1O2JA

Elaborate manifold of short hydrogen bond arrays mediating binding of active site-directed serine protease inhibitors
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Elaborate Manifold of Short Hydrogen Bond Arrays Mediating Binding of Active Site-Directed Serine Protease Inhibitors
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords BETA-TRYPSIN
total genus 53
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2003-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1o2jA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1o2jA02
3ZYEA 1HAYB 5DPAA 1CE5A 3DFJA 1W11U 1QY6A 1O2KA 2FI3E 2NU0E 2ZU4A 1O39A 4DT7B 3BTTE 5HXFA 1O2MA 3FP8E 3V3MA 5JBBS 1OWEA 1QJ7B 2BY5X 3RXMA 1DUAA 1O5EH 3ZVDA 2BD4A 1CA8B 3O8CA 2OP9A 4UEHH 3RXFA 4FUCA 2FYRA 2SFAA 1NRSH 1DWCH 4Z6AH 2ZG0H 5DO4H 1V2VT 2ZDAH 1UK2A 5L2YH 1P2OA 1LPKB 1H4WA 3RXTA 2BDYA 5JBTA 1ELAA 2OXSA 3EA8A 2C4FH 3RXBA 3SGAE 4JZIA 4NSVA 1EB2A 2OLGA 1EOLA 3H7TA 1D6RA 1ABIH 3ATLA 2J2UA 3KL6A 2PV9B 2ZFSA 4IMZA 2BZ6H 3TJUA 1GI9B 2J9NA 1C2GA 1GDNA 4YTAA 1V2MT 1O2LA 2ZHEH 4NA9H 1AFEH 1IQHA 6ESTA 1GI0A 4NGAH 2XBXA 3ZVCA 1TE0A 2Z3DA 3AAUA 3BTDE 4XE4A 3VFEA 4WMDA 3ZZ9A 3LGVA 5IDKA 5DP4A 1QURH 1C2JA 2HRVA 2EC9H 4SGAE 2P16A 1G3DA 2G4UA 4Y8ZA 1GG6B 4UONA 3M61U 2ZU3A 1F0TA 1QBVH 1H1BA 2ZDMA 1QA0A 4YOIA 4NCYA 1TNJA 1L2EA 1QB6A 2ZHFH 2F9PA 3UWJH 3S9BA 2C3SA 1Q2WA 1D3QB 1CBWC 4INLA 2ZGXH 1GJ8B 1BBRE 4BAOB 1DX5M 2LPRA 2SNWA 4VGCB 3M7TA 2BD7A 1P9UA 1THRH 1SFIA 4AORA 2VH0A 1THPB 1D3PB 4RSPA 2UUJB 2G8TA 2CMYA 2C8WB 3OY6U 3PROA 1W8BH 4H42U 1XUJA 3A83A 3BTME 4DVAU 2FM2A 3SJOA 1GI6A 2ZWLH 3GY3A 1L0ZA 1YGCH 1ZTLA 1BTHH 4AYVB 1C5MD 1ZSLA 1ZR0A 3RXHA 1TGSZ 1SLUB 1B5GH 1UVTH 3M5OA 1C5TA 1GJ5H 1QBNA 1K9OE 1V2OT 1O5CB 1EXFA 4Y7BA 1H9LB 1FPCH 1C2DA 2ZTZA 3NPSA 4Y71A 1W0YH 1TBZH 3RMLH 4ISNA 1AUTC 3SQHE 1QRWA 4NG9H 3IITA 1SQTA 4ESTE 1YLDA 3M7QA 2Z7FE 1EPTA 1W10U 4DJZB 3M3VA 2GCHF 3MHWU 3M37A 1G30B 4MPXA 1N8OB 2GVFA 1A0HB 1O3EA 2ZO3H 4A7IB 1FUJA 1TNIA 4GUXA 1IQKA 5CMXH 1KXEA 2H1UA 2XWBI 2W26A 4NZLA 1GI8B 1MKWK 3A88A 3H7OA 5JYIA 3KCGH 3TH3H 1NFWA 1Y3YA 2EI7A 2QN5T 1SR5C 1K1NA 2JH0D 3P92A 2PGBB 3MNXA 1V2ST 1DT2A 4B76A 3A7YA 4O9VA 1EATA 3P8OA 2ZF0H 1ZPCA 2G55A 2BXTH 2O9QA 1O3BA 1EZQA 2Q6GA 1P2MA 1LVBA 2EI8A 4U30A 1XXDA 1CSOE 1Y3WA 1DICA 4I8JA 2AGGX 1C2KA 4UD9H 2JH6D 3QK1A 1HIAA 1MBQA 2FS8A 1GJ6A 1O3JA 1C1PA 1T8LA 3BIVH 4WWYA 4H6SB 3QGJA 1P10A 1C1TA 1O3KA 1DOJA 1SHYA 1YP9A 1B0FA 2A4QA 2FX6A 8GCHG 3SV8A 3KGPA 3F68H 4Z0KA 1XUFA 1GJ7B 5GDSH 2ZCKP 3GDVA 4B1TA 4FUDA 4PROA 1EAWA 2H2ZA 4WJG2 5A2MH 2NU1E 1TLDA 4D9RA 8GCHF 1VCPA 1BITA 1MTSA 1ESTA 1OP8A 1A7SA 1P3CA 1ANBA 1VR1H 2BD3A 3PO1C 4UFEH 1BMNH 1VITF 4RKOB 4ZMAH 3UIRA 4IN2A 1BT7A 4YM9A 2XC4A 2XC5A 1YPHC 3MO6A 4WXIA 1ARBA 5L30H 1RTLA 3SU0A 1VJ9U 3E8LA 1AIXH 1P57B 5F8TA 3C1KA 4LZ4B 1IQNA 1BHXF 2GCTC 2NU4E 1GMHF 3HKJB 2BY9X 4MLFB 1IQLA 3FP6E 1QHRB 2Z9KA 4NFFA 4DURA 1F5RA 4A1XA 5LPRA 1F92A 2OD3B 1HV7A 2Y80A 3LIWA 1J9CH 1D3DB 4ASHA 2CF9H 2ASUB 1V2TT 5T3HA 1ZOMA 1LHDH 2GD4B 3E16B 4IW4E 4B2AA 2HGTH 1QA7A 4BTTB 2BDHA 3F9GA 2R3UA 5I25A 1IHTH 3W94A 1AO5A 1WBGB 2HNTC 1NY22 2PTNA 3K65B 3LKWA 2QAAA 7GCHF 1P2IA 3O8BA 2C90B 1UVSH 1NU7B 4ABJA 2PWXA 3S9CA 5PTPA 1BTUA 3M3SA 3PMJA 1GI7B 1S0QA 5F03A 1SC8U 2EI6A 1GHZA 3SNAA 3AVZA 2XCFA 1BZXE 3RXDA 1O2YA 1CO7E 1CBWB 1O2XA 2FLBH 2B9LA 4K69A 1DITH 3T25A 1O2GH 1P12E 2GV6A 2A5IA 1P2KA 2GGVB 4HZHA 4K60A 2BY6X 4GCHF 5A0BA 5DP9A 2D26C 3BEUA 1ELEE 2V3HH 1T8OA 1TA6A 3BG4C 4D7GA 5C1XA 1P11E 3SZNA 2VIVA 5FCKA 3EGKH 1GBTA 1HIAB 2VIOA 1W14U 2A4OA 2FX4A 4HTCH 1MTNC 1DS2E 1SGTA 3RXKA 1A0JA 1XUIA 2BDGA 2ZC9H 1PQ8A 1TOMH 4E7NA 2F83A 2A0QB 3P8FA 3PWBA 4Q2KA 1F7ZA 1O2PA 5GWZA 4INKA 1GDQA 3M5NA 3BV9B 1GHWH 2J92A 4GHTA 2Z3EA 3N7OA 3FFGA 1G2MA 1ETRH 1ZRKA 3SU1A 1FMGA 1ELTA 2BDCA 2ZQ2A 1OX1A 1N8OC 7KMEH 4MPUA 2G81E 2WINI 4WY3A 7ESTE 2W7UA 1V2WT 1GBBA 1P03A 1TMBH 3S69A 4OGXA 1SQAA 2FS9A 4TPYA 5JPMH 2Y81A 3ZVBA 1O32A 2GV7A 3ZVAA 1NM6A 3PWCA 2ZU1A 1KXFA 1FY4A 1SOTA 4K3JA 1D9IA 3SUEA 2H9HA 1LDTT 2A1DB 1HUTH 3MU1A 2NU3E 2Z9IA 1C5LH 3T28A 6GCHF 2OCVB 1EZXC 3E6PH 1TMTH 2WV4A 3KQCA 3O8DA 4X6NA 3E1XB 2P8OB 2QGRA 2BHGA 1GBJA 4TY6A 4YLUA 1TALA 1DM4B 1G3CA 6GCHG 5HYOA 4WMFA 1Z8GA 1HAPH 2GZ7A 1DSUA 4OS7A 1TONA 5C1UA 4JK6A 4YZUA 2TPIZ 3E91A 2CJIA 1JRTA 2JH5D 4K8BA 4K8YA 1C2FA 4AGKA 3WY8A 1YPKH 1ZSKA 5EXLA 3GY2A 1Q3XA 4ZHMU 3F9FA 2HNTF 3U9AH 4MNYA 3QLPH 2QYIA 4ZHLU 2VVVA 1GJCB 1SGDE 3H5CB 3RXUA 3E0PB 1GJ4H 1J14A 3SNEA 2ANWA 2AGIX 2BQ7B 4HFPB 2XW9A 2F9OA 3ESTA 3SUDA 1HB0B 1JIMA 1SGCA 1WTGH 1TMUH 4HGCA 1NRPH 1ZJDA 2BQ6B 1FPHH 4IC5A 1RS0A 4KELA 1F2SE 2ZP0H 3RXAA 1ZMNA 1PQ5A 4BXSA 1LO6A 2WYJA 2C8YB 3SN8A 1BTPA 1BTZA 2BXUH 3HGNA 5EW2H 1PPCE 3ZZ6A 1C5YB 3TGIE 3SI4H 3MO9A 1LPZB 1CHGA 1HAIH 3GCTG 1VCQA 1FAKH 2QXHA 3PLKA 5FCRA 2TGDA 3NWUA 4ZUHA 3SJKA 2P3UB 3SNBA 1PYTC 3NCLA 4WVPE 2PUXB 1O33A 1SLVB 1E34B 1CQQA 2G5VA 1Y5UT 4D76A 1TNKA 1TAWA 1Z6EA 1TQ7B 2ANKH 3ITIA 1ELFA 3A8CA 1RTFB 1EOJA 3P70B 4FU8A 1MTNB 2P3FH 1E37B 2J94A 3A8AA 3MU8A 2ZGBH 3TITA 4XBCA 4ABHA 1JBUH 3SQEE 2ZGJA 1QBOA 3I29A 1SGEE 3TH2H 1P3EA 4NIVA 2OBQA 1E38B 3LJJA 1KIGH 4WF8A 5T6GA 5HM9A 5AF9H 2XYAA 2ALVA 5EODA 3ATMA 3KQDA 1O2VA 1GMDG 1O3CA 2H6MA 1EP6A 3CS0A 3SU2A 2NU2E 1KY9A 1QL8A 1XVOA 1K21H 1SVPA 1QCPA 1M9UA 1NZQH 1P09A 1UK3A 2FTMA 1OWDA 2DE8A 2Z9GA 5JDUB 1TGCA 1GHBG 1ZPZA 2BVXH 1G37A 1ZZZA 1CU1A 5FBIA 3GCHB 2Q6DA 4AFSA 2AFQB 4X1PU 1PPBH 2W3KA 2VINA 2QV1A 1C1UH 4OS2A 2WYGA 4Y10E 1GMHG 1WSSH 3U69H 3UOPA 1HJ9A 1FY1A 1S85A 2Y82A 4CR5A 1SGIB 1PPEE 2FXRA 3A7WA 2GKVE 1EZUC 3S9AA 1G2LA 2GZ9A 4MG3A 3VB3A 2CGAA 4UFGH 3QN7A 3GY6A 2XBYA 2A5KA 4A92A 1TPAE 1O3MA 1UCYE 2FI5E 2FESH 5C5OA 5BRRE 3SGQE 2GTBA 1VITG 3L6PA 4K1SA 1DWDH 3UNRA 1AMHA 5TCCA 1HAGE 9ESTA 3UNQA 3EE0B 2ZHDA 3MNCA 5C20A 1A61H 5EQRA 1DLEA 1K28D 3TK9A 3V0XA 1NESE 3VXFH 1MKXH 4YLQH 3TJVA 5E2OA 1YCPK 1QRXA 1TRNA 3RDZA 3UUZA 4XFQA 4X8UH 1GL1A 2BVSH 1C2EA 4AG2A 2FOFA 1UJ1A 2A4RA 1QIXB 3MU4A 4AG1A 1FIWA 3P8GA 5F8XA 3S0NA 1S5SA 1C2MA 1P04A 3T26A 4DY7B 3RU4E 3UR9A 5EPYA 3MWIU 1NN6A 1TPOA 4OS5A 1O3NA 1GI4A 2AGEX 5E8EH 1CT2E 1RD3B 1GJAB 1NFXA 3SJ9A 3F1SB 4MNXA 1ZHMA 2P8OC 3ZVGA 1YPHE 1P05A 2ZFQH 1C1RA 1B7XB 4KGAA 4ZROA 2ZA5A 1MCVA 3M7UA 1LHCH 2VWLA 1BUIA 4F49A 2NWNA 1O3FA 1T7CA 3SV9A 1MZDA 1H9HE 1QFKH 3V7TA 4FUFA 2STBE 3SUFA 1HXFH 4OS4A 4ABFA 1KYNA 1EAXA 3SNDA 1O3PB 1FQ3A 4IC6A 1KLIH 1TRYA 1V2RT 1PQAA 4Y8XA 2OTVA 2ZU5A 1NPMA 3NXPA 1BB0B 4CHAB 1AVGH 1GBLA 1J8AA 1AE5A 2Y5FA 1RJXB 1K1MA 5GJ4B 1LMWB 1S0RA 3BTGE 1QJ1B 1TFXA 5ETXA 2W7SA 2CV3A 4CRDA 3VPKA 1V2LT 4K1TA 2TBSA 4KTCA 1GBCA 3HATH 1O31A 2PSXA 4YOGA 1PPGE 2Z3CA 4FVBA 2G00A 2VB0A 2PSYA 3UOUA 3BIUH 6CHAC 3Q3XA 2WPLS 4BAMB 1NO9H 2VIPA 4AYYB 2ZTXA 3T27A 1XXFA 3L33A 1TRMA 1BMAA 1AUJA 1C5RA 1UTJA 2A7HA 4BTIB 1XUKA 4Y8YA 2PUQH 2ZGHA 3LH1A 2QC2A 1HYLA 4O3UA 2VIQA 1TWXB 4B2CA 2ODQA 3URCA 1F0SA 4Q80A 1O3LA 1XM1A 1AHTH 4X8VH 4IGDA 1A5IA 4YT7H 1JIRA 2A45B 1O5DH 3DFLA 1PFXC 1A5HA 3MYWA 3RM2H 1THSH 1XVMA 3LOXA 3VEQB 5GPIB 1MUEB 2FP7B 3PMBB 5FXLA 1O5FH 1YPGH 3V13A 2WV5A 2ZDVH 2ZTYA 3PMHB 1NRNH 3PV4A 3IWMA 4FUIA 2J95A 3VGCC 1O36A 1O5BB 1O2SA 3GCHC 3A7XA 1IQEA 1HAHH 2SGQE 2VNTA 5DP7A 1C1VH 3E3TA 2P95A 2HLCA 1O5AB 3BTEE 4Y79A 1L1JA 3PLPA 1ZYOA 4DOQA 3OTJE 3UREA 4MQAA 3V12A 1O35A 3UQOA 4ABEA 3RXVA 1JXPA 3A89A 3QTVH 3KIDU 2ZNKH 1EPTC 2HALA 1DUEA 1EJNA 1P06A 3ZYDA 3U8TH 1ZTJA 4U2WA 3DUXH 1OWIA 4ABAA 1EKBB 3IG6B 3RXJA 1O2RA 1PPFE 1W13U 3AASA 7GCHG 1C2IA 2ZECA 2ZQ1A 3Q76A 1VGCB 1AE8H 1W7GH 3BTHE 3MNSA 3A7TA 1CA0B 3A86A 2ZFRH 1S82A 1GMDF 5E2PA 4ZKOU 1GBEA 2TGAA 2QF0A 5I46H 2TGPZ 2F9VA 4K1EA 2G52A 1AWHB 3MOCA 1KXBA 5BPEA 1V3XA 1GI2A 1J16A 3LDXH 3ZVFA 2RA3A 3TGKE 1AVXA 4MNVA 4Q7ZA 1VITH 2JETB 2Y5HA 1V2UT 1O3IA 5FHTA 4J2YB 1J17T 1TPSA 3U8RH 3CENA 2O8MA 1ZHRA 1BA8B 2HPPH 1A46H 2ODYB 1O3AA 4FUGA 4F4OC 1GCDA 2PHBA 1MMJN 3EYDA 1AY6H 3FZDA 3E90B 2VU8E 1CGJE 1ELVA 1T32A 2VJ1A 3NK8A 1NFYA 1V2KT 4X6MA 1HJAC 1UTKA 5H4IB 2ZHWH 3RXGA 4O03A 4GSOA 3A84A 1GJ9B 1YCPM 4UFDH 5EGMA 1YPLH 1A5GH 1VZQH 4UE7H 1Q31A 1P8VC 4Y0ZE 2V3OH 2QIQA 3EA7A 3HKIB 2FOCA 1F5KU 4X2XA 4I32A 2RDLA 2AERH 2YOLA 1UTOA 1K1LA 2BMGB 2GP9B 1O2UA 1GBDA 5TJXA 1BDAA 3SGBE 4TYDA 1BTXA 4JZEH 3DD2H 3RMNH 1MU8B 3VXEH 4B74A 1UVPA 3A8DA 1NTPA 1EZSC 1GHVH 3Q77A 3B9FH 2XC0A 3GCTF 2THFB 5G4BA 1O2QA 1Z8JB 5E0JA 5DJ7A 1O2NA 2D1JA 5DKMA 1ZRBA 4GCHG 2GDDA 3RUOA 3RXQA 8LPRA 1QL7A 2AS9A 2DE9A 5JB8S 1GGDB 4ZXXH 2ZDLA 3BTKE 1DANH 1YF4A 1ETTH 1BBRK 2BOHB 3QDZB 8KME2 4ABGA 5FBEA 1LKBA 4X2YA 1NFUA 1X7AC 1UO6A 4X1QU 3SORA 1K1OA 1SGNE 1PQ7A 2ZFFH 1C9TA 1SGPE 1EASA 1AU8A 1OP0A 1A3EH 4ABDA 4CBOA 4JCNA 4THNH 3LJOA 1FI8A 1T8NA 1F0RA 2QCYA 1WOFA 3BSQA 3D65E 3R3GB 1EAUA 3RXIA 2VH6A 3RM0H 1N6XA 2PKAB 5JB9S 4I8HA 1D6WA 1ETSH 3ELAH 1C1MA 1W0ZU 2GX4A 4JYVH 3RU4D 3RXLA 1GVZA 2VVCA 1C4V2 1SG8B 3LC5A 4BAKB 2BM2A 5HGGA 4WXVA 5C67A 3UY9A 1SBWA 1QR3E 3QZRA 3UWIA 3TJNA 1C5PA 3KEEA 2UWLA 4YESB 1HNEE 2CXVA 1FZZA 5B6OA 1C5OH 1WTHD 5CHAB 2UUKB 1GGDC 1F5LA 1NRQH 2F91A 3SJ8A 3BTWE 1OP2A 4AFZA 3T62A 3DT0H 3SV7A 2Z94A 1KSNA 5E0HA 1ANDA 3KNXA 1AKSB 1C5XB 2GMTC 2A2XH 1AI8H 3LPRA 2ESTE 1A4WH 3HPTB 2CHAB 1HLTH 1S84A 3GY4A 4XDEA 1FY5A 1MQ6A 1ZJKA 2ZCHP 5LPEA 1WQVH 3QZQA 5J4QA 3F6UH 2WPHS 1ZGIA 2EEKA 1IQIA 5DP3A 3NKKA 3GICB 4Q7YA 3OX7U 5FX6A 1P2QA 1JWTA 3KN2A 1Z8IB 3BF6H 1HBTH 1C1SA 2D8WA 5C3NA 3CS7A 2FLRH 4CR9A 4GVUA 1ID5H 5GCHG 3A82A 2BLWA 1HCGA 2VIDA 4JK5A 2FOEA 5AFYH 1VGCC 1TX8A 3GDUA 3LGWA 4AN7A 4ZKRU 1SMFE 1UTQA 1O3OA 1GJBB 1CHOF 4ISHH 2OC8A 1OWJA 2BD5A 3EA9A 1BMLA 1ELDE 4X8SH 1FLEE 1CHOG 3TIUA 4BAHB 2Z6BD 4A6LA 3PLBA 2HVXA 3CP7A 1HAZB 3ODDA 1NU9A 4AB9A 2ZFTA 4NIXA 1RRKA 4KKDA 1G9IE 4TWWA 3SBKA 3ATIA 4KTSA 4Y76A 1OXGA 1TQ0B 3W95A 1HAVA 2Z9JA 1BHXB 2V35A 1OYTH 4ZXYH 1GI1A 2ZI2H 1ESBA 3VB4A 1HGTH 3KHVA 3FZZA 5CE1A 3LGTA 2WPJS 2ZDNA 1ELGA 1NT1A 1GJDB 1FAXA 1BOQA 1ELBA 1L1GA 1TNLA 4X1RU 3ENSB 1LCYA 5FPYA 1A2CH 1O3DA 2Y5GA 1LVYA 3SO3A 2C93B 5AFZH 1GPZA 1WV7H 2UWPA 1DY9A 2XWAA 2FODA 2ZPRA 4X1NU 3UTUH 5L6NH 1JRSA 3PYHA 1C2HA 2A7JA 5C5NA 1ARCA 3LC3A 1DWEH 1TA2A 1K1IA 4Y11E 4BAQB 1GBIA 1BRCE 1FJSA 1WAYB 3RMMH 4KP0A 5AVDA 1DSTA 1GHBF 2YNAA 4FUBA 1P9SA 4FUJA 1AGJA 2BDIA 1QB1A 3Q00A 1UHBB 2OQUA 4ISOA 1W7XH 2FDAA 2ZIQH 3JZ1B 4FU9A 2Y7XA 1UVUH 2AYWA 1KXCA 3M3TA 1C1NA 2A31A 5LPFA 1T31A 3FANA 5A0AE 1P2NA 1C5SA 1XKAC 4GPGA 1LHGH 5EXMA 1Y3UA 4XOJA 5EXNA 2BOKA 4LZ1H 3UPEA 3EQ0H 1TB6H 3UNSA 2VWNA 3AW0A 4AZ2B 4YT6H 1UHBA 2WPMS 1MTUA 1P01A 1JMOH 1LQEA 3TNSA 1UTPA 2F9NA 4CHAC 1OWHA 1K22H 4J1YA 5DP8A 1O5GH 1ZTKA 2CF8H 2FWWA 5K7RA 2BD8A 3HGPA 1WYKA 2ZEBA 1MKWH 2XTTB 1O2OA 1Y5BT 2CN0H 4YO9A 2GT8A 2STAE 4A1TA 1YCPH 3E0NB 2QF3A 1GI5A 3TJOA 3LGYA 2R9PA 3ZZAA 1C4Y2 1SGFA 1TNHA 4TY7A 1RIWB 5A09A 1FNIA 1AQ7A 2PLXA 3VB7A 1GVLA 3U1IB 2HPQH 1UTMA 1MZAA 2G5NA 2SGEE 1DVAH 6LPRA 2VGCB 2BZAA 4DCDA 1C9PA 2EA3A 1TIOA 3MI4A 3F9HA 1EP5A 1SGFG 3MU5A 4CRAA 2TIOA 3HK6B 1C5QA 2BD9A 1IQGA 2FIRH 4NFEA 4X8TH 4I31A 1GMCF 4SGBE 3QO6A 5FAHA 4XBDA 5JBCS 3BEFB 5DGJA 2CHAC 3U8OH 4OS6A 3A87A 2FMJA 2Q6FA 1O2HA 2FTLE 2ZFPH 2B7DH 3FVFB 4B73A 4D9QA 1KDQB 2ZCLP 1H8DH 5DP6A 2IPHA 1YM0A 1L1NA 1KDQA 2FOHA 4DGJA 5EQSA 1Z1IA 1GL0E 2SGPE 2IN2A 4FUHA 5DG6A 2OC7A 1O2JA 3M5MA 3P95A 3MMGA 5FPSA 2ZPQA 3GY5A 1AFQB 4AX9H 4AGJA 1C5NH 4A1VA 2OQ5A 3RXEA 1HAOH 3SU3A 1KTTB 4X1SU 5F8ZA 3RXRA 3ZZDA 2FPZA 2BLVA 1PPHE 1OSSA 5C2ZA 3R0FA 1GDUA 3MO3A 3VGCB 3A8BA 4AB8A 2QXGA 2F9UA 3SV6A 1E0FD 2AIPA 5GXPA 5K0HA 2ZHQH 3Q3YA 5C1YA 4AOQA 4TWYA 4IS5A 1C2LA 1SB1H 1LQDB 3GYLB 1OS8A 2BB4A 1VJAU 1HAVB 2WUCA 3T2NA 3KF2A 2FOAA 3SOSA 2BX4A 1O38A 3OYPA 1QL9A 2C8XB 2PKSB 2R0LA 2ANYA 4OGYA 1O37A 4NIYA 1PYTD 2OINA 3S7KB 3P8NA 1GHAF 4NZQA 2V0BA 3HK3B 4ABBA 2ZPSA 2ULLA 1A3BH 1ZHPA 1FIZA 3LU9B 3Q3KA 3P17H 2XBVA 3BEIB 3DHKH 2RA0A 4X2VA 3UFAA 1HJAB 2P93A 1CA0C 1S6FA 1TOCB 1AD8H 1FN8A 2FYQA 3M35A 3OY5U 2UUFB 2Y7ZA 5GCHF 3U1JB 3NUMA 2WUBA 4D8NA 1QRZA 1TYNA 4GAWA 5EQQA 4IMQA 1YKTA 1DY8A 1P0SH 2JETC 1TBQH 2BQWB 3GY8A 3STJA 4X2WA 3RC4A 1QB9A 3LGIA 4OS1A 3URDA 2O8LA 3PTBA 3M36A 4CBNA 1BCUH 1CT0E 1PJPA 1DXPA 2TGTA 2B5TB 1RTKA 4M7GA 1A1RA 4I33A 3TK6A 5A8ZA 1GCTB 1XMNB 1IQJA 3FAOA 2BLOA 5A8YA 1C4U2 3A85A 1G36A 1L4ZA 4NA7A 3K2UA 3BTFE 4U01A 3A80A 3RC5A 2GDEH 3P6ZB 1NC6A 3VB5A 5DP5A 3RLYH 1XX9A 1GBFA 1MD8A 2PKAA 3M5LA 4ZHAA 2AIQA 4I7YH 2AMQA 2BY8X 4R0IA 2SGDE 1EUFA 1OYQA 3LT3A 1SGRE 2A4GA 5J4SA 4K2YA 2B8OH 7LPRA 1HJ8A 2G51A 2PGQB 1C1QA 2XCNA 1V2QT 4Y0YE 4E05H 2J4IA 1AZZA 1MD7A 2A32A 3MH4A 4LK4A 4U32A 2GZ8A 4B71A 4IBLH 3D62A 3SHAH 1LTOA 1RIWC 2H9TH 1TGBA 1N6YA 1FY8E 5IYTA 1O2IA 1OKXA 4CRCA 1K2I1 2VWOA 1UTLM 3G01A 3RXCA 1HPGA 1C1OA 3BN9A 3K6YA 5CHAC 4FU7A 1O2ZA 1BRUP 1CT4E 1OWKA 1C5ZB 1INCA 1DWBH 5T6FA 2A7CA 4Y6DA 1CGIE 1TGNA 1BIOA 1AWFH 3JZ2B 1ZMLA 4VGCC 1LHEH 3B23B 1LVMA 3MTYA 1LHFH 1C1WH 1HDTH 4DIHH 3B8JA 3SW2B 4BOHA 3GOVB 1NROH 1IOEA 2BDAA 3MU0A 4E06H 3QX5H 2R0KA 1Y3VA 5E0GA 2FEQH 4JYTA 2IOTA 3C27B 4BANB 1QNJA 1FXYA 4CRBA 2Z9LA 1LVOA 1SGQE 1NRRH 2G4TA 1K1PA 1ZGVA 2W5EA 1GBKA 1MTWA 2AMDA 4KTUA 2UWOA 5EU8A 1SGYE 2XXLA 4QT8C 4X6PA 1DLKB 1ZLRA 1ZPBA 2BDBA 3S7HB 2QY0B 1AFQC 1D4PB 4ZH8A 5EW1H 1Z1JA 1Y3XA 1WUNH 1IAUA 1EJAA 1DDJA 4CRFA 4IN1A 3TH4H 5ESBA 1B0EA 2FO9A 2WPIS 4JYUH 2OC0A 3ZZ5A 1SLXB 4NWLA 1TX7A 1YLCA 4RKJB 1N1LA 1O0DH 1GHAG 1CVWH 1YPJH 2XRCA 2RG3A 3MH7A 4ISIH 1VCWA 4NWKA 3RLWH 1H8IH 2BD2A 2QXIA 3BG8A 3GCOA 4BTUB 1UCYK 4LOYH 4X6OA 4ISLA 2IJOB 3D49H 3ZZ4A 1UMAH 5FX5A 3EAJA 1MAXA 3F9EA 2FZZA 3D23A 3ATKA 1XUHA 2AH4X 1FV9A 1SLWB 1O30A 1ZSJA 1NS3A 1V2JT 3SJIA 1GHYH 3LONA 1Z71A 1D3TB 1ZMJA 3LH3A 1BQYA 2OC1A 3PM3A 3RMOH 5T6DA 4BXWA 1QTFA 1DXWA 1CGHA 2BYAX 1XKBC 1HFDA 1O2WA 3TNTA 1YBWA 4AFQA 4ZAEA 3A7VA 1WQSA 1IQFA 3OU0A 4ABIA 1SL3A 3A81A 1GWAA 2F9BH 2H5DA 2PR3A 3GDSA 1EJMA 3ZVEA 4JZFH 1ANCA 4X0WU 2HNTE 1ANEA 4FUEA 4B75A 4I8KA 2OUAA 1W2KH 3RXSA 1E35B 2GCTB 4H6TA 3KQBA 2O8UA 3TK5A 2GCHG 1RGQA 3LGUA 4CRGA 1YC0A 2AMPA 2BTCE 3FP7E 1W12U 2W3IA 1EAIA 3NZIA 3RXPA 4I8GA 4O97A 3SUGA 1C5VA 4LXBH 1AN1E 2HWLB 4HI3A 2F3CE 3ZV9A 1MU6B 2SGAA 4NSYA 5EG4A 2O8WA 3ODFA 2H9EH 3PO1B 1FONA 1LKAA 1OPHB 3VB6A 4K5ZA 1RXPA 1E36B 4MTBA 1HRTH 3I78A 1JOUB 1GCTC 3QTOH 1YYY1 2DUCA 4INHA 5HM2A 2A5AA 3RXOA 2JKHA 2Y6TA 1BJVA 4GHQA 1DE7H 5SGAE 2P3TB 3MFJA 1GMCG 2VIWA 3L3TA 6CHAB 4XSKU 3PTNA 1FDPA 4I8LA 1S6HA 3AW1A 2FOBA 3QGNB 1O2TA 3RC6A 2P94A 4TPIZ 1XUGA 1O3HA 5LH8A 2QXJA 3ATWA 4R8TB 2SNVA 1MCTA 1MBMA 2GMTB 1SI5H 4JMYA 1KXDA 1S83A 1EQ9A 2TRMA 3SV2H 4MVNA 4FXGH 2GT7A 1AB9B 1MKXK 1PPZA 2ALPA 4YOJA 1GHXH 1F0UA 2BY7X 3SI3H 1WU1A 1YPMH 2VWMA 5ESTE 5F6MA 2V6NA 4O3TA 3BTQE 1QQUA 1Y8TA 1KTSB 1T8MA 2ILNA 3ZZBA 1ESAA 2QA9E 2J34A 3KQEA 4ZKSU 1L4DA 5A8XA 5L2ZH 3SHCH 1Z8RA 4CREA 3MH6A 5FPTA 1C5WB 1C5UA 1V2NT 2VGCC 3OSYA 2BX3A 1GG6C 3QWCH 1DFPA 3BG4B 4GLYA 1BTWA 4Y7AA 1HXEH 5EPNA 3ZV8A 2BLQA 3RU4T 1T4VH 2Q1JA 2PW8H 2VVUA 3K9XB 1SFQB 1J15A 3TLOA 2PFEA 9LPRA 2KAIB 2FOGA 1S81A 4MNWA 1ELCA 1AB9C 1TNGA 2ODPA 5EOKA 1UVOA 2YNBA 1UK4A 1KLTA 1UCYH 1WCZA 4JZ1A 4Q7XA 1DPOA 4WMEA 3GISB 1IQMA 1O3GA 1QJ6B 1EX3A 3GY7A 1AVWA 3TVJB 3DA9B 1SQOA 4UDWH 3O8RA 2SGFE 5DK1A 3PB1E 1TPPA 1OOKB 2H5CA 4NA8A 3K6ZA 4MPVA 3TGJE 1EPTB 1BTYA 1G3BA 3SU6A 2ZDKA 4CH2B 1MH0A 4BNRA 1FN6A 3A7ZA 1BRBE 4XBBA 2K1QA 3AAVA 2FI4E 5GIBA 1P02A 3MNBA 2R3YA 3ZZ3A 2XNIA 1Z7KA 1HAXB 4DW2U 2A2QH 1H9IE 2LNCA 1ACBE 3RP2A 4A5TS 3ZZ8A 3GCNA 2ZGCA 4H4FA 3T29A 1QGFA 1P2JA 1FY3A 1MTVA 4DG4A 2WPKS 1SSXA 1ABJH 1GVKB 1BBRH 1GBMA 1AZ8A 3EDXB 1LPGB 2R2MB 4D7FA 1GBAA 1EB1H 2M5TA 1YPEH 2RCEA 3UQVA 1BJUA 3TU7H 3STIA 3SNCA 4MPWA 4ZKNU 3QUMP 4CH8B 1O34A 3UR6A 5ABWA 2D2DA 1V2PT 1U6QA 1SHHB 1MAYA 2R2WU 1G32B 3MH5A 1MQ5A 5A0CA 4DIIH 1BRAA 1Y59T 3SU5A 4WH8A 5JBAS 4WH6A 1BMMH 1K1JA 1RFNA 4RN6A 2PKSC 2KAIA 3U98H 2OBOA 1GBHA 4AFUA 4UFFH 1ORFA 1UTNA 3ZZCA 2P59A 1T4UH 2UUYA 3TPIZ 4B2BA 1W3CA 2ANMH 1TX6A 2ZU2A 2I6SA 3SU4A 2J38A 5TCAA 1SPJA 4FVDA 2PTCE 1Y5AT 2BVRH 5LGOA 1A0LA 1IHSH 3I77A 2HOBA 2FOMB 1QQ4A 1TGTA 5AHGH 3PMAB 2I6QA 1V6DA 3T5FH 2XBWA 1KLJH 1G3EA 2O8TA 2ZZUH 4E7RG 1SOZA 3ZZ7A 3GYMA 4MDSA 4JZDH 2B0FA 1TBRH 1TABE 2AEIH 4NIWA 8ESTE 5HMAA 1AKSA 2C8ZB 1GI3A 2ZKSA 1Z6JH 1KXAA
chains in the Genus database with same CATH superfamily
4P02A 3DSOA 3ZYEA 2V3MA 1HAYB 5DPAA 1CE5A 3DFJA 1W11U 1QY6A 1O2KA 2FI3E 2NU0E 2ZU4A 1O39A 4DT7B 3BTTE 5HXFA 1O2MA 3FP8E 3V3MA 5EJLA 5JBBS 1OWEA 1QJ7B 2BY5X 3RXMA 1DUAA 1O5EH 3ZVDA 2BD4A 1CA8B 3O8CA 2OP9A 4UEHH 3RXFA 4FUCA 2FYRA 2SFAA 1NRSH 1DWCH 4Z6AH 2ZG0H 5DO4H 1V2VT 2ZDAH 1UK2A 5L2YH 1P2OA 1LPKB 1H4WA 3RXTA 2BDYA 5JBTA 1ELAA 2OXSA 3EA8A 2C4FH 3RXBA 3SGAE 4JZIA 4NSVA 1EB2A 2OLGA 1EOLA 3H7TA 1D6RA 1ABIH 3ATLA 2J2UA 3KL6A 2PV9B 2ZFSA 4IMZA 2BZ6H 3TJUA 1GI9B 2J9NA 1C2GA 1GDNA 4YTAA 1V2MT 1O2LA 2ZHEH 4NA9H 1AFEH 1IQHA 6ESTA 1GI0A 4NGAH 2XBXA 3ZVCA 1TE0A 2Z3DA 3AAUA 3BTDE 2WV9A 2KFWA 4XE4A 3VFEA 5EJ1A 4WMDA 3ZZ9A 3LGVA 5IDKA 3F0PA 2KCPA 5DP4A 1QURH 1OHHD 1C2JA 2HRVA 2EC9H 3UB0A 4SGAE 2P16A 1G3DA 2G4UA 4B6EA 4Y8ZA 1GG6B 4UONA 3M61U 2ZU3A 4HG6A 1F0TA 1QBVH 4YXWD 1H1BA 2ZDMA 1QA0A 4YOIA 4NCYA 1H8ED 1TNJA 1L2EA 1QB6A 2ZHFH 2F9PA 3UWJH 3S9BA 2C3SA 1Q2WA 1D3QB 1CBWC 4INLA 2ZGXH 1GJ8B 1BBRE 4BAOB 1DX5M 2LPRA 2SNWA 4VGCB 3M7TA 2BD7A 1P9UA 1THRH 1SFIA 4AORA 2VH0A 1THPB 1D3PB 4RSPA 2JDID 2UUJB 2G8TA 2CMYA 2C8WB 4Z1MD 3OY6U 3PROA 1W8BH 4H42U 1XUJA 3A83A 3BTME 4DVAU 2LP6A 2FM2A 3SJOA 1GI6A 2ZWLH 3GY3A 1L0ZA 1YGCH 1ZTLA 1BTHH 4AYVB 1C5MD 1ZSLA 1ZR0A 3RXHA 1TGSZ 1SLUB 1B5GH 1UVTH 3M5OA 1C5TA 1GJ5H 1QBNA 1K9OE 1V2OT 1O5CB 3FOAA 1EXFA 4Y7BA 1H9LB 1FPCH 1C2DA 2ZTZA 3NPSA 4Y71A 2YMSD 1W0YH 1TBZH 3RMLH 4ISNA 1AUTC 3SQHE 1QRWA 4NG9H 3IITA 1SQTA 3AK5A 4ESTE 1YLDA 3M7QA 2Z7FE 1EPTA 1W10U 4DJZB 3M3VA 2GCHF 3MHWU 3M37A 1G30B 4MPXA 1N8OB 2GVFA 1A0HB 1O3EA 2ZO3H 4A7IB 1FUJA 1TNIA 4GUXA 1IQKA 5CMXH 1KXEA 2H1UA 2XWBI 2W26A 4NZLA 1GI8B 1MKWK 3OE7D 3A88A 3H7OA 1E1QD 5JYIA 3KCGH 3TH3H 2K8IA 1NFWA 1Y3YA 2EI7A 2QN5T 1SR5C 1K1NA 2JH0D 3P92A 2PGBB 3MNXA 1V2ST 1DT2A 4RT0A 4B76A 3A7YA 4O9VA 1EATA 3P8OA 2ZF0H 1ZPCA 2G55A 2BXTH 2O9QA 1O3BA 1EZQA 2Q6GA 1P2MA 1LVBA 2EI8A 4U30A 1XXDA 1CSOE 1Y3WA 1DICA 4I8JA 2AGGX 1C2KA 4UD9H 2JH6D 3QK1A 1HIAA 1MBQA 2WSSD 2FS8A 1GJ6A 1O3JA 1C1PA 1T8LA 3BIVH 1KMHB 4WWYA 4H6SB 3QGJA 1E79D 1P10A 1C1TA 1O3KA 1DOJA 1SHYA 2W6JD 1YP9A 1B0FA 2A4QA 2FX6A 8GCHG 3SV8A 3KGPA 3F68H 4Z0KA 1XUFA 1GJ7B 5GDSH 2ZCKP 2OK5A 3GDVA 2PP6A 4B1TA 4FUDA 4PROA 1EAWA 2H2ZA 4WJG2 5A2MH 4OM9A 2NU1E 1TLDA 4D9RA 8GCHF 1VCPA 1BITA 1MTSA 1ESTA 1OP8A 1A7SA 1P3CA 1ANBA 1VR1H 2BD3A 3PO1C 4UFEH 1BMNH 1VITF 4RKOB 2VBCA 4ZMAH 3UIRA 4IN2A 1BT7A 4YM9A 2XC4A 3DSGA 2XC5A 1YPHC 3MO6A 4WXIA 1ARBA 5L30H 1RTLA 3SU0A 1VJ9U 3E8LA 1AIXH 1P57B 5F8TA 3C1KA 4LZ4B 1IQNA 1BHXF 5C94A 2GCTC 2NU4E 1GMHF 3HKJB 2BY9X 4MLFB 1IQLA 3FP6E 1QHRB 2Z9KA 4NFFA 4DURA 1F5RA 3DSPA 4A1XA 5LPRA 1F92A 2OD3B 1HV7A 2Y80A 3LIWA 1J9CH 1D3DB 4ASHA 2CF9H 2ASUB 1V2TT 5T3HA 1ZOMA 1LHDH 2GD4B 3E16B 4IW4E 4B2AA 2HGTH 1QA7A 4BTTB 2BDHA 3F9GA 2R3UA 5I25A 1IHTH 3W94A 1AO5A 1WBGB 2HNTC 1NY22 2PTNA 3K65B 3LKWA 5HIYA 2QAAA 7GCHF 1P2IA 3O8BA 5IK2D 2C90B 1UVSH 1NU7B 4ABJA 2PWXA 3S9CA 5PTPA 1BTUA 3M3SA 3PMJA 1GI7B 1S0QA 5F03A 1SC8U 2EI6A 1GHZA 3SNAA 3AVZA 2XCFA 1BZXE 3RXDA 1O2YA 1CO7E 1CBWB 1O2XA 2FLBH 2B9LA 4F55A 4K69A 1DITH 3T25A 1O2GH 1P12E 1S6LA 2GV6A 2A5IA 1P2KA 2GGVB 4HZHA 4K60A 2BY6X 4GCHF 5A0BA 5DP9A 2D26C 3BEUA 1ELEE 2V3HH 1T8OA 1TA6A 1COWD 3BG4C 4D7GA 5C1XA 1P11E 3SZNA 2VIVA 5FCKA 3EGKH 1GBTA 1HIAB 2VIOA 1W14U 2A4OA 3F2GA 2FX4A 4HTCH 1MTNC 1DS2E 1SGTA 3RXKA 2IJD1 2KX4A 1A0JA 1XUIA 2BDGA 1BMFD 2ZC9H 1PQ8A 1TOMH 4E7NA 2F83A 2A0QB 3P8FA 3PWBA 4Q2KA 1F7ZA 1O2PA 5GWZA 4INKA 1GDQA 3M5NA 3BV9B 1GHWH 2J92A 4GHTA 2Z3EA 3N7OA 3FFGA 1G2MA 1ETRH 1ZRKA 3SU1A 1FMGA 1ELTA 2BDCA 2ZQ2A 1OX1A 1N8OC 7KMEH 4MPUA 2WZQA 2G81E 2WINI 4WY3A 7ESTE 2W7UA 4B6FA 1V2WT 1GBBA 1P03A 2W6ID 2KCYA 1TMBH 3S69A 4OGXA 1SQAA 2FS9A 4TPYA 5JPMH 2Y81A 3ZVBA 1O32A 2GV7A 3ZVAA 1NM6A 3PWCA 2ZU1A 1KXFA 1FY4A 1SOTA 4K3JA 1D9IA 5T1VA 3SUEA 2H9HA 1LDTT 2A1DB 1HUTH 3MU1A 2NU3E 2Z9IA 1C5LH 3T28A 6GCHF 2OCVB 1EZXC 3E6PH 1TMTH 2WV4A 3KQCA 3O8DA 4X6NA 3E1XB 2P8OB 2QGRA 2BHGA 1GBJA 4TY6A 4YLUA 1TALA 1DM4B 1G3CA 6GCHG 5HYOA 4WMFA 1Z8GA 1HAPH 2GZ7A 1DSUA 4OS7A 1TONA 5C1UA 2XNDD 4JK6A 4YZUA 2TPIZ 3E91A 2CJIA 1JRTA 2JH5D 4K8BA 4K8YA 1C2FA 4AGKA 3WY8A 1YPKH 1ZSKA 5EXLA 3GY2A 1Q3XA 4ZHMU 3F9FA 2HNTF 3U9AH 4MNYA 3QLPH 2QYIA 4ZHLU 2VVVA 1GJCB 1SGDE 3H5CB 3RXUA 3E0PB 1GJ4H 1J14A 2YMSB 3SNEA 2ANWA 2AGIX 3DCLA 2BQ7B 3OTPA 4HFPB 2RFKC 2XW9A 2F9OA 3ESTA 2K0QA 3SUDA 1HB0B 1JIMA 1SGCA 1WTGH 1TMUH 4HGCA 1NRPH 1ZJDA 2BQ6B 1FPHH 4IC5A 1RS0A 4KELA 1F2SE 2ZP0H 3RXAA 1ZMNA 1E1RD 1PQ5A 4BXSA 1LO6A 2WYJA 3W1EA 2C8YB 3SN8A 1BTPA 1BTZA 2BXUH 3HGNA 5EW2H 1PPCE 3ZZ6A 1C5YB 3TGIE 3SI4H 3MO9A 1LPZB 1CHGA 1HAIH 2J98A 3GCTG 1VCQA 3PV2A 1FAKH 2QXHA 3PLKA 5FCRA 2TGDA 3NWUA 4ZUHA 3SJKA 2P3UB 3SNBA 1PYTC 1MABB 3NCLA 4WVPE 2PUXB 5B6LA 1O33A 1SLVB 1E34B 1CQQA 2G5VA 1Y5UT 2J97A 4D76A 5KECA 1TNKA 1TAWA 1Z6EA 1TQ7B 2ANKH 3ITIA 2KZ4A 1ELFA 3PV5A 3A8CA 1RTFB 1EOJA 3P70B 4FU8A 1MTNB 2P3FH 1E37B 2J94A 3A8AA 3MU8A 2ZGBH 3TITA 4XBCA 4ABHA 1JBUH 3SQEE 2ZGJA 1QBOA 3I29A 1SGEE 3TH2H 1P3EA 4NIVA 2OBQA 1E38B 3LJJA 1KIGH 4WF8A 5T6GA 5HM9A 5AF9H 2XYAA 2ALVA 5EODA 3ATMA 3KQDA 1O2VA 1GMDG 1O3CA 2H6MA 1EP6A 3CS0A 3SU2A 2NU2E 1KY9A 1QL8A 1XVOA 1K21H 1SVPA 1QCPA 1M9UA 1NZQH 1P09A 1UK3A 2FTMA 1OWDA 2DE8A 2Z9GA 5JDUB 1TGCA 1GHBG 1ZPZA 2BVXH 1G37A 1ZZZA 1CU1A 5FBIA 3GCHB 3PRBA 2Q6DA 4AFSA 2AFQB 4X1PU 1PPBH 2W3KA 2VINA 2QV1A 1C1UH 3OEED 4OS2A 2WYGA 4Y10E 1GMHG 1WSSH 3U69H 3UOPA 1HJ9A 1FY1A 1S85A 2Y82A 4CR5A 1SGIB 1PPEE 2FXRA 3A7WA 2GKVE 1EZUC 3S9AA 1G2LA 2GZ9A 4MG3A 3VB3A 2CGAA 4UFGH 3QN7A 3GY6A 2XBYA 2A5KA 1H8HD 4A92A 1TPAE 1O3MA 1UCYE 2FI5E 2FESH 5C5OA 5BRRE 3SGQE 2GTBA 1VITG 5F53A 3L6PA 4K1SA 1DWDH 3UNRA 1AMHA 1QZ8A 5TCCA 1HAGE 9ESTA 3UNQA 3EE0B 2ZHDA 3MNCA 5C20A 1A61H 5EQRA 1DLEA 1K28D 4FETA 3TK9A 3V0XA 1NESE 3VXFH 1MKXH 2KCAA 4YLQH 3TJVA 5E2OA 1YCPK 1QRXA 1TRNA 3RDZA 3UUZA 4XFQA 4X8UH 4Q4LA 1GL1A 2BVSH 1C2EA 4AG2A 2FOFA 1UJ1A 2A4RA 1QIXB 3MU4A 4AG1A 1FIWA 3P8GA 5F8XA 3S0NA 1S5SA 1C2MA 1P04A 5CHBA 3T26A 4DY7B 3RU4E 3UR9A 5EPYA 3MWIU 1NN6A 1TPOA 4OS5A 1O3NA 1GI4A 2AGEX 5E8EH 1CT2E 1RD3B 1GJAB 1NFXA 3SJ9A 3F1SB 4MNXA 1ZHMA 2YMSC 2P8OC 3ZVGA 1YPHE 1P05A 2ZFQH 1C1RA 1B7XB 4KGAA 2JJ2D 4ZROA 2ZA5A 1MCVA 3M7UA 1LHCH 2VWLA 1BUIA 4F49A 2NWNA 1O3FA 1T7CA 3SV9A 1MZDA 1H9HE 1QFKH 3V7TA 4FUFA 2STBE 3SUFA 1HXFH 4OS4A 4ABFA 1KYNA 1EAXA 3SNDA 1O3PB 1FQ3A 4IC6A 1KLIH 1TRYA 1V2RT 5C17A 1PQAA 4Y8XA 5C0TA 2OTVA 2ZU5A 1NPMA 3NXPA 1BB0B 4CHAB 1AVGH 3OAAD 1GBLA 1W0KD 1J8AA 1AE5A 2Y5FA 1RJXB 1K1MA 5GJ4B 1YLNA 1LMWB 1S0RA 3BTGE 1QJ1B 1TFXA 3NRLA 5ETXA 2W7SA 2CV3A 4CRDA 3VPKA 1V2LT 4K1TA 2TBSA 4KTCA 1GBCA 3HATH 1O31A 2PSXA 4YOGA 1PPGE 2Z3CA 4FVBA 2G00A 2VB0A 2PSYA 3UOUA 3BIUH 6CHAC 3Q3XA 2WPLS 4BAMB 1NO9H 2VIPA 4AYYB 2ZTXA 3T27A 1XXFA 3L33A 1TRMA 1BMAA 1AUJA 1C5RA 1UTJA 2A7HA 4BTIB 1XUKA 4Y8YA 2PUQH 2ZGHA 3LH1A 2QC2A 1HYLA 1YWUA 4O3UA 3ZIAD 1TWXB 2VIQA 4B2CA 2ODQA 3URCA 1F0SA 4Q80A 3WW7A 1O3LA 1XM1A 1AHTH 3KYFA 4X8VH 4IGDA 1A5IA 4YT7H 1JIRA 2A45B 1O5DH 3DFLA 1PFXC 1A5HA 3MYWA 3RM2H 1THSH 1XVMA 3LOXA 3VEQB 5GPIB 1MUEB 2FP7B 3PMBB 5FXLA 1O5FH 1YPGH 3V13A 2WV5A 2ZDVH 2ZTYA 3PMHB 1NRNH 3PV4A 3IWMA 4FUIA 2J95A 3VGCC 1O36A 1O5BB 1O2SA 3GCHC 3A7XA 1IQEA 1HAHH 2SGQE 2VNTA 5DP7A 1C1VH 3E3TA 2P95A 2HLCA 1O5AB 3BTEE 4Y79A 1L1JA 2QF4A 3PLPA 1ZYOA 4DOQA 3OTJE 3UREA 4MQAA 3V12A 1O35A 3UQOA 4ABEA 3RXVA 1JXPA 2V7QD 3A89A 3QTVH 3KIDU 2ZNKH 1EPTC 2HALA 1DUEA 1EJNA 1P06A 3ZYDA 3U8TH 1ZTJA 4U2WA 3DUXH 1OWIA 4ABAA 1EKBB 3IG6B 3RXJA 1O2RA 1PPFE 1W13U 3AASA 7GCHG 1C2IA 2ZECA 2ZQ1A 3Q76A 1VGCB 1AE8H 1W7GH 3BTHE 3MNSA 3A7TA 1CA0B 2KR7A 3A86A 2ZFRH 1S82A 1GMDF 5E2PA 4ZKOU 1GBEA 2TGAA 2QF0A 5I46H 2TGPZ 2F9VA 4K1EA 2G52A 1AWHB 3MOCA 1KXBA 5BPEA 1V3XA 1GI2A 1J16A 3LDXH 3ZVFA 2RA3A 3TGKE 1AVXA 4MNVA 4Q7ZA 1VITH 5CDFE 2JETB 2Y5HA 1V2UT 1O3IA 5FHTA 4J2YB 1J17T 1TPSA 3U8RH 3CENA 2O8MA 1ZHRA 1BA8B 2HPPH 1A46H 2ODYB 1O3AA 4FUGA 4F4OC 1GCDA 2PHBA 1MMJN 3EYDA 1AY6H 3FZDA 3E90B 2VU8E 1CGJE 1ELVA 1T32A 2VJ1A 3NK8A 1NFYA 1V2KT 4X6MA 1HJAC 1UTKA 1VKYA 5H4IB 2ZHWH 3RXGA 2GJGA 4O03A 4GSOA 3A84A 1GJ9B 1YCPM 4UFDH 5EGMA 1YPLH 1A5GH 1VZQH 4UE7H 1Q31A 1P8VC 4Y0ZE 2V3OH 2QIQA 3EA7A 3HKIB 2FOCA 3UAIC 1F5KU 4X2XA 4I32A 2RDLA 2AERH 2YOLA 1UTOA 1K1LA 2BMGB 2GP9B 1O2UA 1GBDA 3N7DA 5TJXA 1BDAA 3SGBE 4TYDA 1BTXA 4JZEH 3DD2H 3RMNH 1MU8B 3VXEH 3F2HA 4B74A 1UVPA 3A8DA 2EQNA 1NTPA 1EZSC 1GHVH 3Q77A 3B9FH 2XC0A 3GCTF 5GNDA 2THFB 5G4BA 1O2QA 3KQ5A 1Z8JB 5E0JA 5DJ7A 1O2NA 2D1JA 5DKMA 1ZRBA 4GCHG 2GDDA 3RUOA 3RXQA 8LPRA 1QL7A 2AS9A 2DE9A 5JB8S 1GGDB 4ZXXH 2ZDLA 3BTKE 1DANH 1YF4A 1ETTH 4ASUD 1BBRK 2BOHB 3QDZB 8KME2 4ABGA 5FBEA 1LKBA 4X2YA 1NFUA 1X7AC 1UO6A 4X1QU 3SORA 2LELA 3FKSD 1K1OA 1SGNE 1PQ7A 2ZFFH 1C9TA 1SGPE 3N7EA 1EASA 1AU8A 1OP0A 5EIYA 1A3EH 4ABDA 4CBOA 4JCNA 4THNH 3LJOA 1FI8A 1T8NA 1F0RA 2QCYA 1WOFA 3BSQA 3D65E 3R3GB 1EAUA 3RXIA 2VH6A 3RM0H 1N6XA 2PKAB 5JB9S 4I8HA 1D6WA 1ETSH 3ELAH 1C1MA 1W0ZU 2GX4A 4JYVH 3RU4D 3RXLA 1GVZA 2VVCA 1C4V2 1SG8B 3LC5A 4BAKB 2BM2A 5HGGA 4WXVA 5C67A 3UY9A 1SBWA 1QR3E 3QZRA 3UWIA 3TJNA 1C5PA 3KEEA 2UWLA 4YESB 1HNEE 2CXVA 1FZZA 5B6OA 1C5OH 1WTHD 1FX0B 5CHAB 2UUKB 1GGDC 1F5LA 1NRQH 2F91A 3SJ8A 3BTWE 1OP2A 4AFZA 3T62A 3DT0H 3SV7A 2Z94A 1KSNA 5E0HA 1ANDA 3KNXA 1AKSB 1C5XB 2GMTC 2A2XH 1AI8H 3LPRA 2ESTE 4TSFD 1A4WH 3WWBA 4ZCNA 3HPTB 2CHAB 1HLTH 1S84A 3GY4A 4XDEA 1FY5A 1MQ6A 1ZJKA 2ZCHP 5LPEA 1WQVH 3QZQA 5J4QA 3F6UH 2WPHS 1ZGIA 4Q63A 2EEKA 1IQIA 5DP3A 3NKKA 3GICB 4Q7YA 3OX7U 5FX6A 1P2QA 1JWTA 3KN2A 1Z8IB 3BF6H 1HBTH 1C1SA 2D8WA 5C3NA 3CS7A 2FLRH 4CR9A 4GVUA 1ID5H 5GCHG 3A82A 2BLWA 1HCGA 2J98B 2VIDA 2FOEA 4JK5A 5AFYH 1VGCC 1TX8A 3GDUA 3LGWA 1SQRA 4AN7A 4ZKRU 1SMFE 1UTQA 1UW7A 1O3OA 1GJBB 1CHOF 4ISHH 4ACAA 2L74A 2OC8A 1OWJA 2BD5A 3EA9A 1BMLA 1ELDE 4X8SH 1NBMD 5DSFA 1FLEE 1CHOG 3TIUA 4BAHB 4F48B 2Z6BD 4A6LA 3PLBA 2HVXA 3CP7A 1HAZB 2EY4C 1WXRA 3ODDA 1NU9A 4AB9A 2ZFTA 4NIXA 1RRKA 1NBME 1G9IE 4KKDA 4TWWA 3SBKA 3SYJA 3ATIA 4KTSA 4Y76A 1OXGA 1TQ0B 3W95A 1HAVA 2Z9JA 1BHXB 2IPQX 2V35A 1OYTH 4ZXYH 1GI1A 2ZI2H 1ESBA 3VB4A 1HGTH 3KHVA 3FZZA 5CE1A 3LGTA 2WPJS 2ZDNA 1ELGA 1NT1A 1GJDB 1FAXA 1EFRD 1BOQA 1ELBA 1L1GA 1TNLA 4X1RU 3ENSB 1LCYA 5FPYA 1A2CH 1O3DA 2Y5GA 1LVYA 3SO3A 2C93B 4ACBA 5AFZH 3EE7A 1GPZA 1WV7H 2UWPA 1DY9A 2XWAA 2FODA 2ZPRA 4X1NU 3UTUH 5L6NH 1JRSA 3PYHA 1C2HA 2A7JA 5C5NA 1ARCA 3LC3A 1DWEH 1TA2A 1K1IA 4Y11E 4BAQB 1GBIA 1BRCE 1FJSA 1WAYB 3RMMH 4KP0A 5AVDA 1DSTA 1GHBF 2YNAA 4FUBA 1P9SA 1K0HA 4FUJA 1AGJA 5C0UA 2BDIA 1QB1A 3Q00A 1UHBB 2OQUA 4ISOA 1W7XH 2FDAA 2ZIQH 3JZ1B 4FU9A 2Y7XA 1UVUH 2AYWA 1KXCA 3M3TA 1C1NA 2A31A 5LPFA 1T31A 3FANA 5A0AE 1P2NA 1C5SA 1XKAC 4GPGA 1LHGH 5EXMA 1Y3UA 4XOJA 5EXNA 2BOKA 4LZ1H 3UPEA 3EQ0H 1TB6H 3FN8A 3UNSA 2VWNA 3AW0A 4AZ2B 4YT6H 1UHBA 2WPMS 1MTUA 1P01A 1JMOH 1LQEA 3TNSA 1UTPA 2F9NA 4CHAC 1OWHA 1K22H 4J1YA 5DP8A 1O5GH 1ZTKA 2CF8H 2FWWA 5K7RA 2BD8A 4RT1A 3HGPA 1WYKA 2QF5A 2ZEBA 1MKWH 2XTTB 1O2OA 1Y5BT 2CN0H 4YO9A 2GT8A 2STAE 4A1TA 1YCPH 3E0NB 1SKYE 2QF3A 1GI5A 3TJOA 3LGYA 2R9PA 3ZZAA 1C4Y2 1SGFA 1TNHA 4TY7A 3GS9A 1RIWB 5A09A 1FNIA 1AQ7A 2PLXA 3VB7A 1GVLA 3U1IB 2HPQH 1UTMA 1MZAA 2G5NA 2SGEE 1DVAH 6LPRA 2VGCB 2BZAA 4DCDA 1C9PA 2EA3A 1TIOA 3MI4A 3F9HA 1EP5A 1SGFG 3MU5A 4TT3D 4CRAA 2TIOA 3HK6B 1C5QA 2BD9A 1IQGA 2FIRH 4NFEA 4X8TH 4I31A 1GMCF 4SGBE 3QO6A 5FAHA 4XBDA 5JBCS 2KM0A 3BEFB 5DGJA 2CHAC 3U8OH 4OS6A 3A87A 2FMJA 2Q6FA 1O2HA 2FTLE 2HLDD 3FO8D 2ZFPH 2B7DH 3FVFB 4B73A 4D9QA 1KDQB 2ZCLP 1H8DH 5DP6A 2IPHA 1YM0A 1L1NA 1KDQA 2FOHA 4DGJA 5EQSA 1Z1IA 1GL0E 2SGPE 2IN2A 4FUHA 3F2FA 5DG6A 2OC7A 4AC9A 1O2JA 3M5MA 3P95A 3H09A 3MMGA 5FPSA 5FL7D 2ZPQA 3GY5A 3KYGA 1AFQB 4AX9H 4AGJA 1C5NH 4A1VA 2OQ5A 3RXEA 1HAOH 3SU3A 1KTTB 4I86A 4X1SU 5F8ZA 3RXRA 3ZZDA 2FPZA 2BLVA 1PPHE 1OSSA 5C2ZA 3R0FA 1GDUA 3MO3A 2KCOA 3VGCB 3A8BA 4AB8A 2QXGA 2F9UA 3SV6A 1E0FD 2AIPA 5GXPA 5K0HA 2ZHQH 3Q3YA 2HVYB 5C1YA 4AOQA 4TWYA 4IS5A 1C2LA 1SB1H 1LQDB 3GYLB 1OS8A 2BB4A 1VJAU 1HAVB 2WUCA 3T2NA 3KF2A 2FOAA 3SOSA 2BX4A 1O38A 3OYPA 1QL9A 2C8XB 3U28C 2PKSB 2R0LA 2ANYA 4OGYA 1O37A 4NIYA 1PYTD 2OINA 3S7KB 3P8NA 1GHAF 4NZQA 2V0BA 3HK3B 4ABBA 2ZPSA 2ULLA 1A3BH 1ZHPA 1FIZA 3LU9B 3Q3KA 3P17H 2XBVA 3BEIB 3DHKH 2RA0A 4X2VA 3UFAA 1HJAB 2P93A 1CA0C 1S6FA 1TOCB 1AD8H 1FN8A 2FYQA 3M35A 3OY5U 2UUFB 2Y7ZA 5GCHF 3U1JB 3NUMA 2WUBA 4D8NA 1QRZA 1TYNA 4GAWA 5EQQA 4IMQA 1YKTA 1DY8A 1P0SH 2JETC 1TBQH 2BQWB 3GY8A 3STJA 4X2WA 3RC4A 1QB9A 3LGIA 4OS1A 3URDA 2O8LA 3PTBA 3M36A 4CBNA 1BCUH 1CT0E 1PJPA 1DXPA 2TGTA 2B5TB 1RTKA 4M7GA 1A1RA 4I33A 3TK6A 5A8ZA 5KEDA 1GCTB 1XMNB 1IQJA 3FAOA 2BLOA 5KGOA 5A8YA 1C4U2 3A85A 1G36A 1L4ZA 4NA7A 3K2UA 3BTFE 4U01A 3A80A 5HIZA 2GDEH 3P6ZB 1NC6A 3RC5A 3VB5A 5DP5A 3RLYH 1XX9A 1GBFA 1MD8A 2PKAA 3M5LA 4ZHAA 2AIQA 4I7YH 2AMQA 2BY8X 2JIZD 4R0IA 3F0OA 2SGDE 1EUFA 3WWFA 1OYQA 3LT3A 1SGRE 2A4GA 5J4SA 4K2YA 2B8OH 7LPRA 1HJ8A 2G51A 2M2AA 2PGQB 1C1QA 2XCNA 1V2QT 4Y0YE 4E05H 2F4LA 2J4IA 1AZZA 1MD7A 2A32A 3MH4A 1YY3A 4LK4A 2GZ8A 4U32A 4B71A 4IBLH 3D62A 3SHAH 1LTOA 1RIWC 2H9TH 1TGBA 1N6YA 1FY8E 5IYTA 1O2IA 1OKXA 4CRCA 1K2I1 2VWOA 1UTLM 3G01A 3RXCA 1HPGA 3CNRA 1C1OA 3BN9A 3K6YA 5CHAC 4FU7A 1O2ZA 1BRUP 1CT4E 1OWKA 1C5ZB 1INCA 1DWBH 5T6FA 2A7CA 4Y6DA 1CGIE 1TGNA 4FOUC 1BIOA 1AWFH 3JZ2B 1ZMLA 4VGCC 1LHEH 3B23B 1LVMA 3MTYA 1LHFH 1C1WH 1HDTH 3F3BA 3OFND 4DIHH 3B8JA 3SW2B 4BOHA 3GOVB 3N99A 1NROH 1IOEA 2BDAA 3MU0A 4E06H 3QX5H 2R0KA 1Y3VA 5E0GA 2FEQH 4JYTA 2IOTA 3C27B 2J5UA 4BANB 1QNJA 2AHME 1FXYA 2CK3D 4CRBA 2Z9LA 1LVOA 1SGQE 2L6OA 1NRRH 2G4TA 1K1PA 1ZGVA 2W5EA 1GBKA 1MTWA 2AMDA 4KTUA 2UWOA 5EU8A 1SGYE 2XXLA 4QT8C 4X6PA 1DLKB 1ZLRA 1ZPBA 2BDBA 3S7HB 2QY0B 1AFQC 1D4PB 4ZH8A 5EW1H 1Z1JA 1Y3XA 1WUNH 1IAUA 1EJAA 1DDJA 4CRFA 2QE7D 4IN1A 3TH4H 5ESBA 1B0EA 2FO9A 2WPIS 4JYUH 2OC0A 3ZZ5A 1SLXB 4NWLA 1TX7A 1YLCA 4XD7D 4RKJB 1N1LA 1O0DH 1GHAG 1CVWH 1YPJH 2XRCA 2RG3A 3MH7A 4ISIH 1VCWA 4NWKA 3RLWH 1H8IH 2BD2A 2QXIA 3BG8A 3GCOA 4BTUB 1UCYK 4LOYH 4X6OA 4ISLA 2IJOB 3D49H 3ZZ4A 1UMAH 5FX5A 3EAJA 1MAXA 3F9EA 2FZZA 3D23A 3ATKA 1XUHA 2AH4X 1FV9A 1SLWB 1O30A 1ZSJA 1NS3A 1V2JT 3SJIA 1GHYH 3LONA 1Z71A 1D3TB 1ZMJA 3LH3A 1BQYA 2OC1A 3PM3A 3RMOH 5T6DA 4BXWA 1QTFA 1DXWA 1CGHA 2BYAX 1XKBC 1HFDA 1O2WA 3TNTA 1YBWA 4AFQA 4ZAEA 3A7VA 1WQSA 1IQFA 3OU0A 4ABIA 1SL3A 3A81A 1GWAA 2F9BH 2H5DA 2PR3A 3GDSA 1EJMA 3ZVEA 4JZFH 1ANCA 4X0WU 2HNTE 1ANEA 4FUEA 4B75A 4I8KA 2OUAA 1W2KH 3RXSA 1E35B 2GCTB 4H6TA 3KQBA 2O8UA 3TK5A 2GCHG 1RGQA 3LGUA 4CRGA 1YC0A 2AMPA 2BTCE 3FP7E 1W12U 2W3IA 1EAIA 3NZIA 3RXPA 4I8GA 4O97A 3SUGA 1C5VA 4LXBH 1AN1E 2HWLB 4HI3A 2F3CE 3ZV9A 1MU6B 2SGAA 4NSYA 5EG4A 2O8WA 3ODFA 2H9EH 3PO1B 2RDEA 1FONA 1LKAA 1OPHB 3VB6A 4K5ZA 3MQKC 1RXPA 1WDIA 1E36B 4MTBA 1HRTH 3I78A 1JOUB 1GCTC 3QTOH 1YYY1 2DUCA 4INHA 5HM2A 2A5AA 3RXOA 2JKHA 2Y6TA 1BJVA 4GHQA 1DE7H 5SGAE 2P3TB 3MFJA 4RI0A 1GMCG 2VIWA 3L3TA 6CHAB 4XSKU 3PTNA 1FDPA 4I8LA 1S6HA 3AW1A 2FOBA 3QGNB 1O2TA 3RC6A 2P94A 4TPIZ 1XUGA 1O3HA 5LH8A 2QXJA 3ATWA 4R8TB 2SNVA 1MCTA 1MBMA 2GMTB 1SI5H 4JMYA 1KXDA 1S83A 1EQ9A 5DN6D 3PRDA 2TRMA 1W0JD 2WHXA 3SV2H 4MVNA 4FXGH 2GT7A 1AB9B 1MKXK 1PPZA 2ALPA 4YOJA 2F43B 1GHXH 5EJZA 1F0UA 2BY7X 3SI3H 1WU1A 1YPMH 2VWMA 5ESTE 5F6MA 2V6NA 4O3TA 3BTQE 1QQUA 1Y8TA 1KTSB 1T8MA 2ILNA 3ZZBA 1ESAA 2QA9E 2J34A 3KQEA 4ZKSU 1L4DA 5A8XA 5L2ZH 3SHCH 1Z8RA 4CREA 3MH6A 5FPTA 1C5WB 1C5UA 1V2NT 2VGCC 3OSYA 2BX3A 1GG6C 3QWCH 1DFPA 3BG4B 4GLYA 1BTWA 4Y7AA 1HXEH 5EPNA 3ZV8A 2BLQA 3RU4T 1T4VH 2Q1JA 3SZEA 2PW8H 2VVUA 3K9XB 1SFQB 1J15A 3TLOA 2PFEA 9LPRA 2KAIB 2FOGA 1S81A 4MNWA 1ELCA 1AB9C 1TNGA 2ODPA 5EOKA 1UVOA 2YNBA 3VG8A 2JJ1D 1UK4A 1KLTA 1UCYH 1WCZA 4JZ1A 4Q7XA 1DPOA 4WMEA 3GISB 1IQMA 1O3GA 1QJ6B 1EX3A 3GY7A 1AVWA 3TVJB 3DA9B 1SQOA 4UDWH 3O8RA 2SGFE 5DK1A 3PB1E 1TPPA 1OOKB 2H5CA 4NA8A 3K6ZA 4MPVA 3TGJE 1EPTB 1BTYA 1G3BA 3SU6A 4XRNA 2ZDKA 4CH2B 1MH0A 4BNRA 1FN6A 3OEHD 3A7ZA 1BRBE 4XBBA 2K1QA 3AAVA 2FI4E 5GIBA 1P02A 3MNBA 2R3YA 3ZZ3A 2XNIA 1Z7KA 1HAXB 4DW2U 2A2QH 1H9IE 2LNCA 1ACBE 3RP2A 4A5TS 3ZZ8A 3GCNA 2ZGCA 4H4FA 3T29A 1QGFA 1P2JA 1FY3A 1MTVA 4DG4A 2WPKS 1SSXA 1ABJH 1GVKB 1BBRH 1GBMA 1AZ8A 3EDXB 1LPGB 2R2MB 4D7FA 4M9FA 1GBAA 1EB1H 2M5TA 1YPEH 2RCEA 3UQVA 1BJUA 3TU7H 3STIA 3SNCA 4MPWA 4ZKNU 3QUMP 4CH8B 1O34A 3UR6A 5ABWA 2D2DA 1V2PT 1U6QA 1SHHB 5HKKD 1MAYA 2R2WU 1G32B 3MH5A 1MQ5A 5A0CA 4DIIH 4P00A 1BRAA 1Y59T 3SU5A 2XOKD 4WH8A 5JBAS 4WH6A 4DT4A 1BMMH 1K1JA 1RFNA 4RN6A 2PKSC 2KAIA 3U98H 2OBOA 1GBHA 4AFUA 4UFFH 1ORFA 1UTNA 3ZZCA 2P59A 1T4UH 2UUYA 3TPIZ 4B2BA 1W3CA 2ANMH 1TX6A 2ZU2A 2I6SA 3SU4A 2J38A 5TCAA 1SPJA 2WPDD 4FVDA 2PTCE 1Y5AT 2BVRH 5LGOA 1A0LA 1IHSH 3I77A 2HOBA 2FOMB 1QQ4A 1TGTA 5AHGH 3PMAB 2I6QA 1V6DA 3T5FH 2XBWA 1KLJH 1G3EA 2O8TA 2ZZUH 4E7RG 1SOZA 3ZZ7A 3GYMA 4MDSA 4JZDH 2B0FA 1TBRH 1TABE 2AEIH 4NIWA 8ESTE 5HMAA 1AKSA 2C8ZB 1GI3A 2ZKSA 1Z6JH 1KXAA
chains in the Genus database with same CATH topology
3ZYEA 1HAYB 5DPAA 1CE5A 3DFJA 1W11U 1QY6A 1O2KA 2FI3E 2NU0E 2ZU4A 1O39A 4DT7B 3BTTE 5HXFA 1O2MA 3FP8E 3V3MA 5JBBS 1OWEA 1QJ7B 2BY5X 3RXMA 1DUAA 1O5EH 3ZVDA 2BD4A 1CA8B 3O8CA 2OP9A 4UEHH 3RXFA 4FUCA 2FYRA 2SFAA 1NRSH 1DWCH 4Z6AH 2ZG0H 5DO4H 1V2VT 2ZDAH 1UK2A 5L2YH 1P2OA 1LPKB 1H4WA 3RXTA 2BDYA 5JBTA 1ELAA 2OXSA 3EA8A 2C4FH 3RXBA 3SGAE 4JZIA 4NSVA 1EB2A 2OLGA 1EOLA 3H7TA 1D6RA 1ABIH 3ATLA 2J2UA 3KL6A 2PV9B 2ZFSA 4IMZA 2BZ6H 3TJUA 1GI9B 2J9NA 1C2GA 1GDNA 4YTAA 1V2MT 1O2LA 2ZHEH 4NA9H 1AFEH 1IQHA 6ESTA 1GI0A 4NGAH 2XBXA 3ZVCA 1TE0A 2Z3DA 3AAUA 3BTDE 4XE4A 3VFEA 4WMDA 3ZZ9A 3LGVA 5IDKA 5DP4A 1QURH 1C2JA 2HRVA 2EC9H 4SGAE 2P16A 1G3DA 2G4UA 4Y8ZA 1GG6B 4UONA 3M61U 2ZU3A 1F0TA 1QBVH 1H1BA 2ZDMA 1QA0A 4YOIA 4NCYA 1TNJA 1L2EA 1QB6A 2ZHFH 2F9PA 3UWJH 3S9BA 2C3SA 1Q2WA 1D3QB 1CBWC 4INLA 2ZGXH 1GJ8B 1BBRE 4BAOB 1DX5M 2LPRA 2SNWA 4VGCB 3M7TA 2BD7A 1P9UA 1THRH 1SFIA 4AORA 2VH0A 1THPB 1D3PB 4RSPA 2UUJB 2G8TA 2CMYA 2C8WB 3OY6U 3PROA 1W8BH 4H42U 1XUJA 3A83A 3BTME 4DVAU 2FM2A 3SJOA 1GI6A 2ZWLH 3GY3A 1L0ZA 1YGCH 1ZTLA 1BTHH 4AYVB 1C5MD 1ZSLA 1ZR0A 3RXHA 1TGSZ 1SLUB 1B5GH 1UVTH 3M5OA 1C5TA 1GJ5H 1QBNA 1K9OE 1V2OT 1O5CB 1EXFA 4Y7BA 1H9LB 1FPCH 1C2DA 2ZTZA 3NPSA 4Y71A 1W0YH 1TBZH 3RMLH 4ISNA 1AUTC 3SQHE 1QRWA 4NG9H 3IITA 1SQTA 4ESTE 1YLDA 3M7QA 2Z7FE 1EPTA 1W10U 4DJZB 3M3VA 2GCHF 3MHWU 3M37A 1G30B 4MPXA 1N8OB 2GVFA 1A0HB 1O3EA 2ZO3H 4A7IB 1FUJA 1TNIA 4GUXA 1IQKA 5CMXH 1KXEA 2H1UA 2XWBI 2W26A 4NZLA 1GI8B 1MKWK 3A88A 3H7OA 5JYIA 3KCGH 3TH3H 1NFWA 1Y3YA 2EI7A 2QN5T 1SR5C 1K1NA 2JH0D 3P92A 2PGBB 3MNXA 1V2ST 1DT2A 4B76A 3A7YA 4O9VA 1EATA 3P8OA 2ZF0H 1ZPCA 2G55A 2BXTH 2O9QA 1O3BA 1EZQA 2Q6GA 1P2MA 1LVBA 2EI8A 4U30A 1XXDA 1CSOE 1Y3WA 1DICA 4I8JA 2AGGX 1C2KA 4UD9H 2JH6D 3QK1A 1HIAA 1MBQA 2FS8A 1GJ6A 1O3JA 1C1PA 1T8LA 3BIVH 4WWYA 4H6SB 3QGJA 1P10A 1C1TA 1O3KA 1DOJA 1SHYA 1YP9A 1B0FA 2A4QA 2FX6A 8GCHG 3SV8A 3KGPA 3F68H 4Z0KA 1XUFA 1GJ7B 5GDSH 2ZCKP 3GDVA 4B1TA 4FUDA 4PROA 1EAWA 2H2ZA 4WJG2 5A2MH 2NU1E 1TLDA 4D9RA 8GCHF 1VCPA 1BITA 1MTSA 1ESTA 1OP8A 1A7SA 1P3CA 1ANBA 1VR1H 2BD3A 3PO1C 4UFEH 1BMNH 1VITF 4RKOB 4ZMAH 3UIRA 4IN2A 1BT7A 4YM9A 2XC4A 2XC5A 1YPHC 3MO6A 4WXIA 1ARBA 5L30H 1RTLA 3SU0A 1VJ9U 3E8LA 1AIXH 1P57B 5F8TA 3C1KA 4LZ4B 1IQNA 1BHXF 2GCTC 2NU4E 1GMHF 3HKJB 2BY9X 4MLFB 1IQLA 3FP6E 1QHRB 2Z9KA 4NFFA 4DURA 1F5RA 4A1XA 5LPRA 1F92A 2OD3B 1HV7A 2Y80A 3LIWA 1J9CH 1D3DB 4ASHA 2CF9H 2ASUB 1V2TT 5T3HA 1ZOMA 1LHDH 2GD4B 3E16B 4IW4E 4B2AA 2HGTH 1QA7A 4BTTB 2BDHA 3F9GA 2R3UA 5I25A 1IHTH 3W94A 1AO5A 1WBGB 2HNTC 1NY22 2PTNA 3K65B 3LKWA 2QAAA 7GCHF 1P2IA 3O8BA 2C90B 1UVSH 1NU7B 4ABJA 2PWXA 3S9CA 5PTPA 1BTUA 3M3SA 3PMJA 1GI7B 1S0QA 5F03A 1SC8U 2EI6A 1GHZA 3SNAA 3AVZA 2XCFA 1BZXE 3RXDA 1O2YA 1CO7E 1CBWB 1O2XA 2FLBH 2B9LA 4K69A 1DITH 3T25A 1O2GH 1P12E 2GV6A 2A5IA 1P2KA 2GGVB 4HZHA 4K60A 2BY6X 4GCHF 5A0BA 5DP9A 2D26C 3BEUA 1ELEE 2V3HH 1T8OA 1TA6A 3BG4C 4D7GA 5C1XA 1P11E 3SZNA 2VIVA 5FCKA 3EGKH 1GBTA 1HIAB 2VIOA 1W14U 2A4OA 2FX4A 4HTCH 1MTNC 1DS2E 1SGTA 3RXKA 1A0JA 1XUIA 2BDGA 2ZC9H 1PQ8A 1TOMH 4E7NA 2F83A 2A0QB 3P8FA 3PWBA 4Q2KA 1F7ZA 1O2PA 5GWZA 4INKA 1GDQA 3M5NA 3BV9B 1GHWH 2J92A 4GHTA 2Z3EA 3N7OA 3FFGA 1G2MA 1ETRH 1ZRKA 3SU1A 1FMGA 1ELTA 2BDCA 2ZQ2A 1OX1A 1N8OC 7KMEH 4MPUA 2G81E 2WINI 4WY3A 7ESTE 2W7UA 1V2WT 1GBBA 1P03A 1TMBH 3S69A 4OGXA 1SQAA 2FS9A 4TPYA 5JPMH 2Y81A 3ZVBA 1O32A 2GV7A 3ZVAA 1NM6A 3PWCA 2ZU1A 1KXFA 1FY4A 1SOTA 4K3JA 1D9IA 3SUEA 2H9HA 1LDTT 2A1DB 1HUTH 3MU1A 2NU3E 2Z9IA 1C5LH 3T28A 6GCHF 2OCVB 1EZXC 3E6PH 1TMTH 2WV4A 3KQCA 3O8DA 4X6NA 3E1XB 2P8OB 2QGRA 2BHGA 1GBJA 4TY6A 4YLUA 1TALA 1DM4B 1G3CA 6GCHG 5HYOA 4WMFA 1Z8GA 1HAPH 2GZ7A 1DSUA 4OS7A 1TONA 5C1UA 4JK6A 4YZUA 2TPIZ 3E91A 2CJIA 1JRTA 2JH5D 4K8BA 4K8YA 1C2FA 4AGKA 3WY8A 1YPKH 1ZSKA 5EXLA 3GY2A 1Q3XA 4ZHMU 3F9FA 2HNTF 3U9AH 4MNYA 3QLPH 2QYIA 4ZHLU 2VVVA 1GJCB 1SGDE 3H5CB 3RXUA 3E0PB 1GJ4H 1J14A 3SNEA 2ANWA 2AGIX 2BQ7B 4HFPB 2XW9A 2F9OA 3ESTA 3SUDA 1HB0B 1JIMA 1SGCA 1WTGH 1TMUH 4HGCA 1NRPH 1ZJDA 2BQ6B 1FPHH 4IC5A 1RS0A 4KELA 1F2SE 2ZP0H 3RXAA 1ZMNA 1PQ5A 4BXSA 1LO6A 2WYJA 2C8YB 3SN8A 1BTPA 1BTZA 2BXUH 3HGNA 5EW2H 1PPCE 3ZZ6A 1C5YB 3TGIE 3SI4H 3MO9A 1LPZB 1CHGA 1HAIH 3GCTG 1VCQA 1FAKH 2QXHA 3PLKA 5FCRA 2TGDA 3NWUA 4ZUHA 3SJKA 2P3UB 3SNBA 1PYTC 3NCLA 4WVPE 2PUXB 1O33A 1SLVB 1E34B 1CQQA 2G5VA 1Y5UT 4D76A 1TNKA 1TAWA 1Z6EA 1TQ7B 2ANKH 3ITIA 1ELFA 3A8CA 1RTFB 1EOJA 3P70B 4FU8A 1MTNB 2P3FH 1E37B 2J94A 3A8AA 3MU8A 2ZGBH 3TITA 4XBCA 4ABHA 1JBUH 3SQEE 2ZGJA 1QBOA 3I29A 1SGEE 3TH2H 1P3EA 4NIVA 2OBQA 1E38B 3LJJA 1KIGH 4WF8A 5T6GA 5HM9A 5AF9H 2XYAA 2ALVA 5EODA 3ATMA 3KQDA 1O2VA 1GMDG 1O3CA 2H6MA 1EP6A 3CS0A 3SU2A 2NU2E 1KY9A 1QL8A 1XVOA 1K21H 1SVPA 1QCPA 1M9UA 1NZQH 1P09A 1UK3A 2FTMA 1OWDA 2DE8A 2Z9GA 5JDUB 1TGCA 1GHBG 1ZPZA 2BVXH 1G37A 1ZZZA 1CU1A 5FBIA 3GCHB 2Q6DA 4AFSA 2AFQB 4X1PU 1PPBH 2W3KA 2VINA 2QV1A 1C1UH 4OS2A 2WYGA 4Y10E 1GMHG 1WSSH 3U69H 3UOPA 1HJ9A 1FY1A 1S85A 2Y82A 4CR5A 1SGIB 1PPEE 2FXRA 3A7WA 2GKVE 1EZUC 3S9AA 1G2LA 2GZ9A 4MG3A 3VB3A 2CGAA 4UFGH 3QN7A 3GY6A 2XBYA 2A5KA 4A92A 1TPAE 1O3MA 1UCYE 2FI5E 2FESH 5C5OA 5BRRE 3SGQE 2GTBA 1VITG 3L6PA 4K1SA 1DWDH 3UNRA 1AMHA 5TCCA 1HAGE 9ESTA 3UNQA 3EE0B 2ZHDA 3MNCA 5C20A 1A61H 5EQRA 1DLEA 1K28D 3TK9A 3V0XA 1NESE 3VXFH 1MKXH 4YLQH 3TJVA 5E2OA 1YCPK 1QRXA 1TRNA 3RDZA 3UUZA 4XFQA 4X8UH 1GL1A 2BVSH 1C2EA 4AG2A 2FOFA 1UJ1A 2A4RA 1QIXB 3MU4A 4AG1A 1FIWA 3P8GA 5F8XA 3S0NA 1S5SA 1C2MA 1P04A 3T26A 4DY7B 3RU4E 3UR9A 5EPYA 3MWIU 1NN6A 1TPOA 4OS5A 1O3NA 1GI4A 2AGEX 5E8EH 1CT2E 1RD3B 1GJAB 1NFXA 3SJ9A 3F1SB 4MNXA 1ZHMA 2P8OC 3ZVGA 1YPHE 1P05A 2ZFQH 1C1RA 1B7XB 4KGAA 4ZROA 2ZA5A 1MCVA 3M7UA 1LHCH 2VWLA 1BUIA 4F49A 2NWNA 1O3FA 1T7CA 3SV9A 1MZDA 1H9HE 1QFKH 3V7TA 4FUFA 2STBE 3SUFA 1HXFH 4OS4A 4ABFA 1KYNA 1EAXA 3SNDA 1O3PB 1FQ3A 4IC6A 1KLIH 1TRYA 1V2RT 1PQAA 4Y8XA 2OTVA 2ZU5A 1NPMA 3NXPA 1BB0B 4CHAB 1AVGH 1GBLA 1J8AA 1AE5A 2Y5FA 1RJXB 1K1MA 5GJ4B 1LMWB 1S0RA 3BTGE 1QJ1B 1TFXA 5ETXA 2W7SA 2CV3A 4CRDA 3VPKA 1V2LT 4K1TA 2TBSA 4KTCA 1GBCA 3HATH 1O31A 2PSXA 4YOGA 1PPGE 2Z3CA 4FVBA 2G00A 2VB0A 2PSYA 3UOUA 3BIUH 6CHAC 3Q3XA 2WPLS 4BAMB 1NO9H 2VIPA 4AYYB 2ZTXA 3T27A 1XXFA 3L33A 1TRMA 1BMAA 1AUJA 1C5RA 1UTJA 2A7HA 4BTIB 1XUKA 4Y8YA 2PUQH 2ZGHA 3LH1A 2QC2A 1HYLA 4O3UA 2VIQA 1TWXB 4B2CA 2ODQA 3URCA 1F0SA 4Q80A 1O3LA 1XM1A 1AHTH 4X8VH 4IGDA 1A5IA 4YT7H 1JIRA 2A45B 1O5DH 3DFLA 1PFXC 1A5HA 3MYWA 3RM2H 1THSH 1XVMA 3LOXA 3VEQB 5GPIB 1MUEB 2FP7B 3PMBB 5FXLA 1O5FH 1YPGH 3V13A 2WV5A 2ZDVH 2ZTYA 3PMHB 1NRNH 3PV4A 3IWMA 4FUIA 2J95A 3VGCC 1O36A 1O5BB 1O2SA 3GCHC 3A7XA 1IQEA 1HAHH 2SGQE 2VNTA 5DP7A 1C1VH 3E3TA 2P95A 2HLCA 1O5AB 3BTEE 4Y79A 1L1JA 3PLPA 1ZYOA 4DOQA 3OTJE 3UREA 4MQAA 3V12A 1O35A 3UQOA 4ABEA 3RXVA 1JXPA 3A89A 3QTVH 3KIDU 2ZNKH 1EPTC 2HALA 1DUEA 1EJNA 1P06A 3ZYDA 3U8TH 1ZTJA 4U2WA 3DUXH 1OWIA 4ABAA 1EKBB 3IG6B 3RXJA 1O2RA 1PPFE 1W13U 3AASA 7GCHG 1C2IA 2ZECA 2ZQ1A 3Q76A 1VGCB 1AE8H 1W7GH 3BTHE 3MNSA 3A7TA 1CA0B 3A86A 2ZFRH 1S82A 1GMDF 5E2PA 4ZKOU 1GBEA 2TGAA 2QF0A 5I46H 2TGPZ 2F9VA 4K1EA 2G52A 1AWHB 3MOCA 1KXBA 5BPEA 1V3XA 1GI2A 1J16A 3LDXH 3ZVFA 2RA3A 3TGKE 1AVXA 4MNVA 4Q7ZA 1VITH 2JETB 2Y5HA 1V2UT 1O3IA 5FHTA 4J2YB 1J17T 1TPSA 3U8RH 3CENA 2O8MA 1ZHRA 1BA8B 2HPPH 1A46H 2ODYB 1O3AA 4FUGA 4F4OC 1GCDA 2PHBA 1MMJN 3EYDA 1AY6H 3FZDA 3E90B 2VU8E 1CGJE 1ELVA 1T32A 2VJ1A 3NK8A 1NFYA 1V2KT 4X6MA 1HJAC 1UTKA 5H4IB 2ZHWH 3RXGA 4O03A 4GSOA 3A84A 1GJ9B 1YCPM 4UFDH 5EGMA 1YPLH 1A5GH 1VZQH 4UE7H 1Q31A 1P8VC 4Y0ZE 2V3OH 2QIQA 3EA7A 3HKIB 2FOCA 1F5KU 4X2XA 4I32A 2RDLA 2AERH 2YOLA 1UTOA 1K1LA 2BMGB 2GP9B 1O2UA 1GBDA 5TJXA 1BDAA 3SGBE 4TYDA 1BTXA 4JZEH 3DD2H 3RMNH 1MU8B 3VXEH 4B74A 1UVPA 3A8DA 1NTPA 1EZSC 1GHVH 3Q77A 3B9FH 2XC0A 3GCTF 2THFB 5G4BA 1O2QA 1Z8JB 5E0JA 5DJ7A 1O2NA 2D1JA 5DKMA 1ZRBA 4GCHG 2GDDA 3RUOA 3RXQA 8LPRA 1QL7A 2AS9A 2DE9A 5JB8S 1GGDB 4ZXXH 2ZDLA 3BTKE 1DANH 1YF4A 1ETTH 1BBRK 2BOHB 3QDZB 8KME2 4ABGA 5FBEA 1LKBA 4X2YA 1NFUA