4HGCA

Crystal structure of bovine trypsin complexed with sfti-1 analog containing a peptoid residue at position p1
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cationic trypsin
publication title Structure of a proteolytically resistant analogue of (NLys)(5)SFTI-1 in complex with trypsin: evidence for the direct participation of the Ser214 carbonyl group in serine protease-mediated proteolysis.
pubmed doi rcsb
molecule tags Hydrolase/hydrolase inhibitor
total genus 60
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2012-10-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4hgcA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4hgcA02
2ZF0H 1BRBE 5AFZH 1CBWB 3EA8A 3MWIU 4IMQA 1Y8TA 5EG4A 1ACBE 1FIWA 1Z6EA 1P06A 4BOHA 2H9EH 1Z8JB 2ZDVH 2J92A 4TWYA 2WPHS 3RUOA 5DPAA 1DWBH 1HAYB 3SUDA 3SUFA 1C5MD 3RXHA 3KF2A 3A8AA 3KNXA 3GCNA 3LC3A 3SUGA 1ANCA 2GCTC 4MDSA 1WTHD 1OPHB 1L0ZA 1S82A 2H6MA 4BANB 4WXVA 1C1WH 3MU4A 1GI4A 2ZU4A 4GSOA 3RMNH 1XUKA 1AFEH 2O9QA 4YT6H 4YZUA 5LPRA 3M3SA 1ZPBA 1CBWC 3A82A 1P04A 1IQKA 1O2OA 3MYWA 2ALPA 4JZIA 3OSYA 1TAWA 4Q80A 2WYJA 1T31A 1EZQA 4A5TS 1VCPA 1YPHE 3FZDA 1PPBH 2OLGA 1PPZA 5F8XA 1O34A 1HAPH 2R3UA 7ESTE 3E90B 3E91A 2PR3A 3BEIB 3BTWE 4CRBA 2UUJB 2BLOA 4WMEA 1DWCH 3KHVA 1MMJN 1BUIA 3T27A 2Z9KA 3F1SB 1T8MA 1O3FA 3BSQA 1SVPA 4F49A 1B5GH 1HAOH 4X6OA 4ABFA 2V0BA 2AEIH 1XKBC 5E0GA 1JBUH 2BVXH 2Z9LA 1F0RA 2GT7A 2O8UA 3RXDA 3HKJB 3QLPH 1TMTH 1KXDA 2QAAA 4E06H 3GY6A 1GMHF 1C5YB 1YPMH 3RU4E 1N6YA 4KKDA 4AYYB 3P8NA 3C1KA 1ZJKA 1HAIH 4X6NA 1ELTA 1YM0A 3TIUA 1PPHE 1QCPA 4ZHAA 4Y8YA 1O2WA 2P95A 3BTQE 5TCCA 4DVAU 5HM2A 1B7XB 2VIQA 1O33A 3VXFH 4FU9A 4M7GA 4I8KA 1HIAA 1TBZH 4E7RG 3PMAB 2QXHA 1SGFA 4IN1A 1O5CB 3M36A 4A7IB 4ABBA 1HXFH 2VWMA 3RXEA 3GCHB 2FPZA 1DM4B 1TX6A 4H6TA 5LPFA 1UK3A 3KIDU 4K5ZA 3ZZ9A 2GTBA 3TU7H 1EPTB 1ZMLA 5F8ZA 2FDAA 1RD3B 1FI8A 1DVAH 3PMHB 1UTMA 2NU4E 1O2HA 3I78A 4YM9A 1LQDB 4K3JA 3MNBA 1GCDA 1XUJA 1O3CA 3FANA 1C1NA 3P8GA 1Y3WA 1IOEA 5J4SA 2Y7XA 3MFJA 3GCHC 3TJVA 4INKA 5EXMA 1SGTA 4JMYA 1BIOA 1XKAC 1UVUH 1EPTC 1XX9A 3EAJA 1ZTKA 2BZAA 3FP7E 1P09A 2A5KA 4Y8XA 3T5FH 3NXPA 3ZVFA 1HAZB 1BTHH 1Z1IA 1YGCH 2ZGXH 1V3XA 4FUDA 1GBEA 1A3BH 1J17T 2Z3EA 2OUAA 1Z8GA 4JYVH 3RC6A 4BTTB 1CHOG 4CREA 5EXLA 4JK5A 1O5GH 1TNHA 2JKHA 1OP8A 4R8TB 3A88A 1EAXA 1BRUP 1FONA 3ZZ3A 2CF9H 1C4V2 1O0DH 4I8LA 1ORFA 1P12E 3G01A 1GL0E 3NPSA 1FY8E 3B23B 3HKIB 5I46H 3ATKA 1QIXB 1SSXA 7LPRA 1GMCG 1AD8H 1MQ6A 2PUQH 2A5IA 2BHGA 5EQSA 2Y5HA 2DUCA 1ZMJA 4VGCB 4KTSA 1FPHH 2Z6BD 1K22H 1P02A 3SV8A 3QUMP 1AB9B 1F5KU 1BJUA 2XC0A 1A1RA 2CHAB 1P10A 3ATLA 3SQEE 1TGTA 3L3TA 1QB6A 1HRTH 1KXEA 1NROH 1SOTA 2FIRH 2QYIA 1MH0A 2Z94A 3TK5A 1QL8A 2ZTYA 5LH8A 1DWEH 1D3PB 2FMJA 2UUFB 2VWOA 3SJ9A 4AOQA 4VGCC 4MPWA 3PLPA 1A0LA 3FAOA 1ABIH 2ZFRH 5GPIB 3PB1E 3SU6A 3ZZ4A 4YESB 5BPEA 1AB9C 2ZFSA 3BTEE 5JBAS 1ZHRA 1QY6A 3RXGA 3CS7A 1Y3YA 2CHAC 1DX5M 2ANMH 1MQ5A 2WINI 3TNTA 3U98H 1G3DA 3URCA 4FUBA 2XBXA 1C1VH 1BRAA 3S69A 5T6DA 3S9BA 2JETB 1OXGA 1ZJDA 1LPZB 3ATWA 1AN1E 3IWMA 4DW2U 3ZZDA 5DP9A 1P2IA 1N1LA 3T29A 4ABDA 3DHKH 1GVLA 4J2YB 4FUEA 2ZFQH 4GCHF 4JYUH 4K2YA 4A1TA 2ODYB 4UONA 4JZ1A 2BM2A 4XBCA 4GVUA 6GCHG 4CR5A 1QNJA 2Y81A 2SFAA 3ZZ6A 1HUTH 4NA8A 1DPOA 2G00A 4FUJA 2CN0H 1GMDG 2W26A 3ZZ5A 1K1MA 3RXRA 5FCKA 1AVWA 2GD4B 3SHAH 2JETC 1C1SA 1M9UA 1ELVA 4AGJA 3BN9A 4TY7A 3MNSA 5EQQA 2XTTB 4CHAB 3TPIZ 1K1IA 1C5LH 3RC4A 1IQJA 1KSNA 1L2EA 1V2TT 2ZHWH 4FUHA 4K1SA 1QFKH 4K1TA 4BAHB 1O3OA 1O3HA 1GBLA 3A8DA 4NIYA 1TNLA 5G4BA 2I6QA 1AKSA 3VB3A 1U6QA 1N8OB 2VWNA 3O8RA 4ASHA 3U8OH 2ZI2H 2EI7A 2WUCA 1MKWH 3D49H 4TY6A 1C5RA 3RM2H 3SU2A 1UTNA 1O39A 4NGAH 2QXIA 3KQEA 4CHAC 4NFFA 3A8BA 2IJOB 3ODDA 2B5TB 4FVBA 1O2IA 2VB0A 1W3CA 3PTBA 5E0HA 1CU1A 1XUGA 5FPSA 1FY5A 1MCVA 2HNTE 2HLCA 3RXIA 3HK3B 2FZZA 4CH2B 2G8TA 4ESTE 1AO5A 2FX4A 1S85A 3QK1A 1GDNA 3H7OA 1W2KH 5DP8A 1Y3VA 1N8OC 5JDUB 1C1OA 1QL7A 3GISB 3UNRA 3MNXA 2WV4A 2ZA5A 2ODQA 3P70B 5C5NA 4Y79A 3RMLH 3UQOA 2BDGA 1C2EA 2GP9B 1RIWB 2A4QA 2PKAB 2TBSA 2Y7ZA 2BYAX 1AQ7A 2Z3CA 1CGHA 1DITH 1CHGA 1J14A 2OC0A 2GV7A 1GJ5H 4DG4A 1OWHA 2ZPQA 1KTTB 1ELDE 4WWYA 5EPYA 1W0ZU 1GJCB 5FPTA 2VVCA 3I29A 1GI0A 1O36A 1E0FD 1V2NT 1Z6JH 2ZZUH 4JZFH 1SGEE 1WTGH 3EDXB 2O8LA 1C5SA 1H8DH 3UR9A 4BAKB 1PQ7A 1O3BA 2BY6X 1HV7A 1GMCF 2GVFA 2Z9IA 4OGXA 1DXPA 2TGAA 4INLA 1CGJE 2BOKA 2BQ6B 2ZTZA 1RIWC 2EI6A 1P8VC 2HPQH 1VCWA 1FZZA 3VFEA 1AE8H 5H4IB 1F5LA 3M5OA 3MU0A 4NZLA 2HWLB 1BCUH 1SQTA 1J16A 1WSSH 4FVDA 3I77A 1HJAB 3VB4A 1V2LT 4GHTA 2G51A 2EEKA 2R3YA 2W3KA 1EKBB 5DP5A 1OYQA 2H1UA 2ZDAH 1V2ST 3W94A 4ABJA 1NS3A 4FU8A 3D65E 4FUFA 1EXFA 3AW0A 3SOSA 3S0NA 1LHFH 2WYGA 4BAMB 2DE9A 3TK6A 1W12U 4Q7XA 5T3HA 3TJUA 1JOUB 2A32A 1ZMNA 1CT2E 4UD9H 4D7FA 1GHBG 1JRSA 1NU7B 1GHYH 1S81A 1MU8B 1BBRH 1G37A 1C1UH 1ZR0A 4Y11E 2VWLA 1Z71A 1Q31A 1QHRB 4INHA 5TJXA 2FOMB 2H2ZA 2PFEA 1MCTA 3BTME 1ELAA 3RM0H 2BZ6H 1GJ7B 1D3QB 1TPAE 4WMDA 1F2SE 1HJAC 2ZGJA 4WVPE 1DS2E 5DG6A 3LGUA 2ZPSA 2VIDA 2VU8E 3SJOA 5A0CA 1FAKH 3ODFA 1PPEE 4B76A 3OX7U 2OP9A 1PYTC 1RTFB 3NK8A 1T4UH 1K21H 1TPSA 5EQRA 2BY7X 2IOTA 4O9VA 2FOHA 2ANWA 1IQNA 2EA3A 2HPPH 1A7SA 1P01A 1WBGB 1GI3A 3BTHE 3PLKA 4YOJA 3PO1B 1ABJH 1QRZA 3AASA 1OWEA 1Y59T 1O3PB 2OC7A 2AMDA 4MPUA 1CVWH 1GHXH 1A5IA 2J4IA 1MZDA 3O8DA 1EPTA 2C93B 3UNQA 3V12A 3SU5A 5GDSH 1KXCA 1H9HE 4XDEA 4FUGA 2P3TB 1GBTA 1O5DH 4YO9A 2BD7A 1MD8A 1YKTA 1V2RT 1TNKA 1DDJA 1TFXA 3VGCB 3TGIE 1FY4A 1YPJH 1GBAA 2CGAA 3BV9B 4ZXYH 4D76A 2J94A 1VITH 1GI6A 1SOZA 3SGBE 3PO1C 1SC8U 3HGPA 3RXFA 3QO6A 2RG3A 3ZZ7A 3ZVBA 1C2KA 4WH8A 3SJKA 1GHWH 2I6SA 1MTUA 1NRPH 4DIIH 2A7HA 5GXPA 2PV9B 4D9RA 1NFYA 3VB5A 4IW4E 3NCLA 1TGBA 2F9NA 2BQWB 2B9LA 1XVMA 4H42U 4QT8C 1EAIA 1HGTH 1CA8B 4ZHLU 3E0PB 1NU9A 3A7YA 4X1SU 5EODA 4NA9H 3A8CA 2NU0E 3RXJA 2AGGX 1UHBB 1UVSH 3VGCC 1D4PB 1Z1JA 2ZDNA 3SJ8A 5PTPA 1O30A 1XMNB 2NWNA 1SGDE 5L2YH 1K2I1 4U32A 4GPGA 2J9NA 4AFSA 4BTUB 1SGCA 3U8TH 3PWBA 3E8LA 1D3DB 3U9AH 1GI7B 1EZSC 1O2JA 1SPJA 3GICB 2F9BH 1AUTC 1AU8A 3M5MA 1QTFA 2BDAA 1DANH 1P9UA 2Q1JA 1FY3A 1P9SA 1ZSKA 1O3DA 1JXPA 1EASA 1SGIB 3AVZA 1ZRBA 1VJ9U 3UQVA 2VIOA 3MHWU 3UOPA 3URDA 3V7TA 1QJ1B 1TYNA 3QX5H 1QRWA 1CT0E 1O3AA 4I33A 3SV9A 2BOHB 1HB0B 4K8BA 1WV7H 5DJ7A 1C2IA 4XE4A 1EZUC 1L1JA 2XBVA 1J8AA 4TPYA 3S7HB 1S6HA 3E16B 1LHCH 3QGJA 1W7XH 5DP3A 3RXOA 4AFZA 4IGDA 3A85A 2ASUB 2VIVA 4B71A 2FTMA 1H9LB 1XUHA 1GI9B 2F3CE 1GDQA 6ESTA 7KMEH 3KQDA 2FI4E 1TOCB 1DE7H 4UEHH 1OP0A 4SGBE 3UPEA 1TALA 1E34B 2BD5A 3HPTB 2F83A 5FCRA 4WF8A 2B0FA 4E05H 3HK6B 3RLYH 5EU8A 1BA8B 1O2NA 3SORA 2XCFA 1MKWK 2VIPA 5F8TA 1WCZA 2ZKSA 3RXBA 3A87A 8GCHG 1DLEA 3P92A 4Y0YE 4X2WA 7GCHG 1BRCE 2SNVA 3MH6A 3F9HA 1HJ8A 1NT1A 4NIVA 3TNSA 3TVJB 1W14U 5DP6A 1C2DA 2FOBA 1TGNA 3RXLA 1B0FA 3RXMA 3RXCA 3DFJA 3ZVDA 1FN8A 3LGIA 5GIBA 5JBBS 3U69H 1KDQB 2SGDE 4X8VH 1SFQB 1OSSA 3NWUA 4UDWH 1LHGH 2VINA 2GCHF 1F5RA 2ZFFH 2R9PA 3RXAA 1NFUA 5DKMA 2A31A 5E2PA 2H5DA 3ATIA 3KGPA 4WMFA 2QY0B 1EOLA 1YBWA 4DGJA 1DUEA 1TPOA 1O32A 2FODA 1P3EA 1O2UA 1ANBA 2ALVA 1CO7E 2J2UA 1MD7A 3VPKA 1P2JA 1LKAA 4MNYA 2BVSH 3GY4A 4ABIA 3BF6H 3BTGE 1LDTT 2FS9A 1H8IH 2BY8X 2LNCA 4NSYA 1TMBH 5HGGA 1E35B 1W0YH 1MKXK 3LT3A 1YF4A 3BG8A 1P0SH 3MMGA 2PTNA 3TH4H 3GDSA 2OQUA 3NKKA 1V2MT 2C8YB 4Q7ZA 1UJ1A 5ETXA 1QB1A 3BG4B 4HZHA 2ILNA 3F68H 8ESTE 4B2BA 4MG3A 4NG9H 1GWAA 5JBTA 3EGKH 3PTNA 1THSH 4BXSA 3UR6A 1P57B 1VITF 1MTWA 1O2TA 1V2VT 4Y7BA 3GYLB 1C4Y2 4LXBH 3KQBA 1HFDA 3RP2A 1V2OT 1NPMA 4OS2A 3LC5A 2Z3DA 2ZG0H 3RXPA 3SGAE 3EE0B 4E7NA 1RJXB 2ZHEH 3P6ZB 1FLEE 1LKBA 1WOFA 3M5LA 1O2VA 2BLVA 3LJJA 3T25A 2CJIA 1O2QA 3GY8A 1ESAA 4OS7A 1RTLA 5FX5A 3SJIA 1O3NA 1BBRK 1E37B 1HJ9A 4NWLA 1JRTA 5C3NA 1QQ4A 3ZZAA 1EP6A 5FHTA 2TRMA 3SV2H 4CRDA 1P05A 2PKAA 2VH0A 4Y8ZA 1D3TB 3FVFB 1A46H 1INCA 1DFPA 4MNVA 4O3TA 3UFAA 2FYQA 1QL9A 1TLDA 2OINA 1P11E 3VB7A 1O2RA 1BMLA 5F6MA 1C9PA 2W5EA 2GKVE 3PYHA 3ZZ8A 1FNIA 1GHVH 1TBQH 4X6MA 2VVUA 4X2VA 3SV6A 2F9OA 1MUEB 1HXEH 1ZTJA 1EUFA 2PUXB 2STBE 1YC0A 3WY8A 3BTFE 3HATH 3SV7A 1BTPA 1KXFA 1UVTH 3V3MA 1DICA 2Q6FA 1W10U 3QZQA 1ZHPA 1C1TA 1DSUA 1C2JA 1K1NA 5L6NH 3M3TA 2W7SA 5L2ZH 4ZUHA 1YPEH 5B6OA 1A2CH 1BHXB 1UTKA 1W7GH 1C2MA 2GX4A 3MO6A 2OBQA 3B8JA 1NC6A 3C27B 3UREA 1KYNA 1Y5UT 2QXJA 1BMAA 4ZKNU 4A92A 1SG8B 4RKJB 2BX3A 1O3LA 3K6YA 1SLWB 1P03A 2P3FH 4ABAA 1BB0B 1TIOA 2D2DA 3PM3A 1L1GA 1TA2A 1LO6A 1GBHA 1HDTH 5JPMH 2RDLA 1S6FA 1Y3XA 3EA7A 1BOQA 2BDHA 3SO3A 1EJAA 3CS0A 1AUJA 3OY5U 3B9FH 2D26C 1Y5BT 3M7TA 2QCYA 5EW1H 1NFWA 1C5ZB 3LGYA 1YLCA 3ZVGA 2FI5E 4B73A 4JZEH 9LPRA 1CE5A 7GCHF 5HM9A 3K65B 4XBDA 1NRSH 5C5OA 1QR3E 2P3UB 4TWWA 3SI4H 1GJDB 4NSVA 2ZCLP 1PPGE 1LTOA 1SB1H 2C3SA 4UFEH 1FIZA 1GBFA 2OTVA 3BTDE 5CHAB 1PQ8A 3LGVA 3RXSA 5AFYH 1K1JA 1DY9A 1O2MA 2PWXA 1QBOA 1GHZA 4X0WU 4X8UH 8LPRA 5EW2H 1G3EA 1LQEA 4ZMAH 1OWJA 1T32A 2H5CA 1GJ8B 4JYTA 2P8OB 1O3EA 3SHCH 3GCOA 1LCYA 3EA9A 3LPRA 1MBMA 1QJ6B 2BLQA 5GCHG 2NU3E 3PMJA 4THNH 1K1PA 4NZQA 4RKOB 1XXDA 4OS1A 4YLQH 2KAIB 2GV6A 4CRGA 1ETRH 2R2WU 2VJ1A 2XBYA 1IQGA 2XNIA 3DFLA 1C1QA 5IYTA 5CHAC 2ZU3A 1NZQH 4ISIH 4HTCH 1ANEA 2BDBA 1N6XA 1PYTD 4JK6A 1P2KA 1BTWA 2UWPA 3RXQA 5JB8S 3M3VA 2WPMS 3MH7A 1EAUA 3FZZA 2FTLE 1IQIA 3UNSA 1ELBA 2P8OC 4R0IA 1ZLRA 2GT8A 2BQ7B 5K7RA 1RRKA 2SGAA 1TNJA 2BD3A 1SQAA 2VIWA 1O5BB 3U1JB 2FOGA 3FFGA 1UTJA 1CHOF 1QJ7B 3SNCA 4MPVA 1KY9A 2FLRH 1EJMA 5A8YA 2PSXA 4GUXA 2ZFPH 1FMGA 2ZTXA 1UHBA 3W95A 1KLJH 2HRVA 3JZ2B 2ESTE 2QA9E 4BAOB 2WPIS 2FEQH 3K2UA 3QWCH 1GPZA 4ABGA 1F0SA 5DP4A 5C67A 1OX1A 1O5EH 2FOCA 1SGRE 1YCPH 4ZKSU 2JH6D 1NO9H 3TLOA 1G2LA 2A4RA 1MU6B 3MU8A 5TCAA 1KLTA 1AI8H 2ZGHA 1GBMA 2RCEA 5ESTE 4I8GA 2RA3A 2AIQA 1F7ZA 4ISHH 4HI3A 2A0QB 2OQ5A 4AG2A 2CMYA 1Y5AT 2NU1E 1K9OE 5JYIA 4MNWA 1FY1A 4CH8B 2A4OA 2B7DH 6CHAB 4A6LA 1AMHA 2Z9JA 3TITA 4X1RU 1HAVB 2AIPA 2QV1A 1S83A 3GCTG 2P94A 2RA0A 1HAXB 3AAUA 1C5TA 1T8NA 3JZ1B 3RMMH 1RXPA 1BBRE 1BMMH 2V3HH 4ABEA 1O2LA 2QC2A 5AVDA 1PQAA 2A5AA 3A80A 1IQFA 2M5TA 1IQHA 2BDCA 1TNIA 4NIXA 1UCYH 2HALA 5DO4H 2PW8H 3QTVH 2QN5T 4HGCA 1FUJA 5EPNA 3LH1A 1TGCA 2FOAA 3LH3A 4X2XA 4X1QU 6LPRA 3NUMA 4ZKRU 2R0LA 2H9HA 4X2YA 4ZKOU 2Z7FE 6CHAC 4SGAE 1AZ8A 1THPB 1X7AC 2GMTB 5E8EH 2ZDLA 3SBKA 3LGWA 3FP6E 4O03A 4YTAA 4D8NA 1LMWB 1O3JA 1H1BA 4BTIB 3VEQB 1W8BH 3STIA 1ESBA 1PQ5A 3U8RH 4DIHH 1TA6A 1ELGA 2BDYA 3UOUA 4AG1A 2F9UA 1K28D 1SGQE 2FOFA 2XW9A 3MH4A 3A7VA 4Q2KA 1ZZZA 2JH0D 2A2XH 5A0AE 1O2SA 1GI1A 1SR5C 2A2QH 1KDQA 2W3IA 4I8JA 1C2FA 1RFNA 1Q3XA 1WU1A 3RLWH 1TGSZ 3T26A 3GOVB 2ZDKA 4U30A 4CR9A 4CBNA 6GCHF 3M5NA 1OS8A 2TGTA 4H4FA 2GMTC 3MU5A 1D6WA 1FPCH 2ZU2A 1GMDF 4UFGH 4B75A 2V6NA 2BTCE 4I32A 1EAWA 2PTCE 3Q76A 1E36B 1OYTH 4A1XA 3P95A 3GY3A 4OS6A 3ZZCA 1EATA 3QN7A 2FESH 2FS8A 3RXVA 1G36A 1G9IE 2XBWA 4J1YA 1SFIA 2FP7B 1O2YA 1SGFG 2ODPA 1Z8RA 2QXGA 3ELAH 2R0KA 4D7GA 5C2ZA 2A45B 2VVVA 1HNEE 4AX9H 1SLVB 2V35A 2GZ7A 3H5CB 1C5PA 3T62A 2TIOA 4RN6A 3SNAA 1A61H 3QTOH 1ZYOA 3MI4A 3ATMA 2G52A 1V2JT 3LJOA 1SLUB 3MOCA 4MVNA 2ZGBH 3LU9B 2C8ZB 1AVXA 3P8FA 3GYMA 2ZIQH 1T8OA 4X1PU 4I8HA 4XFQA 2ZU1A 3RC5A 5GCHF 4B1TA 3A84A 1KTSB 4OS5A 4FUIA 1GL1A 4ISOA 1HAHH 4KGAA 4H6SB 2UUKB 3MNCA 1S84A 3EYDA 4U2WA 4AGKA 3T2NA 2J38A 2A7JA 3AW1A 4XSKU 1DWDH 2PKSB 1UVPA 1CQQA 5A2MH 1OP2A 1V6DA 5FBIA 1SGPE 1F0TA 1O2PA 5T6FA 1BMNH 2ZC9H 1J15A 5C1YA 3OYPA 1O3GA 2UWLA 5A0BA 2ZWLH 2P16A 1NRRH 2HNTF 1XM1A 3A86A 1TBRH 4Y71A 1GGDB 1DT2A 1PPCE 1FN6A 1PPFE 3GDUA 3M7UA 1C5XB 3GY5A 4KP0A 1T7CA 3M61U 4NIWA 4Q7YA 9ESTA 1F92A 1A3EH 3ZVAA 1P2OA 2F9VA 3SW2B 1YP9A 1OKXA 2Y5GA 1VJAU 1S5SA 1GJ4H 1WYKA 3CENA 1C1MA 5FX6A 3AAVA 5K0HA 2C8WB 2GDEH 1SGYE 2STAE 2PKSC 1O38A 2J95A 1F0UA 3OU0A 3PV4A 2C90B 3N7OA 4WXIA 1LHDH 2PHBA 4K60A 2FYRA 2FO9A 1GI2A 1O3IA 2BXTH 1EQ9A 4YLUA 2YNBA 3F6UH 1V2KT 4WH6A 1O3KA 1GGDC 1VZQH 2CXVA 2VNTA 3Q3XA 1YYY1 4GCHG 1YPGH 2FXRA 3E6PH 3ZVCA 1O2XA 2OCVB 5CE1A 1NM6A 1EX3A 1HBTH 1CSOE 3ITIA 4IC6A 3R3GB 2ZCHP 1KIGH 4RSPA 1Y3UA 2A1DB 4CBOA 3PROA 2ZU5A 3STJA 2TPIZ 3F9EA 1QGFA 1B0EA 2C8XB 4MLFB 1A5HA 1JWTA 1TB6H 3SGQE 3Q3YA 2BD4A 2SGEE 1LPKB 3RU4T 1IHTH 1WQVH 4MQAA 4AB9A 2Q6GA 3SU0A 1BITA 1GG6B 5AF9H 2AMPA 2NU2E 5EXNA 1TX7A 3GCTF 4FXGH 1O5FH 4MNXA 3ZZBA 1BT7A 1FQ3A 3MO3A 4Y0ZE 1THRH 4AB8A 2SGQE 1H4WA 1K1OA 1DUAA 1FJSA 1BDAA 1GHBF 2XC5A 3A83A 2WPKS 1GBBA 1GJBB 4BAQB 1GBCA 2FX6A 4GLYA 1G32B 3UWJH 1UTLM 3QZRA 3KEEA 1D9IA 2JH5D 2O8MA 3E0NB 2ANKH 1NRNH 4NFEA 2XCNA 3M35A 1AWFH 2OD3B 4K8YA 2GZ8A 2WPJS 3L33A 1C1PA 1GG6C 2THFB 1UTOA 1IQMA 1P2NA 3LOXA 1L1NA 1IHSH 1GCTB 4IS5A 2G5VA 3FP8E 1W13U 2HNTC 3BEUA 2DE8A 5BRRE 1HCGA 1TWXB 3VXEH 1YCPK 4UFDH 1ZSJA 1ELFA 1WAYB 2V3OH 1ARBA 1EP5A 2G5NA 1O2KA 4X6PA 2AFQB 2B8OH 1LVBA 4LZ4B 1ID5H 5A8ZA 4TPIZ 1EB2A 4Y6DA 4YT7H 3SUEA 1UTQA 1GJ9B 1K1LA 1CT4E 1AGJA 1G3CA 1LVYA 5JBCS 1NRQH 1QB9A 1WQSA 3A81A 2BY9X 4IMZA 2XC4A 1GCTC 1BHXF 1WUNH 3OTJE 3MTYA 1DXWA 2KAIA 3TJOA 1V2PT 1NN6A 1TMUH 5DGJA 1AIXH 2W7UA 3Q00A 4DJZB 2ZP0H 3SNEA 4OGYA 1IQLA 5AHGH 2OC1A 1C4U2 1KXBA 3UIRA 5GWZA 3BG4C 5SGAE 1EZXC 1BTUA 1O35A 1QBNA 2FM2A 2UWOA 2J34A 2GGVB 1UCYK 4NA7A 4AZ2B 2ZO3H 5E2OA 1DOJA 1MBQA 1O3MA 1W11U 2G55A 2BX4A 4O3UA 2ZGCA 1GJ6A 1GBIA 3TGJE 1L4ZA 5EGMA 3SQHE 2ZQ1A 4YOIA 3RXKA 2HGTH 3L6PA 1YPKH 1LHEH 2AS9A 1C5OH 3MH5A 1TNGA 4BNRA 2A7CA 4B74A 1KXAA 1A5GH 1ETTH 1C5NH 2C4FH 1GHAG 4DY7B 4K69A 1YPLH 1C9TA 2Y6TA 3TH2H 4AFQA 1H9IE 1ZTLA 1A0JA 2SNWA 5J4QA 1NESE 3U1IB 3IG6B 1BZXE 3KN2A 1TRYA 1G30B 3KQCA 3GY7A 1ZOMA 1CGIE 5DK1A 5A09A 3D23A 3UY9A 1FAXA 1QURH 3LDXH 2G81E 3GDVA 4ISLA 4ZROA 2G4TA 1QA0A 5FXLA 4B2AA 1VR1H 1TRMA 3P17H 2BDIA 4XOJA 1T4VH 1NTPA 1RTKA 1UK4A 4BXWA 2PLXA 2BVRH 4ZHMU 2BD9A 1XUIA 2XYAA 3V0XA 4DURA 1HYLA 4WY3A 1YLDA 1C5QA 1A0HB 2Y5FA 3F9GA 2FLBH 2ZNKH 1ANDA 3OY6U 1PJPA 3RMOH 1V2UT 1GDUA 3TK9A 1TX8A 3PWCA 3BTTE 1HIAB 1S0RA 1VGCB 4KELA 5GJ4B 1TONA 1HAVA 2OC8A 2BY5X 2CV3A 2O8TA 1O2ZA 3IITA 2TGPZ 2EC9H 2SGFE 5JB9S 1O5AB 5FAHA 1UO6A 3A7XA 4X8TH 1MTSA 5ESBA 1V2QT 3EQ0H 2IPHA 3GY2A 1MAXA 3RXTA 5IDKA 2BLWA 2ULLA 3E1XB 3PLBA 1SI5H 1GVZA 4UE7H 2PGQB 3QGNB 1P2QA 4F4OC 8GCHF 1D6RA 1L4DA 1AHTH 1JIRA 3A89A 1V2WT 4HFPB 1DLKB 2BD8A 1CA0B 2A4GA 3MO9A 4LOYH 1VGCC 3BTKE 2AGEX 2XWBI 3RU4D 3KL6A 1P2MA 4Y76A 2ZHQH 3ZYDA 1HAGE 1SQOA 4O97A 3E3TA 1SMFE 4MTBA 5EOKA 1SHHB 4KTCA 2Y80A 1MTNB 3ZVEA 5L30H 5ABWA 1GVKB 4YOGA 3SU3A 3LONA 2IN2A 3P8OA 1RGQA 3DUXH 2Z9GA 1G3BA 4OS4A 1RS0A 3MU1A 5T6GA 4I31A 2ANYA 2FWWA 2BMGB 5HXFA 1QRXA 3QDZB 2SGPE 2ZFTA 2K1QA 1IAUA 2VH6A 2ZECA 1TOMH 4UFFH 1LVMA 1CA0C 2AYWA 1SBWA 2F91A 4Z0KA 3A7ZA 3TH3H 1C2HA 3NZIA 4CRFA 3PMBB 1AFQB 3TJNA 3ZV8A 2P59A 3H7TA 2ZHFH 2UUYA 5CMXH 4FU7A 1LVOA 2H9TH 4JCNA 4AFUA 3DD2H 1GBKA 3BIUH 1UVOA 5FPYA 1MTNC 3M7QA 1ELEE 1ELCA 1QA7A 3Q77A 3HGNA 1BTZA 2AGIX 2PSYA 2ZPRA 2OXSA 2BXUH 1C2GA 2ZEBA 2F9PA 1YCPM 2GZ9A 3SNBA 1YPHC 2BD2A 1AFQC 2BB4A 2D1JA 4ZH8A 3V13A 1ZRKA 4DOQA 1UK2A 3SU4A 3SN8A 1NY22 1FXYA 2ZDMA 1TQ7B 2FI3E 1ESTA 3SU1A 1OWDA 4K1EA 2VGCB 2HOBA 4Z6AH 4ZAEA 5C20A 1Z8IB 1ZPZA 1C2LA 1OOKB 2Y82A 1ZPCA 1O2GH 1GBJA 4CRCA 1QQUA 1GBDA 1SHYA 4DT7B 2WV5A 1GI5A 1XXFA 4Y7AA 5FBEA 4PROA 1T8LA 1UTPA 2AH4X 1BTYA 1MKXH 3KCGH 3SZNA 5C1XA 4I7YH 3S9AA 2ZQ2A 3K9XB 1GMHG 3D62A 4X1NU 3VB6A 3LKWA 4U01A 1AZZA 5E0JA 1TPPA 3BIVH 1MTVA 1AY6H 1GJAB 2VGCC 1TE0A 4IN2A 4NWKA 3UUZA 4AORA 5LGOA 3ENSB 1EB1H 5LPEA 1BTXA 2QGRA 1BQYA 3M37A 3O8CA 4ZXXH 4IC5A 1UCYE 2OBOA 1FDPA 1S0QA 1TRNA 1DSTA 1MZAA 1TABE 2EI8A 3LIWA 2FOEA 5DP7A 3UTUH 1GHAF 5A8XA 1EJNA 2AERH 1JIMA 2O8WA 1NFXA 1EOJA 2TGDA 4X8SH 3A7TA 5I25A 1C5UA 1ZGIA 2D8WA 5F03A 3RDZA 2YOLA 2GCHG 2AMQA 3DT0H 4MPXA 2ZHDA 1TQ0B 2CF8H 1MAYA 3K6ZA 2G4UA 1FV9A 1GI8B 2LPRA 1E38B 1Z7KA 4CRAA 3UWIA 1O37A 3DA9B 2GDDA 1SL3A 2XRCA 2WUBA 3SI3H 3O8BA 2Q6DA 1LPGB 1IQEA 3BEFB 4GHQA 4TYDA 2YNAA 2QIQA 1XVOA 1DY8A 1AVGH 5C1UA 1Q2WA 3ZV9A 1AE5A 3T28A 2XWAA 1ARCA 2WPLS 4AN7A 4A1VA 1BJVA 3TGKE 2QF0A 1OWIA 1VCQA 1P3CA 1AKSB 2PGBB 4D9QA 4FUCA 3SNDA 5HMAA 4DCDA 1HLTH 4LZ1H 1XUFA 1O31A 3Q3KA 4ABHA 4WJG2 1KLIH 1J9CH 1AWHB 1ZSLA 3S7KB 1C1RA 1JMOH 1UMAH 1C5VA 4B2CA 3LGTA 1VITG 1A4WH 3R0FA 3ZYEA 4XBBA 4NCYA 1QBVH 2QF3A 3ESTA 3F9FA 5HYOA 4JZDH 1ZGVA 2HVXA 4GAWA 4LK4A 1G2MA 1SLXB 4IBLH 4KTUA 3A7WA 3S9CA 2R2MB 1HPGA 2GCTB 8KME2 3CP7A 3RXUA 4AYVB 1C5WB 4ISNA 1OWKA 1SGNE 4Y10E 1ZHMA 2P93A 1ETSH 2ZCKP 1PFXC 2XXLA
chains in the Genus database with same CATH superfamily
2ZF0H 1BRBE 5AFZH 1CBWB 3EA8A 3MWIU 1NBME 4IMQA 1Y8TA 5EG4A 1ACBE 1FIWA 1Z6EA 1P06A 4BOHA 2H9EH 1Z8JB 2ZDVH 2J92A 4TWYA 2WPHS 3RUOA 5DPAA 1DWBH 1HAYB 3SUDA 3SUFA 1C5MD 3RXHA 3KF2A 5B6LA 3A8AA 3KNXA 3GCNA 3LC3A 3SUGA 1ANCA 2GCTC 4MDSA 1WTHD 1OPHB 1L0ZA 1S82A 2H6MA 4BANB 3F3BA 4WXVA 1C1WH 3MU4A 1GI4A 2ZU4A 4GSOA 3RMNH 1XUKA 1AFEH 2O9QA 4YT6H 4YZUA 5LPRA 3M3SA 1ZPBA 1CBWC 3A82A 1P04A 3H09A 5C94A 1IQKA 1O2OA 3MYWA 2ALPA 3N99A 3OSYA 4JZIA 1TAWA 4Q80A 1W0JD 2WYJA 1T31A 1EZQA 4A5TS 1VCPA 1YPHE 3FZDA 1PPBH 2OLGA 1PPZA 5F8XA 1O34A 1HAPH 2R3UA 7ESTE 3E90B 3E91A 2PR3A 3BEIB 3BTWE 2YMSB 4CRBA 2UUJB 2BLOA 4WMEA 1DWCH 3KHVA 1MMJN 1BUIA 3T27A 2Z9KA 3F1SB 1T8MA 1O3FA 3BSQA 3FN8A 1SVPA 4F49A 1B5GH 1HAOH 4X6OA 4ABFA 3F0OA 2V0BA 2AEIH 1XKBC 5E0GA 1JBUH 2BVXH 2Z9LA 1F0RA 2GT7A 2O8UA 3RXDA 3HKJB 3QLPH 1TMTH 1KXDA 2QAAA 2JJ1D 4E06H 3GY6A 1GMHF 1C5YB 1YPMH 3RU4E 1N6YA 4KKDA 4AYYB 3P8NA 3C1KA 1ZJKA 1HAIH 4X6NA 1ELTA 1YM0A 3GS9A 3TIUA 1PPHE 1QCPA 4ZHAA 4Y8YA 1O2WA 2P95A 3BTQE 5TCCA 4DVAU 2KZ4A 5HM2A 1B7XB 2VIQA 1O33A 3VXFH 4FU9A 4M7GA 2F4LA 4I8KA 1HIAA 1TBZH 4E7RG 1E1QD 3PMAB 4RT1A 2QXHA 1SGFA 4IN1A 1O5CB 3M36A 4A7IB 4ABBA 1HXFH 2VWMA 3RXEA 3GCHB 2FPZA 1DM4B 1TX6A 4H6TA 5LPFA 1UK3A 3KIDU 5EJZA 4K5ZA 4ACBA 3ZZ9A 2GTBA 3TU7H 1EPTB 5KECA 1ZMLA 5F8ZA 2FDAA 1RD3B 1FI8A 1DVAH 1VKYA 1UTMA 3KQ5A 3PMHB 2NU4E 1O2HA 3I78A 4YM9A 1LQDB 4K3JA 3MNBA 1GCDA 1XUJA 1O3CA 3FANA 1C1NA 3P8GA 1Y3WA 1IOEA 5J4SA 4ACAA 2Y7XA 3MFJA 5CDFE 3GCHC 3TJVA 4INKA 5EXMA 2JDID 1SGTA 4JMYA 1BIOA 1XKAC 1UVUH 1EPTC 1XX9A 3EAJA 1ZTKA 2BZAA 3FP7E 1P09A 2A5KA 4Y8XA 3T5FH 3NXPA 3ZVFA 1HAZB 1BTHH 1Z1IA 1YGCH 2L6OA 2ZGXH 1V3XA 4FUDA 1GBEA 1A3BH 1J17T 2Z3EA 2OUAA 3OE7D 1Z8GA 4JYVH 3RC6A 4BTTB 1CHOG 4CREA 5EXLA 4JK5A 1O5GH 1TNHA 2JKHA 1OP8A 4R8TB 3A88A 1EAXA 1BRUP 1FONA 3ZZ3A 2CF9H 1C4V2 1O0DH 4I8LA 1ORFA 1P12E 3G01A 1GL0E 3NPSA 1FY8E 3B23B 3HKIB 5I46H 3DSGA 3ATKA 1QIXB 1SSXA 7LPRA 1GMCG 1AD8H 1MQ6A 2PUQH 2A5IA 2BHGA 5EQSA 2Y5HA 2QF4A 2DUCA 1ZMJA 4VGCB 4KTSA 1FPHH 2Z6BD 1K22H 1P02A 3SV8A 3QUMP 1AB9B 1F5KU 1BJUA 2XC0A 1A1RA 2CHAB 1P10A 3ATLA 3SYJA 3SQEE 1TGTA 3L3TA 1QB6A 1HRTH 1KXEA 1NROH 1SOTA 2FIRH 2QYIA 1MH0A 2Z94A 3TK5A 1QL8A 2ZTYA 5LH8A 1DWEH 1D3PB 2FMJA 2UUFB 2VWOA 3SJ9A 4AOQA 4VGCC 4MPWA 3PLPA 1A0LA 4RI0A 3FAOA 1ABIH 2ZFRH 5GPIB 3PB1E 3SU6A 3ZZ4A 4YESB 3WWBA 5BPEA 1AB9C 2ZFSA 3BTEE 5JBAS 1ZHRA 1QY6A 3RXGA 3CS7A 1Y3YA 2CHAC 1DX5M 2ANMH 1MQ5A 2WINI 3TNTA 3U98H 1G3DA 3URCA 4FUBA 4AC9A 2XBXA 1C1VH 1BRAA 3S69A 5T6DA 3S9BA 2JETB 2K0QA 1OXGA 1ZJDA 1LPZB 3ATWA 1AN1E 3IWMA 4DW2U 3ZZDA 5DP9A 1P2IA 4TSFD 1N1LA 3T29A 5EIYA 2KM0A 4ABDA 3DHKH 1GVLA 4J2YB 4FUEA 2ZFQH 4GCHF 1QZ8A 2J5UA 4JYUH 4K2YA 4A1TA 2ODYB 4UONA 4JZ1A 2BM2A 4XBCA 4GVUA 6GCHG 4CR5A 1QNJA 2Y81A 2SFAA 3ZZ6A 1HUTH 4NA8A 1DPOA 2G00A 4FUJA 1WXRA 2CN0H 1GMDG 2W26A 3ZZ5A 1K1MA 3RXRA 5FCKA 4Q63A 1AVWA 2GD4B 3SHAH 2JETC 2JIZD 1C1SA 1M9UA 1ELVA 4AGJA 3BN9A 4TY7A 3MNSA 5EQQA 3DCLA 2XTTB 4CHAB 2V7QD 3TPIZ 1K1IA 1C5LH 3RC4A 1IQJA 1KSNA 1L2EA 1V2TT 2ZHWH 4FUHA 4K1SA 1QFKH 4K1TA 4BAHB 1O3OA 1O3HA 1GBLA 3A8DA 4NIYA 1TNLA 5G4BA 2I6QA 1AKSA 3VB3A 1U6QA 1N8OB 2VWNA 3O8RA 4ASHA 3U8OH 2ZI2H 2EI7A 2WUCA 1MKWH 3D49H 4TY6A 1C5RA 3RM2H 3SU2A 1UTNA 1O39A 4NGAH 2QXIA 3KQEA 4CHAC 4NFFA 3A8BA 2IJOB 3ODDA 2B5TB 4FVBA 5DN6D 1O2IA 2VB0A 1W3CA 3PTBA 5E0HA 1CU1A 1XUGA 5FPSA 1FY5A 1MCVA 2HNTE 2HLCA 3RXIA 3HK3B 2FZZA 4CH2B 2G8TA 4ESTE 1AO5A 2FX4A 1S85A 3QK1A 1GDNA 3H7OA 1W2KH 5DP8A 1Y3VA 1N8OC 5JDUB 1C1OA 1QL7A 3GISB 3UNRA 3MNXA 2WV4A 2ZA5A 2ODQA 3P70B 5C5NA 4Y79A 3RMLH 3UQOA 2BDGA 1C2EA 2GP9B 1RIWB 2A4QA 2PKAB 2TBSA 2Y7ZA 2BYAX 1AQ7A 2Z3CA 1CGHA 1DITH 1CHGA 1J14A 2OC0A 2GV7A 2WSSD 1GJ5H 4DG4A 1OWHA 2ZPQA 1KTTB 1ELDE 2IPQX 4WWYA 5EPYA 1W0ZU 1GJCB 5FPTA 2VVCA 5FL7D 3I29A 1GI0A 1O36A 1E0FD 1V2NT 1Z6JH 2ZZUH 2QF5A 4JZFH 1SGEE 1WTGH 3EDXB 1C5SA 2O8LA 1H8DH 3UR9A 4BAKB 1PQ7A 1O3BA 2BY6X 1HV7A 1GMCF 2GVFA 2Z9IA 4OGXA 1DXPA 2TGAA 4INLA 1CGJE 2BOKA 2BQ6B 2ZTZA 1RIWC 2EI6A 2L74A 1P8VC 2HPQH 1VCWA 1FZZA 3VFEA 1AE8H 5H4IB 1F5LA 3M5OA 3MU0A 4NZLA 2HWLB 1BCUH 1SQTA 1J16A 1WSSH 4FVDA 3I77A 1HJAB 3VB4A 1V2LT 4GHTA 2G51A 2EEKA 2R3YA 2RDEA 2W3KA 1EKBB 5DP5A 1OYQA 2H1UA 2ZDAH 1V2ST 3W94A 4ABJA 1NS3A 4FU8A 3D65E 4FUFA 1EXFA 3AW0A 3SOSA 3S0NA 1LHFH 2WYGA 4BAMB 1WDIA 2DE9A 3TK6A 1W12U 4Q7XA 5T3HA 3TJUA 1JOUB 3FOAA 2A32A 1ZMNA 1CT2E 4UD9H 4D7FA 1GHBG 2J98B 1JRSA 1NU7B 1GHYH 1S81A 1MU8B 1BBRH 1G37A 1C1UH 1ZR0A 4Y11E 2VWLA 1Z71A 1Q31A 1QHRB 4INHA 5TJXA 2FOMB 2H2ZA 2PFEA 1MCTA 3BTME 1ELAA 3RM0H 2BZ6H 1GJ7B 1D3QB 1TPAE 4WMDA 1F2SE 1HJAC 2ZGJA 4WVPE 1DS2E 5DG6A 3LGUA 2ZPSA 3F2HA 2VIDA 2VU8E 3SJOA 5A0CA 4FOUC 1FAKH 3ODFA 1PPEE 4B76A 3OX7U 2OP9A 1PYTC 1RTFB 3NK8A 1T4UH 1K21H 1TPSA 5EQRA 2BY7X 2IOTA 4O9VA 2FOHA 2ANWA 1IQNA 2EA3A 2HPPH 3U28C 1A7SA 1P01A 1WBGB 1GI3A 3BTHE 3PLKA 4YOJA 3PO1B 1ABJH 1QRZA 3AASA 1OWEA 1Y59T 1YWUA 1O3PB 2OC7A 2AMDA 4MPUA 1CVWH 1GHXH 1A5IA 4DT4A 2J4IA 1MZDA 3O8DA 1EPTA 2C93B 3UNQA 3V12A 3SU5A 5GDSH 1KXCA 1H9HE 4XDEA 4FUGA 2P3TB 1GBTA 1O5DH 2M2AA 2KCAA 4YO9A 2BD7A 1MD8A 1YKTA 1V2RT 1TNKA 1DDJA 1TFXA 3VGCB 3TGIE 1FY4A 1YPJH 1GBAA 2CGAA 3BV9B 4ZXYH 2YMSD 4D76A 2J94A 1VITH 1GI6A 1SOZA 3SGBE 3PO1C 1SC8U 3HGPA 3RXFA 3QO6A 2RG3A 3ZZ7A 3ZVBA 1C2KA 4WH8A 3SJKA 1GHWH 2I6SA 1MTUA 1NRPH 4DIIH 2A7HA 5GXPA 2PV9B 4D9RA 1NFYA 3VB5A 4IW4E 3NCLA 1TGBA 2F9NA 2BQWB 2B9LA 1XVMA 4H42U 4QT8C 1EAIA 4I86A 1HGTH 1CA8B 4ZHLU 3E0PB 1NU9A 3A7YA 1COWD 4X1SU 5EODA 4NA9H 3A8CA 2NU0E 3RXJA 2AGGX 1UHBB 1UVSH 3VGCC 1D4PB 2KCPA 1Z1JA 2ZDNA 3SJ8A 5PTPA 1O30A 1XMNB 2NWNA 4P02A 1SGDE 5L2YH 1K2I1 3OAAD 4U32A 4GPGA 2J9NA 4AFSA 4BTUB 3CNRA 2OK5A 1SGCA 3U8TH 3PWBA 3E8LA 4F55A 1D3DB 3U9AH 1GI7B 1EZSC 1O2JA 1SPJA 5EJLA 4ZCNA 3GICB 2F9BH 1AUTC 1AU8A 3M5MA 1QTFA 2BDAA 1DANH 5GNDA 1P9UA 2Q1JA 1FY3A 1P9SA 1ZSKA 4HG6A 1O3DA 1JXPA 1EASA 1SGIB 1YY3A 3AVZA 1ZRBA 1VJ9U 3UQVA 2VIOA 3MHWU 3UOPA 1EFRD 3URDA 3V7TA 1QJ1B 1TYNA 3QX5H 1QRWA 1CT0E 1O3AA 4I33A 3SV9A 2BOHB 1HB0B 4K8BA 1WV7H 5DJ7A 1C2IA 3OEHD 4XE4A 1EZUC 5T1VA 1L1JA 2XBVA 1J8AA 4TPYA 3S7HB 1S6HA 3E16B 1LHCH 3QGJA 1W7XH 5DP3A 3RXOA 4AFZA 4IGDA 3A85A 2ASUB 2VIVA 4B71A 2FTMA 1H9LB 1XUHA 3FO8D 1GI9B 2F3CE 1GDQA 6ESTA 7KMEH 3KQDA 2FI4E 1TOCB 1DE7H 4UEHH 1OP0A 4SGBE 3UPEA 1TALA 1E34B 2BD5A 3HPTB 2F83A 5FCRA 4XD7D 4WF8A 3DSOA 2B0FA 4E05H 3HK6B 3RLYH 5EU8A 1BA8B 1O2NA 3SORA 2XCFA 2YMSC 1MKWK 2VIPA 5F8TA 1WCZA 2ZKSA 3RXBA 4Z1MD 3A87A 8GCHG 1DLEA 3P92A 4Y0YE 4X2WA 7GCHG 1BRCE 2SNVA 3MH6A 3F9HA 1HJ8A 1NT1A 4NIVA 3TNSA 3TVJB 1SQRA 1W14U 5DP6A 1C2DA 2FOBA 1TGNA 3RXLA 1B0FA 3RXMA 3RXCA 3DFJA 3ZVDA 1FN8A 3LGIA 3OEED 5GIBA 5JBBS 3U69H 1KDQB 2SGDE 4X8VH 1SFQB 1OSSA 3NWUA 4UDWH 1LHGH 5HIZA 2VINA 2GCHF 1F5RA 2ZFFH 2R9PA 3RXAA 1NFUA 4OM9A 5DKMA 2A31A 4M9FA 5E2PA 2H5DA 3ATIA 3KGPA 5IK2D 4WMFA 2QY0B 1EOLA 1YBWA 4DGJA 1DUEA 1TPOA 1O32A 3F2FA 2FODA 1P3EA 1O2UA 1ANBA 2ALVA 3N7EA 1CO7E 2J2UA 1MD7A 3VPKA 1P2JA 1LKAA 4MNYA 2BVSH 3GY4A 4ABIA 3BF6H 3BTGE 1LDTT 2FS9A 1H8IH 2BY8X 2J97A 2LNCA 4NSYA 1TMBH 5HGGA 1E35B 1W0YH 1MKXK 3LT3A 1YF4A 3BG8A 1P0SH 2WV9A 3MMGA 2PTNA 3TH4H 3GDSA 5EJ1A 2OQUA 3NKKA 1V2MT 2C8YB 4Q7ZA 1UJ1A 5ETXA 3NRLA 1QB1A 3BG4B 4HZHA 2ILNA 3F68H 8ESTE 4B2BA 4MG3A 4NG9H 1GWAA 5JBTA 3EGKH 3PTNA 1THSH 2WHXA 1SKYE 4BXSA 3UR6A 1P57B 1KMHB 1VITF 1H8ED 1MTWA 1O2TA 5HKKD 1V2VT 4Y7BA 3GYLB 1C4Y2 3OTPA 3EE7A 4LXBH 3KQBA 1HFDA 3RP2A 1V2OT 1NPMA 4OS2A 3LC5A 2Z3DA 2ZG0H 3RXPA 3SGAE 3EE0B 4E7NA 1RJXB 2ZHEH 3P6ZB 1FLEE 1LKBA 1WOFA 3M5LA 1O2VA 2BLVA 3LJJA 3T25A 2CJIA 1O2QA 3GY8A 1ESAA 4OS7A 1RTLA 5FX5A 3SJIA 1O3NA 1BBRK 1E37B 1HJ9A 4NWLA 1JRTA 5C3NA 1QQ4A 3ZZAA 1EP6A 2XOKD 5FHTA 2TRMA 3SV2H 4CRDA 1P05A 2PKAA 2VH0A 4Y8ZA 1D3TB 3KYGA 3FVFB 1A46H 1INCA 1DFPA 4MNVA 4O3TA 3UFAA 3KYFA 2FYQA 1QL9A 1TLDA 2OINA 1P11E 3VB7A 1O2RA 1BMLA 5F6MA 1C9PA 2W5EA 2GKVE 3PYHA 3ZZ8A 1FNIA 1GHVH 1TBQH 4X6MA 4B6EA 2VVUA 4X2VA 3SV6A 2F9OA 1MUEB 1HXEH 1ZTJA 1EUFA 2PUXB 2STBE 1YC0A 3WY8A 3BTFE 3HATH 3SV7A 1BTPA 1KXFA 1UVTH 3V3MA 1DICA 3PRDA 2Q6FA 1W10U 3QZQA 1ZHPA 1C1TA 2K8IA 1DSUA 1C2JA 1K1NA 5L6NH 3M3TA 2W7SA 5L2ZH 4ZUHA 1YPEH 5B6OA 1A2CH 1BHXB 1UTKA 1W7GH 1C2MA 2GX4A 3MO6A 2OBQA 3B8JA 1NC6A 3C27B 3UREA 1KYNA 1Y5UT 2QXJA 1BMAA 4ZKNU 4A92A 1SG8B 4RKJB 2BX3A 1O3LA 3K6YA 1SLWB 1P03A 2P3FH 4ABAA 1BB0B 1TIOA 2D2DA 3PM3A 1L1GA 1TA2A 1LO6A 1GBHA 1HDTH 5JPMH 2RDLA 1S6FA 1Y3XA 3EA7A 1BOQA 2BDHA 2J98A 3FKSD 1EJAA 3SO3A 3CS0A 3WWFA 1AUJA 3OY5U 3B9FH 2D26C 1Y5BT 3M7TA 4RT0A 2QCYA 5EW1H 1NFWA 1C5ZB 3F2GA 3LGYA 1YLCA 3ZVGA 2FI5E 4B73A 4JZEH 9LPRA 1CE5A 7GCHF 5HM9A 3K65B 4XBDA 1NRSH 5C5OA 1QR3E 5C0TA 2P3UB 4TWWA 3SI4H 1GJDB 4NSVA 2ZCLP 1PPGE 1LTOA 1SB1H 2C3SA 4UFEH 1E1RD 1FIZA 1GBFA 2OTVA 3BTDE 5CHAB 1PQ8A 3LGVA 2KFWA 3RXSA 5AFYH 1K1JA 1DY9A 1O2MA 2PWXA 1QBOA 1GHZA 2XNDD 4X0WU 4X8UH 8LPRA 5EW2H 1G3EA 1LQEA 4ZMAH 1OWJA 1E79D 1T32A 2H5CA 1GJ8B 4JYTA 2P8OB 1O3EA 3SHCH 3GCOA 1LCYA 3EA9A 3LPRA 1MBMA 1QJ6B 2BLQA 5GCHG 2NU3E 3PMJA 4THNH 1K1PA 4NZQA 4RKOB 1XXDA 4OS1A 3UAIC 4YLQH 2KAIB 2GV6A 4CRGA 1ETRH 2R2WU 2VJ1A 2XBYA 1IQGA 2XNIA 3DFLA 1C1QA 5IYTA 5CHAC 2ZU3A 1NZQH 4ISIH 4HTCH 1ANEA 2BDBA 1N6XA 1PYTD 4JK6A 1P2KA 1BTWA 2UWPA 3RXQA 5JB8S 3M3VA 2WPMS 3MH7A 1EAUA 3FZZA 2FTLE 1IQIA 3UNSA 3WW7A 1ELBA 2P8OC 4R0IA 1ZLRA 2GT8A 2BQ7B 5K7RA 1RRKA 2SGAA 2HVYB 1TNJA 2BD3A 1SQAA 2VIWA 1O5BB 3U1JB 2FOGA 3FFGA 1UTJA 1CHOF 1QJ7B 3SNCA 3PRBA 4MPVA 1KY9A 2CK3D 2FLRH 1EJMA 5A8YA 2PSXA 4GUXA 2ZFPH 1FMGA 2ZTXA 1UHBA 3W95A 1KLJH 2HRVA 3JZ2B 2ESTE 2QA9E 4BAOB 2KCOA 2FEQH 2WPIS 3K2UA 3QWCH 5C0UA 1GPZA 4ABGA 1F0SA 5DP4A 2HLDD 5C67A 1OX1A 4P00A 2IJD1 1O5EH 5HIYA 2FOCA 1SGRE 1YCPH 4ZKSU 2JH6D 1NO9H 3TLOA 1G2LA 2A4RA 1MU6B 2W6JD 3MU8A 5TCAA 1KLTA 1AI8H 2ZGHA 1GBMA 2RCEA 5ESTE 4I8GA 2RA3A 2AIQA 1F7ZA 4ISHH 4HI3A 2A0QB 2OQ5A 4AG2A 2CMYA 1Y5AT 2NU1E 1K9OE 5JYIA 4MNWA 1FY1A 3SZEA 4CH8B 2A4OA 2B7DH 6CHAB 4A6LA 1AMHA 2Z9JA 3TITA 4X1RU 1HAVB 2AIPA 2QV1A 1S83A 3GCTG 2P94A 2RA0A 1HAXB 3AAUA 1C5TA 1T8NA 3JZ1B 3RMMH 1RXPA 1BBRE 1BMMH 2V3HH 4ABEA 1O2LA 2QC2A 5AVDA 1PQAA 2A5AA 3A80A 1IQFA 1IQHA 2BDCA 2M5TA 1TNIA 4NIXA 1UCYH 2HALA 5DO4H 2PW8H 3QTVH 2QN5T 4HGCA 1FUJA 5EPNA 2VBCA 3LH1A 1TGCA 2FOAA 3LH3A 4X2XA 4X1QU 6LPRA 3NUMA 4ZKRU 2R0LA 2H9HA 4X2YA 4ZKOU 2Z7FE 6CHAC 4SGAE 1AZ8A 1THPB 1X7AC 2GMTB 5E8EH 2ZDLA 3SBKA 3LGWA 3FP6E 4O03A 4YTAA 4D8NA 1LMWB 1O3JA 1H1BA 4BTIB 3VEQB 1W8BH 3STIA 1ESBA 1PQ5A 3U8RH 4DIHH 3VG8A 1TA6A 1ELGA 2BDYA 3UOUA 4AG1A 3DSPA 2F9UA 1K28D 1SGQE 2FOFA 2XW9A 3MH4A 3A7VA 4Q2KA 1ZZZA 2JH0D 3F0PA 2A2XH 5A0AE 1O2SA 1GI1A 1SR5C 2A2QH 1KDQA 2W3IA 4I8JA 1C2FA 1RFNA 1Q3XA 1WU1A 3RLWH 1TGSZ 3T26A 3GOVB 3UB0A 2ZDKA 4U30A 4CR9A 4CBNA 1UW7A 6GCHF 3M5NA 1OS8A 2TGTA 4H4FA 2GMTC 2WZQA 3MU5A 1D6WA 1FPCH 2ZU2A 1GMDF 4UFGH 4B75A 2V6NA 2BTCE 4I32A 1EAWA 2PTCE 3Q76A 1E36B 1OYTH 4A1XA 3P95A 3GY3A 4OS6A 3ZZCA 1EATA 3QN7A 2FESH 2FS8A 3RXVA 1G36A 1G9IE 2XBWA 4J1YA 1SFIA 2FP7B 1O2YA 1SGFG 2ODPA 1Z8RA 2QXGA 3ELAH 2R0KA 4D7GA 5C2ZA 2A45B 2VVVA 1HNEE 4AX9H 1SLVB 2V35A 2GZ7A 2JJ2D 3H5CB 1C5PA 3T62A 2TIOA 4RN6A 3SNAA 4YXWD 1A61H 3QTOH 1ZYOA 3MI4A 3ATMA 2G52A 1V2JT 3LJOA 1SLUB 3MOCA 4MVNA 2ZGBH 3LU9B 2C8ZB 1AVXA 3P8FA 3GYMA 2ZIQH 1T8OA 4X1PU 4I8HA 4XFQA 2ZU1A 3RC5A 5GCHF 4B1TA 3A84A 1KTSB 4OS5A 4FUIA 1GL1A 4ISOA 1HAHH 4KGAA 4H6SB 2UUKB 3MNCA 1S84A 3EYDA 4U2WA 4AGKA 3T2NA 2J38A 2A7JA 3AW1A 4XSKU 1DWDH 2PKSB 1UVPA 1CQQA 5A2MH 1OP2A 1V6DA 5FBIA 1SGPE 1F0TA 1O2PA 5T6FA 1BMNH 2ZC9H 1J15A 5C1YA 3OYPA 1O3GA 2UWLA 5A0BA 2ZWLH 2P16A 1NRRH 2AHME 2HNTF 1XM1A 4Q4LA 3A86A 1TBRH 4Y71A 1GGDB 1DT2A 1PPCE 1FN6A 1PPFE 3GDUA 3M7UA 1C5XB 3GY5A 4KP0A 2GJGA 1T7CA 3M61U 4NIWA 4Q7YA 4B6FA 9ESTA 1F92A 1A3EH 3ZVAA 1P2OA 2F9VA 3SW2B 1YP9A 1OKXA 2Y5GA 1VJAU 1S5SA 1GJ4H 1WYKA 3CENA 1C1MA 5FX6A 3AAVA 5K0HA 2C8WB 2GDEH 1SGYE 2STAE 2PKSC 1O38A 2J95A 1F0UA 3OU0A 3PV4A 2C90B 3N7OA 4WXIA 1LHDH 2QE7D 2PHBA 4K60A 2FYRA 2FO9A 1GI2A 1O3IA 2BXTH 1EQ9A 4YLUA 2V3MA 2YNBA 3F6UH 1V2KT 4WH6A 1O3KA 1GGDC 1VZQH 2CXVA 2VNTA 3Q3XA 1YYY1 4GCHG 1YPGH 2FXRA 1MABB 3E6PH 3ZVCA 1O2XA 2OCVB 5CE1A 1NM6A 1EX3A 1HBTH 1CSOE 3ITIA 4IC6A 3R3GB 2ZCHP 1KIGH 4RSPA 1Y3UA 4TT3D 2A1DB 4CBOA 3PROA 2ZU5A 3STJA 2TPIZ 3F9EA 1QGFA 1B0EA 2C8XB 4MLFB 1A5HA 1JWTA 1TB6H 3SGQE 3Q3YA 2BD4A 2SGEE 1LPKB 3RU4T 1IHTH 1WQVH 4MQAA 4AB9A 2Q6GA 3SU0A 4XRNA 1K0HA 1BITA 1GG6B 5AF9H 2AMPA 2NU2E 5EXNA 1TX7A 3GCTF 4FXGH 1O5FH 4MNXA 3ZZBA 1BT7A 1FQ3A 3MO3A 4Y0ZE 1THRH 4AB8A 2SGQE 1H4WA 1K1OA 1DUAA 1FJSA 1BDAA 1GHBF 2XC5A 3A83A 2WPKS 1GBBA 1GJBB 4BAQB 1GBCA 2FX6A 4GLYA 1G32B 3UWJH 1UTLM 3QZRA 3KEEA 1D9IA 2JH5D 2O8MA 3AK5A 3E0NB 2ANKH 1NRNH 4NFEA 2XCNA 3M35A 1AWFH 2OD3B 4K8YA 2GZ8A 2WPJS 3L33A 1C1PA 1GG6C 2THFB 1UTOA 1IQMA 1P2NA 3LOXA 1L1NA 1IHSH 1GCTB 4IS5A 2G5VA 3FP8E 1W13U 2HNTC 3BEUA 2DE8A 5BRRE 1HCGA 1TWXB 3VXEH 1YCPK 4UFDH 1ZSJA 1ELFA 1WAYB 2EQNA 2V3OH 1ARBA 1EP5A 5DSFA 2G5NA 1O2KA 4X6PA 2AFQB 2B8OH 1LVBA 4LZ4B 1ID5H 5A8ZA 5KEDA 4TPIZ 1EB2A 4Y6DA 4YT7H 3SUEA 1UTQA 2W6ID 1GJ9B 1K1LA 1CT4E 1AGJA 1G3CA 1LVYA 5JBCS 1NRQH 1QB9A 1WQSA 2KR7A 3A81A 2BY9X 4IMZA 2XC4A 4ASUD 1GCTC 1W0KD 1BHXF 1WUNH 3OTJE 3MTYA 1DXWA 2KAIA 3TJOA 1V2PT 1NN6A 1TMUH 2F43B 5DGJA 1AIXH 2W7UA 3Q00A 4DJZB 2ZP0H 3SNEA 4OGYA 1IQLA 5AHGH 2OC1A 1C4U2 1KXBA 3UIRA 5GWZA 3BG4C 5SGAE 1EZXC 1BTUA 1O35A 1QBNA 2FM2A 2UWOA 2J34A 2GGVB 1UCYK 4NA7A 4AZ2B 3PV2A 2ZO3H 5E2OA 1DOJA 1MBQA 1O3MA 1W11U 2G55A 2BX4A 4O3UA 2ZGCA 1GJ6A 1GBIA 3TGJE 2LP6A 1L4ZA 5EGMA 3SQHE 2ZQ1A 4YOIA 3RXKA 2HGTH 3L6PA 1YPKH 1LHEH 2AS9A 1C5OH 2KCYA 3MH5A 1TNGA 4BNRA 1NBMD 2A7CA 4B74A 1KXAA 1A5GH 1ETTH 1C5NH 2C4FH 1GHAG 4DY7B 5CHBA 4K69A 1YPLH 1C9TA 2Y6TA 3TH2H 4AFQA 1H9IE 1ZTLA 1A0JA 2SNWA 5J4QA 1S6LA 1NESE 3U1IB 3IG6B 1BZXE 3KN2A 1TRYA 1G30B 3KQCA 3GY7A 1ZOMA 1CGIE 5DK1A 5A09A 3D23A 3UY9A 1FAXA 1QURH 3LDXH 2G81E 3GDVA 4ISLA 4ZROA 2G4TA 1QA0A 5FXLA 4B2AA 1VR1H 1TRMA 3P17H 2BDIA 4XOJA 1T4VH 1NTPA 1RTKA 1UK4A 4BXWA 2PLXA 1FX0B 2BVRH 4ZHMU 2BD9A 1XUIA 2XYAA 3V0XA 2LELA 4DURA 1HYLA 4WY3A 1YLDA 1C5QA 1A0HB 2Y5FA 3N7DA 3F9GA 2FLBH 2ZNKH 1ANDA 3OY6U 1PJPA 3RMOH 1V2UT 1GDUA 3TK9A 1TX8A 3PWCA 3BTTE 1HIAB 1S0RA 1VGCB 4KELA 5GJ4B 1TONA 1HAVA 2OC8A 2BY5X 2CV3A 2O8TA 1O2ZA 3IITA 2TGPZ 2EC9H 2SGFE 5JB9S 1O5AB 5FAHA 1UO6A 3A7XA 4X8TH 1MTSA 5ESBA 1V2QT 3EQ0H 2IPHA 3GY2A 2PP6A 1MAXA 3RXTA 5IDKA 2BLWA 2ULLA 3E1XB 3PLBA 1SI5H 1GVZA 4UE7H 2PGQB 3QGNB 1P2QA 4F4OC 8GCHF 1D6RA 1L4DA 1AHTH 1JIRA 3A89A 1V2WT 3PV5A 4HFPB 1DLKB 2BD8A 1CA0B 2A4GA 3MO9A 3W1EA 4LOYH 1VGCC 3BTKE 2AGEX 2XWBI 3RU4D 3KL6A 1P2MA 1OHHD 4Y76A 2ZHQH 3ZYDA 1HAGE 1SQOA 4O97A 3E3TA 1SMFE 3ZIAD 4MTBA 5EOKA 1SHHB 4KTCA 2Y80A 1MTNB 3ZVEA 5L30H 5ABWA 1GVKB 4YOGA 3SU3A 3LONA 2IN2A 3P8OA 1RGQA 3DUXH 2Z9GA 1G3BA 4OS4A 1RS0A 3MU1A 5T6GA 4I31A 2ANYA 2FWWA 2BMGB 5HXFA 1QRXA 3QDZB 2SGPE 1H8HD 2ZFTA 2K1QA 1IAUA 2VH6A 2ZECA 1TOMH 1YLNA 4UFFH 1LVMA 1CA0C 2AYWA 1SBWA 2F91A 4Z0KA 3A7ZA 3TH3H 1C2HA 3NZIA 4CRFA 3PMBB 1AFQB 3TJNA 3ZV8A 2P59A 3H7TA 2ZHFH 2UUYA 5CMXH 4FU7A 1LVOA 2H9TH 4JCNA 4AFUA 3DD2H 1GBKA 2WPDD 3BIUH 1UVOA 5FPYA 1MTNC 3M7QA 1ELEE 1ELCA 1QA7A 3Q77A 3HGNA 1BTZA 2AGIX 2PSYA 2ZPRA 2OXSA 2BXUH 1C2GA 2ZEBA 2F9PA 1YCPM 2GZ9A 3SNBA 1YPHC 2BD2A 1AFQC 2BB4A 2D1JA 4ZH8A 3V13A 1ZRKA 4DOQA 1UK2A 3SU4A 3SN8A 1NY22 1FXYA 2ZDMA 1TQ7B 2FI3E 1ESTA 2EY4C 3SU1A 1OWDA 4K1EA 2VGCB 2HOBA 4Z6AH 4ZAEA 5C20A 5C17A 1Z8IB 1ZPZA 1C2LA 1OOKB 2Y82A 1ZPCA 1O2GH 1GBJA 4CRCA 1QQUA 1GBDA 1SHYA 3MQKC 4DT7B 2WV5A 1GI5A 1XXFA 4Y7AA 5FBEA 4PROA 1T8LA 1UTPA 2AH4X 1BTYA 1MKXH 3KCGH 5KGOA 3SZNA 5C1XA 4I7YH 3S9AA 2ZQ2A 3K9XB 1GMHG 3D62A 4X1NU 3VB6A 3LKWA 4U01A 1AZZA 1BMFD 5E0JA 1TPPA 2RFKC 3BIVH 1MTVA 1AY6H 1GJAB 2VGCC 1TE0A 4IN2A 4NWKA 3UUZA 4AORA 5LGOA 3ENSB 1EB1H 5LPEA 1BTXA 2QGRA 1BQYA 3M37A 3O8CA 4ZXXH 4IC5A 1UCYE 2OBOA 1FDPA 1S0QA 3OFND 1TRNA 1DSTA 1MZAA 1TABE 2EI8A 3LIWA 2FOEA 5DP7A 3UTUH 1GHAF 5A8XA 1EJNA 2AERH 1JIMA 2O8WA 1NFXA 1EOJA 2TGDA 4X8SH 3A7TA 5I25A 1C5UA 1ZGIA 2D8WA 5F03A 3RDZA 2YOLA 2GCHG 2AMQA 3DT0H 4MPXA 2ZHDA 1TQ0B 2CF8H 1MAYA 3K6ZA 2G4UA 1FV9A 1GI8B 2LPRA 1E38B 1Z7KA 4CRAA 3UWIA 1O37A 4FETA 3DA9B 2GDDA 1SL3A 2XRCA 2WUBA 3SI3H 3O8BA 2Q6DA 1LPGB 1IQEA 3BEFB 4GHQA 4TYDA 2YNAA 4F48B 2QIQA 1XVOA 1DY8A 1AVGH 5C1UA 1Q2WA 3ZV9A 1AE5A 3T28A 2XWAA 1ARCA 2WPLS 4AN7A 4A1VA 1BJVA 3TGKE 2QF0A 1OWIA 1VCQA 1P3CA 1AKSB 2PGBB 4D9QA 4FUCA 3SNDA 5HMAA 2KX4A 4DCDA 1HLTH 4LZ1H 1XUFA 1O31A 3Q3KA 4ABHA 4WJG2 1KLIH 1J9CH 1AWHB 1ZSLA 3S7KB 1C1RA 1JMOH 1UMAH 1C5VA 4B2CA 5F53A 3LGTA 1VITG 1A4WH 3R0FA 3ZYEA 4XBBA 4NCYA 1QBVH 2QF3A 3ESTA 3F9FA 5HYOA 4JZDH 1ZGVA 2HVXA 4GAWA 4LK4A 1G2MA 1SLXB 4IBLH 4KTUA 3A7WA 3S9CA 2R2MB 1HPGA 2GCTB 8KME2 3CP7A 3RXUA 4AYVB 1C5WB 4ISNA 1OWKA 1SGNE 4Y10E 1ZHMA 2P93A 1ETSH 2ZCKP 1PFXC 2XXLA
chains in the Genus database with same CATH topology
2ZF0H 1BRBE 5AFZH 1CBWB 3EA8A 3MWIU 4IMQA 1Y8TA 5EG4A 1ACBE 1FIWA 1Z6EA 1P06A 4BOHA 2H9EH 1Z8JB 2ZDVH 2J92A 4TWYA 2WPHS 3RUOA 5DPAA 1DWBH 1HAYB 3SUDA 3SUFA 1C5MD 3RXHA 3KF2A 3A8AA 3KNXA 3GCNA 3LC3A 3SUGA 1ANCA 2GCTC 4MDSA 1WTHD 1OPHB 1L0ZA 1S82A 2H6MA 4BANB 4WXVA 1C1WH 3MU4A 1GI4A 2ZU4A 4GSOA 3RMNH 1XUKA 1AFEH 2O9QA 4YT6H 4YZUA 5LPRA 3M3SA 1ZPBA 1CBWC 3A82A 1P04A 1IQKA 1O2OA 3MYWA 2ALPA 4JZIA 3OSYA 1TAWA 4Q80A 2WYJA 1T31A 1EZQA 4A5TS 1VCPA 1YPHE 3FZDA 1PPBH 2OLGA 1PPZA 5F8XA 1O34A 1HAPH 2R3UA 7ESTE 3E90B 3E91A 2PR3A 3BEIB 3BTWE 4CRBA 2UUJB 2BLOA 4WMEA 1DWCH 3KHVA 1MMJN 1BUIA 3T27A 2Z9KA 3F1SB 1T8MA 1O3FA 3BSQA 1SVPA 4F49A 1B5GH 1HAOH 4X6OA 4ABFA 2V0BA 2AEIH 1XKBC 5E0GA 1JBUH 2BVXH 2Z9LA 1F0RA 2GT7A 2O8UA 3RXDA 3HKJB 3QLPH 1TMTH 1KXDA 2QAAA 4E06H 3GY6A 1GMHF 1C5YB 1YPMH 3RU4E 1N6YA 4KKDA 4AYYB 3P8NA 3C1KA 1ZJKA 1HAIH 4X6NA 1ELTA 1YM0A 3TIUA 1PPHE 1QCPA 4ZHAA 4Y8YA 1O2WA 2P95A 3BTQE 5TCCA 4DVAU 5HM2A 1B7XB 2VIQA 1O33A 3VXFH 4FU9A 4M7GA 4I8KA 1HIAA 1TBZH 4E7RG 3PMAB 2QXHA 1SGFA 4IN1A 1O5CB 3M36A 4A7IB 4ABBA 1HXFH 2VWMA 3RXEA 3GCHB 2FPZA 1DM4B 1TX6A 4H6TA 5LPFA 1UK3A 3KIDU 4K5ZA 3ZZ9A 2GTBA 3TU7H 1EPTB 1ZMLA 5F8ZA 2FDAA 1RD3B 1FI8A 1DVAH 3PMHB 1UTMA 2NU4E 1O2HA 3I78A 4YM9A 1LQDB 4K3JA 3MNBA 1GCDA 1XUJA 1O3CA 3FANA 1C1NA 3P8GA 1Y3WA 1IOEA 5J4SA 2Y7XA 3MFJA 3GCHC 3TJVA 4INKA 5EXMA 1SGTA 4JMYA 1BIOA 1XKAC 1UVUH 1EPTC 1XX9A 3EAJA 1ZTKA 2BZAA 3FP7E 1P09A 2A5KA 4Y8XA 3T5FH 3NXPA 3ZVFA 1HAZB 1BTHH 1Z1IA 1YGCH 2ZGXH 1V3XA 4FUDA 1GBEA 1A3BH 1J17T 2Z3EA 2OUAA 1Z8GA 4JYVH 3RC6A 4BTTB 1CHOG 4CREA 5EXLA 4JK5A 1O5GH 1TNHA 2JKHA 1OP8A 4R8TB 3A88A 1EAXA 1BRUP 1FONA 3ZZ3A 2CF9H 1C4V2 1O0DH 4I8LA 1ORFA 1P12E 3G01A 1GL0E 3NPSA 1FY8E 3B23B 3HKIB 5I46H 3ATKA 1QIXB 1SSXA 7LPRA 1GMCG 1AD8H 1MQ6A 2PUQH 2A5IA 2BHGA 5EQSA 2Y5HA 2DUCA 1ZMJA 4VGCB 4KTSA 1FPHH 2Z6BD 1K22H 1P02A 3SV8A 3QUMP 1AB9B 1F5KU 1BJUA 2XC0A 1A1RA 2CHAB 1P10A 3ATLA 3SQEE 1TGTA 3L3TA 1QB6A 1HRTH 1KXEA 1NROH 1SOTA 2FIRH 2QYIA 1MH0A 2Z94A 3TK5A 1QL8A 2ZTYA 5LH8A 1DWEH 1D3PB 2FMJA 2UUFB 2VWOA 3SJ9A 4AOQA 4VGCC 4MPWA 3PLPA 1A0LA 3FAOA 1ABIH 2ZFRH 5GPIB 3PB1E 3SU6A 3ZZ4A 4YESB 5BPEA 1AB9C 2ZFSA 3BTEE 5JBAS 1ZHRA 1QY6A 3RXGA 3CS7A 1Y3YA 2CHAC 1DX5M 2ANMH 1MQ5A 2WINI 3TNTA 3U98H 1G3DA 3URCA 4FUBA 2XBXA 1C1VH 1BRAA 3S69A 5T6DA 3S9BA 2JETB 1OXGA 1ZJDA 1LPZB 3ATWA 1AN1E 3IWMA 4DW2U 3ZZDA 5DP9A 1P2IA 1N1LA 3T29A 4ABDA 3DHKH 1GVLA 4J2YB 4FUEA 2ZFQH 4GCHF 4JYUH 4K2YA 4A1TA 2ODYB 4UONA 4JZ1A 2BM2A 4XBCA 4GVUA 6GCHG 4CR5A 1QNJA 2Y81A 2SFAA 3ZZ6A 1HUTH 4NA8A 1DPOA 2G00A 4FUJA 2CN0H 1GMDG 2W26A 3ZZ5A 1K1MA 3RXRA 5FCKA 1AVWA 2GD4B 3SHAH 2JETC 1C1SA 1M9UA 1ELVA 4AGJA 3BN9A 4TY7A 3MNSA 5EQQA 2XTTB 4CHAB 3TPIZ 1K1IA 1C5LH 3RC4A 1IQJA 1KSNA 1L2EA 1V2TT 2ZHWH 4FUHA 4K1SA 1QFKH 4K1TA 4BAHB 1O3OA 1O3HA 1GBLA 3A8DA 4NIYA 1TNLA 5G4BA 2I6QA 1AKSA 3VB3A 1U6QA 1N8OB 2VWNA 3O8RA 4ASHA 3U8OH 2ZI2H 2EI7A 2WUCA 1MKWH 3D49H 4TY6A 1C5RA 3RM2H 3SU2A 1UTNA 1O39A 4NGAH 2QXIA 3KQEA 4CHAC 4NFFA 3A8BA 2IJOB 3ODDA 2B5TB 4FVBA 1O2IA 2VB0A 1W3CA 3PTBA 5E0HA 1CU1A 1XUGA 5FPSA 1FY5A 1MCVA 2HNTE 2HLCA 3RXIA 3HK3B 2FZZA 4CH2B 2G8TA 4ESTE 1AO5A 2FX4A 1S85A 3QK1A 1GDNA 3H7OA 1W2KH 5DP8A 1Y3VA 1N8OC 5JDUB 1C1OA 1QL7A 3GISB 3UNRA 3MNXA 2WV4A 2ZA5A 2ODQA 3P70B 5C5NA 4Y79A 3RMLH 3UQOA 2BDGA 1C2EA 2GP9B 1RIWB 2A4QA 2PKAB 2TBSA 2Y7ZA 2BYAX 1AQ7A 2Z3CA 1CGHA 1DITH 1CHGA 1J14A 2OC0A 2GV7A 1GJ5H 4DG4A 1OWHA 2ZPQA 1KTTB 1ELDE 4WWYA 5EPYA 1W0ZU 1GJCB 5FPTA 2VVCA 3I29A 1GI0A 1O36A 1E0FD 1V2NT 1Z6JH 2ZZUH 4JZFH 1SGEE 1WTGH 3EDXB 2O8LA 1C5SA 1H8DH 3UR9A 4BAKB 1PQ7A 1O3BA 2BY6X 1HV7A 1GMCF 2GVFA 2Z9IA 4OGXA 1DXPA 2TGAA 4INLA 1CGJE 2BOKA 2BQ6B 2ZTZA 1RIWC 2EI6A 1P8VC 2HPQH 1VCWA 1FZZA 3VFEA 1AE8H 5H4IB 1F5LA 3M5OA 3MU0A 4NZLA 2HWLB 1BCUH 1SQTA 1J16A 1WSSH 4FVDA 3I77A 1HJAB 3VB4A 1V2LT 4GHTA 2G51A 2EEKA 2R3YA 2W3KA 1EKBB 5DP5A 1OYQA 2H1UA 2ZDAH 1V2ST 3W94A 4ABJA 1NS3A 4FU8A 3D65E 4FUFA 1EXFA 3AW0A 3SOSA 3S0NA 1LHFH 2WYGA 4BAMB 2DE9A 3TK6A 1W12U 4Q7XA 5T3HA 3TJUA 1JOUB 2A32A 1ZMNA 1CT2E 4UD9H 4D7FA 1GHBG 1JRSA 1NU7B 1GHYH 1S81A 1MU8B 1BBRH 1G37A 1C1UH 1ZR0A 4Y11E 2VWLA 1Z71A 1Q31A 1QHRB 4INHA 5TJXA 2FOMB 2H2ZA 2PFEA 1MCTA 3BTME 1ELAA 3RM0H 2BZ6H 1GJ7B 1D3QB 1TPAE 4WMDA 1F2SE 1HJAC 2ZGJA 4WVPE 1DS2E 5DG6A 3LGUA 2ZPSA 2VIDA 2VU8E 3SJOA 5A0CA 1FAKH 3ODFA 1PPEE 4B76A 3OX7U 2OP9A 1PYTC 1RTFB 3NK8A 1T4UH 1K21H 1TPSA 5EQRA 2BY7X 2IOTA 4O9VA 2FOHA 2ANWA 1IQNA 2EA3A 2HPPH 1A7SA 1P01A 1WBGB 1GI3A 3BTHE 3PLKA 4YOJA 3PO1B 1ABJH 1QRZA 3AASA 1OWEA 1Y59T 1O3PB 2OC7A 2AMDA 4MPUA 1CVWH 1GHXH 1A5IA 2J4IA 1MZDA 3O8DA 1EPTA 2C93B 3UNQA 3V12A 3SU5A 5GDSH 1KXCA 1H9HE 4XDEA 4FUGA 2P3TB 1GBTA 1O5DH 4YO9A 2BD7A 1MD8A 1YKTA 1V2RT 1TNKA 1DDJA 1TFXA 3VGCB 3TGIE 1FY4A 1YPJH 1GBAA 2CGAA 3BV9B 4ZXYH 4D76A 2J94A 1VITH 1GI6A 1SOZA 3SGBE 3PO1C 1SC8U 3HGPA 3RXFA 3QO6A 2RG3A 3ZZ7A 3ZVBA 1C2KA 4WH8A 3SJKA 1GHWH 2I6SA 1MTUA 1NRPH 4DIIH 2A7HA 5GXPA 2PV9B 4D9RA 1NFYA 3VB5A 4IW4E 3NCLA 1TGBA 2F9NA 2BQWB 2B9LA 1XVMA 4H42U 4QT8C 1EAIA 1HGTH 1CA8B 4ZHLU 3E0PB 1NU9A 3A7YA 4X1SU 5EODA 4NA9H 3A8CA 2NU0E 3RXJA 2AGGX 1UHBB 1UVSH 3VGCC 1D4PB 1Z1JA 2ZDNA 3SJ8A 5PTPA 1O30A 1XMNB 2NWNA 1SGDE 5L2YH 1K2I1 4U32A 4GPGA 2J9NA 4AFSA 4BTUB 1SGCA 3U8TH 3PWBA 3E8LA 1D3DB 3U9AH 1GI7B 1EZSC 1O2JA 1SPJA 3GICB 2F9BH 1AUTC 1AU8A 3M5MA 1QTFA 2BDAA 1DANH 1P9UA 2Q1JA 1FY3A 1P9SA 1ZSKA 1O3DA 1JXPA 1EASA 1SGIB 3AVZA 1ZRBA 1VJ9U 3UQVA 2VIOA 3MHWU 3UOPA 3URDA 3V7TA 1QJ1B 1TYNA 3QX5H 1QRWA 1CT0E 1O3AA 4I33A 3SV9A 2BOHB 1HB0B 4K8BA 1WV7H 5DJ7A 1C2IA 4XE4A 1EZUC 1L1JA 2XBVA 1J8AA 4TPYA 3S7HB 1S6HA 3E16B 1LHCH 3QGJA 1W7XH 5DP3A 3RXOA 4AFZA 4IGDA 3A85A 2ASUB 2VIVA 4B71A 2FTMA 1H9LB 1XUHA 1GI9B 2F3CE 1GDQA 6ESTA 7KMEH 3KQDA 2FI4E 1TOCB 1DE7H 4UEHH 1OP0A 4SGBE 3UPEA 1TALA 1E34B 2BD5A 3HPTB 2F83A 5FCRA 4WF8A 2B0FA 4E05H 3HK6B 3RLYH 5EU8A 1BA8B 1O2NA 3SORA 2XCFA 1MKWK 2VIPA 5F8TA 1WCZA 2ZKSA 3RXBA 3A87A 8GCHG 1DLEA 3P92A 4Y0YE 4X2WA 7GCHG 1BRCE 2SNVA 3MH6A 3F9HA 1HJ8A 1NT1A 4NIVA 3TNSA 3TVJB 1W14U 5DP6A 1C2DA 2FOBA 1TGNA 3RXLA 1B0FA 3RXMA 3RXCA 3DFJA 3ZVDA 1FN8A 3LGIA 5GIBA 5JBBS 3U69H 1KDQB 2SGDE 4X8VH 1SFQB 1OSSA 3NWUA 4UDWH 1LHGH 2VINA 2GCHF 1F5RA 2ZFFH 2R9PA 3RXAA 1NFUA 5DKMA 2A31A 5E2PA 2H5DA 3ATIA 3KGPA 4WMFA 2QY0B 1EOLA 1YBWA 4DGJA 1DUEA 1TPOA 1O32A 2FODA 1P3EA 1O2UA 1ANBA 2ALVA 1CO7E 2J2UA 1MD7A 3VPKA 1P2JA 1LKAA 4MNYA 2BVSH 3GY4A 4ABIA 3BF6H 3BTGE 1LDTT 2FS9A 1H8IH 2BY8X 2LNCA 4NSYA 1TMBH 5HGGA 1E35B 1W0YH 1MKXK 3LT3A 1YF4A 3BG8A 1P0SH 3MMGA 2PTNA 3TH4H 3GDSA 2OQUA 3NKKA 1V2MT 2C8YB 4Q7ZA 1UJ1A 5ETXA 1QB1A 3BG4B 4HZHA 2ILNA 3F68H 8ESTE 4B2BA 4MG3A 4NG9H 1GWAA 5JBTA 3EGKH 3PTNA 1THSH 4BXSA 3UR6A 1P57B 1VITF 1MTWA 1O2TA 1V2VT 4Y7BA 3GYLB 1C4Y2 4LXBH 3KQBA 1HFDA 3RP2A 1V2OT 1NPMA 4OS2A 3LC5A 2Z3DA 2ZG0H 3RXPA 3SGAE 3EE0B 4E7NA 1RJXB 2ZHEH 3P6ZB 1FLEE 1LKBA 1WOFA 3M5LA 1O2VA 2BLVA 3LJJA 3T25A 2CJIA 1O2QA 3GY8A 1ESAA 4OS7A 1RTLA 5FX5A 3SJIA 1O3NA 1BBRK 1E37B 1HJ9A 4NWLA 1JRTA 5C3NA 1QQ4A 3ZZAA 1EP6A 5FHTA 2TRMA 3SV2H 4CRDA 1P05A 2PKAA 2VH0A 4Y8ZA 1D3TB 3FVFB 1A46H 1INCA 1DFPA 4MNVA 4O3TA 3UFAA 2FYQA 1QL9A 1TLDA 2OINA 1P11E 3VB7A 1O2RA 1BMLA 5F6MA 1C9PA 2W5EA 2GKVE 3PYHA 3ZZ8A 1FNIA 1GHVH 1TBQH 4X6MA 2VVUA 4X2VA 3SV6A 2F9OA 1MUEB 1HXEH 1ZTJA 1EUFA 2PUXB 2STBE 1YC0A 3WY8A 3BTFE 3HATH 3SV7A 1BTPA 1KXFA 1UVTH 3V3MA 1DICA 2Q6FA 1W10U 3QZQA 1ZHPA 1C1TA 1DSUA 1C2JA 1K1NA 5L6NH 3M3TA 2W7SA 5L2ZH 4ZUHA 1YPEH 5B6OA 1A2CH 1BHXB 1UTKA 1W7GH 1C2MA 2GX4A 3MO6A 2OBQA 3B8JA 1NC6A 3C27B 3UREA 1KYNA 1Y5UT 2QXJA 1BMAA 4ZKNU 4A92A 1SG8B 4RKJB 2BX3A 1O3LA 3K6YA 1SLWB 1P03A 2P3FH 4ABAA 1BB0B 1TIOA 2D2DA 3PM3A 1L1GA 1TA2A 1LO6A 1GBHA 1HDTH 5JPMH 2RDLA 1S6FA 1Y3XA 3EA7A 1BOQA 2BDHA 3SO3A 1EJAA 3CS0A 1AUJA 3OY5U 3B9FH 2D26C 1Y5BT 3M7TA 2QCYA 5EW1H 1NFWA 1C5ZB 3LGYA 1YLCA 3ZVGA 2FI5E 4B73A 4JZEH 9LPRA 1CE5A 7GCHF 5HM9A 3K65B 4XBDA 1NRSH 5C5OA 1QR3E 2P3UB 4TWWA 3SI4H 1GJDB 4NSVA 2ZCLP 1PPGE