4D8NA

Human kallikrein 6 inhibitors with a para-amidobenzylanmine p1 group carry a high binding efficiency
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
222
structure length
222
Chain Sequence
LVHGGPCDKTSHPYQAALYTSGHLLCGGVLIHPLWVLTAAHCKKPNLQVFLGKHNLGQQESSQEQSSVVRAVIHPDYDAASHDQDIMLLRLARPAKLSELIQPLPLERDCSAQTTSCHILGWGKTADGDFPDTIQCAYIHLVSREECEHAYPGQITQNMLCAGDEKYGKDSCQGDSGGPLVCGDHLRGLVSWGNIPCGSKEKPGVYTNVCRYTNWIQKTIQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Kallikrein-6
publication title Human kallikrein 6 inhibitors with a para-amidobenzylanmine P1 group identified through virtual screening.
pubmed doi rcsb
source organism Homo sapiens
total genus 52
structure length 222
sequence length 222
ec nomenclature ec 3.4.21.-:
pdb deposition date 2012-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4d8nA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4d8nA02
3ZZ9A 1DS2E 1CT2E 5GJ4B 1D6RA 4RKOB 3U1IB 2OQUA 1WSSH 4UONA 2AIQA 1AE8H 2ZPQA 4IMZA 4B76A 2J38A 3CS0A 1DANH 1A4WH 4MQAA 3GDVA 3RXAA 3F9HA 4BTTB 3ZZ5A 4BAHB 4DGJA 3ZYEA 1ZPZA 3GY8A 1SHHB 4D7FA 3MNCA 1S83A 5FBEA 2F83A 1OP8A 3RXBA 1TPAE 1GBAA 1OWDA 4CRGA 4ZMAH 3LU9B 2SNVA 4H42U 1PPEE 1O2YA 3EGKH 3NCLA 1H9IE 3PM3A 3VPKA 1DY9A 1ZOMA 2O8UA 2FOBA 1C1TA 4NIXA 3QTVH 1P2QA 1F5RA 4JYUH 1S84A 5DJ7A 1ELFA 1KXDA 1TBQH 3RMOH 3RUOA 1F0RA 2QYIA 3B8JA 2P3UB 3RXTA 3SNBA 3ZVBA 2G4UA 2GCHF 4A7IB 1RIWB 1KXBA 3LDXH 3A7ZA 3NPSA 4YOIA 4DOQA 4A1XA 1F0UA 3SV8A 3C27B 5ETXA 3CP7A 1F7ZA 3VB6A 3G01A 4NA7A 2G52A 3T25A 1D3PB 1O3EA 1HJAC 3RLYH 1E0FD 2THFB 8ESTE 1P11E 4NFEA 3UIRA 3GCNA 1EZXC 2PKSC 1TWXB 3F9EA 2A7JA 4X8TH 4VGCC 1P57B 3HK3B 1EQ9A 2JKHA 4UFGH 2AGGX 4XBBA 1JIMA 3HKJB 1ZHPA 3A85A 4ZAEA 3TNTA 1TRYA 3RXFA 1O2LA 1O34A 5FPSA 1OYQA 3Q77A 1ZSKA 1QRZA 4R8TB 2BLOA 2ULLA 1GCDA 2FXRA 2GDDA 1SLWB 5AHGH 4AG1A 1HCGA 1RRKA 1T7CA 2ZPRA 2BM2A 5LH8A 1LHFH 1GBMA 1MBMA 1AE5A 1SGPE 4B71A 1W13U 4YO9A 5EODA 3SV9A 2R0KA 3LGWA 2BVSH 1O2WA 3P92A 1LKAA 4ABHA 1YLCA 2CXVA 3K2UA 2XTTB 1PJPA 3KQBA 3IITA 3U9AH 5A8XA 3VGCC 5TCCA 2XNIA 3EYDA 3M35A 2A5AA 2AMPA 2ZDNA 2Z9JA 2QA9E 4F49A 2VWOA 1HJAB 3SHCH 3R0FA 1BRBE 2PKSB 1MU8B 2AIPA 2PGBB 2VH0A 4VGCB 2H9HA 2BX4A 2BTCE 1CHOG 5GDSH 2DUCA 5L2ZH 1QRWA 1CGJE 1SBWA 4Y7BA 2VIPA 2FI3E 3HGPA 1KLTA 1AHTH 1SB1H 3SN8A 3GYLB 4FU9A 3SU3A 4HFPB 1A7SA 3P8NA 5TCAA 1NFYA 2SGPE 1V2JT 3ATIA 3TK6A 1C5NH 3M61U 1LQDB 1SGYE 2FLRH 3IG6B 4AFZA 1V3XA 1LCYA 2A5IA 1GJ4H 2Y81A 4BTIB 3UWJH 2VVVA 2JETC 2F9PA 3A80A 1VJAU 1GHBG 3VGCB 2BY8X 3SGAE 1HB0B 1ABIH 3SUGA 4LOYH 5H4IB 5CMXH 1NPMA 3A89A 1AVXA 1LQEA 1C4Y2 1TFXA 3L33A 3MYWA 3OX7U 1AVWA 1WCZA 2GV7A 2QF3A 3UUZA 5EW1H 2BY7X 1ZTKA 2VWMA 1LHDH 3ZV9A 3PO1C 1K1LA 4WVPE 1SGCA 1KTSB 4WWYA 3RXRA 2CN0H 1C2LA 3UOPA 1GHZA 3A8BA 1SC8U 5BPEA 1TPPA 1DDJA 3UFAA 1GBIA 1Z8RA 4MDSA 1V6DA 1ZYOA 2CV3A 5EQQA 2QY0B 1HAHH 1BMAA 1YCPM 4KP0A 1HAXB 5DP9A 3E8LA 1NRPH 3UPEA 1EAUA 3VXFH 4D76A 1P8VC 2WYJA 3TGJE 3QWCH 1ZJKA 1MCVA 2ZEBA 5DP4A 2PHBA 1GI2A 3ODFA 1IQJA 4YOGA 4ESTE 2ZPSA 2G4TA 1RS0A 1OP2A 2EEKA 2JETB 1UTOA 3T26A 3TJOA 5FAHA 2FI4E 4Y10E 2ZGXH 3MHWU 1HAPH 1BB0B 1AUTC 1SGIB 3URCA 3U8OH 3I29A 5A0CA 1TOMH 2WV4A 3SNAA 1TQ0B 1AIXH 3TIUA 2TBSA 3D49H 3TGKE 1CQQA 2A2XH 4DIHH 1EJAA 1DXWA 1BTUA 1TA2A 5DKMA 2FTMA 1FN6A 1V2LT 1NT1A 1EOJA 2BDAA 2VWNA 2QGRA 1KY9A 2BDBA 1GCTC 1E35B 2ANWA 5HYOA 3PMHB 3ZVCA 1A5HA 4ZKOU 3MOCA 1HAOH 2FOGA 3A84A 2CJIA 1GGDC 1KXEA 1J14A 2A1DB 3VFEA 4K8YA 1SMFE 1TRNA 3MNXA 4TPYA 5DP6A 1Z71A 3A86A 4ISLA 4K60A 4X1NU 4J2YB 1V2QT 4DJZB 3ELAH 3FP7E 1ACBE 4OGYA 1TONA 4TYDA 2A4RA 1N8OC 3M5OA 3ZVDA 1QTFA 4WMEA 1HAYB 1C1PA 2EA3A 2ZGJA 5C2ZA 1GJAB 1CVWH 1P2MA 4Z0KA 5DO4H 3RM0H 8LPRA 1TNHA 3UR6A 1W3CA 3GCOA 4CRBA 6GCHG 1G3DA 2Y5GA 2VU8E 3HGNA 2AMDA 4MNWA 4MPUA 2VVCA 5L6NH 1NROH 1FY3A 4AGJA 7ESTE 4UE7H 3P8OA 1GHAF 1GCTB 4TWYA 2BMGB 1AWFH 3S9AA 2BZ6H 1EXFA 2GZ7A 2TGTA 1TQ7B 4BAKB 1O5GH 3FAOA 1GGDB 2FDAA 4Y8ZA 1ESTA 3LONA 1KLIH 3U69H 4DVAU 2RG3A 4FUDA 4LXBH 4FUBA 1GPZA 5PTPA 1C9PA 3UR9A 1O3PB 1UMAH 2ALPA 1RJXB 5EQRA 1CE5A 4FXGH 4E7RG 1FAKH 3BV9B 3TPIZ 4ZXYH 4ZROA 1YCPH 1N8OB 3S69A 1ORFA 3S7HB 1QGFA 4O03A 5IYTA 1TAWA 1SQTA 3SV6A 1K2I1 2GVFA 3PWCA 1OWIA 1AZZA 1FLEE 2Z9LA 1LHGH 3VEQB 1HLTH 4JZ1A 4Q7XA 3SW2B 1ZZZA 1V2WT 3RP2A 4B1TA 1W0ZU 1O2KA 1GI5A 1BBRE 2LPRA 3QGJA 4UD9H 3K6YA 2Y80A 1ID5H 3A81A 3GYMA 1AWHB 1G3CA 4JZEH 1NFWA 1W2KH 1H1BA 5EPNA 1YPMH 1BJVA 3VB7A 3ZZAA 2C8XB 1J17T 4O3TA 3EE0B 3SU4A 1BRUP 3BIUH 4Y8XA 4AN7A 3M3VA 4WF8A 2FMJA 3FANA 1GI1A 3CENA 1A3EH 1UK3A 1FZZA 5EPYA 3RXPA 1PFXC 1YYY1 3FVFB 3SJKA 4OS5A 2ZCKP 2J9NA 3MU4A 3RMLH 1GMDF 3GISB 1QBNA 1O5EH 3MO6A 2ZFPH 4NCYA 5E0JA 1BTWA 4WY3A 1GI9B 4X6OA 1C4U2 1NFUA 4TY7A 2O8MA 1T8NA 4AFSA 1MAXA 2ZU4A 3SI4H 1WOFA 2FZZA 1NRNH 1SL3A 3TJNA 4WH6A 1UVOA 2SGQE 2SGAA 1MAYA 1BRAA 1FIWA 1TIOA 2IN2A 2FIRH 1EP5A 3GCTF 4TY6A 2GKVE 3UQVA 5A8ZA 2F9OA 1C1MA 2P95A 1QB9A 3DT0H 5JB8S 5GCHG 1Y3YA 1O2QA 3STIA 1A1RA 2ZNKH 2ZQ1A 1WV7H 1O3KA 1OP0A 1DY8A 2ZDMA 1NC6A 1C1VH 2BOKA 3ENSB 4JZIA 2EI7A 2OCVB 1LDTT 1DFPA 2F9NA 1VCQA 4X8UH 3UNSA 2H9EH 4YESB 1DSUA 4MNYA 1FQ3A 3WY8A 4X2WA 1AUJA 1Z8IB 1MKWH 2NU4E 1MTNC 2G51A 1LVOA 3MO3A 3R3GB 1GDUA 5AVDA 2BY6X 4U01A 4K1EA 4K3JA 4UEHH 2H1UA 2ASUB 2Y5HA 1XUGA 1GBTA 4GUXA 1L4ZA 1G3EA 3FZZA 1RGQA 1HDTH 2SGDE 2H9TH 3NXPA 3ATWA 1W8BH 3FP8E 1VGCC 2VWLA 4DY7B 5F6MA 1YGCH 3UY9A 3GDSA 1L1NA 3AW0A 2R3UA 2ILNA 1K22H 1FY1A 3GDUA 3KCGH 3Q76A 3NUMA 5EXMA 2Y6TA 3PMAB 1S85A 1SGNE 1GJBB 1CSOE 1V2MT 1TPOA 8GCHF 2ZU5A 3BTQE 2ZFSA 1NU7B 1Q31A 5GXPA 2J4IA 2Y5FA 3HATH 1THPB 1ANEA 4RSPA 5F03A 1FI8A 1MTNB 2NWNA 2SGEE 2HOBA 4OGXA 4NZLA 3U8TH 1AB9C 1E36B 2PUXB 7GCHG 1ZPBA 2OP9A 1DM4B 4IN1A 2A0QB 5JPMH 1KDQA 1QHRB 4NZQA 1SGFG 4ABIA 2G00A 5E0HA 3TH4H 1KLJH 2H6MA 3ESTA 1MMJN 4GLYA 1VGCB 2FX4A 1D3QB 3RXIA 4D9RA 1BA8B 2ZG0H 3NWUA 1HJ8A 1V2NT 1C1SA 1LPGB 3ODDA 4MPWA 1IQIA 1INCA 3BTKE 1GBBA 2C8ZB 2FOMB 1LKBA 1EAWA 5E2PA 4YOJA 2BD7A 3RU4E 1BIOA 1VJ9U 5AFYH 3SU1A 5FBIA 2OLGA 3KQDA 1O2MA 3RXHA 2ANYA 1LHEH 1UO6A 4XE4A 1UTNA 4YTAA 2HGTH 1OWJA 4J1YA 1FPHH 2VIDA 4I8LA 1TYNA 1CGIE 4MNVA 1F5LA 5EXLA 2G81E 1AB9B 3BEFB 4Y0YE 3UQOA 2D26C 2NU2E 1P3CA 2NU1E 3MU1A 2OD3B 5C3NA 3PROA 2ZC9H 3TGIE 3MH7A 2TPIZ 4ZHMU 1C5UA 1GI7B 1O31A 4ZHLU 2ZP0H 3STJA 1HIAA 2OUAA 2XCFA 2PKAA 3PLPA 1TGCA 2GT8A 2TGDA 1TNKA 3UOUA 3SORA 3BTTE 4KGAA 1O3FA 3P95A 1FY5A 3CS7A 3SNDA 1GBLA 2VB0A 3SJ9A 1H8IH 4LZ4B 1H9HE 4AG2A 2VIOA 4GCHG 2EI6A 2F3CE 1EKBB 1O2TA 3A83A 3ZZ3A 1TNJA 5J4SA 3S9BA 3RXUA 1ZJDA 3T27A 2FOAA 1O2IA 2PW8H 1D9IA 2C90B 5A0AE 3F6UH 1O5DH 1Y8TA 1GJ6A 4AZ2B 2RA0A 4K2YA 1E38B 2STAE 3KL6A 3SGBE 1V2VT 2R2WU 2PSYA 4WJG2 1CHGA 2A5KA 3TJUA 5AF9H 1GL0E 1ZSJA 1P06A 5C1UA 1ZSLA 1C2JA 2XC5A 1VITH 3SUFA 1GMHG 2ZU2A 4IS5A 1O5FH 1Y3XA 1DT2A 1FXYA 2BD9A 3H5CB 4D9QA 2QV1A 1A3BH 1AD8H 2GP9B 1NRSH 1Z1IA 2V35A 3KEEA 3MMGA 4H4FA 1NTPA 5HXFA 1LVBA 1NESE 2I6SA 4CREA 3D65E 1ZLRA 3KHVA 1O36A 2GDEH 4I8GA 5EG4A 3MH5A 3TH2H 3UNQA 1QL8A 1BHXF 3RLWH 1Y3WA 5AFZH 3M7QA 1DWDH 1HIAB 3TVJB 5JBBS 1QRXA 5BRRE 3DHKH 3LH1A 1IQGA 5F8ZA 4E7NA 1O3LA 4KTSA 4FU7A 3ATMA 3QGNB 4K69A 1QBOA 1O3CA 4NA8A 7KMEH 3EDXB 3PMBB 3MFJA 1TBZH 3SOSA 5EW2H 1K1IA 3RXLA 1MZAA 2PV9B 2ZTZA 4I33A 4U2WA 3MI4A 2AGIX 3T62A 1C2DA 3PLBA 4K8BA 1A5IA 5HM9A 1QL9A 4NIVA 4INKA 2QC2A 2P16A 1EAIA 3A88A 5DP8A 1C1UH 1IQHA 3KQCA 1O2JA 4IW4E 3ZYDA 2WUBA 3TNSA 1DX5M 4ISNA 2ZHQH 1GDNA 1MBQA 3O8BA 3RC4A 1Y5BT 4A6LA 1PPZA 2P94A 1S81A 5J4QA 1O3HA 1EAXA 2J92A 5JB9S 1OKXA 3A82A 1UK4A 2P8OC 1ZRBA 2PSXA 1TMUH 3C1KA 4XBCA 4OS7A 2BD5A 3BTWE 1OS8A 2B0FA 2YOLA 1WTGH 4AFUA 1LMWB 4WH8A 4CBOA 2V3OH 1CT0E 1MCTA 1G9IE 3Q3XA 4I31A 5FXLA 4Q2KA 2IPHA 1EATA 2BVRH 1AN1E 3UWIA 1GI0A 3PMJA 2ZDLA 1GHWH 4FUFA 3S0NA 1O5AB 2OXSA 3SJOA 1O0DH 1QQ4A 1YC0A 3LGIA 1U6QA 3B23B 2OC0A 3T5FH 4WMDA 3ZVGA 1N6XA 1ANCA 2I6QA 2ZTXA 4F4OC 3E1XB 2V3HH 4DG4A 3ZZ6A 3RMNH 1F5KU 1O2VA 5C20A 2KAIA 2BYAX 2PR3A 1EB1H 3Q3KA 4Y0ZE 5TJXA 2HNTC 1CA8B 1W12U 3RXKA 1MUEB 4A1VA 2CGAA 5T6GA 1HAGE 1BQYA 1PPGE 1K9OE 3FP6E 5EQSA 1P2OA 1C5OH 3MO9A 1S5SA 2XBWA 4FUEA 1DICA 4GAWA 1EZSC 1GJ8B 1JBUH 3ATLA 2P8OB 4X1PU 1WTHD 2BLWA 2LNCA 2ZDAH 1V2RT 7LPRA 2FWWA 3RDZA 1Z7KA 1XXDA 4CBNA 5C67A 1SQAA 1TGBA 1AKSA 3UTUH 3A87A 1B0EA 1BZXE 2ZHFH 1XMNB 1CHOF 4HTCH 4KELA 3DA9B 1P01A 2OINA 2A32A 5FX6A 2WINI 1J15A 1V2TT 3LC3A 1TX7A 4IC5A 1O3BA 3PTNA 1NN6A 2XYAA 4HI3A 1BMNH 2V6NA 3MU5A 1TRMA 2BVXH 4XOJA 1UHBA 6LPRA 3BEIB 3OYPA 3SV2H 1XVMA 4Q7YA 1V2OT 1S6HA 3OSYA 2VGCC 1A0JA 1ETTH 1P03A 2PGQB 1LPKB 1G36A 1DPOA 1VITG 1CBWC 2ZFTA 1QBVH 1H8DH 2TGAA 1WU1A 2GZ9A 2NU0E 3M36A 1S0RA 1ELAA 1ZMJA 2SGFE 1YPHE 3JZ2B 1HXFH 1GHBF 1N6YA 4I8JA 1TOCB 1A0HB 1MTVA 1HYLA 1THRH 2A4OA 2C8WB 1V2UT 4ABDA 5DK1A 2YNAA 1IQLA 4H6TA 1LHCH 1MKXK 1C9TA 3DFLA 1TNLA 1C2MA 2JH0D 2Q6DA 1DOJA 3A8CA 1ZPCA 1C2IA 1K1MA 1AFEH 4M7GA 1J16A 2QXGA 1EJNA 2J2UA 1BRCE 3P8GA 3V7TA 2Z9KA 1FAXA 3TJVA 3Q3YA 2Y7ZA 1NFXA 1ESAA 2JH5D 1T31A 1C5QA 1GJ5H 1P9SA 2Z94A 1AQ7A 4JZDH 1O2RA 1AVGH 1PYTD 1ZTLA 3LGUA 5A09A 2FTLE 3PB1E 5EXNA 2J34A 1XXFA 1Z6EA 1GBCA 1SVPA 5FPYA 2ZGCA 1A0LA 1RD3B 3SNCA 1O38A 5LPEA 2W3IA 1KTTB 1VCWA 4ZUHA 2VGCB 1GBJA 3SV7A 3MNBA 4O9VA 1SOZA 1GI6A 1CBWB 2ZA5A 4X2XA 1GMCG 1J9CH 3BIVH 3VXEH 1TALA 2M5TA 2Z3DA 1C5WB 2R0LA 1JXPA 1WQSA 1G32B 4ABGA 1ELEE 1HNEE 2WPKS 1D6WA 4AGKA 1VR1H 3TK9A 1TABE 2ZHWH 1LVMA 1S0QA 1K21H 5K7RA 1O3MA 1HRTH 1SLUB 4CHAC 2XC4A 3M3SA 5FCRA 2Z3CA 3FZDA 5HMAA 4K1SA 3I77A 4HZHA 1BUIA 1SGFA 1B5GH 3GY2A 3PWBA 2Q6GA 3S7KB 4ZKRU 4X6MA 3RU4D 1O2OA 2FI5E 1O2GH 4U32A 2CF9H 4FU8A 1HAIH 5HM2A 1DSTA 4X1SU 2ODPA 1YP9A 1XM1A 3U8RH 4E06H 2BXTH 1Y3UA 2B7DH 2ZFRH 3RXVA 2UUFB 3H7TA 1SOTA 1HUTH 1BBRK 1MQ6A 1XX9A 3SU6A 1OXGA 2K1QA 3PTBA 2WYGA 5FCKA 2TGPZ 1AI8H 3E0NB 3M3TA 2RDLA 1GBDA 4O3UA 5L2YH 1EX3A 5JBAS 3T28A 3BF6H 1LVYA 1BDAA 1UTKA 2G8TA 3T29A 2ODQA 1IAUA 3QZRA 3HKIB 1C1RA 3L6PA 1SGDE 1ANDA 1F0TA 1TBRH 9ESTA 4CHAB 1C5SA 1G2LA 2QIQA 6GCHF 4GHTA 2XXLA 1DXPA 3W94A 1C2EA 2BY9X 1BCUH 4BTUB 2EC9H 2QCYA 1WQVH 1UVSH 1Y3VA 5EOKA 2QF0A 1M9UA 3BEUA 1UJ1A 3GY3A 2RCEA 4I32A 2UWOA 1XVOA 1SSXA 4ISIH 1TPSA 3M5NA 2Y82A 1MZDA 3OTJE 1V2PT 2FPZA 1FONA 1EOLA 3ATKA 1AFQC 1BMLA 1BTZA 4JYTA 3RXDA 2Z9GA 1ZHMA 2FEQH 4FUJA 5K0HA 5L30H 1ZGVA 3F9GA 2UUYA 1ZHRA 2ODYB 1TX8A 1OWKA 1QURH 4AB9A 1ZTJA 2D1JA 4NWKA 3LH3A 1P3EA 3BTHE 4H6SB 3P17H 2BOHB 3RXEA 4I8HA 2H2ZA 4AYVB 2FX6A 1XUKA 2A2QH 1WUNH 2GCHG 4BOHA 2ZI2H 1XKAC 4CRAA 1RTKA 1GMCF 1UTJA 1SG8B 5C1XA 1L2EA 2FODA 4CRCA 3P8FA 1ELTA 1KIGH 2JH6D 1QA0A 3RMMH 4MPVA 3F9FA 1LPZB 3MU8A 2OQ5A 1BTHH 1PQ5A 3ZVAA 3BTEE 2XBXA 2HVXA 1P9UA 4GPGA 2ZZUH 1HXEH 1SFIA 2A7HA 3AVZA 3NZIA 1P0SH 1OOKB 4BXWA 1ARCA 4CRDA 3SU5A 1QA7A 1AFQB 1D4PB 1C5LH 3GY4A 3Q00A 2IJOB 4ABEA 4Y7AA 1C2HA 1IHSH 3SI3H 1BOQA 1P2KA 3SBKA 3TH3H 3VB4A 1S6FA 3M5MA 5DP7A 2ZDVH 1TB6H 5A8YA 1GHXH 1QIXB 1QY6A 1JIRA 4CRFA 4DIIH 2B9LA 3GOVB 1D3DB 1P05A 1CGHA 1PPCE 1GWAA 2FM2A 3LGYA 1C4V2 2PTNA 3ZZBA 1E34B 4SGBE 1IHTH 3KIDU 1QFKH 1V2ST 2VIVA 5CE1A 1F92A 4NSVA 3URDA 3GCHC 4BXSA 1EUFA 1AGJA 5LPRA 1BITA 4D8NA 1EJMA 2XBYA 2XWBI 1O3JA 4GSOA 1W0YH 4R0IA 5DPAA 5LPFA 1O2NA 4X8SH 2FP7B 3AAVA 2YNBA 4ZH8A 2BDHA 4OS1A 2PTCE 1GVKB 1O3OA 2BX3A 2GT7A 1UTQA 2C93B 1QR3E 3BSQA 3P6ZB 4ZHAA 5I25A 2ZDKA 4INLA 4Y76A 1TNIA 2ZQ2A 3LJOA 5GCHF 3RXOA 1O2UA 2WPMS 1FV9A 1GBKA 2UWLA 3ZZDA 3RXJA 1OX1A 1UCYH 1TMTH 1DVAH 2BZAA 1UCYK 4NA9H 2ZO3H 1FJSA 5ESTE 1AY6H 1FMGA 1PYTC 3MTYA 3SU0A 4AORA 1TGTA 1O3NA 1OPHB 1AO5A 5T6FA 2BDIA 2EI8A 1O2HA 1TGNA 1G30B 4UFEH 2FYRA 3AW1A 2GCTC 3E3TA 4KTUA 1THSH 4IC6A 1O30A 4ZKNU 3M7TA 1EZQA 1KXCA 1NM6A 1P2NA 2ZGBH 1NRRH 1WBGB 2C8YB 3GY5A 3GCHB 1B7XB 1C5VA 3A7XA 4DCDA 2SNWA 1ETRH 1G37A 2FOCA 2W26A 2WPIS 1KDQB 3M7UA 1Y5AT 2BQ7B 3A8DA 2O8TA 3E90B 1YPGH 2IOTA 3K6ZA 1SLXB 1HBTH 1HGTH 1W11U 2B8OH 2AGEX 2XCNA 4AYYB 1ELDE 2W5EA 1ZMLA 4BAMB 4PROA 5HGGA 4CR9A 4ISHH 4X2VA 1YPJH 1K1PA 2Y7XA 1SPJA 2OBQA 1HAVA 5GPIB 3BTME 5A2MH 1C5PA 1DWCH 3K65B 3HK6B 4JK5A 2W7UA 1C5MD 1HJ9A 1GJDB 1EPTA 1IQFA 4MG3A 4Y71A 3F1SB 3EA8A 1GHVH 3KNXA 1SI5H 1GI8B 3ITIA 3ZVFA 1C2FA 4Q7ZA 2HALA 5A0BA 1DUAA 1RFNA 6ESTA 5JDUB 1AU8A 4B2AA 1OSSA 1WYKA 4D7GA 1J8AA 1SLVB 1AMHA 5FHTA 4B2BA 2GCTB 1EPTC 4X6NA 7GCHF 2XW9A 1ARBA 1GJ7B 1MTWA 3SJ8A 4Q80A 1SGEE 4X8VH 4TWWA 1PPBH 2GZ8A 2FO9A 4Z6AH 3AASA 2ZU1A 3E6PH 3T2NA 4E05H 1XKBC 3MU0A 3GICB 1X7AC 2G5NA 1Y59T 5I46H 4I7YH 2PKAB 4GVUA 4XDEA 1ELVA 1XUIA 4WXIA 3TU7H 4JK6A 1QJ7B 2J94A 4IN2A 1TMBH 1SGTA 3SU2A 3V0XA 1G2MA 1H4WA 2BLVA 1QB6A 1WAYB 2AH4X 3LGTA 1T8OA 2FS8A 5FPTA 2H5DA 1F0SA 5G4BA 1SHYA 2GTBA 2ZIQH 3A7WA 1C1QA 4ABJA 2A45B 1PQAA 3W95A 2J95A 5C1YA 1IQEA 5FX5A 3RXMA 1HAVB 2HWLB 3EA7A 3RXGA 1EPTB 2FESH 1C1OA 1XUFA 3BTDE 3OU0A 4A1TA 1BTYA 1TX6A 5F8XA 3O8DA 1L4DA 2ZWLH 1DWBH 2VNTA 1LO6A 1HAZB 2HNTE 3OY5U 2ALVA 2D2DA 1RTFB 3RXQA 1CA0C 3ZZ8A 2ANMH 4FUIA 1T8LA 1GVLA 2ZFFH 4ISOA 3M5LA 2Z3EA 3RM2H 3L3TA 1MQ5A 2O9QA 4Y6DA 5B6OA 1FDPA 3EAJA 2DE9A 4AOQA 3JZ1B 2FYQA 2WUCA 3U98H 1K1OA 2OC8A 2P93A 4XSKU 5LGOA 1RTLA 4GCHF 4AB8A 4OS6A 1O5CB 2BB4A 4OS4A 1ABJH 1MH0A 4B2CA 4FUHA 4NG9H 1GVZA 3A7YA 4OS2A 3RU4T 2FOFA 1TE0A 1K28D 3QK1A 1ZMNA 2ZF0H 3RXCA 3KF2A 3BN9A 5GIBA 1GHAG 1T8MA 4LZ1H 2BDCA 1D3TB 1QJ6B 3NK8A 4NFFA 4ABAA 3UNRA 2G5VA 1JRTA 2R3YA 3QX5H 1O3IA 2AERH 1GJCB 4DURA 3E91A 1Z8GA 3A7TA 1O3GA 1C1WH 4ABBA 2UUKB 1YKTA 4ASHA 1KXFA 1O5BB 4IMQA 3QN7A 3E16B 4LK4A 2WPLS 1GMHF 2CHAC 2VINA 2AYWA 1JMOH 1JOUB 1CA0B 1UTMA 4Y11E 1ANBA 5IDKA 2TRMA 4CR5A 4JMYA 3O8CA 1JRSA 4FVDA 4B74A 1T4VH 1V2KT 2CMYA 1RXPA 4MPXA 2ZKSA 1GBFA 2VH6A 1O35A 4X0WU 1EP6A 1C2GA 3SUDA 4SGAE 1L0ZA 3E0PB 1C5YB 2XWAA 4GHQA 5SGAE 2GD4B 1HFDA 1KXAA 5DGJA 3F68H 4I8KA 3M37A 4YLUA 1TLDA 2HLCA 4XBDA 1Y5UT 3DD2H 1TA6A 2C4FH 2FS9A 3PO1B 2BD2A 1OWEA 1P02A 1UTLM 5JYIA 1K1JA 1PPFE 2XBVA 3BTFE 4JZFH 1LTOA 1KYNA 1QL7A 2WPHS 5DG6A 1ELCA 1C5ZB 1ETSH 2R2MB 3BG4C 2AMQA 3KGPA 3BG8A 2QXJA 2F9BH 1GMDG 4O97A 1SQOA 4BAOB 1FUJA 1O32A 2A4QA 1BTXA 1SGRE 2W3KA 1C2KA 1N1LA 1ZR0A 2BD4A 3LGVA 1KSNA 2F9VA 2O8LA 3BTGE 2CHAB 1P12E 1HV7A 4RN6A 1ELBA 2KAIB 1UVPA 4YT7H 1DUEA 1EZUC 3PYHA 1CO7E 1T32A 4CH2B 5JBTA 1NU9A 1FPCH 1O3DA 4X1QU 1A61H 5GWZA 1MKXH 2ZHEH 1F2SE 3EQ0H 4YM9A 4TPIZ 4MLFB 2ZHDA 2QN5T 3SHAH 2VJ1A 1Z1JA 1O2XA 2ANKH 1YLDA 3QO6A 3QUMP 2C3SA 4WMFA 3GCTG 2Z9IA 3EA9A 1O37A 2RA3A 1XUJA 2WPJS 2GGVB 4U30A 1BJUA 3S9CA 1EASA 2ZGHA 5DP5A 3H7OA 2BQ6B 1VZQH 2VVUA 3O8RA 1AKSB 1E37B 1MU6B 2XRCA 1W7GH 1ZGIA 3RC5A 2ESTE 3RXSA 3QDZB 1B0FA 2QXHA 3BG4B 1IQNA 1FIZA 3KQEA 4A92A 1FNIA 2F91A 1W10U 1XUHA 4BANB 1UHBB 4WXVA 3V13A 1O2SA 4K5ZA 3D62A 2AEIH 4YLQH 4MTBA 2HRVA 3MH4A 4FVBA 2NU3E 4X1RU 5JBCS 1P2JA 1DE7H 4YZUA 1A5GH 1S82A 4JCNA 1UTPA 2OC1A 2PLXA 1YCPK 4NWLA 2FOHA 1MD7A 1YPHC 1K1NA 1FY4A 4XFQA 3HPTB 4BAQB 4HGCA 4FUCA 3LIWA 1CT4E 3LC5A 2BDGA 2BDYA 1NY22 1Z8JB 1L1GA 2ZU3A 1JWTA 2FOEA 5ESBA 2TIOA 2UWPA 4Y8YA 3SQEE 1NO9H 1HPGA 1GG6C 1YPEH 3MNSA 4THNH 1O2ZA 1QNJA 4UDWH 9LPRA 2Z7FE 1O39A 3LT3A 3RC6A 1GJ9B 1NRQH 2PWXA 2Z6BD 3GY6A 8GCHG 3P70B 3DUXH 2A7CA 1P2IA 3N7OA 3UREA 1MD8A 1BBRH 3D23A 2P3TB 1ZRKA 1NZQH 1UK2A 4QT8C 1CU1A 1O33A 3K9XB 2ZCLP 3LPRA 3SO3A 3SQHE 4B75A 3B9FH 1GL1A 3GY7A 1A2CH 3U1JB 4UFFH 1QB1A 2PUQH 4FUGA 1GI3A 1PPHE 2XC0A 3LKWA 3AAUA 2UUJB 1VITF 1QCPA 1Q3XA 3FFGA 1TGSZ 1SR5C 1O2PA 1C5RA 3VB5A 1MTSA 3A8AA 3V12A 2F9UA 3QLPH 4B73A 2WV5A 1GBHA 3DFJA 1BMMH 1GBEA 5C5NA 1W7XH 1GDQA 2Q1JA 4DT7B 2OTVA 1ELGA 4UFDH 5F8TA 5T3HA 1P09A 1SFQB 2BXUH 3MH6A 4DW2U 1GG6B 2BLQA 3MWIU 1DWEH 2GMTC 1IQMA 1H9LB 2G55A 5ABWA 2STBE 2HPPH 5DP3A 3LJJA 2VIQA 4IBLH 2V0BA 1MTUA 1PQ8A 1YPLH 4Y79A 2W7SA 2ZTYA 5CHAC 3V3MA 3VB3A 1UVTH 1DITH 3OY6U 2ZCHP 2AFQB 1A46H 2Q6FA 2ZFQH 4AX9H 5T6DA 1BHXB 1SGQE 2ZECA 4X6PA 3TLOA 1C5TA 4YT6H 3SUEA 2FLBH 5E0GA 4X2YA 2PFEA 3QZQA 4K1TA 1YBWA 4KTCA 4NIYA 1MKWK 3ZZ4A 2BD3A 1EB2A 1G3BA 3SJIA 4MNXA 1FN8A 5EU8A 2QXIA 1QJ1B 1OWHA 3LOXA 3TK5A 1C1NA 1DLKB 5E2OA 6CHAC 2VIWA 2A31A 2P3FH 5C5OA 4ABFA 8KME2 3QTOH 1YM0A 1ESBA 1P10A 2HPQH 3SNEA 3NKKA 4AFQA 3ZVEA 1DLEA 4NGAH 4NSYA 3SGQE 4ZKSU 1T4UH 1YF4A 1BTPA 1YPKH 3A7VA 2GMTB 2A4GA 2HNTF 1FY8E 4ZXXH 1BT7A 3ZZ7A 4BNRA 2BY5X 2OC7A 3I78A 3ZZCA 5CHAB 2R9PA 3IWMA 3PLKA 1IQKA 4MVNA 2P59A 2GV6A 2QAAA 4RKJB 4KKDA 2B5TB 3KN2A 2CF8H 1VCPA 2SFAA 4NIWA 1W14U 4INHA 4IGDA 3ZV8A 2BQWB 1P04A 2BHGA 3PV4A 1Z6JH 4CH8B 1TNGA 1UVUH 4A5TS 1QQUA 1GHYH 2BD8A 2AS9A 1NS3A 2DE8A 1RIWC 1C5XB 6CHAB 1AZ8A 1UCYE 1OYTH 3SZNA 2OBOA 1GI4A 2O8WA 5EGMA 1O3AA 5E8EH 2D8WA 1PQ7A 2H5CA 1L1JA 1IOEA 3TITA 4JYVH 1Q2WA 2GX4A
chains in the Genus database with same CATH superfamily
3ZZ9A 1DS2E 1CT2E 5GJ4B 1D6RA 4RKOB 3U1IB 2OQUA 1WSSH 4UONA 2AIQA 1AE8H 2ZPQA 4IMZA 4B76A 2J38A 3CS0A 1DANH 1A4WH 4MQAA 3GDVA 3RXAA 3F9HA 4BTTB 3ZZ5A 4BAHB 4DGJA 3ZYEA 1ZPZA 3GY8A 1SHHB 4D7FA 3MNCA 1S83A 5FBEA 2F83A 1OP8A 4FOUC 1TPAE 1GBAA 1OWDA 3RXBA 4CRGA 4ZMAH 3LU9B 2SNVA 4H42U 3OTPA 1PPEE 1H8ED 1O2YA 3EGKH 3NCLA 1H9IE 3PM3A 3VPKA 1DY9A 1ZOMA 5IK2D 2O8UA 2FOBA 1C1TA 4NIXA 3QTVH 1P2QA 1F5RA 4JYUH 1S84A 5DJ7A 1ELFA 1KXDA 1TBQH 3RMOH 3RUOA 1F0RA 2QYIA 3B8JA 2P3UB 3RXTA 3SNBA 3ZVBA 2G4UA 2GCHF 4A7IB 1RIWB 1KXBA 3LDXH 3A7ZA 3NPSA 4YOIA 4DOQA 4A1XA 1F0UA 3SV8A 2EQNA 3C27B 3CP7A 1F7ZA 3OEHD 5ETXA 3VB6A 3G01A 4NA7A 2G52A 3T25A 1D3PB 1O3EA 2V7QD 1HJAC 3RLYH 1E0FD 2THFB 8ESTE 1P11E 4NFEA 3UIRA 3GCNA 1EZXC 2PKSC 1TWXB 3F9EA 2A7JA 4X8TH 4VGCC 1P57B 3HK3B 1EQ9A 2JKHA 4UFGH 2AGGX 4XBBA 1JIMA 3HKJB 1ZHPA 3A85A 4ZAEA 3TNTA 1TRYA 3RXFA 1O2LA 1O34A 5FPSA 1OYQA 3Q77A 2RFKC 1ZSKA 1QRZA 4R8TB 2BLOA 2ULLA 1GCDA 2FXRA 2GDDA 1SLWB 5AHGH 4AG1A 1HCGA 3FO8D 1RRKA 1T7CA 2ZPRA 2BM2A 5LH8A 1LHFH 1GBMA 1MBMA 1AE5A 1SGPE 4B71A 1W13U 4YO9A 5EODA 3SV9A 2R0KA 3LGWA 2BVSH 1O2WA 3P92A 2JJ1D 1LKAA 4ABHA 1YLCA 2CXVA 3K2UA 2XTTB 1PJPA 3KQBA 3IITA 3U9AH 5A8XA 3VGCC 5TCCA 2XNIA 3EYDA 3M35A 2A5AA 2AMPA 2ZDNA 2Z9JA 2QA9E 4F49A 2VWOA 2K8IA 1HJAB 3SHCH 3R0FA 1BRBE 2PKSB 1MU8B 2AIPA 2PGBB 2VH0A 4VGCB 2H9HA 2BX4A 2BTCE 4DT4A 1CHOG 5GDSH 2DUCA 5L2ZH 1QRWA 1CGJE 1SBWA 4Y7BA 2VIPA 2FI3E 3HGPA 1KLTA 1AHTH 1SB1H 3SN8A 3GYLB 4FU9A 3SU3A 4HFPB 1A7SA 3P8NA 5TCAA 1NFYA 2SGPE 1V2JT 3ATIA 3FKSD 3KYGA 3TK6A 1C5NH 5B6LA 3M61U 2EY4C 1LQDB 1SGYE 2FLRH 5GNDA 3IG6B 4AFZA 1V3XA 1LCYA 2A5IA 1GJ4H 2Y81A 4BTIB 3UWJH 2VVVA 2JETC 2F9PA 3A80A 1VJAU 1GHBG 3VGCB 2BY8X 3SGAE 1HB0B 1ABIH 3SUGA 4LOYH 5H4IB 3UAIC 5CMXH 1NPMA 3A89A 1AVXA 1LQEA 1C4Y2 1TFXA 3L33A 3MYWA 3OX7U 5KGOA 1AVWA 1WCZA 2GV7A 2QF3A 3UUZA 5EIYA 2BY7X 5EW1H 1ZTKA 2VWMA 1LHDH 3ZV9A 4F48B 3PO1C 1K1LA 4WVPE 1SGCA 1KTSB 4WWYA 3RXRA 2CN0H 4ZCNA 1C2LA 3UOPA 1GHZA 3A8BA 3WW7A 1SC8U 5BPEA 1TPPA 1DDJA 3UFAA 1GBIA 1Z8RA 4MDSA 1V6DA 1ZYOA 2CV3A 5EQQA 2QY0B 1HAHH 1BMAA 3OEED 1YCPM 4KP0A 1HAXB 5DP9A 3E8LA 1NRPH 3UPEA 1EAUA 3VXFH 4D76A 1P8VC 2WYJA 3TGJE 3QWCH 1ZJKA 1MCVA 2ZEBA 5DP4A 2PHBA 1GI2A 3ODFA 1IQJA 4YOGA 4ESTE 5C0TA 2ZPSA 2G4TA 1RS0A 1OP2A 2EEKA 2JETB 1UTOA 3T26A 3TJOA 5FAHA 2FI4E 4Y10E 2ZGXH 3MHWU 1HAPH 1BB0B 1AUTC 1SGIB 3URCA 3U8OH 3I29A 5A0CA 1TOMH 2WV4A 3SNAA 1TQ0B 1AIXH 3TIUA 2TBSA 3D49H 3TGKE 1CQQA 2A2XH 4DIHH 1EJAA 1SKYE 1DXWA 1BTUA 1TA2A 5DKMA 2FTMA 1FN6A 1V2LT 1NT1A 1EOJA 2BDAA 2QF4A 2VWNA 3DSGA 2QGRA 2WPDD 3FOAA 1KY9A 2BDBA 1GCTC 1E35B 2ANWA 5HYOA 3PMHB 3ZVCA 1A5HA 4ZKOU 3MOCA 1HAOH 2FOGA 3A84A 2CJIA 1GGDC 1KXEA 1J14A 2A1DB 3VFEA 4K8YA 1SMFE 1TRNA 3MNXA 4TPYA 5DP6A 1Z71A 3A86A 4ISLA 4K60A 4X1NU 4J2YB 1V2QT 4DJZB 3ELAH 3FP7E 1ACBE 4OGYA 4B6FA 1TONA 4TYDA 2F4LA 2A4RA 1N8OC 4XRNA 3M5OA 3ZVDA 1QTFA 4WMEA 3ZIAD 1HAYB 1C1PA 2EA3A 2ZGJA 5C2ZA 1GJAB 1CVWH 1P2MA 4Z0KA 3WWBA 5DO4H 2IJD1 3RM0H 8LPRA 1TNHA 3UR6A 4B6EA 1W3CA 3GCOA 4CRBA 6GCHG 1G3DA 2Y5GA 2VU8E 3HGNA 2AMDA 4MNWA 4MPUA 1KMHB 2VVCA 5L6NH 1NROH 1FY3A 2L6OA 4AGJA 7ESTE 4UE7H 3P8OA 1GHAF 1GCTB 4TWYA 2BMGB 1AWFH 3S9AA 2BZ6H 1EXFA 2GZ7A 2TGTA 1TQ7B 4BAKB 1O5GH 3FAOA 1GGDB 2FDAA 4Y8ZA 1ESTA 3LONA 1KLIH 2KM0A 3U69H 4DVAU 2RG3A 4FUDA 4LXBH 4FUBA 1GPZA 5PTPA 1C9PA 3UR9A 1O3PB 1UMAH 2ALPA 1RJXB 5EQRA 1CE5A 4FXGH 4E7RG 1FAKH 3BV9B 3TPIZ 4ZXYH 4ZROA 1YCPH 1N8OB 3S69A 1ORFA 3S7HB 1QGFA 4O03A 5IYTA 1TAWA 1SQTA 3SV6A 1K2I1 2GVFA 3PWCA 1OWIA 1AZZA 1FLEE 2Z9LA 1LHGH 3VEQB 1HLTH 4JZ1A 4Q7XA 3SW2B 1ZZZA 1V2WT 3RP2A 4B1TA 1W0ZU 1O2KA 1GI5A 1BBRE 2LPRA 3QGJA 4UD9H 3K6YA 2Y80A 1ID5H 3A81A 3GYMA 1AWHB 1G3CA 4JZEH 1NFWA 1W2KH 1H1BA 5EPNA 1YPMH 1BJVA 3VB7A 3ZZAA 2C8XB 1J17T 4O3TA 3F2GA 3EE0B 3SU4A 1BRUP 3BIUH 4Y8XA 4AN7A 3M3VA 4WF8A 2FMJA 3FANA 1GI1A 3CENA 1A3EH 1UK3A 1FZZA 5EPYA 3RXPA 1PFXC 1YYY1 3FVFB 3SJKA 2M2AA 4OS5A 2ZCKP 2J9NA 3MU4A 3RMLH 1GMDF 3GISB 1QBNA 1O5EH 5FL7D 3MO6A 2ZFPH 4NCYA 5E0JA 1YLNA 1BTWA 4WY3A 1GI9B 2KR7A 4X6OA 1C4U2 1NFUA 4TY7A 2O8MA 1T8NA 4AFSA 1MAXA 2ZU4A 3SI4H 1WOFA 2FZZA 1NRNH 1SL3A 3TJNA 2KCYA 4WH6A 1UVOA 2SGQE 2SGAA 1MAYA 1BRAA 1FIWA 1TIOA 2IN2A 2FIRH 1EP5A 3GCTF 4TY6A 2GKVE 3UQVA 5A8ZA 2F9OA 1C1MA 2P95A 1QB9A 3DT0H 5JB8S 5GCHG 2HLDD 1Y3YA 1O2QA 3STIA 1A1RA 2ZNKH 2ZQ1A 1WV7H 1O3KA 1OP0A 1DY8A 2ZDMA 1NC6A 1C1VH 2BOKA 3ENSB 3OFND 4JZIA 2EI7A 2OCVB 1LDTT 1DFPA 2F9NA 1VCQA 4X8UH 3UNSA 2H9EH 4YESB 1DSUA 3MQKC 4MNYA 1FQ3A 3WY8A 4X2WA 1AUJA 3N7EA 1Z8IB 3F3BA 1MKWH 2NU4E 4OM9A 1MTNC 2G51A 1LVOA 3MO3A 1FX0B 3R3GB 1GDUA 5AVDA 2BY6X 4U01A 4K1EA 4K3JA 4UEHH 2H1UA 2ASUB 2Y5HA 1XUGA 1GBTA 4GUXA 1L4ZA 1G3EA 3FZZA 1RGQA 2J97A 1HDTH 2SGDE 4RT1A 2H9TH 3NXPA 3ATWA 1W8BH 3FP8E 1VGCC 2VWLA 4DY7B 5F6MA 1YGCH 3UY9A 3GDSA 1L1NA 3AW0A 2R3UA 2ILNA 1K22H 1EFRD 2KFWA 1FY1A 3GDUA 3KCGH 3Q76A 3NUMA 5EXMA 2Y6TA 3PMAB 1S85A 1SGNE 1GJBB 1CSOE 1V2MT 1TPOA 8GCHF 2ZU5A 3BTQE 2ZFSA 1NU7B 1Q31A 5GXPA 2J4IA 2Y5FA 3HATH 1THPB 1ANEA 4RSPA 5F03A 1FI8A 1MTNB 2NWNA 2J98A 2SGEE 2HOBA 4OGXA 4NZLA 3U8TH 1VKYA 1AB9C 1E36B 2PUXB 7GCHG 1ZPBA 2OP9A 1DM4B 4IN1A 2A0QB 5JPMH 1KDQA 1QHRB 4NZQA 1SGFG 4ABIA 2G00A 5E0HA 5HIYA 5EJZA 3TH4H 1KLJH 2H6MA 3ESTA 1MMJN 4GLYA 1VGCB 2FX4A 1D3QB 3RXIA 4D9RA 1BA8B 2ZG0H 3NWUA 1HJ8A 1V2NT 1C1SA 1LPGB 3ODDA 4MPWA 1IQIA 1INCA 3BTKE 1GBBA 2C8ZB 2FOMB 1LKBA 1EAWA 5E2PA 4YOJA 2BD7A 1S6LA 2VBCA 3RU4E 1BIOA 1VJ9U 5AFYH 3SU1A 5FBIA 2OLGA 3KQDA 1O2MA 3RXHA 2ANYA 1LHEH 1UO6A 4XE4A 1UTNA 4YTAA 2HGTH 1OWJA 4J1YA 1FPHH 1QZ8A 2VIDA 4I8LA 1TYNA 1CGIE 4MNVA 1F5LA 5EXLA 2G81E 1AB9B 3BEFB 3PV2A 4Y0YE 3UQOA 3KYFA 2KCAA 2D26C 2NU2E 1P3CA 2NU1E 3MU1A 2OD3B 5C3NA 3PROA 2ZC9H 3TGIE 3MH7A 2CK3D 2TPIZ 4ZHMU 1C5UA 1GI7B 1O31A 4ZHLU 2J98B 2ZP0H 3STJA 1HIAA 2OUAA 2XCFA 1COWD 2PKAA 3PLPA 1TGCA 2GT8A 2TGDA 1TNKA 3UOUA 3SORA 3BTTE 3F2FA 1O3FA 4KGAA 3P95A 1FY5A 3CS7A 3SNDA 1GBLA 2VB0A 3SJ9A 1H8IH 4LZ4B 1H9HE 4AG2A 5C17A 2VIOA 4GCHG 2EI6A 2F3CE 1EKBB 1O2TA 3A83A 3ZZ3A 1TNJA 5J4SA 3S9BA 3RXUA 1ZJDA 3T27A 2FOAA 1O2IA 2PW8H 1D9IA 2C90B 5A0AE 5CHBA 3F6UH 1O5DH 1Y8TA 1GJ6A 4AZ2B 2RA0A 4K2YA 1E38B 2STAE 3KL6A 3SGBE 1V2VT 2R2WU 2PSYA 4WJG2 1CHGA 2A5KA 3TJUA 5AF9H 1GL0E 1ZSJA 1P06A 5C1UA 1ZSLA 2QE7D 1C2JA 2XC5A 1VITH 3SUFA 1GMHG 2ZU2A 4IS5A 1O5FH 1Y3XA 1DT2A 1FXYA 2BD9A 3H5CB 4D9QA 2QV1A 1A3BH 1AD8H 2GP9B 1NRSH 1Z1IA 2V35A 3KEEA 3MMGA 4H4FA 1NTPA 5HXFA 1LVBA 1NESE 2I6SA 4CREA 3D65E 1ZLRA 3KHVA 1O36A 2GDEH 4I8GA 5EG4A 3MH5A 3TH2H 3UNQA 1QL8A 1BHXF 3RLWH 1Y3WA 5AFZH 3M7QA 1DWDH 1HIAB 3TVJB 5JBBS 1QRXA 5BRRE 3DHKH 3LH1A 1IQGA 5F8ZA 4E7NA 1O3LA 4KTSA 4FU7A 3ATMA 3QGNB 4K69A 1QBOA 1O3CA 4NA8A 7KMEH 3EDXB 3PMBB 3MFJA 1TBZH 3SOSA 3F0OA 5EW2H 1K1IA 3RXLA 1MZAA 2PV9B 2ZTZA 4I33A 4U2WA 3MI4A 2AGIX 3T62A 1C2DA 3PLBA 4K8BA 1A5IA 5HM9A 1QL9A 4NIVA 4INKA 2QC2A 2P16A 1EAIA 3A88A 5DP8A 5F53A 1C1UH 1IQHA 3KQCA 1O2JA 4IW4E 3ZYDA 2WUBA 3TNSA 1DX5M 4ISNA 2ZHQH 1GDNA 1MBQA 3O8BA 3RC4A 1Y5BT 4A6LA 1PPZA 2P94A 1S81A 5J4QA 1O3HA 1EAXA 2J92A 5JB9S 1OKXA 3A82A 1UK4A 1ZRBA 2P8OC 2PSXA 1TMUH 3C1KA 4XBCA 4OS7A 2BD5A 3BTWE 1OS8A 2B0FA 2YOLA 1WTGH 4AFUA 3N7DA 1LMWB 4WH8A 4CBOA 2V3OH 1CT0E 1MCTA 1G9IE 3Q3XA 4I31A 5FXLA 4Q2KA 2IPHA 1EATA 2BVRH 1AN1E 3UWIA 1GI0A 3PMJA 2ZDLA 1GHWH 4FUFA 3S0NA 1O5AB 2OXSA 3SJOA 1O0DH 1QQ4A 4HG6A 1YC0A 4AC9A 3LGIA 1U6QA 3B23B 2OC0A 3T5FH 4WMDA 3ZVGA 1N6XA 1ANCA 2I6QA 2ZTXA 4F4OC 3E1XB 2V3HH 4DG4A 3ZZ6A 3RMNH 1F5KU 1O2VA 5C20A 2KAIA 2BYAX 2PR3A 1EB1H 3Q3KA 4Y0ZE 5TJXA 2HNTC 1CA8B 1W12U 3RXKA 1MUEB 2GJGA 4A1VA 2CGAA 5T6GA 1HAGE 1BQYA 1PPGE 1K9OE 3U28C 3FP6E 5EQSA 1P2OA 1C5OH 3MO9A 1S5SA 2XBWA 4FUEA 1DICA 4GAWA 1EZSC 1GJ8B 1JBUH 3ATLA 2P8OB 4X1PU 1WTHD 2BLWA 2LNCA 2ZDAH 1V2RT 7LPRA 2FWWA 3F2HA 3RDZA 1Z7KA 1XXDA 4CBNA 5C67A 1SQAA 1TGBA 1AKSA 3UTUH 3A87A 1B0EA 1BZXE 2ZHFH 1XMNB 1CHOF 4HTCH 4KELA 2JDID 3DA9B 1P01A 2OINA 2A32A 5FX6A 2WINI 1W0KD 1J15A 1V2TT 2PP6A 2WSSD 3LC3A 1TX7A 4IC5A 1O3BA 3PTNA 1NN6A 2XYAA 4HI3A 1BMNH 2V6NA 3MU5A 1TRMA 2BVXH 4XOJA 1UHBA 6LPRA 3BEIB 3OYPA 3SV2H 1XVMA 4Q7YA 1V2OT 1S6HA 5KECA 5DSFA 3OSYA 2VGCC 1A0JA 1ETTH 1P03A 2PGQB 1LPKB 1G36A 1DPOA 1VITG 1CBWC 2ZFTA 1QBVH 1H8DH 2TGAA 1WU1A 2GZ9A 2NU0E 3M36A 1S0RA 1ELAA 1ZMJA 2SGFE 3UB0A 1YPHE 3JZ2B 1HXFH 1GHBF 1N6YA 4I8JA 1TOCB 1A0HB 1MTVA 1HYLA 1THRH 2A4OA 2HVYB 2C8WB 5DN6D 1V2UT 4ABDA 5DK1A 2YNAA 1IQLA 4H6TA 1LHCH 1MKXK 1C9TA 3DFLA 4Q63A 1TNLA 3DSPA 1C2MA 2J5UA 2JH0D 2Q6DA 1DOJA 3EE7A 3A8CA 1ZPCA 1C2IA 2KCPA 3PRBA 1K1MA 1AFEH 4M7GA 1J16A 1OHHD 2QXGA 1EJNA 1WDIA 2J2UA 1BRCE 3P8GA 3V7TA 2Z9KA 3W1EA 4YXWD 1FAXA 3TJVA 3Q3YA 2Y7ZA 1NFXA 1ESAA 2JH5D 1T31A 1C5QA 1GJ5H 1P9SA 2Z94A 1AQ7A 4JZDH 1O2RA 1AVGH 1PYTD 1ZTLA 3LGUA 5A09A 2FTLE 3PB1E 5EXNA 2J34A 1XXFA 1Z6EA 1GBCA 1SVPA 5FPYA 2ZGCA 1A0LA 1RD3B 3SNCA 1O38A 5LPEA 2L74A 2W3IA 1KTTB 1VCWA 1K0HA 4ZUHA 2VGCB 1GBJA 2XOKD 3SV7A 3MNBA 4O9VA 1SOZA 1GI6A 1CBWB 2ZA5A 4X2XA 1GMCG 1J9CH 3BIVH 4Q4LA 3VXEH 1TALA 2M5TA 2Z3DA 1C5WB 2R0LA 1JXPA 1WQSA 1G32B 4ABGA 1ELEE 1HNEE 2WPKS 1D6WA 4AGKA 1VR1H 3TK9A 1TABE 2ZHWH 1LVMA 1S0QA 1K21H 5K7RA 1O3MA 1HRTH 1SLUB 4CHAC 2XC4A 3M3SA 5FCRA 2Z3CA 3FZDA 2LELA 5HMAA 4K1SA 3I77A 4HZHA 1BUIA 1SGFA 1B5GH 3GY2A 3PWBA 2Q6GA 3S7KB 4ZKRU 4X6MA 3RU4D 1O2OA 2FI5E 1O2GH 4U32A 2CF9H 4FU8A 1HAIH 5HM2A 1DSTA 4X1SU 2ODPA 1YP9A 1XM1A 3U8RH 4E06H 2BXTH 1Y3UA 2B7DH 2ZFRH 3RXVA 2UUFB 3H7TA 1SOTA 1HUTH 1BBRK 1MQ6A 1XX9A 3SU6A 4Z1MD 1OXGA 2K1QA 3PTBA 2WYGA 5FCKA 2TGPZ 1AI8H 1SQRA 3E0NB 3M3TA 2RDLA 1GBDA 4O3UA 5L2YH 4F55A 1EX3A 2YMSD 5JBAS 3T28A 3BF6H 1LVYA 1BDAA 3DSOA 1UTKA 2G8TA 3T29A 2ODQA 1IAUA 3QZRA 3HKIB 1C1RA 3L6PA 1SGDE 1ANDA 1F0TA 1TBRH 9ESTA 4CHAB 1C5SA 1G2LA 2QIQA 6GCHF 4GHTA 2XXLA 1DXPA 3W94A 1C2EA 2BY9X 1BCUH 4BTUB 2EC9H 2QCYA 3CNRA 1WQVH 1UW7A 1UVSH 1Y3VA 5EOKA 2QF0A 1M9UA 3BEUA 1UJ1A 3GY3A 2RCEA 4I32A 2UWOA 1XVOA 1SSXA 4ISIH 1TPSA 3M5NA 3SYJA 2Y82A 1MZDA 3OTJE 1V2PT 2FPZA 1FONA 1EOLA 3ATKA 1AFQC 1BMLA 1BTZA 4JYTA 3RXDA 2Z9GA 1ZHMA 2FEQH 4FUJA 5K0HA 5L30H 1ZGVA 3F9GA 2UUYA 1ZHRA 2ODYB 1TX8A 1OWKA 1QURH 4AB9A 1ZTJA 2D1JA 4NWKA 3LH3A 3FN8A 1P3EA 3BTHE 4H6SB 3P17H 2BOHB 3RXEA 4I8HA 2H2ZA 4AYVB 2FX6A 1XUKA 2A2QH 1WUNH 2GCHG 4BOHA 3N99A 2ZI2H 1XKAC 4CRAA 1RTKA 1GMCF 1YY3A 1UTJA 1SG8B 5C1XA 1L2EA 2FODA 4CRCA 3P8FA 1ELTA 1KIGH 2JH6D 4XD7D 1QA0A 3RMMH 4MPVA 3F9FA 5HKKD 1LPZB 3MU8A 2OQ5A 1BTHH 2JJ2D 3H09A 1PQ5A 3ZVAA 3BTEE 2XBXA 2HVXA 1P9UA 4GPGA 2ZZUH 1HXEH 1SFIA 2A7HA 3AVZA 3NZIA 1P0SH 2IPQX 1OOKB 4BXWA 1ARCA 4CRDA 3SU5A 1QA7A 1AFQB 1D4PB 1C5LH 3GY4A 3Q00A 2IJOB 4ABEA 4Y7AA 1C2HA 1IHSH 3SI3H 1BOQA 1P2KA 3SBKA 3TH3H 3VB4A 1S6FA 3M5MA 1E1QD 5DP7A 2ZDVH 1TB6H 5A8YA 1GHXH 1QIXB 1QY6A 1JIRA 4CRFA 4DIIH 2B9LA 3GOVB 1D3DB 1P05A 1CGHA 1PPCE 1GWAA 2FM2A 3LGYA 2QF5A 1C4V2 2PTNA 3ZZBA 1E34B 4SGBE 1IHTH 3KIDU 1QFKH 1MABB 1V2ST 2VIVA 5CE1A 1F92A 4NSVA 3URDA 3GCHC 4BXSA 1EUFA 1AGJA 5LPRA 1BITA 4D8NA 1EJMA 2XBYA 2XWBI 1O3JA 4GSOA 1W0YH 4R0IA 5DPAA 5LPFA 1O2NA 4X8SH 2FP7B 3AAVA 2WHXA 2YNBA 4ZH8A 2BDHA 4OS1A 5T1VA 1NBMD 2PTCE 1GVKB 1O3OA 2BX3A 4I86A 2GT7A 1UTQA 2C93B 1QR3E 3BSQA 3P6ZB 4ZHAA 5I25A 2ZDKA 3PRDA 4INLA 4Y76A 1TNIA 2ZQ2A 3LJOA 5GCHF 4TSFD 3RXOA 1O2UA 4M9FA 2WPMS 1FV9A 1GBKA 2UWLA 3ZZDA 3RXJA 1OX1A 1UCYH 1TMTH 1DVAH 2BZAA 1UCYK 4NA9H 2ZO3H 1FJSA 5ESTE 1AY6H 1FMGA 1PYTC 3MTYA 3SU0A 4AORA 1TGTA 1O3NA 1OPHB 1AO5A 5T6FA 2BDIA 2EI8A 1O2HA 1TGNA 1G30B 4UFEH 2FYRA 3AW1A 2GCTC 3E3TA 4KTUA 1THSH 4IC6A 3DCLA 1O30A 4ZKNU 3M7TA 1EZQA 2AHME 1KXCA 3GS9A 1NM6A 1P2NA 2ZGBH 1NRRH 1WBGB 2C8YB 3GY5A 3GCHB 1B7XB 1C5VA 3A7XA 4DCDA 2SNWA 1ETRH 1G37A 2FOCA 2W26A 2WPIS 1KDQB 3M7UA 1Y5AT 2BQ7B 3A8DA 2O8TA 3E90B 1YPGH 2IOTA 1BMFD 3K6ZA 2K0QA 1SLXB 1WXRA 1HBTH 1HGTH 1W11U 2B8OH 2AGEX 2XCNA 4AYYB 1ELDE 2W5EA 1ZMLA 4BAMB 4PROA 5HGGA 4CR9A 4ISHH 4X2VA 1W0JD 1YPJH 1K1PA 2Y7XA 1SPJA 2OBQA 1HAVA 5GPIB 3BTME 5A2MH 1C5PA 1DWCH 3K65B 3HK6B 4JK5A 2W7UA 1C5MD 1HJ9A 1GJDB 1EPTA 1IQFA 4MG3A 4Y71A 3F1SB 3EA8A 1GHVH 3KNXA 1SI5H 1GI8B 3ITIA 3ZVFA 1C2FA 4Q7ZA 2HALA 4TT3D 5A0BA 1DUAA 1RFNA 6ESTA 5JDUB 1AU8A 4B2AA 1OSSA 1WYKA 4D7GA 1J8AA 1SLVB 1AMHA 5FHTA 4B2BA 2GCTB 1EPTC 2JIZD 4X6NA 7GCHF 2XW9A 1ARBA 1GJ7B 1MTWA 3SJ8A 2YMSC 4Q80A 1SGEE 4X8VH 4TWWA 1PPBH 2GZ8A 2FO9A 4Z6AH 3AASA 2ZU1A 3E6PH 3T2NA 3WWFA 2WV9A 4E05H 1XKBC 3MU0A 3GICB 1X7AC 2G5NA 1Y59T 5I46H 4I7YH 2PKAB 4GVUA 4XDEA 1ELVA 1XUIA 4WXIA 3TU7H 4JK6A 1QJ7B 2J94A 4IN2A 1TMBH 1SGTA 3SU2A 3V0XA 1G2MA 1H4WA 2BLVA 1QB6A 1WAYB 2AH4X 3LGTA 1T8OA 3KQ5A 2FS8A 3OE7D 5FPTA 2H5DA 1F0SA 5G4BA 1SHYA 2GTBA 2ZIQH 3A7WA 1C1QA 4ABJA 2A45B 1PQAA 3W95A 2J95A 5C1YA 1IQEA 5FX5A 3RXMA 1HAVB 2HWLB 3EA7A 3RXGA 1EPTB 1H8HD 2FESH 1C1OA 1XUFA 3BTDE 3OU0A 4A1TA 1BTYA 1TX6A 5F8XA 3O8DA 1L4DA 2ZWLH 2V3MA 1DWBH 2VNTA 1LO6A 1HAZB 2HNTE 3OY5U 2ALVA 2D2DA 1RTFB 3RXQA 1CA0C 2YMSB 1E79D 3ZZ8A 1NBME 2ANMH 4FUIA 1T8LA 1GVLA 2ZFFH 4ISOA 3M5LA 2Z3EA 3RM2H 3L3TA 1MQ5A 2O9QA 4Y6DA 5B6OA 1FDPA 3EAJA 3NRLA 2DE9A 4AOQA 3JZ1B 2FYQA 2WUCA 3U98H 1K1OA 2OC8A 2P93A 4XSKU 5LGOA 1RTLA 4GCHF 4AB8A 4OS6A 5EJLA 1O5CB 2BB4A 4OS4A 1ABJH 1MH0A 4B2CA 2XNDD 4FUHA 4NG9H 1GVZA 3A7YA 4OS2A 3RU4T 2FOFA 1TE0A 1K28D 3QK1A 1ZMNA 2ZF0H 4ASUD 3RXCA 3KF2A 3BN9A 5GIBA 1GHAG 1T8MA 4LZ1H 2BDCA 1D3TB 1QJ6B 3NK8A 4NFFA 4ABAA 3UNRA 2G5VA 1JRTA 2R3YA 3QX5H 1O3IA 2AERH 1GJCB 4DURA 3E91A 1Z8GA 3A7TA 1O3GA 1C1WH 4ABBA 2UUKB 1YKTA 4ASHA 1KXFA 1O5BB 4IMQA 3VG8A 3QN7A 3E16B 4LK4A 2WPLS 1GMHF 2CHAC 2VINA 2AYWA 1JMOH 1JOUB 1CA0B 1UTMA 4Y11E 1ANBA 5IDKA 2TRMA 4CR5A 4JMYA 3O8CA 1JRSA 4FVDA 4B74A 1T4VH 1V2KT 2CMYA 1RXPA 4MPXA 2ZKSA 1GBFA 4P02A 2VH6A 1O35A 4X0WU 3OAAD 1EP6A 1C2GA 3SUDA 4SGAE 1L0ZA 3E0PB 1C5YB 2XWAA 4GHQA 5SGAE 2GD4B 1HFDA 1KXAA 5DGJA 3F68H 4I8KA 3M37A 4YLUA 1TLDA 2HLCA 4XBDA 1Y5UT 3DD2H 1TA6A 2C4FH 2FS9A 3PO1B 2BD2A 1OWEA 1P02A 1UTLM 5JYIA 1K1JA 1PPFE 2XBVA 3BTFE 4JZFH 1LTOA 1KYNA 1QL7A 2WPHS 5DG6A 1ELCA 1C5ZB 1ETSH 2R2MB 3BG4C 2AMQA 3KGPA 3BG8A 2QXJA 2F9BH 1GMDG 4O97A 1SQOA 4BAOB 1FUJA 1O32A 2A4QA 1BTXA 1SGRE 2W3KA 1C2KA 1N1LA 1ZR0A 2BD4A 3LGVA 1KSNA 2F9VA 2O8LA 3BTGE 2CHAB 1P12E 2OK5A 1HV7A 4RN6A 1ELBA 2KAIB 1UVPA 4YT7H 1DUEA 5C0UA 1EZUC 3PYHA 5HIZA 1CO7E 1T32A 4CH2B 5JBTA 1NU9A 1FPCH 1O3DA 4X1QU 1A61H 5GWZA 1MKXH 2ZHEH 1F2SE 3EQ0H 4YM9A 4TPIZ 2KX4A 4MLFB 2ZHDA 2QN5T 3SHAH 2VJ1A 1Z1JA 1O2XA 2ANKH 1YLDA 3QO6A 3QUMP 2C3SA 4WMFA 3GCTG 2Z9IA 3EA9A 1O37A 4ACBA 2RA3A 1XUJA 2WPJS 2GGVB 4U30A 1BJUA 3S9CA 1EASA 2ZGHA 5DP5A 3H7OA 2BQ6B 3PV5A 1VZQH 2VVUA 3O8RA 1YWUA 1AKSB 1E37B 1MU6B 2XRCA 1W7GH 5KEDA 1ZGIA 3RC5A 2ESTE 3RXSA 3QDZB 2WZQA 1B0FA 4RT0A 2KCOA 2QXHA 3BG4B 1IQNA 1FIZA 3KQEA 4A92A 1FNIA 2F91A 1W10U 1XUHA 4BANB 1UHBB 4WXVA 3V13A 1O2SA 4K5ZA 3D62A 2AEIH 4YLQH 4MTBA 2HRVA 3MH4A 4FVBA 2NU3E 4X1RU 5JBCS 1P2JA 1DE7H 4YZUA 1A5GH 1S82A 4JCNA 1UTPA 2OC1A 2PLXA 1YCPK 4NWLA 2W6JD 2FOHA 2LP6A 1MD7A 1YPHC 1K1NA 1FY4A 4XFQA 3HPTB 4BAQB 4HGCA 4FUCA 3LIWA 1CT4E 3LC5A 2BDGA 2BDYA 1NY22 1Z8JB 1L1GA 2ZU3A 1JWTA 2FOEA 5ESBA 2TIOA 2UWPA 4Y8YA 3SQEE 1NO9H 1HPGA 1GG6C 1YPEH 3MNSA 4THNH 1O2ZA 1QNJA 4UDWH 9LPRA 2Z7FE 1O39A 3LT3A 3RC6A 1GJ9B 1NRQH 2PWXA 2Z6BD 3GY6A 8GCHG 3P70B 3DUXH 2A7CA 1P2IA 3N7OA 3UREA 1MD8A 1BBRH 3D23A 2P3TB 1ZRKA 1NZQH 1UK2A 4QT8C 1CU1A 1O33A 3K9XB 2ZCLP 3LPRA 3SO3A 3SQHE 4B75A 3B9FH 1GL1A 3GY7A 1A2CH 3U1JB 4UFFH 1QB1A 2PUQH 4FUGA 1GI3A 1PPHE 2XC0A 3LKWA 3AAUA 2UUJB 1VITF 1QCPA 5EJ1A 1Q3XA 3FFGA 1TGSZ 1SR5C 1O2PA 1C5RA 3VB5A 4ACAA 1MTSA 3A8AA 3V12A 2F9UA 3F0PA 3QLPH 4B73A 3AK5A 1E1RD 1GBHA 2WV5A 3DFJA 1BMMH 1GBEA 4P00A 5C5NA 4RI0A 1W7XH 1GDQA 2Q1JA 4DT7B 2OTVA 1ELGA 4UFDH 5F8TA 5T3HA 1P09A 1SFQB 2BXUH 3MH6A 4DW2U 1GG6B 2BLQA 3MWIU 1DWEH 2GMTC 1IQMA 1H9LB 2G55A 5ABWA 2STBE 2HPPH 5DP3A 3LJJA 3SZEA 2VIQA 4IBLH 2V0BA 1MTUA 1PQ8A 1YPLH 4Y79A 2W7SA 2ZTYA 5CHAC 3V3MA 3VB3A 1UVTH 1DITH 3OY6U 2ZCHP 2AFQB 1A46H 2Q6FA 2F43B 2ZFQH 4FETA 4AX9H 5T6DA 1BHXB 1SGQE 2ZECA 4X6PA 3TLOA 1C5TA 4YT6H 3SUEA 2FLBH 5E0GA 4X2YA 2PFEA 3QZQA 4K1TA 1YBWA 4KTCA 4NIYA 1MKWK 3ZZ4A 5CDFE 2BD3A 1EB2A 1G3BA 3SJIA 4MNXA 1FN8A 5EU8A 2QXIA 1QJ1B 1OWHA 3LOXA 3TK5A 1C1NA 1DLKB 5E2OA 6CHAC 2VIWA 2A31A 2P3FH 5C5OA 4ABFA 8KME2 3QTOH 1YM0A 1ESBA 1P10A 2HPQH 3SNEA 3NKKA 4AFQA 3ZVEA 5C94A 1DLEA 4NGAH 4NSYA 3SGQE 4ZKSU 1T4UH 1YF4A 1BTPA 1YPKH 3A7VA 2GMTB 2A4GA 2HNTF 1FY8E 2RDEA 4ZXXH 1BT7A 3ZZ7A 4BNRA 2BY5X 2OC7A 3I78A 3ZZCA 5CHAB 2R9PA 3IWMA 3PLKA 1IQKA 4MVNA 2P59A 2GV6A 2QAAA 4RKJB 4KKDA 2B5TB 3KN2A 2CF8H 1VCPA 2SFAA 4NIWA 1W14U 4INHA 4IGDA 3ZV8A 2BQWB 1P04A 2BHGA 3PV4A 1Z6JH 4CH8B 1TNGA 1UVUH 4A5TS 1QQUA 1GHYH 2BD8A 2AS9A 1NS3A 2DE8A 1RIWC 1C5XB 6CHAB 1AZ8A 2W6ID 1UCYE 2KZ4A 1OYTH 3SZNA 2OBOA 1GI4A 2O8WA 5EGMA 1O3AA 5E8EH 2D8WA 1PQ7A 2H5CA 1L1JA 1IOEA 3TITA 4JYVH 1Q2WA 2GX4A
chains in the Genus database with same CATH topology
3ZZ9A 1DS2E 1CT2E 5GJ4B 1D6RA 4RKOB 3U1IB 2OQUA 1WSSH 4UONA 2AIQA 1AE8H 2ZPQA 4IMZA 4B76A 2J38A 3CS0A 1DANH 1A4WH 4MQAA 3GDVA 3RXAA 3F9HA 4BTTB 3ZZ5A 4BAHB 4DGJA 3ZYEA 1ZPZA 3GY8A 1SHHB 4D7FA 3MNCA 1S83A 5FBEA 2F83A 1OP8A 3RXBA 1TPAE 1GBAA 1OWDA 4CRGA 4ZMAH 3LU9B 2SNVA 4H42U 1PPEE 1O2YA 3EGKH 3NCLA 1H9IE 3PM3A 3VPKA 1DY9A 1ZOMA 2O8UA 2FOBA 1C1TA 4NIXA 3QTVH 1P2QA 1F5RA 4JYUH 1S84A 5DJ7A 1ELFA 1KXDA 1TBQH 3RMOH 3RUOA 1F0RA 2QYIA 3B8JA 2P3UB 3RXTA 3SNBA 3ZVBA 2G4UA 2GCHF 4A7IB 1RIWB 1KXBA 3LDXH 3A7ZA 3NPSA 4YOIA 4DOQA 4A1XA 1F0UA 3SV8A 3C27B 5ETXA 3CP7A 1F7ZA 3VB6A 3G01A 4NA7A 2G52A 3T25A 1D3PB 1O3EA 1HJAC 3RLYH 1E0FD 2THFB 8ESTE 1P11E 4NFEA 3UIRA 3GCNA 1EZXC 2PKSC 1TWXB 3F9EA 2A7JA 4X8TH 4VGCC 1P57B 3HK3B 1EQ9A 2JKHA 4UFGH 2AGGX 4XBBA 1JIMA 3HKJB 1ZHPA 3A85A 4ZAEA 3TNTA 1TRYA 3RXFA 1O2LA 1O34A 5FPSA 1OYQA 3Q77A 1ZSKA 1QRZA 4R8TB 2BLOA 2ULLA 1GCDA 2FXRA 2GDDA 1SLWB 5AHGH 4AG1A 1HCGA 1RRKA 1T7CA 2ZPRA 2BM2A 5LH8A 1LHFH 1GBMA 1MBMA 1AE5A 1SGPE 4B71A 1W13U 4YO9A 5EODA 3SV9A 2R0KA 3LGWA 2BVSH 1O2WA 3P92A 1LKAA 4ABHA 1YLCA 2CXVA 3K2UA 2XTTB 1PJPA 3KQBA 3IITA 3U9AH 5A8XA 3VGCC 5TCCA 2XNIA 3EYDA 3M35A 2A5AA 2AMPA 2ZDNA 2Z9JA 2QA9E 4F49A 2VWOA 1HJAB 3SHCH 3R0FA 1BRBE 2PKSB 1MU8B 2AIPA 2PGBB 2VH0A 4VGCB 2H9HA 2BX4A 2BTCE 1CHOG 5GDSH 2DUCA 5L2ZH 1QRWA 1CGJE 1SBWA 4Y7BA 2VIPA 2FI3E 3HGPA 1KLTA 1AHTH 1SB1H 3SN8A 3GYLB 4FU9A 3SU3A 4HFPB 1A7SA 3P8NA 5TCAA 1NFYA 2SGPE 1V2JT 3ATIA 3TK6A 1C5NH 3M61U 1LQDB 1SGYE 2FLRH 3IG6B 4AFZA 1V3XA 1LCYA 2A5IA 1GJ4H 2Y81A 4BTIB 3UWJH 2VVVA 2JETC 2F9PA 3A80A 1VJAU 1GHBG 3VGCB 2BY8X 3SGAE 1HB0B 1ABIH 3SUGA 4LOYH 5H4IB 5CMXH 1NPMA 3A89A 1AVXA 1LQEA 1C4Y2 1TFXA 3L33A 3MYWA 3OX7U 1AVWA 1WCZA 2GV7A 2QF3A 3UUZA 5EW1H 2BY7X 1ZTKA 2VWMA 1LHDH 3ZV9A 3PO1C 1K1LA 4WVPE 1SGCA 1KTSB 4WWYA 3RXRA 2CN0H 1C2LA 3UOPA 1GHZA 3A8BA 1SC8U 5BPEA 1TPPA 1DDJA 3UFAA 1GBIA 1Z8RA 4MDSA 1V6DA 1ZYOA 2CV3A 5EQQA 2QY0B 1HAHH 1BMAA 1YCPM 4KP0A 1HAXB 5DP9A 3E8LA 1NRPH 3UPEA 1EAUA 3VXFH 4D76A 1P8VC 2WYJA 3TGJE 3QWCH 1ZJKA 1MCVA 2ZEBA 5DP4A 2PHBA 1GI2A 3ODFA 1IQJA 4YOGA 4ESTE 2ZPSA 2G4TA 1RS0A 1OP2A 2EEKA 2JETB 1UTOA 3T26A 3TJOA 5FAHA 2FI4E 4Y10E 2ZGXH 3MHWU 1HAPH 1BB0B 1AUTC 1SGIB 3URCA 3U8OH 3I29A 5A0CA 1TOMH 2WV4A 3SNAA 1TQ0B 1AIXH 3TIUA 2TBSA 3D49H 3TGKE 1CQQA 2A2XH 4DIHH 1EJAA 1DXWA 1BTUA 1TA2A 5DKMA 2FTMA 1FN6A 1V2LT 1NT1A 1EOJA 2BDAA 2VWNA 2QGRA 1KY9A 2BDBA 1GCTC 1E35B 2ANWA 5HYOA 3PMHB 3ZVCA 1A5HA 4ZKOU 3MOCA 1HAOH 2FOGA 3A84A 2CJIA 1GGDC 1KXEA 1J14A 2A1DB 3VFEA 4K8YA 1SMFE 1TRNA 3MNXA 4TPYA 5DP6A 1Z71A 3A86A 4ISLA 4K60A 4X1NU 4J2YB 1V2QT 4DJZB 3ELAH 3FP7E 1ACBE 4OGYA 1TONA 4TYDA 2A4RA 1N8OC 3M5OA 3ZVDA 1QTFA 4WMEA 1HAYB 1C1PA 2EA3A 2ZGJA 5C2ZA 1GJAB 1CVWH 1P2MA 4Z0KA 5DO4H 3RM0H 8LPRA 1TNHA 3UR6A 1W3CA 3GCOA 4CRBA 6GCHG 1G3DA 2Y5GA 2VU8E 3HGNA 2AMDA 4MNWA 4MPUA 2VVCA 5L6NH 1NROH 1FY3A 4AGJA 7ESTE 4UE7H 3P8OA 1GHAF 1GCTB 4TWYA 2BMGB 1AWFH 3S9AA 2BZ6H 1EXFA 2GZ7A 2TGTA 1TQ7B 4BAKB 1O5GH 3FAOA 1GGDB 2FDAA 4Y8ZA 1ESTA 3LONA 1KLIH 3U69H 4DVAU 2RG3A 4FUDA 4LXBH 4FUBA 1GPZA 5PTPA 1C9PA 3UR9A 1O3PB 1UMAH 2ALPA 1RJXB 5EQRA 1CE5A 4FXGH 4E7RG 1FAKH 3BV9B 3TPIZ 4ZXYH 4ZROA 1YCPH 1N8OB 3S69A 1ORFA 3S7HB 1QGFA 4O03A 5IYTA 1TAWA 1SQTA 3SV6A 1K2I1 2GVFA 3PWCA 1OWIA 1AZZA 1FLEE 2Z9LA 1LHGH 3VEQB 1HLTH 4JZ1A 4Q7XA 3SW2B 1ZZZA 1V2WT 3RP2A 4B1TA 1W0ZU 1O2KA 1GI5A 1BBRE 2LPRA 3QGJA 4UD9H 3K6YA 2Y80A 1ID5H 3A81A 3GYMA 1AWHB 1G3CA 4JZEH 1NFWA 1W2KH 1H1BA 5EPNA 1YPMH 1BJVA 3VB7A 3ZZAA 2C8XB 1J17T 4O3TA 3EE0B 3SU4A 1BRUP 3BIUH 4Y8XA 4AN7A 3M3VA 4WF8A 2FMJA 3FANA 1GI1A 3CENA 1A3EH 1UK3A 1FZZA 5EPYA 3RXPA 1PFXC 1YYY1 3FVFB 3SJKA 4OS5A 2ZCKP 2J9NA 3MU4A 3RMLH 1GMDF 3GISB 1QBNA 1O5EH 3MO6A 2ZFPH 4NCYA 5E0JA 1BTWA 4WY3A 1GI9B 4X6OA 1C4U2 1NFUA 4TY7A 2O8MA 1T8NA 4AFSA 1MAXA 2ZU4A 3SI4H 1WOFA 2FZZA 1NRNH 1SL3A 3TJNA 4WH6A 1UVOA 2SGQE 2SGAA 1MAYA 1BRAA 1FIWA 1TIOA 2IN2A 2FIRH 1EP5A 3GCTF 4TY6A 2GKVE 3UQVA 5A8ZA 2F9OA 1C1MA 2P95A 1QB9A 3DT0H 5JB8S 5GCHG 1Y3YA 1O2QA 3STIA 1A1RA 2ZNKH 2ZQ1A 1WV7H 1O3KA 1OP0A 1DY8A 2ZDMA 1NC6A 1C1VH 2BOKA 3ENSB 4JZIA 2EI7A 2OCVB 1LDTT 1DFPA 2F9NA 1VCQA 4X8UH 3UNSA 2H9EH 4YESB 1DSUA 4MNYA 1FQ3A 3WY8A 4X2WA 1AUJA 1Z8IB 1MKWH 2NU4E 1MTNC 2G51A 1LVOA 3MO3A 3R3GB 1GDUA 5AVDA 2BY6X 4U01A 4K1EA 4K3JA 4UEHH 2H1UA 2ASUB 2Y5HA 1XUGA 1GBTA 4GUXA 1L4ZA 1G3EA 3FZZA 1RGQA 1HDTH 2SGDE 2H9TH 3NXPA 3ATWA 1W8BH 3FP8E 1VGCC 2VWLA 4DY7B 5F6MA 1YGCH 3UY9A 3GDSA 1L1NA 3AW0A 2R3UA 2ILNA 1K22H 1FY1A 3GDUA 3KCGH 3Q76A 3NUMA 5EXMA 2Y6TA 3PMAB 1S85A 1SGNE 1GJBB 1CSOE 1V2MT 1TPOA 8GCHF 2ZU5A 3BTQE 2ZFSA 1NU7B 1Q31A 5GXPA 2J4IA 2Y5FA 3HATH 1THPB 1ANEA 4RSPA 5F03A 1FI8A 1MTNB 2NWNA 2SGEE 2HOBA 4OGXA 4NZLA 3U8TH 1AB9C 1E36B 2PUXB 7GCHG 1ZPBA 2OP9A 1DM4B 4IN1A 2A0QB 5JPMH 1KDQA 1QHRB 4NZQA 1SGFG 4ABIA 2G00A 5E0HA 3TH4H 1KLJH 2H6MA 3ESTA 1MMJN 4GLYA 1VGCB 2FX4A 1D3QB 3RXIA 4D9RA 1BA8B 2ZG0H 3NWUA 1HJ8A 1V2NT 1C1SA 1LPGB 3ODDA 4MPWA 1IQIA 1INCA 3BTKE 1GBBA 2C8ZB 2FOMB 1LKBA 1EAWA 5E2PA 4YOJA 2BD7A 3RU4E 1BIOA 1VJ9U 5AFYH 3SU1A 5FBIA 2OLGA 3KQDA 1O2MA 3RXHA 2ANYA 1LHEH 1UO6A 4XE4A 1UTNA 4YTAA 2HGTH 1OWJA 4J1YA 1FPHH 2VIDA 4I8LA 1TYNA 1CGIE 4MNVA 1F5LA 5EXLA 2G81E 1AB9B 3BEFB 4Y0YE 3UQOA 2D26C 2NU2E 1P3CA 2NU1E 3MU1A 2OD3B 5C3NA 3PROA 2ZC9H 3TGIE 3MH7A 2TPIZ 4ZHMU 1C5UA 1GI7B 1O31A 4ZHLU 2ZP0H 3STJA 1HIAA 2OUAA 2XCFA 2PKAA 3PLPA 1TGCA 2GT8A 2TGDA 1TNKA 3UOUA 3SORA 3BTTE 4KGAA 1O3FA 3P95A 1FY5A 3CS7A 3SNDA 1GBLA 2VB0A 3SJ9A 1H8IH 4LZ4B 1H9HE 4AG2A 2VIOA 4GCHG 2EI6A 2F3CE 1EKBB 1O2TA 3A83A 3ZZ3A 1TNJA 5J4SA 3S9BA 3RXUA 1ZJDA 3T27A 2FOAA 1O2IA 2PW8H 1D9IA 2C90B 5A0AE 3F6UH 1O5DH 1Y8TA 1GJ6A 4AZ2B 2RA0A 4K2YA 1E38B 2STAE 3KL6A 3SGBE 1V2VT 2R2WU 2PSYA 4WJG2 1CHGA 2A5KA 3TJUA 5AF9H 1GL0E 1ZSJA 1P06A 5C1UA 1ZSLA 1C2JA 2XC5A 1VITH 3SUFA 1GMHG 2ZU2A 4IS5A 1O5FH 1Y3XA 1DT2A 1FXYA 2BD9A 3H5CB 4D9QA 2QV1A 1A3BH 1AD8H 2GP9B 1NRSH 1Z1IA 2V35A 3KEEA 3MMGA 4H4FA 1NTPA 5HXFA 1LVBA 1NESE 2I6SA 4CREA 3D65E 1ZLRA 3KHVA 1O36A 2GDEH 4I8GA 5EG4A 3MH5A 3TH2H 3UNQA 1QL8A 1BHXF 3RLWH 1Y3WA 5AFZH 3M7QA 1DWDH 1HIAB 3TVJB 5JBBS 1QRXA 5BRRE 3DHKH 3LH1A 1IQGA 5F8ZA 4E7NA 1O3LA 4KTSA 4FU7A 3ATMA 3QGNB 4K69A 1QBOA 1O3CA 4NA8A 7KMEH 3EDXB 3PMBB 3MFJA 1TBZH 3SOSA 5EW2H 1K1IA 3RXLA 1MZAA 2PV9B 2ZTZA 4I33A 4U2WA 3MI4A 2AGIX 3T62A 1C2DA 3PLBA 4K8BA 1A5IA 5HM9A 1QL9A 4NIVA 4INKA 2QC2A 2P16A 1EAIA 3A88A 5DP8A 1C1UH 1IQHA 3KQCA 1O2JA 4IW4E 3ZYDA 2WUBA 3TNSA 1DX5M 4ISNA 2ZHQH 1GDNA 1MBQA 3O8BA 3RC4A 1Y5BT 4A6LA 1PPZA 2P94A 1S81A 5J4QA 1O3HA 1EAXA 2J92A 5JB9S 1OKXA 3A82A 1UK4A 2P8OC 1ZRBA 2PSXA 1TMUH 3C1KA 4XBCA 4OS7A 2BD5A 3BTWE 1OS8A 2B0FA 2YOLA 1WTGH 4AFUA 1LMWB 4WH8A 4CBOA 2V3OH 1CT0E 1MCTA 1G9IE 3Q3XA 4I31A 5FXLA 4Q2KA 2IPHA 1EATA 2BVRH 1AN1E 3UWIA 1GI0A 3PMJA 2ZDLA 1GHWH 4FUFA 3S0NA 1O5AB 2OXSA 3SJOA 1O0DH 1QQ4A 1YC0A 3LGIA 1U6QA 3B23B 2OC0A 3T5FH 4WMDA 3ZVGA 1N6XA 1ANCA 2I6QA 2ZTXA 4F4OC 3E1XB 2V3HH 4DG4A 3ZZ6A 3RMNH 1F5KU 1O2VA 5C20A 2KAIA 2BYAX 2PR3A 1EB1H 3Q3KA 4Y0ZE 5TJXA 2HNTC 1CA8B 1W12U 3RXKA 1MUEB 4A1VA 2CGAA 5T6GA 1HAGE 1BQYA 1PPGE 1K9OE 3FP6E 5EQSA 1P2OA 1C5OH 3MO9A 1S5SA 2XBWA 4FUEA 1DICA 4GAWA 1EZSC 1GJ8B 1JBUH 3ATLA 2P8OB 4X1PU 1WTHD 2BLWA 2LNCA 2ZDAH 1V2RT 7LPRA 2FWWA 3RDZA 1Z7KA 1XXDA 4CBNA 5C67A 1SQAA 1TGBA 1AKSA 3UTUH 3A87A 1B0EA 1BZXE 2ZHFH 1XMNB 1CHOF 4HTCH 4KELA 3DA9B 1P01A 2OINA 2A32A 5FX6A 2WINI 1J15A 1V2TT 3LC3A 1TX7A 4IC5A 1O3BA 3PTNA 1NN6A 2XYAA 4HI3A 1BMNH 2V6NA 3MU5A 1TRMA 2BVXH 4XOJA 1UHBA 6LPRA 3BEIB 3OYPA 3SV2H 1XVMA 4Q7YA 1V2OT 1S6HA 3OSYA 2VGCC 1A0JA 1ETTH 1P03A 2PGQB 1LPKB 1G36A 1DPOA 1VITG 1CBWC 2ZFTA 1QBVH 1H8DH 2TGAA 1WU1A 2GZ9A 2NU0E 3M36A 1S0RA 1ELAA 1ZMJA 2SGFE 1YPHE 3JZ2B 1HXFH 1GHBF 1N6YA 4I8JA 1TOCB 1A0HB 1MTVA 1HYLA 1THRH 2A4OA 2C8WB 1V2UT 4ABDA 5DK1A 2YNAA 1IQLA 4H6TA 1LHCH 1MKXK 1C9TA 3DFLA 1TNLA 1C2MA 2JH0D 2Q6DA 1DOJA 3A8CA 1ZPCA 1C2IA 1K1MA 1AFEH 4M7GA 1J16A 2QXGA 1EJNA 2J2UA 1BRCE