4D8NA

Human kallikrein 6 inhibitors with a para-amidobenzylanmine p1 group carry a high binding efficiency
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
222
structure length
222
Chain Sequence
LVHGGPCDKTSHPYQAALYTSGHLLCGGVLIHPLWVLTAAHCKKPNLQVFLGKHNLGQQESSQEQSSVVRAVIHPDYDAASHDQDIMLLRLARPAKLSELIQPLPLERDCSAQTTSCHILGWGKTADGDFPDTIQCAYIHLVSREECEHAYPGQITQNMLCAGDEKYGKDSCQGDSGGPLVCGDHLRGLVSWGNIPCGSKEKPGVYTNVCRYTNWIQKTIQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Kallikrein-6
publication title Human kallikrein 6 inhibitors with a para-amidobenzylanmine P1 group identified through virtual screening.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 52
structure length 222
sequence length 222
ec nomenclature ec 3.4.21.-:
pdb deposition date 2012-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4d8nA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4d8nA02
1C1PA 1AZ8A 1HAVB 4AB9A 1OYTH 1O2XA 1SOZA 1GVZA 1QCPA 1TGNA 1ZSJA 1AI8H 2YNAA 1BRBE 2AEIH 1O3BA 1CT2E 2FOHA 2W26A 2XCFA 3ZZDA 1E37B 1TONA 3EA9A 4JZ1A 4NIXA 5T6GA 4FVDA 2B7DH 1O5GH 2BDHA 2ZGXH 4I8HA 3UREA 3UIRA 3SJKA 1BMNH 3VB4A 1ETSH 1SR5C 1UCYE 1NFXA 1RTFB 4Y10E 1PQ7A 4ABJA 1OP2A 3S9CA 2FP7B 4B73A 2BLWA 2B8OH 2HNTC 1SOTA 3B23B 1E35B 3D23A 4K60A 1AKSA 1NESE 1SI5H 1SSXA 4X8TH 2JETC 2Y81A 3LH3A 2QIQA 1GBMA 1C5PA 3A84A 1TAWA 2Y82A 3TPIZ 4NZQA 4X2WA 3OYPA 3M5MA 1TALA 1D6RA 1KLTA 2BDGA 2G55A 2QAAA 3SV9A 3K6ZA 4NGAH 3BEUA 1FQ3A 1VCWA 1BJUA 1C1OA 3MYWA 5FAHA 1AGJA 1V2JT 4WJG2 5DP5A 1MZAA 4UFFH 4DIIH 1YCPK 2Z7FE 1L2EA 4Y0YE 1YM0A 2EI6A 1AFQB 1YPMH 1TNKA 2GZ7A 1O3FA 1EJMA 1XUGA 1DT2A 1TRMA 1SGFA 2VVVA 1THSH 5GCHG 3SU3A 2Z6BD 3BG4B 5L2ZH 4JZEH 3E91A 3A83A 2TGDA 4E05H 3LU9B 1C4V2 3D65E 1ELFA 1NFWA 1GBCA 2Y80A 1YP9A 4AGJA 3DT0H 1KDQA 3KQDA 5DO4H 2F9NA 5EODA 2F9UA 1LQEA 1EB1H 2PGQB 2GZ8A 4YOGA 2H2ZA 2ZF0H 4LZ1H 2BD7A 6GCHG 1RGQA 3GYLB 4YOIA 1GI1A 5K7RA 4ISOA 1H1BA 1VITG 1GG6B 1WOFA 1BMMH 1AWHB 1XVMA 3A7ZA 1KXFA 3MNXA 2FZZA 2G4TA 1AUJA 1GJDB 1MKXH 3ZYEA 5IYTA 1LKAA 4KTSA 3FANA 2A2XH 3ATIA 1IAUA 3BIVH 1Z71A 1SLUB 4BTIB 2ZHQH 2QN5T 1BQYA 2ILNA 3P8GA 3PROA 5L6NH 1TA6A 5C1XA 3P8FA 3TK6A 4X6NA 2PKSB 1CVWH 3QGJA 2H9TH 1GHZA 1UTMA 2AGEX 1A0JA 4OS5A 1NPMA 3P92A 4DURA 2G5NA 4BTUB 3P8NA 2H5CA 3M3TA 1DXPA 1Y59T 4MQAA 1YLCA 4SGBE 1N6XA 3RLYH 2VVUA 1GI8B 4VGCB 1BTYA 1K9OE 3E8LA 5A2MH 5E0GA 2R9PA 2VIVA 1ANBA 3LPRA 1DANH 1VGCB 4BAMB 3I29A 5GJ4B 2Z9KA 1O3MA 2A0QB 4YT6H 1C1MA 3RXDA 5FCRA 4FUCA 1BTUA 3K9XB 1T8NA 1V2LT 1KXEA 3GYMA 2BZ6H 5A0BA 3ZVBA 3UR6A 2AMDA 1S6HA 2G51A 4D8NA 1HLTH 1YKTA 1P57B 1FIWA 4RN6A 1OWEA 3EA7A 4WXIA 1XUKA 1KYNA 2ZO3H 1FPCH 4NA8A 1O2ZA 3T5FH 1RJXB 3PMHB 1A5HA 2TPIZ 2ANMH 1GJ8B 1G2MA 3KL6A 1MCTA 3BTME 3SJIA 1MKWH 1C5YB 2HGTH 2W7UA 2OC1A 2ZCKP 2ZNKH 3CENA 3GDVA 5GCHF 2OUAA 3AAUA 3BTEE 4K1EA 2IN2A 1CHOG 2BDBA 3MH7A 1FY3A 3ZVEA 2FOAA 3DFJA 3M7QA 2ZTXA 5DP4A 4UFDH 1FI8A 2VU8E 5IDKA 1V2UT 4MVNA 2CV3A 3RU4D 3F9GA 2HNTE 2I6QA 1VCPA 3ZZBA 2AFQB 2F9VA 3N7OA 1O2PA 3BV9B 2RA3A 3ELAH 3RXMA 1RIWB 1IQHA 2P8OC 5ESTE 1ARCA 5L30H 2AMQA 1VITF 1O2KA 3Q3KA 3G01A 5C1YA 2LNCA 1V2PT 1ZMJA 1HIAB 1IQMA 1P09A 3M7TA 3LONA 6CHAC 4B2CA 2GV7A 2P3FH 2ZGCA 1UHBB 1Z7KA 1GI5A 1YCPH 3KGPA 4ZH8A 1MZDA 3RMOH 1O5DH 2OXSA 3BTKE 2Z3EA 4IMQA 3SV7A 3NK8A 4Q2KA 1MUEB 3RC6A 1W13U 3MH4A 1UVSH 2ZHDA 4I8KA 3OY5U 1TFXA 3P95A 1JXPA 3QTOH 1ORFA 1LTOA 2ZTYA 1TQ0B 4ZROA 2BD9A 2KAIA 1Y3XA 1DUAA 4WMFA 1W10U 3PMJA 4MLFB 5DP7A 1HGTH 2V6NA 2BDYA 2FDAA 4CRBA 1TYNA 4U01A 1IQNA 2C90B 3ZVDA 1NM6A 2ALPA 1ZTLA 2PLXA 1O5FH 3LKWA 2OQ5A 1WSSH 3K6YA 1A0HB 1FIZA 1DY9A 3ZV9A 1GJAB 3SGQE 1V2QT 2FOCA 4ZKNU 1O38A 5DP3A 1SGDE 1G3DA 3CP7A 2OC7A 2WINI 4A1TA 2O8WA 2XXLA 2JH5D 4KGAA 1AHTH 3VEQB 2FPZA 1SGTA 2OCVB 5EXMA 4O97A 3RUOA 1U6QA 2B9LA 2D2DA 3SQHE 2F9OA 3V13A 4B76A 1GHYH 1N1LA 1MBMA 1XX9A 1H9HE 2TIOA 1CHOF 1P2KA 3KN2A 1RTKA 3LGWA 3RXAA 4OS2A 2ZCHP 7GCHG 4B75A 1L4ZA 1CBWB 2AYWA 4GCHG 1J9CH 3MU0A 4TY6A 1C1NA 4MNWA 1JRSA 1S0QA 1E36B 2GZ9A 2WPIS 2PKAB 2VGCC 2STAE 1HAPH 2RCEA 5TCAA 4AG2A 3TNSA 3RLWH 1TRYA 3U9AH 1A46H 3ZV8A 1SGCA 1P04A 1K1LA 3LH1A 1V3XA 1TPAE 2ESTE 4ZUHA 1OOKB 2ASUB 2FI5E 2BX4A 1D9IA 1TMBH 1ZMLA 2GCTC 4MNVA 2FOGA 2GCHG 2BY9X 1EZXC 1TGBA 3RXPA 1G36A 1QNJA 1W0ZU 2A5IA 1EAIA 4GLYA 2H5DA 1G30B 1GBJA 4KTUA 3RXQA 4QT8C 3SJOA 1DY8A 3FVFB 1W12U 3STJA 3VB6A 4CH8B 2CMYA 1FZZA 4M7GA 4DJZB 1TBRH 1J14A 2THFB 1ARBA 4IN1A 3M35A 2VWOA 1H8DH 3TIUA 5DGJA 5EQQA 3RXUA 1MD8A 2NU0E 1ZJDA 1HNEE 4XBCA 1KY9A 2Z94A 1C5UA 5JYIA 1K21H 1XUJA 2XNIA 2FX6A 2XWAA 4Y7BA 4D9RA 1C2IA 2ZFTA 1K22H 2A2QH 1BOQA 1F0UA 1C5WB 2FX4A 2UWPA 1N8OC 1P12E 1HJ8A 2UUJB 1P02A 1TNLA 4Y79A 3RDZA 1ABJH 1BBRK 1EAUA 1KXAA 2RA0A 3U8TH 1O3NA 1YC0A 2FOMB 1BRUP 5EG4A 3LIWA 2XC0A 3ATLA 5CHAB 2WV5A 4AFUA 4H6SB 1EOLA 2GVFA 1C4U2 2A4QA 3ATWA 1HAYB 3B8JA 1PPGE 3GY3A 4NSVA 4DCDA 4I33A 5GIBA 3SBKA 1WCZA 3SGAE 2Z3DA 1QL7A 2FLBH 1LVMA 2HLCA 5LPRA 1C5SA 4ZKRU 5HM9A 3A8CA 3UY9A 1SGFG 1P05A 5DP6A 5EU8A 7GCHF 1QQ4A 1QURH 1XUHA 1YPHC 1OP8A 3GY5A 1H9IE 1ELGA 1K1IA 2PTCE 3KHVA 3ZZAA 2G52A 1MTVA 1Q2WA 3A7YA 2WV4A 3E6PH 3KF2A 2ZHEH 2DE9A 3ZVAA 3ATKA 1FMGA 1O36A 5EOKA 2BD4A 3SI4H 1FY8E 1TMTH 3BSQA 1JRTA 3S0NA 5C3NA 4GAWA 2VH0A 1HAIH 4FU8A 2YNBA 1AFEH 1MTNB 4HFPB 2ZU1A 2W3IA 2DE8A 3SUFA 1NS3A 4XSKU 1CGIE 1GI6A 1IOEA 1OX1A 2GGVB 3JZ1B 5B6OA 2J38A 1Y5UT 1Z8IB 4I8LA 3AW0A 4Y71A 4AFSA 1FONA 5JBAS 4RKJB 1ESBA 3GY8A 4YT7H 4AG1A 4HZHA 2FLRH 2FI3E 4B2BA 1GJCB 1W7XH 1CA0C 4BAQB 1DE7H 1CHGA 2ODPA 2V35A 1OWDA 3QLPH 1O2QA 2F9PA 2PW8H 2FTMA 1UK4A 3LDXH 2CHAB 4HI3A 1T4UH 1A0LA 1J15A 2NU3E 4WH8A 1QTFA 1C2KA 2PFEA 3E0PB 1UVPA 1SLWB 1C5VA 2WPJS 1V2RT 3GDUA 1S0RA 1ANCA 3UQOA 1QBOA 1V2TT 2A4OA 2ZIQH 3UNRA 3S9AA 4XDEA 4CHAC 1ZGVA 1JWTA 1NRNH 1B7XB 2GMTC 3GCHC 1QFKH 1LMWB 2ZP0H 3M61U 1P2OA 5FBIA 2VIDA 5L2YH 1ESAA 1HFDA 5LH8A 2PGBB 5FBEA 3F9FA 4OS6A 2Y6TA 3K65B 4UFGH 2G81E 2H6MA 1HJAC 2ZU2A 3TH3H 4AX9H 4GVUA 5EW2H 2PV9B 4ZKOU 1SGQE 1KDQB 3KEEA 4FUHA 3SV2H 1OSSA 2ZQ2A 2VIOA 1UK3A 2WYJA 1TX8A 5GXPA 4ISIH 9LPRA 1PFXC 1OXGA 1D4PB 1NT1A 4FUJA 2CJIA 3QZRA 4U32A 2WPMS 1AY6H 1V2WT 1SQOA 5C2ZA 5F03A 1GJ7B 1KLJH 4A92A 1YPJH 1C4Y2 3SU2A 1O2JA 1LHGH 1NC6A 2GDDA 1D6WA 3OSYA 1F92A 3BG8A 2BVXH 4BAKB 1C5NH 3URCA 3MFJA 3ZZ4A 1A4WH 3DFLA 1QGFA 1Y3VA 3NWUA 1F0TA 3UOUA 2OINA 4X1RU 2ZU3A 1OWKA 2F3CE 3PLBA 1ETRH 1GPZA 1YPKH 3ITIA 4OS4A 2STBE 1BHXB 1AN1E 1FAKH 1H4WA 2CF8H 3A82A 2ZCLP 1P03A 1IQEA 3MU5A 3A8DA 3HK6B 3MWIU 1DWEH 1H9LB 3ATMA 3RM2H 1OYQA 5F8ZA 3GCTF 3I78A 1YPLH 4GHTA 2P16A 1RD3B 2ZTZA 1L1NA 2BQ7B 1O2YA 3QZQA 1MKWK 5C5NA 2SNVA 1QRXA 3RXHA 3A80A 2G8TA 4R0IA 1BHXF 2V3OH 5AHGH 1C5QA 1CGHA 1ELTA 1YPHE 3EA8A 3A7TA 1WUNH 1ELVA 1BZXE 3GY6A 3TJVA 1EJAA 2TBSA 1C1VH 4I8JA 2HALA 1AFQC 3BTGE 1C2DA 1UVUH 4NWKA 1T8MA 2I6SA 2PR3A 1S6FA 1W3CA 2ZDLA 2ZFPH 3URDA 4O3TA 1DSTA 5DP9A 3A85A 2NU2E 8LPRA 1DX5M 2BD2A 2C93B 1P2IA 3RMMH 2ZC9H 4NA7A 1O2HA 1DOJA 5JB9S 2ULLA 1UTQA 3PB1E 4Q7YA 3MNSA 1EJNA 1NZQH 1A7SA 3VGCC 4LK4A 4Y6DA 1ZLRA 1GMHG 1A5IA 5JPMH 3RXTA 1TMUH 4ASHA 3SGBE 1A3BH 2W5EA 3SI3H 2BVSH 5ETXA 1ZOMA 1AB9C 1UK2A 4Y11E 1EPTC 1O3JA 4X1PU 2FS8A 2Y7XA 4FXGH 2P59A 1LPZB 3RM0H 1FY5A 1LVYA 4NZLA 1SBWA 3ZVGA 3TNTA 3RXRA 2PSYA 1EQ9A 1F0SA 2FOFA 2OP9A 1DS2E 5DK1A 3FP7E 2NU1E 1LDTT 2XWBI 2Z9LA 3P17H 1ZR0A 3H5CB 2ZPSA 3FP6E 4ZMAH 2HNTF 1TGSZ 2TRMA 1GHBG 4Y76A 3SQEE 4XFQA 1O32A 5DG6A 3QX5H 5H4IB 1YGCH 3RXFA 1NO9H 1TPSA 2Q1JA 2B5TB 3W95A 3SV8A 4I7YH 4INKA 5A8XA 4NIVA 1BITA 1P2QA 4X1NU 1B5GH 4UEHH 1W0YH 5JB8S 2FTLE 1YF4A 3M3SA 1FAXA 1GMCG 5PTPA 1LHCH 4A7IB 1PJPA 1G32B 1XUIA 4TWWA 1ELBA 1DVAH 1UTOA 4K8BA 3UTUH 1PPBH 2BLVA 1ELDE 3IITA 4OS7A 2Z9IA 4AB8A 2EEKA 5DJ7A 2OTVA 3MI4A 4Y8YA 2QCYA 1AWFH 2RDLA 1MTWA 1NY22 2PHBA 3GISB 1GCTC 1K1OA 1O5CB 1GI7B 2G4UA 2OQUA 4ABAA 3MNBA 3KQEA 1E0FD 1V6DA 2SGFE 3S9BA 1SVPA 1HAHH 3LC5A 4UDWH 4ABIA 3KNXA 2FYQA 4X6OA 1FV9A 4BXWA 4YZUA 3TGJE 1O2LA 1XXDA 2P95A 1EX3A 3M5NA 3Q00A 4INLA 3BTQE 1HAGE 2AS9A 1SGYE 2FWWA 2O9QA 1GBLA 1C9TA 1NU7B 1V2ST 2BZAA 5EPYA 1HBTH 3UR9A 4RSPA 1NTPA 2ZGHA 3IG6B 4XBBA 2F9BH 4F4OC 3ZZ8A 2PUXB 1GMHF 2JH6D 4RKOB 1ZTJA 3SJ9A 2BMGB 2JKHA 4X2XA 2ZEBA 1RIWC 5K0HA 1FJSA 1V2KT 3EAJA 5A8ZA 1C2GA 4Z0KA 1CU1A 1W14U 2FO9A 2F83A 5A8YA 3QN7A 2QF3A 2ZDVH 5A0CA 3PMBB 4ZHMU 1SFQB 4TWYA 2GTBA 1VCQA 2OC8A 2ZPQA 1BCUH 3BF6H 4JMYA 1OS8A 3RXGA 2QV1A 3LGYA 2Z9GA 2FMJA 3T28A 4XBDA 4Y7AA 2A4GA 4ABGA 1GBFA 3U8RH 6GCHF 1P10A 1FXYA 1UTJA 1O0DH 1O2NA 1GHBF 4CRAA 4NA9H 5DKMA 1RTLA 3HK3B 1IQGA 5F6MA 4IBLH 1TOMH 3GDSA 2TGTA 1D3TB 2Q6DA 1F5KU 1O39A 1BRAA 3S69A 3PM3A 5BPEA 4FU9A 3L6PA 3ODFA 2ZFQH 3TK9A 3TJUA 1GBHA 1VZQH 1GMCF 2R3YA 1T31A 3B9FH 1NRQH 1AMHA 5ESBA 4PROA 1BIOA 2LPRA 3PO1C 1GI2A 2R3UA 3RC5A 2AGGX 1XM1A 1VJ9U 2AMPA 4F49A 4FUBA 1CGJE 2CGAA 5E0JA 3T2NA 4YTAA 1P2JA 2C8YB 2EA3A 1HDTH 1TOCB 4GUXA 1Y3UA 1QBVH 1AE8H 1BT7A 4CH2B 3DA9B 1UJ1A 2A5KA 3UQVA 1Y5AT 5EW1H 1B0EA 1PPEE 2O8MA 4JYVH 4H4FA 4BANB 1QB9A 2FEQH 3D49H 1EPTA 4X1SU 5F8TA 3ESTA 2P8OB 2D1JA 3T25A 3V7TA 1O3HA 1QY6A 1QQUA 5GWZA 1F5LA 1P3CA 1UCYH 4MTBA 1F7ZA 1AD8H 6CHAB 2H9HA 1CBWC 3GOVB 3VB7A 2ZI2H 4NFFA 3L33A 3A81A 4WWYA 2EI8A 2A32A 3SHAH 2C4FH 3DHKH 1G3EA 2VNTA 5HXFA 2ZFSA 1Y3WA 2BQ6B 1B0FA 1TNGA 2FIRH 2GT8A 2OC0A 1FPHH 2ZWLH 2DUCA 1O3CA 5JBBS 1MBQA 2SGQE 1D3PB 2A5AA 2BD5A 4HTCH 1P3EA 1ZPZA 1LHFH 3EE0B 4D76A 2FYRA 2BD3A 1HCGA 2VIWA 2XRCA 3O8BA 1EP6A 4BXSA 1IQIA 2QA9E 1ZRBA 4D7FA 2Y5FA 2SNWA 5AFZH 1F0RA 3LGTA 1Q3XA 1BBRE 2Z3CA 3FZDA 5FPTA 5EPNA 3O8CA 1A3EH 5C67A 1L1JA 3TU7H 2ZDAH 1GGDC 1ZMNA 2IJOB 4KP0A 1TPOA 1H8IH 1ANDA 1GI4A 4SGAE 2UUYA 5AF9H 5C20A 5CE1A 4IMZA 2VJ1A 3SORA 1QA0A 2O8LA 2R0LA 4JZIA 3F9HA 1MU6B 3LGIA 3NUMA 2FM2A 2F91A 1F2SE 1TWXB 4JZDH 1IQFA 1BUIA 2SGPE 5JDUB 1Q31A 3R0FA 3RXVA 2ZGBH 4YOJA 3OY6U 4IN2A 1OWHA 3CS0A 3MNCA 1JBUH 1C2LA 3UNQA 4B71A 1C1RA 2ZU4A 3E3TA 1YBWA 1ZPBA 4WXVA 2ZU5A 4CR5A 1ZRKA 3AASA 2K1QA 1S83A 3A88A 7LPRA 1QJ7B 4MNYA 2XC5A 1S81A 4MPXA 1V2VT 4LXBH 3A7VA 3SNCA 1GCDA 3A8BA 3LC3A 4E7RG 2GCTB 4H6TA 4JYTA 1TGTA 1UMAH 1SHYA 1UTPA 2QC2A 3LGVA 1C2EA 1C1QA 1HXFH 1KTTB 2QXGA 4IW4E 1HB0B 3SNDA 3NPSA 4LOYH 5EGMA 1TBQH 1DM4B 1O2OA 1NU9A 1P01A 1TB6H 4A1VA 1JOUB 1WTHD 2J2UA 2VH6A 3RU4E 4ABEA 1HPGA 1GBKA 1MTNC 5FCKA 4TPIZ 1UVTH 3QO6A 4FUGA 1C5LH 4GCHF 1ZJKA 2A7HA 3LT3A 5GPIB 1P2NA 3I77A 2RG3A 3MTYA 1K1NA 2BY8X 2Y5GA 2BY7X 7ESTE 4CR9A 3TGIE 3RXBA 5E0HA 3PTBA 2UUKB 3UUZA 1P2MA 4GSOA 1O3EA 1WQSA 4H42U 1NN6A 1KTSB 1SQAA 3U8OH 3PV4A 2GKVE 4K1TA 4AYVB 1PYTD 2FS9A 1INCA 3ZZ9A 2ZG0H 1XVOA 2GCHF 1ID5H 1QA7A 4A6LA 1BRCE 1JIMA 5FX6A 5HM2A 1Y3YA 1SGPE 4THNH 2QXHA 1K1PA 1RS0A 2GP9B 2HPQH 1DLEA 1AU8A 2ZA5A 1NRPH 1LHDH 1P06A 3GY2A 1AKSB 2BVRH 3KCGH 1DWDH 2UWOA 3FFGA 1GHXH 3M5LA 3M5OA 5T6DA 1E34B 3RP2A 1LPGB 3RXCA 3ZVCA 3QTVH 1L1GA 1O5EH 2XBVA 3ZZ6A 4CRFA 2R2WU 1HAZB 2BDCA 1VJAU 9ESTA 2XYAA 4BAHB 3AW1A 1UTNA 3PLKA 4U30A 2AGIX 3SNEA 1WTGH 1Y5BT 4K2YA 3IWMA 3UOPA 1PPCE 3SUDA 2P93A 2A4RA 1O3KA 5DP8A 1SGRE 1GHAG 1BA8B 1YCPM 1Z1JA 1ANEA 1SPJA 2WYGA 4ZKSU 4YO9A 3O8RA 1ESTA 3ZVFA 4Q7ZA 1AQ7A 4IGDA 2ANYA 4R8TB 2NU4E 1S84A 4XOJA 1M9UA 1CA0B 3M36A 1TQ7B 5SGAE 1FDPA 2XW9A 1SB1H 2VIPA 1GI3A 1O33A 1O3GA 5T6FA 4U2WA 3UWJH 2BTCE 3RXJA 2BXUH 3TK5A 2PWXA 1O3DA 4NIYA 1UTLM 1GJBB 2FESH 2EI7A 1TGCA 4BTTB 3SV6A 3V3MA 1SFIA 1CT0E 1AE5A 1QJ6B 3SZNA 1PPHE 5EXLA 1WAYB 2A45B 2FODA 2VIQA 3MO9A 4TPYA 4X1QU 1EASA 4FUEA 1ZSLA 5A09A 1YPGH 4Q7XA 4CRDA 1GBAA 2AIQA 2BXTH 2D26C 4WF8A 1PQ8A 1G9IE 2GMTB 2H9EH 2AIPA 1G37A 3GCHB 1QBNA 5E8EH 1WQVH 1FNIA 2W3KA 3D62A 2A31A 3R3GB 3SJ8A 2WPLS 4FU7A 4DIHH 3SO3A 1WV7H 5JBTA 1Y8TA 1V2OT 1VITH 3ZZ5A 4J1YA 1HJAB 4KTCA 3A89A 5BRRE 5HYOA 3KQBA 4I32A 1KXDA 1FUJA 3F9EA 3GY4A 3H7OA 2JH0D 1C2MA 3EDXB 4MDSA 3STIA 4DY7B 3OX7U 2XCNA 1C5TA 2P3TB 4KKDA 1HXEH 4AZ2B 1O3PB 1T7CA 2R2MB 3S7HB 4Q80A 2TGPZ 1T8LA 1J8AA 2J95A 1C1WH 2IOTA 2PSXA 4DW2U 1O2SA 3WY8A 3VB3A 2J34A 3QGNB 1DLKB 1NROH 3RMNH 3QDZB 1A61H 2G5VA 2O8TA 1V2NT 1C1TA 1GDQA 1RRKA 3BG4C 4K1SA 2GDEH 2HPPH 1T4VH 4DGJA 1C5MD 1TX7A 1ELCA 2QF0A 5FPSA 1FN6A 2TGAA 1W7GH 1FY4A 1PQAA 1QB6A 1MU8B 4CRGA 1GHAF 3T26A 4WMEA 2BM2A 4UONA 1IQJA 3Q76A 2J94A 3SNBA 4AN7A 3NKKA 1NRRH 2WPKS 5GDSH 1EUFA 2P94A 1LCYA 1C5RA 4MPWA 4LZ4B 2BOKA 3LGUA 1GG6C 5I46H 1TX6A 3MH5A 3U1IB 1EZQA 2ANWA 3CS7A 1SLXB 1WU1A 1THPB 4DT7B 2AH4X 3HATH 1EOJA 1LVOA 1HYLA 3Q77A 5TCCA 2O8UA 3W94A 4YLQH 7KMEH 2VVCA 2VWMA 1YLDA 2JETB 1S5SA 1O2VA 2C8WB 4Z6AH 1NFUA 5AFYH 3MO3A 1QL9A 1X7AC 1TE0A 5HMAA 1A1RA 1EZUC 2PKSC 4YESB 2BY5X 5TJXA 1MQ6A 2W7SA 2VWLA 1GJ6A 1IHTH 1SGEE 4X8UH 1HUTH 1UCYK 1LKBA 1XMNB 3ODDA 8GCHG 5LGOA 1XKBC 1EATA 3KQCA 3VGCB 3C1KA 4CREA 1GHWH 3E90B 4I31A 1O3LA 1MMJN 4VGCC 2XC4A 3A7XA 4WH6A 4TY7A 1EP5A 1O2TA 3U69H 4DVAU 4BAOB 1P9UA 1VGCC 3RXIA 3VB5A 3SNAA 4Y0ZE 1C5ZB 1P8VC 3MU1A 2Q6GA 3VFEA 3AAVA 1CT4E 1XKAC 2OD3B 2KAIB 4AFZA 1DWCH 3EQ0H 1P0SH 4WY3A 1AB9B 1EPTB 3BTTE 3HGPA 1EXFA 2BX3A 1C1UH 4NCYA 2XBWA 4MG3A 3RXSA 5F8XA 4X8VH 4YM9A 5ABWA 3UPEA 1K2I1 1HAVA 2WUCA 3E16B 5FPYA 2G00A 3P8OA 2ZDKA 3JZ2B 4GHQA 1ELAA 3PWCA 3TH4H 4JK6A 4DG4A 2CXVA 3QUMP 1O5BB 1TNJA 4MNXA 1CA8B 1SGNE 4A1XA 4O9VA 3RXEA 1LPKB 1TPPA 2GV6A 4FUDA 4CBOA 5LPFA 1BMAA 3L3TA 3UFAA 1EB2A 6LPRA 1LQDB 1MTSA 1Z8GA 1GL0E 2J92A 1GJ4H 4B2AA 1DITH 1THRH 4WVPE 4D7GA 3GCNA 4JK5A 1P11E 3ZZCA 5A0AE 4ISHH 1PPFE 4WMDA 1GHVH 1P9SA 1LO6A 2H1UA 3M3VA 1O37A 2VINA 1SGIB 4ZHAA 1J17T 1TABE 1KIGH 4Y8XA 5CMXH 3K2UA 1GCTB 2CN0H 4ABDA 2BDAA 2EC9H 4NIWA 1VR1H 1G3BA 3EYDA 5EQSA 1BJVA 3BEFB 3MH6A 4O03A 4AORA 2C8ZB 3MHWU 2ZDNA 1BMLA 3EGKH 1QHRB 3BIUH 1N6YA 5I25A 1SHHB 1OKXA 3M37A 1OP0A 1BB0B 1GDNA 2OBQA 3PYHA 3U1JB 3Q3XA 4TYDA 1GBTA 8GCHF 1AIXH 4OS1A 1ABIH 3F6UH 1W2KH 2UUFB 4ABFA 3LJOA 2OBOA 2FOEA 5G4BA 1OPHB 1SG8B 1SLVB 1ZHMA 1QRZA 4HGCA 5DPAA 8ESTE 1S82A 4JZFH 1J16A 5FHTA 2ZZUH 3M7UA 2VWNA 3VXFH 1BTPA 3T27A 1PQ5A 4OGYA 1C1SA 2GX4A 3A7WA 1GWAA 1AVXA 2FXRA 1IQLA 1G2LA 3OU0A 1ZYOA 3TVJB 1O2GH 2NWNA 2HRVA 2ZECA 1MTUA 3TLOA 1MQ5A 3MO6A 4INHA 2ZFRH 3U98H 1Z6EA 1O2UA 1FY1A 3TH2H 1ELEE 1T8OA 4D9QA 2BOHB 4ZXYH 1A2CH 1O31A 2PTNA 4AYYB 1GVKB 1SL3A 1QJ1B 3PLPA 2AERH 3SUEA 1ETTH 4UD9H 5HGGA 5FX5A 5EXNA 1CE5A 1HJ9A 3A87A 3SU5A 2BHGA 2J4IA 1GBIA 3BTWE 3ZZ3A 3PO1B 4IS5A 2ZGJA 3RU4T 3FAOA 1DFPA 1XXFA 3PTNA 2BLQA 1BTXA 3BTHE 1DICA 1ZHPA 3BEIB 5LPEA 3T29A 3V12A 3ZYDA 3C27B 3GCOA 4ZHLU 1O35A 4GPGA 3NCLA 4UE7H 3BTFE 2WUBA 2A7CA 3F68H 4AGKA 1RFNA 2SGEE 4FUFA 3TJNA 3HKIB 6ESTA 1ZZZA 1O30A 3SU0A 1L0ZA 1GBEA 1LVBA 3LOXA 3QWCH 1MCVA 2BY6X 2FI4E 2YOLA 1BDAA 1E38B 1QR3E 1CQQA 4I8GA 1IHSH 4K3JA 2GD4B 1ZPCA 2ZHFH 1KXCA 3MOCA 2SGAA 4ABHA 4J2YB 3HPTB 3PMAB 2UWLA 3BN9A 1PPZA 3OTJE 4BNRA 5AVDA 3NXPA 1OWJA 4A5TS 5J4SA 4ZAEA 3MU8A 1UO6A 5CHAC 1YYY1 1V2MT 4NSYA 1F5RA 4IC6A 1T32A 3E1XB 1W11U 1TNHA 4ISNA 3TGKE 4ISLA 2HVXA 1QRWA 2VGCB 1WBGB 8KME2 1Z8JB 2WPHS 4FVBA 1UVOA 2J9NA 1HIAA 1GL1A 3RXKA 4X0WU 5T3HA 4X2YA 1UHBA 1SQTA 1A5GH 1W8BH 1GGDB 1GI9B 2QY0B 1DUEA 1G3CA 3RXLA 1QIXB 5E2OA 4NFEA 1WYKA 3V0XA 1QB1A 1SMFE 2P3UB 1UTKA 3HKJB 5EQRA 3TJOA 1K1MA 1DXWA 2BYAX 4B1TA 4Y8ZA 2IPHA 1O3IA 1MD7A 2OLGA 1JIRA 1GMDG 1TBZH 3Q3YA 3QK1A 1OWIA 4ABBA 4MPVA 2ALVA 1K28D 1DSUA 1C2FA 2QGRA 4FUIA 4CRCA 3MU4A 1KSNA 3P70B 2B0FA 1AVWA 2BDIA 2BD8A 1FN8A 1TNIA 5C5OA 3SU6A 1O2RA 3MMGA 4KELA 1Z1IA 1GJ9B 2BLOA 1CO7E 1O2IA 3E0NB 1MH0A 1C9PA 3FP8E 4O3UA 1O3OA 3VXEH 1ZTKA 3A8AA 2QXJA 4X6MA 1EAXA 1N8OB 2SFAA 3GY7A 1GBDA 1KXBA 1NRSH 1BTWA 1JMOH 2CF9H 3KIDU 4YLUA 1Z6JH 2ZKSA 1O2WA 3BTDE 4ESTE 2CHAC 4OGXA 1NFYA 4AFQA 2A7JA 3SU4A 1IQKA 1GJ5H 1FLEE 4AOQA 4K69A 2PUQH 1C5XB 1GVLA 4X6PA 1GBBA 4JYUH 2ODYB 4NG9H 4K5ZA 2BQWB 2PKAA 1AVGH 4UFEH 1PYTC 1TIOA 3SW2B 2GT7A 2ZQ1A 1TRNA 2HOBA 1D3DB 1S85A 2D8WA 2M5TA 2ZPRA 1L4DA 2VB0A 4NWLA 1O34A 1KLIH 2QYIA 3GCTG 3F1SB 3SN8A 1EAWA 1BTHH 4E7NA 4DOQA 3RMLH 1D3QB 1ZHRA 3SUGA 3UWIA 5FXLA 2ODQA 1AZZA 3O8DA 1HV7A 5E2PA 1MAYA 1QL8A 3DD2H 4B74A 1YPEH 1C2HA 3NZIA 1HAXB 2HWLB 3SOSA 1DDJA 4BOHA 4IC5A 3ENSB 1GMDF 3TITA 2V3HH 3FZZA 1HAOH 1C2JA 3VPKA 1RXPA 1K1JA 2Y5HA 2R0KA 2A1DB 1TLDA 4K8YA 4E06H 4JCNA 2Z9JA 2ZHWH 3PWBA 2V0BA 2BB4A 2ANKH 2SGDE 1ACBE 1MAXA 1GI0A 1ZSKA 1XUFA 3RXOA 1EZSC 2XBXA 3LJJA 5JBCS 1MKXK 2Y7ZA 1O2MA 1GDUA 1O3AA 3H7TA 3GICB 1Z8RA 1AUTC 1HRTH 2QXIA 3UNSA 1C5OH 3S7KB 1DPOA 1BTZA 1AO5A 2FOBA 4X2VA 3ZZ7A 4CBNA 3SU1A 2XTTB 2ZFFH 4CHAB 1CSOE 2ZDMA 1DWBH 3T62A 2XBYA 1O5AB 3RC4A 5J4QA 2C8XB 3SHCH 5C1UA 4XE4A 3P6ZB 1LHEH 3HGNA 2C3SA 1SC8U 4ZXXH 1EKBB 1ZGIA 3A86A 1TA2A 1BBRH 4X8SH 3AVZA 2Q6FA 3DUXH 4MPUA
chains in the Genus database with same CATH superfamily
1C1PA 1AZ8A 1HAVB 4AB9A 1OYTH 1O2XA 1SOZA 1GVZA 5C17A 1QCPA 1TGNA 1ZSJA 1AI8H 2YNAA 1BRBE 2AEIH 1H8ED 1O3BA 1CT2E 2FOHA 2W26A 2XCFA 3ZZDA 1E37B 3F2FA 1TONA 3EA9A 4JZ1A 4NIXA 5T6GA 4FVDA 2B7DH 1O5GH 2BDHA 2RDEA 2ZGXH 4I8HA 3UREA 3UIRA 3SJKA 1BMNH 3VB4A 1ETSH 1SR5C 1UCYE 3N7EA 2KFWA 2YMSC 1NFXA 1RTFB 4Y10E 1PQ7A 4ABJA 1OP2A 3S9CA 2FP7B 4B73A 2BLWA 2B8OH 2HNTC 1SOTA 3B23B 1E35B 3D23A 4K60A 3PRDA 1AKSA 1NESE 1SI5H 2PP6A 1SSXA 4X8TH 2JETC 2Y81A 3LH3A 2QIQA 1GBMA 1C5PA 3A84A 1TAWA 2Y82A 4RI0A 3TPIZ 4NZQA 4X2WA 3OYPA 3M5MA 1TALA 1D6RA 1KLTA 2BDGA 2G55A 2QAAA 3PV5A 3SV9A 3K6ZA 2J97A 2W6JD 4NGAH 3BEUA 1FQ3A 1VCWA 1BJUA 3DSGA 1C1OA 3MYWA 5FAHA 1AGJA 1V2JT 4WJG2 2HVYB 5DP5A 1MZAA 5IK2D 3OFND 4UFFH 4DIIH 1YCPK 2Z7FE 1L2EA 4Y0YE 1W0JD 1YM0A 2EI6A 1AFQB 1YPMH 1TNKA 2GZ7A 1O3FA 1EJMA 1XUGA 1DT2A 1TRMA 2EQNA 1SGFA 2VVVA 1THSH 5GCHG 3SU3A 2Z6BD 3BG4B 5L2ZH 4JZEH 3E91A 3A83A 2TGDA 4E05H 3LU9B 1C4V2 3D65E 1ELFA 1NFWA 1GBCA 2Y80A 1YP9A 4AGJA 3DT0H 1KDQA 3KQDA 5DO4H 2F9NA 5EODA 2F9UA 1LQEA 1EB1H 2PGQB 2GZ8A 4YOGA 2H2ZA 2ZF0H 4LZ1H 2BD7A 6GCHG 1RGQA 3GYLB 4YOIA 1GI1A 5K7RA 4ISOA 1H1BA 1VITG 1GG6B 1WOFA 1BMMH 1AWHB 1XVMA 3A7ZA 1KXFA 3MNXA 2FZZA 2KCAA 2KM0A 2G4TA 1AUJA 1GJDB 1MKXH 3ZYEA 5IYTA 1LKAA 4KTSA 3FANA 2A2XH 3ATIA 1IAUA 3BIVH 1Z71A 1SLUB 4BTIB 2ZHQH 2QN5T 1BQYA 2ILNA 3P8GA 3PROA 3U28C 1TA6A 5L6NH 5C1XA 3P8FA 1E79D 3TK6A 4X6NA 2PKSB 1CVWH 3QGJA 2H9TH 1GHZA 1UTMA 2AGEX 1A0JA 4OS5A 1NPMA 3P92A 4DURA 2G5NA 4BTUB 3P8NA 2H5CA 3M3TA 1DXPA 1Y59T 4MQAA 1YLCA 4SGBE 1N6XA 3RLYH 2VVUA 1GI8B 4VGCB 1BTYA 1K9OE 3E8LA 5A2MH 5E0GA 2R9PA 2VIVA 1ANBA 3LPRA 1DANH 1VGCB 4BAMB 3I29A 5GJ4B 2Z9KA 1O3MA 2A0QB 4YT6H 1C1MA 3RXDA 5FCRA 4FUCA 1BTUA 3K9XB 1T8NA 1V2LT 1KXEA 3GYMA 2BZ6H 5A0BA 3ZVBA 3UR6A 2AMDA 1S6HA 2G51A 4D8NA 1HLTH 1YKTA 1P57B 1FIWA 4RN6A 1OWEA 3EA7A 4WXIA 1XUKA 1KYNA 2ZO3H 1FPCH 4NA8A 1O2ZA 3T5FH 1RJXB 3PMHB 1A5HA 2TPIZ 2ANMH 1GJ8B 1G2MA 3KL6A 1MCTA 3BTME 3SJIA 1MKWH 1C5YB 2HGTH 2K0QA 2W7UA 2OC1A 2ZCKP 2ZNKH 3CENA 3GDVA 5GCHF 2OUAA 1NBME 3AAUA 3BTEE 4K1EA 2IN2A 1CHOG 2BDBA 3MH7A 3F0OA 1FY3A 3ZVEA 2FOAA 3DFJA 3M7QA 2ZTXA 5DP4A 4UFDH 1FI8A 1EFRD 2VU8E 5IDKA 1V2UT 4MVNA 2CV3A 3RU4D 3F9GA 2HNTE 2I6QA 1VCPA 3ZZBA 2AFQB 2F9VA 3N7OA 1O2PA 3BV9B 2RA3A 3ELAH 3RXMA 1RIWB 1IQHA 2P8OC 5ESTE 5KECA 1ARCA 1MABB 5L30H 2AMQA 1VITF 1O2KA 3Q3KA 3G01A 4FETA 5C1YA 1K0HA 2RFKC 2LNCA 1V2PT 1ZMJA 1HIAB 1IQMA 1P09A 3M7TA 3LONA 6CHAC 4B2CA 2GV7A 2V3MA 2P3FH 2ZGCA 1UHBB 1Z7KA 1GI5A 1YCPH 3KGPA 4ZH8A 1MZDA 3RMOH 1O5DH 2OXSA 3BTKE 2Z3EA 4IMQA 3SV7A 3NK8A 4Q2KA 1MUEB 3RC6A 1W13U 3CNRA 3MH4A 1UVSH 2ZHDA 4I8KA 3OY5U 1TFXA 4XD7D 3P95A 1JXPA 3QTOH 3W1EA 1ORFA 1LTOA 2ZTYA 1TQ0B 2OK5A 4ZROA 2BD9A 2KAIA 1Y3XA 1DUAA 4WMFA 1W10U 3PMJA 4MLFB 5DP7A 1HGTH 2V6NA 2BDYA 2FDAA 4CRBA 1TYNA 4U01A 2J98A 1IQNA 2C90B 3ZVDA 1NM6A 2ALPA 1ZTLA 2PLXA 1O5FH 3LKWA 2OQ5A 1WSSH 3K6YA 1A0HB 1FIZA 1DY9A 3ZV9A 1GJAB 4RT0A 3UAIC 3SGQE 1V2QT 2FOCA 4ZKNU 1O38A 5DP3A 1SGDE 1G3DA 3CP7A 2OC7A 2WINI 4A1TA 2O8WA 2XXLA 2JH5D 4KGAA 1AHTH 3VEQB 2FPZA 1SGTA 2OCVB 5EXMA 4O97A 3RUOA 1U6QA 2B9LA 2D2DA 3SQHE 2F9OA 3V13A 4B76A 1GHYH 1N1LA 1MBMA 1XX9A 1H9HE 2TIOA 1CHOF 1P2KA 3KN2A 1RTKA 3LGWA 3RXAA 4OS2A 2ZCHP 7GCHG 4B75A 1L4ZA 4HG6A 1CBWB 2AYWA 4GCHG 1J9CH 3MU0A 4TY6A 1C1NA 4MNWA 1JRSA 1S0QA 2EY4C 1E36B 2GZ9A 2WPIS 2PKAB 2VGCC 2STAE 1HAPH 2KCOA 2RCEA 5TCAA 4AG2A 3TNSA 3RLWH 1TRYA 3U9AH 1A46H 3ZV8A 1SGCA 1P04A 1K1LA 3LH1A 1V3XA 1TPAE 2ESTE 4ZUHA 1OOKB 2ASUB 2FI5E 2BX4A 1D9IA 1TMBH 1ZMLA 2GCTC 4MNVA 2FOGA 2GCHG 2BY9X 1EZXC 5KGOA 1TGBA 3RXPA 1G36A 1QNJA 1W0ZU 2A5IA 1EAIA 4GLYA 2H5DA 1G30B 1GBJA 4KTUA 3RXQA 4QT8C 3SJOA 1DY8A 3FVFB 1W12U 3GS9A 3STJA 3VB6A 4CH8B 2CMYA 1FZZA 4M7GA 4DJZB 1TBRH 1J14A 2THFB 1ARBA 4IN1A 3M35A 2VWOA 1H8DH 3TIUA 5DGJA 5EQQA 3RXUA 1MD8A 2NU0E 1ZJDA 1HNEE 4XBCA 1KY9A 2Z94A 1C5UA 5JYIA 1K21H 1XUJA 2XNIA 3VG8A 2FX6A 2XWAA 4Y7BA 4D9RA 1C2IA 2ZFTA 1K22H 2A2QH 1BOQA 1F0UA 1C5WB 2FX4A 2UWPA 1WXRA 1N8OC 1P12E 1HJ8A 2UUJB 1P02A 1TNLA 4Y79A 3RDZA 1ABJH 1BBRK 1EAUA 1KXAA 2RA0A 3U8TH 1O3NA 1YC0A 2FOMB 1BRUP 5EG4A 3LIWA 2XC0A 3ATLA 5CHAB 2WV5A 4AFUA 4H6SB 1EOLA 2GVFA 1C4U2 2A4QA 3ATWA 1HAYB 3B8JA 1PPGE 3GY3A 4NSVA 4DCDA 4I33A 5GIBA 3SBKA 1WCZA 4Z1MD 3SGAE 2Z3DA 1QL7A 2FLBH 1LVMA 2HLCA 3FOAA 1C5SA 5LPRA 4ZKRU 5HM9A 3A8CA 3UY9A 1SGFG 1P05A 5DP6A 5EU8A 7GCHF 1QQ4A 1QURH 1XUHA 1YPHC 1OP8A 3GY5A 1H9IE 1ELGA 1K1IA 2PTCE 3KHVA 3ZZAA 2G52A 1MTVA 1Q2WA 3A7YA 2WV4A 3E6PH 3KF2A 2ZHEH 2DE9A 3ZVAA 3ATKA 1FMGA 4FOUC 1O36A 5EOKA 2BD4A 3SI4H 5GNDA 1FY8E 1TMTH 3BSQA 5C94A 1JRTA 3S0NA 3NRLA 5C3NA 4GAWA 2VH0A 1HAIH 4FU8A 2YNBA 1AFEH 1YY3A 1MTNB 4HFPB 2ZU1A 2W3IA 2DE8A 3SUFA 1NS3A 4XSKU 1CGIE 1GI6A 1IOEA 1OX1A 2GGVB 3JZ1B 5B6OA 2J38A 1Y5UT 1Z8IB 4P00A 4I8LA 3AW0A 4Y71A 4AFSA 1FONA 5JBAS 4RKJB 1ESBA 1OHHD 3GY8A 4YT7H 4AG1A 4HZHA 2FLRH 2FI3E 4B2BA 1GJCB 1W7XH 1CA0C 4BAQB 1DE7H 1CHGA 2ODPA 2V35A 1OWDA 3QLPH 1O2QA 2F9PA 2PW8H 4RT1A 2FTMA 1UK4A 3LDXH 4TSFD 2CHAB 4HI3A 1T4UH 1A0LA 1J15A 2NU3E 4WH8A 1QTFA 1C2KA 2PFEA 3E0PB 1UVPA 1SLWB 4TT3D 1C5VA 2WPJS 1V2RT 3GDUA 1S0RA 1ANCA 3UQOA 1QBOA 1V2TT 2A4OA 2ZIQH 3UNRA 3S9AA 4XDEA 4CHAC 1ZGVA 1JWTA 1NRNH 1B7XB 2GMTC 3GCHC 1QFKH 1LMWB 2ZP0H 3M61U 1P2OA 5FBIA 2VIDA 5L2YH 1ESAA 1HFDA 5LH8A 2PGBB 5FBEA 3F9FA 4OS6A 2Y6TA 3K65B 4UFGH 5EJZA 2G81E 2H6MA 1HJAC 2ZU2A 3TH3H 4AX9H 4GVUA 5EW2H 2PV9B 4ZKOU 1SGQE 1KDQB 3KEEA 4FUHA 3SV2H 1OSSA 2ZQ2A 2VIOA 1UK3A 2WYJA 1TX8A 5GXPA 4ISIH 9LPRA 1PFXC 1OXGA 1D4PB 4ASUD 1NT1A 4FUJA 2CJIA 3QZRA 4U32A 2WPMS 1AY6H 1V2WT 1SQOA 5C2ZA 4F55A 5F03A 1GJ7B 1KLJH 4A92A 1YPJH 1C4Y2 3SU2A 1O2JA 1LHGH 1NC6A 2GDDA 1D6WA 3OSYA 1F92A 3BG8A 2BVXH 4BAKB 1C5NH 3URCA 3MFJA 2K8IA 3ZZ4A 4B6FA 1A4WH 1VKYA 3DFLA 1QGFA 1Y3VA 3NWUA 1F0TA 3UOUA 2OINA 4X1RU 2ZU3A 1OWKA 2F3CE 3PLBA 1ETRH 1GPZA 1YPKH 3ITIA 4OS4A 2STBE 1BHXB 1AN1E 1FAKH 1H4WA 2CF8H 2M2AA 3A82A 2ZCLP 1P03A 1IQEA 3MU5A 3A8DA 3HK6B 3MWIU 5C0TA 1DWEH 1H9LB 3ATMA 3RM2H 1OYQA 5F8ZA 3GCTF 3I78A 1YPLH 4GHTA 2P16A 1RD3B 2ZTZA 1L1NA 2BQ7B 2F43B 1O2YA 3QZQA 1MKWK 5C5NA 2SNVA 1QRXA 3RXHA 3A80A 2G8TA 4R0IA 1BHXF 2V3OH 5AHGH 1C5QA 1CGHA 1ELTA 1YPHE 3EA8A 3A7TA 1WUNH 1ELVA 1BZXE 3GY6A 3TJVA 5EJ1A 1EJAA 2TBSA 1C1VH 4I8JA 2HALA 1AFQC 3BTGE 1C2DA 1UVUH 4NWKA 1T8MA 3UB0A 2I6SA 2PR3A 1S6FA 1W3CA 2ZDLA 2ZFPH 3URDA 4O3TA 1DSTA 5DP9A 3A85A 2NU2E 8LPRA 1DX5M 2BD2A 2C93B 3FO8D 1P2IA 3RMMH 2ZC9H 4NA7A 2WHXA 1O2HA 1DOJA 5JB9S 2ULLA 1UTQA 3PB1E 4Q7YA 3MNSA 1EJNA 1NZQH 1A7SA 3VGCC 4LK4A 4Y6DA 1ZLRA 1GMHG 2W6ID 1A5IA 3WW7A 5JPMH 3RXTA 1TMUH 4ASHA 5B6LA 3SGBE 1A3BH 2W5EA 3SI3H 2BVSH 5ETXA 1ZOMA 1AB9C 1UK2A 4Y11E 1EPTC 1O3JA 4X1PU 2FS8A 2Y7XA 2YMSB 4FXGH 2P59A 1LPZB 3RM0H 1FY5A 1LVYA 4NZLA 1SBWA 3ZVGA 3TNTA 3RXRA 2PSYA 1EQ9A 1F0SA 2FOFA 2OP9A 1DS2E 5DK1A 3FP7E 2NU1E 1LDTT 2XWBI 2Z9LA 3P17H 1ZR0A 3H5CB 2ZPSA 3FP6E 4ZMAH 2HNTF 1TGSZ 2TRMA 1GHBG 4Y76A 3SQEE 4XFQA 4I86A 1O32A 5DG6A 3QX5H 5H4IB 1YGCH 3RXFA 1NO9H 1TPSA 2Q1JA 2B5TB 3W95A 4DT4A 3SV8A 4I7YH 4INKA 5A8XA 4NIVA 1BITA 1P2QA 4X1NU 1B5GH 4UEHH 1W0YH 5JB8S 2L6OA 2FTLE 1YF4A 3M3SA 1FAXA 1GMCG 5PTPA 1LHCH 4A7IB 1PJPA 1G32B 1XUIA 4TWWA 1ELBA 1DVAH 1UTOA 4K8BA 3UTUH 1PPBH 2BLVA 1ELDE 3IITA 4OS7A 2Z9IA 4AB8A 2EEKA 5DJ7A 2OTVA 3MI4A 2J98B 4Y8YA 2QCYA 1AWFH 2RDLA 1MTWA 3N7DA 1NY22 2PHBA 3GISB 1GCTC 1K1OA 1O5CB 1GI7B 2G4UA 2OQUA 4ABAA 3MNBA 3KQEA 1E0FD 1V6DA 2SGFE 3S9BA 1SVPA 1HAHH 3LC5A 4UDWH 4ABIA 3KNXA 2FYQA 4X6OA 2KCYA 1FV9A 5T1VA 4BXWA 4YZUA 3TGJE 1O2LA 1XXDA 2P95A 1EX3A 3M5NA 3Q00A 4INLA 3BTQE 1HAGE 2AS9A 1SGYE 2FWWA 2O9QA 1GBLA 1C9TA 1NU7B 1V2ST 2BZAA 5EPYA 1HBTH 3UR9A 4RSPA 1NTPA 2ZGHA 3IG6B 4XBBA 2F9BH 5DN6D 3F3BA 4ACAA 4F4OC 3ZZ8A 2PUXB 1GMHF 2JH6D 4RKOB 1ZTJA 3SJ9A 2BMGB 2JKHA 4X2XA 2ZEBA 1RIWC 5K0HA 1FJSA 1V2KT 3EAJA 5A8ZA 1C2GA 4Z0KA 1CU1A 1W14U 2FO9A 2F83A 5A8YA 3QN7A 2QF3A 2ZDVH 5A0CA 3PMBB 4ZHMU 1SFQB 2QF4A 4TWYA 2GTBA 1VCQA 2OC8A 2ZPQA 1BCUH 3BF6H 5C0UA 4JMYA 1OS8A 2L74A 3RXGA 2QV1A 3LGYA 2Z9GA 3DSOA 2FMJA 3T28A 3EE7A 4XBDA 4Y7AA 2A4GA 4ABGA 1GBFA 3U8RH 6GCHF 1P10A 1FXYA 1UTJA 1O0DH 1O2NA 1GHBF 4CRAA 1UW7A 4NA9H 5DKMA 1RTLA 3HK3B 1IQGA 5F6MA 4IBLH 1TOMH 3GDSA 2TGTA 1D3TB 2Q6DA 1F5KU 1O39A 1BRAA 3S69A 3PM3A 5BPEA 4FU9A 3L6PA 3ODFA 2ZFQH 3TK9A 3TJUA 1GBHA 1VZQH 1GMCF 2R3YA 1T31A 3B9FH 2GJGA 1NRQH 1AMHA 5ESBA 4PROA 1BIOA 2LPRA 3PO1C 2WPDD 3DSPA 1GI2A 2R3UA 3RC5A 2AGGX 1XM1A 1VJ9U 2AMPA 4F49A 4FUBA 1CGJE 2CGAA 5E0JA 3T2NA 2CK3D 4YTAA 1P2JA 2C8YB 2EA3A 1HDTH 1TOCB 4GUXA 2HLDD 1Y3UA 1COWD 1QBVH 1AE8H 1BT7A 3H09A 4CH2B 3DA9B 1UJ1A 2A5KA 3UQVA 1Y5AT 5DSFA 5EW1H 1B0EA 1PPEE 2O8MA 4JYVH 4H4FA 4BANB 1QB9A 2FEQH 2QF5A 3D49H 1EPTA 4X1SU 5F8TA 3ESTA 2P8OB 2D1JA 3T25A 3OTPA 3V7TA 1O3HA 1QY6A 1QQUA 5GWZA 1F5LA 1P3CA 1UCYH 4MTBA 1F7ZA 1AD8H 6CHAB 2H9HA 1CBWC 3GOVB 5HIYA 3VB7A 2ZI2H 4NFFA 3L33A 3A81A 4WWYA 2EI8A 2A32A 3SHAH 2C4FH 3DHKH 1G3EA 2VNTA 5HXFA 2ZFSA 2IPQX 1Y3WA 2BQ6B 1B0FA 1TNGA 2FIRH 2GT8A 2OC0A 1FPHH 2ZWLH 5F53A 2DUCA 1O3CA 5JBBS 1MBQA 2SGQE 1D3PB 2A5AA 4B6EA 2BD5A 4HTCH 1P3EA 1ZPZA 3SYJA 1LHFH 3EE0B 4D76A 2FYRA 2BD3A 1HCGA 2VIWA 2XRCA 2XOKD 3O8BA 1EP6A 4BXSA 1IQIA 2QA9E 1ZRBA 4D7FA 2Y5FA 2SNWA 5AFZH 1F0RA 2WSSD 3LGTA 1Q3XA 1BBRE 2Z3CA 1W0KD 3FZDA 5FPTA 5EPNA 3O8CA 1A3EH 5C67A 1L1JA 4Q63A 3TU7H 2ZDAH 1GGDC 1ZMNA 2IJOB 4KP0A 1TPOA 1H8IH 1ANDA 1GI4A 4SGAE 4OM9A 2UUYA 5AF9H 5C20A 5CE1A 4IMZA 2VJ1A 3SORA 1QA0A 2O8LA 2R0LA 2JJ2D 4JZIA 3F9HA 1MU6B 3LGIA 3NUMA 2FM2A 2F91A 1F2SE 1TWXB 4JZDH 1IQFA 1BUIA 2SGPE 5JDUB 1Q31A 3R0FA 3RXVA 2ZGBH 4YOJA 3OY6U 4IN2A 1OWHA 3CS0A 3MNCA 1JBUH 1C2LA 3UNQA 4B71A 1C1RA 1SQRA 2ZU4A 3E3TA 1YBWA 1ZPBA 4WXVA 2ZU5A 4CR5A 1ZRKA 3AASA 2K1QA 1S83A 3A88A 7LPRA 1QJ7B 4MNYA 2XC5A 1S81A 4MPXA 1V2VT 4LXBH 3A7VA 3SNCA 1GCDA 3A8BA 3LC3A 4E7RG 2GCTB 4H6TA 4JYTA 1TGTA 1UMAH 1SHYA 1UTPA 2QC2A 3LGVA 1C2EA 1C1QA 1HXFH 4YXWD 1KTTB 2QXGA 4IW4E 1HB0B 3SNDA 3NPSA 4LOYH 5EGMA 1TBQH 1DM4B 1O2OA 1NU9A 1P01A 1TB6H 4A1VA 1JOUB 1WTHD 2J2UA 2VH6A 3RU4E 4ABEA 1HPGA 1GBKA 1MTNC 2KZ4A 5FCKA 4TPIZ 1UVTH 3QO6A 4FUGA 1C5LH 4GCHF 1ZJKA 2A7HA 3LT3A 4ZCNA 5GPIB 1P2NA 3I77A 2RG3A 3MTYA 1K1NA 2BY8X 2Y5GA 2BY7X 7ESTE 4CR9A 3TGIE 3RXBA 5E0HA 3PTBA 2UUKB 3UUZA 1P2MA 4GSOA 1O3EA 1WQSA 4H42U 1NN6A 1KTSB 1SQAA 3U8OH 3PV4A 2GKVE 4K1TA 4AYVB 1PYTD 2FS9A 1INCA 3ZZ9A 2ZG0H 1XVOA 2GCHF 1ID5H 1QA7A 4A6LA 1BRCE 1JIMA 5FX6A 5HM2A 1Y3YA 1SGPE 4THNH 2QXHA 1K1PA 1RS0A 2GP9B 2HPQH 1DLEA 1AU8A 2ZA5A 1NRPH 2XNDD 1LHDH 1P06A 3GY2A 3ZIAD 1AKSB 2BVRH 3KCGH 1DWDH 2UWOA 3FFGA 1GHXH 3M5LA 3M5OA 5T6DA 1E34B 3RP2A 1LPGB 3RXCA 3ZVCA 3QTVH 1L1GA 1O5EH 2XBVA 3ZZ6A 4CRFA 2R2WU 1HAZB 2BDCA 1VJAU 9ESTA 2XYAA 4BAHB 3AW1A 1UTNA 3PLKA 4U30A 4F48B 2AGIX 3SNEA 1WTGH 1Y5BT 4K2YA 3IWMA 1H8HD 3UOPA 1PPCE 3SUDA 2P93A 2A4RA 1O3KA 5DP8A 1SGRE 1GHAG 1Z1JA 1BA8B 1YCPM 1ANEA 1SPJA 1QZ8A 2WYGA 4ZKSU 4YO9A 3O8RA 1ESTA 3ZVFA 4Q7ZA 1AQ7A 4IGDA 2ANYA 4R8TB 2NU4E 1S84A 4XOJA 1M9UA 1CA0B 3M36A 1TQ7B 5SGAE 1FDPA 2XW9A 1SB1H 2KX4A 2VIPA 1GI3A 1O33A 3N99A 1O3GA 5T6FA 4U2WA 3UWJH 2BTCE 3RXJA 2BXUH 3TK5A 3FN8A 2PWXA 1O3DA 4NIYA 1UTLM 1GJBB 2FESH 2EI7A 1TGCA 4BTTB 3SV6A 3V3MA 1SFIA 1CT0E 1AE5A 1QJ6B 3SZNA 1PPHE 5EXLA 1WAYB 2A45B 2FODA 2VIQA 3MO9A 4TPYA 4X1QU 1EASA 4FUEA 1ZSLA 5A09A 1YPGH 4Q7XA 4CRDA 1BMFD 1GBAA 2AIQA 2BXTH 2D26C 4WF8A 1PQ8A 1G9IE 2GMTB 2H9EH 2AIPA 1G37A 3GCHB 1QBNA 5E8EH 1WQVH 1FNIA 2W3KA 3D62A 2A31A 3R3GB 3SJ8A 2WPLS 4FU7A 4DIHH 3SO3A 1WV7H 5JBTA 1Y8TA 1V2OT 1VITH 3ZZ5A 4J1YA 1HJAB 1NBMD 4KTCA 3A89A 5BRRE 5HYOA 3DCLA 3KQBA 4I32A 1KXDA 1FUJA 3F9EA 3GY4A 2YMSD 3H7OA 2JH0D 1C2MA 2JJ1D 3EDXB 4MDSA 3STIA 4DY7B 3OX7U 2XCNA 1C5TA 2P3TB 4KKDA 1HXEH 4AZ2B 1O3PB 1T7CA 2R2MB 2V7QD 3S7HB 4Q80A 2TGPZ 1T8LA 2WV9A 1J8AA 2J95A 1C1WH 2IOTA 2PSXA 4DW2U 1O2SA 3WY8A 3VB3A 2J34A 3QGNB 1DLKB 1NROH 3RMNH 3QDZB 1A61H 2G5VA 2O8TA 4ACBA 1V2NT 1C1TA 1GDQA 1RRKA 3BG4C 4K1SA 2GDEH 2HPPH 1T4VH 4DGJA 1C5MD 1TX7A 1ELCA 2QF0A 5FPSA 1FN6A 2TGAA 1W7GH 1FY4A 1PQAA 1QB6A 2F4LA 1MU8B 4CRGA 1GHAF 3T26A 4WMEA 2BM2A 1WDIA 4UONA 1IQJA 3Q76A 2J94A 3SNBA 4AN7A 3NKKA 1NRRH 2WPKS 5GDSH 1EUFA 2P94A 1LCYA 3F0PA 1C5RA 4MPWA 4LZ4B 2BOKA 3LGUA 1GG6C 5I46H 1TX6A 3MH5A 3U1IB 1EZQA 2ANWA 3CS7A 1SLXB 3F2GA 1WU1A 1THPB 4DT7B 2AH4X 3HATH 1EOJA 1LVOA 1HYLA 3Q77A 5TCCA 2O8UA 3W94A 4YLQH 7KMEH 2VVCA 2VWMA 2LELA 1YLDA 2JETB 1S5SA 1O2VA 2C8WB 4Z6AH 1NFUA 5AFYH 3MO3A 1QL9A 1X7AC 1TE0A 5HMAA 1A1RA 1EZUC 2PKSC 4YESB 2BY5X 5TJXA 1MQ6A 2W7SA 2VWLA 1GJ6A 1IHTH 3FKSD 1SGEE 4X8UH 1HUTH 1UCYK 1LKBA 1XMNB 3ODDA 8GCHG 5LGOA 1XKBC 1EATA 3KQCA 3VGCB 3C1KA 4CREA 1GHWH 3E90B 4I31A 1O3LA 1MMJN 4VGCC 2XC4A 3A7XA 4WH6A 4TY7A 1EP5A 1O2TA 3U69H 4DVAU 4BAOB 1P9UA 1VGCC 3RXIA 3VB5A 3SNAA 4Y0ZE 1C5ZB 1P8VC 3MU1A 2Q6GA 3VFEA 3AAVA 1CT4E 1XKAC 2OD3B 2KAIB 4AFZA 1DWCH 3EQ0H 1P0SH 4WY3A 1AB9B 3OAAD 1EPTB 3BTTE 3HGPA 1EXFA 5HIZA 2BX3A 1C1UH 4NCYA 2XBWA 4MG3A 3RXSA 5F8XA 4X8VH 4YM9A 5ABWA 3UPEA 1K2I1 1HAVA 2WUCA 3E16B 5FPYA 2G00A 3P8OA 2ZDKA 3JZ2B 4GHQA 1ELAA 3PWCA 3TH4H 4JK6A 4DG4A 2CXVA 3QUMP 1O5BB 1TNJA 4MNXA 1CA8B 1SGNE 4A1XA 4O9VA 3RXEA 1LPKB 1TPPA 2GV6A 4FUDA 4CBOA 5LPFA 1BMAA 3L3TA 3UFAA 1EB2A 6LPRA 1LQDB 1MTSA 1Z8GA 1GL0E 2J92A 1GJ4H 4B2AA 1DITH 1THRH 4XRNA 4WVPE 4D7GA 3GCNA 4JK5A 1P11E 3ZZCA 5A0AE 4ISHH 1PPFE 4WMDA 1GHVH 1P9SA 1LO6A 2H1UA 3M3VA 1O37A 2VINA 1SGIB 4ZHAA 1J17T 1TABE 1KIGH 4Y8XA 5CMXH 3K2UA 1GCTB 2CN0H 4ABDA 2BDAA 5CDFE 2EC9H 4NIWA 1VR1H 1G3BA 3EYDA 5EQSA 1BJVA 3BEFB 3MH6A 4O03A 4AORA 2C8ZB 3MHWU 2ZDNA 1BMLA 3EGKH 1QHRB 3BIUH 1N6YA 5I25A 1SHHB 1OKXA 3M37A 1OP0A 1BB0B 1GDNA 2OBQA 3PYHA 3U1JB 3Q3XA 4TYDA 1GBTA 3WWBA 8GCHF 1AIXH 4OS1A 1ABIH 3F6UH 1W2KH 2UUFB 3F2HA 4ABFA 3LJOA 2OBOA 2FOEA 5G4BA 1OPHB 1SG8B 1SLVB 1ZHMA 1QRZA 4HGCA 5DPAA 8ESTE 3OEED 1S82A 4JZFH 1J16A 5FHTA 2ZZUH 3M7UA 2VWNA 3VXFH 1BTPA 4AC9A 3T27A 1PQ5A 4OGYA 1C1SA 2GX4A 3A7WA 1GWAA 1AVXA 2FXRA 1KMHB 1IQLA 1G2LA 3OU0A 1ZYOA 3TVJB 5EJLA 1O2GH 2NWNA 2HRVA 2ZECA 1MTUA 3TLOA 1MQ5A 3MO6A 4INHA 2ZFRH 3U98H 5CHBA 1Z6EA 1O2UA 1FY1A 4M9FA 3TH2H 1ELEE 1T8OA 4D9QA 5HKKD 2BOHB 4ZXYH 1A2CH 1YLNA 1O31A 2PTNA 4AYYB 1GVKB 1SL3A 1QJ1B 3PLPA 2AERH 3SUEA 1ETTH 4UD9H 5HGGA 5FX5A 5EXNA 3PRBA 1CE5A 1HJ9A 3A87A 3SU5A 2BHGA 2J4IA 1GBIA 3BTWE 1YWUA 3PO1B 3ZZ3A 4IS5A 2KCPA 2ZGJA 3RU4T 3FAOA 1DFPA 1XXFA 3PTNA 2BLQA 1BTXA 3BTHE 1DICA 1ZHPA 3BEIB 5LPEA 3T29A 3V12A 3ZYDA 3C27B 3GCOA 4ZHLU 1O35A 4GPGA 3NCLA 4UE7H 3BTFE 2WUBA 2A7CA 3F68H 4AGKA 1RFNA 2KR7A 2SGEE 5FL7D 4FUFA 3TJNA 3KYFA 3KYGA 3HKIB 6ESTA 1ZZZA 5EIYA 3OEHD 1O30A 3SU0A 1L0ZA 1GBEA 1LVBA 3LOXA 3QWCH 1MCVA 2BY6X 2FI4E 2YOLA 1BDAA 1E38B 1QR3E 1CQQA 4I8GA 1IHSH 4K3JA 2GD4B 1ZPCA 2ZHFH 1KXCA 3MOCA 2SGAA 4ABHA 4J2YB 3HPTB 3PMAB 2UWLA 3BN9A 1PPZA 3OTJE 4BNRA 5AVDA 3NXPA 1OWJA 4A5TS 5J4SA 4ZAEA 3MU8A 1UO6A 5CHAC 1YYY1 1V2MT 4NSYA 1F5RA 4IC6A 1T32A 2WZQA 3E1XB 1W11U 1TNHA 1S6LA 4ISNA 3TGKE 3MQKC 4ISLA 2HVXA 1QRWA 2VGCB 1WBGB 4P02A 8KME2 1Z8JB 2WPHS 4FVBA 1UVOA 2J9NA 1HIAA 1GL1A 3RXKA 4X0WU 5T3HA 4X2YA 1UHBA 1SQTA 1A5GH 1W8BH 1GGDB 1GI9B 2QY0B 1DUEA 1G3CA 3RXLA 1QIXB 5E2OA 4NFEA 1WYKA 3V0XA 1QB1A 1SMFE 2P3UB 1UTKA 3HKJB 5EQRA 3TJOA 1K1MA 1DXWA 2BYAX 4B1TA 4Y8ZA 4Q4LA 2IPHA 1O3IA 1MD7A 2OLGA 1JIRA 1GMDG 1TBZH 3Q3YA 3OE7D 3QK1A 1OWIA 4ABBA 4MPVA 2ALVA 1K28D 1DSUA 1C2FA 2QGRA 4FUIA 4CRCA 2LP6A 3MU4A 1KSNA 3P70B 2B0FA 1AVWA 2BDIA 2BD8A 1FN8A 1TNIA 5C5OA 3SU6A 1O2RA 3MMGA 4KELA 1Z1IA 1GJ9B 2BLOA 1E1RD 1CO7E 1O2IA 2VBCA 3E0NB 1MH0A 1C9PA 3FP8E 4O3UA 1O3OA 3VXEH 1ZTKA 3A8AA 2QXJA 4X6MA 1EAXA 1N8OB 2SFAA 3GY7A 1GBDA 3SZEA 1KXBA 1NRSH 1BTWA 1JMOH 2CF9H 3KIDU 4YLUA 1Z6JH 2ZKSA 2IJD1 1O2WA 3BTDE 4ESTE 2CHAC 4OGXA 1NFYA 4AFQA 2A7JA 3SU4A 1IQKA 1GJ5H 1FLEE 4AOQA 4K69A 2PUQH 1C5XB 1GVLA 2JDID 4X6PA 1GBBA 4JYUH 2ODYB 4NG9H 4K5ZA 2BQWB 2PKAA 1AVGH 4UFEH 1PYTC 1TIOA 3SW2B 2GT7A 2ZQ1A 1TRNA 2HOBA 1D3DB 1S85A 2D8WA 2M5TA 2ZPRA 3KQ5A 1L4DA 2VB0A 4NWLA 1FX0B 1O34A 1KLIH 2QYIA 3GCTG 3F1SB 3SN8A 1EAWA 1BTHH 4E7NA 4DOQA 3RMLH 1D3QB 1ZHRA 3SUGA 3UWIA 5FXLA 2ODQA 1AZZA 3O8DA 1HV7A 5E2PA 1MAYA 1QL8A 3DD2H 4B74A 2J5UA 1YPEH 1C2HA 3NZIA 1HAXB 2HWLB 3SOSA 1DDJA 4BOHA 4IC5A 3ENSB 1GMDF 3TITA 2V3HH 3FZZA 1HAOH 1C2JA 3VPKA 1RXPA 1K1JA 2Y5HA 2R0KA 2A1DB 1TLDA 4K8YA 4E06H 5KEDA 4JCNA 2Z9JA 2ZHWH 3PWBA 2QE7D 2V0BA 2BB4A 2ANKH 2SGDE 1ACBE 1MAXA 1GI0A 1ZSKA 1XUFA 3RXOA 1EZSC 2XBXA 3LJJA 5JBCS 1MKXK 2Y7ZA 1SKYE 2AHME 1O2MA 1GDUA 1O3AA 3H7TA 3GICB 1Z8RA 1AUTC 3WWFA 1HRTH 2QXIA 3UNSA 1C5OH 3S7KB 1DPOA 1BTZA 1AO5A 2FOBA 4X2VA 3ZZ7A 4CBNA 3SU1A 2XTTB 2ZFFH 4CHAB 1CSOE 2ZDMA 1DWBH 3T62A 2XBYA 3AK5A 1O5AB 3RC4A 5J4QA 2C8XB 3SHCH 5C1UA 4XE4A 3P6ZB 1LHEH 3HGNA 1E1QD 2C3SA 1SC8U 4ZXXH 2JIZD 1EKBB 1ZGIA 3A86A 1TA2A 1BBRH 4X8SH 3AVZA 2Q6FA 3DUXH 3PV2A 4MPUA
chains in the Genus database with same CATH topology
1C1PA 1AZ8A 1HAVB 4AB9A 1OYTH 1O2XA 1SOZA 1GVZA 1QCPA 1TGNA 1ZSJA 1AI8H 2YNAA 1BRBE 2AEIH 1O3BA 1CT2E 2FOHA 2W26A 2XCFA 3ZZDA 1E37B 1TONA 3EA9A 4JZ1A 4NIXA 5T6GA 4FVDA 2B7DH 1O5GH 2BDHA 2ZGXH 4I8HA 3UREA 3UIRA 3SJKA 1BMNH 3VB4A 1ETSH 1SR5C 1UCYE 1NFXA 1RTFB 4Y10E 1PQ7A 4ABJA 1OP2A 3S9CA 2FP7B 4B73A 2BLWA 2B8OH 2HNTC 1SOTA 3B23B 1E35B 3D23A 4K60A 1AKSA 1NESE 1SI5H 1SSXA 4X8TH 2JETC 2Y81A 3LH3A 2QIQA 1GBMA 1C5PA 3A84A 1TAWA 2Y82A 3TPIZ 4NZQA 4X2WA 3OYPA 3M5MA 1TALA 1D6RA 1KLTA 2BDGA 2G55A 2QAAA 3SV9A 3K6ZA 4NGAH 3BEUA 1FQ3A 1VCWA 1BJUA 1C1OA 3MYWA 5FAHA 1AGJA 1V2JT 4WJG2 5DP5A 1MZAA 4UFFH 4DIIH 1YCPK 2Z7FE 1L2EA 4Y0YE 1YM0A 2EI6A 1AFQB 1YPMH 1TNKA 2GZ7A 1O3FA 1EJMA 1XUGA 1DT2A 1TRMA 1SGFA 2VVVA 1THSH 5GCHG 3SU3A 2Z6BD 3BG4B 5L2ZH 4JZEH 3E91A 3A83A 2TGDA 4E05H 3LU9B 1C4V2 3D65E 1ELFA 1NFWA 1GBCA 2Y80A 1YP9A 4AGJA 3DT0H 1KDQA 3KQDA 5DO4H 2F9NA 5EODA 2F9UA 1LQEA 1EB1H 2PGQB 2GZ8A 4YOGA 2H2ZA 2ZF0H 4LZ1H 2BD7A 6GCHG 1RGQA 3GYLB 4YOIA 1GI1A 5K7RA 4ISOA 1H1BA 1VITG 1GG6B 1WOFA 1BMMH 1AWHB 1XVMA 3A7ZA 1KXFA 3MNXA 2FZZA 2G4TA 1AUJA 1GJDB 1MKXH 3ZYEA 5IYTA 1LKAA 4KTSA 3FANA 2A2XH 3ATIA 1IAUA 3BIVH 1Z71A 1SLUB 4BTIB 2ZHQH 2QN5T 1BQYA 2ILNA 3P8GA 3PROA 5L6NH 1TA6A 5C1XA 3P8FA 3TK6A 4X6NA 2PKSB 1CVWH 3QGJA 2H9TH 1GHZA 1UTMA 2AGEX 1A0JA 4OS5A 1NPMA 3P92A 4DURA 2G5NA 4BTUB 3P8NA 2H5CA 3M3TA 1DXPA 1Y59T 4MQAA 1YLCA 4SGBE 1N6XA 3RLYH 2VVUA 1GI8B 4VGCB 1BTYA 1K9OE 3E8LA 5A2MH 5E0GA 2R9PA 2VIVA 1ANBA 3LPRA 1DANH 1VGCB 4BAMB 3I29A 5GJ4B 2Z9KA 1O3MA 2A0QB 4YT6H 1C1MA 3RXDA 5FCRA 4FUCA 1BTUA 3K9XB 1T8NA 1V2LT 1KXEA 3GYMA 2BZ6H 5A0BA 3ZVBA 3UR6A 2AMDA 1S6HA 2G51A 4D8NA 1HLTH 1YKTA 1P57B 1FIWA 4RN6A 1OWEA 3EA7A 4WXIA 1XUKA 1KYNA 2ZO3H 1FPCH 4NA8A 1O2ZA 3T5FH 1RJXB 3PMHB 1A5HA 2TPIZ 2ANMH 1GJ8B 1G2MA 3KL6A 1MCTA 3BTME 3SJIA 1MKWH 1C5YB 2HGTH 2W7UA 2OC1A 2ZCKP 2ZNKH 3CENA 3GDVA 5GCHF 2OUAA 3AAUA 3BTEE 4K1EA 2IN2A 1CHOG 2BDBA 3MH7A 1FY3A 3ZVEA 2FOAA 3DFJA 3M7QA 2ZTXA 5DP4A 4UFDH 1FI8A 2VU8E 5IDKA 1V2UT 4MVNA 2CV3A 3RU4D 3F9GA 2HNTE 2I6QA 1VCPA 3ZZBA 2AFQB 2F9VA 3N7OA 1O2PA 3BV9B 2RA3A 3ELAH 3RXMA 1RIWB 1IQHA 2P8OC 5ESTE 1ARCA 5L30H 2AMQA 1VITF 1O2KA 3Q3KA 3G01A 5C1YA 2LNCA 1V2PT 1ZMJA 1HIAB 1IQMA 1P09A 3M7TA 3LONA 6CHAC 4B2CA 2GV7A 2P3FH 2ZGCA 1UHBB 1Z7KA 1GI5A 1YCPH 3KGPA 4ZH8A 1MZDA 3RMOH 1O5DH 2OXSA 3BTKE 2Z3EA 4IMQA 3SV7A 3NK8A 4Q2KA 1MUEB 3RC6A 1W13U 3MH4A 1UVSH 2ZHDA 4I8KA 3OY5U 1TFXA 3P95A 1JXPA 3QTOH 1ORFA 1LTOA 2ZTYA 1TQ0B 4ZROA 2BD9A 2KAIA 1Y3XA 1DUAA 4WMFA 1W10U 3PMJA 4MLFB 5DP7A 1HGTH 2V6NA 2BDYA 2FDAA 4CRBA 1TYNA 4U01A 1IQNA 2C90B 3ZVDA 1NM6A 2ALPA 1ZTLA 2PLXA 1O5FH 3LKWA 2OQ5A 1WSSH 3K6YA 1A0HB 1FIZA 1DY9A 3ZV9A 1GJAB 3SGQE 1V2QT 2FOCA 4ZKNU 1O38A 5DP3A 1SGDE 1G3DA 3CP7A 2OC7A 2WINI 4A1TA 2O8WA 2XXLA 2JH5D 4KGAA 1AHTH 3VEQB 2FPZA 1SGTA 2OCVB 5EXMA 4O97A 3RUOA 1U6QA 2B9LA 2D2DA 3SQHE 2F9OA 3V13A 4B76A 1GHYH 1N1LA 1MBMA 1XX9A 1H9HE 2TIOA 1CHOF 1P2KA 3KN2A 1RTKA 3LGWA 3RXAA 4OS2A 2ZCHP 7GCHG 4B75A 1L4ZA 1CBWB 2AYWA 4GCHG 1J9CH 3MU0A 4TY6A 1C1NA 4MNWA 1JRSA 1S0QA 1E36B 2GZ9A 2WPIS 2PKAB 2VGCC 2STAE 1HAPH 2RCEA 5TCAA 4AG2A 3TNSA 3RLWH 1TRYA 3U9AH 1A46H 3ZV8A 1SGCA 1P04A 1K1LA 3LH1A 1V3XA 1TPAE 2ESTE 4ZUHA 1OOKB 2ASUB 2FI5E 2BX4A 1D9IA 1TMBH 1ZMLA 2GCTC 4MNVA 2FOGA 2GCHG 2BY9X 1EZXC 1TGBA 3RXPA 1G36A 1QNJA 1W0ZU 2A5IA 1EAIA 4GLYA 2H5DA 1G30B 1GBJA 4KTUA 3RXQA 4QT8C 3SJOA 1DY8A 3FVFB 1W12U 3STJA 3VB6A 4CH8B 2CMYA 1FZZA 4M7GA 4DJZB 1TBRH 1J14A 2THFB 1ARBA 4IN1A 3M35A 2VWOA 1H8DH 3TIUA 5DGJA 5EQQA 3RXUA 1MD8A 2NU0E 1ZJDA 1HNEE 4XBCA 1KY9A 2Z94A 1C5UA 5JYIA 1K21H 1XUJA 2XNIA 2FX6A 2XWAA 4Y7BA 4D9RA 1C2IA 2ZFTA 1K22H 2A2QH 1BOQA 1F0UA 1C5WB 2FX4A 2UWPA 1N8OC 1P12E 1HJ8A 2UUJB 1P02A 1TNLA 4Y79A 3RDZA 1ABJH 1BBRK 1EAUA 1KXAA 2RA0A 3U8TH 1O3NA 1YC0A 2FOMB 1BRUP 5EG4A 3LIWA 2XC0A 3ATLA 5CHAB 2WV5A 4AFUA 4H6SB 1EOLA 2GVFA 1C4U2 2A4QA 3ATWA 1HAYB 3B8JA 1PPGE 3GY3A 4NSVA 4DCDA 4I33A 5GIBA 3SBKA 1WCZA 3SGAE 2Z3DA 1QL7A 2FLBH 1LVMA 2HLCA 5LPRA 1C5SA 4ZKRU 5HM9A 3A8CA 3UY9A 1SGFG 1P05A 5DP6A 5EU8A 7GCHF 1QQ4A 1QURH 1XUHA 1YPHC 1OP8A 3GY5A 1H9IE 1ELGA 1K1IA 2PTCE 3KHVA 3ZZAA 2G52A 1MTVA 1Q2WA 3A7YA 2WV4A 3E6PH 3KF2A 2ZHEH 2DE9A 3ZVAA 3ATKA 1FMGA 1O36A 5EOKA 2BD4A 3SI4H 1FY8E 1TMTH 3BSQA 1JRTA 3S0NA 5C3NA 4GAWA 2VH0A 1HAIH 4FU8A 2YNBA 1AFEH 1MTNB 4HFPB 2ZU1A 2W3IA 2DE8A 3SUFA 1NS3A 4XSKU 1CGIE 1GI6A 1IOEA 1OX1A 2GGVB 3JZ1B 5B6OA 2J38A 1Y5UT 1Z8IB 4I8LA 3AW0A 4Y71A 4AFSA 1FONA 5JBAS 4RKJB 1ESBA 3GY8A 4YT7H 4AG1A 4HZHA 2FLRH 2FI3E 4B2BA 1GJCB 1W7XH 1CA0C 4BAQB 1DE7H 1CHGA 2ODPA 2V35A 1OWDA 3QLPH 1O2QA 2F9PA 2PW8H 2FTMA 1UK4A 3LDXH 2CHAB 4HI3A 1T4UH 1A0LA 1J15A 2NU3E 4WH8A 1QTFA 1C2KA 2PFEA 3E0PB 1UVPA 1SLWB 1C5VA 2WPJS 1V2RT 3GDUA 1S0RA 1ANCA 3UQOA 1QBOA 1V2TT 2A4OA 2ZIQH 3UNRA 3S9AA 4XDEA 4CHAC 1ZGVA 1JWTA 1NRNH 1B7XB 2GMTC 3GCHC 1QFKH 1LMWB 2ZP0H 3M61U 1P2OA 5FBIA 2VIDA 5L2YH 1ESAA 1HFDA 5LH8A 2PGBB 5FBEA 3F9FA 4OS6A 2Y6TA 3K65B 4UFGH 2G81E 2H6MA 1HJAC 2ZU2A 3TH3H 4AX9H 4GVUA 5EW2H 2PV9B 4ZKOU 1SGQE 1KDQB 3KEEA 4FUHA 3SV2H 1OSSA 2ZQ2A 2VIOA 1UK3A 2WYJA 1TX8A 5GXPA 4ISIH 9LPRA 1PFXC 1OXGA 1D4PB 1NT1A 4FUJA 2CJIA 3QZRA 4U32A 2WPMS 1AY6H 1V2WT 1SQOA 5C2ZA 5F03A 1GJ7B 1KLJH 4A92A 1YPJH 1C4Y2 3SU2A 1O2JA 1LHGH 1NC6A 2GDDA 1D6WA 3OSYA 1F92A 3BG8A 2BVXH 4BAKB 1C5NH 3URCA 3MFJA 3ZZ4A 1A4WH 3DFLA 1QGFA 1Y3VA 3NWUA 1F0TA 3UOUA 2OINA 4X1RU 2ZU3A 1OWKA 2F3CE 3PLBA 1ETRH 1GPZA 1YPKH 3ITIA 4OS4A 2STBE 1BHXB 1AN1E 1FAKH 1H4WA 2CF8H 3A82A 2ZCLP 1P03A 1IQEA 3MU5A 3A8DA 3HK6B 3MWIU 1DWEH 1H9LB 3ATMA 3RM2H 1OYQA 5F8ZA 3GCTF 3I78A 1YPLH 4GHTA 2P16A 1RD3B 2ZTZA 1L1NA 2BQ7B 1O2YA 3QZQA 1MKWK 5C5NA 2SNVA 1QRXA 3RXHA 3A80A 2G8TA 4R0IA 1BHXF 2V3OH 5AHGH 1C5QA 1CGHA 1ELTA 1YPHE 3EA8A 3A7TA 1WUNH 1ELVA 1BZXE 3GY6A 3TJVA 1EJAA 2TBSA 1C1VH 4I8JA 2HALA 1AFQC 3BTGE 1C2DA 1UVUH 4NWKA 1T8MA 2I6SA 2PR3A 1S6FA 1W3CA 2ZDLA 2ZFPH 3URDA 4O3TA 1DSTA 5DP9A 3A85A 2NU2E 8LPRA 1DX5M 2BD2A 2C93B 1P2IA 3RMMH 2ZC9H 4NA7A 1O2HA 1DOJA 5JB9S 2ULLA 1UTQA 3PB1E 4Q7YA 3MNSA 1EJNA 1NZQH 1A7SA 3VGCC 4LK4A 4Y6DA 1ZLRA 1GMHG 1A5IA 5JPMH 3RXTA 1TMUH 4ASHA 3SGBE 1A3BH 2W5EA 3SI3H 2BVSH 5ETXA 1ZOMA 1AB9C 1UK2A 4Y11E 1EPTC 1O3JA 4X1PU 2FS8A 2Y7XA 4FXGH 2P59A 1LPZB 3RM0H 1FY5A 1LVYA 4NZLA 1SBWA 3ZVGA 3TNTA 3RXRA 2PSYA 1EQ9A 1F0SA 2FOFA 2OP9A 1DS2E 5DK1A 3FP7E 2NU1E 1LDTT 2XWBI 2Z9LA 3P17H 1ZR0A 3H5CB 2ZPSA 3FP6E 4ZMAH 2HNTF 1TGSZ 2TRMA 1GHBG 4Y76A 3SQEE 4XFQA 1O32A 5DG6A 3QX5H 5H4IB 1YGCH 3RXFA 1NO9H 1TPSA 2Q1JA 2B5TB 3W95A 3SV8A 4I7YH 4INKA 5A8XA 4NIVA 1BITA 1P2QA 4X1NU 1B5GH 4UEHH 1W0YH 5JB8S 2FTLE 1YF4A 3M3SA 1FAXA 1GMCG 5PTPA 1LHCH 4A7IB 1PJPA 1G32B 1XUIA 4TWWA 1ELBA 1DVAH 1UTOA 4K8BA 3UTUH 1PPBH 2BLVA 1ELDE 3IITA 4OS7A 2Z9IA 4AB8A 2EEKA 5DJ7A 2OTVA 3MI4A 4Y8YA 2QCYA 1AWFH 2RDLA 1MTWA 1NY22 2PHBA 3GISB 1GCTC 1K1OA 1O5CB 1GI7B 2G4UA 2OQUA 4ABAA 3MNBA 3KQEA 1E0FD 1V6DA 2SGFE 3S9BA 1SVPA 1HAHH 3LC5A 4UDWH 4ABIA 3KNXA 2FYQA 4X6OA 1FV9A 4BXWA 4YZUA 3TGJE 1O2LA 1XXDA 2P95A 1EX3A 3M5NA 3Q00A 4INLA 3BTQE 1HAGE 2AS9A 1SGYE 2FWWA 2O9QA 1GBLA 1C9TA 1NU7B 1V2ST 2BZAA 5EPYA 1HBTH 3UR9A 4RSPA 1NTPA 2ZGHA 3IG6B 4XBBA 2F9BH 4F4OC 3ZZ8A 2PUXB 1GMHF 2JH6D 4RKOB 1ZTJA 3SJ9A 2BMGB 2JKHA 4X2XA 2ZEBA 1RIWC 5K0HA 1FJSA 1V2KT 3EAJA 5A8ZA 1C2GA 4Z0KA 1CU1A 1W14U 2FO9A 2F83A 5A8YA 3QN7A 2QF3A 2ZDVH 5A0CA 3PMBB 4ZHMU 1SFQB 4TWYA 2GTBA 1VCQA 2OC8A 2ZPQA 1BCUH 3BF6H 4JMYA 1OS8A 3RXGA 2QV1A 3LGYA 2Z9GA 2FMJA 3T28A 4XBDA 4Y7AA 2A4GA 4ABGA 1GBFA 3U8RH 6GCHF 1P10A 1FXYA 1UTJA 1O0DH 1O2NA 1GHBF 4CRAA 4NA9H 5DKMA 1RTLA 3HK3B 1IQGA 5F6MA 4IBLH 1TOMH 3GDSA 2TGTA 1D3TB 2Q6DA 1F5KU 1O39A 1BRAA 3S69A 3PM3A 5BPEA 4FU9A 3L6PA 3ODFA 2ZFQH 3TK9A 3TJUA 1GBHA 1VZQH 1GMCF 2R3YA 1T31A 3B9FH 1NRQH 1AMHA 5ESBA 4PROA 1BIOA 2LPRA 3PO1C 1GI2A 2R3UA 3RC5A 2AGGX 1XM1A 1VJ9U 2AMPA 4F49A 4FUBA 1CGJE 2CGAA 5E0JA 3T2NA 4YTAA 1P2JA 2C8YB 2EA3A 1HDTH 1TOCB 4GUXA 1Y3UA 1QBVH 1AE8H 1BT7A 4CH2B 3DA9B