4HGCA

Crystal structure of bovine trypsin complexed with sfti-1 analog containing a peptoid residue at position p1
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Cationic trypsin
publication title Structure of a proteolytically resistant analogue of (NLys)(5)SFTI-1 in complex with trypsin: evidence for the direct participation of the Ser214 carbonyl group in serine protease-mediated proteolysis.
pubmed doi rcsb
total genus 60
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2012-10-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4hgcA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4hgcA02
2AIQA 2XWAA 3UOPA 3SO3A 2O8MA 2OC8A 1MU6B 2VH0A 3EGKH 2GTBA 1EP6A 1K1NA 1SLXB 4IBLH 3T5FH 3SGBE 1SSXA 2CHAB 1GHXH 1P2MA 2OD3B 3TJOA 3O8RA 3TNSA 1QURH 5A09A 4IC6A 1UCYK 3S9AA 4X8UH 4XOJA 4D8NA 1ELFA 3LONA 2YNBA 3Q3XA 1T4VH 5IYTA 1EZXC 3PM3A 4Z0KA 2J95A 3SJ9A 1QQUA 1O3BA 5HM9A 5JBTA 3QUMP 4UFEH 2BVSH 3LC5A 1BTHH 4F49A 4CR9A 1C2GA 4OS1A 1ETTH 1DWDH 3IG6B 2G5NA 4Y76A 5A0BA 1V2WT 1ARBA 1DDJA 3M5OA 5ETXA 3UQVA 1GMCF 1J9CH 4DT7B 1H9HE 3EA7A 4CR5A 4MG3A 3FZZA 1VJAU 1NRRH 1RTFB 3SI4H 4I8JA 1C5UA 3FVFB 1GJ8B 1O36A 1C1SA 3LGWA 1NROH 2W7SA 1E35B 1ZRBA 3RXSA 1BTWA 1NRSH 4FU8A 3P8NA 3TGJE 1CU1A 1A3BH 1P06A 3VPKA 3ELAH 3KL6A 8LPRA 2A7HA 2XXLA 3KQDA 4TPYA 1CHOF 3RXTA 5DP9A 2K1QA 1ACBE 3STIA 4YZUA 1AKSB 1C1RA 4DW2U 3U9AH 1CO7E 1GBDA 1W14U 3K9XB 2ANYA 1V2PT 2FIRH 1KTSB 3QZQA 2V3OH 1DWEH 2BD4A 2XCFA 3BTDE 1GMDF 4NZLA 2QGRA 2FOHA 2GD4B 4K2YA 2ZA5A 3WY8A 1MCVA 3GCOA 2ZI2H 2VIOA 1BBRE 2H9EH 3ZV9A 3AVZA 2QXGA 3LGIA 4FVDA 5DPAA 1FY5A 5JDUB 5AF9H 1P09A 4MNWA 3H5CB 4WXVA 1FMGA 1YPLH 2C90B 4JZIA 1PQ5A 3V12A 1CGHA 2ZU2A 2BDHA 3QX5H 1GI1A 2HNTC 1GHWH 1KY9A 1YLDA 3D49H 2VINA 1AHTH 1C5PA 2XBVA 2P94A 2DE8A 5EXMA 1WCZA 4ISHH 1PYTD 1GL1A 2PKSB 1AD8H 5F6MA 3HGPA 2BX4A 4RN6A 1IQMA 4Y7BA 2ZPRA 3GCTF 1NRQH 1SOTA 2JH6D 1N8OB 2OQUA 5F8XA 1BCUH 1TQ7B 4Y11E 1G3CA 2ANMH 1DANH 3F9GA 2FXRA 1T8MA 2HOBA 3GY4A 5C20A 2G4TA 1QBVH 2PHBA 3PB1E 1C2LA 2J38A 1OKXA 1DWCH 2WV4A 4AG1A 1FZZA 4LK4A 2CGAA 1Z1JA 1Z8IB 2ZU1A 2ZFPH 5BRRE 3PV4A 6LPRA 1FN6A 5PTPA 3SUFA 1S6HA 1QCPA 4X1RU 3NWUA 1GJDB 3BF6H 3VXFH 1V6DA 1PPFE 2J4IA 1DSTA 3AAVA 1GVKB 4I7YH 3VB5A 1Y3UA 1IHTH 1BITA 3GDSA 1V2JT 1QRXA 3KEEA 4INLA 1GI8B 4YLUA 5JPMH 1VITF 2QA9E 1G36A 1D6RA 3SU0A 2FX4A 4AB8A 1TYNA 3GOVB 2VB0A 1O3PB 1GBIA 4UONA 3BG4B 1E34B 1O2JA 2Y5GA 1MUEB 2GZ8A 3KIDU 2BD7A 1UTLM 2PUQH 4U2WA 1Y5UT 2VIVA 1JIMA 1C1WH 1ESTA 1LTOA 7KMEH 1MZDA 3FANA 3U8OH 5C67A 3SV7A 2WYJA 1KXEA 1SPJA 1GI9B 2SNVA 4K1SA 4I33A 1O2ZA 1SOZA 3UIRA 3QDZB 1O3EA 2GMTC 1L2EA 1YM0A 4TY7A 1L0ZA 3LIWA 1KDQA 3BTTE 1C1MA 1OXGA 1ZHMA 5GPIB 1O30A 4A1XA 1BT7A 5EU8A 1SLVB 2GCHG 1GG6C 3TVJB 4CRDA 2RA3A 1TB6H 2GCTB 3GY8A 1MTVA 1HJAC 1QJ7B 2A4QA 3LGVA 1S81A 1TBQH 1UTQA 5FPSA 1HJ9A 1DLEA 1MAXA 1HAOH 4RSPA 2DE9A 7GCHF 1SC8U 1V2ST 4X2YA 1SL3A 1TGNA 1SMFE 4IS5A 3K6YA 4ISLA 3RXKA 4I31A 1K1IA 3QN7A 4UD9H 1VITH 5L2YH 1C5NH 3OX7U 5EGMA 3LGYA 2OXSA 1BA8B 1BJUA 5AFYH 5AFZH 3E1XB 1TNJA 1AVWA 1SLWB 5H4IB 1D9IA 1AO5A 1C5RA 4NIYA 1B7XB 2VIQA 4CRBA 2NU2E 1ZOMA 1S84A 1ZLRA 3F9HA 3K6ZA 1TONA 1INCA 1FY3A 4K8BA 3F1SB 2GZ7A 4FU7A 5I46H 1TQ0B 4MQAA 2SGPE 1UTKA 5GCHG 3RMOH 3FFGA 3VFEA 2XC5A 1O35A 5GIBA 2UUYA 4YLQH 4KELA 1SGEE 3HKJB 1FDPA 1S6FA 3EA9A 1UHBA 4CBOA 1BB0B 1LDTT 1K22H 4MPWA 4MNVA 1TOMH 1BMMH 1DM4B 1GWAA 2ZDMA 1J15A 2CF9H 3CP7A 3ZZ9A 3L3TA 3EE0B 4O03A 2BDBA 2Y7XA 1O2YA 1C1OA 4AORA 1MKWH 4E05H 3E91A 1FPCH 1D3QB 2ZPQA 1GJ6A 4X2XA 1VGCC 2IOTA 1JRSA 3MNBA 1GBFA 5EXLA 1MTNB 2PKAA 2ZDNA 3F6UH 3C27B 1UVUH 3CS0A 1SGYE 1UVOA 2J2UA 3ZYEA 1P03A 1NRPH 1WUNH 2J9NA 3E3TA 3RXMA 4I8HA 3SNEA 2GX4A 2ALPA 1P02A 1TGBA 2XCNA 3S69A 4K8YA 1TGSZ 2ZFTA 5C2ZA 2BLQA 1K21H 1GBCA 3VGCB 4SGBE 2UUFB 1C1PA 4Y0YE 2ZZUH 3UNSA 2P3TB 3TU7H 2C4FH 2BVRH 2HGTH 1CBWC 1D3DB 1O2QA 3PWBA 4NA7A 1T32A 1FI8A 3T25A 1TRMA 2ZG0H 1E0FD 2P8OB 3BTME 8ESTE 4HGCA 1EUFA 1NM6A 1GJ9B 4CBNA 1S82A 3TK6A 5LPRA 4ZROA 5ABWA 1C5TA 1KLTA 4Y7AA 3SBKA 3P8OA 2BY9X 4MVNA 1G32B 4FUFA 1DUAA 1O3MA 3SQHE 5JBCS 1SQAA 1LVBA 2PTCE 4HTCH 1C1NA 1V2VT 1FIZA 1O2IA 1TMBH 1V2OT 2XBYA 1GL0E 1QL9A 1NU7B 1GGDB 2AMDA 1UJ1A 1ELGA 3MFJA 2Y80A 3DFLA 4XDEA 1PPCE 4X8TH 5A2MH 5C1UA 1KDQB 2ZDVH 4KGAA 1DUEA 1NS3A 3MTYA 1YCPH 1HNEE 1EZQA 3ATKA 2OUAA 1TAWA 2HWLB 1ELVA 2A7JA 1O5FH 2O8WA 2UUJB 1YBWA 4TYDA 3LDXH 1W3CA 3ODFA 2AGGX 2CXVA 1SI5H 3SJIA 3TJVA 1D3PB 1FIWA 4ZUHA 4ZHAA 5CHAC 5FX5A 3Q76A 4R8TB 1O34A 1ABIH 1TWXB 2WYGA 5A8YA 5E2OA 3B9FH 2VVCA 3UY9A 2A0QB 3M3SA 2BY6X 4AG2A 1GDNA 2ZFSA 2ZHFH 2FM2A 4BAHB 1EZUC 2AFQB 2R2WU 1Q31A 3H7OA 1C1QA 3SV8A 3TJUA 4WH8A 3RU4E 1MTWA 3GCHB 4WMDA 3P95A 3RXGA 2JETC 1AFQC 4NSYA 3KCGH 4B2CA 2BZ6H 3M7QA 5EXNA 4BAKB 4NIWA 4I32A 2OBQA 5AVDA 3TLOA 4UEHH 1TX8A 2G5VA 6CHAB 2TGDA 1YPKH 3MO3A 1E38B 2BDYA 1GBMA 3PTNA 4X8SH 1W2KH 5E0HA 1O2LA 3MOCA 1ETRH 3MYWA 1K28D 3UR6A 4O3TA 1D6WA 1PPGE 3JZ1B 2STBE 4D7GA 1A5IA 1W10U 2ZTZA 2A2XH 2BD9A 3E8LA 1P57B 3MI4A 4MDSA 1N1LA 1OP2A 4F4OC 1C5WB 5EW1H 1MH0A 5JBBS 2Y6TA 3LH1A 2VVVA 2WPHS 2CMYA 4HFPB 1S83A 4XSKU 4ABHA 1UTOA 2HPPH 3DUXH 5DP7A 2FI3E 1F5KU 1NFWA 2NU3E 1O3JA 2BYAX 3RDZA 3SHAH 3BTEE 1FONA 1A5GH 1ELAA 1AQ7A 2ODYB 1AE8H 1MQ5A 4E06H 1GHZA 1AGJA 2OLGA 1O37A 4X1QU 3NZIA 1ZSKA 1EJMA 3S0NA 2D1JA 2Z94A 2KAIA 4D76A 1O2TA 3UWIA 3MH6A 1IAUA 1ZJKA 5FPTA 2FMJA 1UVPA 2OCVB 4AZ2B 1CGIE 2XW9A 1O32A 2A2QH 1ZRKA 1ZHPA 5F03A 4ABJA 1ZPCA 4DGJA 5A8XA 4Y8YA 1AN1E 1DFPA 1HDTH 1TRNA 1WOFA 1CT0E 3NXPA 1LMWB 1F0SA 1UCYE 1V2NT 4ZXYH 1GI3A 4X8VH 3DA9B 4OGYA 1TGTA 4K60A 1CA0C 2FYRA 2B8OH 1XVOA 1NESE 3LGTA 1V2QT 2LPRA 1C2JA 2C8WB 3M37A 4RKOB 1BQYA 4A6LA 2G51A 2D2DA 1GBHA 1TRYA 4ZHMU 1LHEH 3TPIZ 1A4WH 1ABJH 2GDEH 2R3YA 2G52A 2ZTXA 1OPHB 3ODDA 4GHQA 1WV7H 4CHAB 5GJ4B 1G2MA 2F9UA 3TK9A 2ZFQH 2SGQE 5AHGH 2ZGJA 4LZ1H 1CT2E 1O5DH 1PJPA 2XC0A 1G2LA 4YOIA 2TBSA 4D7FA 1BDAA 1O2NA 3BEFB 4FUIA 5DK1A 2GCHF 1W7XH 5G4BA 5T6FA 3SJOA 2C8ZB 4Z6AH 1B5GH 2UWOA 1AB9C 1IQIA 2J34A 3AW1A 3GISB 1RIWC 1DOJA 2GP9B 3SNDA 1TNLA 1ELEE 1V2MT 1BMAA 4J2YB 2BY5X 2Z9IA 5HM2A 3QGJA 5FCRA 5EW2H 3A8AA 1ZJDA 2ZF0H 1XXDA 2PUXB 1W13U 2FTLE 3QZRA 2EI6A 2QYIA 1HAVB 3P8FA 4B75A 1O2XA 2XWBI 1QGFA 1GCTC 2GV6A 3DD2H 2PSXA 1B0FA 4BAMB 4BTUB 1EOJA 1Z6EA 1UTPA 3RXEA 1FAXA 5TCCA 4CRAA 1P0SH 3HK3B 1O2MA 1HAPH 5E0GA 1BUIA 1C5ZB 1QBNA 5GCHF 1BRCE 5E2PA 1H9LB 2OC0A 1FY1A 3HK6B 4XE4A 5LPEA 2D26C 2VWLA 1EPTB 1P2KA 2ZU5A 4AGJA 3MMGA 1P11E 5DP4A 5ESTE 1A0LA 1ELCA 1MD8A 2FESH 1SHYA 2XNIA 1H1BA 1JWTA 1NY22 1VJ9U 3RXRA 1EJNA 1FNIA 1ZZZA 1FXYA 1CT4E 2BY8X 2PWXA 4AX9H 1P10A 5T6GA 1CGJE 1O2RA 1UK4A 1KXCA 3O8DA 4WY3A 1EX3A 1XUIA 3TITA 4B1TA 5GDSH 3SUEA 1GBAA 2QAAA 4TWYA 3ZVEA 4AN7A 1GPZA 1MKXH 1TMUH 4K3JA 2ESTE 1Q3XA 1ARCA 1ZPZA 2P3FH 1IQFA 2SGEE 2I6QA 4KKDA 1BJVA 1G9IE 2AEIH 1W11U 1WQSA 1MMJN 1NRNH 1ZSLA 5F8TA 1AVGH 1HGTH 1C1VH 1D3TB 5TCAA 1O38A 2F9BH 1KLJH 2CHAC 2V0BA 3TK5A 1THSH 1L1NA 4AOQA 1DICA 2SNWA 1WAYB 1CHGA 1MCTA 1HPGA 1OYTH 3MNXA 1HCGA 2G81E 5JB9S 3ZVAA 1YKTA 4UE7H 1IOEA 1GBLA 2GT8A 2M5TA 1RFNA 4GVUA 5C5NA 2FEQH 2QF0A 4CRFA 1P2NA 5DP8A 1MU8B 1QB9A 3ZVGA 3W94A 3PLKA 1ZGVA 3KNXA 5J4SA 2OQ5A 1P05A 3EDXB 5HMAA 1DLKB 2TIOA 1NPMA 3FP6E 1DPOA 2BMGB 4U01A 1QBOA 3ZZ3A 1N6YA 3RMLH 1OS8A 3F68H 1PQ7A 2ZPSA 3SN8A 3RLWH 5C3NA 1W0YH 1Z8GA 2FODA 1GJ5H 1GJAB 2UWLA 3TNTA 2BLVA 4YT6H 3ZZ7A 1T8LA 4X6PA 5DGJA 4ISNA 4FUGA 2AERH 2IN2A 4X2WA 3RXCA 4Y8XA 1HB0B 1HFDA 3LH3A 3U69H 2A5IA 1N6XA 3ATMA 1O3IA 1TOCB 2D8WA 2BZAA 2FLRH 3OTJE 1FY8E 3RXOA 2VIWA 1RD3B 2VJ1A 3VEQB 1RXPA 2QXJA 4YOGA 5SGAE 3FZDA 4LZ4B 5BPEA 1ANDA 1Y59T 4FUHA 1C4Y2 1F92A 4DJZB 1O3CA 1HAHH 1P2IA 1HXFH 1O2UA 3IITA 2NU4E 1TNGA 3OYPA 3UPEA 4BXSA 4WMEA 4JZFH 1GHYH 1W8BH 2Q1JA 3MH4A 1AE5A 1Z1IA 2BX3A 3P6ZB 1ID5H 2FZZA 4MPVA 1B0EA 4ASHA 2Y5HA 3A7YA 1GJCB 2ZGBH 2Q6GA 1O3KA 4ISOA 2UUKB 1GJ7B 1M9UA 1FUJA 2PKSC 1DXWA 2J92A 2PR3A 3UR9A 2VWMA 1QY6A 3GY5A 3HGNA 1TX6A 1A7SA 2BXUH 4XBDA 3ZVFA 3VB7A 2DUCA 4NIXA 2A4GA 1BZXE 1QTFA 1N8OC 4UFFH 1QB1A 3SGAE 3NKKA 4AFQA 4QT8C 1GI0A 3A86A 4YM9A 3E6PH 1TFXA 1O31A 1AI8H 1GHVH 4UFDH 1GHBG 2HLCA 1ZGIA 4B74A 4FXGH 3W95A 3GY7A 1AUTC 2R0KA 1AZZA 3TH4H 2ZIQH 2F3CE 2BQ7B 1V2RT 1HIAA 3EA8A 4ZXXH 2ZFFH 1SGFG 3H7TA 3D62A 1HAYB 3HKIB 1O2OA 1UO6A 4FUCA 2EI7A 4DG4A 3A85A 3EAJA 3OY5U 1AMHA 3RXIA 2VGCB 1W7GH 1KXFA 2A32A 3GY3A 5DO4H 1EJAA 5FBIA 3GYMA 3A80A 5EG4A 4WH6A 3L33A 3ZZ6A 3RXJA 4Y8ZA 3RMMH 5GWZA 1JXPA 3ZZBA 3UWJH 3RXQA 1CVWH 3PMAB 5IDKA 3RM2H 1QJ1B 4GPGA 1QFKH 3BG4C 3S7HB 1OWDA 2ZO3H 3LJJA 3GDUA 2B0FA 4Q2KA 2BDCA 2WPJS 3KQEA 3VB3A 2VWNA 1NFUA 1GDUA 2P16A 2BM2A 1OP8A 3FAOA 1LO6A 4MLFB 1RS0A 3SU2A 1NTPA 1GI5A 1JMOH 2GT7A 1CHOG 3RXUA 1P2QA 1Y5BT 4GHTA 2WPMS 4GLYA 3RXFA 3UOUA 1J17T 3E0PB 2GCTC 3ATWA 4TPIZ 1LVOA 4JCNA 1MKWK 1ZMNA 2FOAA 4JK6A 3UNRA 2H9HA 4FU9A 2PGBB 3RC5A 4X2VA 1UK2A 3V3MA 1F5RA 5E0JA 2O8LA 3SU5A 2HALA 2TGPZ 1TNKA 3BSQA 4O9VA 1C2HA 1JOUB 3V7TA 1O3GA 1C2EA 1Y3XA 2AYWA 1QJ6B 1AFQB 1HAXB 2F9OA 1A3EH 1TPAE 5A8ZA 2BOHB 3KN2A 5C1XA 1XKBC 5JYIA 1IHSH 4KP0A 1ZR0A 3CS7A 1F5LA 2BDAA 3GYLB 3MU5A 1ORFA 1YC0A 4NGAH 4MNXA 3P92A 2W3IA 7LPRA 4Q7XA 4I8KA 4ABGA 4ISIH 3NK8A 1WTGH 2BVXH 1L4DA 3UFAA 4I8GA 4OS4A 3RXVA 2Z3DA 2BDGA 4U30A 2ZQ1A 4IMZA 1DSUA 3TH2H 1QL8A 5JBAS 4UDWH 5LH8A 1FPHH 4A7IB 4BANB 3A83A 3U1JB 1TLDA 1P3EA 4XBCA 1AZ8A 1Q2WA 4J1YA 4ZH8A 3D23A 3QTOH 4VGCB 1ELDE 1GI4A 4OS2A 1LQDB 3QK1A 3SV6A 2BXTH 1HV7A 1F0RA 1XXFA 3MU0A 5EPNA 1TE0A 6GCHG 1C1TA 5I25A 1PPHE 1TGCA 1MTNC 3PO1B 2YOLA 2XRCA 4OGXA 1OYQA 3M5LA 1YPHE 1V3XA 4Y79A 1MBMA 1HYLA 1Y8TA 1YCPK 4KTCA 2NU1E 1Y3YA 1O39A 1JBUH 1GBJA 5HGGA 3VGCC 1F2SE 1EASA 1NFYA 1HIAB 2QC2A 3L6PA 2B5TB 1O33A 3S9BA 1J14A 3A84A 2Z3EA 4CRGA 4X6OA 1C1UH 2PSYA 1FN8A 2P3UB 5E8EH 2A5KA 2P8OC 4HZHA 1O3LA 1UHBB 1O3DA 2FS8A 1H8IH 2GZ9A 4YO9A 4AYVB 3FP8E 1O5AB 4E7NA 2W5EA 2ZHEH 1K1JA 1HAZB 8GCHG 1V2TT 1SR5C 3QGNB 2XC4A 2PLXA 3U8RH 4KTUA 2G8TA 3PMBB 4DURA 5LPFA 3MU1A 4MTBA 1AWFH 2WUBA 4H6SB 1KLIH 1W0ZU 4JZ1A 2FOEA 3NPSA 2PKAB 3O8BA 3LJOA 5FPYA 2GVFA 2FPZA 3BN9A 4ZKSU 2BD5A 1EXFA 4GAWA 1GGDC 1JIRA 3C1KA 1P9SA 3SOSA 1VCPA 3MNSA 3ZVBA 7GCHG 1E37B 1L1GA 2OP9A 5K7RA 1NT1A 2XTTB 3SNCA 1C5YB 4IC5A 4K69A 2HNTF 1P3CA 1Z7KA 1A1RA 3U8TH 1AKSA 5T6DA 4AFZA 1L4ZA 4ZMAH 1DE7H 1DWBH 4MPXA 1FAKH 1OWIA 4ESTE 3ITIA 4NA9H 4ABBA 1TPOA 4BTIB 1ESBA 4GUXA 5LGOA 2H5DA 3RLYH 1EB1H 1DITH 3K65B 2G00A 5EQQA 3RM0H 3RU4D 1O2KA 1C9TA 1NZQH 1TNHA 3A8DA 3I29A 3MO9A 4X1NU 1C9PA 1AFEH 4Q7ZA 2TPIZ 1MD7A 1KYNA 1XM1A 3PYHA 2BQ6B 2WUCA 2H6MA 2HRVA 3SORA 2ZGCA 3A7XA 3ZZAA 5FX6A 1SGPE 4B76A 2QXHA 4H4FA 1YLCA 2STAE 1LHCH 4X1SU 2SGFE 3GY2A 1RRKA 1SG8B 2JH5D 2VVUA 4YOJA 3AW0A 3RP2A 1J8AA 3M61U 3GCNA 1WBGB 1GI6A 3MHWU 3GCHC 1MTSA 4NSVA 2Z9LA 3VXEH 5J4QA 1SLUB 1NFXA 2H2ZA 2IJOB 4ABIA 2GGVB 5EQRA 1XUFA 2NWNA 3M5MA 1YYY1 4ZKRU 1ETSH 2GKVE 4ABAA 1CSOE 6CHAC 1HAIH 1O2HA 2FX6A 2F9VA 1EOLA 3MH5A 3RC4A 2FP7B 5DP5A 1IQKA 4BAQB 1UVSH 4IW4E 3ZYDA 1LVYA 2P59A 3RMNH 1GBTA 5CMXH 1GVZA 1RJXB 3HATH 2F83A 3S9CA 1VCQA 4JYUH 3QO6A 1G3EA 2ZU4A 2ODQA 2XYAA 5CE1A 1YCPM 1SGNE 2Q6FA 2YNAA 1GHBF 3AAUA 3QWCH 3LPRA 1YPHC 1ESAA 3EQ0H 5T3HA 4AYYB 2W3KA 2AH4X 1HUTH 3TIUA 2HPQH 1LPZB 3GDVA 3PLPA 3Q00A 1MZAA 1XKAC 3UREA 3SZNA 5FAHA 3MU4A 3VB4A 1YPMH 5DP6A 2FO9A 1THPB 3R3GB 9ESTA 4NFEA 3BTGE 3SQEE 4B2BA 1TBRH 3RC6A 3ATIA 2JH0D 3MNCA 3N7OA 1LQEA 4HI3A 1EAXA 3B8JA 1GBBA 1V2UT 2W7UA 1GI7B 4MNYA 4CREA 3SJ8A 1XUGA 2AMQA 3PTBA 1ZSJA 1AU8A 4CH8B 1XUHA 2VIDA 3ZZ4A 3SU6A 1YP9A 1XX9A 4E7RG 2FI4E 2VWOA 2SFAA 1S0RA 3T62A 3RU4T 1H4WA 1UTJA 1QIXB 3A87A 2VIPA 2H9TH 3VB6A 4A1VA 2ILNA 3CENA 3PMHB 1VR1H 1H8DH 1CA8B 4O97A 1BRUP 1G30B 3E16B 2TGAA 1F7ZA 3KQCA 3BEUA 4CHAC 1C5VA 1K1PA 1E36B 1TA2A 2BQWB 1KIGH 5EODA 5L2ZH 1SGRE 4DIIH 1KXAA 1P2JA 3STJA 4NCYA 1O0DH 1ANBA 1O2VA 2BLWA 3ZZ5A 1Z71A 1A5HA 3SUGA 1FLEE 4KTSA 4DY7B 5DKMA 2ZECA 3MH7A 3GICB 3SW2B 4FUBA 4H42U 2BHGA 1OWEA 2KAIB 1P01A 2BB4A 2ZDAH 3F9EA 2ZHQH 3UUZA 2Y5FA 1NO9H 1OSSA 1XMNB 3IWMA 4ABFA 2OC1A 2OTVA 2FOCA 2ODPA 2WPLS 1IQJA 2WPIS 3V0XA 4ABDA 4JK5A 2C8YB 2H1UA 2I6SA 2VU8E 1PPBH 1TPSA 3RXDA 3ZZDA 4BOHA 1T8NA 1Y5AT 1KTTB 1MKXK 1TA6A 1BRBE 2QN5T 1DY9A 1GVLA 2FYQA 2GMTB 3TGIE 1ELBA 4X0WU 3URCA 2O8TA 1O2WA 2BD8A 1GG6B 3I78A 1YPJH 1EAIA 1ANCA 2QXIA 1HJAB 1BBRH 5L6NH 2B9LA 1HRTH 2Z7FE 4AGKA 2BTCE 1MAYA 4A1TA 2WPKS 4K1EA 2Z6BD 1GBEA 1MTUA 4FVBA 1OX1A 3SV9A 1TALA 2V6NA 1EPTC 3BTQE 2HVXA 2PGQB 4Y0ZE 1ZTLA 1O3FA 3KGPA 1ANEA 1KXDA 1EQ9A 1LHFH 4A5TS 3PROA 4NWKA 3DT0H 4DVAU 5HYOA 4BXWA 4NG9H 2CV3A 3A7WA 2Z9JA 1CE5A 1BBRK 1Z6JH 1GDQA 2F91A 2Y7ZA 1FQ3A 2BLOA 4IN2A 3ZZCA 4NFFA 4X1PU 6GCHF 1IQNA 3BIUH 1XUJA 1AWHB 2CN0H 1VCWA 1XVMA 1IQLA 2O9QA 1OP0A 1GCDA 1V2KT 1WYKA 1GHAG 1BMLA 4Q80A 2C8XB 4LOYH 3RXLA 3A7ZA 1EAUA 1WSSH 1KXBA 4B73A 2EC9H 2RDLA 1BTYA 3SU4A 1GMHG 4I8LA 3AASA 1P9UA 1UK3A 1UTNA 3HPTB 4ZHLU 4PROA 1QA7A 3U98H 2OINA 2W26A 1EAWA 2FOMB 3D65E 4GCHG 1AUJA 1U6QA 3T2NA 1DVAH 1BTPA 1C2FA 4UFGH 2ANWA 1A2CH 2AGEX 4YT7H 1VGCB 1PYTC 4A92A 1SGCA 3FP7E 1Z8JB 4AFSA 1A61H 2F9PA 2ZGXH 3M3TA 1LKBA 1NU9A 4K5ZA 4THNH 3GY6A 1FV9A 2Z9GA 3A81A 8GCHF 1THRH 5EOKA 4INKA 4U32A 1GBKA 2F9NA 2WV5A 1PFXC 1D4PB 1C2KA 1F0UA 3SU3A 1HBTH 1C5SA 1C2IA 1EB2A 4NZQA 2A4OA 1EZSC 1QQ4A 1LHGH 4OS5A 4LXBH 3OU0A 1BHXF 2BD2A 3A82A 2CF8H 3P8GA 2ZCKP 4FUEA 1BIOA 4B71A 2PW8H 3SJKA 1CBWB 2ZCHP 1MBQA 2Y81A 1JRTA 1K2I1 2BDIA 3QLPH 5K0HA 2ZC9H 3MU8A 1IQEA 2H5CA 1SBWA 3Q3YA 1OOKB 1HAGE 4WF8A 1QRZA 2A45B 3NUMA 2O8UA 3ZZ8A 1LPKB 2PFEA 3A7TA 1WTHD 1SQOA 3JZ2B 4WMFA 3PLBA 4Y71A 1C2DA 3PWCA 4GSOA 3OY6U 2Z3CA 2PTNA 3M3VA 2IPHA 1GI2A 4ZKOU 5C1YA 2AGIX 2VH6A 3SHCH 4JYTA 1S85A 5ESBA 4R0IA 4D9QA 2G4UA 2ZCLP 3DHKH 5FBEA 3URDA 3I77A 2RA0A 1QRWA 2GDDA 3TGKE 2FS9A 3V13A 1GMCG 1P8VC 1BMNH 4BTTB 1IQHA 2ASUB 5FCKA 1DY8A 3P17H 3T28A 1BTXA 1A46H 1RGQA 1V2LT 3QTVH 1LVMA 2ZU3A 4K1TA 4Y6DA 4SGAE 1SB1H 3SU1A 1UVTH 1IQGA 2ZGHA 1AVXA 2FTMA 4X6MA 1KSNA 4IGDA 1K9OE 3Q3KA 2A7CA 4Q7YA 2TGTA 1FJSA 1O2PA 3BTKE 3M36A 1EKBB 1XUKA 2QIQA 5CHAB 3S7KB 1TABE 2EA3A 5DG6A 1LPGB 1C5LH 4ABEA 1ZHRA 3LKWA 3OSYA 1SVPA 1MQ6A 2A5AA 3M7TA 3NCLA 2FOGA 2FOBA 4AFUA 3BTHE 2ZP0H 3BTFE 2CJIA 4ZKNU 1BHXB 1GMDG 3A8BA 1T4UH 3RUOA 4D9RA 3ATLA 2ZDLA 2FDAA 3A88A 3G01A 2RCEA 1G3BA 3LGUA 3BV9B 1O2SA 4ZAEA 1QHRB 4TY6A 1O5GH 2P95A 3ZVCA 2JETB 4TWWA 4YTAA 1HJ8A 4XFQA 2QF3A 3BG8A 3SGQE 2OC7A 2TRMA 1HLTH 3BEIB 1YF4A 2A31A 5A0AE 9LPRA 5L30H 5C5OA 2Z9KA 3T29A 1X7AC 1ZTKA 3BIVH 3RXHA 3GCTG 1Y3VA 3TH3H 3U1IB 2QY0B 2BOKA 5DP3A 5TJXA 1H9IE 2V35A 1LHDH 1EP5A 2GV7A 1YGCH 2VGCC 4NIVA 2ZTYA 1ZPBA 3SUDA 1DS2E 1QA0A 1S5SA 3LT3A 1T31A 1O3AA 4INHA 2J94A 1C5OH 1F0TA 1K1MA 4DOQA 4JZEH 1AIXH 1J16A 1C5QA 2FOFA 4Y10E 1DX5M 2OBOA 4DCDA 2AS9A 4OS6A 2WINI 1P12E 3K2UA 3SV2H 3RXPA 1TIOA 1TBZH 1LCYA 1O2GH 4RKJB 1LKAA 2SGAA 4FUJA 3ZVDA 2ZKSA 3KHVA 1OWKA 1ZMJA 5F8ZA 1QL7A 2V3HH 3T26A 1ZTJA 4XBBA 1UTMA 3SI3H 3Q77A 2BD3A 1PQ8A 2FLBH 1DT2A 1O3HA 2ULLA 3UNQA 4WWYA 2RG3A 2R3UA 2SGDE 1GJBB 1EATA 1VITG 1A0HB 4OS7A 4AB9A 1O3NA 1TPPA 1O5CB 1HAVA 7ESTE 4FUDA 2QCYA 1G3DA 1CA0B 2ZHWH 3T27A 2ZNKH 1ELTA 3SNAA 2BY7X 5FXLA 2R0LA 3MWIU 1SGTA 2ZEBA 1PQAA 4JYVH 4WVPE 1G37A 5FHTA 4O3UA 5GXPA 1SGQE 1BTZA 4NWLA 2EI8A 5HXFA 2ZFRH 1C5XB 1OWJA 1OWHA 2ZWLH 1YPEH 3F9FA 3E0NB 4YESB 4B2AA 3A89A 4IMQA 3UQOA 1EPTA 1W12U 3O8CA 3BTWE 1QR3E 2QV1A 3R0FA 5EPYA 1AB9B 2XBWA 1SFQB 2VNTA 1RIWB 2ZQ2A 1T8OA 2FI5E 1GJ4H 6ESTA 1O5BB 3DFJA 1UMAH 3P70B 5A0CA 2FWWA 4CRCA 2AIPA 3M5NA 1FY4A 2R9PA 1Y3WA 1BOQA 3A8CA 2P93A 1ZMLA 2JKHA 2XBXA 2THFB 1RTLA 3EYDA 4H6TA 1P2OA 1YPGH 1T7CA 2ZDKA 2EEKA 2ZHDA 1GCTB 1QB6A 3SNBA 1TX7A 2AMPA 1AY6H 1WU1A 4VGCC 1L1JA 1PPZA 4MPUA 3PMJA 1NC6A 1BRAA 1QNJA 1S0QA 5B6OA 1O5EH 2Y82A 2A1DB 1GHAF 3PO1C 3E90B 1C4U2 1SFIA 3B23B 5EQSA 3LC3A 2R2MB 1SGDE 3RXAA 2Q6DA 4BNRA 1DXPA 1C5MD 4M7GA 3RXBA 1GMHF 5DJ7A 2HNTE 1TNIA 2UWPA 1RTKA 4GCHF 1TMTH 2ANKH 3KQBA 4BAOB 1VZQH 2LNCA 5JB8S 1PPEE 1WQVH 1A0JA 1ZYOA 3KF2A 4WJG2 1SQTA 3ENSB 3A7VA 1CQQA 4X6NA 3ESTA 2ALVA 1SGIB 2B7DH 1K1OA 3LU9B 1C4V2 8KME2 1SGFA 1SHHB 2A4RA 3MO6A 3ZV8A 1NN6A 1BTUA 1K1LA 4CH2B 4WXIA 2G55A 4JMYA 3LOXA 4JZDH 1O3OA 1UCYH 3UTUH 3M35A 1HXEH 2C3SA 4DIHH 4NA8A 3TJNA 4IN1A 1C2MA 1Z8RA 2NU0E 3M7UA 1P04A 2PV9B 2C93B
chains in the Genus database with same CATH superfamily
2AIQA 2XWAA 3UOPA 3SO3A 2O8MA 2OC8A 1MU6B 2VH0A 3EGKH 2GTBA 1EP6A 1K1NA 1SLXB 4IBLH 3T5FH 3SGBE 1SSXA 2CHAB 1GHXH 1P2MA 2OD3B 3TJOA 3O8RA 3TNSA 1QURH 5A09A 4IC6A 1UCYK 2GJGA 3S9AA 4X8UH 4XOJA 4D8NA 1ELFA 3LONA 2YNBA 3Q3XA 1T4VH 5IYTA 1EZXC 3PM3A 4Z0KA 2J95A 3SJ9A 1QQUA 1O3BA 5HM9A 5JBTA 3QUMP 4UFEH 2BVSH 3LC5A 1BTHH 4F49A 4CR9A 1NBME 1C2GA 4OS1A 1ETTH 5CHBA 1DWDH 3IG6B 2G5NA 4Y76A 5A0BA 1V2WT 1ARBA 1DDJA 1SKYE 3M5OA 5ETXA 3UQVA 1GMCF 1J9CH 4DT7B 1H9HE 3EA7A 2W6JD 4CR5A 4MG3A 3FZZA 1VJAU 1NRRH 1RTFB 3SI4H 4I8JA 1C5UA 3FVFB 1GJ8B 1O36A 1C1SA 3LGWA 1NROH 2W7SA 1E35B 1ZRBA 3RXSA 1BTWA 1NRSH 4FU8A 3P8NA 3TGJE 1CU1A 1A3BH 1P06A 3VPKA 3ELAH 3KL6A 8LPRA 2A7HA 2XXLA 3KQDA 2XOKD 4TPYA 1CHOF 3RXTA 5DP9A 2K1QA 1ACBE 2WZQA 3STIA 3OFND 4YZUA 3FOAA 1AKSB 1C1RA 4DW2U 3U9AH 1CO7E 1GBDA 1W14U 3K9XB 5B6LA 2ANYA 1V2PT 2FIRH 1KTSB 3QZQA 2V3OH 1DWEH 2BD4A 2XCFA 3BTDE 1GMDF 4NZLA 2QGRA 2FOHA 4OM9A 2GD4B 4B6FA 4K2YA 2ZA5A 3WY8A 1MCVA 3GCOA 2ZI2H 2VIOA 1BBRE 2H9EH 3ZV9A 3AVZA 2QXGA 3LGIA 4FVDA 5DPAA 1FY5A 5JDUB 5AF9H 1P09A 4MNWA 3H5CB 4WXVA 1FMGA 1YPLH 1W0KD 2C90B 4JZIA 1PQ5A 3V12A 1CGHA 2ZU2A 2BDHA 3QX5H 1GI1A 2HNTC 1GHWH 1KY9A 1YLDA 3D49H 2VINA 1AHTH 1C5PA 2XBVA 2P94A 1H8HD 2DE8A 5EXMA 1WCZA 4ISHH 1PYTD 1GL1A 2PKSB 1AD8H 5F6MA 3HGPA 2BX4A 4RN6A 1IQMA 4Y7BA 2ZPRA 3GCTF 1NRQH 1SOTA 2JH6D 1N8OB 2OQUA 5F8XA 1BCUH 1TQ7B 4Y11E 1G3CA 2ANMH 2YMSC 1DANH 3F9GA 2FXRA 1T8MA 2HOBA 3GY4A 5C20A 2G4TA 1QBVH 2PHBA 3PB1E 1C2LA 2J38A 1OKXA 1DWCH 2WV4A 4AG1A 1FZZA 4LK4A 2CGAA 1Z1JA 1Z8IB 2ZU1A 2ZFPH 4RT0A 5BRRE 3PV4A 6LPRA 1FN6A 5PTPA 3SUFA 1S6HA 2J97A 1QCPA 4X1RU 3NWUA 1GJDB 3BF6H 3VXFH 1V6DA 1PPFE 2J4IA 1DSTA 3AAVA 1GVKB 4I7YH 3VB5A 2RDEA 1Y3UA 1IHTH 1BITA 3GDSA 1V2JT 1QRXA 3KEEA 4INLA 1GI8B 4YLUA 5JPMH 1VITF 2QA9E 1G36A 1D6RA 3SU0A 2FX4A 4AB8A 1TYNA 3GOVB 2VB0A 1O3PB 1GBIA 4UONA 4FOUC 3BG4B 1E34B 1O2JA 2Y5GA 1MUEB 2GZ8A 3KIDU 2BD7A 1UTLM 2PUQH 4U2WA 1Y5UT 2VIVA 3FN8A 1JIMA 1C1WH 1ESTA 1LTOA 3CNRA 7KMEH 1MZDA 3FANA 3U8OH 5C67A 3SV7A 2WYJA 1KXEA 1SPJA 1GI9B 2SNVA 4K1SA 4I33A 1O2ZA 1SOZA 3UIRA 3QDZB 1O3EA 2GMTC 1L2EA 1YM0A 4TY7A 1L0ZA 3LIWA 1KDQA 3BTTE 1C1MA 1OXGA 1ZHMA 5GPIB 1O30A 4A1XA 1BT7A 5EU8A 3PRDA 1SLVB 2GCHG 1GG6C 3TVJB 4CRDA 2RA3A 1TB6H 2GCTB 3GY8A 1MTVA 1HJAC 1QJ7B 2A4QA 3LGVA 1S81A 1TBQH 1UTQA 5FPSA 4M9FA 1HJ9A 1DLEA 1MAXA 1HAOH 4RSPA 2DE9A 7GCHF 1SC8U 1V2ST 4X2YA 1SL3A 1TGNA 1SMFE 4IS5A 4I86A 3K6YA 4ISLA 3RXKA 2CK3D 4I31A 1K1IA 3QN7A 4UD9H 1VITH 5L2YH 1C5NH 3OX7U 5EGMA 3LGYA 2OXSA 1BA8B 1BJUA 5AFYH 5AFZH 3E1XB 1TNJA 1AVWA 1SLWB 5H4IB 1D9IA 1AO5A 1C5RA 4NIYA 1B7XB 2VIQA 4CRBA 2NU2E 1ZOMA 1S84A 1ZLRA 3F9HA 3K6ZA 1TONA 1INCA 1FY3A 4K8BA 3F1SB 2GZ7A 4FU7A 5I46H 1TQ0B 4MQAA 2SGPE 1UTKA 5GCHG 3RMOH 3FFGA 3VFEA 2XC5A 1O35A 5GIBA 2UUYA 4YLQH 4KELA 1SGEE 3HKJB 1FDPA 1S6FA 3EA9A 1UHBA 4CBOA 1BB0B 1LDTT 1K22H 4MPWA 4MNVA 1TOMH 1BMMH 1DM4B 1GWAA 2ZDMA 1J15A 2CF9H 3CP7A 2OK5A 3ZZ9A 3L3TA 3EE0B 4O03A 2BDBA 2Y7XA 1O2YA 1C1OA 4AORA 1MKWH 4E05H 3E91A 1FPCH 1D3QB 2ZPQA 1GJ6A 4X2XA 1VGCC 2IOTA 1JRSA 4DT4A 3MNBA 1GBFA 5EXLA 1MTNB 2PKAA 2ZDNA 3F6UH 3C27B 1UVUH 3CS0A 1SGYE 1UVOA 2J2UA 3ZYEA 2IJD1 1P03A 1NRPH 1WUNH 2J9NA 3E3TA 3RXMA 4I8HA 3SNEA 2GX4A 2ALPA 1P02A 1TGBA 2XCNA 3S69A 4K8YA 1TGSZ 2ZFTA 5C2ZA 2BLQA 1K21H 1GBCA 3VGCB 4SGBE 2UUFB 1C1PA 4Y0YE 2W6ID 2ZZUH 3UNSA 2P3TB 3TU7H 2C4FH 2BVRH 2HGTH 1CBWC 1D3DB 1O2QA 3PWBA 4NA7A 1T32A 1FI8A 3T25A 1TRMA 2KCPA 2ZG0H 1E0FD 2P8OB 3BTME 8ESTE 3KQ5A 3U28C 4HGCA 1EUFA 1NM6A 1GJ9B 4CBNA 1S82A 3TK6A 5LPRA 4HG6A 4ACAA 4ZROA 5ABWA 1C5TA 1KLTA 4Y7AA 3SBKA 3P8OA 2BY9X 4MVNA 1G32B 4FUFA 1DUAA 1O3MA 3SQHE 5JBCS 1SQAA 3GS9A 1LVBA 2PTCE 4HTCH 1C1NA 3WWBA 1V2VT 1FIZA 1O2IA 1TMBH 1V2OT 2XBYA 1GL0E 1QL9A 1NU7B 1GGDB 2AMDA 1UJ1A 1ELGA 3MFJA 2Y80A 3DFLA 4XDEA 1PPCE 4X8TH 5A2MH 5C1UA 1KDQB 2ZDVH 4KGAA 5EJZA 1DUEA 1NS3A 3MTYA 1YCPH 1HNEE 1EZQA 3ATKA 1TAWA 2A7JA 2HWLB 1ELVA 2OUAA 1O5FH 2O8WA 2UUJB 1YBWA 3KYGA 4TYDA 3LDXH 1W3CA 3ODFA 2AGGX 2CXVA 1SI5H 3SJIA 3TJVA 1D3PB 1FIWA 4ZUHA 4ZHAA 5CHAC 5FX5A 3Q76A 4R8TB 1O34A 1ABIH 1TWXB 2WYGA 5A8YA 5E2OA 3B9FH 2VVCA 3UY9A 2A0QB 3M3SA 2BY6X 4AG2A 1GDNA 2ZFSA 2ZHFH 2FM2A 4BAHB 1EZUC 2AFQB 2R2WU 1Q31A 3H7OA 1C1QA 3SV8A 3TJUA 4WH8A 3RU4E 1MTWA 3GCHB 4WMDA 3P95A 3RXGA 2JETC 1AFQC 4NSYA 3KCGH 4B2CA 2BZ6H 3M7QA 5EXNA 4BAKB 4NIWA 4I32A 2OBQA 5AVDA 3TLOA 4UEHH 1TX8A 2G5VA 6CHAB 1UW7A 2TGDA 3F3BA 1YPKH 3MO3A 1E38B 2BDYA 1GBMA 3PTNA 4X8SH 1W2KH 5E0HA 1O2LA 3MOCA 1ETRH 3MYWA 1K28D 3UR6A 4O3TA 1D6WA 1PPGE 3JZ1B 2STBE 4D7GA 1A5IA 1W10U 2ZTZA 2A2XH 2BD9A 3E8LA 1P57B 3MI4A 4MDSA 1N1LA 1OP2A 4F4OC 1C5WB 5EW1H 1MH0A 5JBBS 2Y6TA 3LH1A 2VVVA 2WPHS 2CMYA 4HFPB 1S83A 4XSKU 3ZIAD 4ABHA 1UTOA 5C0TA 2HPPH 3DUXH 5DP7A 2FI3E 1F5KU 1NFWA 2NU3E 1O3JA 2BYAX 3RDZA 3SHAH 3BTEE 1FONA 1A5GH 1ELAA 1AQ7A 2ODYB 1AE8H 1MQ5A 4E06H 1GHZA 1AGJA 2OLGA 1O37A 4X1QU 3NZIA 1ZSKA 1EJMA 3S0NA 2D1JA 2Z94A 2KAIA 4D76A 5KECA 1O2TA 3UWIA 3MH6A 1IAUA 1ZJKA 5FPTA 2FMJA 1UVPA 2OCVB 4AZ2B 1CGIE 2XW9A 1O32A 2A2QH 1ZRKA 1ZHPA 5F03A 4ABJA 1ZPCA 4DGJA 5A8XA 4Y8YA 1AN1E 1DFPA 1HDTH 1TRNA 1OHHD 1WOFA 1CT0E 3NXPA 1LMWB 1F0SA 1UCYE 1V2NT 4ZXYH 1GI3A 4X8VH 4RI0A 3DA9B 4OGYA 1TGTA 4K60A 1CA0C 2FYRA 2B8OH 1XVOA 1NESE 3LGTA 1V2QT 1COWD 2LPRA 1C2JA 2C8WB 3M37A 4RKOB 1BQYA 4A6LA 2G51A 2KFWA 2D2DA 1GBHA 1TRYA 2WV9A 4ZHMU 1LHEH 3TPIZ 3FKSD 1A4WH 1ABJH 2GDEH 2R3YA 2G52A 2ZTXA 1OPHB 3ODDA 4GHQA 1WV7H 4CHAB 5GJ4B 1G2MA 2F9UA 3TK9A 2ZFQH 2SGQE 5AHGH 2ZGJA 4LZ1H 1CT2E 2WHXA 1O5DH 1PJPA 2XC0A 1G2LA 4YOIA 2KCAA 2TBSA 4D7FA 1BDAA 1O2NA 3BEFB 4FUIA 5DK1A 2GCHF 1W7XH 5G4BA 5T6FA 3SJOA 2C8ZB 4Z6AH 1B5GH 2UWOA 1AB9C 1IQIA 2J34A 3AW1A 3GISB 1RIWC 1DOJA 2GP9B 3SNDA 1TNLA 1ELEE 1V2MT 1BMAA 4J2YB 2BY5X 2Z9IA 5HM2A 3QGJA 5FCRA 5EW2H 3A8AA 1ZJDA 2ZF0H 1XXDA 2PUXB 1W13U 2FTLE 3QZRA 2EI6A 2QYIA 1HAVB 3P8FA 4B75A 1O2XA 2XWBI 1QGFA 1GCTC 2GV6A 3DD2H 2PSXA 1B0FA 5CDFE 4BAMB 4BTUB 1EOJA 1Z6EA 2EY4C 1UTPA 3RXEA 1FAXA 5IK2D 5TCCA 4CRAA 1P0SH 3HK3B 1O2MA 1HAPH 5E0GA 1BUIA 1C5ZB 1QBNA 5GCHF 1BRCE 5E2PA 1H9LB 2OC0A 1FY1A 3HK6B 4XE4A 5LPEA 2D26C 2K0QA 2YMSD 2VWLA 1EPTB 1P2KA 2ZU5A 4AGJA 3MMGA 1P11E 5DP4A 5ESTE 1A0LA 1ELCA 1MD8A 2FESH 1SHYA 2XNIA 1H1BA 1JWTA 1NY22 1VJ9U 3RXRA 1EJNA 1FNIA 1ZZZA 1FXYA 1CT4E 2BY8X 3OTPA 2PWXA 4AX9H 1P10A 5T6GA 1CGJE 1O2RA 1UK4A 1KXCA 3O8DA 2QF5A 4WY3A 1EX3A 1XUIA 3TITA 1H8ED 4B1TA 5GDSH 3SUEA 1GBAA 2QAAA 5DN6D 4TWYA 3ZVEA 4ACBA 4AN7A 1GPZA 1MKXH 1TMUH 4K3JA 1KMHB 2ESTE 1Q3XA 1ARCA 1ZPZA 2P3FH 1IQFA 2SGEE 2I6QA 4KKDA 1BJVA 1G9IE 2AEIH 1W11U 1WQSA 1MMJN 1NRNH 1ZSLA 5F8TA 1AVGH 1HGTH 1C1VH 4Z1MD 1D3TB 5TCAA 1O38A 2F9BH 1KLJH 2CHAC 2V0BA 3TK5A 1THSH 1L1NA 4AOQA 1NBMD 1DICA 2SNWA 1WAYB 1CHGA 1MCTA 1HPGA 1OYTH 3MNXA 1HCGA 2G81E 5JB9S 3ZVAA 1YKTA 4UE7H 1IOEA 1GBLA 2GT8A 2M5TA 1RFNA 4GVUA 5C5NA 2FEQH 2QF0A 4CRFA 1P2NA 5DP8A 1MU8B 1QB9A 3ZVGA 3W94A 2XNDD 3PLKA 1ZGVA 3KNXA 5J4SA 2OQ5A 1P05A 3EDXB 5HMAA 1DLKB 1QZ8A 2F4LA 2TIOA 1NPMA 3FP6E 1DPOA 2BMGB 4U01A 1QBOA 3ZZ3A 1N6YA 3RMLH 1OS8A 3F68H 1PQ7A 2ZPSA 4ZCNA 3SN8A 1W0JD 3RLWH 5C3NA 1W0YH 1Z8GA 2FODA 1GJ5H 1GJAB 2UWLA 3TNTA 2BLVA 4YT6H 2L6OA 3ZZ7A 1T8LA 4X6PA 5DGJA 4ISNA 4FUGA 1S6LA 2AERH 2IN2A 4X2WA 3RXCA 4Y8XA 1HB0B 1HFDA 3LH3A 3U69H 2A5IA 5FL7D 1N6XA 3ATMA 1O3IA 1TOCB 2D8WA 2BZAA 2FLRH 3OTJE 1FY8E 3RXOA 2VIWA 1RD3B 2VJ1A 3VEQB 1RXPA 2QXJA 4YOGA 5SGAE 3FZDA 4LZ4B 5BPEA 1ANDA 1Y59T 4FUHA 1C4Y2 1F92A 4DJZB 1O3CA 1HAHH 1P2IA 1HXFH 1O2UA 3IITA 2NU4E 1TNGA 3OYPA 3UPEA 4BXSA 4WMEA 4JZFH 1GHYH 1W8BH 2QE7D 2Q1JA 3MH4A 1AE5A 1Z1IA 2BX3A 1EFRD 3P6ZB 1ID5H 2FZZA 3PV2A 4MPVA 1B0EA 4ASHA 2Y5HA 3A7YA 1GJCB 2ZGBH 2Q6GA 1O3KA 4ISOA 2UUKB 1GJ7B 1M9UA 1FUJA 3F2FA 2PKSC 1DXWA 2J92A 3UAIC 2PR3A 3UR9A 2VWMA 1QY6A 3GY5A 3HGNA 1TX6A 1A7SA 2BXUH 4XBDA 3ZVFA 3VB7A 2DUCA 4NIXA 2A4GA 1BZXE 1QTFA 1N8OC 4UFFH 1QB1A 3SGAE 3NKKA 4AFQA 4QT8C 1GI0A 3A86A 4YM9A 3E6PH 1TFXA 1O31A 1AI8H 1GHVH 4UFDH 1GHBG 2HLCA 1ZGIA 4B74A 4FXGH 3W95A 3GY7A 1AUTC 2R0KA 3KYFA 1AZZA 3TH4H 2ZIQH 2F3CE 2BQ7B 1V2RT 3F0OA 1HIAA 5HIYA 3EA8A 4ZXXH 2ZFFH 1SGFG 3H7TA 3D62A 1HAYB 3HKIB 1O2OA 1UO6A 4FUCA 2EI7A 4DG4A 3A85A 3EAJA 3OY5U 1AMHA 3RXIA 2VGCB 1W7GH 1KXFA 2A32A 3GY3A 5DO4H 1EJAA 5FBIA 3GYMA 3A80A 5EG4A 4WH6A 3L33A 3ZZ6A 3RXJA 4Y8ZA 3RMMH 5GWZA 1JXPA 3ZZBA 3UWJH 3RXQA 1CVWH 3PMAB 5IDKA 3RM2H 1QJ1B 4GPGA 1QFKH 3BG4C 3S7HB 1OWDA 2ZO3H 3LJJA 3GDUA 2K8IA 2B0FA 4Q2KA 2BDCA 2WPJS 3KQEA 3OE7D 3VB3A 2VWNA 1NFUA 1GDUA 2P16A 2BM2A 1OP8A 3FAOA 1LO6A 4MLFB 1RS0A 3PV5A 3SU2A 1NTPA 2J98A 1GI5A 1JMOH 2GT7A 1CHOG 3RXUA 1P2QA 1Y5BT 4GHTA 2WPMS 4GLYA 3RXFA 3UOUA 1J17T 3E0PB 2GCTC 3ATWA 4TPIZ 1LVOA 4JCNA 1MKWK 1ZMNA 2FOAA 4JK6A 5EJ1A 3UNRA 2H9HA 4FU9A 2PGBB 3RC5A 4X2VA 1UK2A 3V3MA 1F5RA 5E0JA 2O8LA 3SU5A 2HALA 2TGPZ 1TNKA 3BSQA 3F2GA 1C2HA 1JOUB 4O9VA 3V7TA 1O3GA 1C2EA 1Y3XA 2AYWA 1QJ6B 1AFQB 1HAXB 2JDID 2F9OA 1A3EH 1TPAE 5A8ZA 2BOHB 3KN2A 5C1XA 1XKBC 5JYIA 1IHSH 4KP0A 1ZR0A 3CS7A 3OEED 1F5LA 2BDAA 3GYLB 3MU5A 3NRLA 1ORFA 1YC0A 4NGAH 4MNXA 3P92A 2W3IA 7LPRA 4Q7XA 4I8KA 4ABGA 4ISIH 3NK8A 1WTGH 2BVXH 1L4DA 2KCYA 4YXWD 3UFAA 4I8GA 4OS4A 3RXVA 2Z3DA 2BDGA 4U30A 2J5UA 2ZQ1A 4IMZA 1DSUA 3TH2H 1QL8A 5JBAS 4UDWH 5LH8A 1FPHH 4A7IB 4BANB 3A83A 3U1JB 1TLDA 1P3EA 4XBCA 1AZ8A 1Q2WA 4J1YA 4ZH8A 3DSPA 3D23A 3QTOH 4VGCB 1ELDE 1GI4A 4OS2A 2KX4A 1LQDB 3QK1A 3SV6A 2BXTH 1HV7A 1F0RA 3AK5A 1XXFA 3MU0A 5EPNA 1TE0A 6GCHG 1C1TA 5I25A 1PPHE 1TGCA 1MTNC 3PO1B 2YOLA 2XRCA 4OGXA 1OYQA 3M5LA 3UB0A 1YPHE 1V3XA 4Y79A 1MBMA 1HYLA 1Y8TA 1YCPK 4KTCA 2NU1E 1Y3YA 1O39A 1JBUH 1GBJA 5HGGA 3VGCC 1F2SE 1EASA 1NFYA 1HIAB 2QC2A 3L6PA 2B5TB 1O33A 3S9BA 1J14A 3A84A 2Z3EA 4CRGA 4X6OA 1C1UH 2PSYA 1FN8A 2P3UB 5E8EH 2A5KA 2P8OC 4HZHA 1O3LA 1UHBB 1O3DA 2FS8A 1H8IH 2GZ9A 4YO9A 4AYVB 3FP8E 1O5AB 4E7NA 2W5EA 2ZHEH 1E79D 4Q4LA 1K1JA 1HAZB 8GCHG 1V2TT 1SR5C 3QGNB 2XC4A 2PLXA 3U8RH 4KTUA 2G8TA 3PMBB 4DURA 5LPFA 3MU1A 4MTBA 1AWFH 2F43B 2WUBA 4H6SB 1KLIH 1W0ZU 4JZ1A 2FOEA 3DSOA 3NPSA 2PKAB 3O8BA 3LJOA 5FPYA 2GVFA 1K0HA 2FPZA 3BN9A 4ZKSU 2BD5A 1EXFA 4GAWA 1GGDC 1JIRA 3C1KA 1P9SA 3SOSA 3MQKC 1VCPA 5KEDA 3MNSA 3ZVBA 7GCHG 1E37B 1L1GA 2OP9A 5C17A 5K7RA 1NT1A 2XTTB 3SNCA 1C5YB 4IC5A 4K69A 2HNTF 1P3CA 1Z7KA 1A1RA 3U8TH 1AKSA 5T6DA 4AFZA 1L4ZA 4F55A 4ZMAH 1DE7H 1DWBH 4MPXA 2V3MA 1FAKH 1OWIA 4ESTE 3ITIA 4NA9H 4ABBA 1VKYA 1TPOA 4BTIB 3SZEA 1ESBA 2JIZD 4GUXA 5KGOA 5LGOA 2H5DA 3RLYH 1EB1H 1DITH 3K65B 2G00A 5EQQA 3RM0H 3RU4D 1O2KA 1C9TA 1NZQH 1TNHA 3A8DA 3I29A 3MO9A 4X1NU 5HIZA 1C9PA 1AFEH 4Q7ZA 2TPIZ 2LELA 2KZ4A 1MD7A 1KYNA 1XM1A 3PYHA 2BQ6B 2WUCA 2H6MA 2HRVA 3SORA 2ZGCA 3A7XA 3ZZAA 5FX6A 1SGPE 4B76A 2QXHA 4H4FA 1YLCA 2STAE 1LHCH 3F0PA 2SGFE 3GY2A 4X1SU 1RRKA 1SG8B 2JH5D 2VVUA 4YOJA 3AW0A 3WWFA 3RP2A 1J8AA 3M61U 3GCNA 1WBGB 1GI6A 3MHWU 3GCHC 1MTSA 4NSVA 2Z9LA 3VXEH 5J4QA 1SLUB 1NFXA 2H2ZA 2IJOB 3WW7A 4ABIA 2GGVB 5EQRA 1XUFA 2NWNA 3M5MA 1YYY1 4ZKRU 1ETSH 2GKVE 4ABAA 1CSOE 6CHAC 1HAIH 3OEHD 1O2HA 2FX6A 2F9VA 1EOLA 3MH5A 3RC4A 2FP7B 5DP5A 1IQKA 4BAQB 1UVSH 4IW4E 3ZYDA 1LVYA 2P59A 3RMNH 1GBTA 5CMXH 1GVZA 1RJXB 3HATH 2F83A 3S9CA 1VCQA 4JYUH 3QO6A 1G3EA 2ZU4A 5C0UA 2ODQA 2KCOA 2XYAA 5CE1A 1YCPM 1SGNE 2Q6FA 2YNAA 1GHBF 3AAUA 3QWCH 3LPRA 1YPHC 1ESAA 3EQ0H 5T3HA 4AYYB 2W3KA 2AH4X 1HUTH 3TIUA 2HPQH 1LPZB 3GDVA 3PLPA 3Q00A 1MZAA 1XKAC 3UREA 3SZNA 5FAHA 3MU4A 3VB4A 1YPMH 5DP6A 2FO9A 5F53A 1THPB 3R3GB 9ESTA 4NFEA 3BTGE 3SQEE 4B2BA 1TBRH 3RC6A 3ATIA 2JH0D 3MNCA 3N7OA 5GNDA 1LQEA 3DCLA 4HI3A 1EAXA 3B8JA 1GBBA 3PRBA 1V2UT 2W7UA 1GI7B 4MNYA 4CREA 2YMSB 3SJ8A 1XUGA 2AMQA 3PTBA 1ZSJA 1AU8A 4CH8B 1XUHA 2VIDA 3ZZ4A 3SU6A 1YP9A 1XX9A 4E7RG 2FI4E 2VWOA 2SFAA 1S0RA 3T62A 3RU4T 1H4WA 1UTJA 3OAAD 1QIXB 3A87A 3N99A 2VIPA 4P02A 2H9TH 3VB6A 4A1VA 2ILNA 3CENA 3PMHB 1VR1H 1H8DH 1CA8B 4O97A 1BRUP 2WPDD 2KM0A 1G30B 3E16B 2TGAA 1F7ZA 3KQCA 3SYJA 3BEUA 4CHAC 1C5VA 1K1PA 1E36B 1TA2A 2BQWB 1KIGH 5EODA 5L2ZH 1SGRE 4DIIH 1KXAA 1P2JA 5T1VA 3STJA 4NCYA 1O0DH 1ANBA 1O2VA 2BLWA 3ZZ5A 1Z71A 1A5HA 3SUGA 1FLEE 4KTSA 4DY7B 5DKMA 2ZECA 3MH7A 3GICB 3SW2B 4FUBA 4H42U 2BHGA 1OWEA 2KAIB 1P01A 2BB4A 2ZDAH 3F9EA 2ZHQH 3UUZA 2Y5FA 1NO9H 1OSSA 1XMNB 3IWMA 4ABFA 2OC1A 2OTVA 2FOCA 2ODPA 2WPLS 1IQJA 2WPIS 4TSFD 3V0XA 4ABDA 4JK5A 2C8YB 2H1UA 2I6SA 2VU8E 1PPBH 1TPSA 3RXDA 3ZZDA 4BOHA 1T8NA 1Y5AT 1KTTB 2WSSD 1MKXK 1TA6A 2KR7A 1BRBE 2QN5T 1DY9A 1GVLA 2FYQA 2GMTB 4XD7D 3TGIE 1ELBA 4X0WU 3URCA 2O8TA 1O2WA 2BD8A 1GG6B 3I78A 1YPJH 1EAIA 1ANCA 2QXIA 1HJAB 1BBRH 5L6NH 2B9LA 1HRTH 2Z7FE 4AGKA 4ASUD 2HVYB 2BTCE 1MAYA 4A1TA 2WPKS 4K1EA 2Z6BD 1GBEA 1MTUA 4FVBA 1OX1A 3SV9A 1TALA 2V6NA 1EPTC 3BTQE 2HVXA 2PGQB 4Y0ZE 1ZTLA 1O3FA 3KGPA 1ANEA 1KXDA 1EQ9A 1LHFH 4A5TS 3PROA 4NWKA 3DT0H 5DSFA 4DVAU 5HYOA 4BXWA 4NG9H 2CV3A 3A7WA 2Z9JA 1CE5A 1BBRK 1Z6JH 1GDQA 2F91A 2Y7ZA 1FQ3A 2BLOA 4IN2A 3ZZCA 2QF4A 4NFFA 4X1PU 6GCHF 1IQNA 3BIUH 1XUJA 1AWHB 2CN0H 4RT1A 1VCWA 1XVMA 1IQLA 2O9QA 3N7EA 1OP0A 1GCDA 1V2KT 1WYKA 1GHAG 1BMLA 4Q80A 2C8XB 3VG8A 4LOYH 3RXLA 3A7ZA 1EAUA 1WSSH 1KXBA 4B73A 2EC9H 2RDLA 1BTYA 3SU4A 1GMHG 4I8LA 3AASA 1P9UA 1UK3A 1UTNA 3HPTB 4ZHLU 4PROA 1QA7A 3U98H 2OINA 2W26A 1EAWA 2FOMB 3D65E 4GCHG 1AUJA 1U6QA 3T2NA 1DVAH 1BTPA 1C2FA 4UFGH 2ANWA 1A2CH 2AGEX 4YT7H 1VGCB 1PYTC 4A92A 1SGCA 3FP7E 1E1RD 1MABB 1E1QD 1Z8JB 4AFSA 1A61H 2F9PA 2ZGXH 3M3TA 1LKBA 1NU9A 4K5ZA 4THNH 3GY6A 1FV9A 2Z9GA 3A81A 3H09A 1THRH 2L74A 5EOKA 8GCHF 4INKA 4U32A 1GBKA 2F9NA 2WV5A 1PFXC 1D4PB 1C2KA 1F0UA 4AC9A 3SU3A 1HBTH 1C5SA 1C2IA 1EB2A 4NZQA 2A4OA 1EZSC 1QQ4A 1LHGH 4OS5A 4LXBH 3OU0A 1BHXF 2BD2A 3A82A 2CF8H 3P8GA 2ZCKP 4FUEA 1BIOA 4B71A 4F48B 2PW8H 3SJKA 1CBWB 2ZCHP 1MBQA 2Y81A 1JRTA 1K2I1 2BDIA 3QLPH 5K0HA 2ZC9H 3MU8A 1IQEA 2H5CA 1SBWA 3Q3YA 1OOKB 1HAGE 4WF8A 1QRZA 2A45B 3NUMA 2O8UA 3ZZ8A 1LPKB 2PFEA 3A7TA 1WTHD 1SQOA 3JZ2B 4WMFA 3PLBA 4Y71A 1C2DA 3PWCA 4GSOA 3OY6U 2Z3CA 2PTNA 3M3VA 2IPHA 1GI2A 4ZKOU 5C1YA 2AGIX 3DSGA 2VH6A 3SHCH 4JYTA 1S85A 5ESBA 4R0IA 4D9QA 2G4UA 2ZCLP 3DHKH 5FBEA 3URDA 3I77A 2RA0A 1QRWA 2GDDA 3TGKE 2FS9A 3V13A 1GMCG 1P8VC 1BMNH 4BTTB 1IQHA 2ASUB 5FCKA 1DY8A 3P17H 3T28A 1BTXA 1A46H 1RGQA 1V2LT 3QTVH 1LVMA 2ZU3A 4K1TA 4Y6DA 3W1EA 4SGAE 1SB1H 3SU1A 1UVTH 1IQGA 2ZGHA 1AVXA 2FTMA 4X6MA 1KSNA 4IGDA 1K9OE 3Q3KA 2A7CA 4Q7YA 2TGTA 1FJSA 1O2PA 3BTKE 3M36A 1EKBB 1XUKA 2QIQA 5CHAB 3S7KB 4FETA 1TABE 2EA3A 5DG6A 1LPGB 1C5LH 4ABEA 1ZHRA 3LKWA 3OSYA 1SVPA 1MQ6A 1SQRA 2A5AA 3M7TA 3NCLA 2FOGA 2FOBA 4AFUA 3BTHE 2ZP0H 3BTFE 2CJIA 4ZKNU 1BHXB 1GMDG 3A8BA 1T4UH 3RUOA 4D9RA 3ATLA 2ZDLA 2FDAA 3A88A 3G01A 2RCEA 1G3BA 3LGUA 3BV9B 1O2SA 4ZAEA 1QHRB 4TY6A 2AHME 1O5GH 2P95A 3ZVCA 2JETB 4TWWA 4YTAA 1HJ8A 4XFQA 2QF3A 3BG8A 3SGQE 2OC7A 2TRMA 1HLTH 3BEIB 1YF4A 2A31A 5A0AE 9LPRA 5L30H 5C5OA 2Z9KA 3T29A 1X7AC 1ZTKA 3BIVH 3RXHA 3GCTG 1Y3VA 3TH3H 3U1IB 2QY0B 2BOKA 5DP3A 5HKKD 5TJXA 1H9IE 2V35A 1LHDH 5EJLA 1EP5A 5C94A 2GV7A 1YGCH 2M2AA 2VGCC 4NIVA 2ZTYA 1ZPBA 3SUDA 1DS2E 1QA0A 1S5SA 3LT3A 2JJ2D 1BMFD 1T31A 1O3AA 4INHA 2J94A 1C5OH 1F0TA 1K1MA 4P00A 4DOQA 4JZEH 1AIXH 1J16A 1C5QA 3FO8D 3N7DA 2FOFA 4Y10E 1DX5M 2OBOA 3EE7A 4DCDA 2PP6A 2AS9A 4OS6A 2WINI 1P12E 3K2UA 3SV2H 3RXPA 1TIOA 1TBZH 1LCYA 1O2GH 4RKJB 4TT3D 1LKAA 2SGAA 4FUJA 3ZVDA 2ZKSA 3KHVA 1OWKA 1ZMJA 5F8ZA 2LP6A 1QL7A 2V3HH 3T26A 1ZTJA 4XBBA 1UTMA 3SI3H 3Q77A 2BD3A 1PQ8A 2FLBH 1DT2A 1O3HA 2ULLA 3UNQA 4WWYA 2RG3A 2R3UA 2SGDE 1GJBB 1EATA 1VITG 1A0HB 4OS7A 4AB9A 1O3NA 1TPPA 1O5CB 1HAVA 7ESTE 4FUDA 2QCYA 1G3DA 1CA0B 2ZHWH 3T27A 2ZNKH 4Q63A 1ELTA 3SNAA 2BY7X 5FXLA 2R0LA 3MWIU 1SGTA 2ZEBA 1PQAA 4JYVH 4WVPE 1G37A 5FHTA 4O3UA 5GXPA 1SGQE 1YY3A 1BTZA 4NWLA 2EI8A 5HXFA 2ZFRH 1C5XB 4B6EA 1OWJA 1OWHA 2ZWLH 1YPEH 2VBCA 3F9FA 3E0NB 4YESB 4B2AA 3A89A 4IMQA 3UQOA 1EPTA 1W12U 3O8CA 3BTWE 1QR3E 2QV1A 1WXRA 3R0FA 5EPYA 1AB9B 2XBWA 1SFQB 4XRNA 2VNTA 1RIWB 2ZQ2A 1T8OA 2FI5E 1GJ4H 6ESTA 1O5BB 3DFJA 1UMAH 3P70B 5A0CA 1YLNA 2FWWA 4CRCA 2AIPA 3M5NA 1FY4A 2R9PA 2J98B 1Y3WA 2HLDD 1BOQA 3A8CA 2P93A 1ZMLA 2JKHA 2XBXA 2THFB 1RTLA 3EYDA 4H6TA 5EIYA 1P2OA 1YPGH 1T7CA 2ZDKA 2EEKA 2ZHDA 2RFKC 1GCTB 1QB6A 3SNBA 1TX7A 2AMPA 1AY6H 1WU1A 4VGCC 1L1JA 1PPZA 4MPUA 1FX0B 3PMJA 1NC6A 1BRAA 1QNJA 1S0QA 5B6OA 1O5EH 2Y82A 2A1DB 1GHAF 3PO1C 1WDIA 3E90B 1C4U2 1SFIA 3B23B 5EQSA 3LC3A 2R2MB 1SGDE 2IPQX 3RXAA 2Q6DA 4BNRA 1DXPA 1C5MD 4M7GA 3RXBA 1GMHF 5DJ7A 2HNTE 1TNIA 2UWPA 1RTKA 4GCHF 1YWUA 1TMTH 2ANKH 3KQBA 4BAOB 1VZQH 2LNCA 5JB8S 1PPEE 1WQVH 1A0JA 1ZYOA 3KF2A 4WJG2 1SQTA 3ENSB 3A7VA 1CQQA 4X6NA 3ESTA 2ALVA 1SGIB 2B7DH 1K1OA 3LU9B 1C4V2 8KME2 1SGFA 1SHHB 2A4RA 3MO6A 3ZV8A 1NN6A 1BTUA 2JJ1D 1K1LA 4CH2B 4WXIA 2G55A 4JMYA 3LOXA 4JZDH 1O3OA 1UCYH 2V7QD 3UTUH 3M35A 1HXEH 2C3SA 4DIHH 4NA8A 3TJNA 4IN1A 1C2MA 1Z8RA 2NU0E 3M7UA 1P04A 2PV9B 2C93B 3F2HA 2EQNA
chains in the Genus database with same CATH topology
2AIQA 2XWAA 3UOPA 3SO3A 2O8MA 2OC8A 1MU6B 2VH0A 3EGKH 2GTBA 1EP6A 1K1NA 1SLXB 4IBLH 3T5FH 3SGBE 1SSXA 2CHAB 1GHXH 1P2MA 2OD3B 3TJOA 3O8RA 3TNSA 1QURH 5A09A 4IC6A 1UCYK 3S9AA 4X8UH 4XOJA 4D8NA 1ELFA 3LONA 2YNBA 3Q3XA 1T4VH 5IYTA 1EZXC 3PM3A 4Z0KA 2J95A 3SJ9A 1QQUA 1O3BA 5HM9A 5JBTA 3QUMP 4UFEH 2BVSH 3LC5A 1BTHH 4F49A 4CR9A 1C2GA 4OS1A 1ETTH 1DWDH 3IG6B 2G5NA 4Y76A 5A0BA 1V2WT 1ARBA 1DDJA 3M5OA 5ETXA 3UQVA 1GMCF 1J9CH 4DT7B 1H9HE 3EA7A 4CR5A 4MG3A 3FZZA 1VJAU 1NRRH 1RTFB 3SI4H 4I8JA 1C5UA 3FVFB 1GJ8B 1O36A 1C1SA 3LGWA 1NROH 2W7SA 1E35B 1ZRBA 3RXSA 1BTWA 1NRSH 4FU8A 3P8NA 3TGJE 1CU1A 1A3BH 1P06A 3VPKA 3ELAH 3KL6A 8LPRA 2A7HA 2XXLA 3KQDA 4TPYA 1CHOF 3RXTA 5DP9A 2K1QA 1ACBE 3STIA 4YZUA 1AKSB 1C1RA 4DW2U 3U9AH 1CO7E 1GBDA 1W14U 3K9XB 2ANYA 1V2PT 2FIRH 1KTSB 3QZQA 2V3OH 1DWEH 2BD4A 2XCFA 3BTDE 1GMDF 4NZLA 2QGRA 2FOHA 2GD4B 4K2YA 2ZA5A 3WY8A 1MCVA 3GCOA 2ZI2H 2VIOA 1BBRE 2H9EH 3ZV9A 3AVZA 2QXGA 3LGIA 4FVDA 5DPAA 1FY5A 5JDUB 5AF9H 1P09A 4MNWA 3H5CB 4WXVA 1FMGA 1YPLH 2C90B 4JZIA 1PQ5A 3V12A 1CGHA 2ZU2A 2BDHA 3QX5H 1GI1A 2HNTC 1GHWH 1KY9A 1YLDA 3D49H 2VINA 1AHTH 1C5PA 2XBVA 2P94A 2DE8A 5EXMA 1WCZA 4ISHH 1PYTD 1GL1A 2PKSB 1AD8H 5F6MA 3HGPA 2BX4A 4RN6A 1IQMA 4Y7BA 2ZPRA 3GCTF 1NRQH 1SOTA 2JH6D 1N8OB 2OQUA 5F8XA 1BCUH 1TQ7B 4Y11E 1G3CA 2ANMH 1DANH 3F9GA 2FXRA 1T8MA 2HOBA 3GY4A 5C20A 2G4TA 1QBVH 2PHBA 3PB1E 1C2LA 2J38A 1OKXA 1DWCH 2WV4A 4AG1A 1FZZA 4LK4A 2CGAA 1Z1JA 1Z8IB 2ZU1A 2ZFPH 5BRRE 3PV4A 6LPRA 1FN6A 5PTPA 3SUFA 1S6HA 1QCPA 4X1RU 3NWUA 1GJDB 3BF6H 3VXFH 1V6DA 1PPFE 2J4IA 1DSTA 3AAVA 1GVKB 4I7YH 3VB5A 1Y3UA 1IHTH 1BITA 3GDSA 1V2JT 1QRXA 3KEEA 4INLA 1GI8B 4YLUA 5JPMH 1VITF 2QA9E 1G36A 1D6RA 3SU0A 2FX4A 4AB8A 1TYNA 3GOVB 2VB0A 1O3PB 1GBIA 4UONA 3BG4B 1E34B 1O2JA 2Y5GA 1MUEB 2GZ8A 3KIDU 2BD7A 1UTLM 2PUQH 4U2WA 1Y5UT 2VIVA 1JIMA 1C1WH 1ESTA 1LTOA 7KMEH 1MZDA 3FANA 3U8OH 5C67A 3SV7A 2WYJA 1KXEA 1SPJA 1GI9B 2SNVA 4K1SA 4I33A 1O2ZA 1SOZA 3UIRA 3QDZB 1O3EA 2GMTC 1L2EA 1YM0A 4TY7A 1L0ZA 3LIWA 1KDQA 3BTTE 1C1MA 1OXGA 1ZHMA 5GPIB 1O30A 4A1XA 1BT7A 5EU8A 1SLVB 2GCHG 1GG6C 3TVJB 4CRDA 2RA3A 1TB6H 2GCTB 3GY8A 1MTVA 1HJAC 1QJ7B 2A4QA 3LGVA 1S81A 1TBQH 1UTQA 5FPSA 1HJ9A 1DLEA 1MAXA 1HAOH 4RSPA 2DE9A 7GCHF 1SC8U 1V2ST 4X2YA 1SL3A 1TGNA 1SMFE 4IS5A 3K6YA 4ISLA 3RXKA 4I31A 1K1IA 3QN7A 4UD9H 1VITH 5L2YH 1C5NH 3OX7U 5EGMA 3LGYA 2OXSA 1BA8B 1BJUA 5AFYH 5AFZH 3E1XB 1TNJA 1AVWA 1SLWB 5H4IB 1D9IA 1AO5A 1C5RA 4NIYA 1B7XB 2VIQA 4CRBA 2NU2E 1ZOMA 1S84A 1ZLRA 3F9HA 3K6ZA 1TONA 1INCA 1FY3A 4K8BA 3F1SB 2GZ7A 4FU7A 5I46H 1TQ0B 4MQAA 2SGPE 1UTKA 5GCHG 3RMOH 3FFGA 3VFEA 2XC5A 1O35A 5GIBA 2UUYA 4YLQH 4KELA 1SGEE 3HKJB 1FDPA 1S6FA 3EA9A 1UHBA 4CBOA 1BB0B 1LDTT 1K22H 4MPWA 4MNVA 1TOMH 1BMMH 1DM4B 1GWAA 2ZDMA 1J15A 2CF9H 3CP7A 3ZZ9A 3L3TA 3EE0B 4O03A 2BDBA 2Y7XA 1O2YA 1C1OA 4AORA 1MKWH 4E05H 3E91A 1FPCH 1D3QB 2ZPQA 1GJ6A 4X2XA 1VGCC 2IOTA 1JRSA 3MNBA 1GBFA 5EXLA 1MTNB 2PKAA 2ZDNA 3F6UH 3C27B 1UVUH 3CS0A 1SGYE 1UVOA 2J2UA 3ZYEA 1P03A 1NRPH 1WUNH 2J9NA 3E3TA 3RXMA 4I8HA 3SNEA 2GX4A 2ALPA 1P02A 1TGBA 2XCNA 3S69A 4K8YA 1TGSZ 2ZFTA 5C2ZA 2BLQA 1K21H 1GBCA 3VGCB 4SGBE 2UUFB 1C1PA 4Y0YE 2ZZUH 3UNSA 2P3TB 3TU7H 2C4FH 2BVRH 2HGTH 1CBWC 1D3DB 1O2QA 3PWBA 4NA7A 1T32A 1FI8A 3T25A 1TRMA 2ZG0H 1E0FD 2P8OB 3BTME 8ESTE 4HGCA 1EUFA 1NM6A 1GJ9B 4CBNA 1S82A 3TK6A 5LPRA 4ZROA 5ABWA 1C5TA 1KLTA 4Y7AA 3SBKA 3P8OA 2BY9X 4MVNA 1G32B 4FUFA 1DUAA 1O3MA 3SQHE 5JBCS 1SQAA 1LVBA 2PTCE 4HTCH 1C1NA 1V2VT 1FIZA 1O2IA 1TMBH 1V2OT 2XBYA 1GL0E 1QL9A 1NU7B 1GGDB 2AMDA 1UJ1A 1ELGA 3MFJA 2Y80A 3DFLA 4XDEA 1PPCE 4X8TH 5A2MH 5C1UA 1KDQB 2ZDVH 4KGAA 1DUEA 1NS3A 3MTYA 1YCPH 1HNEE 1EZQA 3ATKA 2OUAA 1TAWA 2HWLB 1ELVA 2A7JA 1O5FH 2O8WA 2UUJB 1YBWA 4TYDA 3LDXH 1W3CA 3ODFA 2AGGX 2CXVA 1SI5H 3SJIA 3TJVA 1D3PB 1FIWA 4ZUHA 4ZHAA 5CHAC 5FX5A 3Q76A 4R8TB 1O34A 1ABIH 1TWXB 2WYGA 5A8YA 5E2OA 3B9FH 2VVCA 3UY9A 2A0QB 3M3SA 2BY6X 4AG2A 1GDNA 2ZFSA 2ZHFH 2FM2A 4BAHB 1EZUC 2AFQB 2R2WU 1Q31A 3H7OA 1C1QA 3SV8A 3TJUA 4WH8A 3RU4E 1MTWA 3GCHB 4WMDA 3P95A 3RXGA 2JETC 1AFQC 4NSYA 3KCGH 4B2CA 2BZ6H 3M7QA 5EXNA 4BAKB 4NIWA 4I32A 2OBQA 5AVDA 3TLOA 4UEHH 1TX8A 2G5VA 6CHAB 2TGDA 1YPKH 3MO3A 1E38B 2BDYA 1GBMA 3PTNA 4X8SH 1W2KH 5E0HA 1O2LA 3MOCA 1ETRH 3MYWA 1K28D 3UR6A 4O3TA 1D6WA 1PPGE 3JZ1B 2STBE 4D7GA 1A5IA 1W10U 2ZTZA 2A2XH 2BD9A 3E8LA 1P57B 3MI4A 4MDSA 1N1LA 1OP2A 4F4OC 1C5WB 5EW1H 1MH0A 5JBBS 2Y6TA 3LH1A 2VVVA 2WPHS 2CMYA 4HFPB 1S83A 4XSKU 4ABHA 1UTOA 2HPPH 3DUXH 5DP7A 2FI3E 1F5KU 1NFWA 2NU3E 1O3JA 2BYAX 3RDZA 3SHAH 3BTEE 1FONA 1A5GH 1ELAA 1AQ7A 2ODYB 1AE8H 1MQ5A 4E06H 1GHZA 1AGJA 2OLGA 1O37A 4X1QU 3NZIA 1ZSKA 1EJMA 3S0NA 2D1JA 2Z94A 2KAIA 4D76A 1O2TA 3UWIA 3MH6A 1IAUA 1ZJKA 5FPTA 2FMJA 1UVPA 2OCVB 4AZ2B 1CGIE 2XW9A 1O32A 2A2QH 1ZRKA 1ZHPA 5F03A 4ABJA 1ZPCA 4DGJA 5A8XA 4Y8YA 1AN1E 1DFPA 1HDTH 1TRNA 1WOFA 1CT0E 3NXPA 1LMWB 1F0SA 1UCYE 1V2NT 4ZXYH 1GI3A 4X8VH 3DA9B 4OGYA 1TGTA 4K60A 1CA0C 2FYRA 2B8OH 1XVOA 1NESE 3LGTA 1V2QT 2LPRA 1C2JA 2C8WB 3M37A 4RKOB 1BQYA 4A6LA 2G51A 2D2DA 1GBHA 1TRYA 4ZHMU 1LHEH 3TPIZ 1A4WH 1ABJH 2GDEH 2R3YA 2G52A 2ZTXA 1OPHB 3ODDA 4GHQA 1WV7H 4CHAB 5GJ4B 1G2MA 2F9UA 3TK9A 2ZFQH 2SGQE 5AHGH 2ZGJA 4LZ1H 1CT2E 1O5DH 1PJPA 2XC0A 1G2LA 4YOIA 2TBSA 4D7FA 1BDAA 1O2NA 3BEFB 4FUIA 5DK1A 2GCHF 1W7XH 5G4BA 5T6FA 3SJOA 2C8ZB 4Z6AH 1B5GH 2UWOA 1AB9C 1IQIA 2J34A 3AW1A 3GISB 1RIWC 1DOJA 2GP9B 3SNDA 1TNLA 1ELEE 1V2MT 1BMAA 4J2YB 2BY5X 2Z9IA 5HM2A 3QGJA 5FCRA 5EW2H 3A8AA 1ZJDA 2ZF0H 1XXDA 2PUXB 1W13U 2FTLE 3QZRA 2EI6A 2QYIA 1HAVB 3P8FA 4B75A 1O2XA 2XWBI 1QGFA 1GCTC 2GV6A 3DD2H 2PSXA 1B0FA 4BAMB 4BTUB 1EOJA 1Z6EA 1UTPA 3RXEA 1FAXA 5TCCA 4CRAA 1P0SH 3HK3B 1O2MA 1HAPH 5E0GA 1BUIA 1C5ZB 1QBNA 5GCHF 1BRCE 5E2PA 1H9LB 2OC0A 1FY1A 3HK6B 4XE4A 5LPEA 2D26C 2VWLA 1EPTB 1P2KA 2ZU5A 4AGJA 3MMGA 1P11E 5DP4A 5ESTE 1A0LA 1ELCA 1MD8A 2FESH 1SHYA 2XNIA 1H1BA 1JWTA 1NY22 1VJ9U 3RXRA 1EJNA 1FNIA 1ZZZA 1FXYA 1CT4E 2BY8X 2PWXA 4AX9H 1P10A 5T6GA 1CGJE 1O2RA 1UK4A 1KXCA 3O8DA 4WY3A 1EX3A 1XUIA 3TITA 4B1TA 5GDSH 3SUEA 1GBAA 2QAAA 4TWYA 3ZVEA 4AN7A 1GPZA 1MKXH 1TMUH 4K3JA 2ESTE 1Q3XA 1ARCA 1ZPZA 2P3FH 1IQFA 2SGEE 2I6QA 4KKDA 1BJVA 1G9IE 2AEIH 1W11U 1WQSA 1MMJN 1NRNH 1ZSLA 5F8TA 1AVGH 1HGTH 1C1VH 1D3TB 5TCAA 1O38A 2F9BH 1KLJH 2CHAC 2V0BA 3TK5A 1THSH 1L1NA 4AOQA 1DICA 2SNWA 1WAYB 1CHGA 1MCTA 1HPGA 1OYTH 3MNXA 1HCGA 2G81E 5JB9S 3ZVAA 1YKTA 4UE7H 1IOEA 1GBLA 2GT8A 2M5TA 1RFNA 4GVUA 5C5NA 2FEQH 2QF0A 4CRFA 1P2NA 5DP8A 1MU8B 1QB9A 3ZVGA 3W94A 3PLKA 1ZGVA 3KNXA 5J4SA 2OQ5A 1P05A 3EDXB 5HMAA 1DLKB 2TIOA 1NPMA 3FP6E 1DPOA 2BMGB 4U01A 1QBOA 3ZZ3A 1N6YA 3RMLH 1OS8A 3F68H 1PQ7A 2ZPSA 3SN8A 3RLWH 5C3NA 1W0YH 1Z8GA 2FODA 1GJ5H 1GJAB 2UWLA 3TNTA 2BLVA 4YT6H 3ZZ7A 1T8LA 4X6PA 5DGJA 4ISNA 4FUGA 2AERH 2IN2A 4X2WA 3RXCA 4Y8XA 1HB0B 1HFDA 3LH3A 3U69H 2A5IA 1N6XA 3ATMA 1O3IA 1TOCB 2D8WA 2BZAA 2FLRH 3OTJE 1FY8E 3RXOA 2VIWA 1RD3B 2VJ1A 3VEQB 1RXPA 2QXJA 4YOGA 5SGAE 3FZDA 4LZ4B 5BPEA 1ANDA 1Y59T 4FUHA 1C4Y2 1F92A 4DJZB 1O3CA 1HAHH 1P2IA 1HXFH 1O2UA 3IITA 2NU4E 1TNGA 3OYPA 3UPEA 4BXSA 4WMEA 4JZFH 1GHYH 1W8BH 2Q1JA 3MH4A 1AE5A 1Z1IA 2BX3A 3P6ZB 1ID5H 2FZZA 4MPVA 1B0EA 4ASHA 2Y5HA 3A7YA 1GJCB 2ZGBH 2Q6GA 1O3KA 4ISOA 2UUKB 1GJ7B 1M9UA 1FUJA 2PKSC 1DXWA 2J92A 2PR3A 3UR9A 2VWMA 1QY6A 3GY5A 3HGNA 1TX6A 1A7SA 2BXUH 4XBDA 3ZVFA 3VB7A 2DUCA 4NIXA 2A4GA 1BZXE 1QTFA 1N8OC 4UFFH 1QB1A 3SGAE 3NKKA 4AFQA 4QT8C 1GI0A 3A86A 4YM9A 3E6PH 1TFXA 1O31A 1AI8H 1GHVH 4UFDH 1GHBG 2HLCA 1ZGIA 4B74A 4FXGH 3W95A 3GY7A 1AUTC 2R0KA 1AZZA 3TH4H 2ZIQH 2F3CE 2BQ7B 1V2RT 1HIAA 3EA8A 4ZXXH 2ZFFH 1SGFG 3H7TA 3D62A 1HAYB 3HKIB 1O2OA 1UO6A 4FUCA 2EI7A 4DG4A 3A85A 3EAJA 3OY5U 1AMHA 3RXIA 2VGCB 1W7GH 1KXFA 2A32A 3GY3A 5DO4H 1EJAA 5FBIA 3GYMA 3A80A 5EG4A 4WH6A 3L33A 3ZZ6A 3RXJA 4Y8ZA 3RMMH 5GWZA 1JXPA 3ZZBA 3UWJH 3RXQA 1CVWH 3PMAB 5IDKA 3RM2H 1QJ1B 4GPGA 1QFKH 3BG4C 3S7HB 1OWDA 2ZO3H 3LJJA 3GDUA 2B0FA 4Q2KA 2BDCA 2WPJS 3KQEA 3VB3A 2VWNA 1NFUA 1GDUA 2P16A