2G52A 3FP6E 1V2OT 2UUKB 3VPKA 1HXEH 3H5CB 1BBRE 1DT2A 1K22H 1T8LA 2ZFPH 4ABFA 1P01A 1ETSH 1ZRKA 1W7GH 3MTYA 4BTIB 2HGTH 1BTYA 2ZCLP 1TX7A 1ABJH 4JZFH 3RMNH 2SGAA 3QZRA 4XDEA 3RXLA 1LPZB 1O2LA 1HDTH 1O3DA 2VIOA 1AUJA 3KEEA 2AS9A 1Z1IA 4CRDA 3ZVFA 1UCYH 1C2MA 1G9IE 3Q3KA 5JB8S 1C2FA 1CBWC 5DP7A 1O32A 4Y8XA 1QURH 4CRFA 1P2QA 3ZV8A 3VXEH 1MTVA 1HAOH 1O3NA 2PWXA 2FOCA 1C1PA 4A1VA 1ESAA 4VGCC 3W94A 3Q76A 2ZHQH 5A09A 3OX7U 1ZJDA 1O34A 4AYYB 1KXEA 1SGPE 3LGTA 4XSKU 1D3PB 1CT2E 3PO1C 1BA8B 1RIWC 2RCEA 1GGDC 1HAZB 1XUHA 1IHTH 5DP4A 3ZVGA 2ODQA 1FJSA 4ZROA 2B7DH 2FX4A 1GJ4H 5GDSH 1O2TA 3MNXA 2ZC9H 1O2NA 1GJ7B 2BLVA 1D3TB 1ZMJA 3KQEA 2AGIX 1IQGA 1BDAA 1CA0C 1F0UA 1OOKB 3SJKA 3T5FH 3SNBA 1OS8A 2O8UA 4MPUA 4ZH8A 4INHA 1VCWA 2OC0A 1GJCB 1GDUA 3A7TA 3RXFA 1G37A 1MU6B 1YPHC 4JZ1A 5FCKA 1TE0A 3ZZ4A 7KMEH 5EG4A 4MDSA 1EAUA 1C5OH 3FAOA 3AAVA 1SLWB 2BHGA 3MO6A 1TBQH 2BD4A 3BG4B 5SGAE 3TJVA 2A7JA 1YPEH 3RU4E 2ZHEH 5T6GA 2F9PA 1O36A 4Q7ZA 2TGPZ 4D7GA 5I25A 3MFJA 5HM2A 2ZFRH 5C20A 3M3VA 4QT8C 1OXGA 4X1NU 4Y8ZA 1SGYE 2GKVE 1ZLRA 8LPRA 4ABIA 1W7XH 3A85A 4B75A 4X1RU 2GCTB 1GBAA 2FOFA 1A4WH 3Q77A 3M7TA 6GCHF 3U8OH 2XRCA 2ZHFH 4MNWA 2ZCKP 1DXPA 4GVUA 2FIRH 1A46H 3ATWA 1GHAG 2ULLA 1C2KA 3OU0A 4UFEH 2OTVA 3UTUH 1HPGA 4BANB 1BBRH 1ELAA 1BMLA 1W10U 3LGUA 2IOTA 3BEFB 1KTTB 2FEQH 3ZVEA 1DSTA 1O5EH 3DFLA 5FBEA 1WSSH 1S81A 1GI1A 2WYGA 2ZGHA 3S9AA 1LDTT 2BQ7B 4YLQH 1TGCA 2STBE 3SBKA 1FLEE 2FYQA 2Z7FE 4XFQA 3FZDA 1IQFA 3P17H 1YCPM 4UFFH 2ZPRA 5FXLA 3RXAA 1NTPA 1Y5UT 1HAVB 4MPVA 5EGMA 2WV4A 3SI4H 1FZZA 1O2IA 3MNBA 1G3DA 4GLYA 2Y7XA 4RSPA 1N6YA 3SGBE 3M5OA 4E7NA 3P8GA 4WMFA 1TQ7B 1P12E 2JETB 4B2BA 4LOYH 1JXPA 5DG6A 2R0LA 2H9HA 1AUTC 1AU8A 1J15A 1GMHF 5DGJA 3VGCB 1SQTA 1UMAH 5AVDA 3DUXH 1GMHG 3EA9A 1KLIH 4IMQA 4WH6A 3UPEA 4OS5A 1WBGB 2ZDLA 1F0RA 2BY9X 1L4ZA 1LKAA 2SGDE 3B9FH 1T4UH 3M36A 3BTFE 1LKBA 1FY8E 4Y79A 3A86A 5ETXA 2RA0A 2UWLA 1AY6H 2W7SA 2VVVA 5E0GA 1QBNA 3FANA 4NFEA 3SQHE 3MNSA 2HPQH 1YPLH 4FU9A 4Z6AH 1C1OA 1P3EA 1H4WA 5AFYH 2ZDMA 1P09A 1DDJA 1T8OA 2W5EA 3RXSA 1H8IH 1RXPA 4ISLA 4Y0ZE 2Y80A 4ABEA 1FN6A 1Z7KA 1ZMNA 4XOJA 1NRSH 1NRQH 3VB6A 2RDLA 2ZHWH 1AO5A 1GI4A 3KQCA 4K8BA 1ZTKA 5T3HA 2CF8H 2BDAA 1K28D 1OWIA 4X8TH 1BRAA 4AG2A 1OP2A 3ZYDA 5JBAS 1BHXF 3EGKH 5E0HA 2W26A 1YPJH 3SU4A 2C3SA 1V2WT 1AB9C 3SN8A 1O5CB 3UR6A 3UR9A 4B76A 2QGRA 3C1KA 3RXBA 1MZDA 4YZUA 4YO9A 1AVXA 3SJ8A 1DWDH 1T4VH 3RU4D 4F49A 2GMTC 4OS7A 1E38B 1W3CA 1DWEH 3S9BA 1PYTC 2H9EH 3Q3XA 1Y3WA 4Q7YA 1INCA 2PSYA 4I8GA 2C8XB 3ODFA 5JYIA 4AOQA 1W8BH 2DUCA 1ELBA 1THRH 3LKWA 1CE5A 3GY5A 3A87A 2AIQA 1ELDE 3RXDA 4E06H 3URDA 2PV9B 3M5MA 1CBWB 3LONA 1UHBA 3RMLH 2GTBA 1GJAB 2JH6D 2ZI2H 3LJJA 3SV6A 2BDGA 1P9SA 3BG8A 2HWLB 1GJ9B 5FHTA 1ANCA 1O31A 1DM4B 1O2VA 1Z8RA 1GBFA 1PQ5A 2PHBA 1O2MA 1SGFA 2BZ6H 4Y0YE 1W12U 1YLDA 5FCRA 5LGOA 2FI4E 1GCTC 2QC2A 2Z94A 5F8TA 2ODYB 1GBKA 1E37B 4VGCB 5DP6A 3RXRA 2Z3CA 6ESTA 4Q7XA 1N1LA 1PFXC 5C5NA 3O8CA 4BAHB 5JBCS 2AMQA 1DWBH 1MAYA 3RM2H 3PO1B 1FUJA 1BCUH 3SUGA 1RIWB 1IQNA 5JBTA 1K1PA 4AFZA 1GGDB 2CN0H 2XW9A 3UUZA 1C2DA 1YYY1 4CRGA 8ESTE 3ZVBA 2NU2E 1NN6A 2J94A 2AFQB 1BZXE 4THNH 3MMGA 3UIRA 1T8NA 1AGJA 1C5XB 2YOLA 4DW2U 4JZEH 1TGSZ 1WU1A 4GSOA 1BTPA 1H9LB 1TGBA 1CA0B 4O3TA 2BQ6B 1EZQA 2Z9GA 1L1JA 5TCCA 4YOJA 1S6FA 1MCTA 3GDUA 1ZZZA 2J9NA 3SHCH 1TBRH 3RC6A 1O2QA 1AFEH 2LPRA 2CHAC 4I8KA 4UFGH 3LGVA 1WOFA 3QK1A 2GCHG 1TBZH 3RXPA 5DPAA 4NIVA 2BY5X 1QY6A 4AYVB 4XBDA 2AIPA 1SQAA 1PPFE 1C2LA 1O3OA 3PTBA 1GHWH 1Z8IB 4FVDA 4MLFB 1C5VA 1XXDA 2CF9H 4ZHAA 1P57B 3UQVA 4RN6A 3SUDA 2WINI 5DP5A 2P3TB 2R3UA 2H1UA 2Z9IA 3GCTF 5HYOA 2BD8A 5EU8A 1GI3A 2ESTE 1A0HB 3A7WA 3GCTG 2J95A 1CU1A 1CGHA 1QA0A 4DIIH 3GCNA 5GJ4B 3BIUH 4ZUHA 1X7AC 2F83A 3S0NA 2HRVA 1QJ6B 1GI7B 1GWAA 1NC6A 2QA9E 3TITA 1QL8A 3KGPA 1V6DA 1EPTC 1AN1E 1BIOA 1GI0A 3K6ZA 4Q80A 1YCPK 1GG6C 1O3MA 1C5SA 2BZAA 1Y3XA 1ZGVA 5GPIB 2VH0A 1SOTA 3LU9B 3SJ9A 1TALA 1UTNA 2BDIA 2BDCA 2BM2A 2G5VA 2OBOA 1ELGA 1LO6A 2VIVA 1O5AB 4WWYA 3A89A 1GCDA 3MH6A 2A4OA 1THPB 4AFQA 1V3XA 2FOEA 1RRKA 1T7CA 1C2EA 4JYUH 3SV8A 1MTNC 3SNEA 5A2MH 1ELVA 2ANWA 2ZQ1A 3RXUA 2PR3A 1MAXA 2Z3DA 3VXFH 1SC8U 4K1SA 1KXFA 1SPJA 4CR9A 3D65E 2CJIA 3MO9A 1JWTA 2VVCA 3K9XB 1HAVA 3RC4A 1SHYA 1Y3YA 2WPIS 2A7CA 3ZYEA 2FZZA 4NGAH 1QNJA 2A1DB 4A1TA 2G81E 2FX6A 2BXTH 1TIOA 1L0ZA 2ZCHP 3ZZAA 2WV5A 1MCVA 2QAAA 5DJ7A 2F9VA 2NU4E 1P2MA 1HCGA 1UVOA 1S0RA 1TONA 2QXHA 3B8JA 1V2QT 5HM9A 4YOIA 2Y5HA 1F0SA 1HV7A 3F9FA 4BXSA 1ZHMA 3ZZDA 3E0NB 1ZHRA 1QRWA 3DFJA 4WJG2 4I8HA 1OPHB 3SZNA 3A7YA 1TABE 1G3EA 4ISHH 2ZWLH 1V2VT 3MU0A 3QZQA 1GMCF 3PB1E 1GBMA 4AORA 5DP9A 1DPOA 1K1IA 5LPEA 3CS0A 2V3OH 3R0FA 5E2OA 1SMFE 1EOLA 1ANEA 1AB9B 2BMGB 3BTHE 1D6WA 1HAXB 1QL7A 3MOCA 3KN2A 2BLOA 1SGQE 1ZSKA 2FI5E 3TLOA 1BRUP 3NXPA 2AERH 2V3HH 1LVOA 2O8LA 1UTPA 3KIDU 4DGJA 4ZKSU 2GMTB 1SGDE 1CHOG 3GY6A 3NK8A 3KCGH 1BTUA 1KXBA 1VCQA 1BMAA 1CT0E 4B71A 5GXPA 3RXHA 3A84A 2OXSA 5DP3A 4TY7A 1DVAH 1ZPCA 2V0BA 4UE7H 4MG3A 4JMYA 3K65B 5LPFA 1A61H 4ZAEA 4WH8A 1DUEA 3GDSA 3OYPA 3S9CA 3RC5A 1C1RA 2TRMA 1Q31A 2P94A 1XUGA 4X1SU 4HI3A 5JDUB 1P02A 1W11U 3A80A 1PPZA 3KHVA 1TYNA 3TU7H 4WF8A 5A8ZA 1GCTB 4BXWA 1KLTA 1IQLA 3ZZ5A 1YCPH 4U2WA 2CGAA 2LNCA 4ISNA 1TOCB 1BB0B 1RFNA 3B23B 1NFXA 3UOUA 3E16B 1P2NA 1Y59T 1Y3VA 4FXGH 4A92A 1D3DB 1MTWA 4X1QU 3ZV9A 4AN7A 7LPRA 1C2GA 4IBLH 5HMAA 1SLVB 2OQ5A 1HFDA 1NFWA 1G2MA 1C4Y2 2WPJS 4X0WU 1LCYA 3BN9A 3PLKA 3VB5A 1FNIA 3U8RH 1AI8H 1A7SA 2H5DA 3BTDE 2FLRH 4I32A 4Y7AA 5JPMH 2XBXA 5IYTA 2ILNA 4NIWA 3GDVA 1FAKH 4M7GA 1SGIB 4H42U 4AGKA 1HXFH 4AFUA 3RM0H 4ABAA 1XVOA 2VIWA 2CHAB 1UVSH 3UNQA 4XBCA 1OSSA 1TNIA 2ZTXA 1QB9A 2XC5A 1CGJE 4U30A 2BYAX 2BD7A 1WV7H 2SGQE 1YBWA 1AHTH 2FS9A 1GBBA 4U01A 1FXYA 2XTTB 4XE4A 5FX5A 1FV9A 1C1QA 1CO7E 1XKBC 2BY8X 4O3UA 5C67A 1O3LA 1EASA 1JRSA 2ANYA 1UO6A 1O5DH 2XC4A 3RXIA 4JK5A 1MTUA 2XNIA 3U1IB 4X6PA 5FPSA 1A1RA 5HGGA 3RUOA 3ZVCA 2XBYA 4Y8YA 3TVJB 2FOBA 2ZPSA 1GVLA 3FZZA 5C2ZA 1QRZA 1J14A 1ETTH 2VB0A 1EB1H 1O3KA 4IN2A 1IOEA 1L4DA 3BTGE 4LZ1H 1RTKA 4JYVH 3UWIA 1GI6A 1EPTB 1GHXH 1B0FA 2FP7B 1GG6B 2VJ1A 4IS5A 2OC7A 1Y8TA 1PPCE 1XUIA 3PTNA 2XWBI 4KKDA 3RXVA 4WMEA 1TNLA 2FYRA 5EPNA 1H9HE 1RD3B 2SNWA 3KQDA 1DY8A 3LJOA 3GCHC 1QBVH 2VIQA 3I78A 3QLPH 1QHRB 4GHQA 4O03A 1ABIH 1F92A 1MTNB 1GVZA 2BB4A 3ZVAA 3RXMA 3BEUA 1A3BH 4K1EA 4BAOB 1ZPBA 1C2IA 1ZSJA 4GUXA 2JKHA 2P3FH 2FMJA 1BMMH 3LGYA 4K3JA 2BLQA 4X2WA 4DY7B 3PMAB 4ABDA 1NFUA 1SGFG 2FOHA 4UONA 1KXCA 4A1XA 2W7UA 3EDXB 3BTME 3HPTB 4I8LA 1LHFH