4D8NA

Human kallikrein 6 inhibitors with a para-amidobenzylanmine p1 group carry a high binding efficiency
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
222
structure length
222
Chain Sequence
LVHGGPCDKTSHPYQAALYTSGHLLCGGVLIHPLWVLTAAHCKKPNLQVFLGKHNLGQQESSQEQSSVVRAVIHPDYDAASHDQDIMLLRLARPAKLSELIQPLPLERDCSAQTTSCHILGWGKTADGDFPDTIQCAYIHLVSREECEHAYPGQITQNMLCAGDEKYGKDSCQGDSGGPLVCGDHLRGLVSWGNIPCGSKEKPGVYTNVCRYTNWIQKTIQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Human kallikrein 6 inhibitors with a para-amidobenzylanmine P1 group identified through virtual screening.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Kallikrein-6
total genus 52
structure length 222
sequence length 222
ec nomenclature ec 3.4.21.-:
pdb deposition date 2012-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4d8nA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4d8nA02
1ELEE 4XSKU 3RMMH 5HXFA 1TMUH 1MKXH 5LPEA 2ZQ1A 1GMHG 1ZPZA 2FEQH 1UVUH 4E7RG 2OINA 1IAUA 2C8YB 4BXWA 1DUEA 5DG6A 2PKSC 4KELA 2H9TH 3SJOA 1NU7B 2A7JA 4K60A 1TYNA 5DGJA 1YPMH 1J17T 2FI5E 1MU8B 4NA8A 5EQQA 1NFWA 1SHHB 2BLWA 3ZZBA 2VINA 1TBZH 2BHGA 2C8WB 3AW0A 5BRRE 4D9QA 1DWDH 3QX5H 1A5IA 1CSOE 1W7GH 3ODDA 3P17H 1ZMNA 2H1UA 2PSXA 2WPMS 2PTCE 3K9XB 4JYUH 1NRNH 2DUCA 4ASHA 1BUIA 2W7SA 1GL1A 4MLFB 1TABE 3EQ0H 1O3IA 2KAIB 5EOKA 4JZIA 1EP5A 1N1LA 5FX5A 1BMLA 2K1QA 1CHOG 4ZMAH 1BHXF 2HRVA 1P9UA 1SLWB 3RM0H 3MNSA 1DM4B 2UWOA 1QR3E 1O2TA 2BD4A 2A7HA 5FBEA 1M9UA 5K0HA 1XXDA 5C2ZA 2CF9H 1QY6A 1DY8A 3ZZ6A 2FOGA 2V3OH 2BMGB 1NROH 1D3TB 4UFFH 1DWBH 1PFXC 3RC4A 1KIGH 3KL6A 1QJ1B 1AGJA 1GHVH 1L2EA 4ABAA 1WYKA 1GJ7B 2ANYA 1FAXA 3FAOA 4UEHH 3UQOA 1HXFH 2OCVB 1XMNB 4MNWA 1P02A 1QNJA 1C2JA 1FNIA 4RN6A 2H2ZA 1O38A 1WQVH 4E05H 2AH4X 5DP6A 1PPGE 3NCLA 3ESTA 1G36A 1LVMA 1Z8RA 1TGBA 3FFGA 3FP7E 2OP9A 2Q1JA 1YPKH 1O5FH 1RGQA 1GVLA 2VGCB 2ANKH 9LPRA 1NRQH 1VITG 2V35A 1O31A 1EAWA 1JWTA 1UVOA 4NFFA 1AB9B 1BBRH 1HAPH 3RMLH 3B9FH 1TONA 4X2VA 4IS5A 1VZQH 2C3SA 2XC5A 3RXQA 2VIVA 2P8OC 3TK9A 2CHAC 4X8VH 1GI0A 1UTPA 1O3OA 2EI7A 1P2IA 5GIBA 3NUMA 1VR1H 1KLTA 1GL0E 1O3NA 4RKOB 1XX9A 2ZKSA 1GMHF 1EUFA 1HAVB 4MG3A 1Y5AT 2G4TA 2H9HA 1PPHE 3SUFA 2GT8A 4B75A 1NFUA 4DURA 5JPMH 3GISB 1C1UH 3NZIA 1N8OC 3OYPA 2NU2E 1ACBE 1OWKA 3JZ1B 3RXEA 3IWMA 1ZSJA 1XUFA 1CBWC 1BMMH 3P70B 1SB1H 1EB1H 1BDAA 4JZ1A 4YOIA 1HYLA 1WV7H 4X6OA 2BY9X 3LGVA 1PQAA 4AB9A 4TWWA 4Y0ZE 4H42U 3SNCA 4B74A 3U8OH 3T27A 3ZZAA 4ABDA 1ZTKA 4E7NA 5EW1H 1H9HE 1A0LA 4NZQA 2VIDA 1ZTLA 1QBOA 2PFEA 1ZHRA 4MNVA 4ZROA 2BLVA 3SGAE 4J1YA 3ZZDA 1RTKA 2ZDNA 4X1PU 2GVFA 5CHAB 3AVZA 1LMWB 1GHWH 3UNQA 1C9TA 1ABJH 1V2OT 3BN9A 4UE7H 1SLUB 1FN8A 3SU5A 1KXFA 3SUEA 4FUGA 4B73A 3LKWA 2GCHF 3BV9B 1AI8H 1JRTA 1HUTH 1NTPA 2EI6A 2F9PA 5JBAS 1AE8H 2FP7B 1C1QA 3MH5A 1LDTT 4IGDA 2BDHA 3RXUA 4BTIB 4ABBA 1NFYA 1LQDB 2QV1A 1ZSKA 4XFQA 1FQ3A 2W5EA 4F4OC 1BZXE 1F5LA 1C1PA 2R3UA 4XE4A 3GDVA 2A31A 1YC0A 3SORA 3V13A 1H4WA 4JYVH 3A88A 4SGBE 1YLCA 2FTMA 3A7ZA 3RDZA 1O2YA 3UNSA 2AYWA 1RIWC 5E0HA 1SGFG 1O2OA 3MFJA 1HIAB 4ABHA 4FUDA 1ANBA 2VIPA 2G51A 3BG4B 4Y11E 3UWJH 1RD3B 5A8YA 2XC0A 1DT2A 1C5NH 1O2MA 3URCA 2GDEH 4MDSA 5FAHA 3GCTG 1W2KH 3LGIA 1C1OA 4CH2B 1TMTH 1QA0A 3DHKH 1A7SA 1FY1A 2LNCA 1F0TA 1EOJA 1K1JA 4NWKA 3OTJE 2BVXH 2QAAA 4TWYA 2EA3A 1C5YB 1OX1A 5DP5A 2I6QA 1D4PB 4WH6A 1GBEA 3TNSA 4RKJB 2VJ1A 1K1LA 5E0JA 5ESTE 5T6FA 1SQOA 2FWWA 4A1TA 2BM2A 2ZA5A 1SQAA 1AE5A 3QN7A 1ABIH 5GPIB 3T25A 1UTJA 1D6RA 1GGDC 3QGNB 3QLPH 5E2PA 5L2ZH 3RM2H 3SV9A 4IN1A 1O2GH 1DUAA 4OGYA 1S82A 4I8GA 3QK1A 4NGAH 4MNYA 1MTNB 2ZDAH 3RC6A 3TVJB 3ZZ7A 1ZR0A 4ZHLU 2J4IA 1GVZA 1EJAA 2AERH 5T6DA 1IOEA 1AFEH 3A82A 3OSYA 1BTWA 2B5TB 4K1EA 4NIWA 1O3GA 3A7XA 2V6NA 5A09A 1PPEE 3GICB 3TU7H 1DX5M 1UTNA 1T31A 1KXEA 1JXPA 1K1IA 2ZTZA 3GY6A 1MBMA 2CMYA 2TBSA 1A3BH 1HRTH 4Q7XA 5AVDA 3TH4H 1A1RA 4ABJA 1GI5A 1UVSH 1QL7A 1MZAA 3GCNA 3AAVA 4PROA 3O8RA 3N7OA 4INKA 4UDWH 1AZZA 4ZH8A 1BCUH 3ZZCA 3BTHE 1RJXB 1GBMA 4B2AA 1GG6C 1L1NA 1A46H 2GD4B 1P03A 3F9FA 1V2LT 1YGCH 2P59A 3FP8E 1Y8TA 3RXKA 3KCGH 3P8NA 3A87A 4AFZA 1KLIH 2IOTA 1EJNA 3ZYEA 2WV5A 4QT8C 2ZDLA 1BQYA 3LPRA 4R8TB 1KDQB 1P2OA 2O9QA 4KGAA 4BAHB 1YBWA 5CMXH 1O2IA 2AGIX 5A0AE 1FZZA 1C9PA 4X1SU 3TJOA 1ELBA 1UMAH 2B9LA 1HAOH 4YESB 2FX6A 3FVFB 1HLTH 1V2RT 1Z8JB 2J38A 2PGBB 5A8ZA 1TGCA 2ILNA 5DP4A 1WSSH 3T62A 1GHZA 3EE0B 1CGHA 1O5BB 1W0ZU 2AEIH 1BJVA 1QHRB 1CT4E 3K6ZA 1UTLM 3A8DA 1SBWA 3GY3A 1EP6A 1H9IE 1W7XH 5C5NA 3GCTF 2OLGA 1JIRA 2Y7XA 4KTSA 5FHTA 3GY2A 1VGCC 2FTLE 2TGTA 1IQEA 1OXGA 2XCFA 1XKBC 4K8YA 4Q80A 1Z6EA 2P3UB 3A7TA 2ZPSA 1SFQB 5FXLA 3CENA 1P12E 2WPJS 7LPRA 3ATKA 3A8CA 2XNIA 2H5DA 5EPNA 1H9LB 1AHTH 1MCTA 2A4GA 2Y81A 2AMPA 1Z1JA 2XBVA 3VXFH 1TBQH 4X0WU 2ESTE 2XRCA 2WPKS 2BY6X 4OS6A 1O34A 2Z3CA 5GXPA 1WUNH 2OC1A 4Y71A 1MTUA 1C5QA 1OSSA 2ZHWH 3E0NB 3QUMP 2PHBA 2QXJA 1B0EA 1UK3A 3BTTE 4HTCH 1BA8B 2AMDA 3KF2A 3SV8A 3KNXA 1TOMH 3ZVFA 1A5HA 3Q3KA 3MO3A 1O35A 1LVYA 2Z9KA 1AMHA 1MBQA 3LONA 1F7ZA 2Y80A 5CE1A 3M5LA 1MTVA 1OYQA 8GCHF 1ANCA 3CS7A 7ESTE 2OC0A 1C1TA 2Z6BD 4UFEH 1CT0E 3RXDA 1GBIA 2M5TA 2ZNKH 1C2DA 1F0SA 1MD8A 1P3EA 2FOMB 1O2WA 1DLKB 1O2NA 4NSYA 2WUBA 2Q6FA 3MHWU 1F0UA 1GBBA 4D8NA 5TJXA 2Z9JA 4AB8A 3P95A 1ESTA 1MAYA 2VWNA 2BOKA 2FDAA 2TPIZ 2ZO3H 3STIA 2FS9A 2F9UA 3F6UH 3DA9B 5A0BA 5F8ZA 3MNBA 4B71A 1S85A 2CXVA 3PLPA 4BAOB 2J34A 2WPIS 2ZGBH 5H4IB 2BTCE 1C2EA 1FY4A 4INLA 1HNEE 2Z3EA 1NU9A 2QN5T 3U1JB 1ARCA 4X2XA 1GJDB 4OS1A 1HIAA 3P6ZB 3URDA 4BANB 2FM2A 1TNIA 2O8TA 2O8UA 4Y8YA 3V3MA 4AGKA 4YZUA 5HGGA 1P57B 2I6SA 2AGEX 1TA6A 4K3JA 4DVAU 1O3KA 2Q6GA 4ISLA 1TLDA 1XUGA 6GCHF 1CA0C 3NWUA 2BY5X 1NFXA 1GJBB 3KEEA 1GHBG 1TGTA 1AD8H 3VFEA 1VGCB 1AKSA 4ISOA 5HMAA 1SSXA 4DY7B 1SQTA 2STAE 1CQQA 1HGTH 3MU0A 1E38B 4HGCA 2QXGA 3SV7A 1O2HA 1Y5BT 5IYTA 2V3HH 3SW2B 3VB6A 1O2RA 1LTOA 3AASA 4GSOA 1G30B 3TJNA 4ZUHA 1SI5H 1PYTC 5FCKA 1GI2A 3I29A 1K28D 4MPVA 8LPRA 4X8TH 1PPZA 1VJ9U 2J92A 2YOLA 4WVPE 3G01A 4OGXA 1GHAG 1KTSB 4MNXA 4GPGA 3ZVDA 2XBYA 3LC5A 3ZVAA 3UOUA 2Z9IA 1O3DA 2F83A 4TY6A 1GJ6A 2XC4A 6GCHG 2J9NA 5EGMA 1MTWA 1F5RA 1GHBF 1EXFA 1IQMA 2QF0A 1OP8A 1KTTB 4JMYA 3A7VA 1LQEA 4IN2A 4ISNA 2FOBA 4B2CA 3F1SB 3TK5A 4TPIZ 1W0YH 3A7WA 2HALA 3F9EA 2UWLA 3RXFA 2J94A 2GT7A 3M3TA 2ALVA 4OS2A 2Q6DA 1P11E 3SOSA 1ZHMA 3ZZ3A 1Q31A 1O2XA 2NU3E 3P8FA 2BDBA 1C5SA 3RLYH 4NIYA 3P92A 1UTOA 2BQWB 3GCHC 2GDDA 4U2WA 4WJG2 1XKAC 2CF8H 3E1XB 3VB4A 3RXPA 1GHAF 3ELAH 1MTSA 1SFIA 1EZUC 1K2I1 3GOVB 7GCHF 1ETRH 1OS8A 1C1MA 3ITIA 5LPRA 1C1SA 2JH5D 1HAHH 2HNTC 2BY8X 2XYAA 1KYNA 3QZRA 2TGDA 3RXSA 1PPBH 2GZ8A 1K1PA 1DY9A 2GGVB 1XUHA 2SGAA 4GLYA 4BTUB 4YT6H 4NIVA 1GHXH 1EAXA 3H5CB 2BVSH 1EKBB 3M3VA 3TPIZ 3R3GB 1C2FA 1V2UT 1SC8U 3VB3A 1O2JA 1HCGA 5DP7A 3BG8A 3KIDU 4MQAA 1THRH 1P06A 2OXSA 2FPZA 2JH6D 1EB2A 1D3DB 1SR5C 3V0XA 1O2LA 5HM2A 1K9OE 1KXDA 3SQHE 1TQ0B 3RXAA 2P94A 4JK5A 3MTYA 1ANDA 3PLKA 1IQGA 1EPTC 1WQSA 1N6XA 3IITA 5F8TA 1QTFA 2TGAA 1QJ7B 4I31A 1SVPA 1UO6A 1GJAB 5A8XA 2PR3A 1ZGVA 1ZTJA 1T8LA 1C5UA 4WMDA 1FV9A 4FUFA 2WYGA 2IJOB 2ZI2H 4AG2A 1O3CA 4H6TA 3A8BA 2OC8A 1BRAA 3M7TA 3EA9A 2ZCHP 1E34B 4ABIA 1SLVB 1OWEA 1EZSC 1RS0A 3SU1A 5EXNA 1O3EA 4X1QU 1MKWK 4A5TS 2GMTC 1HJ9A 1QB6A 3RUOA 1GPZA 1P3CA 2BX4A 4GHTA 1GI8B 1TPOA 4BAQB 5DO4H 2ZF0H 2ZFSA 1WTHD 3BTFE 2Z9GA 1NPMA 1QB9A 1CVWH 4WF8A 3SNAA 4ZKSU 3A86A 2ZHFH 1SG8B 1TOCB 4AX9H 3A83A 2GV6A 3TH2H 2THFB 3FANA 1DITH 2BLOA 2W3KA 2OQUA 2BLQA 3IG6B 1GBTA 2XBXA 1O37A 5L2YH 3VB7A 1FIWA 1TBRH 2D2DA 5JDUB 2VIWA 3DT0H 3UR6A 2PUXB 2GX4A 4OS7A 3C1KA 3RXBA 4K1SA 4U30A 1C5ZB 1N6YA 1GVKB 4NSVA 4CHAC 3RXHA 2ZDMA 1UK4A 2FYQA 1SGFA 1GHYH 3ZV9A 3L6PA 1T8OA 1YPJH 5CHAC 2YNAA 2Z94A 3GYLB 1W3CA 4WY3A 1LVBA 3B8JA 1YYY1 2ZECA 1F0RA 4ISHH 4JZFH 2ODPA 1QURH 4FUBA 2O8WA 1KY9A 1GJCB 1ZMJA 3HK6B 4O3TA 4CRBA 5C1UA 3UY9A 1A5GH 1D6WA 3BTKE 3HKIB 1JRSA 3QTVH 1YPLH 4NZLA 1H8IH 1A61H 5FX6A 1TFXA 5FCRA 1QBNA 3PYHA 4CRDA 1MU6B 1UVPA 5C1YA 1EAUA 1OWHA 1C2GA 6CHAC 3KN2A 1O5AB 3DUXH 1CGJE 8KME2 2FYRA 5BPEA 1AFQC 1YPEH 1GWAA 2H5CA 2ZGHA 3DFLA 4Y8ZA 2DE8A 2PUQH 1PJPA 3U69H 2BD5A 1YKTA 3LC3A 1FAKH 4UFDH 3S0NA 3LH3A 4YO9A 3GCOA 1L1JA 3GY4A 2FOEA 2VIOA 4X2WA 4XBBA 1GBLA 1Q2WA 4VGCB 4BAMB 2G8TA 2CV3A 5T6GA 2A32A 1MKWH 5HYOA 1WAYB 1GMDG 4HZHA 3RXRA 2A5IA 3LJOA 1KXAA 3QGJA 5DPAA 3T29A 3D65E 4ZHAA 3UWIA 2NU4E 2VVVA 4WMEA 4X8UH 4K8BA 4YM9A 3RU4E 1V3XA 3SZNA 1BBRK 3F9HA 3MU8A 1FY3A 1P09A 1TQ7B 4CREA 5EXLA 3U98H 2ZFTA 2FO9A 1GJ4H 3TLOA 1LCYA 3HGNA 1O2KA 2G00A 3PLBA 1AY6H 1QL9A 2Y7ZA 5LPFA 3EA7A 4DJZB 2VU8E 2Y5FA 1C5MD 2R2MB 4O3UA 3UR9A 1YPGH 1T8MA 1BIOA 1UCYH 3ATIA 1O5DH 2ZU5A 1IQLA 1THPB 1OOKB 3ODFA 3EGKH 3AW1A 3ZV8A 1O5EH 3PMHB 1P2KA 1AB9C 1OWIA 3PTNA 4Y76A 1FDPA 3MO9A 1O2UA 2FODA 5ETXA 2ZGJA 2FOHA 1ZYOA 1ETSH 1G32B 1ZJDA 2GV7A 1O33A 4CBOA 1UHBB 4R0IA 1VCQA 2XWBI 3TH3H 1O3PB 2CHAB 5EU8A 3PB1E 1LKBA 8GCHG 2HOBA 1IQFA 2PKSB 4I7YH 1AZ8A 1ZLRA 2RA3A 1RTLA 1VITH 4YTAA 1SGEE 3HKJB 3QWCH 4K2YA 1HAVA 5JYIA 2UUJB 4LZ4B 1SGNE 3A89A 4ZKNU 2ZEBA 2SFAA 3VXEH 4Y79A 1K1OA 4I8HA 1OPHB 5DP3A 1SOTA 1HFDA 2HNTE 2H9EH 1GDQA 1QIXB 2Y5GA 4OS4A 1EX3A 1BRCE 3MO6A 1C5TA 1QB1A 3BEUA 3P8GA 1LHCH 5FBIA 1WCZA 1QRXA 4FU7A 1AN1E 2BDAA 1S5SA 1OP0A 4Z6AH 4AOQA 1P8VC 1S81A 3SUDA 1HJ8A 1GI7B 3PWBA 1T8NA 1W8BH 4X1RU 2QC2A 3T2NA 4IMZA 1KLJH 1ORFA 2BZ6H 2D1JA 3LDXH 1O2VA 2AIPA 4THNH 1DWCH 1P01A 5I46H 2HNTF 3ENSB 2WV4A 3QZQA 4NA7A 4ESTE 4FU9A 3LH1A 4KP0A 1PQ7A 4UFGH 1G9IE 5EQSA 2F3CE 3SV6A 1SGTA 4I8LA 2F9BH 1UJ1A 4Y7BA 4GVUA 4A92A 1DICA 1IQJA 1DOJA 3BEFB 5EPYA 2G52A 1W10U 1LO6A 4MVNA 2GTBA 4AZ2B 3E6PH 2A7CA 4ZAEA 2JETC 2O8MA 2Y82A 4FUEA 1BITA 3MU1A 1G3CA 1OP2A 4FUJA 1IQHA 3SJKA 5LGOA 4A7IB 2H6MA 1ZHPA 4HI3A 1O2QA 4ABGA 3UOPA 1VJAU 2FOCA 3S9CA 2ZHDA 1HAZB 2ODYB 3MI4A 3EAJA 2GZ9A 2W3IA 1EPTA 1SGQE 5AF9H 1ELGA 4I8JA 2XWAA 3PWCA 1Z1IA 1ELCA 1AO5A 1HAYB 1L0ZA 3UQVA 4NG9H 2ANWA 2ZU3A 2VNTA 1TRYA 3LGYA 3RP2A 1H8DH 2SNWA 3BTQE 1O3MA 1MQ6A 3QDZB 5SGAE 1F2SE 1IQKA 4AFQA 1FPCH 1P0SH 1FIZA 4FUHA 3EA8A 1CT2E 1SGRE 1NY22 2A5AA 1YLDA 5C67A 2SGFE 2ZZUH 1B5GH 4BTTB 1MH0A 1X7AC 4DIIH 3CS0A 4B1TA 1FMGA 3BEIB 1D3QB 3ZZ5A 4GAWA 1HJAB 7KMEH 1HAXB 1BOQA 2ZHQH 4DCDA 2G5NA 5DJ7A 2ZGXH 2P95A 2TIOA 1LHEH 1ZRBA 2VIQA 1BRBE 3A80A 1D3PB 1FN6A 2AMQA 3BTME 1Y3XA 2ZG0H 4K5ZA 1LPZB 2WPHS 2WUCA 4YLQH 5AFYH 2NU1E 3GYMA 5JBBS 5PTPA 1BTPA 1TNGA 2VVCA 4CRCA 4M7GA 2GCHG 1T32A 1FY8E 3R0FA 1UTKA 2BDGA 1CA8B 4AN7A 3S9BA 1GDUA 1KXBA 2BY7X 2G55A 3RXMA 3RXTA 3H7TA 3DD2H 2A2XH 2UWPA 5G4BA 1LPGB 2QGRA 1TALA 1TE0A 3E91A 3M37A 3E8LA 2JETB 5L6NH 1W14U 1BJUA 2ZC9H 4E06H 4MTBA 1K1NA 5EXMA 1BRUP 1E0FD 1O3LA 3RXOA 5EW2H 2OTVA 1SPJA 4K69A 2QCYA 3RMOH 4AFUA 1ID5H 4Y8XA 4DIHH 2FS8A 4BNRA 3VGCB 1XVMA 2OC7A 3MWIU 2W26A 2J2UA 5TCCA 2DE9A 2BXTH 2IPHA 1GDNA 2FX4A 3ZZ9A 4AYVB 4JK6A 1NO9H 4ZHMU 1EQ9A 1YM0A 2A4RA 4CBNA 3E90B 1EATA 2VH0A 6ESTA 4RSPA 3ZVGA 3UTUH 1AVGH 4YT7H 4Y10E 1NESE 2BDCA 2AS9A 2WINI 2ZCLP 5E8EH 1V2WT 2OQ5A 1YCPM 5B6OA 1GI9B 1GMCG 2ALPA 1GBDA 3QTOH 2XBWA 1V2KT 1AU8A 1UK2A 1Y3UA 1ZOMA 2ZIQH 3UIRA 3M7QA 5LH8A 1ELVA 2SNVA 2ULLA 1AIXH 1YCPK 3OU0A 2J95A 1W13U 1V2TT 5E2OA 1CBWB 2ZU1A 4ABFA 3A85A 1G2LA 4CRGA 5K7RA 1RIWB 3L33A 4WXVA 1GGDB 2GP9B 1LPKB 1TGSZ 2UUFB 4ZKOU 1SL3A 1GI1A 3CP7A 3BTWE 1NS3A 1L1GA 4Z0KA 1DXPA 5JB9S 5EODA 3UNRA 1O3JA 1HBTH 1GI6A 4FUCA 4IC5A 5C5OA 2FESH 2AIQA 1GBKA 2R2WU 3FZZA 3RU4D 4D9RA 1NRRH 1P2JA 1YF4A 1HB0B 2JKHA 1TX6A 2PLXA 4GCHF 1FPHH 1QQUA 1C4Y2 2HPQH 2ODQA 1XUIA 2BD7A 1TAWA 1WBGB 2BX3A 1MQ5A 2EI8A 2ZPRA 2ZWLH 4XBCA 1F5KU 1JBUH 3NK8A 5JBTA 1BBRE 1G37A 1Z8GA 3ZZ8A 3TNTA 1O32A 2OBQA 2IN2A 3JZ2B 1FI8A 3M5NA 1MTNC 1O2ZA 2B8OH 1FONA 2AGGX 1QJ6B 2BYAX 2HWLB 2PSYA 4TPYA 2PGQB 1PYTD 4XOJA 1CGIE 2Y6TA 5AHGH 3SJ8A 4FU8A 5GWZA 1FJSA 2P93A 1CHOF 4F49A 4JCNA 1HXEH 5FPSA 2ZP0H 3A84A 3KQCA 1PPFE 1DANH 1HV7A 1K21H 1S83A 1TA2A 1AWHB 1LVOA 1C1WH 1AUTC 2WYJA 1P04A 1J15A 1YCPH 3B23B 3M3SA 1LHDH 2P3FH 2C8ZB 1E37B 1ZRKA 4SGAE 2C93B 3P8OA 1Q3XA 1GJ8B 1ZGIA 2ZGCA 2TRMA 3M36A 1DXWA 3MU4A 4NCYA 3KQEA 2W7UA 1ZSLA 1NM6A 1C2HA 3GY7A 3FP6E 3PO1C 2PV9B 1DS2E 1ELFA 4FVBA 1INCA 1J9CH 1FY5A 1TMBH 2KAIA 3I78A 1BTUA 3ATLA 3BTGE 3PTBA 1C2IA 2A0QB 2OBOA 3L3TA 1YPHE 2QXHA 4H4FA 3VPKA 1W12U 4U32A 2SGDE 2PWXA 3SNDA 2ZFPH 3GY8A 3RXGA 2GCTB 1BTYA 1IHSH 3FZDA 1GCDA 2CJIA 1GCTB 1ZPBA 3SU3A 1C1NA 1C1VH 1VITF 1Y3WA 4Y7AA 2G4UA 4YOJA 2PW8H 2GMTB 2ZDVH 2LPRA 1O30A 9ESTA 1C5RA 1CHGA 1F92A 1NC6A 5GCHF 3MH4A 4B2BA 1PQ5A 5C3NA 1AVXA 1V2NT 2SGQE 2A1DB 1RTFB 4LK4A 1TRNA 1SGDE 2A2QH 1XM1A 2VGCC 1VCPA 3E16B 3HK3B 3MYWA 1ETTH 1C2LA 2O8LA 3M35A 1A4WH 1L4ZA 2FXRA 1G3EA 3BIVH 2CGAA 1C5XB 1TGNA 3TGJE 3A8AA 1RXPA 3M61U 3TK6A 4WXIA 3V12A 1SMFE 1T4VH 1FXYA 1AUJA 2RA0A 2ANMH 2BZAA 2R9PA 3HGPA 3PMBB 1Z8IB 2Z3DA 1PQ8A 4GCHG 3SNBA 4FUIA 3SI4H 1RRKA 4DT7B 2BVRH 2PKAA 1OKXA 1V2VT 4Q7YA 1NZQH 1S0QA 1TIOA 1O5GH 3RMNH 4NIXA 3SBKA 3T26A 5GCHG 4AYYB 1A0HB 3QO6A 1TPSA 4XBDA 2Y5HA 4NWLA 1TB6H 3F9GA 2WPLS 1GG6B 1WU1A 1G3BA 4DOQA 5ABWA 3PMAB 3D62A 2ZTYA 4MPWA 3HATH 2B0FA 2B7DH 1ARBA 3BTEE 2Z9LA 1ZZZA 3PO1B 4AORA 3HPTB 2GCTC 3T5FH 5L30H 2ZU4A 3U8TH 5FPYA 3NKKA 4IW4E 5EQRA 2BB4A 1OWDA 3TIUA 1XUKA 4LXBH 3LGWA 1G3DA 1Z7KA 3BTDE 3ZVEA 1MUEB 1NT1A 1J14A 3SN8A 2C8XB 1C2KA 4KTUA 2ZFQH 2GKVE 5AFZH 3S9AA 3RXLA 1CA0B 2FLBH 1T4UH 5A2MH 1BT7A 3SGQE 5DK1A 4VGCC 1Y3VA 1GCTC 2BD2A 1DPOA 5DP9A 4I33A 1QA7A 2NWNA 4Q2KA 1EOLA 1MKXK 5F8XA 5F03A 1W11U 1GI3A 4FXGH 4JZEH 1WOFA 3MH7A 1Y59T 2SGEE 1GBCA 2ZPQA 4CRAA 2F9OA 4WWYA 2ZDKA 1EAIA 2D8WA 1WTGH 2HVXA 4XDEA 1K1MA 5GJ4B 5FPTA 1S84A 3T28A 1B7XB 4UONA 3KQBA 8ESTE 1C5PA 3AAUA 1ANEA 4OS5A 3ATWA 2FI4E 4O97A 2RG3A 4AG1A 4O03A 2UUYA 1AKSB 4AGJA 1SOZA 2QA9E 3MNXA 3SHAH 1V2QT 2VB0A 2VWMA 4ABEA 5F6MA 5A0CA 1BTHH 4X6NA 2OD3B 1E35B 3ZVBA 3EYDA 4GUXA 3D49H 1BTZA 1HDTH 1VCWA 4Q7ZA 3PROA 1UTQA 1P9SA 1IQIA 1LKAA 1TPPA 1HAIH 4KKDA 2EEKA 4X8SH 2R0KA 4ISIH 4CR9A 3NXPA 1O5CB 2HLCA 3LOXA 3SJ9A 3GDSA 2V0BA 3SU6A 2BD9A 3BG4C 4ZXYH 3RC5A 3S7HB 1B0FA 1DVAH 3PV4A 1SGCA 1YPHC 4CH8B 1QL8A 2FLRH 2YNBA 4J2YB 3OY6U 1SHYA 1SGYE 4CRFA 4KTCA 4WMFA 1O3AA 4IMQA 3SI3H 4B76A 3U9AH 5TCAA 3SJIA 3OY5U 3TJUA 1QFKH 5C1XA 4X1NU 2BDIA 3UUZA 2HGTH 2ZQ2A 2STBE 3GDUA 1TX8A 1J8AA 4TYDA 3ZVCA 2F9NA 4TY7A 4A6LA 2BXUH 2NU0E 7GCHG 3VEQB 1O2SA 3LGTA 3LJJA 2FZZA 2A45B 1KXCA 3MH6A 2AFQB 1HAGE 4HFPB 1QCPA 1NRPH 3KQDA 3OX7U 1DWEH 2BQ7B 4D7FA 1O39A 3F68H 3O8BA 3ATMA 3STJA 1JOUB 2R3YA 3K2UA 1C5WB 1PPCE 1E36B 4BOHA 1ELDE 1ESAA 5E0GA 3ZZ4A 1CU1A 3Q77A 5I25A 4GHQA 1C1RA 3M5OA 4X6MA 2XCNA 1RFNA 3A7YA 1S6HA 3LU9B 1ELTA 2VH6A 1MD7A 1OYTH 1QQ4A 1MZDA 4D7GA 1TWXB 3RU4T 2EC9H 3M7UA 1LHGH 2ZU2A 1XXFA 1NN6A 4A1VA 3E0PB 1C4V2 1V2ST 4CR5A 3GCHB 2JH0D 1IQNA 2A5KA 1EZXC 1UTMA 1BMNH 1D9IA 3RXIA 5T3HA 3K6YA 2QYIA 3WY8A 3MNCA 1O3FA 2VWLA 1V2PT 1V2MT 1OWJA 1A2CH 1GBHA 1UVTH 3I77A 4JZDH 4O9VA 2OUAA 1ZMLA 1ZPCA 3RLWH 3SO3A 3SGBE 1C5LH 1GBAA 4I8KA 3KHVA 1P2QA 5ESBA 3UREA 3PM3A 3SV2H 1TNHA 2FOFA 3MMGA 1JMOH 3SHCH 1A0JA 3ZYDA 1O0DH 3S7KB 5EG4A 1C5OH 1Z6JH 1YP9A 3SQEE 2F9VA 2RDLA 1UCYK 3SUGA 6LPRA 4JYTA 5DKMA 1P2NA 2ZFFH 2CN0H 2QXIA 1AFQB 1BHXB 2A4OA 1V2JT 3W94A 3TITA 4D76A 4WH8A 1NRSH 2BQ6B 4Y6DA 1C5VA 3RXVA 1O3BA 2PKAB 3H7OA 3SU4A 4BAKB 3BIUH 3W95A 1GBJA 2PTNA 2BD8A 3DFJA 3LGUA 4IBLH 3UFAA 1GJ5H 1HJAC 1KDQA 3PMJA 2C90B 2R0LA 4ZXXH 3U8RH 2FI3E 2BDYA 2XW9A 1U6QA 1A3EH 2XTTB 1DLEA 1AWFH 1JIMA 1SGIB 3C27B 2QY0B 4CHAB 4AFSA 1CO7E 4H6SB 1K22H 3NPSA 4X2YA 1SLXB 2BD3A 1Y5UT 1G2MA 1GI4A 3MOCA 2FMJA 1IHTH 3Q00A 3RXCA 2FOAA 1TNJA 2UUKB 5J4QA 2ZFRH 1MMJN 2G5VA 3V7TA 4K1TA 3E3TA 3TGIE 1H1BA 1P10A 1DDJA 3K65B 1C4U2 1QGFA 1TRMA 1DSTA 1XVOA 3O8DA 4I32A 1CE5A 3TJVA 2ASUB 1BTXA 3D23A 4X6PA 2GZ7A 4DW2U 4DG4A 2SGPE 2G81E 4A1XA 1MCVA 1O36A 1TX7A 4MPXA 1TNLA 1THSH 2QF3A 2FIRH 1ESBA 1EPTB 1GBFA 1BB0B 1TPAE 3S69A 1MAXA 1ELAA 2P3TB 1J16A 2BOHB 3LIWA 6CHAB 1P2MA 2D26C 3RXJA 3VGCC 1UCYE 4BXSA 4YOGA 3EDXB 2A4QA 1DSUA 2QIQA 1T7CA 4NFEA 3MU5A 1XUJA 1HPGA 3LT3A 1N8OB 2VWOA 1KSNA 1QRWA 1Z71A 1FUJA 1O2PA 4UD9H 2P16A 3Q3YA 3UPEA 1EASA 1GJ9B 4LZ1H 3A81A 1QRZA 5JB8S 2F91A 3BF6H 1V6DA 3SU2A 1LHFH 4IC6A 4ZKRU 3GY5A 5IDKA 1BMAA 2RCEA 5GDSH 4Y0YE 4INHA 5DP8A 3U1IB 1L4DA 2TGPZ 5HM9A 4LOYH 1GMDF 3BSQA 3SU0A 1EZQA 2P8OB 2VVUA 1FLEE 4FVDA 1S6FA 1O3HA 1C2MA 1AVWA 1TNKA 1DE7H 1EJMA 4YLUA 1S0RA 3O8CA 4U01A 1UHBA 4DGJA 4MPUA 3Q76A 3VB5A 1GMCF 1ZJKA 1P05A 2ZHEH 1AQ7A 4NA9H 1DFPA 1SGPE 2ZTXA 5J4SA 2HPPH 2XXLA 3TGKE 1QBVH 1Y3YA 2ZCKP 3Q3XA 3SNEA 2Z7FE 3M5MA 2C4FH 5C20A 3KGPA 5JBCS
chains in the Genus database with same CATH superfamily
1ELEE 2K0QA 4XSKU 3RMMH 5HXFA 1TMUH 1MKXH 5LPEA 2ZQ1A 1GMHG 1ZPZA 2FEQH 1UVUH 4E7RG 2OINA 1IAUA 2C8YB 4BXWA 4RI0A 1DUEA 5DG6A 5F53A 2PKSC 4KELA 2H9TH 3SJOA 1NU7B 2A7JA 4K60A 1TYNA 5DGJA 1YPMH 1J17T 2FI5E 1MU8B 4NA8A 5EQQA 1NFWA 1SHHB 2BLWA 4M9FA 3ZZBA 2VINA 1TBZH 2BHGA 2C8WB 3AW0A 5BRRE 4D9QA 1DWDH 3QX5H 1A5IA 1CSOE 1W7GH 3ODDA 3P17H 1ZMNA 2H1UA 2PSXA 3H09A 1SKYE 2WPMS 2PTCE 3K9XB 4JYUH 1NRNH 2DUCA 4ASHA 1BUIA 2W7SA 1GL1A 4MLFB 1TABE 3EQ0H 1O3IA 2KAIB 2YMSD 5EOKA 4JZIA 4RT1A 1EP5A 1N1LA 5FX5A 1BMLA 2JDID 2K1QA 1CHOG 4ZMAH 1BHXF 2HRVA 1P9UA 1SLWB 3RM0H 3MNSA 1DM4B 2UWOA 1QR3E 1O2TA 2BD4A 2A7HA 5FBEA 1M9UA 5K0HA 1XXDA 5C2ZA 2CF9H 1QY6A 1DY8A 3ZZ6A 2J98B 2FOGA 2V3OH 2BMGB 1NROH 1D3TB 4UFFH 1DWBH 1PFXC 3RC4A 1KIGH 3KL6A 1QJ1B 1AGJA 1GHVH 1L2EA 4ABAA 1WYKA 1GJ7B 2ANYA 1FAXA 1S6LA 1E79D 3FAOA 4UEHH 3UQOA 1HXFH 2OCVB 1XMNB 4MNWA 1P02A 1QNJA 1C2JA 1FNIA 4RN6A 2H2ZA 1O38A 1WQVH 4E05H 2AH4X 5DP6A 4ACAA 1PPGE 3NCLA 3ESTA 1G36A 1LVMA 1Z8RA 1TGBA 3FFGA 3FP7E 2OP9A 2Q1JA 1YPKH 1O5FH 5KECA 1RGQA 1GVLA 2KR7A 3WW7A 2VGCB 2ANKH 9LPRA 1NRQH 1VITG 2V35A 1O31A 5GNDA 1EAWA 1JWTA 1UVOA 4NFFA 1AB9B 1BBRH 1HAPH 3RMLH 3B9FH 1TONA 4X2VA 4IS5A 1VZQH 2C3SA 2XC5A 3F0PA 3RXQA 2VIVA 2P8OC 3TK9A 2CHAC 4X8VH 1GI0A 1UTPA 1O3OA 2EI7A 1P2IA 5GIBA 3NUMA 1VR1H 1KLTA 1GL0E 1O3NA 4RKOB 1XX9A 2ZKSA 1GMHF 1EUFA 1HAVB 4MG3A 1Y5AT 2G4TA 2H9HA 5EIYA 1PPHE 3SUFA 2GT8A 4B75A 1NFUA 4DURA 5JPMH 3GISB 1C1UH 3NZIA 1N8OC 3OYPA 2NU2E 5C0TA 5EJZA 1ACBE 1OWKA 3JZ1B 3RXEA 3IWMA 1ZSJA 1XUFA 1CBWC 1BMMH 3P70B 1SB1H 1EB1H 1BDAA 4JZ1A 4YOIA 1HYLA 1WV7H 4X6OA 1WXRA 2BY9X 3LGVA 1PQAA 4AB9A 4TWWA 4Y0ZE 4H42U 3SNCA 4B74A 3U8OH 3T27A 3ZZAA 4ABDA 1ZTKA 4E7NA 5EW1H 1H9HE 1A0LA 4NZQA 2VIDA 1ZTLA 1QBOA 3FN8A 2PFEA 1ZHRA 4MNVA 4ZROA 5KGOA 2BLVA 3SGAE 4J1YA 3ZZDA 1RTKA 2ZDNA 4X1PU 2GVFA 5CHAB 3AVZA 1LMWB 1GHWH 3UNQA 5HIZA 1C9TA 1ABJH 1V2OT 3BN9A 2KZ4A 4UE7H 1SLUB 1FN8A 3SU5A 1KXFA 3SUEA 4FUGA 4B73A 3LKWA 2GCHF 3BV9B 1AI8H 1JRTA 1HUTH 1NTPA 2EI6A 2F9PA 2J5UA 1AE8H 2FP7B 5JBAS 1C1QA 3MH5A 1UW7A 1LDTT 4IGDA 2BDHA 3RXUA 4BTIB 4ABBA 1NFYA 1LQDB 2QV1A 1YLNA 1ZSKA 4XFQA 1FQ3A 2W5EA 4F4OC 1BZXE 2XOKD 1F5LA 1C1PA 2R3UA 4XE4A 3GDVA 4F55A 2A31A 1YC0A 3SORA 3V13A 1H4WA 4JYVH 3A88A 4SGBE 3ZIAD 1YLCA 2FTMA 3A7ZA 3RDZA 1O2YA 3UNSA 2AYWA 1RIWC 5E0HA 1SGFG 1O2OA 3MFJA 1HIAB 4ABHA 4FUDA 1ANBA 2VIPA 2G51A 3BG4B 4Y11E 3UWJH 1RD3B 5A8YA 2XC0A 1DT2A 1C5NH 1O2MA 3URCA 2GDEH 4MDSA 5FAHA 4F48B 3GCTG 1W2KH 3LGIA 1C1OA 4CH2B 1TMTH 4B6FA 3MQKC 1QA0A 3DHKH 1A7SA 1FY1A 2LNCA 4TSFD 1F0TA 1EOJA 1K1JA 4NWKA 2L74A 2BVXH 3OTJE 2QAAA 4TWYA 2EA3A 1C5YB 1OX1A 5DP5A 2I6QA 1D4PB 4WH6A 1GBEA 3TNSA 4RKJB 2VJ1A 1K1LA 5E0JA 5ESTE 5T6FA 1SQOA 2F4LA 2FWWA 2BM2A 2ZA5A 4A1TA 1SQAA 1AE5A 3QN7A 1ABIH 5GPIB 3T25A 1UTJA 1D6RA 1GGDC 3QGNB 3QLPH 2JIZD 5E2PA 1E1QD 5L2ZH 3RM2H 3SV9A 4IN1A 1O2GH 1DUAA 4OGYA 1S82A 4I8GA 3QK1A 4NGAH 4MNYA 1MTNB 2ZDAH 3RC6A 3TVJB 3ZZ7A 1ZR0A 4ZHLU 2J4IA 1GVZA 4YXWD 1EJAA 3W1EA 5CDFE 2AERH 5T6DA 1IOEA 2KCOA 1AFEH 3A82A 3OSYA 1BTWA 2B5TB 5T1VA 4K1EA 4NIWA 1O3GA 3A7XA 2V6NA 5A09A 1PPEE 3GICB 3TU7H 1K0HA 1DX5M 1UTNA 1T31A 1KXEA 1JXPA 1K1IA 2ZTZA 3GY6A 1MBMA 2CMYA 2TBSA 1A3BH 1HRTH 4Q7XA 5AVDA 3TH4H 1A1RA 4ABJA 1GI5A 1UVSH 1QL7A 1MZAA 3GCNA 3AAVA 4PROA 3O8RA 3N7OA 4INKA 4UDWH 1AZZA 4ZH8A 1BCUH 1YWUA 3ZZCA 3BTHE 1RJXB 1GBMA 4B2AA 1GG6C 1L1NA 1A46H 2IJD1 2GD4B 1P03A 3F9FA 1V2LT 1YGCH 2P59A 3FP8E 1Y8TA 3RXKA 3KCGH 3P8NA 3A87A 4AFZA 1KLIH 2IOTA 1EJNA 3ZYEA 5C17A 2WV5A 2YMSC 4QT8C 2ZDLA 1BQYA 3LPRA 4R8TB 1KDQB 1P2OA 2O9QA 4KGAA 4BAHB 1YBWA 5CMXH 1O2IA 2AGIX 5A0AE 1FZZA 1C9PA 4X1SU 3TJOA 1ELBA 1UMAH 2B9LA 1HAOH 4YESB 2FX6A 3FVFB 1HLTH 1V2RT 3FOAA 1Z8JB 2J38A 2PGBB 5A8ZA 1TGCA 2ILNA 5DP4A 1WSSH 3T62A 1GHZA 3EE0B 1CGHA 2V7QD 1O5BB 1W0ZU 2AEIH 1BJVA 1MABB 1EFRD 1QHRB 1CT4E 3K6ZA 3OTPA 1UTLM 3A8DA 1SBWA 3GY3A 1EP6A 1H9IE 1W7XH 5C5NA 3GCTF 2OLGA 1JIRA 2Y7XA 4KTSA 5FHTA 3GY2A 1VGCC 5KEDA 2FTLE 2TGTA 1IQEA 1OXGA 2XCFA 1XKBC 4K8YA 4Q80A 1Z6EA 2P3UB 3A7TA 2ZPSA 1SFQB 5FXLA 3CENA 1P12E 2WPJS 7LPRA 3ATKA 3A8CA 2XNIA 4ZCNA 2H5DA 5EPNA 1H9LB 1AHTH 1MCTA 2A4GA 2Y81A 2AMPA 1Z1JA 2XBVA 3UAIC 3VXFH 1TBQH 4X0WU 2ESTE 2XRCA 2WPKS 2BY6X 4OS6A 1O34A 5B6LA 2Z3CA 5GXPA 1WUNH 2OC1A 2WZQA 4Y71A 1MTUA 1C5QA 1OSSA 2ZHWH 3E0NB 3QUMP 2PHBA 2QXJA 1B0EA 1UK3A 3BTTE 2IPQX 4HTCH 1BA8B 2AMDA 3KF2A 3SV8A 3KNXA 1TOMH 3ZVFA 1A5HA 3Q3KA 1H8HD 3MO3A 1O35A 1LVYA 2Z9KA 1AMHA 1MBQA 3LONA 1F7ZA 2Y80A 5CE1A 3M5LA 1MTVA 1OYQA 8GCHF 2CK3D 1ANCA 3CS7A 7ESTE 2WPDD 2OC0A 1C1TA 2Z6BD 4UFEH 1CT0E 3RXDA 1GBIA 2M5TA 2ZNKH 1C2DA 1F0SA 1MD8A 1P3EA 2FOMB 1O2WA 1DLKB 1O2NA 4NSYA 2WUBA 2Q6FA 3MHWU 1F0UA 1GBBA 4D8NA 5TJXA 2Z9JA 4AB8A 5FL7D 3P95A 1ESTA 1MAYA 2VWNA 2BOKA 2FDAA 2TPIZ 2ZO3H 3STIA 2FS9A 2F9UA 3F6UH 3DA9B 5A0BA 5F8ZA 3MNBA 4B71A 1S85A 2CXVA 3PLPA 4BAOB 2J34A 2WPIS 2ZGBH 5H4IB 2BTCE 1C2EA 1FY4A 4INLA 1HNEE 2Z3EA 1NU9A 2QN5T 3U1JB 1ARCA 4X2XA 1GJDB 4OS1A 1HIAA 3P6ZB 3URDA 4BANB 2FM2A 1TNIA 2O8TA 2O8UA 4Y8YA 3V3MA 4AGKA 4YZUA 5HGGA 1P57B 2I6SA 2AGEX 1TA6A 4K3JA 1W0KD 4DVAU 1O3KA 2Q6GA 4ISLA 1TLDA 1XUGA 6GCHF 1CA0C 3NWUA 2BY5X 1NFXA 1GJBB 3KEEA 1GHBG 1TGTA 1AD8H 3VFEA 1VGCB 1AKSA 4ISOA 5HMAA 1SSXA 4DY7B 1SQTA 2STAE 1CQQA 1HGTH 3MU0A 1E38B 4HGCA 2QXGA 3SV7A 1O2HA 1Y5BT 5IYTA 2V3HH 3SW2B 3VB6A 1O2RA 1LTOA 3AASA 1YY3A 4GSOA 1G30B 3TJNA 4ZUHA 1SI5H 1PYTC 5FCKA 1GI2A 3I29A 1K28D 4MPVA 8LPRA 4X8TH 1PPZA 1VJ9U 2J92A 2YOLA 4WVPE 3G01A 4OGXA 1GHAG 1KTSB 4MNXA 4GPGA 1KMHB 3ZVDA 2XBYA 3LC5A 3ZVAA 3UOUA 2Z9IA 1O3DA 2F83A 4TY6A 1GJ6A 2XC4A 6GCHG 2J9NA 5EGMA 1MTWA 1F5RA 1GHBF 1EXFA 1NBME 1IQMA 2QF0A 3U28C 1OP8A 1KTTB 4JMYA 3A7VA 1LQEA 4IN2A 4ISNA 2FOBA 4B2CA 3F1SB 3TK5A 4B6EA 4TPIZ 1W0YH 3A7WA 2HALA 3F9EA 2UWLA 3RXFA 2J94A 2GT7A 3M3TA 2ALVA 4OS2A 2Q6DA 1P11E 3SOSA 1ZHMA 3ZZ3A 1Q31A 1O2XA 2NU3E 3P8FA 2BDBA 3UB0A 1C5SA 3RLYH 4NIYA 3P92A 1UTOA 2BQWB 3GCHC 2GDDA 4U2WA 4WJG2 1XKAC 2CF8H 2QF5A 3E1XB 3VB4A 3RXPA 1GHAF 3ELAH 1MTSA 1SFIA 1EZUC 1K2I1 3GOVB 7GCHF 1ETRH 1OS8A 1C1MA 3ITIA 5LPRA 4I86A 1C1SA 2JH5D 1HAHH 2HNTC 2BY8X 2XYAA 1KYNA 3QZRA 2TGDA 3RXSA 1PPBH 2GZ8A 1K1PA 1DY9A 2GGVB 1XUHA 2SGAA 4GLYA 4BTUB 4YT6H 4NIVA 1GHXH 1EAXA 2GJGA 3H5CB 2BVSH 1EKBB 3M3VA 3TPIZ 3R3GB 1C2FA 1V2UT 1SC8U 3VB3A 1O2JA 1HCGA 5DP7A 3BG8A 3KIDU 4MQAA 1THRH 1P06A 2OXSA 2FPZA 2JH6D 1EB2A 1D3DB 1SR5C 3V0XA 1O2LA 5HM2A 1K9OE 1KXDA 3SQHE 1TQ0B 3RXAA 2P94A 4JK5A 3MTYA 1ANDA 3PLKA 1IQGA 1EPTC 1WQSA 1N6XA 3IITA 5F8TA 1QTFA 2TGAA 1QJ7B 4I31A 1SVPA 1UO6A 1GJAB 5A8XA 2PR3A 1ZGVA 1ZTJA 3WWFA 1T8LA 2PP6A 1C5UA 4WMDA 1FV9A 4FUFA 2WYGA 2IJOB 2ZI2H 4AG2A 1O3CA 4H6TA 3A8BA 2OC8A 1BRAA 3M7TA 3EA9A 2ZCHP 1E34B 4ABIA 1SLVB 1OWEA 1EZSC 1RS0A 3SU1A 5EXNA 1O3EA 4X1QU 1MKWK 4A5TS 2GMTC 1HJ9A 1QB6A 3RUOA 1GPZA 1P3CA 2BX4A 4GHTA 5C0UA 1GI8B 5EJLA 1TPOA 4BAQB 5DO4H 2ZF0H 2ZFSA 1WTHD 3BTFE 2Z9GA 1NPMA 1QB9A 1CVWH 4WF8A 3SNAA 4ZKSU 3A86A 2ZHFH 1SG8B 4XRNA 1TOCB 4AX9H 3A83A 2GV6A 3TH2H 2THFB 3FANA 1DITH 2BLOA 3F2GA 2W3KA 2OQUA 2BLQA 3IG6B 1GBTA 2XBXA 1O37A 5L2YH 3VB7A 1FIWA 3AK5A 1TBRH 2D2DA 5JDUB 2VIWA 3DT0H 3UR6A 2PUXB 2GX4A 4OS7A 3C1KA 3RXBA 4K1SA 4U30A 1C5ZB 1N6YA 1GVKB 4NSVA 4CHAC 3RXHA 2ZDMA 1UK4A 2FYQA 1SGFA 1GHYH 3ZV9A 3L6PA 1T8OA 1YPJH 5CHAC 2YNAA 2Z94A 3GYLB 1W3CA 4WY3A 1LVBA 3B8JA 1YYY1 2ZECA 1F0RA 4ISHH 4JZFH 2ODPA 1QURH 2F43B 4FUBA 2O8WA 1KY9A 1GJCB 1ZMJA 3HK6B 4O3TA 4CRBA 5C1UA 3UY9A 1A5GH 1D6WA 3BTKE 3HKIB 1JRSA 3QTVH 1YPLH 4NZLA 1H8IH 1A61H 5FX6A 1TFXA 5FCRA 1QBNA 3PYHA 4CRDA 1MU6B 1UVPA 5C1YA 1EAUA 1OWHA 1C2GA 6CHAC 3KN2A 1O5AB 3DSOA 3DUXH 1CGJE 8KME2 2FYRA 5BPEA 1AFQC 1YPEH 1GWAA 2H5CA 2ZGHA 3DFLA 4Y8ZA 2DE8A 2PUQH 1PJPA 3U69H 2BD5A 1YKTA 3LC3A 1FAKH 4UFDH 3S0NA 3LH3A 4YO9A 3GCOA 1L1JA 3GY4A 2FOEA 2VIOA 4X2WA 4XBBA 1GBLA 1Q2WA 4VGCB 4BAMB 2G8TA 2EY4C 2CV3A 5T6GA 2A32A 1MKWH 5HYOA 1WAYB 1GMDG 4HZHA 3KYGA 3RXRA 2A5IA 2VBCA 1KXAA 3LJOA 3QGJA 5DPAA 3OE7D 3T29A 3D65E 3FO8D 4ZHAA 3UWIA 2NU4E 2VVVA 4WMEA 4X8UH 4K8BA 4YM9A 3RU4E 1V3XA 3SZNA 1BBRK 3F9HA 3MU8A 1FY3A 1P09A 1TQ7B 2WSSD 4CREA 5EXLA 3U98H 2ZFTA 2FO9A 1GJ4H 3TLOA 1LCYA 3HGNA 1O2KA 2G00A 3PLBA 1AY6H 1QL9A 3F3BA 2Y7ZA 4RT0A 5LPFA 1W0JD 3EA7A 4DJZB 2QF4A 2VU8E 2Y5FA 1C5MD 3PV2A 2R2MB 4O3UA 3UR9A 1YPGH 1QZ8A 1T8MA 1BIOA 1UCYH 3ATIA 1O5DH 2ZU5A 3F0OA 2KM0A 1IQLA 1THPB 1OOKB 3ODFA 3EGKH 3AW1A 3ZV8A 1O5EH 3PMHB 1P2KA 1AB9C 1OWIA 3PTNA 4Y76A 1FDPA 3PV5A 3MO9A 1O2UA 2FODA 5ETXA 2ZGJA 2FOHA 1ZYOA 1ETSH 5HKKD 1G32B 1ZJDA 2GV7A 1O33A 4CBOA 1UHBB 4R0IA 1VCQA 2XWBI 3TH3H 1O3PB 2CHAB 5EU8A 3PB1E 1LKBA 8GCHG 2HOBA 1IQFA 2PKSB 1VKYA 4I7YH 1AZ8A 1ZLRA 2RA3A 1RTLA 1VITH 4YTAA 1SGEE 3HKJB 3QWCH 4K2YA 1HAVA 5JYIA 2UUJB 4LZ4B 1SGNE 3A89A 4DT4A 4ZKNU 2ZEBA 2SFAA 3VXEH 4Y79A 1K1OA 4I8HA 1OPHB 5DP3A 1SOTA 1HFDA 2HNTE 2H9EH 1GDQA 1QIXB 2Y5GA 4OS4A 1EX3A 1BRCE 3MO6A 1C5TA 1QB1A 3BEUA 3P8GA 1LHCH 5FBIA 1WCZA 1QRXA 4FU7A 1AN1E 2BDAA 1S5SA 1OP0A 3DCLA 4Z6AH 4AOQA 1P8VC 4TT3D 1S81A 3SUDA 2L6OA 1HJ8A 1GI7B 3PWBA 1T8NA 1W8BH 4X1RU 2QC2A 3T2NA 4IMZA 1KLJH 1ORFA 2BZ6H 2D1JA 3LDXH 1O2VA 2AIPA 4THNH 1DWCH 1P01A 3F2FA 2HNTF 3ENSB 4Q4LA 5I46H 2WV4A 3QZQA 4NA7A 4ESTE 4FU9A 4OM9A 3LH1A 4KP0A 1PQ7A 4UFGH 5IK2D 1G9IE 5EQSA 2F3CE 3SV6A 1SGTA 4I8LA 2F9BH 1UJ1A 4Y7BA 4GVUA 4A92A 1DICA 1IQJA 1DOJA 3BEFB 5EPYA 1WDIA 2G52A 1W10U 1LO6A 4MVNA 2GTBA 4AZ2B 3E6PH 2A7CA 4ZAEA 3OFND 2JETC 2O8MA 2Y82A 4FUEA 1BITA 3MU1A 1G3CA 1OP2A 4FUJA 1IQHA 3SJKA 5LGOA 4A7IB 2H6MA 1ZHPA 4HI3A 1O2QA 2HVYB 4ABGA 3UOPA 1VJAU 2FOCA 3S9CA 2ZHDA 1HAZB 2ODYB 3MI4A 3EAJA 2GZ9A 2W3IA 1EPTA 3WWBA 1SGQE 5AF9H 1ELGA 4I8JA 2XWAA 3PWCA 1Z1IA 1ELCA 1AO5A 1HAYB 1L0ZA 3UQVA 4NG9H 2ANWA 2ZU3A 2VNTA 1TRYA 3LGYA 3RP2A 4ACBA 1H8DH 2SNWA 3BTQE 1O3MA 3SZEA 1BMFD 1MQ6A 3QDZB 5SGAE 1F2SE 1IQKA 4AFQA 1FPCH 1P0SH 1FIZA 4FUHA 2J98A 3EA8A 1CT2E 1SGRE 1NY22 2A5AA 4P00A 1YLDA 5C67A 2SGFE 2ZZUH 1B5GH 4BTTB 1MH0A 1X7AC 4DIIH 3CS0A 4B1TA 1FMGA 3BEIB 1D3QB 3ZZ5A 4GAWA 1HJAB 7KMEH 1HAXB 1BOQA 2HLDD 2ZHQH 4DCDA 2G5NA 5DJ7A 2ZGXH 2P95A 2TIOA 1LHEH 1ZRBA 2VIQA 1BRBE 3A80A 1D3PB 1FN6A 2AMQA 3BTME 1Y3XA 2ZG0H 4K5ZA 1LPZB 2WPHS 2WUCA 4YLQH 5AFYH 2NU1E 3GYMA 5JBBS 5PTPA 1BTPA 1TNGA 2VVCA 4CRCA 4M7GA 2GCHG 1T32A 1FY8E 3R0FA 1UTKA 2BDGA 1CA8B 4AN7A 3S9BA 1GDUA 1KXBA 2BY7X 2G55A 3RXMA 3RXTA 3H7TA 3DD2H 2A2XH 2UWPA 5G4BA 1LPGB 2QGRA 1TALA 1TE0A 3E91A 3M37A 3E8LA 2JETB 5L6NH 1W14U 1BJUA 2ZC9H 4E06H 4MTBA 1K1NA 5EXMA 1BRUP 1E0FD 1O3LA 3RXOA 5EW2H 3DSGA 2OTVA 1SPJA 4K69A 2QCYA 3RMOH 4AFUA 1ID5H 4Y8XA 4DIHH 2FS8A 4BNRA 3VGCB 1XVMA 2OC7A 3MWIU 2W26A 2J2UA 5TCCA 2DE9A 2BXTH 2IPHA 1GDNA 2FX4A 3ZZ9A 4AYVB 4JK6A 1NO9H 4ZHMU 1EQ9A 1YM0A 2A4RA 4CBNA 3E90B 1EATA 2VH0A 6ESTA 4RSPA 3ZVGA 3UTUH 1AVGH 4YT7H 4Y10E 1NESE 2BDCA 2AS9A 2WINI 2ZCLP 5E8EH 1V2WT 2OQ5A 1YCPM 5B6OA 1GI9B 1GMCG 2ALPA 1GBDA 3QTOH 2XBWA 3N99A 1V2KT 1AU8A 1UK2A 1Y3UA 1ZOMA 2WV9A 2ZIQH 3UIRA 3M7QA 5LH8A 1ELVA 2J97A 2SNVA 2ULLA 1AIXH 1YCPK 2RFKC 3OU0A 2J95A 1W13U 1V2TT 5E2OA 1CBWB 2ZU1A 4ABFA 3A85A 1G2LA 4CRGA 5K7RA 4ASUD 1RIWB 3L33A 4WXVA 1GGDB 2GP9B 1LPKB 1TGSZ 2UUFB 4ZKOU 1SL3A 1GI1A 3CP7A 3BTWE 1NS3A 1L1GA 4Z0KA 1DXPA 5JB9S 5EODA 3UNRA 1O3JA 1HBTH 1GI6A 4FUCA 4IC5A 5C5OA 2FESH 2AIQA 1GBKA 2R2WU 3FZZA 3RU4D 4D9RA 1NRRH 1P2JA 1YF4A 4FOUC 1HB0B 2JKHA 1TX6A 2PLXA 4GCHF 1FPHH 1QQUA 1C4Y2 2HPQH 2ODQA 1XUIA 2BD7A 1TAWA 1WBGB 2BX3A 1MQ5A 2KCAA 2EI8A 2ZPRA 2ZWLH 4XBCA 1F5KU 1JBUH 3NK8A 5JBTA 1BBRE 1COWD 1G37A 1Z8GA 3ZZ8A 3TNTA 1O32A 2OBQA 2IN2A 3JZ2B 1FI8A 3M5NA 1MTNC 1O2ZA 2B8OH 1FONA 2AGGX 1QJ6B 2BYAX 2HWLB 2PSYA 4TPYA 2PGQB 1PYTD 4XOJA 1CGIE 2Y6TA 1SQRA 5AHGH 3SJ8A 4FU8A 5GWZA 1FJSA 2P93A 1CHOF 4F49A 4JCNA 1HXEH 5FPSA 2ZP0H 3A84A 3KQCA 1PPFE 1DANH 1HV7A 1K21H 1S83A 1TA2A 1AWHB 1LVOA 1C1WH 1AUTC 2WYJA 1P04A 1J15A 1YCPH 3B23B 3M3SA 1LHDH 2P3FH 2C8ZB 1E37B 1ZRKA 4SGAE 2C93B 3P8OA 1Q3XA 1GJ8B 3N7EA 1ZGIA 2ZGCA 2TRMA 3M36A 1DXWA 3MU4A 4NCYA 3KQEA 2W7UA 1ZSLA 1NM6A 1C2HA 3GY7A 3FP6E 3PO1C 2PV9B 1DS2E 1ELFA 2K8IA 4FVBA 1INCA 1J9CH 1FY5A 1TMBH 2KAIA 3I78A 1BTUA 3ATLA 3BTGE 3PTBA 1C2IA 2A0QB 2OBOA 3L3TA 1YPHE 2QXHA 4H4FA 3VPKA 1W12U 4AC9A 4U32A 2SGDE 2PWXA 3SNDA 2ZFPH 3GY8A 3DSPA 3RXGA 2GCTB 1BTYA 1IHSH 3FZDA 1GCDA 3NRLA 2CJIA 1GCTB 1ZPBA 3SU3A 1C1NA 1C1VH 1VITF 1Y3WA 4Y7AA 2G4UA 4YOJA 2PW8H 2GMTB 2ZDVH 5EJ1A 2LPRA 1O30A 9ESTA 1C5RA 1CHGA 2WHXA 1F92A 1NC6A 5DSFA 2JJ2D 5GCHF 3MH4A 4B2BA 1PQ5A 5C3NA 1AVXA 1V2NT 2SGQE 2A1DB 1RTFB 4LK4A 1TRNA 1SGDE 2M2AA 2YMSB 2A2QH 3FKSD 1XM1A 2VGCC 1VCPA 3E16B 3HK3B 3OEHD 3MYWA 1ETTH 3SYJA 1C2LA 2O8LA 3M35A 1A4WH 1L4ZA 2FXRA 1G3EA 3BIVH 2CGAA 1C5XB 1TGNA 3TGJE 3A8AA 1RXPA 3M61U 3TK6A 4WXIA 3V12A 1SMFE 2KCPA 3OAAD 1T4VH 1FXYA 1AUJA 2RA0A 2W6JD 2ANMH 2BZAA 2R9PA 3HGPA 3PMBB 1Z8IB 2Z3DA 1PQ8A 4GCHG 3SNBA 4FUIA 3SI4H 1RRKA 4DT7B 2BVRH 2XNDD 2PKAA 1OKXA 1V2VT 4Q7YA 1NZQH 1S0QA 1TIOA 1O5GH 3RMNH 4NIXA 3SBKA 3T26A 5GCHG 4AYYB 1A0HB 3QO6A 1TPSA 4XBDA 2Y5HA 2QE7D 4NWLA 1TB6H 3F9GA 2WPLS 1GG6B 1WU1A 1G3BA 4DOQA 5ABWA 3PMAB 5HIYA 3D62A 2ZTYA 4MPWA 3HATH 2B0FA 2B7DH 1ARBA 3BTEE 2Z9LA 4Q63A 1ZZZA 3PO1B 4AORA 3HPTB 2GCTC 3T5FH 5L30H 2ZU4A 3U8TH 3CNRA 5FPYA 3NKKA 4IW4E 5EQRA 2BB4A 1OWDA 3TIUA 1XUKA 4LXBH 3LGWA 1G3DA 1Z7KA 3BTDE 3ZVEA 1MUEB 1NT1A 1J14A 3SN8A 2C8XB 1C2KA 4KTUA 2ZFQH 3VG8A 2GKVE 5AFZH 3S9AA 3RXLA 1CA0B 2FLBH 1T4UH 5A2MH 1BT7A 3SGQE 5DK1A 4VGCC 1Y3VA 1GCTC 2BD2A 1DPOA 1NBMD 2V3MA 5C94A 5DP9A 4I33A 1QA7A 2NWNA 4Q2KA 1EOLA 1MKXK 5F8XA 5F03A 1W11U 1GI3A 3EE7A 4FXGH 4JZEH 1WOFA 3MH7A 1Y59T 2SGEE 1GBCA 2ZPQA 4CRAA 2F9OA 4WWYA 2ZDKA 1EAIA 2D8WA 1WTGH 2HVXA 4XDEA 1K1MA 5GJ4B 5FPTA 1S84A 3T28A 1B7XB 4UONA 3KQBA 8ESTE 1C5PA 2LELA 3AAUA 1ANEA 4OS5A 3ATWA 2FI4E 4O97A 2RG3A 4AG1A 4O03A 2UUYA 1AKSB 4AGJA 1SOZA 2QA9E 3MNXA 3SHAH 2KX4A 2JJ1D 1V2QT 2VB0A 2VWMA 4ABEA 5F6MA 5A0CA 1BTHH 4X6NA 2OD3B 1E35B 3ZVBA 3EYDA 4GUXA 3D49H 1BTZA 5DN6D 1HDTH 1VCWA 4Q7ZA 3PROA 1UTQA 3PRDA 1P9SA 1IQIA 1LKAA 1TPPA 1HAIH 4KKDA 2EEKA 4X8SH 2R0KA 4ISIH 4CR9A 3NXPA 1O5CB 2HLCA 3LOXA 3SJ9A 2KCYA 3GDSA 2V0BA 3SU6A 2BD9A 3BG4C 4ZXYH 3RC5A 3S7HB 1B0FA 1DVAH 3GS9A 3PV4A 1SGCA 1YPHC 4CH8B 1QL8A 2FLRH 2YNBA 4J2YB 3OY6U 1SHYA 1SGYE 4CRFA 4KTCA 4WMFA 1O3AA 4IMQA 3SI3H 4B76A 3U9AH 1FX0B 5TCAA 3SJIA 3OY5U 3TJUA 1QFKH 5C1XA 4X1NU 2BDIA 3UUZA 2HGTH 2ZQ2A 2STBE 3GDUA 1TX8A 1J8AA 4TYDA 3ZVCA 2F9NA 4TY7A 4A6LA 2BXUH 2NU0E 7GCHG 3VEQB 1O2SA 3LGTA 3LJJA 2EQNA 2FZZA 2A45B 1KXCA 3MH6A 2AFQB 1HAGE 4HFPB 1QCPA 1NRPH 3KQDA 3OX7U 1DWEH 2BQ7B 4D7FA 1O39A 3F68H 3O8BA 4HG6A 3ATMA 3STJA 1JOUB 2R3YA 3K2UA 1C5WB 1PPCE 1E36B 4BOHA 1ELDE 1ESAA 5E0GA 3ZZ4A 1CU1A 3Q77A 5I25A 4GHQA 1C1RA 3M5OA 4X6MA 2XCNA 1RFNA 3A7YA 1S6HA 3LU9B 1ELTA 1MD7A 1OYTH 2VH6A 1QQ4A 1MZDA 3KQ5A 4D7GA 1TWXB 3RU4T 2EC9H 3M7UA 1LHGH 2ZU2A 1XXFA 1NN6A 4A1VA 3E0PB 1C4V2 1V2ST 4CR5A 3GCHB 2JH0D 1IQNA 2A5KA 1EZXC 1UTMA 1BMNH 1D9IA 3RXIA 5T3HA 3K6YA 2QYIA 3WY8A 3MNCA 1O3FA 2LP6A 2VWLA 1V2PT 1V2MT 1OWJA 1A2CH 1GBHA 1UVTH 3I77A 4JZDH 4O9VA 2OUAA 1ZMLA 1ZPCA 3RLWH 3SO3A 3SGBE 1C5LH 1GBAA 4I8KA 3KHVA 1P2QA 5ESBA 3UREA 3PM3A 3SV2H 1TNHA 2FOFA 3MMGA 1JMOH 3SHCH 1A0JA 3ZYDA 1O0DH 3S7KB 5EG4A 1C5OH 1Z6JH 1YP9A 3SQEE 2F9VA 2RDLA 1UCYK 2OK5A 3SUGA 6LPRA 4JYTA 5DKMA 1P2NA 2ZFFH 2CN0H 2QXIA 5CHBA 4XD7D 1AFQB 1BHXB 2A4OA 1V2JT 3W94A 3TITA 4D76A 4WH8A 1NRSH 2BQ6B 4Y6DA 1C5VA 3RXVA 1O3BA 2PKAB 3H7OA 3SU4A 4BAKB 3BIUH 3W95A 1GBJA 4P02A 1H8ED 2PTNA 2BD8A 3DFJA 3LGUA 4IBLH 3UFAA 1GJ5H 1HJAC 1KDQA 3PMJA 2C90B 1OHHD 2R0LA 4ZXXH 3U8RH 2FI3E 2BDYA 2XW9A 1U6QA 1A3EH 3KYFA 1DLEA 2XTTB 1AWFH 1JIMA 1SGIB 3C27B 2QY0B 4CHAB 4AFSA 1CO7E 4H6SB 1K22H 3NPSA 4X2YA 1SLXB 2BD3A 1Y5UT 1G2MA 1GI4A 3MOCA 2FMJA 1IHTH 3Q00A 3RXCA 2FOAA 1TNJA 2UUKB 5J4QA 2ZFRH 1MMJN 2G5VA 3V7TA 4K1TA 3E3TA 3TGIE 1H1BA 1P10A 1DDJA 3K65B 4FETA 1C4U2 1QGFA 1TRMA 1DSTA 1XVOA 2RDEA 3O8DA 4I32A 1CE5A 3TJVA 2ASUB 1BTXA 3PRBA 3D23A 4X6PA 3N7DA 2GZ7A 4DW2U 4DG4A 2SGPE 2G81E 4A1XA 1MCVA 1O36A 1TX7A 4MPXA 1TNLA 1THSH 2QF3A 2FIRH 1ESBA 1EPTB 1GBFA 1BB0B 1TPAE 3S69A 1MAXA 1ELAA 2P3TB 1J16A 2BOHB 3LIWA 6CHAB 4Z1MD 1P2MA 2D26C 3RXJA 3VGCC 1UCYE 4BXSA 4YOGA 3EDXB 2A4QA 1DSUA 2AHME 2QIQA 1T7CA 4NFEA 3MU5A 1XUJA 1HPGA 3LT3A 1N8OB 2VWOA 1KSNA 1QRWA 1Z71A 1FUJA 1O2PA 4UD9H 2P16A 3Q3YA 3UPEA 1EASA 1GJ9B 4LZ1H 3A81A 1QRZA 5JB8S 2F91A 3BF6H 1V6DA 3SU2A 1LHFH 4IC6A 4ZKRU 3GY5A 5IDKA 1BMAA 2RCEA 5GDSH 4Y0YE 4INHA 5DP8A 3U1IB 1L4DA 2TGPZ 5HM9A 4LOYH 1GMDF 3F2HA 3BSQA 3SU0A 1EZQA 2P8OB 2VVUA 1FLEE 4FVDA 1S6FA 1O3HA 1C2MA 1AVWA 1TNKA 1DE7H 1EJMA 4YLUA 1S0RA 3O8CA 4U01A 1UHBA 4DGJA 2KFWA 4MPUA 2W6ID 3Q76A 3VB5A 1GMCF 1E1RD 1P05A 1ZJKA 2ZHEH 1AQ7A 4NA9H 1DFPA 1SGPE 2ZTXA 5J4SA 2HPPH 2XXLA 3TGKE 1QBVH 1Y3YA 2ZCKP 3Q3XA 3SNEA 2Z7FE 3M5MA 2C4FH 5C20A 3KGPA 3OEED 5JBCS
chains in the Genus database with same CATH topology
1ELEE 4XSKU 3RMMH 5HXFA 1TMUH 1MKXH 5LPEA 2ZQ1A 1GMHG 1ZPZA 2FEQH 1UVUH 4E7RG 2OINA 1IAUA 2C8YB 4BXWA 1DUEA 5DG6A 2PKSC 4KELA 2H9TH 3SJOA 1NU7B 2A7JA 4K60A 1TYNA 5DGJA 1YPMH 1J17T 2FI5E 1MU8B 4NA8A 5EQQA 1NFWA 1SHHB 2BLWA 3ZZBA 2VINA 1TBZH 2BHGA 2C8WB 3AW0A 5BRRE 4D9QA 1DWDH 3QX5H 1A5IA 1CSOE 1W7GH 3ODDA 3P17H 1ZMNA 2H1UA 2PSXA 2WPMS 2PTCE 3K9XB 4JYUH 1NRNH 2DUCA 4ASHA 1BUIA 2W7SA 1GL1A 4MLFB 1TABE 3EQ0H 1O3IA 2KAIB 5EOKA 4JZIA 1EP5A 1N1LA 5FX5A 1BMLA 2K1QA 1CHOG 4ZMAH 1BHXF 2HRVA 1P9UA 1SLWB 3RM0H 3MNSA 1DM4B 2UWOA 1QR3E 1O2TA 2BD4A 2A7HA 5FBEA 1M9UA 5K0HA 1XXDA 5C2ZA 2CF9H 1QY6A 1DY8A 3ZZ6A 2FOGA 2V3OH 2BMGB 1NROH 1D3TB 4UFFH 1DWBH 1PFXC 3RC4A 1KIGH 3KL6A 1QJ1B 1AGJA 1GHVH 1L2EA 4ABAA 1WYKA 1GJ7B 2ANYA 1FAXA 3FAOA 4UEHH 3UQOA 1HXFH 2OCVB 1XMNB 4MNWA 1P02A 1QNJA 1C2JA 1FNIA 4RN6A 2H2ZA 1O38A 1WQVH 4E05H 2AH4X 5DP6A 1PPGE 3NCLA 3ESTA 1G36A 1LVMA 1Z8RA 1TGBA 3FFGA 3FP7E 2OP9A 2Q1JA 1YPKH 1O5FH 1RGQA 1GVLA 2VGCB 2ANKH 9LPRA 1NRQH 1VITG 2V35A 1O31A 1EAWA 1JWTA 1UVOA 4NFFA 1AB9B 1BBRH 1HAPH 3RMLH 3B9FH 1TONA 4X2VA 4IS5A 1VZQH 2C3SA 2XC5A 3RXQA 2VIVA 2P8OC 3TK9A 2CHAC 4X8VH 1GI0A 1UTPA 1O3OA 2EI7A 1P2IA 5GIBA 3NUMA 1VR1H 1KLTA 1GL0E 1O3NA 4RKOB 1XX9A 2ZKSA 1GMHF 1EUFA 1HAVB 4MG3A 1Y5AT 2G4TA 2H9HA 1PPHE 3SUFA 2GT8A 4B75A 1NFUA 4DURA 5JPMH 3GISB 1C1UH 3NZIA 1N8OC 3OYPA 2NU2E 1ACBE 1OWKA 3JZ1B 3RXEA 3IWMA 1ZSJA 1XUFA 1CBWC 1BMMH 3P70B 1SB1H 1EB1H 1BDAA 4JZ1A 4YOIA 1HYLA 1WV7H 4X6OA 2BY9X 3LGVA 1PQAA 4AB9A 4TWWA 4Y0ZE 4H42U 3SNCA 4B74A 3U8OH 3T27A 3ZZAA 4ABDA 1ZTKA 4E7NA 5EW1H 1H9HE 1A0LA 4NZQA 2VIDA 1ZTLA 1QBOA 2PFEA 1ZHRA 4MNVA 4ZROA 2BLVA 3SGAE 4J1YA 3ZZDA 1RTKA 2ZDNA 4X1PU 2GVFA 5CHAB 3AVZA 1LMWB 1GHWH 3UNQA 1C9TA 1ABJH 1V2OT 3BN9A 4UE7H 1SLUB 1FN8A 3SU5A 1KXFA 3SUEA 4FUGA 4B73A 3LKWA 2GCHF 3BV9B 1AI8H 1JRTA 1HUTH 1NTPA 2EI6A 2F9PA 5JBAS 1AE8H 2FP7B 1C1QA 3MH5A 1LDTT 4IGDA 2BDHA 3RXUA 4BTIB 4ABBA 1NFYA 1LQDB 2QV1A 1ZSKA 4XFQA 1FQ3A 2W5EA 4F4OC 1BZXE 1F5LA 1C1PA 2R3UA 4XE4A 3GDVA 2A31A 1YC0A 3SORA 3V13A 1H4WA 4JYVH 3A88A 4SGBE 1YLCA 2FTMA 3A7ZA 3RDZA 1O2YA 3UNSA 2AYWA 1RIWC 5E0HA 1SGFG 1O2OA 3MFJA 1HIAB 4ABHA 4FUDA 1ANBA 2VIPA 2G51A 3BG4B 4Y11E 3UWJH 1RD3B 5A8YA 2XC0A 1DT2A 1C5NH 1O2MA 3URCA 2GDEH 4MDSA 5FAHA 3GCTG 1W2KH 3LGIA 1C1OA 4CH2B 1TMTH 1QA0A 3DHKH 1A7SA 1FY1A 2LNCA 1F0TA 1EOJA 1K1JA 4NWKA 3OTJE 2BVXH 2QAAA 4TWYA 2EA3A 1C5YB 1OX1A 5DP5A 2I6QA 1D4PB 4WH6A 1GBEA 3TNSA 4RKJB 2VJ1A 1K1LA 5E0JA 5ESTE 5T6FA 1SQOA 2FWWA 4A1TA 2BM2A 2ZA5A 1SQAA 1AE5A 3QN7A 1ABIH 5GPIB 3T25A 1UTJA 1D6RA 1GGDC 3QGNB 3QLPH 5E2PA 5L2ZH 3RM2H 3SV9A 4IN1A 1O2GH 1DUAA 4OGYA 1S82A 4I8GA 3QK1A 4NGAH 4MNYA 1MTNB 2ZDAH 3RC6A 3TVJB 3ZZ7A 1ZR0A 4ZHLU 2J4IA 1GVZA 1EJAA 2AERH 5T6DA 1IOEA 1AFEH 3A82A 3OSYA 1BTWA 2B5TB 4K1EA 4NIWA 1O3GA 3A7XA 2V6NA 5A09A 1PPEE 3GICB 3TU7H 1DX5M 1UTNA 1T31A 1KXEA 1JXPA 1K1IA 2ZTZA 3GY6A 1MBMA 2CMYA 2TBSA 1A3BH 1HRTH 4Q7XA 5AVDA 3TH4H 1A1RA 4ABJA 1GI5A 1UVSH 1QL7A 1MZAA 3GCNA 3AAVA 4PROA 3O8RA 3N7OA 4INKA 4UDWH 1AZZA 4ZH8A 1BCUH 3ZZCA 3BTHE 1RJXB 1GBMA 4B2AA 1GG6C 1L1NA 1A46H 2GD4B 1P03A 3F9FA 1V2LT 1YGCH 2P59A 3FP8E 1Y8TA 3RXKA 3KCGH 3P8NA 3A87A 4AFZA 1KLIH 2IOTA 1EJNA 3ZYEA 2WV5A 4QT8C 2ZDLA 1BQYA 3LPRA 4R8TB 1KDQB 1P2OA 2O9QA 4KGAA 4BAHB 1YBWA 5CMXH 1O2IA 2AGIX 5A0AE 1FZZA 1C9PA 4X1SU 3TJOA 1ELBA 1UMAH 2B9LA 1HAOH 4YESB 2FX6A 3FVFB 1HLTH 1V2RT 1Z8JB 2J38A 2PGBB 5A8ZA 1TGCA 2ILNA 5DP4A 1WSSH 3T62A 1GHZA 3EE0B 1CGHA 1O5BB 1W0ZU 2AEIH 1BJVA 1QHRB 1CT4E 3K6ZA 1UTLM 3A8DA 1SBWA 3GY3A 1EP6A 1H9IE 1W7XH 5C5NA 3GCTF 2OLGA 1JIRA 2Y7XA 4KTSA 5FHTA 3GY2A 1VGCC 2FTLE 2TGTA 1IQEA 1OXGA 2XCFA 1XKBC 4K8YA 4Q80A 1Z6EA 2P3UB 3A7TA 2ZPSA 1SFQB 5FXLA 3CENA 1P12E 2WPJS 7LPRA 3ATKA 3A8CA 2XNIA 2H5DA 5EPNA 1H9LB 1AHTH 1MCTA 2A4GA 2Y81A 2AMPA 1Z1JA 2XBVA 3VXFH 1TBQH 4X0WU 2ESTE 2XRCA 2WPKS 2BY6X 4OS6A 1O34A 2Z3CA 5GXPA 1WUNH 2OC1A 4Y71A 1MTUA 1C5QA 1OSSA 2ZHWH 3E0NB 3QUMP 2PHBA 2QXJA 1B0EA 1UK3A 3BTTE 4HTCH 1BA8B 2AMDA 3KF2A 3SV8A 3KNXA 1TOMH 3ZVFA 1A5HA 3Q3KA 3MO3A 1O35A 1LVYA 2Z9KA 1AMHA 1MBQA 3LONA 1F7ZA 2Y80A 5CE1A 3M5LA 1MTVA 1OYQA 8GCHF 1ANCA 3CS7A 7ESTE 2OC0A 1C1TA 2Z6BD 4UFEH 1CT0E 3RXDA 1GBIA 2M5TA 2ZNKH 1C2DA 1F0SA 1MD8A 1P3EA 2FOMB 1O2WA 1DLKB 1O2NA 4NSYA 2WUBA 2Q6FA 3MHWU 1F0UA 1GBBA 4D8NA 5TJXA 2Z9JA 4AB8A 3P95A 1ESTA 1MAYA 2VWNA 2BOKA 2FDAA 2TPIZ 2ZO3H 3STIA 2FS9A 2F9UA 3F6UH 3DA9B 5A0BA 5F8ZA 3MNBA 4B71A 1S85A 2CXVA 3PLPA 4BAOB 2J34A 2WPIS 2ZGBH 5H4IB 2BTCE 1C2EA 1FY4A 4INLA 1HNEE 2Z3EA 1NU9A 2QN5T 3U1JB 1ARCA 4X2XA 1GJDB 4OS1A 1HIAA 3P6ZB 3URDA 4BANB 2FM2A 1TNIA 2O8TA 2O8UA 4Y8YA 3V3MA 4AGKA 4YZUA 5HGGA 1P57B 2I6SA 2AGEX 1TA6A 4K3JA 4DVAU 1O3KA 2Q6GA 4ISLA 1TLDA 1XUGA 6GCHF 1CA0C 3NWUA 2BY5X 1NFXA 1GJBB 3KEEA 1GHBG 1TGTA 1AD8H 3VFEA 1VGCB 1AKSA 4ISOA 5HMAA 1SSXA 4DY7B 1SQTA 2STAE 1CQQA 1HGTH 3MU0A 1E38B 4HGCA 2QXGA 3SV7A 1O2HA 1Y5BT 5IYTA 2V3HH 3SW2B 3VB6A 1O2RA 1LTOA 3AASA 4GSOA 1G30B 3TJNA 4ZUHA 1SI5H 1PYTC 5FCKA 1GI2A 3I29A 1K28D 4MPVA 8LPRA 4X8TH 1PPZA 1VJ9U 2J92A 2YOLA 4WVPE 3G01A 4OGXA 1GHAG 1KTSB 4MNXA 4GPGA 3ZVDA 2XBYA 3LC5A 3ZVAA 3UOUA 2Z9IA 1O3DA 2F83A 4TY6A 1GJ6A 2XC4A 6GCHG 2J9NA 5EGMA 1MTWA 1F5RA 1GHBF 1EXFA 1IQMA 2QF0A 1OP8A 1KTTB 4JMYA 3A7VA 1LQEA 4IN2A 4ISNA 2FOBA 4B2CA 3F1SB 3TK5A 4TPIZ 1W0YH 3A7WA 2HALA 3F9EA 2UWLA 3RXFA 2J94A 2GT7A 3M3TA 2ALVA 4OS2A 2Q6DA 1P11E 3SOSA 1ZHMA 3ZZ3A 1Q31A 1O2XA 2NU3E 3P8FA 2BDBA 1C5SA 3RLYH 4NIYA 3P92A 1UTOA 2BQWB 3GCHC 2GDDA 4U2WA 4WJG2 1XKAC 2CF8H 3E1XB 3VB4A 3RXPA 1GHAF 3ELAH 1MTSA 1SFIA 1EZUC 1K2I1 3GOVB 7GCHF 1ETRH 1OS8A 1C1MA 3ITIA 5LPRA 1C1SA 2JH5D 1HAHH 2HNTC 2BY8X 2XYAA 1KYNA 3QZRA 2TGDA 3RXSA 1PPBH 2GZ8A 1K1PA 1DY9A 2GGVB 1XUHA 2SGAA 4GLYA 4BTUB 4YT6H 4NIVA 1GHXH 1EAXA 3H5CB 2BVSH 1EKBB 3M3VA 3TPIZ 3R3GB 1C2FA 1V2UT 1SC8U 3VB3A 1O2JA 1HCGA 5DP7A 3BG8A 3KIDU 4MQAA 1THRH 1P06A 2OXSA 2FPZA 2JH6D 1EB2A 1D3DB 1SR5C 3V0XA 1O2LA 5HM2A 1K9OE 1KXDA 3SQHE 1TQ0B 3RXAA 2P94A 4JK5A 3MTYA 1ANDA 3PLKA 1IQGA 1EPTC 1WQSA 1N6XA 3IITA 5F8TA 1QTFA 2TGAA 1QJ7B 4I31A 1SVPA 1UO6A 1GJAB 5A8XA 2PR3A 1ZGVA 1ZTJA 1T8LA 1C5UA 4WMDA 1FV9A 4FUFA 2WYGA 2IJOB 2ZI2H 4AG2A 1O3CA 4H6TA 3A8BA 2OC8A 1BRAA 3M7TA 3EA9A 2ZCHP 1E34B 4ABIA 1SLVB 1OWEA 1EZSC 1RS0A 3SU1A 5EXNA 1O3EA 4X1QU 1MKWK 4A5TS 2GMTC 1HJ9A 1QB6A 3RUOA 1GPZA 1P3CA 2BX4A 4GHTA 1GI8B 1TPOA 4BAQB 5DO4H 2ZF0H 2ZFSA 1WTHD 3BTFE 2Z9GA 1NPMA 1QB9A 1CVWH 4WF8A 3SNAA 4ZKSU 3A86A 2ZHFH 1SG8B 1TOCB 4AX9H 3A83A 2GV6A 3TH2H 2THFB 3FANA 1DITH 2BLOA 2W3KA 2OQUA 2BLQA 3IG6B 1GBTA 2XBXA 1O37A 5L2YH 3VB7A 1FIWA 1TBRH 2D2DA 5JDUB 2VIWA 3DT0H 3UR6A 2PUXB 2GX4A 4OS7A 3C1KA 3RXBA 4K1SA 4U30A 1C5ZB 1N6YA 1GVKB 4NSVA 4CHAC 3RXHA 2ZDMA 1UK4A 2FYQA 1SGFA 1GHYH 3ZV9A 3L6PA 1T8OA 1YPJH 5CHAC 2YNAA 2Z94A 3GYLB 1W3CA 4WY3A 1LVBA 3B8JA 1YYY1 2ZECA 1F0RA 4ISHH 4JZFH 2ODPA 1QURH 4FUBA 2O8WA 1KY9A 1GJCB 1ZMJA 3HK6B 4O3TA 4CRBA 5C1UA 3UY9A 1A5GH 1D6WA 3BTKE 3HKIB 1JRSA 3QTVH 1YPLH 4NZLA 1H8IH 1A61H 5FX6A 1TFXA 5FCRA 1QBNA 3PYHA 4CRDA 1MU6B 1UVPA 5C1YA 1EAUA 1OWHA 1C2GA 6CHAC 3KN2A 1O5AB 3DUXH 1CGJE 8KME2 2FYRA 5BPEA 1AFQC 1YPEH 1GWAA 2H5CA 2ZGHA 3DFLA 4Y8ZA 2DE8A 2PUQH 1PJPA 3U69H 2BD5A 1YKTA 3LC3A 1FAKH 4UFDH 3S0NA 3LH3A 4YO9A 3GCOA 1L1JA 3GY4A 2FOEA 2VIOA 4X2WA 4XBBA 1GBLA 1Q2WA 4VGCB 4BAMB 2G8TA 2CV3A 5T6GA 2A32A 1MKWH 5HYOA 1WAYB 1GMDG 4HZHA 3RXRA 2A5IA 3LJOA 1KXAA 3QGJA 5DPAA 3T29A 3D65E 4ZHAA 3UWIA 2NU4E 2VVVA 4WMEA 4X8UH 4K8BA 4YM9A 3RU4E 1V3XA 3SZNA 1BBRK 3F9HA 3MU8A 1FY3A 1P09A 1TQ7B 4CREA 5EXLA 3U98H 2ZFTA 2FO9A 1GJ4H 3TLOA 1LCYA 3HGNA 1O2KA 2G00A 3PLBA 1AY6H 1QL9A 2Y7ZA 5LPFA 3EA7A 4DJZB 2VU8E 2Y5FA 1C5MD 2R2MB 4O3UA 3UR9A 1YPGH 1T8MA 1BIOA 1UCYH 3ATIA 1O5DH 2ZU5A 1IQLA 1THPB 1OOKB 3ODFA 3EGKH 3AW1A 3ZV8A 1O5EH 3PMHB 1P2KA 1AB9C 1OWIA 3PTNA 4Y76A 1FDPA 3MO9A 1O2UA 2FODA 5ETXA 2ZGJA 2FOHA 1ZYOA 1ETSH 1G32B 1ZJDA 2GV7A 1O33A 4CBOA 1UHBB 4R0IA 1VCQA 2XWBI 3TH3H 1O3PB 2CHAB 5EU8A 3PB1E 1LKBA 8GCHG </