4D8NA

Human kallikrein 6 inhibitors with a para-amidobenzylanmine p1 group carry a high binding efficiency
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
222
structure length
222
Chain Sequence
b'LVHGGPCDKTSHPYQAALYTSGHLLCGGVLIHPLWVLTAAHCKKPNLQVFLGKHNLGQQESSQEQSSVVRAVIHPDYDAASHDQDIMLLRLARPAKLSELIQPLPLERDCSAQTTSCHILGWGKTADGDFPDTIQCAYIHLVSREECEHAYPGQITQNMLCAGDEKYGKDSCQGDSGGPLVCGDHLRGLVSWGNIPCGSKEKPGVYTNVCRYTNWIQKTIQA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Kallikrein-6
molecule tags Hydrolase/hydrolase inhibitor
source organism Homo sapiens
publication title Human kallikrein 6 inhibitors with a para-amidobenzylanmine P1 group identified through virtual screening.
pubmed doi rcsb
total genus 52
structure length 222
sequence length 222
ec nomenclature ec 3.4.21.-:
pdb deposition date 2012-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4d8nA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4d8nA02
1K2I1 5ESTE 3M7QA 1DOJA 3ZV8A 4D7FA 2BDCA 1P2IA 2PGQB 5L2YH 3SJOA 1Y5UT 2G4TA 1CA0B 1TMUH 1V2NT 1YPJH 3Q3YA 1ZMLA 2A4OA 5HM2A 2ZDLA 1Z8IB 2PTNA 3PO1B 4MNWA 1C5LH 1CE5A 2ZGXH 1GG6B 2QCYA 1VR1H 2BLQA 2OQUA 4D9RA 1SGRE 1O3BA 2BD2A 1XXFA 1G32B 3ZV9A 3TK9A 1GBFA 4Z6AH 4BAKB 3GY5A 2ZU5A 2OBOA 1EP5A 5FPTA 1JBUH 5DKMA 9ESTA 2BB4A 6GCHG 1YP9A 2XYAA 8GCHF 1GG6C 1V2UT 3UNSA 1YPMH 3MTYA 4B71A 3MNBA 1EJNA 5GJ4B 1AKSA 5K7RA 2WPHS 3W95A 1FNIA 3U98H 2AGIX 3EQ0H 4FUJA 5A0CA 3S9CA 1AD8H 2QGRA 4JZFH 2WYJA 1C2JA 1NU7B 2OQ5A 3A7XA 2W5EA 3RXGA 1BHXF 4FUCA 2TPIZ 3SUEA 4OS6A 5L30H 3KIDU 1G9IE 2J9NA 3RU4D 1UTLM 1GJ7B 3ZZAA 1SI5H 2ZCLP 1HLTH 1BMLA 4XFQA 2VH0A 2WPIS 1G3DA 5EXNA 2A5IA 3BEIB 1JIMA 1GI4A 1MCTA 1K1MA 3TJUA 4E05H 1ZOMA 1TBQH 4DGJA 1QQUA 3TJNA 1RS0A 2BM2A 4KP0A 1O33A 3M36A 2Z9KA 5GXPA 9LPRA 1OYTH 1OP8A 2JETC 3A7YA 2J34A 3RC5A 2IOTA 5F6MA 2PWXA 3ZZ6A 4TY7A 1YPLH 1DXWA 1TPSA 3OYPA 1DWDH 3STJA 3MH7A 1SQAA 1CA8B 1P2KA 2SGPE 2OINA 2Z9LA 1KXCA 2IJOB 2FOFA 3CS0A 1BQYA 2Z6BD 2EC9H 1GJ9B 2FIRH 1JMOH 1J9CH 7ESTE 1RTKA 2A5AA 1O39A 5T6GA 2PGBB 3D23A 4ABFA 1HDTH 1G36A 1UHBA 3RXUA 2TRMA 1GHYH 1GL0E 1CU1A 1K1IA 2Y7XA 1GJ4H 3H7OA 3GCHB 1A4WH 1SLWB 4GHTA 3HATH 1BB0B 4MNVA 1SLXB 1W3CA 1AQ7A 4B73A 3ATLA 1O2IA 1HGTH 4AX9H 4WF8A 3SGBE 4Y7AA 3SOSA 5LH8A 7GCHF 1W11U 1SOTA 1TA6A 1YPKH 1SHHB 4ZXXH 3NZIA 1P2QA 3MH5A 2Q6DA 2ZFQH 1C5TA 5AF9H 1P3CA 4BAOB 4F4OC 2TGDA 1QJ6B 1OP2A 4NA9H 4I33A 4BANB 1GDNA 2UUJB 2GT7A 2TIOA 2BOKA 1FLEE 4BAQB 4THNH 2ZHEH 4GUXA 3DFJA 4NZQA 1SGIB 1P2NA 2FMJA 1TGBA 6ESTA 5TCAA 1EZSC 1MTNC 4TWWA 1EASA 3OTJE 5JBCS 2CF8H 3ZZBA 2A4QA 3RXBA 1UMAH 1HAZB 1MZAA 3RXKA 2H5DA 1PPGE 2VJ1A 3PYHA 3BTEE 4Q7YA 3URCA 3M5MA 1A0JA 1EJMA 1GI6A 1PFXC 5LPEA 3A85A 1BHXB 1SGFG 1FN6A 2V3HH 3E1XB 1EJAA 2FOEA 4FVDA 1GMDF 2FX4A 2LNCA 1T31A 1GBMA 1Z1JA 1C5WB 1K22H 2FWWA 5DPAA 1JXPA 1C5MD 1UTKA 5JBAS 2BXUH 3ATMA 1C5UA 3UQOA 3K2UA 1DICA 1EZQA 2H5CA 2UWLA 2O8WA 3SNEA 1YPHE 3LJJA 4ZHLU 1QRXA 3RXIA 2FEQH 1C1VH 2OCVB 1P2OA 3T29A 2BDIA 3PLPA 2VIDA 1O2UA 5FBEA 4ZMAH 1O3JA 2XTTB 1MKWH 3QK1A 1O3NA 2OLGA 2AMDA 1O3MA 1XUIA 1MBQA 1PJPA 1P11E 1ZTJA 1L1NA 3SJ8A 1V2LT 1GBJA 1MKXK 3LOXA 2BY6X 2ZCKP 1S0QA 2ZF0H 2PV9B 1FQ3A 4YLQH 1XUJA 2Y5GA 1GGDB 1GCTB 2BX3A 2J95A 3Q00A 2ZPRA 1PPBH 5C3NA 1GI1A 1JRTA 5CE1A 3RXCA 2C4FH 1UCYK 3I77A 2FOBA 2FX6A 1O3PB 4AGKA 5AVDA 4U01A 3CENA 3VFEA 3DUXH 4NIWA 1P10A 3RXHA 4INKA 4KGAA 5G4BA 3AASA 3ODDA 2XXLA 8LPRA 7GCHG 4ZH8A 1V6DA 3QZQA 1C4V2 5DP6A 3MNSA 4YM9A 2HPPH 1HAXB 3PWCA 1ZRBA 1AUJA 4GVUA 3VGCB 3R0FA 2TGTA 2ZO3H 1KXBA 1YF4A 5F8XA 2LPRA 4NIXA 3EYDA 2AGEX 2QXIA 4JMYA 2PSXA 2VB0A 3MI4A 2XBXA 1TAWA 2TGPZ 1IQMA 3K6ZA 1F2SE 1SGQE 4DIIH 5FAHA 1O35A 1QQ4A 1TNJA 3P70B 1JWTA 1TX6A 3NWUA 2F9UA 3HKIB 3MHWU 2D2DA 2TBSA 5C5NA 2SGDE 2FPZA 1QGFA 1OWKA 1M9UA 2FDAA 2BD3A 3M5NA 1A3BH 1C2MA 1AVXA 1IQHA 2FYQA 4DIHH 1ZJKA 1LPKB 2D8WA 1GWAA 1NZQH 1O3EA 1SGDE 2CHAC 4LZ1H 3F1SB 2OC0A 5EOKA 3TJVA 2QAAA 2AIPA 4JK5A 3TK6A 2XRCA 1XX9A 1DLKB 1L0ZA 1GI2A 1FIWA 4LXBH 1J16A 1O2QA 4LOYH 4ZKRU 1GGDC 1O3HA 2ZDKA 2AIQA 4H6TA 3V7TA 2R2WU 2BZAA 1GJAB 2D26C 3U1JB 1TNHA 2FODA 1VITF 1TPOA 2BY7X 1P9UA 2ZCHP 3H5CB 2BDYA 1ESTA 4K3JA 1BRUP 2PKAA 3MNXA 1V2JT 1FUJA 4ZROA 1IAUA 1TMBH 1UTQA 1BCUH 1BTWA 1AU8A 3GDUA 1BRCE 1N1LA 1QHRB 3KCGH 4AGJA 1EOJA 2ZHDA 1P0SH 8KME2 1DSTA 4TWYA 4BAMB 1BT7A 4X8VH 2O8UA 2AH4X 3RXLA 3ZZCA 2M5TA 1LTOA 3UPEA 7LPRA 5JBBS 1HCGA 3BTQE 1NFYA 1V2TT 2ZDAH 3SV7A 1PQAA 1WUNH 1C1NA 1D9IA 2XBVA 3V12A 1VITH 5EPNA 1O30A 1IQKA 4ABHA 2I6SA 1BITA 3BN9A 1TX7A 4ABAA 2ZDMA 4DY7B 1UJ1A 4MTBA 1NRNH 1F5LA 4I32A 3PROA 1C5QA 1MD8A 5GIBA 3LGWA 2CF9H 5LPRA 1ZSKA 5E8EH 4X6OA 3SU6A 6GCHF 1BJVA 1WU1A 1S6HA 4U30A 1P05A 1TB6H 4MG3A 2A7JA 3LC5A 3LGUA 3QX5H 5IYTA 2BMGB 1PQ7A 2ILNA 2PKAB 5A2MH 1TYNA 1VJ9U 3FP6E 1D6WA 3PMAB 4MDSA 1Y59T 4R8TB 4Y0ZE 1GI8B 2VIQA 1MKWK 2V35A 3AAVA 1V2ST 1FY4A 4I31A 1O2VA 3NPSA 2BD4A 3G01A 1W7XH 3U8OH 3FANA 3IITA 5EGMA 2FOMB 2G5NA 1ORFA 2VGCB 2O8MA 3EDXB 1KY9A 1UVSH 1P12E 3GY2A 1HAIH 4JYTA 1HXEH 1TRMA 1GJBB 3UWJH 1WTGH 4UE7H 2Z9GA 1GHAF 4JZDH 2GCHG 4BNRA 4DURA 1LVYA 5DP9A 1GMCF 4ESTE 2NWNA 2F9PA 1A5HA 1B0EA 1GI3A 2ZU3A 4M7GA 3P92A 3Q3KA 1SGNE 3EA8A 1WAYB 5DO4H 3QGJA 2IN2A 3MH6A 2HLCA 3GOVB 4Y8YA 1DDJA 4FVBA 3PMHB 1G37A 1JRSA 2G81E 3GCOA 4IBLH 1IHTH 4X8TH 4CBOA 1GHBF 1Y8TA 1C2GA 4VGCB 4CREA 3S0NA 5A0AE 3RUOA 3RXDA 1T8MA 3F9GA 1HV7A 1MH0A 5ABWA 1P04A 1N8OB 4YOIA 1O3OA 2BLOA 4B74A 3SV2H 1ACBE 1TIOA 2HOBA 1TGNA 1DUEA 1BTZA 4X2YA 1IQNA 1UK3A 1DFPA 1O2ZA 1RRKA 1BTPA 2ODQA 1H9IE 1SG8B 1ZMNA 4J1YA 2PKSB 1ZPBA 2ALVA 2ZC9H 2ZU2A 1SGFA 4YT6H 1O3FA 3A8DA 3D62A 4K69A 5C5OA 1Y3UA 2Y7ZA 1T32A 3LT3A 1F0UA 2A4RA 1NRQH 2XBWA 1OS8A 3PLBA 3E16B 4YZUA 4O3TA 4CHAC 2Z3DA 1GBCA 3BTFE 1NU9A 3UUZA 4TYDA 2EEKA 3UIRA 4X6NA 1Z1IA 1BTXA 2JH0D 4ABIA 2P8OC 1S0RA 3VXEH 3NCLA 2F9BH 1S81A 4GSOA 1OWIA 3UNRA 1WCZA 2ANYA 1MQ6A 2W3IA 4K1EA 4OS2A 3BG4C 2ZNKH 1S83A 5K0HA 1ZTKA 1W7GH 1DWEH 5EXLA 2Z9JA 1OP0A 2QN5T 2QY0B 8ESTE 1QB6A 4PROA 2BLVA 1W14U 3MU1A 2FESH 1U6QA 3ZZ8A 1ETRH 1EAUA 1NY22 1KIGH 2GT8A 2VIOA 3BG8A 3VB5A 1HJ9A 2ZFSA 1OKXA 1NRRH 1HNEE 1N6XA 2A4GA 1OWHA 1CA0C 1BUIA 1IHSH 3ZVDA 1KLIH 2WPMS 1T8OA 2HGTH 1SLUB 3UFAA 1O34A 3ZVEA 1KDQA 3M37A 1GBDA 1K28D 1H1BA 1XMNB 1V2RT 1C2DA 2HNTC 2FLBH 1MUEB 4WJG2 4WWYA 4I8GA 2ZDVH 3HGNA 1XVMA 3A80A 3SUFA 1FY5A 4JK6A 1O2GH 2ZGJA 1MTUA 3PMBB 1O3LA 4FXGH 4YT7H 4YESB 1ID5H 3RMOH 4IW4E 1GI7B 3RXEA 3NKKA 1Z71A 1GJ6A 3LH3A 2GX4A 2UUKB 1Z7KA 3ZZ5A 2HPQH 5E2PA 1HAVB 1NPMA 1DWCH 2W3KA 1ZSJA 1PQ5A 3A83A 2BY8X 5CMXH 2ZECA 3WY8A 1O2PA 5ETXA 3ZVCA 1GJDB 5C20A 1INCA 2A45B 3VGCC 1X7AC 2QXJA 4XSKU 2I6QA 3N7OA 2GMTB 1HJ8A 4DG4A 5EXMA 3C1KA 1GHWH 3SGAE 2OC8A 1FAXA 3EGKH 2FYRA 2CV3A 2XBYA 1QA0A 4X8UH 2ZKSA 3SGQE 2THFB 3S69A 2Q6FA 5F8TA 1J14A 2AS9A 2OTVA 1TNGA 4UFDH 4UDWH 1TONA 1IQFA 3RXFA 5LGOA 2AERH 2P59A 4B2BA 2BQWB 3TU7H 1TPAE 1UTMA 1UHBB 1C5OH 3ZZ9A 1O5GH 1O32A 3S7HB 1LHCH 4ISNA 1AO5A 4WVPE 2ANWA 1K1OA 2GV6A 3NUMA 1LHFH 3BF6H 3RMLH 1A61H 3VB6A 3U9AH 5EW2H 1V2KT 2XW9A 3MFJA 4I8HA 3RXVA 1WQSA 2BD5A 3BSQA 1C2FA 5HGGA 1TALA 1W10U 5L6NH 1H4WA 1EAWA 1MU8B 3UR9A 1YCPH 3SHCH 3ZYDA 1YYY1 1AN1E 4AFSA 2NU3E 2B5TB 1ZSLA 2F83A 2JKHA 3SJIA 1GVLA 3M3SA 4O3UA 3SW2B 4BXSA 3I78A 3SBKA 3ATWA 3VB3A 5EW1H 4IS5A 3T5FH 1SLVB 1V2PT 1Z8RA 4CRBA 2Z9IA 5JDUB 2ZDNA 4NSVA 1HJAB 2FS9A 1CHOF 1AWFH 1V2OT 1UTNA 1SOZA 2XCNA 3KQEA 4TPIZ 1UVOA 3QZRA 1F0SA 1XM1A 2P8OB 3EA7A 4NGAH 1TLDA 7KMEH 3EA9A 4E7RG 3B8JA 1O5AB 3BTGE 1S84A 4WXVA 1O5FH 2VWMA 2BVRH 4YO9A 1GL1A 2GDEH 1O2SA 4B2AA 3RP2A 4MQAA 1K21H 1TX8A 1UO6A 2QA9E 2WUBA 1QIXB 3MO9A 2BYAX 1GVZA 5CHAC 3ODFA 2H1UA 5TJXA 3SU2A 1TFXA 1ANCA 2P16A 4SGBE 4NFFA 4TY6A 4J2YB 2V0BA 1ZGIA 2VIWA 3IG6B 3RXTA 1QRZA 2ANMH 1AFEH 1TGSZ 1GI5A 4D7GA 3LGYA 3MWIU 3OU0A 1WOFA 2H9TH 1TBZH 1P06A 1WTHD 1CGJE 5B6OA 3KNXA 2BHGA 3TNSA 3BV9B 3E8LA 4ABEA 2BQ7B 3LDXH 1T7CA 1DSUA 4NA7A 4AFUA 1L1GA 1P57B 2QIQA 1O2XA 1WBGB 1JIRA 3GY6A 1LMWB 2XC4A 1UVUH 1DM4B 1TGCA 1ARBA 1MBMA 3BTWE 1QRWA 1O31A 1QTFA 1FI8A 4WY3A 2ZG0H 2STAE 2O8TA 1UTPA 3PV4A 4K1TA 1THRH 5F8ZA 4DW2U 4D76A 3SORA 3LH1A 2QXHA 2VGCC 2ZGHA 3FP7E 2O8LA 5DGJA 4NCYA 1S5SA 1IQLA 3Q76A 5GPIB 3RM0H 1UK2A 2F3CE 1QNJA 1MCVA 1GBHA 3O8CA 1CT4E 2ZFRH 1BRBE 1DUAA 1SBWA 3A86A 1Y3VA 1AMHA 3GCTG 2C8XB 4YOJA 1KXFA 3BEFB 1MAXA 1XUGA 1ZZZA 1YPHC 4Y7BA 1QBOA 2A0QB 5AFZH 2UWPA 3A8AA 1GBTA 1FN8A 3S9BA 3QN7A 8GCHG 1O2WA 2Z3CA 3MU5A 3SI3H 3P8FA 3URDA 2HNTE 1AIXH 1H8DH 1GHVH 1YBWA 1KTTB 4AORA 3M61U 3SNCA 2P94A 4IC5A 2Z7FE 3SHAH 1GPZA 1TBRH 4GLYA 1DY9A 1YCPK 4CRDA 1FPCH 1HXFH 1UTJA 1LVBA 1GJ8B 2Y81A 2XWAA 1PPHE 1PYTC 2EI8A 1VCWA 1TRNA 2Y80A 2PUQH 3F9HA 2XC5A 4LZ4B 1T8LA 1LO6A 1LHEH 4ZKNU 4AZ2B 2GVFA 1XVOA 1Y3XA 4K1SA 4QT8C 2BDBA 3RMNH 3T28A 4K2YA 1O2KA 2YOLA 1DY8A 4YOGA 1O2LA 2FP7B 1J8AA 4BAHB 1QL9A 2OC1A 4INHA 3U1IB 1DE7H 1KXAA 5LPFA 1CO7E 1V2MT 2BY5X 4X2VA 1TOMH 3QDZB 1S82A 3E3TA 4FU7A 2FOCA 2QF3A 3ZVAA 1D3TB 1S85A 2BZ6H 2ZEBA 4ZHMU 2WPLS 1H9LB 3UTUH 3AW1A 3VXFH 2H6MA 1ELTA 1QB1A 1KDQB 3PTNA 4AN7A 2W7SA 3K6YA 2G51A 2CXVA 5C1YA 2Z3EA 4VGCC 1C2EA 1DITH 3S7KB 4RKJB 1LQEA 1W2KH 3PWBA 2AEIH 2ZFPH 1D6RA 1EXFA 2BXTH 2BD7A 3ENSB 1ZR0A 4F49A 4ZKOU 1D3QB 1O3KA 3V3MA 3T26A 2WV5A 1BIOA 1GCTC 4X6MA 6CHAC 2VIPA 1O2NA 4X1QU 1IQEA 2FZZA 1DXPA 5FCRA 2GZ9A 3S9AA 3P8GA 1O2JA 1QURH 1YLDA 1A0HB 4WMEA 4MVNA 3SV9A 2BD9A 1LQDB 3SU0A 3EAJA 1O5CB 3SUGA 2DE8A 3JZ2B 2ALPA 1MQ5A 2ZU1A 1QR3E 2AFQB 4AYYB 3P8NA 1S6FA 2A1DB 1KSNA 1LKBA 4JZ1A 1LHDH 3A7TA 3MNCA 2PW8H 4GCHF 1SQTA 3PMJA 5FX6A 4HTCH 4HZHA 3M35A 1G30B 3A7WA 1AB9C 1C2LA 1EOLA 2WPJS 1CSOE 3QTOH 2F9OA 5F03A 2BX4A 1ELBA 3RU4E 2VNTA 4FUHA 3W94A 3KF2A 1E35B 3QTVH 1O5BB 3O8DA 3RXAA 2ZIQH 2R3YA 4Y0YE 4X6PA 1ZPZA 3A87A 1BBRE 4NWLA 4I8KA 1CVWH 4NIYA 3E90B 2YNAA 5DP5A 1KXDA 3SU3A 1SFIA 1A7SA 4ZHAA 5AHGH 3M3VA 4X0WU 3UQVA 4Y6DA 2Q6GA 1GI9B 1EUFA 4B75A 1XXDA 2XWBI 1SVPA 2VVUA 3D49H 1SR5C 1EPTB 2W7UA 1P01A 2EA3A 2GCTB 1O2MA 2W26A 4Q2KA 4CRCA 2ZU4A 1YLCA 3TITA 5PTPA 3L6PA 4MPXA 3MOCA 5DJ7A 1GBBA 2VWNA 4NA8A 1B5GH 4UFEH 4ABGA 1L2EA 3BTME 1E38B 1PPFE 3BTDE 5DP3A 1C5PA 1C1SA 1V2VT 4JZEH 3HKJB 1N6YA 1YPGH 1K9OE 1GMHF 2ZHWH 1XKAC 2GCHF 1KYNA 2Y5FA 1SC8U 2KAIB 1HBTH 5JPMH 4UEHH 1BMNH 2P3UB 2OBQA 2ODPA 2J4IA 2QV1A 4GCHG 2PR3A 1FY1A 1HAHH 3A81A 2H2ZA 1ARCA 1A2CH 4HFPB 2GGVB 1KTSB 2TGAA 3T27A 4I7YH 4AOQA 2CMYA 2QYIA 1VCPA 1HJAC 5C1UA 1ABJH 1ELVA 4XBDA 1OPHB 3Q77A 1YKTA 2G4UA 3A7ZA 2ZI2H 4KKDA 3O8RA 1L4DA 3PB1E 1BTHH 4RN6A 3HGPA 4Q80A 3UOUA 1P3EA 1Q2WA 4X1SU 4IN2A 4Y79A 3A7VA 4CRGA 1NTPA 1SPJA 1A46H 3GDVA 2FO9A 3ZVGA 5EODA 1ZPCA 1FZZA 1TRYA 4OS4A 4CBNA 1O38A 2FOHA 1GHZA 3TH4H 5J4SA 3GY7A 2SNWA 1E37B 1GMDG 1AWHB 1V3XA 4KTUA 4FU8A 3PTBA 5JBTA 2OC7A 3BTTE 2ULLA 1GHXH 3SN8A 1P09A 2PSYA 3CP7A 1PYTD 2RA0A 1A5IA 1ZRKA 1E0FD 1SB1H 1TWXB 2ZTXA 2DUCA 2SGQE 4CR5A 4OS5A 4X1NU 1O2RA 2J94A 1CBWC 1ZHMA 2B7DH 1KLTA 2SNVA 3TGJE 4ZAEA 1XKBC 3MYWA 1WYKA 1T4VH 2QXGA 3IWMA 4Y76A 1OSSA 2VINA 1OXGA 1TQ7B 1C1MA 1EX3A 4D8NA 1C9TA 3F9FA 1QB9A 3M7UA 1YGCH 1GCDA 3D65E 1RXPA 2P3FH 1FDPA 3VB4A 1SGCA 1HIAB 1KXEA 4XOJA 3LU9B 3LPRA 4TPYA 1ELCA 3FFGA 1ABIH 5DP8A 1C4Y2 1C1UH 4IMQA 1DX5M 2DE9A 4ISLA 4NIVA 4NZLA 2O9QA 1MU6B 1O3DA 1IQIA 2GV7A 5I46H 1Z8GA 3GYMA 1C1RA 2GD4B 1DS2E 1XUFA 4XBBA 5FPSA 1EAXA 2ZZUH 3V13A 5L2ZH 3RXJA 2CGAA 1VITG 3LKWA 4KTSA 3LONA 1OX1A 5BPEA 1K1PA 3A82A 3GY3A 4WXIA 3PO1C 3SI4H 4A7IB 3L3TA 2SGFE 4X2WA 1C1PA 1SGTA 1Z6EA 1QL7A 1P9SA 1K1JA 4BTIB 4CHAB 4CH2B 5EU8A 1WQVH 1GJ5H 1GI0A 2AMPA 3M5LA 1NT1A 4KELA 1AE5A 2YNBA 4A1TA 4B76A 2AYWA 2VWLA 1CT2E 1C2KA 1WSSH 4MLFB 5A8ZA 3NK8A 1YM0A 1EAIA 1HYLA 1SGPE 4UFGH 3RM2H 4CH8B 5FHTA 1B7XB 1G3CA 2ANKH 1RJXB 1UVPA 3E91A 2D1JA 4K60A 5C2ZA 1SMFE 2WUCA 1Q3XA 3M7TA 2Y6TA 2AMQA 3ZVFA 1LKAA 4JYUH 1RIWB 3TH3H 4X2XA 4ABJA 3U8RH 3SU4A 1VCQA 1MMJN 2J38A 1Q31A 3KHVA 1UCYE 4AB8A 5A8XA 1L4ZA 5EQRA 1QCPA 3B9FH 4BTUB 2FTMA 1SGEE 1O2TA 5JB8S 1BJUA 2P95A 1G2LA 1NO9H 1MAYA 1QL8A 3TK5A 2BDHA 3TIUA 1GVKB 1MTSA 1HAVA 4ZXYH 2UWOA 4Y11E 3A89A 5EQQA 1NRSH 3SZNA 4ISOA 2ZFFH 2A7HA 2WPKS 2BD8A 1TA2A 3SNBA 1IOEA 1V2QT 1C5SA 1ANBA 3JZ1B 3P95A 1XUHA 2BQ6B 3K9XB 4K8YA 3ZVBA 1C1WH 4H6SB 4INLA 1SL3A 3E0PB 5FX5A 2BY9X 3F6UH 4NSYA 3SNAA 1TQ0B 2R9PA 1B0FA 4O97A 1F92A 3Q3XA 2FXRA 4HGCA 3VPKA 3RXMA 2GMTC 1AFQB 3ZYEA 1MZDA 1DLEA 2HVXA 3BIVH 3DA9B 1PQ8A 5T6DA 4FUBA 3STIA 3KN2A 4NFEA 3SQHE 2WINI 3GISB 4OGYA 2R0KA 4Z0KA 1Y3YA 1WV7H 1O3IA 1VZQH 2NU0E 1EKBB 5FPYA 2C93B 4ABBA 5HXFA 1AZZA 1C5VA 3OY6U 2Z94A 4AFQA 4MNYA 1OOKB 1L1JA 1ZHRA 3M3TA 4U32A 1PPZA 3PM3A 1QFKH 1O3AA 4Y8XA 1ELEE 1LCYA 4AB9A 1HUTH 1J17T 4Y8ZA 2VWOA 2BLWA 3ZZ4A 3OX7U 3HPTB 2BDGA 3QUMP 4BXWA 1O2YA 4JCNA 3C27B 3TNTA 2OD3B 3ZZ7A 4MPUA 1Z8JB 2PTCE 1ELGA 4DCDA 3FAOA 1V2WT 1DT2A 2GKVE 5I25A 1ETTH 2EI6A 2QC2A 4NG9H 1DVAH 1AVWA 3P6ZB 3TVJB 5C67A 4IC6A 1VGCB 4B1TA 3ATKA 3GCNA 4I8JA 1O5DH 2PLXA 3DHKH 1CGIE 1TABE 1NFUA 4BOHA 1GBLA 1SFQB 2J92A 2GZ7A 1NM6A 3KL6A 1TNKA 1C5RA 2ZP0H 4DOQA 3B23B 3TGKE 1IQJA 4X1RU 2FI5E 2HALA 1O5EH 3UOPA 4A92A 3EE0B 3ATIA 3RLYH 2ZGBH 4CR9A 4WMFA 3QLPH 1TPPA 1ANEA 1BTYA 2PFEA 2RDLA 1D3DB 3LGVA 3LGTA 1HAYB 3VEQB 4R0IA 4A1VA 5SGAE 1A0LA 1TMTH 4RKOB 1AY6H 2B8OH 4WH6A 1KLJH 5T6FA 3SU1A 3BTHE 1O37A 1RFNA 1ZTLA 1BRAA 1Y5BT 3RXSA 3GY8A 2JH6D 2FLRH 3LC3A 4DJZB 1OWJA 1O2HA 2C90B 2RG3A 2VVCA 3MH4A 1LVMA 1Y5AT 2J2UA 4ASHA 2NU2E 1HAGE 1ELFA 2KAIA 4WMDA 2V3OH 3ESTA 2R3UA 5HMAA 2FI3E 2GTBA 5BRRE 2ZPQA 3BEUA 2ZGCA 1FY3A 1MKXH 3FP8E 2BOHB 3SU5A 1QJ7B 3T2NA 3QGNB 5FXLA 4LK4A 1UTOA 3SV8A 1MD7A 5T3HA 2ZFTA 2ZTYA 2CJIA 3E6PH 4D9QA 2UUFB 4NWKA 1P2JA 2ZWLH 1ZHPA 1EZUC 2P93A 4UFFH 1RGQA 5JB9S 4IGDA 2C8ZB 2H9EH 3CS7A 2Y5HA 4ISHH 1G3BA 1QBNA 1LDTT 2XNIA 3F68H 2EI7A 2B9LA 3M5OA 1NC6A 4GAWA 1O36A 1D4PB 1ANDA 1ZGVA 2ZQ2A 3KEEA 1TOCB 4KTCA 4UONA 1H8IH 5DP7A 3SUDA 3V0XA 1IQGA 4A6LA 1AFQC 2G52A 2VU8E 3GICB 1ZLRA 1TE0A 1ELAA 3DT0H 3LGIA 4UD9H 1K1LA 3QO6A 3NXPA 1ESAA 1W0ZU 4K5ZA 2ZHQH 1TNIA 3TJOA 2ZPSA 2SGAA 4H42U 4YTAA 4A1XA 1CBWB 1NFXA 1UVTH 2SFAA 4FUEA 4E7NA 1C1TA 3MMGA 2R2MB 3SJ9A 2BVSH 1DPOA 2BDAA 5HM9A 2WYGA 4H4FA 2H9HA 4CRAA 4MPVA 1C5ZB 2ZHFH 4I8LA 1VGCC 4ZKSU 1G3EA 4MPWA 4DT7B 3ZZDA 3L33A 4CRFA 1CT0E 3PLKA 1HAOH 2FOAA 1Z6JH 1HB0B 2OP9A 1THPB 1LVOA 3MO3A 1F5KU 5J4QA 2A2XH 1MTNB 2RCEA 1GMCG 1A1RA 4JZIA 2GDDA 3FZDA 1UK4A 1W13U 1HRTH 1SHYA 2HWLB 5AFYH 5FBIA 5GDSH 5IDKA 3H7TA 4A5TS 2B0FA 3VB7A 4FUDA 1ELDE 1HFDA 1J15A 2FOGA 1GBIA 5EG4A 1BZXE 5HYOA 3RU4T 2G5VA 1W8BH 1F7ZA 3FVFB 4IMZA 1FIZA 3A84A 5DP4A 2HRVA 4Y71A 1BTUA 3U8TH 1BMAA 1AHTH 2A5KA 4MNXA 3SNDA 2RA3A 1NS3A 3O8BA 1NN6A 1H9HE 2ODYB 3AAUA 3GYLB 3HK3B 5A8YA 2OXSA 4FU9A 1C2IA 2BTCE 1C4U2 1FXYA 3ELAH 3HK6B 1FONA 2F91A 1NFWA 1C9PA 3A8CA 3BTKE 1EPTA 3RXPA 4AFZA 1BDAA 3RC6A 4GHQA 1NROH 4Q7XA 3MU0A 1SSXA 3MU8A 1GJCB 1SQOA 1C2HA 5DG6A 4X8SH 5GCHF 1GBEA 3E0NB 3GDSA 3OSYA 1OYQA 4FUFA 1G2MA 5CHAB 2XCFA 4XBCA 1E34B 1ETSH 1AZ8A 2XC0A 2F9NA 3R3GB 4OGXA 3RXOA 1D3PB 1BBRK 1EQ9A 1HIAA 3KQDA 1P2MA 2ZTZA 3U69H 5E0JA 3ITIA 4FUIA 4YLUA 2C8YB 1AI8H 2ESTE 2G55A 1AUTC 1GBAA 1ZMJA 1EB1H 3MO6A 5E2OA 1RD3B 1C5YB 2Y82A 1PPEE 1C5XB 4IN1A 2HNTF 2GCTC 1W12U 1F0TA 2A2QH 4RSPA 1FPHH 5TCCA 4BTTB 2V6NA 1GMHG 1P03A 4U2WA 3F9EA 1RTFB 1P02A 2C3SA 2CN0H 3K65B 3SV6A 2VIVA 4XE4A 1YCPM 5E0GA 1XUKA 1GDUA 1EATA 3SQEE 3UNQA 1PPCE 4AYVB 1QA7A 2IPHA 2NU4E 2ASUB 1O3GA 3UWIA 1EZXC 2PHBA 1CHOG 1AB9B 1EP6A 2P3TB 2ZQ1A 1FAKH 3T25A 2WV4A 2BVXH 5GWZA 2A31A 4DVAU 3A88A 3RMMH 5H4IB 3LJOA 1NRPH 5A0BA 1QBVH 1RTLA 2QF0A 1OWEA 1THSH 1HAPH 4ISIH 3RC4A 4OS7A 5GCHG 3RLWH 4FUGA 1AGJA 5C1XA 5ESBA 1O0DH 4E06H 2UUYA 1AVGH 1SGYE 2A7CA 1QY6A 4Y10E 3BG4B 1A5GH 1HPGA 2SGEE 3UR6A 3MU4A 3TPIZ 1FMGA 1LPGB 4X1PU 1EPTC 1N8OC 1FV9A 2GZ8A 3KQBA 1C5NH 1T8NA 1YPEH 2OUAA 1F5RA 1T4UH 1MTVA 2NU1E 3DFLA 4K8BA 3QWCH 4AG2A 5E0HA 3GY4A 5JYIA 3UY9A 2G8TA 1VJAU 2PUXB 1MTWA 4ZUHA 3TH2H 5FCKA 2FM2A 1FJSA 2A32A 4OS1A 1A3EH 1BA8B 1BOQA 2PKSC 3AW0A 6CHAB 2K1QA 4JYVH 1NESE 1YC0A 4AG1A 2VVVA 2VH6A 1P8VC 1CHGA 3TGIE 1GHBG 1OWDA 4HI3A 1EB2A 3GCHC 4Q7ZA 3GCTF 3RDZA 1C1OA 1C1QA 5A09A 3KGPA 2C8WB 1ESBA 1BMMH 4O9VA 1O2OA 5EPYA 3DD2H 1JOUB 4SGAE 4O03A 1DANH 3OY5U 3TLOA 3AVZA 1ZJDA 2FI4E 2JH5D 3ZZ3A 3FZZA 2Q1JA 1TNLA 2AGGX 1DWBH 1TGTA 1W0YH 1E36B 1GDQA 1GHAG 1LPZB 1BBRH 2GP9B 2STBE 3P8OA 4B2CA 3P17H 1GBKA 1RIWC 1F0RA 1QJ1B 1AE8H 1UCYH 1CQQA 1AKSB 1Y3WA 3T62A 3A8BA 3SJKA 1K1NA 3KQCA 2FTLE 1O3CA 1FY8E 2R0LA 3SO3A 4WH8A 3I29A 4GPGA 3UREA 4XDEA 6LPRA 2ZA5A 4ABDA 1LHGH 2CHAB 2JETB 2FS8A 5EQSA 3RXQA 5DK1A 3LIWA 3RXRA 3BIUH 1ZYOA 1CGHA 2F9VA 2G00A
chains in the Genus database with same CATH superfamily
1K2I1 5ESTE 3M7QA 1DOJA 3ZV8A 4D7FA 2BDCA 1P2IA 2PGQB 5L2YH 3SJOA 1Y5UT 2G4TA 1CA0B 1TMUH 1V2NT 1YPJH 3Q3YA 1ZMLA 1YY3A 2A4OA 5HM2A 2ZDLA 1Z8IB 2PTNA 3PO1B 4MNWA 1C5LH 1CE5A 2ZGXH 1GG6B 2QCYA 1VR1H 2BLQA 2OQUA 1NBMD 4D9RA 1SGRE 1O3BA 2BD2A 1XXFA 1G32B 3PRDA 3ZV9A 3TK9A 1GBFA 4Z6AH 5EJZA 4BAKB 3GY5A 2ZU5A 2OBOA 1EP5A 5FPTA 1JBUH 5DKMA 9ESTA 3WWFA 2BB4A 6GCHG 1YP9A 2XYAA 8GCHF 1GG6C 1V2UT 3UNSA 1YPMH 3MTYA 4B71A 3MNBA 1EJNA 5GJ4B 1AKSA 5K7RA 2WPHS 5KGOA 3W95A 1FNIA 3U98H 2AGIX 3EQ0H 4FUJA 5A0CA 3S9CA 1AD8H 4M9FA 2QGRA 4JZFH 2WYJA 1C2JA 1NU7B 2OQ5A 3A7XA 2W5EA 3RXGA 1BHXF 4FUCA 2TPIZ 3SUEA 4OS6A 5L30H 3KIDU 1G9IE 2J9NA 3RU4D 1UTLM 1GJ7B 3ZZAA 1SI5H 2ZCLP 1HLTH 1BMLA 2VBCA 4XFQA 2VH0A 2WPIS 1G3DA 5EXNA 1NBME 2A5IA 3BEIB 1JIMA 1GI4A 1MCTA 1K1MA 3TJUA 4E05H 1ZOMA 1TBQH 4DGJA 1QQUA 3TJNA 1RS0A 2BM2A 4KP0A 1O33A 3M36A 2Z9KA 5GXPA 9LPRA 1OYTH 1OP8A 2JETC 3A7YA 2J34A 3RC5A 2IOTA 5F6MA 2IJD1 2PWXA 3ZZ6A 4TY7A 1YPLH 1DXWA 1TPSA 3OYPA 1DWDH 3F2HA 3STJA 3MH7A 1SQAA 1CA8B 5B6LA 1P2KA 2SGPE 2OINA 2Z9LA 1KXCA 2IJOB 2FOFA 3CS0A 1BQYA 2Z6BD 2EC9H 1GJ9B 2EQNA 2FIRH 1JMOH 1J9CH 2JDID 3W1EA 1RTKA 2A5AA 1O39A 5T6GA 7ESTE 2PGBB 3D23A 4ABFA 1HDTH 1G36A 1UHBA 3RXUA 2TRMA 1GHYH 1GL0E 1CU1A 1K1IA 2Y7XA 1GJ4H 3H7OA 3GCHB 1A4WH 1SLWB 4GHTA 3HATH 3OEED 1BB0B 4MNVA 1SLXB 2KZ4A 1W3CA 1AQ7A 4B73A 3ATLA 1O2IA 1HGTH 4AX9H 4WF8A 3SGBE 4Y7AA 2F43B 3SOSA 5LH8A 7GCHF 1W11U 1SOTA 1TA6A 1YPKH 1SHHB 4ZXXH 3NZIA 1P2QA 3MH5A 2Q6DA 2ZFQH 1C5TA 5AF9H 1P3CA 4BAOB 4F4OC 2TGDA 1QJ6B 1OP2A 4NA9H 4I33A 4RI0A 5HIYA 4BANB 1GDNA 2UUJB 2GT7A 2TIOA 3F2FA 2BOKA 1FLEE 4BAQB 4THNH 2ZHEH 4GUXA 3DFJA 4NZQA 1SGIB 1P2NA 2FMJA 1TGBA 6ESTA 5TCAA 3EE7A 1EZSC 1MTNC 2AHME 4TWWA 1EASA 3OTJE 5JBCS 2CF8H 3ZZBA 2A4QA 3AK5A 3RXBA 1UMAH 1HAZB 1MZAA 3RXKA 2H5DA 1PPGE 2VJ1A 3KYFA 3PYHA 3BTEE 4Q7YA 3URCA 3M5MA 1A0JA 1EJMA 1GI6A 1PFXC 5LPEA 3A85A 1BHXB 1SGFG 1FN6A 4FETA 2V3HH 3E1XB 1EJAA 2FOEA 4FVDA 4HG6A 1GMDF 2FX4A 2LNCA 1T31A 1GBMA 1Z1JA 1C5WB 1K22H 2FWWA 5DPAA 1JXPA 1C5MD 1E1QD 1UTKA 5JBAS 2BXUH 3ATMA 1C5UA 3UQOA 3K2UA 1DICA 1EZQA 2H5CA 2UWLA 2O8WA 3SNEA 1YPHE 3LJJA 4ZHLU 1QRXA 3RXIA 2FEQH 1C1VH 2OCVB 1P2OA 3T29A 2BDIA 3PLPA 2VIDA 1O2UA 5FBEA 4ZMAH 1O3JA 2XTTB 1MKWH 3QK1A 1O3NA 2K0QA 2OLGA 2AMDA 1O3MA 1XUIA 1MBQA 1WXRA 1PJPA 1P11E 1ZTJA 1L1NA 3SJ8A 1V2LT 1GBJA 1MKXK 3LOXA 2BY6X 2ZCKP 1S0QA 2ZF0H 2PV9B 1FQ3A 4YLQH 1XUJA 2Y5GA 1GGDB 1GCTB 2BX3A 2J95A 3Q00A 2ZPRA 1PPBH 5C3NA 1GI1A 1JRTA 5CE1A 3RXCA 2C4FH 4F48B 1UCYK 3I77A 2FOBA 3F0PA 2FX6A 1O3PB 4AGKA 5AVDA 4U01A 3CENA 3VFEA 3DUXH 4NIWA 1P10A 3RXHA 4INKA 4KGAA 5G4BA 3AASA 3ODDA 2XXLA 8LPRA 7GCHG 4ZH8A 1V6DA 3QZQA 1C4V2 5DP6A 3MNSA 3FOAA 4YM9A 2HPPH 1HAXB 3PWCA 2KX4A 1ZRBA 1AUJA 4GVUA 3VGCB 3R0FA 3FKSD 2TGTA 2ZO3H 1KXBA 1YF4A 5F8XA 2LPRA 4NIXA 3EYDA 2AGEX 2QXIA 4JMYA 2PSXA 2VB0A 3MI4A 2XBXA 1TAWA 2TGPZ 1IQMA 3K6ZA 1F2SE 1KMHB 1SGQE 4DIIH 5FAHA 1O35A 1QQ4A 1TNJA 3P70B 1JWTA 1TX6A 3NWUA 2F9UA 3HKIB 3MHWU 2TBSA 2D2DA 5C5NA 2SGDE 2FPZA 1QGFA 1OWKA 1M9UA 2FDAA 2BD3A 3M5NA 1OHHD 1A3BH 1C2MA 1AVXA 1IQHA 2FYQA 4DIHH 1ZJKA 1LPKB 2D8WA 1GWAA 1NZQH 1O3EA 1SGDE 2CHAC 4LZ1H 3F1SB 2OC0A 5EOKA 3TJVA 2QAAA 2AIPA 4JK5A 3TK6A 2J5UA 2XRCA 1XX9A 1DLKB 1L0ZA 1GI2A 1FIWA 4LXBH 1J16A 1O2QA 4LOYH 4ZKRU 1GGDC 1O3HA 2ZDKA 2AIQA 4H6TA 3V7TA 2KR7A 2R2WU 2BZAA 1GJAB 2D26C 3U1JB 1TNHA 2FODA 1VITF 1TPOA 2BY7X 1P9UA 4DT4A 2ZCHP 3H5CB 2BDYA 1ESTA 4K3JA 1BRUP 2PKAA 3MNXA 1V2JT 1FUJA 4ZROA 1IAUA 1W0KD 2RFKC 1TMBH 1UTQA 1BCUH 1BTWA 1AU8A 3GDUA 1BRCE 1N1LA 1QHRB 3KCGH 4AGJA 1EOJA 2ZHDA 1P0SH 8KME2 1DSTA 4TWYA 4BAMB 1BT7A 4X8VH 2O8UA 2AH4X 3RXLA 3ZZCA 2M5TA 1LTOA 3UPEA 7LPRA 5JBBS 1HCGA 3BTQE 1NFYA 1V2TT 2ZDAH 3SV7A 1PQAA 1WUNH 2M2AA 1C1NA 1D9IA 2XBVA 4Q4LA 3V12A 1VITH 5EPNA 1O30A 1IQKA 4ABHA 2I6SA 1BITA 3BN9A 1TX7A 4ABAA 2ZDMA 4DY7B 1UJ1A 3N7EA 4MTBA 1NRNH 1F5LA 4I32A 3PROA 1C5QA 1MD8A 5GIBA 3LGWA 2CF9H 5LPRA 1ZSKA 5E8EH 4X6OA 3SU6A 6GCHF 1BJVA 1WU1A 1S6HA 4U30A 1P05A 1TB6H 4MG3A 3OE7D 2A7JA 3LC5A 3MQKC 3LGUA 3QX5H 5IYTA 2BMGB 1PQ7A 2ILNA 2PKAB 5A2MH 1TYNA 1VJ9U 3FP6E 1D6WA 3PMAB 4MDSA 1Y59T 4R8TB 4Y0ZE 1GI8B 2VIQA 1MKWK 2V35A 3AAVA 1V2ST 1FY4A 4I31A 1O2VA 3NPSA 2BD4A 3G01A 1W7XH 3U8OH 3FANA 3IITA 5EGMA 2FOMB 2G5NA 1ORFA 2VGCB 2O8MA 3EDXB 1KY9A 1UVSH 1P12E 3GY2A 1HAIH 4JYTA 1HXEH 2V7QD 1TRMA 1GJBB 3UWJH 1WTGH 4UE7H 2Z9GA 1GHAF 4JZDH 2GCHG 4BNRA 4DURA 1LVYA 5DP9A 1GMCF 3DSGA 4ESTE 2NWNA 2F9PA 1A5HA 1B0EA 1GI3A 2ZU3A 4M7GA 3P92A 3Q3KA 1SGNE 3EA8A 1WAYB 5DO4H 3QGJA 2IN2A 3MH6A 2HLCA 2K8IA 3GOVB 4Y8YA 1DDJA 4FVBA 3PMHB 1G37A 1JRSA 2G81E 3GCOA 4IBLH 1IHTH 4X8TH 4CBOA 1GHBF 1Y8TA 1C2GA 4VGCB 4CREA 3S0NA 5A0AE 3RUOA 3RXDA 1T8MA 3F9GA 1HV7A 1MH0A 5ABWA 4F55A 1P04A 1N8OB 4YOIA 1O3OA 2BLOA 4B74A 3SV2H 1ACBE 1TIOA 2HOBA 1TGNA 1DUEA 1BTZA 4X2YA 1IQNA 1UK3A 1DFPA 1O2ZA 1RRKA 1BTPA 2ODQA 1H9IE 1SG8B 1ZMNA 4J1YA 2PKSB 1ZPBA 2ALVA 2ZC9H 2ZU2A 1SGFA 4YT6H 1O3FA 3A8DA 3D62A 4K69A 5C5OA 1Y3UA 4RT0A 2Y7ZA 1T32A 3LT3A 1F0UA 2A4RA 1NRQH 2XBWA 1OS8A 3PLBA 3E16B 4YZUA 4O3TA 4CHAC 2Z3DA 1GBCA 3BTFE 1NU9A 3UUZA 4TYDA 2EEKA 3UIRA 4X6NA 1Z1IA 1BTXA 2JH0D 4ABIA 2P8OC 1S0RA 3VXEH 3NCLA 2F9BH 1S81A 4GSOA 1OWIA 3UNRA 2CK3D 1WCZA 2ANYA 1MQ6A 2W3IA 4K1EA 4OS2A 3BG4C 2ZNKH 1S83A 5K0HA 1ZTKA 1W7GH 1DWEH 5EXLA 2Z9JA 1OP0A 2QN5T 2QY0B 8ESTE 1QB6A 4PROA 2BLVA 1W14U 3MU1A 2FESH 1U6QA 3ZZ8A 1ETRH 1EAUA 2J98B 1NY22 1KIGH 2GT8A 2VIOA 3BG8A 3GS9A 3VB5A 1HJ9A 2IPQX 1OKXA 2ZFSA 1NRRH 1HNEE 1N6XA 2A4GA 1OWHA 4XD7D 1CA0C 1BUIA 1IHSH 2W6JD 3ZVDA 1KLIH 2WPMS 1T8OA 2HGTH 1SLUB 3UFAA 4ZCNA 1O34A 3ZVEA 1KDQA 3M37A 1GBDA 1K28D 1H1BA 1XMNB 1V2RT 1C2DA 2HNTC 2FLBH 1MUEB 4WJG2 2KCPA 4I8GA 4WWYA 2ZDVH 3HGNA 1XVMA 3A80A 3SUFA 1FY5A 4JK6A 1O2GH 2ZGJA 1MTUA 3PMBB 1O3LA 4FXGH 4YT7H 4YESB 1ID5H 3RMOH 4IW4E 1GI7B 3RXEA 3NKKA 1Z71A 1GJ6A 3LH3A 1SKYE 2GX4A 1Z7KA 2UUKB 3ZZ5A 2HPQH 4XRNA 1HAVB 1NPMA 5E2PA 1DWCH 2W3KA 1ZSJA 1PQ5A 3A83A 2BY8X 5CMXH 2ZECA 3WY8A 1O2PA 5ETXA 3ZVCA 1GJDB 5C20A 1INCA 2A45B 3VGCC 1X7AC 2QXJA 4XSKU 2I6QA 2YMSC 2GMTB 1HJ8A 3N7OA 4DG4A 5EXMA 3C1KA 1GHWH 3SGAE 2OC8A 1FAXA 3EGKH 2FYRA 2CV3A 2XBYA 1QA0A 4X8UH 2ZKSA 3SGQE 2THFB 3KQ5A 4RT1A 3S69A 2Q6FA 5F8TA 1J14A 2KCOA 2AS9A 3DSOA 2OTVA 1TNGA 4UFDH 4UDWH 1TONA 1IQFA 3RXFA 5LGOA 2AERH 2P59A 4B2BA 2BQWB 3TU7H 1TPAE 1UTMA 1UHBB 3DCLA 3OTPA 1C5OH 3ZZ9A 1O5GH 1O32A 3S7HB 1LHCH 4ISNA 1AO5A 4WVPE 2ANWA 1K1OA 2GV6A 3NUMA 1LHFH 3BF6H 1H8ED 3RMLH 1A61H 3VB6A 3U9AH 5EW2H 1V2KT 3CNRA 2XW9A 2WV9A 3MFJA 4I8HA 3RXVA 1WQSA 2BD5A 3BSQA 1C2FA 5HGGA 1TALA 1W10U 5L6NH 1H4WA 1EAWA 1MU8B 3PRBA 3UR9A 1YCPH 3SHCH 3ZYDA 1YYY1 1AN1E 4AFSA 2NU3E 2B5TB 1ZSLA 2F83A 2JKHA 3SJIA 1GVLA 3M3SA 4O3UA 3SW2B 4BXSA 5C94A 3I78A 3SBKA 3ATWA 3VB3A 5EW1H 4IS5A 3T5FH 1SLVB 1V2PT 1Z8RA 4CRBA 2Z9IA 5JDUB 2ZDNA 4NSVA 1SQRA 1HJAB 2FS9A 1CHOF 1AWFH 1V2OT 1YWUA 1UTNA 1SOZA 2XCNA 3KQEA 4TPIZ 1UVOA 3QZRA 1F0SA 1XM1A 2P8OB 3EA7A 4NGAH 3H09A 1TLDA 7KMEH 3EA9A 4E7RG 3B8JA 1O5AB 3BTGE 1S84A 4WXVA 1O5FH 2VWMA 2BVRH 2WZQA 4YO9A 1GL1A 2GDEH 1O2SA 4B2AA 3RP2A 4MQAA 1K21H 1TX8A 1UO6A 2QA9E 2WUBA 1QIXB 3MO9A 2BYAX 4Z1MD 1GVZA 5CHAC 3ODFA 2H1UA 5TJXA 3SU2A 1TFXA 1ANCA 2P16A 4SGBE 4NFFA 4TY6A 2LP6A 2V0BA 1ZGIA 4J2YB 2VIWA 3IG6B 3RXTA 1QRZA 2ANMH 1AFEH 1TGSZ 1GI5A 4D7GA 1BMFD 3LGYA 3MWIU 3OU0A 1WOFA 2H9TH 1TBZH 1P06A 1WTHD 1CGJE 5B6OA 2JJ1D 3KNXA 2BHGA 3TNSA 3BV9B 3E8LA 4ABEA 2BQ7B 3LDXH 1T7CA 1DSUA 4NA7A 4AFUA 1K0HA 1L1GA 1P57B 2QIQA 1O2XA 1WBGB 1JIRA 3GY6A 1LMWB 2XC4A 1UVUH 1DM4B 1TGCA 1ARBA 1MBMA 3BTWE 1QRWA 1O31A 1QTFA 1FI8A 4WY3A 2ZG0H 2STAE 2O8TA 1UTPA 3PV4A 4K1TA 1THRH 2V3MA 5F8ZA 4DW2U 4D76A 3SORA 3LH1A 2QXHA 2VGCC 2ZGHA 3FP7E 2O8LA 5DGJA 4NCYA 1S5SA 1IQLA 3Q76A 5GPIB 3RM0H 1UK2A 2F3CE 1QNJA 1MCVA 3F0OA 1GBHA 3O8CA 1CT4E 2ZFRH 1BRBE 1DUAA 1SBWA 3A86A 1Y3VA 1AMHA 3GCTG 2C8XB 4YOJA 1KXFA 3BEFB 1MAXA 1XUGA 1ZZZA 1YPHC 3FO8D 4Y7BA 1QBOA 2A0QB 5AFZH 2UWPA 3A8AA 1GBTA 1FN8A 3S9BA 3QN7A 5EIYA 8GCHG 1O2WA 2Z3CA 3MU5A 3SI3H 3P8FA 3URDA 2HNTE 1AIXH 1H8DH 1GHVH 3VG8A 1YBWA 1KTTB 4AORA 3UAIC 3M61U 3SNCA 2P94A 4IC5A 2Z7FE 3SHAH 1GPZA 1TBRH 4GLYA 1DY9A 1YCPK 4CRDA 1FPCH 1HXFH 1UTJA 1LVBA 1GJ8B 2Y81A 1PPHE 1PYTC 2XWAA 2EI8A 1VCWA 1TRNA 2Y80A 2PUQH 3F9HA 2XC5A 2WHXA 5F53A 4LZ4B 1T8LA 1LO6A 1LHEH 4ZKNU 4AZ2B 2GVFA 1XVOA 1Y3XA 4K1SA 3OEHD 4QT8C 2BDBA 3RMNH 3T28A 4K2YA 1O2KA 2YOLA 1DY8A 4YOGA 1O2LA 2FP7B 1J8AA 4BAHB 1QL9A 2OC1A 4INHA 3U1IB 1DE7H 1KXAA 5LPFA 1CO7E 1V2MT 2BY5X 4X2VA 1TOMH 3QDZB 1S82A 3E3TA 4FU7A 2FOCA 2QF3A 3ZVAA 1D3TB 1S85A 2BZ6H 2ZEBA 4ZHMU 2WPLS 1H9LB 3UTUH 3AW1A 2KCYA 3VXFH 2H6MA 1ELTA 1QB1A 2QF5A 1KDQB 3PTNA 4AN7A 2W7SA 3K6YA 2G51A 2CXVA 5C1YA 2Z3EA 4VGCC 1C2EA 1DITH 3UB0A 3S7KB 4RKJB 1LQEA 1W2KH 2LELA 3PWBA 2AEIH 2ZFPH 1D6RA 1EXFA 2BXTH 2BD7A 3ENSB 1ZR0A 4F49A 4ZKOU 1D3QB 1O3KA 3V3MA 3T26A 2WV5A 1BIOA 1GCTC 4X6MA 6CHAC 2VIPA 3OFND 1O2NA 4X1QU 1IQEA 2FZZA 1DXPA 5FCRA 2GZ9A 3S9AA 3P8GA 1O2JA 1QURH 1YLDA 1A0HB 4WMEA 4MVNA 3SV9A 2BD9A 1LQDB 3SU0A 3EAJA 1O5CB 3SUGA 2DE8A 3JZ2B 2ALPA 1MQ5A 2ZU1A 1QR3E 2AFQB 4AYYB 3P8NA 1S6FA 2A1DB 1KSNA 1LKBA 4JZ1A 1LHDH 3A7TA 3MNCA 2PW8H 4GCHF 1SQTA 3PMJA 5FX6A 4HTCH 4HZHA 3M35A 1G30B 3A7WA 1AB9C 1C2LA 1EOLA 3PV2A 2WPJS 1CSOE 3QTOH 2F9OA 5F03A 2BX4A 1ELBA 3RU4E 2VNTA 4FUHA 3W94A 3KF2A 1E35B 3QTVH 1O5BB 3O8DA 3RXAA 2ZIQH 2R3YA 4Y0YE 4X6PA 1ZPZA 3A87A 1BBRE 4NWLA 4I8KA 1CVWH 4NIYA 3E90B 2YNAA 5DP5A 1KXDA 3SU3A 1SFIA 1A7SA 4ZHAA 5AHGH 3M3VA 4X0WU 3UQVA 4Y6DA 2Q6GA 1GI9B 1EUFA 4B75A 1XXDA 2PP6A 2XWBI 1SVPA 2VVUA 3D49H 1SR5C 1EPTB 2W7UA 1H8HD 1P01A 4P02A 2EA3A 2GCTB 1O2MA 2W26A 4Q2KA 4CRCA 2ZU4A 1YLCA 3TITA 5PTPA 3L6PA 4MPXA 3MOCA 5DJ7A 1GBBA 2VWNA 4NA8A 1B5GH 4UFEH 4ABGA 1L2EA 3BTME 1E38B 1PPFE 3BTDE 5DP3A 1C5PA 5DSFA 1C1SA 1V2VT 4JZEH 3HKJB 1N6YA 1YPGH 1K9OE 1GMHF 2ZHWH 1XKAC 2GCHF 1KYNA 2Y5FA 1SC8U 2KAIB 1HBTH 4FOUC 4UEHH 5JPMH 1BMNH 2P3UB 2OBQA 2ODPA 2J4IA 2QV1A 4GCHG 2PR3A 1FY1A 1HAHH 3A81A 2H2ZA 1ARCA 1A2CH 4HFPB 2HLDD 2GGVB 3DSPA 1KTSB 2TGAA 3T27A 4I7YH 4AOQA 2CMYA 1WDIA 2QYIA 1VCPA 1HJAC 5C1UA 1ABJH 1ELVA 4XBDA 1OPHB 3Q77A 1YKTA 2G4UA 3A7ZA 2ZI2H 4KKDA 3O8RA 1L4DA 3PB1E 3PV5A 1BTHH 4RN6A 3HGPA 4Q80A 3UOUA 1P3EA 1Q2WA 4X1SU 4IN2A 4Y79A 3A7VA 4CRGA 1NTPA 1SPJA 1A46H 3GDVA 2FO9A 3ZVGA 5EODA 1ZPCA 1FZZA 1TRYA 4OS4A 4CBNA 1O38A 2FOHA 1GHZA 3TH4H 5J4SA 3GY7A 2SNWA 1E37B 1GMDG 1AWHB 1V3XA 4KTUA 4FU8A 3PTBA 5JBTA 2OC7A 3BTTE 2ULLA 1GHXH 3SN8A 1P09A 2PSYA 3CP7A 1PYTD 2RA0A 1A5IA 1ZRKA 1E0FD 1SB1H 1TWXB 2ZTXA 2DUCA 2SGQE 4CR5A 4OS5A 4X1NU 1O2RA 2J94A 1CBWC 1ZHMA 4B6EA 2B7DH 1KLTA 2SNVA 3TGJE 4ZAEA 1XKBC 3MYWA 1WYKA 1T4VH 2QXGA 3IWMA 4Y76A 1OSSA 2VINA 1OXGA 1TQ7B 1C1MA 1EX3A 4D8NA 1C9TA 3F9FA 1QB9A 3M7UA 1YGCH 1GCDA 3D65E 1RXPA 2P3FH 1FDPA 3VB4A 1SGCA 1HIAB 1KXEA 4XOJA 3LU9B 3LPRA 4TPYA 1ELCA 3FFGA 1ABIH 5DP8A 1C4Y2 1C1UH 4IMQA 2HVYB 1DX5M 2DE9A 4ISLA 4NIVA 4NZLA 5IK2D 2O9QA 1MU6B 1O3DA 1IQIA 2GV7A 5I46H 1Z8GA 3GYMA 1C1RA 2GD4B 1DS2E 1XUFA 4XBBA 5FPSA 1EAXA 2ZZUH 3V13A 5L2ZH 3RXJA 5EJLA 2CGAA 1VITG 3LKWA 4KTSA 3LONA 1OX1A 5BPEA 1K1PA 3A82A 3GY3A 4WXIA 3PO1C 3SI4H 3SYJA 4A7IB 3L3TA 2SGFE 4X2WA 5FL7D 1C1PA 1SGTA 2GJGA 1Z6EA 1QL7A 1P9SA 2F4LA 1K1JA 4BTIB 4CHAB 4CH2B 5EU8A 1WQVH 1GJ5H 1GI0A 2AMPA 4TT3D 3M5LA 1NT1A 4KELA 1AE5A 2YNBA 4A1TA 4B76A 2AYWA 2RDEA 2VWLA 1CT2E 1C2KA 1WSSH 4MLFB 5A8ZA 3U28C 3NK8A 1YM0A 1EAIA 1HYLA 1SGPE 4UFGH 3RM2H 4CH8B 5FHTA 1UW7A 1B7XB 1G3CA 2ANKH 1RJXB 1UVPA 3E91A 2D1JA 4K60A 5C2ZA 1SMFE 2WUCA 1Q3XA 3M7TA 2Y6TA 2AMQA 3ZVFA 1LKAA 4JYUH 1RIWB 3TH3H 4X2XA 4ABJA 3SZEA 3U8RH 3SU4A 1VCQA 1MMJN 2J38A 1Q31A 3KHVA 1UCYE 4AB8A 4B6FA 5A8XA 1L4ZA 5EQRA 2OK5A 1QCPA 3B9FH 4BTUB 2FTMA 1SGEE 1O2TA 5JB8S 1BJUA 2P95A 1G2LA 1NO9H 1MAYA 1QL8A 3TK5A 2BDHA 3TIUA 1GVKB 1MTSA 1HAVA 4ZXYH 2UWOA 4Y11E 3A89A 5EQQA 1NRSH 2XOKD 3SZNA 5C0TA 1FX0B 4ISOA 2ZFFH 2A7HA 2WPKS 2BD8A 1TA2A 3SNBA 1IOEA 1V2QT 1C5SA 1ANBA 3JZ1B 3P95A 1XUHA 5C17A 2BQ6B 4YXWD 3K9XB 4K8YA 3ZVBA 1C1WH 4H6SB 4ACAA 4INLA 1SL3A 3E0PB 5FX5A 2BY9X 3F6UH 4NSYA 3SNAA 1TQ0B 2R9PA 1B0FA 4O97A 1F92A 3Q3XA 1COWD 2FXRA 4HGCA 3VPKA 2QE7D 3RXMA 2GMTC 1AFQB 3ZYEA 1MZDA 1DLEA 2HVXA 3BIVH 3DA9B 1PQ8A 5T6DA 4FUBA 3STIA 3KN2A 4NFEA 3SQHE 2WINI 3GISB 4OGYA 2R0KA 4Z0KA 1Y3YA 2YMSB 1WV7H 1O3IA 1VZQH 2NU0E 2JIZD 1EKBB 5FPYA 2C93B 4ABBA 5HXFA 1AZZA 1C5VA 3OY6U 2Z94A 4AFQA 2QF4A 4MNYA 1OOKB 1L1JA 1ZHRA 3M3TA 4U32A 1PPZA 3PM3A 1QFKH 1O3AA 4Y8XA 4ACBA 1ELEE 1LCYA 4AB9A 1HUTH 3KYGA 1J17T 4Y8ZA 2VWOA 2BLWA 3ZZ4A 3OX7U 3HPTB 2BDGA 3QUMP 4BXWA 1O2YA 4JCNA 3C27B 3TNTA 2OD3B 3ZZ7A 4MPUA 1Z8JB 2PTCE 2L74A 1ELGA 4DCDA 3FAOA 1V2WT 1DT2A 2GKVE 5I25A 1ETTH 2EI6A 2QC2A 4NG9H 5C0UA 1DVAH 1AVWA 3P6ZB 3TVJB 5C67A 4IC6A 1VGCB 4B1TA 3ATKA 3GCNA 4I8JA 1O5DH 2PLXA 3DHKH 1CGIE 1TABE 1NFUA 4BOHA 1GBLA 1SFQB 2J92A 2GZ7A 1NM6A 5T1VA 3KL6A 1TNKA 1C5RA 2ZP0H 4DOQA 3B23B 3TGKE 1IQJA 4X1RU 2FI5E 2HALA 1O5EH 3UOPA 4A92A 3EE0B 3ATIA 3RLYH 2ZGBH 4CR9A 4WMFA 3QLPH 1TPPA 1ANEA 1EFRD 1BTYA 2PFEA 2RDLA 1D3DB 3LGVA 3LGTA 1HAYB 3VEQB 4R0IA 4A1VA 5SGAE 1A0LA 1TMTH 4RKOB 1AY6H 2B8OH 4WH6A 1KLJH 5T6FA 2EY4C 3BTHE 1O37A 1RFNA 1ZTLA 1BRAA 3SU1A 2XNDD 1Y5BT 3RXSA 3GY8A 2JH6D 2FLRH 3LC3A 4DJZB 1OWJA 1O2HA 2C90B 2RG3A 2VVCA 3MH4A 1W0JD 1LVMA 1Y5AT 2J2UA 4ASHA 2NU2E 1HAGE 1ELFA 2KAIA 4WMDA 2V3OH 3ESTA 2R3UA 5HMAA 2FI3E 2GTBA 5BRRE 2ZPQA 3BEUA 2ZGCA 1FY3A 1MKXH 3FP8E 2BOHB 3SU5A 1QJ7B 3T2NA 3QGNB 5FXLA 4LK4A 1UTOA 3SV8A 1MD7A 5T3HA 2ZFTA 2ZTYA 2CJIA 3E6PH 4D9QA 2UUFB 4NWKA 1P2JA 2ZWLH 1ZHPA 1EZUC 2P93A 4UFFH 1RGQA 5JB9S 4IGDA 2C8ZB 2H9EH 3CS7A 2Y5HA 4ISHH 1G3BA 4TSFD 1QBNA 1LDTT 2XNIA 3F68H 2EI7A 2B9LA 3M5OA 1NC6A 3WWBA 4GAWA 1O36A 1D4PB 5DN6D 1ANDA 1ZGVA 2ZQ2A 3KEEA 1TOCB 4KTCA 4UONA 1H8IH 5DP7A 3SUDA 3V0XA 1IQGA 4A6LA 1AFQC 2G52A 1E79D 2VU8E 3GICB 1ZLRA 1TE0A 1ELAA 5HKKD 3DT0H 3LGIA 4UD9H 1K1LA 3QO6A 3NXPA 1ESAA 5CHBA 1W0ZU 4K5ZA 2ZHQH 1TNIA 3TJOA 1S6LA 2ZPSA 2SGAA 4H42U 4YTAA 4A1XA 1CBWB 1NFXA 1UVTH 2SFAA 4FUEA 4E7NA 1C1TA 3MMGA 2R2MB 3SJ9A 2BVSH 1DPOA 2BDAA 5HM9A 2WYGA 4H4FA 2H9HA 4CRAA 4MPVA 1C5ZB 2ZHFH 2KCAA 4I8LA 1VGCC 3ZIAD 4ZKSU 1G3EA 4MPWA 4DT7B 3ZZDA 3L33A 1YLNA 4CRFA 1CT0E 3F3BA 3PLKA 1HAOH 2FOAA 1Z6JH 1HB0B 2OP9A 1THPB 1LVOA 3MO3A 1F5KU 5J4QA 2A2XH 1MTNB 2RCEA 1GMCG 1A1RA 4JZIA 3NRLA 2GDDA 3FZDA 1UK4A 1W13U 1HRTH 1SHYA 2HWLB 3N7DA 5AFYH 5FBIA 5GDSH 5IDKA 3H7TA 4A5TS 3WW7A 2B0FA 3VB7A 4FUDA 1ELDE 1HFDA 2W6ID 1J15A 2FOGA 1GBIA 5EG4A 1BZXE 5HYOA 3RU4T 2G5VA 2YMSD 1W8BH 1F7ZA 3FVFB 4IMZA 1FIZA 3A84A 5DP4A 2HRVA 4Y71A 1BTUA 3U8TH 1BMAA 1AHTH 2A5KA 4MNXA 5KEDA 3SNDA 2RA3A 1NS3A 3O8BA 1NN6A 1H9HE 2ODYB 3AAUA 3GYLB 3HK3B 5A8YA 2OXSA 4FU9A 1C2IA 2BTCE 1C4U2 1FXYA 3ELAH 3HK6B 1FONA 2F91A 3FN8A 5GNDA 1NFWA 1VKYA 1C9PA 3A8CA 3BTKE 1EPTA 3RXPA 4AFZA 1BDAA 3OAAD 4GHQA 3RC6A 1NROH 4Q7XA 3MU0A 1SSXA 3MU8A 1GJCB 1SQOA 1C2HA 5DG6A 4X8SH 4Q63A 1GBEA 5GCHF 1MABB 3E0NB 3GDSA 3OSYA 1OYQA 4FUFA 1G2MA 5CHAB 2XCFA 4XBCA 1E34B 1ETSH 1AZ8A 2XC0A 2F9NA 3R3GB 4OGXA 3RXOA 1D3PB 1BBRK 1EQ9A 1HIAA 3KQDA 1P2MA 2ZTZA 3U69H 5E0JA 2KFWA 3ITIA 4FUIA 4YLUA 2C8YB 1AI8H 2ESTE 2G55A 4AC9A 1AUTC 1GBAA 1ZMJA 1EB1H 3MO6A 5E2OA 1RD3B 1C5YB 2Y82A 1PPEE 1C5XB 4IN1A 2HNTF 2GCTC 1W12U 1F0TA 2A2QH 4RSPA 1FPHH 5TCCA 4BTTB 2V6NA 1GMHG 2J97A 1P03A 4U2WA 3F9EA 1RTFB 1P02A 2C3SA 2CN0H 3K65B 3SV6A 2VIVA 4XE4A 1YCPM 5E0GA 1XUKA 1GDUA 1EATA 3SQEE 3UNQA 1PPCE 4AYVB 1QA7A 2IPHA 2NU4E 2ASUB 1O3GA 3UWIA 1EZXC 2PHBA 1CHOG 5HIZA 1AB9B 1EP6A 2P3TB 2ZQ1A 1FAKH 3T25A 2BVXH 2WV4A 5GWZA 2A31A 4DVAU 3A88A 3RMMH 5H4IB 3LJOA 1NRPH 5A0BA 2WPDD 1QBVH 1RTLA 2QF0A 1OWEA 1THSH 1HAPH 2WSSD 4ISIH 3RC4A 4OS7A 5GCHG 3RLWH 4FUGA 1AGJA 5C1XA 5ESBA 1O0DH 4E06H 2UUYA 1AVGH 5KECA 1SGYE 2A7CA 1QY6A 4Y10E 3BG4B 1A5GH 1HPGA 2SGEE 3UR6A 3MU4A 3TPIZ 1FMGA 1LPGB 4X1PU 1EPTC 1N8OC 1FV9A 2GZ8A 3KQBA 1C5NH 1T8NA 1YPEH 2OUAA 1F5RA 1T4UH 1MTVA 2NU1E 3DFLA 4K8BA 3QWCH 4AG2A 5E0HA 3F2GA 3GY4A 5JYIA 3UY9A 2G8TA 1VJAU 2PUXB 1MTWA 4ZUHA 3TH2H 5FCKA 2FM2A 1FJSA 2A32A 4OS1A 1A3EH 1BA8B 1BOQA 2PKSC 3AW0A 6CHAB 2K1QA 4JYVH 1NESE 1YC0A 5EJ1A 4AG1A 2VVVA 2VH6A 1P8VC 1CHGA 3TGIE 1GHBG 1OWDA 4HI3A 1EB2A 3GCHC 4ASUD 4Q7ZA 3GCTF 3RDZA 1C1OA 1C1QA 5A09A 3KGPA 2C8WB 1ESBA 2J98A 1BMMH 4OM9A 4O9VA 1O2OA 4I86A 5EPYA 3DD2H 1JOUB 4SGAE 4O03A 1DANH 1E1RD 3OY5U 3TLOA 3AVZA 2L6OA 1ZJDA 2FI4E 2JH5D 3ZZ3A 3FZZA 2Q1JA 1TNLA 2AGGX 1DWBH 1TGTA 2KM0A 1W0YH 1E36B 1GDQA 1GHAG 1LPZB 1BBRH 2GP9B 2STBE 3P8OA 4B2CA 3P17H 1QZ8A 1GBKA 1RIWC 1F0RA 1QJ1B 3N99A 1AE8H 1UCYH 1CQQA 1AKSB 1Y3WA 3T62A 3A8BA 3SJKA 1K1NA 3KQCA 2FTLE 1O3CA 1FY8E 2JJ2D 2R0LA 3SO3A 4WH8A 3I29A 4GPGA 4P00A 3UREA 4XDEA 6LPRA 2ZA5A 4ABDA 1LHGH 2CHAB 2JETB 2FS8A 5EQSA 3RXQA 5DK1A 3LIWA 3RXRA 3BIUH 1ZYOA 1CGHA 2F9VA 5CDFE 2G00A
chains in the Genus database with same CATH topology
1K2I1 5ESTE 3M7QA 1DOJA 3ZV8A 4D7FA 2BDCA 1P2IA 2PGQB 5L2YH 3SJOA 1Y5UT 2G4TA 1CA0B 1TMUH 1V2NT 1YPJH 3Q3YA 1ZMLA 2A4OA 5HM2A 2ZDLA 1Z8IB 2PTNA 3PO1B 4MNWA 1C5LH 1CE5A 2ZGXH 1GG6B 2QCYA 1VR1H 2BLQA 2OQUA 4D9RA 1SGRE 1O3BA 2BD2A 1XXFA 1G32B 3ZV9A 3TK9A 1GBFA 4Z6AH 4BAKB 3GY5A 2ZU5A 2OBOA 1EP5A 5FPTA 1JBUH 5DKMA 9ESTA 2BB4A 6GCHG 1YP9A 2XYAA 8GCHF 1GG6C 1V2UT 3UNSA 1YPMH 3MTYA 4B71A 3MNBA 1EJNA 5GJ4B 1AKSA 5K7RA 2WPHS 3W95A 1FNIA 3U98H 2AGIX 3EQ0H 4FUJA 5A0CA 3S9CA 1AD8H 2QGRA 4JZFH 2WYJA 1C2JA 1NU7B 2OQ5A 3A7XA 2W5EA 3RXGA 1BHXF 4FUCA 2TPIZ 3SUEA 4OS6A 5L30H 3KIDU 1G9IE 2J9NA 3RU4D 1UTLM 1GJ7B 3ZZAA 1SI5H 2ZCLP 1HLTH 1BMLA 4XFQA 2VH0A 2WPIS 1G3DA 5EXNA 2A5IA 3BEIB 1JIMA 1GI4A 1MCTA 1K1MA 3TJUA 4E05H 1ZOMA 1TBQH 4DGJA 1QQUA 3TJNA 1RS0A 2BM2A 4KP0A 1O33A 3M36A 2Z9KA 5GXPA 9LPRA 1OYTH 1OP8A 2JETC 3A7YA 2J34A 3RC5A 2IOTA 5F6MA 2PWXA 3ZZ6A 4TY7A 1YPLH 1DXWA 1TPSA 3OYPA 1DWDH 3STJA 3MH7A 1SQAA 1CA8B 1P2KA 2SGPE 2OINA 2Z9LA 1KXCA 2IJOB 2FOFA 3CS0A 1BQYA 2Z6BD 2EC9H 1GJ9B 2FIRH 1JMOH 1J9CH 7ESTE 1RTKA 2A5AA 1O39A 5T6GA 2PGBB 3D23A 4ABFA 1HDTH 1G36A 1UHBA 3RXUA 2TRMA 1GHYH 1GL0E 1CU1A 1K1IA 2Y7XA 1GJ4H 3H7OA 3GCHB 1A4WH 1SLWB 4GHTA 3HATH 1BB0B 4MNVA 1SLXB 1W3CA 1AQ7A 4B73A 3ATLA 1O2IA 1HGTH 4AX9H 4WF8A 3SGBE 4Y7AA 3SOSA 5LH8A 7GCHF 1W11U 1SOTA 1TA6A 1YPKH 1SHHB 4ZXXH 3NZIA 1P2QA 3MH5A 2Q6DA 2ZFQH 1C5TA 5AF9H 1P3CA 4BAOB 4F4OC 2TGDA 1QJ6B 1OP2A 4NA9H 4I33A 4BANB 1GDNA 2UUJB 2GT7A 2TIOA 2BOKA 1FLEE 4BAQB 4THNH 2ZHEH 4GUXA 3DFJA 4NZQA 1SGIB 1P2NA 2FMJA 1TGBA 6ESTA 5TCAA 1EZSC 1MTNC 4TWWA 1EASA 3OTJE 5JBCS 2CF8H 3ZZBA 2A4QA 3RXBA 1UMAH 1HAZB 1MZAA 3RXKA 2H5DA 1PPGE 2VJ1A 3PYHA 3BTEE 4Q7YA 3URCA 3M5MA 1A0JA 1EJMA 1GI6A 1PFXC 5LPEA 3A85A 1BHXB 1SGFG 1FN6A 2V3HH 3E1XB 1EJAA 2FOEA 4FVDA 1GMDF 2FX4A 2LNCA 1T31A 1GBMA 1Z1JA 1C5WB 1K22H 2FWWA 5DPAA 1JXPA 1C5MD 1UTKA 5JBAS 2BXUH 3ATMA 1C5UA 3UQOA 3K2UA 1DICA 1EZQA 2H5CA 2UWLA 2O8WA 3SNEA 1YPHE 3LJJA 4ZHLU 1QRXA 3RXIA 2FEQH 1C1VH 2OCVB 1P2OA 3T29A 2BDIA 3PLPA 2VIDA 1O2UA 5FBEA 4ZMAH 1O3JA 2XTTB 1MKWH 3QK1A 1O3NA 2OLGA 2AMDA 1O3MA 1XUIA 1MBQA 1PJPA 1P11E 1ZTJA 1L1NA 3SJ8A 1V2LT 1GBJA 1MKXK 3LOXA 2BY6X 2ZCKP 1S0QA 2ZF0H 2PV9B 1FQ3A 4YLQH 1XUJA 2Y5GA 1GGDB 1GCTB 2BX3A 2J95A 3Q00A 2ZPRA 1PPBH 5C3NA 1GI1A 1JRTA 5CE1A 3RXCA 2C4FH 1UCYK 3I77A 2FOBA 2FX6A 1O3PB 4AGKA 5AVDA 4U01A 3CENA 3VFEA 3DUXH 4NIWA 1P10A 3RXHA 4INKA 4KGAA 5G4BA 3AASA 3ODDA 2XXLA 8LPRA 7GCHG 4ZH8A 1V6DA 3QZQA 1C4V2 5DP6A 3MNSA 4YM9A 2HPPH 1HAXB 3PWCA 1ZRBA 1AUJA 4GVUA 3VGCB 3R0FA 2TGTA 2ZO3H 1KXBA 1YF4A 5F8XA 2LPRA 4NIXA 3EYDA 2AGEX 2QXIA 4JMYA 2PSXA 2VB0A 3MI4A 2XBXA 1TAWA 2TGPZ 1IQMA 3K6ZA 1F2SE 1SGQE 4DIIH 5FAHA 1O35A 1QQ4A 1TNJA 3P70B 1JWTA 1TX6A 3NWUA 2F9UA 3HKIB 3MHWU 2D2DA 2TBSA 5C5NA 2SGDE 2FPZA 1QGFA 1OWKA 1M9UA 2FDAA 2BD3A 3M5NA 1A3BH 1C2MA 1AVXA 1IQHA 2FYQA 4DIHH 1ZJKA 1LPKB 2D8WA 1GWAA 1NZQH 1O3EA 1SGDE 2CHAC 4LZ1H 3F1SB 2OC0A 5EOKA 3TJVA 2QAAA 2AIPA 4JK5A 3TK6A 2XRCA 1XX9A 1DLKB 1L0ZA 1GI2A 1FIWA 4LXBH 1J16A 1O2QA 4LOYH 4ZKRU 1GGDC 1O3HA 2ZDKA 2AIQA 4H6TA 3V7TA 2R2WU 2BZAA 1GJAB 2D26C 3U1JB 1TNHA 2FODA 1VITF 1TPOA 2BY7X 1P9UA 2ZCHP 3H5CB 2BDYA 1ESTA 4K3JA 1BRUP 2PKAA 3MNXA 1V2JT 1FUJA 4ZROA 1IAUA 1TMBH 1UTQA 1BCUH 1BTWA 1AU8A 3GDUA 1BRCE 1N1LA 1QHRB 3KCGH 4AGJA 1EOJA 2ZHDA 1P0SH 8KME2 1DSTA 4TWYA 4BAMB 1BT7A 4X8VH 2O8UA 2AH4X 3RXLA 3ZZCA 2M5TA 1LTOA 3UPEA 7LPRA 5JBBS 1HCGA 3BTQE 1NFYA 1V2TT 2ZDAH 3SV7A 1PQAA 1WUNH 1C1NA 1D9IA 2XBVA 3V12A 1VITH 5EPNA 1O30A 1IQKA 4ABHA 2I6SA 1BITA 3BN9A 1TX7A 4ABAA 2ZDMA 4DY7B 1UJ1A 4MTBA 1NRNH 1F5LA 4I32A 3PROA 1C5QA 1MD8A 5GIBA 3LGWA 2CF9H 5LPRA 1ZSKA 5E8EH 4X6OA 3SU6A 6GCHF 1BJVA 1WU1A 1S6HA 4U30A 1P05A 1TB6H 4MG3A 2A7JA 3LC5A 3LGUA 3QX5H 5IYTA 2BMGB 1PQ7A 2ILNA 2PKAB 5A2MH 1TYNA 1VJ9U 3FP6E 1D6WA 3PMAB 4MDSA 1Y59T 4R8TB 4Y0ZE 1GI8B 2VIQA 1MKWK 2V35A 3AAVA 1V2ST 1FY4A 4I31A 1O2VA 3NPSA 2BD4A 3G01A 1W7XH 3U8OH 3FANA 3IITA 5EGMA 2FOMB 2G5NA 1ORFA 2VGCB 2O8MA 3EDXB 1KY9A 1UVSH 1P12E 3GY2A 1HAIH 4JYTA 1HXEH 1TRMA 1GJBB 3UWJH 1WTGH 4UE7H 2Z9GA 1GHAF 4JZDH 2GCHG 4BNRA 4DURA 1LVYA 5DP9A 1GMCF 4ESTE 2NWNA 2F9PA 1A5HA 1B0EA 1GI3A 2ZU3A 4M7GA 3P92A 3Q3KA 1SGNE 3EA8A 1WAYB 5DO4H 3QGJA 2IN2A 3MH6A 2HLCA 3GOVB 4Y8YA 1DDJA 4FVBA 3PMHB 1G37A 1JRSA 2G81E 3GCOA 4IBLH 1IHTH 4X8TH 4CBOA 1GHBF 1Y8TA 1C2GA 4VGCB 4CREA 3S0NA 5A0AE 3RUOA 3RXDA 1T8MA 3F9GA 1HV7A 1MH0A 5ABWA 1P04A 1N8OB 4YOIA 1O3OA 2BLOA 4B74A 3SV2H 1ACBE 1TIOA 2HOBA 1TGNA 1DUEA 1BTZA 4X2YA 1IQNA 1UK3A 1DFPA 1O2ZA 1RRKA 1BTPA 2ODQA 1H9IE 1SG8B 1ZMNA 4J1YA 2PKSB 1ZPBA 2ALVA 2ZC9H 2ZU2A 1SGFA 4YT6H 1O3FA 3A8DA 3D62A 4K69A 5C5OA 1Y3UA 2Y7ZA 1T32A 3LT3A 1F0UA 2A4RA 1NRQH 2XBWA 1OS8A 3PLBA 3E16B 4YZUA 4O3TA 4CHAC 2Z3DA 1GBCA 3BTFE 1NU9A 3UUZA 4TYDA 2EEKA 3UIRA 4X6NA 1Z1IA 1BTXA 2JH0D 4ABIA 2P8OC 1S0RA 3VXEH 3NCLA 2F9BH 1S81A 4GSOA 1OWIA 3UNRA 1WCZA 2ANYA 1MQ6A 2W3IA 4K1EA 4OS2A 3BG4C 2ZNKH 1S83A 5K0HA 1ZTKA 1W7GH 1DWEH 5EXLA 2Z9JA 1OP0A 2QN5T 2QY0B 8ESTE 1QB6A 4PROA 2BLVA 1W14U 3MU1A 2FESH 1U6QA 3ZZ8A 1ETRH 1EAUA 1NY22 1KIGH 2GT8A 2VIOA 3BG8A 3VB5A 1HJ9A 2ZFSA 1OKXA 1NRRH 1HNEE 1N6XA 2A4GA 1OWHA 1CA0C 1BUIA 1IHSH 3ZVDA 1KLIH 2WPMS 1T8OA 2HGTH 1SLUB 3UFAA 1O34A 3ZVEA 1KDQA 3M37A 1GBDA 1K28D 1H1BA 1XMNB 1V2RT 1C2DA 2HNTC 2FLBH 1MUEB 4WJG2 4WWYA 4I8GA 2ZDVH 3HGNA 1XVMA 3A80A 3SUFA 1FY5A 4JK6A 1O2GH 2ZGJA 1MTUA 3PMBB 1O3LA 4FXGH 4YT7H 4YESB 1ID5H 3RMOH 4IW4E 1GI7B 3RXEA 3NKKA 1Z71A 1GJ6A 3LH3A 2GX4A 2UUKB 1Z7KA 3ZZ5A 2HPQH 5E2PA 1HAVB 1NPMA 1DWCH 2W3KA 1ZSJA 1PQ5A 3A83A 2BY8X 5CMXH 2ZECA 3WY8A 1O2PA 5ETXA 3ZVCA 1GJDB 5C20A 1INCA 2A45B 3VGCC 1X7AC 2QXJA 4XSKU 2I6QA 3N7OA 2GMTB 1HJ8A 4DG4A 5EXMA 3C1KA 1GHWH 3SGAE 2OC8A 1FAXA 3EGKH 2FYRA 2CV3A 2XBYA 1QA0A 4X8UH 2ZKSA 3SGQE 2THFB 3S69A 2Q6FA 5F8TA 1J14A 2AS9A 2OTVA 1TNGA 4UFDH 4UDWH 1TONA 1IQFA 3RXFA 5LGOA 2AERH 2P59A 4B2BA 2BQWB 3TU7H 1TPAE 1UTMA 1UHBB 1C5OH 3ZZ9A 1O5GH 1O32A 3S7HB 1LHCH 4ISNA 1AO5A 4WVPE 2ANWA 1K1OA 2GV6A 3NUMA 1LHFH 3BF6H 3RMLH 1A61H 3VB6A 3U9AH 5EW2H 1V2KT 2XW9A 3MFJA 4I8HA 3RXVA 1WQSA 2BD5A 3BSQA 1C2FA 5HGGA 1TALA 1W10U 5L6NH 1H4WA 1EAWA 1MU8B 3UR9A 1YCPH 3SHCH 3ZYDA 1YYY1 1AN1E 4AFSA 2NU3E 2B5TB 1ZSLA 2F83A 2JKHA 3SJIA 1GVLA 3M3SA 4O3UA 3SW2B 4BXSA 3I78A 3SBKA 3ATWA 3VB3A 5EW1H 4IS5A 3T5FH 1SLVB 1V2PT 1Z8RA 4CRBA 2Z9IA 5JDUB 2ZDNA 4NSVA 1HJAB 2FS9A 1CHOF 1AWFH 1V2OT 1UTNA 1SOZA 2XCNA 3KQEA 4TPIZ 1UVOA 3QZRA 1F0SA 1XM1A 2P8OB 3EA7A 4NGAH 1TLDA 7KMEH 3EA9A 4E7RG 3B8JA 1O5AB 3BTGE 1S84A 4WXVA 1O5FH 2VWMA 2BVRH 4YO9A 1GL1A 2GDEH 1O2SA 4B2AA 3RP2A 4MQAA 1K21H 1TX8A 1UO6A 2QA9E 2WUBA 1QIXB 3MO9A 2BYAX 1GVZA 5CHAC 3ODFA 2H1UA 5TJXA 3SU2A 1TFXA 1ANCA 2P16A 4SGBE 4NFFA 4TY6A 4J2YB 2V0BA 1ZGIA 2VIWA 3IG6B 3RXTA 1QRZA 2ANMH 1AFEH 1TGSZ 1GI5A 4D7GA 3LGYA 3MWIU 3OU0A 1WOFA 2H9TH 1TBZH 1P06A 1WTHD 1CGJE 5B6OA 3KNXA 2BHGA 3TNSA 3BV9B 3E8LA 4ABEA 2BQ7B 3LDXH 1T7CA 1DSUA 4NA7A 4AFUA 1L1GA 1P57B 2QIQA 1O2XA 1WBGB 1JIRA 3GY6A 1LMWB 2XC4A 1UVUH 1DM4B 1TGCA 1ARBA 1MBMA 3BTWE 1QRWA 1O31A 1QTFA 1FI8A 4WY3A 2ZG0H 2STAE 2O8TA 1UTPA 3PV4A 4K1TA 1THRH 5F8ZA 4DW2U 4D76A 3SORA 3LH1A 2QXHA 2VGCC 2ZGHA 3FP7E 2O8LA 5DGJA 4NCYA 1S5SA 1IQLA 3Q76A 5GPIB 3RM0H 1UK2A 2F3CE 1QNJA 1MCVA 1GBHA 3O8CA 1CT4E 2ZFRH 1BRBE 1DUAA 1SBWA 3A86A 1Y3VA 1AMHA 3GCTG 2C8XB 4YOJA 1KXFA 3BEFB 1MAXA 1XUGA 1ZZZA 1YPHC 4Y7BA 1QBOA 2A0QB 5AFZH 2UWPA 3A8AA 1GBTA 1FN8A 3S9BA 3QN7A 8GCHG 1O2WA 2Z3CA 3MU5A 3SI3H 3P8FA 3URDA 2HNTE 1AIXH 1H8DH 1GHVH 1YBWA 1KTTB 4AORA 3M61U 3SNCA 2P94A 4IC5A 2Z7FE 3SHAH 1GPZA 1TBRH 4GLYA 1DY9A 1YCPK 4CRDA 1FPCH 1HXFH 1UTJA 1LVBA 1GJ8B 2Y81A 2XWAA 1PPHE 1PYTC 2EI8A 1VCWA 1TRNA 2Y80A 2PUQH 3F9HA 2XC5A 4LZ4B 1T8LA 1LO6A 1LHEH 4ZKNU 4AZ2B 2GVFA 1XVOA 1Y3XA 4K1SA 4QT8C 2BDBA 3RMNH 3T28A 4K2YA 1O2KA 2YOLA 1DY8A 4YOGA 1O2LA 2FP7B 1J8AA 4BAHB 1QL9A 2OC1A 4INHA 3U1IB 1DE7H 1KXAA 5LPFA 1CO7E 1V2MT 2BY5X 4X2VA 1TOMH 3QDZB 1S82A 3E3TA 4FU7A 2FOCA 2QF3A