1O2JA

Elaborate manifold of short hydrogen bond arrays mediating binding of active site-directed serine protease inhibitors
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Elaborate Manifold of Short Hydrogen Bond Arrays Mediating Binding of Active Site-Directed Serine Protease Inhibitors
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords BETA-TRYPSIN
total genus 53
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2003-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1o2jA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1o2jA02
4ABIA 1GCTB 3QUMP 3LC3A 4QT8C 2ZQ1A 1O2YA 3SNBA 1XVOA 1K1OA 1ZR0A 5HYOA 3VB6A 1C1RA 3MNSA 2VIQA 4I8HA 2VJ1A 3SV7A 2ZU2A 1TNGA 3F9HA 1AUTC 4D76A 2BXTH 1KXEA 2OC1A 2ZEBA 1HAXB 4CH8B 1EAIA 1P9SA 2VIWA 1F0UA 1O3PB 1V2WT 2OBQA 3SGAE 1PPHE 3U1JB 3DHKH 4FUCA 4NA8A 1OWJA 4KTCA 1BBRK 2BVXH 1O3FA 4XOJA 1QBVH 3ATKA 1UTPA 1SGEE 1J14A 1QRXA 1BRUP 1VITH 1LTOA 2IPHA 3A88A 4A5TS 1EJAA 5EODA 5PTPA 4K60A 4I8KA 2Y80A 2QXGA 5C67A 2BTCE 5LGOA 1SGIB 3SUEA 4ZAEA 2B5TB 3KQDA 2QN5T 3E16B 1MKWH 3HATH 3UNQA 3GISB 2GKVE 5DO4H 1TALA 1BA8B 4AFUA 4X1NU 1QBOA 1IQEA 2AGIX 1V3XA 2FLRH 1BUIA 2A4OA 1F2SE 4IGDA 7KMEH 1A3BH 1INCA 2WUCA 2SGFE 4TPYA 1GHBG 1EAXA 3RXIA 5DGJA 1UHBB 3LGYA 4MG3A 1EASA 1C1OA 2P8OB 3A82A 3V0XA 1MTNC 2VWMA 1FY4A 4BAHB 3TH2H 4NCYA 4CR9A 2CGAA 5E0GA 2BD4A 4CRBA 3F9GA 4K69A 1GHYH 1HAZB 1V2ST 1O0DH 3MO3A 4AGKA 3GYMA 4U01A 4GLYA 4YESB 1TIOA 3M61U 3TIUA 1SI5H 4NWKA 2GX4A 1MTSA 1CO7E 3GICB 2XBWA 1HLTH 3ZVFA 1RD3B 1TWXB 1XKAC 2HNTE 4Y7AA 4DIIH 2FEQH 1SLXB 4IC6A 4TY7A 5E8EH 4AZ2B 1KXCA 1CT2E 2ZU5A 3OX7U 2QF0A 1TONA 2ZWLH 4D8NA 1SGRE 2HWLB 1F5KU 2VGCC 2WV4A 2G5NA 2GDDA 2FM2A 4ZROA 1CHGA 2XXLA 2R2MB 3AAUA 5A8ZA 1YPMH 1OS8A 2FOMB 5FPYA 1RTLA 3RXGA 4AFZA 2TGPZ 1T8NA 2C93B 4ISHH 2P3TB 1QIXB 3F9FA 3URDA 3E0PB 1MTNB 2UUKB 3MH5A 2AS9A 1DUAA 2NWNA 1HAYB 1MAYA 2CF9H 2A5KA 2PTNA 2R0KA 1XMNB 4U30A 2ZU3A 1EJMA 1PYTD 2BLOA 2HVXA 2ZC9H 1ZZZA 2VWLA 4Q2KA 1TNKA 1IQIA 3GY5A 4GCHF 1HAIH 4X8TH 4J2YB 1GJBB 3NXPA 2ANKH 3QN7A 4X6MA 4ZKOU 1ZRKA 4MDSA 1TA6A 1ZJKA 1TGCA 1TYNA 2WPKS 1TX7A 1O31A 2BZAA 3LH3A 2FS8A 4JCNA 5TCCA 5F8TA 1QJ6B 3ESTA 3UR6A 2DUCA 4JYVH 3KIDU 4X2WA 3RXUA 2F3CE 1E38B 1AVGH 2NU3E 3PROA 1V2MT 4FUGA 2ZHWH 5IYTA 5DP4A 4DT7B 1W3CA 2ZIQH 1DS2E 4BAKB 2VIPA 7GCHF 4UD9H 1ZSLA 4Q7XA 4BOHA 1Z1JA 2VNTA 5DKMA 1F92A 1IQNA 1GCTC 1GBLA 4ZUHA 1A0HB 2BQ7B 2A4QA 1O5AB 4XBCA 7GCHG 1VZQH 2JKHA 2ZFFH 2OQUA 3MOCA 1NRSH 2C8ZB 4WXIA 1O3NA 2A1DB 1J9CH 2ZECA 4Y0YE 4RKJB 4ZH8A 4F49A 6CHAC 1L2EA 4E06H 3BTQE 1G9IE 3S69A 1P0SH 1MBMA 2FTMA 1RFNA 2Q6GA 2VVCA 2R3UA 2WPHS 4UFFH 1N8OB 2CMYA 3SO3A 5ESBA 1YGCH 1S6HA 1QQUA 3QDZB 5JDUB 5GJ4B 3C27B 2GT8A 4K1SA 1ETSH 3P95A 1O3CA 4ZXYH 4OS6A 5FX5A 5A2MH 3RXSA 4D9RA 1EZQA 2PGBB 1XUJA 4IMZA 1T7CA 4A1TA 1O5GH 2ZA5A 1M9UA 1ZHRA 3GCHB 2XW9A 5JYIA 3PM3A 1HCGA 1A4WH 1S82A 1FZZA 1O5DH 3F6UH 4BAMB 1MCTA 2W7UA 4X8VH 5SGAE 1FY5A 2V3OH 1OWIA 4KKDA 3RMNH 1C5XB 3RM2H 3FVFB 1J8AA 3EGKH 4WVPE 1NZQH 1H8IH 1TPOA 1UTKA 3T5FH 3PMAB 2J34A 4NZLA 2ZFRH 4AB9A 3TJVA 5C1UA 1GPZA 4IN2A 2ZHFH 3UNSA 3FANA 2FX6A 1ANDA 1C2DA 2Y6TA 1GI7B 1KYNA 1O2WA 1NRNH 1C5LH 4A1XA 2R0LA 3SI3H 2FO9A 4X1QU 3SV2H 4AORA 3UQVA 1CT0E 1BQYA 4NA9H 4HGCA 1GHAG 3SGBE 4ZHMU 3SJKA 2ZTXA 1GGDC 2BQWB 1P06A 4K8BA 4F4OC 1UK4A 1UHBA 3RXAA 1BMMH 3LONA 4XBDA 3QLPH 2P93A 1O3KA 2ZP0H 3MU0A 3UOPA 1HAPH 2GCTC 1OP0A 4CRAA 2GCHG 1BBRE 1PPGE 4DIHH 1KXFA 3JZ1B 4KP0A 1FUJA 2DE8A 3M7QA 1GBIA 1TNIA 4FVBA 1FMGA 1HAOH 1TGBA 3MH7A 1VCPA 4DOQA 2BD5A 2BHGA 1D6WA 1LHDH 2D8WA 1QJ7B 4CBNA 3MTYA 1WTGH 2WYGA 3ODDA 1CSOE 1TBQH 4GVUA 4NWLA 3SUFA 1TNHA 1T8LA 1W7XH 1DLKB 2Q6DA 3SI4H 1C2MA 3RXCA 1PJPA 1ARBA 1CE5A 5EPNA 3BEUA 1BHXF 5JBCS 3VB3A 1YPHC 1MKXK 2IJOB 4YLQH 1UCYH 4I7YH 1V2RT 1QTFA 4JZ1A 1UTLM 4FUJA 1SQTA 3GY3A 2KAIB 1YKTA 5EG4A 1ARCA 2Z9IA 1C1TA 1SMFE 3KEEA 1QL7A 5AFYH 3A8DA 1MU6B 1NPMA 2SGPE 2J92A 4I33A 4B71A 1ZYOA 3PMJA 2AH4X 1ELVA 1WU1A 3P8OA 1V2NT 4RSPA 1P2QA 1UVPA 1AMHA 1G3EA 3T29A 2KAIA 1THPB 1O2OA 1QHRB 1EPTC 1EZUC 1TE0A 2BD3A 1HAHH 3P92A 3MMGA 4MVNA 3L33A 3RXRA 1DXPA 5FBIA 3PLKA 1CHOG 1W12U 2BXUH 4IW4E 6GCHF 1FNIA 2RA0A 1MZDA 1G2LA 2FLBH 1BTUA 4BXWA 4ASHA 2G8TA 5DP7A 1LPGB 1K9OE 2ANWA 1HYLA 1SOTA 3ZZDA 6GCHG 1BMAA 4I8JA 2ZG0H 1V6DA 3V3MA 1GBKA 1U6QA 1TRNA 1S81A 1SC8U 1UJ1A 1O2UA 2GDEH 3DA9B 1DWCH 2XC0A 4VGCB 4DURA 1HFDA 2FOEA 3QZQA 1GI2A 1W10U 1GI0A 2J2UA 1C5YB 3MNBA 4A7IB 1MUEB 1D9IA 4Z6AH 1BRBE 1L1NA 1HAVA 1O2MA 3TLOA 4I8LA 2O8MA 3HK6B 1TRYA 2QC2A 1PQ8A 2W3IA 1GHAF 2A5IA 4ZKNU 4MPXA 1T8OA 2G5VA 4FUFA 2FX4A 4UDWH 1H9HE 3TNSA 1O3LA 5EQSA 4OGXA 1P2NA 3E1XB 4AYYB 3ZZ6A 3RXVA 3OU0A 1G37A 5T6DA 1QL9A 3ENSB 5FX6A 1FQ3A 3ELAH 3SBKA 2GCHF 4ZXXH 1E36B 2FZZA 3I78A 1IQFA 2QXJA 3EE0B 3SU2A 3A7ZA 2VH0A 4H6TA 2EI7A 1O38A 2G51A 3PTBA 1OP8A 4UEHH 1SGCA 1Z8JB 1K28D 1XXDA 5ESTE 6ESTA 3EA8A 2PSYA 4Y8XA 1W7GH 1HJAC 3PTNA 1HAGE 5T3HA 1YP9A 5HXFA 1TMUH 4GUXA 2ZF0H 3SGQE 4R0IA 1TMBH 3DUXH 2FPZA 4TY6A 4A92A 5GXPA 2F9PA 5F8XA 3G01A 3URCA 2J38A 2UWLA 5AVDA 1LVOA 2FYRA 4UFEH 3RXOA 2RG3A 1QCPA 2ZU4A 1BTZA 2B7DH 2VB0A 2ZFTA 1P2OA 1TPAE 2SGQE 3LIWA 2ZGBH 5GCHF 1SGDE 3MU1A 1KY9A 2P3FH 5EXLA 4ABEA 3BTFE 5DP5A 2F9BH 1C5TA 1GWAA 4CREA 2ZFSA 2BY7X 3R0FA 1HJ9A 5FPTA 3S0NA 3FAOA 2WPMS 1W8BH 3BTWE 4ZHAA 3A7YA 2P95A 1ETTH 9ESTA 4INHA 3UREA 3MWIU 1C5SA 1V2OT 4KTSA 5FBEA 1PQ7A 2A7JA 3RXQA 1XUGA 3AAVA 1O30A 1OPHB 2OLGA 2VU8E 2Q6FA 3SJOA 1QGFA 1AO5A 3T27A 1BB0B 4DY7B 3B8JA 2O8LA 2PSXA 1NTPA 2A32A 2XC4A 4X1RU 1F0TA 5EU8A 1RTFB 4TWWA 1ABIH 1O2JA 1GL1A 3O8CA 1N6YA 1PPCE 1DWEH 1H9LB 3LU9B 3ZVCA 1LQEA 1JRSA 4INLA 4BNRA 2H9TH 3UR9A 4AGJA 3K6ZA 2DE9A 2STAE 3MO9A 1G36A 3SU1A 3K6YA 3ZZ9A 2ZCKP 1AU8A 2ODYB 2A45B 1EKBB 1P8VC 2W5EA 1VGCB 3TNTA 4MLFB 2JH0D 1DSTA 2FOAA 3RXPA 1TFXA 1O2NA 3EA7A 2EEKA 2HALA 2R9PA 3MH6A 1MTUA 3BTKE 4Q7ZA 5G4BA 2ZDVH 1SBWA 1LCYA 1C1PA 3BV9B 3ZZAA 8LPRA 1FXYA 3KCGH 4NG9H 4YOJA 3FZDA 3GY4A 3M37A 4OGYA 5C5NA 3BSQA 3TPIZ 1YBWA 3W94A 3P17H 1GVLA 2XCNA 3MNXA 1C1UH 1ZPZA 1YCPM 1D3QB 3SU3A 3F9EA 1FN8A 2QCYA 1DOJA 1G30B 1PPBH 4IN1A 3B23B 4R8TB 2G81E 4BAOB 4K3JA 1V2JT 1AWFH 2BQ6B 5JBAS 1ELTA 3D65E 1P3EA 3HKJB 4BTUB 1GI1A 3Q3YA 2PKSB 2Y82A 5DP8A 1QRZA 2FYQA 3UQOA 1LPZB 4TPIZ 2BD8A 5ETXA 3SNDA 1C5WB 3ATMA 5K7RA 1WTHD 1AKSB 4B2BA 3LDXH 2ZNKH 1BMNH 1ORFA 2Z9LA 3KQCA 2D26C 3SU5A 1BTPA 1K21H 2GZ7A 4KTUA 3M3VA 4RN6A 3VFEA 1XM1A 2P59A 2V3HH 1DM4B 4LZ4B 1P02A 2BDHA 1ZJDA 2XWAA 3ZZCA 2UUFB 1O2TA 4H4FA 1SFQB 1AFEH 1CT4E 1O2GH 4FXGH 3ZYEA 4YO9A 1GHWH 2RCEA 4ISLA 1AIXH 3UNRA 1X7AC 3V12A 2G55A 4LXBH 1Z7KA 1K1MA 1P57B 3ZVGA 2GV7A 1O2KA 4O97A 1LO6A 1NFYA 1TA2A 1Z8RA 1H8DH 2ZGXH 1FJSA 1SPJA 2RDLA 1ANEA 4Y76A 4WJG2 2GZ9A 1KDQA 1C1SA 1IQLA 3EAJA 2OP9A 3GY2A 4B74A 3SZNA 5A0AE 1KLTA 4FU7A 3MO6A 5A09A 1YF4A 4NIXA 2XC5A 4XFQA 3SQEE 4ESTE 1IAUA 1QNJA 2JH5D 2AIQA 1FY8E 1EQ9A 4DCDA 2F9OA 2J9NA 2OC0A 3PWCA 5F03A 1C1VH 1SL3A 2XBVA 3DT0H 4ISIH 2ZU1A 2AGGX 2XTTB 5J4SA 1ZOMA 1TB6H 2FMJA 3GOVB 1KTSB 1Y59T 1SB1H 1TPPA 5TJXA 2QV1A 2VINA 4PROA 1DT2A 4GHQA 1S83A 2CHAC 2H1UA 2A2QH 3AW1A 2TRMA 1THRH 3O8BA 5E2OA 1TOCB 2F83A 8KME2 4IC5A 2H5DA 4ABBA 1NROH 3U98H 1SHYA 1HUTH 8GCHF 1Z8GA 3D23A 1C5PA 1J15A 1FAXA 1LDTT 1PPEE 1GJ8B 1WUNH 4B2CA 1NFUA 2BDBA 1O2ZA 2ESTE 1WQSA 2BB4A 4ABFA 1P04A 1XVMA 3LGTA 1N8OC 1S6FA 1OYTH 1C2KA 2FOFA 4MPVA 1K22H 1NU7B 2CHAB 2CF8H 1QJ1B 1DWDH 6CHAB 3OTJE 3PWBA 1TNJA 2ANYA 3QGJA 2BD2A 1O2PA 2FI3E 3O8RA 1FAKH 4O03A 2UWPA 2ZGHA 4U2WA 1K1LA 3FFGA 1TLDA 3KL6A 1DDJA 1UVOA 4B75A 4FUIA 1JMOH 1FY1A 1S5SA 4UONA 3F68H 2Y7ZA 1Y5BT 3GY7A 3QX5H 1O37A 1G2MA 1AHTH 1UTJA 2Y7XA 3FP6E 1C1WH 1K1IA 1P2KA 2OXSA 2ODPA 5GIBA 5I25A 4FUEA 3RXKA 1QFKH 2HLCA 2D1JA 1OX1A 2C90B 1CGHA 1GJAB 1MU8B 2A4RA 1Z1IA 2UWOA 2FESH 2OBOA 1S85A 1E0FD 2Z9KA 3Q00A 2ASUB 1B0EA 1YPEH 3BG8A 3E6PH 2ZFPH 1KXBA 3TITA 3SNCA 1Y3YA 1CGJE 5BRRE 1QY6A 5T6GA 1SGFA 3C1KA 3T28A 2QA9E 2WINI 1SGYE 4MNYA 4CRDA 3UIRA 4MPUA 2NU1E 3LGIA 4DW2U 4ZKRU 3M3TA 1TABE 1C5RA 1MZAA 1C9PA 2AYWA 1BHXB 1XX9A 1HB0B 4SGBE 1VCQA 4OS4A 3U8OH 1O35A 2ZI2H 4NSYA 1EUFA 1UTOA 3TJOA 2GMTB 2IOTA 5LPFA 3PYHA 1AB9B 1TX8A 4JYUH 3NWUA 3AASA 4I31A 2TGDA 2H9HA 2GP9B 4B73A 1ELEE 1YPLH 2BY9X 1MD8A 3T2NA 1THSH 1JOUB 1YPKH 4IMQA 4NGAH 1NM6A 4NFFA 9LPRA 3LJJA 1P10A 3KQEA 2BDGA 5EXNA 4YZUA 2BDYA 2SGDE 3SJ8A 5DP6A 3SNAA 3LGVA 2P94A 2O8WA 2Z7FE 2ZDKA 3F1SB 4Q80A 2FWWA 3M36A 3E90B 3JZ2B 5L2YH 5CHAC 3NPSA 5A0CA 2FIRH 3HGNA 3VGCB 2ZDLA 5TCAA 4CHAC 2UUYA 1GBFA 3A83A 3U9AH 1B5GH 2ZPSA 3BTME 5C5OA 1HGTH 1NN6A 4AG2A 2QY0B 1XUIA 1Q31A 4ABGA 1GI6A 2HOBA 4LZ1H 1SGFG 1AQ7A 3OY5U 2JETB 3P8GA 3A7VA 5F6MA 2ZHDA 1QRWA 4U32A 1DLEA 1GI9B 1AFQC 4J1YA 1FLEE 1TAWA 2BD9A 3MNCA 1GJ4H 3T62A 4LOYH 1HXEH 1A2CH 5C3NA 1O36A 2ZTYA 3LOXA 1AE8H 3BIVH 4ABDA 1GBHA 1O2QA 3VB5A 4AFSA 3ZZ5A 1DFPA 2WV5A 1ZMNA 3RXLA 2PHBA 2PUQH 1P05A 3SU6A 1QB9A 5JB8S 3NK8A 1ZTKA 4Y8YA 4WY3A 3SHAH 1MMJN 4ZHLU 4K8YA 1RXPA 1C5UA 1QL8A 1PQ5A 1NFXA 3TJNA 3H5CB 1G3CA 1O5EH 3LGUA 1Z6JH 4NIYA 2P8OC 2ULLA 1RIWC 1Q3XA 1O33A 4AN7A 3Q3XA 5K0HA 3BIUH 4X6OA 3BTDE 3RU4E 2F9NA 2YNAA 1GGDB 2BVRH 1UVUH 4NA7A 1A3EH 2Y5FA 1C2LA 1YPGH 3EDXB 2AGEX 1TGNA 1MKWK 1TGSZ 4JZIA 1JIRA 3DFJA 3STIA 1WV7H 3MU8A 1MQ5A 4HFPB 3QZRA 5B6OA 3GDSA 1XUHA 4SGAE 5HMAA 3BTEE 1DUEA 1O34A 5HGGA 1LHFH 2ILNA 2BLQA 3SHCH 5JBBS 2GD4B 4AOQA 3OYPA 1A5GH 2EA3A 5A0BA 1MH0A 3L6PA 5L2ZH 3MU4A 3A86A 1SVPA 3H7TA 3ITIA 3PMHB 1V2KT 2PTCE 4Y10E 3OY6U 2Y5GA 1GBAA 2RA3A 3TJUA 1GBJA 1LKBA 3TK6A 4H6SB 1GI4A 2ZO3H 1SSXA 2FXRA 3A85A 3MI4A 1P9UA 1Z8IB 1JIMA 1Y5UT 1AY6H 1SLUB 3RDZA 4YOIA 1BDAA 4K5ZA 1ZSJA 2Y81A 1OYQA 1O3AA 1V2PT 5AFZH 1KTTB 1SLVB 4NIWA 2Z9GA 3M35A 4JYTA 1HAVB 4WXVA 3SU0A 2FOHA 1S0QA 4WF8A 1P12E 2M5TA 1AI8H 1DANH 2C4FH 2Z3EA 1ID5H 2I6QA 2A4GA 1K2I1 4UFDH 4WMEA 1FIWA 2ZDMA 3LJOA 1RGQA 4O3TA 2QGRA 3ATIA 1GL0E 1ELAA 1GVZA 1A61H 3M5MA 2GT7A 1RS0A 5IDKA 1Z6EA 2BDCA 3RXMA 3SN8A 1SHHB 3ZV9A 1GBBA 3GY8A 2A2XH 3T25A 1KXDA 2JH6D 3L3TA 1DWBH 1H1BA 2GV6A 1D3PB 3BF6H 2TBSA 2O8TA 5GWZA 2XNIA 2FS9A 2WYJA 3QK1A 5E0JA 2P16A 3RU4D 1ZMJA 1NC6A 1XUKA 3KF2A 4K1TA 2NU4E 1RRKA 1C4U2 4A6LA 1YLDA 3RP2A 3M5LA 3QTOH 3VGCC 4YM9A 2VIOA 1ZTJA 3RC6A 1MTVA 3U8TH 1QB6A 3E3TA 1DICA 1H9IE 3ZVEA 2H2ZA 1O2IA 5DG6A 1YPJH 4JK6A 3ZZ7A 1SGQE 3IITA 5H4IB 4Y71A 1GG6B 1GHBF 1SLWB 3MFJA 3KGPA 1WQVH 1GMHF 1NESE 2BVSH 1QB1A 4ZMAH 4BXSA 1PQAA 1PPFE 1NRRH 3HK3B 1C5OH 3S9BA 1UVTH 3ZYDA 3BN9A 4JMYA 4JZEH 2XRCA 1OSSA 1C2HA 1NS3A 2LPRA 1GMHG 2Z3CA 5C1YA 2AFQB 3RMMH 1FPHH 1O3OA 2XBXA 2R3YA 4FU9A 2ZGJA 3BTHE 3RXFA 1GMCF 3TVJB 4YOGA 1TGTA 3GDUA 1GJ5H 2AMDA 1CBWC 2TGTA 2BMGB 2GCTB 4NFEA 1BJUA 2QF3A 2AMQA 2FTLE 1A1RA 2CXVA 3MHWU 3SV9A 3ZV8A 2AMPA 2H9EH 3SV8A 1P2JA 1HPGA 4WH6A 1OOKB 4O9VA 1HDTH 1C5ZB 2IN2A 1A0LA 2SNWA 1O3IA 2ALVA 1O2VA 3KQBA 2B9LA 1C2IA 2VVUA 1FIZA 2G4UA 3CS0A 1EP6A 2ZPRA 4WMDA 3S7KB 4M7GA 2HGTH 2OUAA 1FI8A 1OXGA 4YT6H 2PFEA 1NFWA 2QXIA 4DVAU 5DK1A 1A46H 1C4Y2 2O9QA 3E91A 5J4QA 3UWJH 2P3UB 2PKAB 5BPEA 3EYDA 1WAYB 2J95A 1S84A 3UY9A 1C2FA 2Z9JA 3SQHE 1P2MA 5JPMH 1XUFA 1DY9A 4CH2B 2SGEE 1DSUA 1TBZH 1IQGA 3MH4A 5FHTA 1XXFA 3K9XB 1J17T 2F9UA 1O2LA 8ESTE 1TOMH 1WBGB 5EQRA 3TK9A 4GCHG 1LVMA 1EB1H 5EGMA 1RTKA 3TGJE 5EOKA 2BLWA 1SOZA 1GBMA 4YT7H 1C1NA 4GHTA 2ZPQA 1MBQA 1P2IA 3KHVA 1BTYA 3A8CA 2QYIA 3WY8A 1YPHE 1HIAA 1LMWB 1TNLA 1WCZA 1A5IA 1O3DA 1TBRH 1ZTLA 1IHSH 1SQAA 1DY8A 4JZDH 5EPYA 5EW2H 1Y3WA 1UO6A 1UCYK 1SGNE 3OSYA 1GBCA 3V13A 4AB8A 3V7TA 1EATA 3A7XA 3FP8E 1AZZA 3RMOH 1K1NA 1O3BA 4MPWA 5FXLA 4HTCH 5L30H 2FP7B 3SUDA 2O8UA 3K2UA 1D3TB 3RXHA 5FCRA 1IQMA 1Y8TA 4Y8ZA 1VJ9U 3LPRA 1G3BA 3SJIA 4AFQA 3A7TA 2J94A 3ODFA 1BMLA 4D7GA 1HBTH 1EPTA 4ISNA 2A5AA 4GAWA 1MCVA 1B0FA 3BEFB 2GMTC 4BAQB 5DJ7A 1Y3VA 5A8YA 5CE1A 1T31A 1ZLRA 1D3DB 2QXHA 1PYTC 3IG6B 3K65B 3GCHC 5CMXH 1GBDA 1OWEA 4AX9H 4JZFH 3AVZA 3NCLA 1B7XB 1VR1H 3ZVDA 2BOKA 3VB4A 5T6FA 1AZ8A 1CGIE 5DP9A 1BBRH 3O8DA 2EC9H 3D49H 2LNCA 4WMFA 5FPSA 3RXBA 1LPKB 2W26A 1EOJA 1ELGA 5E2PA 2QAAA 4MTBA 1EXFA 2BX4A 2FI4E 2FOBA 1UTQA 1EZSC 4TWYA 5LH8A 4X6PA 4ABJA 3RXDA 1OKXA 2GGVB 1L1JA 4ABHA 1ELFA 2ZDAH 1GVKB 3Q3KA 1GCDA 4Z0KA 1MKXH 3RU4T 3BTGE 1WSSH 1A7SA 2WPIS 1BCUH 3UWIA 3W95A 2HRVA 1IQKA 2OC7A 1UTMA 2Z3DA 5AHGH 3RC4A 2XBYA 1N1LA 3GCTF 1CA8B 1ESAA 1W2KH 1OWKA 3RM0H 3SORA 4FUHA 5EW1H 1DITH 1GI3A 3P8FA 1BTXA 1AVWA 3FP7E 2V0BA 2WUBA 2TPIZ 2XWBI 3SNEA 4NZQA 1QBNA 7LPRA 2VWOA 1O2SA 3RUOA 3VEQB 3B9FH 3E0NB 1VCWA 3KN2A 2PGQB 1QURH 1C5VA 3EA9A 3TGKE 2WPLS 1WOFA 1LHEH 1GHXH 4E7NA 2G00A 2VGCB 1ABJH 1O3GA 3M7TA 2F9VA 4Y79A 4BANB 1ESBA 1SGTA 3ZVBA 1HV7A 1RJXB 2VH6A 1ANBA 1KSNA 1GBTA 1TX6A 3D62A 1HIAB 1G3DA 2ALPA 1GDQA 4INKA 1GHZA 1VITF 3RMLH 2PV9B 3RLYH 4IS5A 3T26A 4CRFA 1G32B 4D7FA 4XSKU 1T4VH 3UFAA 4XBBA 4THNH 3VPKA 1C1MA 3A81A 1ELDE 1EZXC 1O32A 3RXTA 4OS2A 1ANCA 2YOLA 1UK2A 4NIVA 1ZGVA 3P8NA 1DPOA 1P09A 1C4V2 4D9QA 1ZMLA 1EAUA 1F5LA 4RKOB 1YCPH 2BY8X 4WH8A 4B1TA 2H5CA 3HKIB 4K1EA 4HI3A 3SOSA 3LKWA 1TRMA 1CVWH 2BDIA 4X0WU 1UK3A 1GMCG 1GI5A 2J4IA 4Q7YA 1PPZA 2BOHB 1C5QA 1BT7A 4B2AA 3VB7A 5A8XA 3TK5A 4CRCA 2FDAA 3TU7H 3ZVAA 1GJ6A 1GJCB 2QIQA 3QWCH 3TH4H 5C2ZA 1IQHA 3CENA 2G52A 1BIOA 2OD3B 1Y5AT 1W14U 2V6NA 4OS5A 5EQQA 5E0HA 4FU8A 1ZPBA 5JBTA 2YNBA 3UTUH 1O5BB 2A0QB 5DP3A 3FZZA 1GJ7B 1E37B 1F7ZA 1NY22 1NO9H 1ELCA 2F91A 2SFAA 3A87A 3CS7A 1AE5A 1TMTH 3SW2B 2BD7A 2SGAA 6LPRA 1OP2A 3STJA 1GJDB 5HM2A 4XE4A 4A1VA 1AGJA 1KLIH 1YYY1 2C8XB 1L4ZA 1O3HA 4X8UH 1DX5M 4MNWA 4Y0ZE 1SGPE 1BZXE 5DPAA 4DGJA 3QGNB 3A84A 3NUMA 2B8OH 2Z94A 1JXPA 2PKSC 3U69H 1KLJH 5GPIB 4H42U 1QR3E 4K2YA 1AUJA 1YM0A 2EI6A 3QO6A 2OINA 1GI8B 4CBOA 1AWHB 2C8WB 4X6NA 1F0RA 1C2EA 1O2HA 3A8AA 1A5HA 2VIVA 3GCTG 2ZZUH 1V2LT 3LH1A 3M5OA 2G4TA 4AG1A 1ZHMA 1TPSA 4GPGA 2PR3A 1ZSKA 1D6RA 3E8LA 1ZRBA 4YLUA 1C1QA 4DG4A 3I29A 3M5NA 1C2GA 3VXFH 1DXWA 5ABWA 3N7OA 2ANMH 2NU0E 1GDNA 1KIGH 1FN6A 1Y3XA 3VXEH 1W13U 4OS1A 2AIPA 2A7HA 2ZHEH 1P01A 1CU1A 1LHCH 2THFB 3RXEA 3PB1E 1V2UT 3GY6A 1VGCC 1AVXA 1AKSA 1W11U 2HNTC 3A7WA 4ZKSU 4TYDA 2OTVA 5AF9H 2C3SA 1T4UH 1IHTH 1YC0A 4XDEA 4FUBA 2STBE 1GG6C 3MYWA 1FV9A 1GHVH 1OWDA 1V2QT 3PO1B 2BY5X 1O39A 1EP5A 1GMDG 2HPPH 3LGWA 1YLCA 2K1QA 1BOQA 1HRTH 7ESTE 1L1GA 2Y5HA 3PO1C 1MD7A 3RXJA 1EB2A 2BX3A 1ETRH 3BTTE 1BRAA 1EX3A 4UE7H 1GBEA 1GMDF 3GCOA 1KDQB 1L4DA 4Y7BA 1O2XA 4X2XA 5C20A 1ZGIA 1O2RA 2XYAA 1ELBA 3S7HB 4X2YA 5L6NH 3Q77A 4IBLH 3ZZ3A 2BLVA 3DFLA 2Q1JA 4FVDA 2PLXA 1V2VT 4NSVA 1NRQH 1C9TA 2AEIH 3TGIE 4JK5A 1Z71A 1CA0B 5F8ZA 1UMAH 2FI5E 2H6MA 4CRGA 5GDSH 1N6XA 5GCHG 2CN0H 1MAXA 1K1JA 2GZ8A 1AD8H 1L0ZA 3P70B 1VJAU 3GCNA 2ODQA 2EI8A 4OS7A 1F0SA 1P03A 1T32A 4DJZB 1F5RA 3GYLB 1UTNA 3ZZBA 1HXFH 2OCVB 1EJNA 3A89A 4FUDA 4B76A 2VVVA 3PLPA 1E34B 4HZHA 1K1PA 1TQ0B 3A80A 5C1XA 2PWXA 1FY3A 2W3KA 1JBUH 1CHOF 2GVFA 1BTWA 1HJAB 2B0FA 2BZ6H 1FONA 2I6SA 3AW0A 3H7OA 1Y3UA 3A8BA 2GTBA 1DVAH 3NZIA 2WPJS 2PW8H 4ISOA 2FOCA 2BYAX 4O3UA 1ZHPA 2BY6X 3BG4C 1FPCH 3SV6A 1SG8B 2A31A 2HPQH 1EAWA 1GDUA 3U8RH 5FAHA 3SJ9A 4MNVA 3SU4A 1BITA 1W0YH 2D2DA 4MNXA 3ZZ8A 3P6ZB 3UPEA 1FDPA 4MQAA 3PLBA 1KXAA 1ESTA 4I8GA 4UFGH 1H4WA 2JETC 3KNXA 1UVSH 2AERH 1O3EA 2FODA 1HNEE 3ATLA 2ZTZA 2ZQ2A 5FCKA 3HPTB 4E7RG 3ZZ4A 1MQ6A 1LVBA 4VGCC 1XKBC 2UUJB 1SR5C 5HM9A 4CHAB 3S9CA 2VWNA 3HGPA 3GDVA 3I77A 1JRTA 1O5FH 2XCFA 1P11E 1C2JA 1O3JA 1AN1E 8GCHG 1EOLA 1QA0A 1OWHA 1RIWB 1VITG 3BEIB 2TGAA 3M3SA 4X1SU 2OC8A 3M7UA 1CBWB 2C8YB 5LPEA 1V2TT 1IOEA 2ZHQH 3RLWH 5LPRA 2CV3A 2TIOA 1CQQA 3QTVH 1Q2WA 2W7SA 1TQ7B 1LKAA 4LK4A 4ABAA 1LQDB 1BRCE 2CJIA 1WYKA 1PFXC 1LVYA 3EQ0H 3BG4B 2PUXB 3Q76A 1MTWA 2ZCHP 1IQJA 1EPTB 1SQOA 3SUGA 1NT1A 3TH3H 1YCPK 2ZCLP 3PV4A 1BJVA 1AB9C 1NU9A 3S9AA 3R3GB 3U1IB 1HJ8A 1J16A 2R2WU 1P3CA 3NKKA 1JWTA 1AFQB 1D4PB 4AYVB 1C5NH 4KELA 3IWMA 4YTAA 4I32A 4X1PU 3DD2H 4BTTB 1UCYE 4X2VA 3UUZA 4BTIB 2BM2A 2FOGA 1SFIA 1T8MA 4Y11E 4X8SH 1A0JA 4E05H 1QQ4A 2Z6BD 1W0ZU 2ZFQH 4WWYA 1O5CB 2V35A 1ACBE 5EXMA 1NRPH 2NU2E 1C5MD 1E35B 2BDAA 5CHAB 3RC5A 3MU5A 2VIDA 3UOUA 5I46H 4KGAA 3CP7A 3LT3A 1CA0C 2ZDNA 1O3MA 2OQ5A 2PKAA 1GJ9B 4CR5A 1BTHH 2SNVA 2ZGCA 2ZKSA 5JB9S 1LHGH 3PMBB 3ATWA 1ZPCA 2A7CA 2HNTF 1QA7A 3LC5A 1S0RA 4Y6DA 4GSOA 1DE7H
chains in the Genus database with same CATH superfamily
4ABIA 1GCTB 3QUMP 3LC3A 4QT8C 2ZQ1A 1O2YA 3SNBA 1XVOA 3SYJA 1K1OA 1ZR0A 5HYOA 3VB6A 1C1RA 3MNSA 2VIQA 4I8HA 2VJ1A 3SV7A 2ZU2A 1TNGA 3F9HA 1AUTC 4D76A 2BXTH 1KXEA 2OC1A 4OM9A 2ZEBA 1HAXB 2J5UA 4CH8B 1EAIA 1P9SA 2VIWA 1F0UA 1O3PB 1V2WT 2OBQA 3SGAE 1PPHE 3U1JB 3DHKH 4FUCA 4NA8A 1OWJA 4KTCA 1BBRK 2BVXH 1O3FA 4XOJA 1QBVH 3ATKA 1UTPA 1SGEE 1J14A 1QRXA 1BRUP 1VITH 1LTOA 2IPHA 3A88A 4A5TS 1EJAA 5EODA 5PTPA 4K60A 4I8KA 2Y80A 2QXGA 5C67A 3F3BA 2BTCE 5LGOA 1SGIB 2YMSB 4ZAEA 3SUEA 2B5TB 3KQDA 2QN5T 3E16B 1MKWH 3HATH 3UNQA 3GISB 2GKVE 5DO4H 1TALA 1BA8B 4AFUA 4X1NU 4ZCNA 1QBOA 4XD7D 1IQEA 2AGIX 1V3XA 2FLRH 1BUIA 2A4OA 4Q4LA 1F2SE 4IGDA 7KMEH 1A3BH 1INCA 2WUCA 2SGFE 4TPYA 1GHBG 1EAXA 3RXIA 5DGJA 1UHBB 3LGYA 4MG3A 1EASA 1C1OA 1MABB 2P8OB 3A82A 1MTNC 3V0XA 2VWMA 1FY4A 4BAHB 3TH2H 4NCYA 4CR9A 2CGAA 5E0GA 1YY3A 2BD4A 4CRBA 3F9GA 4K69A 1GHYH 1HAZB 4DT4A 1V2ST 1O0DH 3MO3A 4AGKA 1FX0B 3GYMA 4U01A 4GLYA 4YESB 1TIOA 3M61U 3TIUA 1SI5H 4NWKA 2GX4A 3FKSD 1MTSA 1CO7E 3GICB 2XBWA 1HLTH 3ZVFA 1RD3B 1COWD 4TT3D 1TWXB 1XKAC 2HNTE 4Y7AA 4DIIH 2FEQH 1SLXB 4IC6A 4TY7A 5E8EH 5CHBA 4AZ2B 1KXCA 1CT2E 4B6EA 2XOKD 2ZU5A 3OX7U 2QF0A 3OAAD 1TONA 2ZWLH 4D8NA 1SGRE 2HWLB 1F5KU 2VGCC 2WV4A 2G5NA 2GDDA 2W6ID 2FM2A 4ZROA 1CHGA 2XXLA 2R2MB 3AAUA 5A8ZA 1YPMH 1OS8A 2FOMB 5FPYA 1RTLA 3RXGA 4AFZA 2TGPZ 1T8NA 2C93B 4ISHH 2P3TB 1QIXB 3F9FA 3URDA 3E0PB 1MTNB 2UUKB 3MH5A 2AS9A 1DUAA 2NWNA 1HAYB 1MAYA 3OE7D 2CF9H 2A5KA 2PTNA 2R0KA 1XMNB 4U30A 2ZU3A 1EJMA 1PYTD 2BLOA 2HVXA 2ZC9H 1ZZZA 1K0HA 2VWLA 4Q2KA 1TNKA 1IQIA 2KZ4A 3GY5A 4GCHF 4F55A 1HAIH 4X8TH 4J2YB 1GJBB 5IK2D 3KQ5A 3NXPA 2ANKH 3QN7A 4X6MA 4ZKOU 1ZRKA 4MDSA 1TA6A 1ZJKA 1TGCA 1TYNA 2WPKS 1TX7A 3FOAA 1O31A 2BZAA 3LH3A 2FS8A 4JCNA 5TCCA 5F8TA 1QJ6B 3ESTA 3UR6A 2DUCA 4JYVH 3KIDU 4X2WA 3RXUA 2F3CE 1E38B 1AVGH 2NU3E 3PROA 1V2MT 4FUGA 2ZHWH 5IYTA 5DP4A 3OTPA 4DT7B 1W3CA 2ZIQH 1DS2E 4BAKB 2VIPA 7GCHF 4UD9H 1OHHD 1S6LA 1ZSLA 4Q7XA 4BOHA 1Z1JA 2VNTA 3PV5A 3N7DA 5DKMA 1F92A 1IQNA 1GCTC 1GBLA 4ZUHA 1A0HB 2BQ7B 2A4QA 1O5AB 4XBCA 7GCHG 1VZQH 2JKHA 2ZFFH 2OQUA 4F48B 3MOCA 1NRSH 2C8ZB 4WXIA 1O3NA 2A1DB 1J9CH 2ZECA 4Y0YE 4RKJB 4ZH8A 4F49A 6CHAC 1L2EA 4E06H 3BTQE 1G9IE 3S69A 1P0SH 1MBMA 2FTMA 1RFNA 2Q6GA 2VVCA 2R3UA 2WPHS 5F53A 4UFFH 1N8OB 2CMYA 3SO3A 5ESBA 1YGCH 1S6HA 1QQUA 3QDZB 5JDUB 5GJ4B 3C27B 2GT8A 4K1SA 1ETSH 3P95A 1O3CA 4ZXYH 4OS6A 5FX5A 5A2MH 3RXSA 2WZQA 4D9RA 1EZQA 2PGBB 1XUJA 4IMZA 1T7CA 4A1TA 1O5GH 2ZA5A 1M9UA 1ZHRA 3GCHB 2XW9A 5JYIA 3PM3A 1HCGA 1A4WH 1S82A 1FZZA 1O5DH 3F6UH 4AC9A 4BAMB 1MCTA 2W7UA 4X8VH 5SGAE 1FY5A 2V3OH 1OWIA 4KKDA 3RMNH 1C5XB 3RM2H 2WSSD 3FVFB 2KM0A 1J8AA 3EGKH 2QF5A 4WVPE 1NZQH 1H8IH 1TPOA 1UTKA 3T5FH 3PMAB 2J34A 4NZLA 2ZFRH 4AB9A 3TJVA 5C1UA 1GPZA 4IN2A 2ZHFH 3UNSA 3FANA 3WWFA 3WW7A 2FX6A 1ANDA 1C2DA 2V3MA 2Y6TA 1GI7B 1KYNA 1O2WA 1NRNH 1C5LH 4A1XA 2R0LA 3SI3H 2FO9A 4X1QU 5EIYA 3SV2H 4AORA 3UQVA 1CT0E 1BQYA 4NA9H 4HGCA 1GHAG 3SGBE 4ZHMU 3SJKA 2ZTXA 1GGDC 2BQWB 1P06A 4K8BA 4F4OC 1UK4A 1UHBA 5C94A 3RXAA 3PV2A 1BMMH 3LONA 4XBDA 3QLPH 3F0PA 2P93A 1O3KA 2ZP0H 3MU0A 3UOPA 1HAPH 2GCTC 1OP0A 4CRAA 5HIYA 2GCHG 1BBRE 1PPGE 4DIHH 1KXFA 3JZ1B 4KP0A 1FUJA 2DE8A 3M7QA 1GBIA 1TNIA 4FVBA 1FMGA 2WPDD 5HIZA 1HAOH 1TGBA 3MH7A 1VCPA 4DOQA 2BD5A 2BHGA 1D6WA 1LHDH 2D8WA 1QJ7B 4CBNA 3MTYA 1WTGH 2WYGA 3ODDA 1CSOE 4P02A 1TBQH 4GVUA 4NWLA 3SUFA 1TNHA 1T8LA 1W7XH 1DLKB 2Q6DA 3SI4H 1C2MA 3RXCA 1PJPA 1ARBA 1CE5A 5EPNA 3BEUA 1BHXF 5JBCS 3VB3A 1YPHC 1MKXK 4FETA 2IJOB 4YLQH 1UCYH 4I7YH 1V2RT 1QTFA 4JZ1A 1UTLM 4FUJA 1SQTA 2F4LA 3GY3A 2KAIB 3DSGA 1YKTA 5EG4A 1ARCA 2Z9IA 1C1TA 1SMFE 3KEEA 1QL7A 5AFYH 3A8DA 1MU6B 1NPMA 2KFWA 2SGPE 2J92A 4I33A 4B71A 1ZYOA 3PMJA 2AH4X 1ELVA 1WU1A 3P8OA 1V2NT 4RSPA 1P2QA 1UVPA 1AMHA 1G3EA 3T29A 2BD3A 2KAIA 1THPB 1O2OA 1QHRB 1EPTC 1EZUC 1TE0A 1HAHH 3P92A 3MMGA 4MVNA 3L33A 3RXRA 1DXPA 5FBIA 3PLKA 1CHOG 1W12U 2BXUH 4IW4E 6GCHF 1FNIA 2RA0A 1MZDA 1G2LA 2FLBH 1BTUA 4BXWA 4ASHA 2G8TA 5DP7A 1LPGB 1K9OE 2ANWA 1HYLA 1SOTA 3ZZDA 6GCHG 1BMAA 4I8JA 2ZG0H 1V6DA 3V3MA 1GBKA 1U6QA 1TRNA 1S81A 1SC8U 1UJ1A 1O2UA 2GDEH 3DA9B 1DWCH 2XC0A 4VGCB 4DURA 1HFDA 2FOEA 3QZQA 1GI2A 1W10U 1GI0A 2J2UA 1C5YB 3MNBA 4A7IB 1MUEB 1D9IA 4Z6AH 1BRBE 1L1NA 1HAVA 1O2MA 3TLOA 4I8LA 2O8MA 3HK6B 1TRYA 2QC2A 1PQ8A 2W3IA 1GHAF 2A5IA 4ZKNU 4MPXA 1T8OA 2G5VA 4FUFA 2FX4A 4UDWH 1H9HE 3TNSA 1O3LA 5EQSA 4OGXA 1P2NA 3E1XB 4AYYB 3ZZ6A 2M2AA 3RXVA 3OU0A 1G37A 2GJGA 5T6DA 1QL9A 3ENSB 5FX6A 1FQ3A 3ELAH 3SBKA 2GCHF 4RT1A 4ZXXH 1E36B 2FZZA 3I78A 1IQFA 2QXJA 3EE0B 3SU2A 3F0OA 3A7ZA 2VH0A 4H6TA 2EI7A 1O38A 2G51A 3PTBA 1OP8A 4UEHH 1SGCA 1Z8JB 1K28D 3N7EA 1XXDA 5ESTE 6ESTA 3EA8A 2PSYA 4Y8XA 1W7GH 1HJAC 3PTNA 1HAGE 5T3HA 1YP9A 5HXFA 1TMUH 4GUXA 2ZF0H 3SGQE 4R0IA 1TMBH 3DUXH 2FPZA 4TY6A 4A92A 5GXPA 2F9PA 5F8XA 3G01A 3URCA 2J38A 2UWLA 5AVDA 1LVOA 2FYRA 4UFEH 3RXOA 2RG3A 1QCPA 5EJ1A 2ZU4A 1BTZA 2B7DH 2VB0A 2ZFTA 1P2OA 1TPAE 2SGQE 3LIWA 2ZGBH 5KGOA 5GCHF 1SGDE 3MU1A 1KY9A 2P3FH 5EXLA 4ABEA 3BTFE 5DP5A 2F9BH 1C5TA 1GWAA 4CREA 2ZFSA 2BY7X 3R0FA 1HJ9A 5FPTA 3S0NA 3FAOA 2WPMS 1W8BH 3BTWE 2LP6A 4ZHAA 3A7YA 2P95A 1ETTH 9ESTA 4INHA 3UREA 3MWIU 1C5SA 1V2OT 4KTSA 5FBEA 1PQ7A 2A7JA 3RXQA 1XUGA 3AAVA 1O30A 1OPHB 2OLGA 2VU8E 2Q6FA 3SJOA 1QGFA 1AO5A 3T27A 1BB0B 4DY7B 3B8JA 2O8LA 2PSXA 1NTPA 4XRNA 2A32A 2XC4A 4X1RU 1F0TA 5EU8A 1RTFB 4TWWA 1ABIH 1O2JA 3CNRA 1GL1A 3O8CA 1N6YA 1PPCE 1DWEH 4B6FA 1H9LB 3LU9B 3ZVCA 1VKYA 1LQEA 1JRSA 4INLA 4BNRA 2H9TH 3UR9A 4AGJA 1YWUA 5HKKD 3K6ZA 2DE9A 2STAE 3MO9A 1G36A 3SU1A 3K6YA 3ZZ9A 2ZCKP 1AU8A 2ODYB 2A45B 1EKBB 1P8VC 2W5EA 1VGCB 3TNTA 4MLFB 2JH0D 1DSTA 2QF4A 5KEDA 2FOAA 3RXPA 1TFXA 1O2NA 3EA7A 2EEKA 2HALA 3WWBA 2R9PA 3MH6A 1MTUA 3BTKE 4Q7ZA 5G4BA 2ZDVH 1SBWA 5DSFA 1LCYA 1C1PA 3BV9B 3ZZAA 8LPRA 1FXYA 3F2FA 3KCGH 4NG9H 4YOJA 3FZDA 3GY4A 3M37A 4OGYA 5C5NA 3BSQA 3TPIZ 1YBWA 3W94A 3P17H 1GVLA 2XCNA 3MNXA 1C1UH 1ZPZA 1YCPM 1D3QB 3SU3A 3F9EA 1FN8A 2QCYA 1DOJA 1G30B 1PPBH 4IN1A 3B23B 4R8TB 2G81E 1UW7A 4BAOB 4K3JA 1V2JT 1AWFH 2BQ6B 5JBAS 1ELTA 3D65E 1P3EA 3HKJB 4BTUB 1GI1A 1WDIA 3Q3YA 2PKSB 2Y82A 5DP8A 1QRZA 2FYQA 3UQOA 1LPZB 4TPIZ 2BD8A 5ETXA 3SNDA 1C5WB 3ATMA 5K7RA 1WTHD 2EY4C 1EFRD 1AKSB 4B2BA 3LDXH 2ZNKH 1BMNH 1ORFA 2Z9LA 3KQCA 2D26C 3SU5A 1BTPA 1K21H 2GZ7A 4KTUA 2YMSD 3M3VA 4RN6A 3VFEA 1XM1A 2P59A 4M9FA 2V3HH 1DM4B 2IPQX 1P02A 4LZ4B 2BDHA 1ZJDA 2XWAA 3ZZCA 2WV9A 2UUFB 1O2TA 4H4FA 1SFQB 1AFEH 1CT4E 1O2GH 4FXGH 3ZYEA 4YO9A 1GHWH 2RCEA 4ISLA 1AIXH 3UNRA 1X7AC 3V12A 2G55A 4TSFD 2KR7A 4LXBH 1Z7KA 1K1MA 1P57B 2KCPA 3ZVGA 2GV7A 1O2KA 4O97A 1LO6A 1NFYA 1TA2A 1Z8RA 1H8DH 2ZGXH 1FJSA 1SPJA 2RDLA 1ANEA 2RDEA 4Y76A 4WJG2 2GZ9A 1KDQA 1C1SA 1IQLA 3EAJA 2OP9A 3GY2A 4B74A 3SZNA 5A0AE 1KLTA 4FU7A 3MO6A 5A09A 1YF4A 4NIXA 2XC5A 4XFQA 3SQEE 4ESTE 1IAUA 1QNJA 4YXWD 2JH5D 2AIQA 1FY8E 1EQ9A 2PP6A 4DCDA 2F9OA 2J9NA 2OC0A 3PWCA 5F03A 1C1VH 1SL3A 2XBVA 3DT0H 4ISIH 2ZU1A 2AGGX 2XTTB 5J4SA 1E79D 1ZOMA 1TB6H 2FMJA 3GOVB 1KTSB 1Y59T 1SB1H 1TPPA 5TJXA 2QV1A 2VINA 4PROA 1DT2A 4GHQA 1S83A 2CHAC 2H1UA 2A2QH 3AW1A 3DSPA 2TRMA 1THRH 3O8BA 5E2OA 1TOCB 2F83A 5EJZA 8KME2 4IC5A 2H5DA 4ABBA 1NROH 3U98H 1SHYA 1HUTH 8GCHF 1Z8GA 3D23A 1C5PA 1J15A 1FAXA 1LDTT 1PPEE 1GJ8B 1WUNH 4B2CA 1NFUA 2BDBA 1O2ZA 2ESTE 1WQSA 2BB4A 4ABFA 1P04A 1XVMA 3LGTA 3DCLA 1N8OC 1S6FA 1OYTH 1C2KA 1SQRA 2CK3D 2FOFA 4MPVA 1K22H 1NU7B 2CHAB 2CF8H 3N99A 1QJ1B 1DWDH 6CHAB 3OTJE 3PWBA 1TNJA 2ANYA 3QGJA 2BD2A 1O2PA 2FI3E 3O8RA 1FAKH 4O03A 2UWPA 2ZGHA 4U2WA 1K1LA 3FFGA 1TLDA 3KL6A 1DDJA 1UVOA 4B75A 4FUIA 1JMOH 1FY1A 1S5SA 3EE7A 3F68H 2Y7ZA 1Y5BT 4UONA 3GY7A 3QX5H 1O37A 3FO8D 1G2MA 1AHTH 1UTJA 2Y7XA 3FP6E 1C1WH 1K1IA 1P2KA 2OXSA 2ODPA 2JJ1D 5GIBA 5I25A 4FUEA 3RXKA 1QFKH 2HLCA 2D1JA 1OX1A 2C90B 1CGHA 3PRDA 1GJAB 1MU8B 2J97A 2A4RA 1Z1IA 2UWOA 2FESH 2OBOA 1YLNA 1S85A 1E0FD 2Z9KA 3Q00A 2ASUB 1B0EA 1YPEH 3BG8A 3E6PH 2ZFPH 1KXBA 3TITA 3SNCA 1Y3YA 1CGJE 5BRRE 1QY6A 5T6GA 1SGFA 3C1KA 3T28A 2QA9E 2WINI 1SGYE 4MNYA 4CRDA 3UIRA 4MPUA 2NU1E 3LGIA 4DW2U 4ZKRU 3M3TA 1TABE 1C5RA 1MZAA 1C9PA 5EJLA 2AYWA 1BHXB 1XX9A 1HB0B 4SGBE 1VCQA 5C0UA 4OS4A 3U8OH 1O35A 2ZI2H 4NSYA 1EUFA 1UTOA 3TJOA 2GMTB 2IOTA 5LPFA 3PYHA 1AB9B 1TX8A 4JYUH 3NWUA 3AASA 4I31A 2TGDA 2H9HA 5T1VA 2GP9B 4B73A 1ELEE 1YPLH 2BY9X 1MD8A 3T2NA 1THSH 1JOUB 1YPKH 3DSOA 4IMQA 4NGAH 1NM6A 4NFFA 9LPRA 3LJJA 1P10A 3KQEA 2BDGA 5EXNA 4YZUA 2BDYA 2SGDE 3SJ8A 5DP6A 3SNAA 3LGVA 2P94A 2O8WA 2V7QD 2Z7FE 2ZDKA 3F1SB 4Q80A 2FWWA 3M36A 3E90B 3JZ2B 4ACBA 5L2YH 5CHAC 3NPSA 5A0CA 2FIRH 3HGNA 3VGCB 2ZDLA 5TCAA 4CHAC 2UUYA 1GBFA 3A83A 4Q63A 3U9AH 1B5GH 2ZPSA 3BTME 5C5OA 1HGTH 1NN6A 4AG2A 2QY0B 1XUIA 1Q31A 4ABGA 1GI6A 2HOBA 4LZ1H 3MQKC 1SGFG 1AQ7A 3OY5U 2JETB 3P8GA 3A7VA 2JDID 5F6MA 1E1QD 2ZHDA 1QRWA 4U32A 1DLEA 1GI9B 1AFQC 4J1YA 5FL7D 1FLEE 1TAWA 2BD9A 3MNCA 1GJ4H 3T62A 1BMFD 4LOYH 1HXEH 4P00A 1A2CH 5C3NA 1O36A 2ZTYA 3LOXA 1AE8H 3BIVH 2XNDD 4ABDA 1GBHA 1O2QA 3VB5A 3H09A 4AFSA 3ZZ5A 1DFPA 2WV5A 1ZMNA 3RXLA 2PHBA 2PUQH 1P05A 3SU6A 1QB9A 5JB8S 3NK8A 1ZTKA 4Y8YA 4WY3A 3SHAH 1MMJN 4ZHLU 4K8YA 1RXPA 1C5UA 2KCOA 1QL8A 3OEHD 1PQ5A 1NFXA 3TJNA 3H5CB 1G3CA 1O5EH 3LGUA 1Z6JH 4NIYA 2WHXA 2P8OC 2ULLA 1RIWC 1Q3XA 1O33A 4AN7A 3Q3XA 5K0HA 3BIUH 4X6OA 3F2HA 3BTDE 3RU4E 2F9NA 2YNAA 1GGDB 2BVRH 1UVUH 4NA7A 1A3EH 2Y5FA 1C2LA 1YPGH 4RT0A 3EDXB 2JIZD 2AGEX 2L6OA 1TGNA 1MKWK 1TGSZ 4JZIA 1JIRA 3DFJA 3STIA 1WV7H 3MU8A 1MQ5A 4HFPB 3QZRA 5B6OA 3GDSA 1XUHA 4SGAE 5HMAA 3BTEE 1DUEA 1O34A 5HGGA 1LHFH 2ILNA 2BLQA 3SHCH 5JBBS 2GD4B 4AOQA 3OYPA 1A5GH 2EA3A 5A0BA 1MH0A 3L6PA 5L2ZH 3MU4A 3A86A 1SVPA 3H7TA 3ITIA 3PMHB 1V2KT 2PTCE 4Y10E 3OY6U 2Y5GA 1GBAA 2RA3A 3TJUA 1GBJA 1LKBA 3TK6A 4H6SB 5C17A 1GI4A 2ZO3H 1SSXA 2FXRA 3A85A 3MI4A 3OEED 1P9UA 1Z8IB 1JIMA 1Y5UT 1AY6H 1SLUB 3RDZA 4YOIA 1BDAA 4K5ZA 1ZSJA 2Y81A 3AK5A 1OYQA 5B6LA 1O3AA 1V2PT 5AFZH 1KTTB 1SLVB 4NIWA 2Z9GA 3M35A 4JYTA 1HAVB 4WXVA 3SU0A 2FOHA 1S0QA 4WF8A 1P12E 2M5TA 1AI8H 1DANH 2C4FH 2Z3EA 1ID5H 2I6QA 2A4GA 1K2I1 4UFDH 4WMEA 1FIWA 2ZDMA 3LJOA 1RGQA 4O3TA 2QGRA 3ATIA 1GL0E 1ELAA 1GVZA 1A61H 3M5MA 2GT7A 1RS0A 5IDKA 1Z6EA 2BDCA 3RXMA 3SN8A 1SHHB 3ZV9A 1GBBA 3GY8A 2A2XH 3T25A 1KXDA 2JH6D 3L3TA 1DWBH 1H1BA 2GV6A 1D3PB 3BF6H 2TBSA 2O8TA 5GWZA 2XNIA 2FS9A 2WYJA 3QK1A 5E0JA 2P16A 3RU4D 1ZMJA 1NC6A 1XUKA 3KF2A 4K1TA 2NU4E 1RRKA 1C4U2 4A6LA 1YLDA 3RP2A 2QE7D 3M5LA 3QTOH 3VGCC 4YM9A 2VIOA 1ZTJA 3RC6A 1MTVA 3U8TH 1QB6A 3E3TA 1DICA 1H9IE 3ZVEA 2H2ZA 1O2IA 5DG6A 1YPJH 4JK6A 3ZZ7A 1SGQE 3IITA 5H4IB 4Y71A 1GG6B 1GHBF 1SLWB 3MFJA 3KGPA 1WQVH 1GMHF 1NESE 2BVSH 1QB1A 4ZMAH 4BXSA 1PQAA 1PPFE 1NRRH 3HK3B 1C5OH 3S9BA 3KYFA 1UVTH 3ZYDA 3BN9A 4JMYA 4JZEH 2XRCA 1OSSA 1C2HA 1NS3A 2LPRA 1GMHG 2Z3CA 5C1YA 2AFQB 2IJD1 3RMMH 1FPHH 1O3OA 2XBXA 2R3YA 4FU9A 2ZGJA 3BTHE 3RXFA 1GMCF 3UB0A 3TVJB 4YOGA 1TGTA 3GDUA 1GJ5H 2AMDA 1CBWC 2TGTA 1H8ED 2BMGB 2GCTB 4NFEA 1BJUA 3ZIAD 2QF3A 2AMQA 2FTLE 1A1RA 2CXVA 3MHWU 3SV9A 3ZV8A 2AMPA 2H9EH 3SV8A 5CDFE 1P2JA 1HPGA 4WH6A 1OOKB 4O9VA 1HDTH 1C5ZB 2IN2A 1A0LA 2SNWA 1O3IA 2ALVA 1O2VA 3KQBA 2B9LA 1C2IA 2VVUA 1FIZA 2G4UA 3CS0A 1EP6A 2ZPRA 4WMDA 4FOUC 4M7GA 3S7KB 2HGTH 2OUAA 1FI8A 1OXGA 4YT6H 2PFEA 1NFWA 2QXIA 4DVAU 5DK1A 1A46H 1C4Y2 2O9QA 3E91A 5J4QA 3UWJH 2P3UB 2PKAB 5BPEA 3EYDA 1WAYB 2J95A 1S84A 3UY9A 1C2FA 2Z9JA 3SQHE 1P2MA 5JPMH 1XUFA 1DY9A 4CH2B 2SGEE 1DSUA 1TBZH 1IQGA 3MH4A 5FHTA 1XXFA 3K9XB 1J17T 2F9UA 1O2LA 8ESTE 1TOMH 1WBGB 1H8HD 5EQRA 3TK9A 4GCHG 1LVMA 1EB1H 5EGMA 1RTKA 3TGJE 5EOKA 2BLWA 1SOZA 1GBMA 4YT7H 1C1NA 4GHTA 2ZPQA 1MBQA 1P2IA 3KHVA 1BTYA 3A8CA 2QYIA 3WY8A 1YPHE 1HIAA 1LMWB 1TNLA 1WCZA 1A5IA 1O3DA 1TBRH 2KX4A 1ZTLA 1IHSH 1SQAA 1DY8A 4JZDH 5EPYA 5EW2H 1Y3WA 2J98B 1UO6A 1UCYK 1SGNE 3OSYA 1GBCA 3V13A 4AB8A 3V7TA 1EATA 3A7XA 3FP8E 1AZZA 3RMOH 1K1NA 1O3BA 2K8IA 4MPWA 5FXLA 4HTCH 4Z1MD 5L30H 2FP7B 3SUDA 2O8UA 3K2UA 1D3TB 3RXHA 5FCRA 1IQMA 1Y8TA 4Y8ZA 1VJ9U 3LPRA 1G3BA 3SJIA 4AFQA 3A7TA 2J94A 3ODFA 1BMLA 4D7GA 1HBTH 1EPTA 4ISNA 4RI0A 2A5AA 4GAWA 1MCVA 1B0FA 2EQNA 2YMSC 3BEFB 3UAIC 2GMTC 4BAQB 5DJ7A 1Y3VA 5A8YA 5CE1A 1T31A 1ZLRA 4ASUD 1D3DB 2QXHA 1PYTC 3IG6B 3K65B 3GCHC 5CMXH 1GBDA 1OWEA 4AX9H 3GS9A 4JZFH 3AVZA 3NCLA 1B7XB 1VR1H 3ZVDA 2BOKA 3VB4A 5T6FA 1AZ8A 1CGIE 3U28C 5DP9A 5DN6D 1BBRH 3O8DA 2EC9H 3D49H 2LNCA 4WMFA 5FPSA 3RXBA 1LPKB 2W26A 1EOJA 1ELGA 5E2PA 2QAAA 4MTBA 1EXFA 2BX4A 2FI4E 2FOBA 1UTQA 1EZSC 4TWYA 2OK5A 5LH8A 4I86A 1NBME 4X6PA 4ABJA 3RXDA 1OKXA 2GGVB 1L1JA 4ABHA 1ELFA 2ZDAH 1GVKB 3Q3KA 1GCDA 4Z0KA 1MKXH 3RU4T 3BTGE 1WSSH 1A7SA 5C0TA 2WPIS 1BCUH 3UWIA 3W95A 2HRVA 1IQKA 2OC7A 1UTMA 2Z3DA 5AHGH 3RC4A 2XBYA 1N1LA 3GCTF 1CA8B 1ESAA 1W2KH 1OWKA 3RM0H 3SORA 4FUHA 5EW1H 1DITH 1GI3A 3P8FA 1BTXA 1AVWA 3FP7E 2V0BA 2WUBA 2TPIZ 2XWBI 3SNEA 4NZQA 1QBNA 3PRBA 7LPRA 2VWOA 1O2SA 3RUOA 3VEQB 3B9FH 1W0JD 3E0NB 1VCWA 3KN2A 2PGQB 2RFKC 1QURH 1C5VA 3EA9A 3TGKE 2WPLS 1WOFA 1LHEH 1GHXH 4E7NA 2G00A 2VGCB 1WXRA 1ABJH 1O3GA 3M7TA 2F9VA 4Y79A 4BANB 1ESBA 1SGTA 3ZVBA 1HV7A 1RJXB 2VH6A 1ANBA 1KSNA 1GBTA 1TX6A 3D62A 1HIAB 1G3DA 2ALPA 1GDQA 4INKA 1GHZA 1VITF 3RMLH 2PV9B 3RLYH 4IS5A 3T26A 4CRFA 1G32B 4D7FA 4XSKU 1T4VH 3UFAA 4XBBA 4THNH 3VPKA 1C1MA 3A81A 1ELDE 1EZXC 1O32A 3RXTA 4OS2A 1ANCA 2KCYA 1UK2A 2YOLA 4NIVA 1ZGVA 3P8NA 1DPOA 1P09A 1C4V2 4D9QA 1ZMLA 1EAUA 1F5LA 4RKOB 1YCPH 2BY8X 4WH8A 4B1TA 2H5CA 3HKIB 4K1EA 4HI3A 3SOSA 3LKWA 1TRMA 1CVWH 2BDIA 4X0WU 1UK3A 1GMCG 1GI5A 2J4IA 4Q7YA 1PPZA 2BOHB 1C5QA 1BT7A 4B2AA 1QZ8A 3VB7A 5A8XA 3TK5A 4CRCA 2FDAA 3TU7H 3ZVAA 1GJ6A 1GJCB 2QIQA 3QWCH 3TH4H 5C2ZA 1IQHA 3CENA 2G52A 1BIOA 2OD3B 1Y5AT 2L74A 1W14U 2V6NA 4OS5A 5EQQA 5E0HA 4FU8A 1ZPBA 5JBTA 2YNBA 3UTUH 1O5BB 2A0QB 5DP3A 3FZZA 2W6JD 1GJ7B 1E37B 1F7ZA 1NY22 1NO9H 1ELCA 2F91A 2SFAA 3A87A 3CS7A 1AE5A 1TMTH 3SW2B 2BD7A 2SGAA 6LPRA 1OP2A 3STJA 1GJDB 5HM2A 4XE4A 4A1VA 1AGJA 1KLIH 1YYY1 2C8XB 1L4ZA 1O3HA 4X8UH 1DX5M 4MNWA 4Y0ZE 1SGPE 1BZXE 5DPAA 4DGJA 3QGNB 3A84A 3NUMA 2B8OH 2Z94A 1JXPA 2PKSC 3U69H 1KLJH 5GPIB 4H42U 1QR3E 4K2YA 1AUJA 1YM0A 2EI6A 3QO6A 2OINA 1GI8B 2HLDD 4CBOA 1AWHB 2C8WB 4X6NA 1F0RA 1C2EA 1O2HA 3A8AA 1A5HA 2VIVA 3GCTG 4HG6A 2ZZUH 1V2LT 3LH1A 3M5OA 2F43B 2G4TA 4AG1A 1ZHMA 1TPSA 3W1EA 4GPGA 2PR3A 1ZSKA 1D6RA 3E8LA 1ZRBA 4YLUA 1C1QA 4DG4A 3I29A 3M5NA 1C2GA 3VXFH 1DXWA 5ABWA 3N7OA 2ANMH 2NU0E 1GDNA 1KIGH 1FN6A 1Y3XA 3VXEH 1W13U 4OS1A 2AIPA 2A7HA 2ZHEH 1P01A 1CU1A 1LHCH 3VG8A 2THFB 3RXEA 3PB1E 1V2UT 3GY6A 1E1RD 1VGCC 1AVXA 1AKSA 1W11U 2HNTC 3A7WA 4ZKSU 4TYDA 2OTVA 5AF9H 2C3SA 1T4UH 1IHTH 1YC0A 4XDEA 4FUBA 4ACAA 2STBE 1GG6C 3MYWA 1FV9A 1GHVH 1OWDA 1V2QT 3PO1B 2BY5X 1O39A 1EP5A 1GMDG 2HPPH 3LGWA 1YLCA 2K1QA 1BOQA 2JJ2D 1HRTH 7ESTE 1L1GA 2Y5HA 3PO1C 1MD7A 3RXJA 1EB2A 2BX3A 1ETRH 3FN8A 3BTTE 1BRAA 1EX3A 4UE7H 1GBEA 1GMDF 3GCOA 1KDQB 1L4DA 4Y7BA 1O2XA 4X2XA 5C20A 1ZGIA 1O2RA 2XYAA 1ELBA 3S7HB 4X2YA 5L6NH 3Q77A 4IBLH 3ZZ3A 2BLVA 3DFLA 2Q1JA 4FVDA 2PLXA 1V2VT 4NSVA 1NRQH 1C9TA 2AEIH 3NRLA 3TGIE 4JK5A 1Z71A 1CA0B 5F8ZA 1UMAH 2FI5E 2H6MA 3OFND 4CRGA 5GDSH 1N6XA 5GCHG 2CN0H 1MAXA 1K1JA 2GZ8A 1AD8H 1L0ZA 3P70B 1VJAU 3GCNA 2ODQA 2EI8A 4OS7A 1F0SA 1P03A 1T32A 4DJZB 1F5RA 3GYLB 1UTNA 3ZZBA 1HXFH 2OCVB 1EJNA 3A89A 4FUDA 4B76A 2VVVA 3PLPA 1E34B 4HZHA 1K1PA 1TQ0B 3A80A 5C1XA 2PWXA 1FY3A 2W3KA 1JBUH 1CHOF 2GVFA 1BTWA 1HJAB 2B0FA 2BZ6H 1FONA 2I6SA 3AW0A 3H7OA 1Y3UA 3A8BA 2GTBA 1DVAH 3NZIA 2WPJS 2PW8H 4ISOA 2FOCA 2BYAX 4O3UA 1ZHPA 2BY6X 3BG4C 1FPCH 3SV6A 1SG8B 2A31A 2HPQH 1EAWA 1GDUA 2K0QA 3U8RH 5FAHA 3SJ9A 4MNVA 3SU4A 1BITA 1W0YH 2D2DA 4MNXA 3ZZ8A 3P6ZB 3UPEA 1NBMD 1FDPA 4MQAA 3PLBA 2VBCA 1KXAA 1ESTA 4I8GA 4UFGH 1H4WA 2JETC 3KNXA 1UVSH 2AERH 1O3EA 2FODA 1HNEE 3ATLA 2ZTZA 2ZQ2A 3KYGA 5FCKA 3HPTB 4E7RG 3ZZ4A 1MQ6A 1LVBA 4VGCC 1XKBC 2KCAA 2UUJB 1SR5C 5HM9A 4CHAB 3S9CA 2VWNA 3HGPA 3GDVA 3I77A 1JRTA 1O5FH 2XCFA 1P11E 1C2JA 1O3JA 3SZEA 1AN1E 8GCHG 1EOLA 1QA0A 1OWHA 1RIWB 1VITG 3BEIB 1SKYE 2TGAA 3M3SA 4X1SU 2OC8A 3M7UA 1CBWB 2C8YB 5LPEA 1V2TT 1IOEA 2ZHQH 3RLWH 5LPRA 2CV3A 2TIOA 1CQQA 3QTVH 1Q2WA 2W7SA 1TQ7B 1LKAA 4LK4A 2AHME 4ABAA 1LQDB 1BRCE 2CJIA 1WYKA 1PFXC 1LVYA 3EQ0H 3BG4B 2PUXB 3Q76A 1MTWA 2ZCHP 1IQJA 1EPTB 1SQOA 3SUGA 1NT1A 3TH3H 1YCPK 2ZCLP 3PV4A 1BJVA 1AB9C 1NU9A 3S9AA 3R3GB 3U1IB 1HJ8A 1J16A 2R2WU 1P3CA 3NKKA 1JWTA 1AFQB 1D4PB 4AYVB 1C5NH 4KELA 3IWMA 4YTAA 4I32A 4X1PU 3DD2H 4BTTB 1UCYE 4X2VA 3UUZA 4BTIB 2BM2A 2FOGA 1SFIA 1T8MA 2J98A 5KECA 4Y11E 4X8SH 1A0JA 4E05H 1QQ4A 2Z6BD 3F2GA 1W0KD 1W0ZU 2HVYB 2ZFQH 4WWYA 1O5CB 2V35A 1ACBE 5EXMA 1NRPH 2NU2E 1C5MD 1E35B 2BDAA 5CHAB 3RC5A 3MU5A 2VIDA 3UOUA 5I46H 2LELA 4KGAA 3CP7A 3LT3A 1KMHB 1CA0C 5GNDA 2ZDNA 1O3MA 2OQ5A 2PKAA 1GJ9B 4CR5A 1BTHH 2SNVA 2ZGCA 2ZKSA 5JB9S 1LHGH 3PMBB 3ATWA 1ZPCA 2A7CA 2HNTF 1QA7A 3LC5A 1S0RA 4Y6DA 4GSOA 1DE7H
chains in the Genus database with same CATH topology
4ABIA 1GCTB 3QUMP 3LC3A 4QT8C 2ZQ1A 1O2YA 3SNBA 1XVOA 1K1OA 1ZR0A 5HYOA 3VB6A 1C1RA 3MNSA 2VIQA 4I8HA 2VJ1A 3SV7A 2ZU2A 1TNGA 3F9HA 1AUTC 4D76A 2BXTH 1KXEA 2OC1A 2ZEBA 1HAXB 4CH8B 1EAIA 1P9SA 2VIWA 1F0UA 1O3PB 1V2WT 2OBQA 3SGAE 1PPHE 3U1JB 3DHKH 4FUCA 4NA8A 1OWJA 4KTCA 1BBRK 2BVXH 1O3FA 4XOJA 1QBVH 3ATKA 1UTPA 1SGEE 1J14A 1QRXA 1BRUP 1VITH 1LTOA 2IPHA 3A88A 4A5TS 1EJAA 5EODA 5PTPA 4K60A 4I8KA 2Y80A 2QXGA 5C67A 2BTCE 5LGOA 1SGIB 3SUEA 4ZAEA 2B5TB 3KQDA 2QN5T 3E16B 1MKWH 3HATH 3UNQA 3GISB 2GKVE 5DO4H 1TALA 1BA8B 4AFUA 4X1NU 1QBOA 1IQEA 2AGIX 1V3XA 2FLRH 1BUIA 2A4OA 1F2SE 4IGDA 7KMEH 1A3BH 1INCA 2WUCA 2SGFE 4TPYA 1GHBG 1EAXA 3RXIA 5DGJA 1UHBB 3LGYA 4MG3A 1EASA 1C1OA 2P8OB 3A82A 3V0XA 1MTNC 2VWMA 1FY4A 4BAHB 3TH2H 4NCYA 4CR9A 2CGAA 5E0GA 2BD4A 4CRBA 3F9GA 4K69A 1GHYH 1HAZB 1V2ST 1O0DH 3MO3A 4AGKA 3GYMA 4U01A 4GLYA 4YESB 1TIOA 3M61U 3TIUA 1SI5H 4NWKA 2GX4A 1MTSA 1CO7E 3GICB 2XBWA 1HLTH 3ZVFA 1RD3B 1TWXB 1XKAC 2HNTE 4Y7AA 4DIIH 2FEQH 1SLXB 4IC6A 4TY7A 5E8EH 4AZ2B 1KXCA 1CT2E 2ZU5A 3OX7U 2QF0A 1TONA 2ZWLH 4D8NA 1SGRE 2HWLB 1F5KU 2VGCC 2WV4A 2G5NA 2GDDA 2FM2A 4ZROA 1CHGA 2XXLA 2R2MB 3AAUA 5A8ZA 1YPMH 1OS8A 2FOMB 5FPYA 1RTLA 3RXGA 4AFZA 2TGPZ 1T8NA 2C93B 4ISHH 2P3TB 1QIXB 3F9FA 3URDA 3E0PB 1MTNB 2UUKB 3MH5A 2AS9A 1DUAA 2NWNA 1HAYB 1MAYA 2CF9H 2A5KA 2PTNA 2R0KA 1XMNB 4U30A 2ZU3A 1EJMA 1PYTD 2BLOA 2HVXA 2ZC9H 1ZZZA 2VWLA 4Q2KA 1TNKA 1IQIA 3GY5A 4GCHF 1HAIH 4X8TH 4J2YB 1GJBB 3NXPA 2ANKH 3QN7A 4X6MA 4ZKOU 1ZRKA 4MDSA 1TA6A 1ZJKA 1TGCA 1TYNA 2WPKS 1TX7A 1O31A 2BZAA 3LH3A 2FS8A 4JCNA 5TCCA 5F8TA 1QJ6B 3ESTA 3UR6A 2DUCA 4JYVH 3KIDU 4X2WA 3RXUA 2F3CE 1E38B 1AVGH 2NU3E 3PROA 1V2MT 4FUGA 2ZHWH 5IYTA 5DP4A 4DT7B 1W3CA 2ZIQH 1DS2E 4BAKB 2VIPA 7GCHF 4UD9H 1ZSLA 4Q7XA 4BOHA 1Z1JA 2VNTA 5DKMA 1F92A 1IQNA 1GCTC 1GBLA 4ZUHA 1A0HB 2BQ7B 2A4QA 1O5AB 4XBCA 7GCHG 1VZQH 2JKHA 2ZFFH 2OQUA 3MOCA 1NRSH 2C8ZB 4WXIA 1O3NA 2A1DB 1J9CH 2ZECA 4Y0YE 4RKJB 4ZH8A 4F49A 6CHAC 1L2EA 4E06H 3BTQE 1G9IE 3S69A 1P0SH 1MBMA 2FTMA 1RFNA 2Q6GA 2VVCA 2R3UA 2WPHS 4UFFH 1N8OB 2CMYA 3SO3A 5ESBA 1YGCH 1S6HA 1QQUA 3QDZB 5JDUB 5GJ4B 3C27B 2GT8A 4K1SA 1ETSH 3P95A 1O3CA 4ZXYH 4OS6A 5FX5A 5A2MH 3RXSA 4D9RA 1EZQA 2PGBB 1XUJA 4IMZA 1T7CA 4A1TA 1O5GH 2ZA5A 1M9UA 1ZHRA 3GCHB 2XW9A 5JYIA 3PM3A 1HCGA 1A4WH 1S82A 1FZZA 1O5DH 3F6UH 4BAMB 1MCTA 2W7UA 4X8VH 5SGAE 1FY5A 2V3OH 1OWIA 4KKDA 3RMNH 1C5XB 3RM2H 3FVFB 1J8AA 3EGKH 4WVPE 1NZQH 1H8IH 1TPOA 1UTKA 3T5FH 3PMAB 2J34A 4NZLA 2ZFRH 4AB9A 3TJVA 5C1UA 1GPZA 4IN2A 2ZHFH 3UNSA 3FANA 2FX6A 1ANDA 1C2DA 2Y6TA 1GI7B 1KYNA 1O2WA 1NRNH 1C5LH 4A1XA 2R0LA 3SI3H 2FO9A 4X1QU 3SV2H 4AORA 3UQVA 1CT0E 1BQYA 4NA9H 4HGCA 1GHAG 3SGBE 4ZHMU 3SJKA 2ZTXA 1GGDC 2BQWB 1P06A 4K8BA 4F4OC 1UK4A 1UHBA 3RXAA 1BMMH 3LONA 4XBDA 3QLPH 2P93A 1O3KA 2ZP0H 3MU0A 3UOPA 1HAPH 2GCTC 1OP0A 4CRAA 2GCHG 1BBRE 1PPGE 4DIHH 1KXFA 3JZ1B 4KP0A 1FUJA 2DE8A 3M7QA 1GBIA 1TNIA 4FVBA 1FMGA 1HAOH 1TGBA 3MH7A 1VCPA 4DOQA 2BD5A 2BHGA 1D6WA 1LHDH 2D8WA 1QJ7B 4CBNA 3MTYA 1WTGH 2WYGA 3ODDA 1CSOE 1TBQH 4GVUA 4NWLA 3SUFA 1TNHA 1T8LA 1W7XH 1DLKB 2Q6DA 3SI4H 1C2MA 3RXCA 1PJPA 1ARBA 1CE5A 5EPNA 3BEUA 1BHXF 5JBCS 3VB3A 1YPHC 1MKXK 2IJOB 4YLQH 1UCYH 4I7YH 1V2RT 1QTFA 4JZ1A 1UTLM 4FUJA 1SQTA 3GY3A 2KAIB 1YKTA 5EG4A 1ARCA 2Z9IA 1C1TA 1SMFE 3KEEA 1QL7A 5AFYH 3A8DA 1MU6B 1NPMA 2SGPE 2J92A 4I33A 4B71A 1ZYOA 3PMJA 2AH4X 1ELVA 1WU1A 3P8OA 1V2NT 4RSPA 1P2QA 1UVPA 1AMHA 1G3EA 3T29A 2KAIA 1THPB 1O2OA 1QHRB 1EPTC 1EZUC 1TE0A 2BD3A 1HAHH 3P92A 3MMGA 4MVNA 3L33A 3RXRA 1DXPA 5FBIA 3PLKA 1CHOG 1W12U 2BXUH 4IW4E 6GCHF 1FNIA 2RA0A 1MZDA 1G2LA 2FLBH 1BTUA 4BXWA 4ASHA 2G8TA 5DP7A 1LPGB 1K9OE 2ANWA 1HYLA 1SOTA 3ZZDA 6GCHG 1BMAA 4I8JA 2ZG0H 1V6DA 3V3MA 1GBKA 1U6QA 1TRNA 1S81A 1SC8U 1UJ1A 1O2UA 2GDEH 3DA9B 1DWCH 2XC0A 4VGCB 4DURA 1HFDA 2FOEA 3QZQA 1GI2A 1W10U 1GI0A 2J2UA 1C5YB 3MNBA 4A7IB 1MUEB 1D9IA 4Z6AH 1BRBE 1L1NA 1HAVA 1O2MA 3TLOA 4I8LA 2O8MA 3HK6B 1TRYA 2QC2A 1PQ8A 2W3IA 1GHAF 2A5IA 4ZKNU 4MPXA 1T8OA 2G5VA 4FUFA 2FX4A 4UDWH 1H9HE 3TNSA 1O3LA 5EQSA 4OGXA 1P2NA 3E1XB 4AYYB 3ZZ6A 3RXVA 3OU0A 1G37A 5T6DA 1QL9A 3ENSB 5FX6A 1FQ3A 3ELAH 3SBKA 2GCHF 4ZXXH 1E36B 2FZZA 3I78A 1IQFA 2QXJA 3EE0B 3SU2A 3A7ZA 2VH0A 4H6TA 2EI7A 1O38A 2G51A 3PTBA 1OP8A 4UEHH 1SGCA 1Z8JB 1K28D 1XXDA 5ESTE 6ESTA 3EA8A 2PSYA 4Y8XA 1W7GH 1HJAC 3PTNA 1HAGE 5T3HA 1YP9A 5HXFA 1TMUH 4GUXA 2ZF0H 3SGQE 4R0IA 1TMBH 3DUXH 2FPZA 4TY6A 4A92A 5GXPA 2F9PA 5F8XA 3G01A 3URCA 2J38A 2UWLA 5AVDA 1LVOA 2FYRA 4UFEH 3RXOA 2RG3A 1QCPA 2ZU4A 1BTZA 2B7DH 2VB0A 2ZFTA 1P2OA 1TPAE 2SGQE 3LIWA 2ZGBH 5GCHF 1SGDE 3MU1A 1KY9A 2P3FH 5EXLA 4ABEA 3BTFE 5DP5A 2F9BH 1C5TA 1GWAA 4CREA 2ZFSA 2BY7X 3R0FA 1HJ9A 5FPTA 3S0NA 3FAOA 2WPMS 1W8BH 3BTWE 4ZHAA 3A7YA 2P95A 1ETTH 9ESTA 4INHA 3UREA 3MWIU 1C5SA 1V2OT 4KTSA 5FBEA 1PQ7A 2A7JA 3RXQA 1XUGA 3AAVA 1O30A 1OPHB 2OLGA 2VU8E 2Q6FA 3SJOA 1QGFA 1AO5A 3T27A 1BB0B 4DY7B 3B8JA 2O8LA 2PSXA 1NTPA 2A32A 2XC4A 4X1RU 1F0TA 5EU8A 1RTFB 4TWWA 1ABIH 1O2JA 1GL1A 3O8CA 1N6YA 1PPCE 1DWEH 1H9LB 3LU9B 3ZVCA 1LQEA 1JRSA 4INLA 4BNRA 2H9TH 3UR9A 4AGJA 3K6ZA 2DE9A 2STAE 3MO9A 1G36A 3SU1A 3K6YA 3ZZ9A 2ZCKP 1AU8A 2ODYB 2A45B 1EKBB 1P8VC 2W5EA 1VGCB 3TNTA 4MLFB 2JH0D 1DSTA 2FOAA 3RXPA 1TFXA 1O2NA 3EA7A 2EEKA 2HALA 2R9PA 3MH6A 1MTUA 3BTKE 4Q7ZA 5G4BA 2ZDVH 1SBWA 1LCYA 1C1PA 3BV9B 3ZZAA 8LPRA 1FXYA 3KCGH 4NG9H 4YOJA 3FZDA 3GY4A 3M37A 4OGYA 5C5NA 3BSQA 3TPIZ 1YBWA 3W94A 3P17H 1GVLA 2XCNA 3MNXA 1C1UH 1ZPZA 1YCPM 1D3QB 3SU3A 3F9EA 1FN8A 2QCYA 1DOJA 1G30B 1PPBH 4IN1A 3B23B 4R8TB 2G81E 4BAOB 4K3JA 1V2JT 1AWFH 2BQ6B 5JBAS 1ELTA 3D65E 1P3EA 3HKJB 4BTUB 1GI1A 3Q3YA 2PKSB 2Y82A 5DP8A 1QRZA 2FYQA 3UQOA 1LPZB 4TPIZ 2BD8A 5ETXA 3SNDA 1C5WB 3ATMA 5K7RA 1WTHD 1AKSB 4B2BA 3LDXH 2ZNKH 1BMNH 1ORFA 2Z9LA 3KQCA 2D26C 3SU5A 1BTPA 1K21H 2GZ7A 4KTUA 3M3VA 4RN6A 3VFEA 1XM1A 2P59A 2V3HH 1DM4B 4LZ4B 1P02A 2BDHA 1ZJDA 2XWAA 3ZZCA 2UUFB 1O2TA 4H4FA 1SFQB 1AFEH 1CT4E 1O2GH 4FXGH 3ZYEA 4YO9A 1GHWH 2RCEA 4ISLA 1AIXH 3UNRA 1X7AC 3V12A 2G55A 4LXBH 1Z7KA 1K1MA 1P57B 3ZVGA 2GV7A 1O2KA 4O97A 1LO6A 1NFYA 1TA2A 1Z8RA 1H8DH 2ZGXH 1FJSA 1SPJA 2RDLA 1ANEA 4Y76A 4WJG2 2GZ9A 1KDQA 1C1SA 1IQLA 3EAJA 2OP9A 3GY2A 4B74A 3SZNA 5A0AE 1KLTA 4FU7A 3MO6A 5A09A 1YF4A 4NIXA 2XC5A 4XFQA 3SQEE 4ESTE 1IAUA 1QNJA 2JH5D 2AIQA 1FY8E 1EQ9A 4DCDA 2F9OA 2J9NA 2OC0A 3PWCA 5F03A 1C1VH 1SL3A 2XBVA 3DT0H 4ISIH 2ZU1A 2AGGX 2XTTB 5J4SA 1ZOMA 1TB6H 2FMJA 3GOVB 1KTSB 1Y59T 1SB1H 1TPPA 5TJXA 2QV1A 2VINA 4PROA 1DT2A 4GHQA 1S83A 2CHAC 2H1UA 2A2QH 3AW1A 2TRMA 1THRH 3O8BA 5E2OA 1TOCB 2F83A 8KME2 4IC5A 2H5DA 4ABBA 1NROH 3U98H 1SHYA 1HUTH 8GCHF 1Z8GA 3D23A 1C5PA 1J15A 1FAXA 1LDTT 1PPEE 1GJ8B 1WUNH 4B2CA 1NFUA 2BDBA 1O2ZA 2ESTE 1WQSA 2BB4A 4ABFA 1P04A 1XVMA 3LGTA 1N8OC 1S6FA 1OYTH 1C2KA 2FOFA 4MPVA 1K22H 1NU7B 2CHAB 2CF8H 1QJ1B 1DWDH 6CHAB 3OTJE 3PWBA 1TNJA 2ANYA 3QGJA 2BD2A 1O2PA 2FI3E 3O8RA 1FAKH 4O03A 2UWPA 2ZGHA 4U2WA 1K1LA 3FFGA 1TLDA 3KL6A 1DDJA 1UVOA 4B75A 4FUIA 1JMOH 1FY1A 1S5SA 4UONA 3F68H 2Y7ZA 1Y5BT 3GY7A 3QX5H 1O37A 1G2MA 1AHTH 1UTJA 2Y7XA 3FP6E 1C1WH 1K1IA 1P2KA 2OXSA 2ODPA 5GIBA 5I25A 4FUEA 3RXKA 1QFKH 2HLCA 2D1JA 1OX1A 2C90B 1CGHA 1GJAB 1MU8B 2A4RA 1Z1IA 2UWOA 2FESH 2OBOA 1S85A 1E0FD 2Z9KA 3Q00A 2ASUB 1B0EA 1YPEH 3BG8A 3E6PH 2ZFPH 1KXBA 3TITA 3SNCA 1Y3YA 1CGJE 5BRRE 1QY6A 5T6GA 1SGFA 3C1KA 3T28A 2QA9E 2WINI 1SGYE 4MNYA 4CRDA 3UIRA 4MPUA 2NU1E 3LGIA 4DW2U 4ZKRU 3M3TA 1TABE 1C5RA 1MZAA 1C9PA 2AYWA 1BHXB 1XX9A 1HB0B 4SGBE 1VCQA 4OS4A 3U8OH 1O35A 2ZI2H 4NSYA 1EUFA 1UTOA 3TJOA 2GMTB 2IOTA 5LPFA 3PYHA 1AB9B 1TX8A 4JYUH 3NWUA 3AASA 4I31A 2TGDA 2H9HA 2GP9B 4B73A 1ELEE 1YPLH 2BY9X 1MD8A 3T2NA 1THSH 1JOUB 1YPKH 4IMQA 4NGAH 1NM6A 4NFFA 9LPRA 3LJJA 1P10A 3KQEA 2BDGA 5EXNA 4YZUA 2BDYA 2SGDE 3SJ8A 5DP6A 3SNAA 3LGVA 2P94A 2O8WA 2Z7FE 2ZDKA 3F1SB 4Q80A 2FWWA 3M36A 3E90B 3JZ2B 5L2YH 5CHAC 3NPSA 5A0CA 2FIRH 3HGNA 3VGCB 2ZDLA 5TCAA 4CHAC 2UUYA 1GBFA 3A83A 3U9AH 1B5GH 2ZPSA 3BTME 5C5OA 1HGTH 1NN6A 4AG2A