1O2JA

Elaborate manifold of short hydrogen bond arrays mediating binding of active site-directed serine protease inhibitors
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords BETA-TRYPSIN
publication title Elaborate Manifold of Short Hydrogen Bond Arrays Mediating Binding of Active Site-Directed Serine Protease Inhibitors
pubmed doi rcsb
total genus 53
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2003-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1o2jA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1o2jA02
1PQAA 2P95A 3E91A 1ZYOA 5GIBA 2FOMB 1C1WH 2SGQE 2NU4E 2BX3A 3GCHB 4JMYA 1C1SA 2WV4A 1LQDB 3QUMP 4XBDA 4X8VH 3UFAA 3K6YA 1PPCE 5JBAS 2ZIQH 1ZPBA 1SGQE 1NFXA 5I46H 2GMTC 4NWKA 1BA8B 1GJ9B 1J16A 4ABIA 1BMNH 2FI5E 1K1PA 3A85A 2GP9B 4NIWA 3VGCB 3MYWA 3TK6A 2PTNA 4CR9A 2AH4X 3FZZA 1P2JA 1PQ8A 1UK4A 2QGRA 2VIOA 1YKTA 2GCTC 2G8TA 3TGJE 3RC6A 1ESTA 1NO9H 2C3SA 5ETXA 1Y5BT 2AMPA 1C5VA 1O5FH 2A1DB 4ZH8A 1MKWH 1ANDA 2ODQA 3T29A 4UDWH 1GBMA 2C8XB 2ZDLA 1AZZA 5FBIA 3LGWA 1GJBB 3HGNA 2FTLE 4AZ2B 3RDZA 1XXFA 5FPYA 3RMOH 1RS0A 1EJNA 1SLXB 2VH6A 5AFYH 1OS8A 2VVVA 2A4OA 1H9HE 3A7YA 3MNSA 5B6OA 2WYJA 4ABDA 2XW9A 1KXAA 3MHWU 3LJOA 3BTEE 1TOCB 1P2KA 4MQAA 3A80A 3EQ0H 1RTFB 1DT2A 2JH5D 4GUXA 1EZXC 3IWMA 2B8OH 3EA8A 5EQRA 1W14U 5E8EH 1BRUP 3L3TA 1PPHE 5EOKA 1P2IA 2V35A 2V6NA 2G51A 2BX4A 1QBVH 4U2WA 1DWCH 1HUTH 1JMOH 2OUAA 4B2CA 1ZMNA 1H4WA 3ZYEA 1GCTB 4GSOA 1AFQB 3BTGE 1O5DH 1OWEA 1QA7A 3MNCA 2WYGA 2QN5T 3BTQE 3SJ9A 1XUIA 1O36A 1RFNA 2G52A 2A4RA 1W2KH 2Z9JA 1HAOH 1ZSLA 1BTXA 2NU1E 2A45B 2XBXA 3V12A 1HGTH 2ZFSA 4Y0YE 3SJIA 2FS8A 2STAE 4BAQB 3NPSA 2KAIB 2ZA5A 1EOJA 4O3UA 1V2JT 4KP0A 1GI0A 3ATLA 1AZ8A 3TU7H 1S0QA 2P59A 1CQQA 2Z3EA 3LH3A 1W0ZU 1T8LA 3QX5H 4LK4A 5LPRA 5LPFA 2Q6DA 1O2OA 5EW2H 4JCNA 2FXRA 2XXLA 1TPAE 2QF0A 1EAUA 1DWDH 5T3HA 4GCHF 1O34A 1EB1H 4H6TA 4X8UH 3T26A 2BVXH 5A0BA 3BEUA 2XWBI 1KLTA 2QAAA 1OP2A 2OTVA 2Y7ZA 4FXGH 1HAVA 4TYDA 3CS7A 2ZTYA 3UIRA 3SGBE 4AX9H 3DUXH 3P8GA 2ZCKP 1AKSA 3UTUH 2QXHA 6CHAC 1UVSH 2NU0E 1K1OA 3NCLA 4THNH 4BTUB 2I6QA 2SFAA 4CBNA 1DY8A 2J38A 4NA9H 2YNBA 4HZHA 4UONA 1Q2WA 1MBQA 3TGIE 5A09A 4BAOB 3LONA 2R2WU 1CBWC 5DP7A 2PR3A 2SGDE 1Z7KA 2R0KA 1FIWA 1SR5C 3QLPH 5DPAA 3S7KB 2C8ZB 3RU4D 1SLVB 2FOGA 3OSYA 2YNAA 2ZCLP 3AW0A 1W13U 4ZXYH 4WH8A 2BDAA 3RXJA 4MTBA 4GHTA 3RP2A 1O2TA 5E0HA 2P3FH 3E8LA 1L4DA 5FPTA 1AHTH 1E37B 1ELFA 5ESTE 1KTTB 2ZGJA 1O2IA 1V2KT 4WXIA 1E36B 1A61H 3MTYA 1BTHH 1BRBE 1PJPA 4CH2B 1P8VC 5EGMA 3BTTE 1XUJA 1NC6A 2ZGCA 4K1EA 1AIXH 5FAHA 1C1OA 3PROA 4OS7A 2H6MA 1N6YA 1P2MA 3RXKA 1FLEE 5L6NH 4K1SA 2Y81A 3RU4T 1C5NH 3LGTA 3LU9B 5EU8A 4Q7XA 2DE9A 3GY3A 1UK2A 1SQOA 1Y3XA 1DE7H 1O33A 2UWPA 2P93A 1KSNA 2GV6A 5LH8A 1O3HA 4X2XA 4SGBE 2A7HA 3HK3B 4NA8A 5C1YA 3TNSA 4TPYA 2ZDMA 1QB6A 1SGTA 1NESE 1AVWA 1Z8RA 1G36A 4B73A 1BTUA 3RXHA 1ELEE 1GI5A 5JB8S 1U6QA 3KNXA 4CHAC 2FOBA 3ZZ3A 1Z1IA 1TIOA 1PQ5A 1NN6A 4JZ1A 3GYLB 5JPMH 1C5SA 1P2OA 3O8RA 1WBGB 2TGAA 4AG2A 1UVUH 3RXGA 2GTBA 1VCWA 1YCPK 1G30B 3N7OA 1K1NA 5A2MH 1Q31A 1LKAA 1Y3YA 4WMFA 2PV9B 4HFPB 7KMEH 5E2OA 4K5ZA 1O2PA 3E1XB 5FXLA 2A4GA 1JBUH 1C2JA 2BD9A 2G4UA 1Y5AT 4ZHLU 3FANA 1G3DA 1T8OA 1KXEA 2UWLA 2ZFTA 3OX7U 1FONA 3DD2H 1G2MA 3M3SA 4FUGA 4NA7A 1AWFH 1H8IH 5JBBS 3A7ZA 1RTKA 2Z94A 2P8OB 1O3OA 3OY6U 1HJ8A 4MNYA 1ZZZA 4NSYA 3LGUA 1DANH 2VIPA 3A88A 2VIWA 2VGCC 5DP9A 4UFDH 3P92A 1QQUA 3MU4A 4Z6AH 1EZSC 3UUZA 2HGTH 2XCNA 1GGDB 3Q76A 2OQUA 2D8WA 3U8TH 1GHAF 4X6MA 3ZVAA 1BOQA 1BTWA 1UCYE 4JZIA 1OX1A 2QXJA 3URCA 5A8XA 4I8JA 3SO3A 1TGNA 4VGCB 4X1QU 4B2BA 3UPEA 3A8DA 2XBVA 1A0HB 5J4QA 1IHTH 2ZDNA 1GBCA 1BJUA 1O5EH 1KDQB 1Y3UA 1GI3A 1C5RA 1GJ6A 1UTMA 3PMAB 1DXWA 3MH4A 3U1JB 6GCHG 1ELBA 2HRVA 1UTQA 4FUIA 1P02A 1INCA 1GDQA 3RC4A 1TNJA 1GHZA 1EUFA 2BY7X 1J14A 3S9CA 3GOVB 3VXFH 1ANBA 1UO6A 3GYMA 3LH1A 2J92A 2BY9X 2EA3A 1SLWB 4FU7A 1IQFA 3VB5A 2BYAX 5JB9S 2PSYA 1QL9A 1C2MA 2UUKB 1GBDA 1TRMA 2WUBA 1ELDE 2OC0A 4Y8ZA 2XNIA 2ODYB 2Z6BD 2W7SA 4INHA 5ABWA 2GGVB 3U9AH 4CRFA 1VCQA 1O3IA 1QQ4A 4XBCA 5EQQA 3V3MA 1UTJA 4BAHB 2B0FA 4FUJA 3A8BA 3HATH 1HAVB 1W0YH 5EQSA 3RXRA 1MTSA 3ATWA 1C5OH 1C5YB 4NSVA 4Y8XA 1KXBA 3ZZAA 1S81A 1SOTA 5CHAC 1O2GH 3MNXA 1XUHA 4U01A 2VJ1A 4OS4A 4LXBH 1GJCB 1NRSH 4F49A 1F5RA 1FZZA 1FN8A 3UREA 2PLXA 4GPGA 4ZHMU 4FUHA 5AFZH 2AMQA 2V3OH 2ZDKA 4I8HA 4JZEH 1OWJA 1O5AB 3MWIU 1P06A 3M7UA 1CA0B 1QCPA 1AMHA 1N8OC 1ZHMA 1O3CA 1P10A 5SGAE 4KTUA 3U1IB 1FPHH 1ZHRA 2BTCE 4AFUA 1F5KU 1AE5A 1P2NA 4X1NU 1LPZB 1P0SH 1L1GA 3ZVFA 4Q2KA 2CXVA 2ZPQA 1TFXA 3B9FH 4MLFB 1O30A 3AAUA 1V3XA 3PV4A 1A2CH 2TPIZ 3DHKH 3I77A 3BIUH 5TCCA 3SNDA 1HNEE 2EI8A 1AO5A 2Z9GA 1CO7E 1YBWA 2ZHQH 7GCHF 1TX7A 1LHCH 3NWUA 4FVDA 2AGEX 1TB6H 4ABAA 1XVMA 2P94A 1RGQA 1OWHA 4ISLA 5FPSA 2ZFPH 2XBYA 2R0LA 3RM0H 4FU9A 4BTIB 4KKDA 1MU8B 5DGJA 3ZZ7A 4Q7ZA 2KAIA 3E0PB 4GHQA 3RC5A 4CR5A 3RXFA 1A46H 3SGAE 4ABHA 1AUJA 3TK5A 3VXEH 3UOUA 2TGTA 4UFGH 1P2QA 2A7JA 2QXGA 3U98H 3R3GB 1QRWA 5TJXA 3AASA 3UR6A 2OC8A 3TNTA 2PUQH 1UTKA 1C5QA 1TGCA 1V2QT 1HJAB 2Y7XA 1DWEH 1IAUA 3PMHB 3E6PH 1E38B 2FP7B 2J4IA 2HVXA 3QO6A 1J8AA 4Y71A 3QZRA 1FV9A 2GZ9A 4K3JA 2TIOA 1MMJN 1C2EA 3UY9A 1PPGE 5A8YA 2AGIX 1C2FA 1GI8B 1GG6C 2EI7A 2PKAB 1O2YA 2BZ6H 2FS9A 1QBNA 2STBE 2Z3CA 3F9EA 4X6OA 1MTNB 1O3LA 1TBQH 2RA0A 3GY8A 1C5LH 3T28A 1Z8JB 1RIWC 4K69A 1PQ7A 2XWAA 5JBTA 1QRXA 1T8NA 4YLUA 3D23A 4YZUA 3MO3A 3F1SB 4D7FA 1S85A 3SORA 6GCHF 2THFB 4A6LA 1LHEH 5GDSH 5JDUB 1TX8A 4IN1A 1SSXA 1G3CA 4K8BA 4AFSA 5F8XA 3A86A 3GCHC 2F9UA 4I7YH 4X2VA 5C67A 5HYOA 4A1XA 2HOBA 1GMDF 1O3GA 1DOJA 1WTGH 4PROA 5DP5A 1UTNA 2P16A 2ZDVH 3F6UH 2D26C 3F68H 3OY5U 1WOFA 4YOIA 1K1IA 1HJ9A 1OWIA 3OTJE 2FI3E 2FPZA 1EB2A 2IJOB 1C2KA 1XUGA 4ZKRU 2O8MA 1AWHB 1GBBA 4ZAEA 1QJ7B 1OWKA 1QIXB 2C8WB 1O3NA 3OYPA 1E0FD 1P9UA 2DUCA 4K8YA 2ZU5A 4DVAU 2GDDA 1ACBE 3F9GA 1NU9A 2BOHB 4I8KA 3VB7A 3MU1A 1SQTA 1MZDA 1OXGA 4X0WU 1Y5UT 4MPUA 2WPJS 1ZSJA 1SC8U 3B8JA 1AE8H 1EXFA 3GY4A 1OP0A 2ZFFH 4Y76A 2A2XH 1A5HA 2PGBB 2BZAA 1Z6JH 1GWAA 2F91A 4INLA 4DG4A 2XYAA 5DG6A 5EPNA 2M5TA 1MTVA 3LPRA 2QXIA 4UFFH 3P70B 4DT7B 1TPSA 3I29A 3SV8A 1ABIH 1GI4A 3RXCA 5F8TA 3ZV9A 2YOLA 2OBQA 4WMEA 5C20A 3EA7A 3LC5A 4UD9H 1EX3A 1GBFA 1GHXH 1GBLA 2BLQA 3EAJA 4DURA 3ITIA 3ZZ4A 1WAYB 3SQEE 2BLOA 4TWYA 3SHCH 1HAIH 5HGGA 2RDLA 3L33A 1GMHG 3UWJH 5J4SA 3PM3A 3LGVA 2ZU4A 3UNQA 1UTLM 4ZKOU 1JOUB 1GCTC 1AFQC 4IS5A 1AGJA 2Y6TA 2ALVA 2ANYA 2GMTB 2R2MB 2VINA 3DFJA 3AW1A 2BB4A 2F9OA 3BN9A 1S5SA 4BXSA 1BTZA 2VWLA 3U8RH 2TRMA 2FOCA 4ISIH 1LVOA 1WU1A 4IMQA 4AORA 2ZU2A 1OKXA 3ZV8A 2A4QA 2NU3E 5GWZA 1YPHE 2BD4A 4ISOA 4U30A 2A0QB 1AI8H 1UCYH 3SUFA 3SU6A 2LNCA 1XUFA 1PPBH 3A87A 2CF8H 1A5GH 1V2OT 3MO6A 4AG1A 2A7CA 5DP4A 2RA3A 1KDQA 4NZQA 1O3KA 1O3MA 1PFXC 4HI3A 1HLTH 1ZLRA 5EXMA 1QY6A 4FVBA 3KQBA 2FX4A 1F0UA 2BDGA 2QY0B 1RD3B 5EG4A 2BY6X 5EXNA 2HNTE 4Q7YA 2A2QH 4GVUA 1MCVA 1HAYB 2J34A 1ZPCA 3RXEA 1ETRH 3KF2A 1YPGH 3GCTG 1XXDA 3ZZ9A 2ZO3H 1D3PB 1CHGA 1O5CB 4X2WA 1YCPH 5DP6A 1IQGA 1F0RA 1L0ZA 2WPLS 1CT2E 1BIOA 7LPRA 1RTLA 1G32B 2ZTZA 1O2HA 4Z0KA 4YT6H 2UUJB 1CT4E 4CRGA 1TAWA 1C1NA 1UHBB 3A82A 1A0LA 2ULLA 3TLOA 1W11U 1S84A 4AFQA 2TGPZ 1WQVH 1YPEH 1P09A 5HMAA 2AIPA 1N1LA 1C1UH 3QTOH 3TH4H 1F0SA 1QJ1B 3H5CB 3KL6A 3FZDA 3CP7A 1FN6A 1GBTA 1BMMH 1THRH 3RXLA 8LPRA 2ZPRA 1YGCH 2ZG0H 2D1JA 3SU0A 3PYHA 3QDZB 3BG4B 3NK8A 1F92A 4YLQH 2XTTB 3KQDA 1O3PB 2PGQB 1NU7B 5CE1A 1O2VA 2ODPA 3BV9B 8ESTE 1FPCH 1FY1A 1HYLA 1TMBH 1MTWA 2EEKA 3EA9A 1GVKB 2VWNA 4NFEA 1Z8GA 4MNXA 3U8OH 1SGRE 2CF9H 3A83A 5FHTA 2BVRH 2R9PA 2P3TB 2EC9H 3M5MA 1HXEH 4X1RU 1TWXB 3EYDA 1UCYK 1A1RA 2BD8A 3PWCA 4D76A 3TITA 1ORFA 4E7RG 2P3UB 1PYTC 1J17T 2G4TA 2TGDA 1NRPH 2W3KA 1ARBA 4OS6A 3PLBA 1WSSH 4H6SB 4JK5A 1KY9A 3K65B 1SGYE 1JRTA 1TOMH 1C5WB 1SGDE 2NWNA 2XCFA 2Y5FA 4IMZA 1W8BH 4K1TA 1V2PT 3M37A 2OINA 4TY6A 2PW8H 2OBOA 4JYUH 2FDAA 1D6WA 3A84A 2JETB 1CSOE 1FY4A 2QYIA 1LKBA 3SU5A 2VH0A 1V2VT 3B23B 1TMTH 3A8CA 1NM6A 2SGFE 1GHBG 4WWYA 3VEQB 4NG9H 1XM1A 1GI7B 2O8UA 3L6PA 2WPIS 1AB9B 1QL8A 1L4ZA 3D65E 1KLIH 2OC7A 4B76A 4IGDA 3PO1B 1V2ST 2PUXB 1TE0A 1VZQH 1GMHF 2O8LA 1O5GH 1ZTKA 4A92A 1MH0A 3BEIB 2BY8X 2VIVA 4WVPE 1DICA 5EODA 2ZC9H 1NFYA 1EAWA 1GBJA 4AYVB 1HRTH 1DITH 4XE4A 1ZGIA 1WUNH 1ZOMA 1XX9A 2P8OC 2ZFRH 1GI2A 2DE8A 1VJAU 5A8ZA 4CRDA 1AN1E 1DLKB 1FUJA 5F03A 3VB6A 2VB0A 4ABBA 2GCHG 1HDTH 3JZ1B 4AYYB 1B0EA 1C2GA 2OQ5A 4BXWA 1GGDC 3GY2A 1D3TB 4OS5A 2PKAA 1O35A 1O2JA 1O2MA 1D3QB 4I8LA 1ZRKA 3S7HB 3RXPA 4VGCC 3LIWA 2XC5A 3W95A 1AD8H 1JXPA 2FIRH 3SGQE 1K1LA 1D3DB 1BJVA 2A5IA 2BHGA 2FYRA 4DJZB 1V2WT 1GBEA 1C5TA 3QZQA 1EASA 4MPVA 4YESB 3MFJA 1ELVA 1O2SA 3RXTA 1YP9A 1ELCA 4NIYA 1Z8IB 1ANEA 1PPFE 2BXUH 1ZRBA 1A0JA 1GVLA 2ZU3A 3O8DA 4MPWA 1DLEA 4DIIH 4ASHA 2OLGA 1GI9B 1CT0E 2SNWA 2GX4A 1UTPA 1BUIA 3Q3YA 1GPZA 1P05A 2XBWA 5FBEA 1ELTA 3T2NA 5GCHG 3GCTF 4Y6DA 1ZMLA 1CHOG 1E34B 1T4UH 1LVBA 1DM4B 1EZQA 1MCTA 3LC3A 1G3EA 2ZWLH 3TJUA 2BVSH 2GZ8A 2GZ7A 4J2YB 4QT8C 1RRKA 3RXIA 1O3BA 1ARCA 4TY7A 1NFWA 3IG6B 3GY5A 5C1UA 2PHBA 4K2YA 1F5LA 1QA0A 4H42U 4RSPA 4NCYA 2RCEA 2H2ZA 2WPKS 1L1NA 1NROH 1LTOA 1K9OE 1FDPA 3Q77A 2AGGX 1K2I1 2C8YB 3SJ8A 1DPOA 2ZECA 5DJ7A 1P01A 1GMCG 3ZZCA 2BD7A 1DUEA 1YLDA 3DT0H 1GL0E 3V7TA 2G5VA 2FI4E 2Q1JA 5T6GA 2WPMS 3DFLA 3P8NA 2H9EH 1GI1A 5FCKA 1SHHB 3UQVA 2C90B 2VVCA 2PKSB 3M5OA 1ELGA 4OGYA 2AEIH 2CHAB 2K1QA 3VB4A 1YPLH 2ZHFH 1ANCA 1SVPA 3QN7A 1AVGH 5T6DA 1NPMA 2J95A 3LGYA 2GVFA 1E35B 4IN2A 3ZVEA 2VVUA 1QRZA 1T32A 1RJXB 2BQ6B 4X1PU 3BTME 1N6XA 1Z1JA 1YF4A 2ZEBA 1QGFA 4IBLH 1XMNB 2Y82A 2FM2A 2CJIA 3M35A 1TMUH 4R0IA 1O3AA 4DCDA 2ZDAH 2ZFQH 1W7XH 2G81E 1S6FA 5BPEA 2CGAA 1JRSA 4Y8YA 4GLYA 3EGKH 3BF6H 3LKWA 1C5PA 2H1UA 4BAKB 3URDA 1MD8A 4CRAA 2ZCHP 4JYVH 3M36A 1IQMA 3MH5A 1HJAC 5L2ZH 1BHXB 3TJVA 4J1YA 3F9FA 2FZZA 2J9NA 3F9HA 5JYIA 1UK3A 2IN2A 1CA8B 3MH6A 3H7OA 3SNBA 2F9BH 1NRRH 3MO9A 1QBOA 3A7WA 3Q3KA 4DY7B 2GCHF 3C27B 3BG8A 9ESTA 1H9IE 8KME2 5DP3A 3NZIA 3T5FH 1S82A 1FAKH 1GDNA 3FP7E 1P3EA 5F8ZA 1OYTH 1C4U2 4DOQA 1EPTB 2BDHA 3SI4H 1ESAA 1PPZA 1C5UA 4CBOA 1FI8A 1LPKB 2XRCA 1V2RT 1V2LT 1C1TA 1MTNC 3RXSA 3VPKA 1B0FA 1Y3WA 4K60A 2AERH 3ZVGA 5H4IB 2BD3A 5FX5A 3VB3A 1P11E 1S0RA 1TX6A 1GJDB 4B1TA 1QJ6B 3GY6A 1KLJH 4X2YA 1UHBA 3A7XA 1XUKA 4ABGA 1FQ3A 3PTNA 4AB9A 1K28D 5T6FA 1QURH 1SHYA 1J15A 1FJSA 1EAIA 4HTCH 4I32A 1NY22 2W3IA 2Y80A 1GL1A 5GCHF 4CH8B 2JH6D 4NFFA 1CHOF 3PLPA 5I25A 1F0TA 1C1QA 1O0DH 1BZXE 5C2ZA 3ZZ8A 3TH2H 5F6MA 1OPHB 1D4PB 2F9VA 3KQEA 3FVFB 3HGPA 3M7TA 1EKBB 3FFGA 2ALPA 4XBBA 3SU4A 5GXPA 2QIQA 1K1JA 4XSKU 1HIAB 2VNTA 4B2AA 1TA2A 4FUEA 4B74A 4ABFA 5DKMA 4FUDA 1C2HA 2D2DA 2VU8E 2F9NA 3KIDU 2SGAA 3TIUA 5LPEA 1THPB 2ZPSA 2GT7A 2H9TH 1TLDA 4B71A 3SUDA 2HNTC 2AMDA 3FAOA 3LOXA 4BTTB 4ZKNU 3VGCC 3BIVH 1ZTLA 4FU8A 1XKAC 1RIWB 3V0XA 4XDEA 2FO9A 1GJ7B 2A31A 2HALA 4X8SH 1IQKA 3ELAH 2J94A 3HPTB 1NRNH 1HAHH 1IOEA 3MNBA 5A0AE 1SOZA 3BTHE 1M9UA 1HAZB 1LHGH 3A7TA 1VGCB 4Y11E 4A1VA 1SBWA 1NT1A 1V6DA 1OP8A 3A8AA 1TNHA 1O2XA 1CE5A 2W5EA 4CRBA 4UE7H 2R3UA 1MU6B 3STIA 1O38A 1QHRB 1NZQH 1GCDA 5TCAA 3D62A 1GBHA 1DVAH 1ZJKA 3SV9A 4RKOB 1EP5A 2ZGXH 1O31A 1SFQB 3IITA 3MH7A 4AN7A 4HGCA 1O2WA 1C1PA 1QL7A 1NTPA 3KN2A 1GBIA 2OP9A 1P03A 2GDEH 4O97A 2ZQ2A 4Y79A 2ILNA 3DA9B 1GBKA 2HNTF 5C5NA 2Z9LA 4BOHA 4IC5A 4JK6A 3SJOA 1SG8B 1O39A 4NIXA 3ZVBA 1QTFA 2Z7FE 2Z9KA 1BQYA 1TRNA 3RXVA 4MDSA 5AHGH 5EXLA 2FMJA 5IYTA 2AFQB 3P6ZB 2G00A 1Z6EA 2C93B 3GY7A 4X8TH 3SZNA 1SGNE 3H7TA 3SV7A 1H9LB 4M7GA 1IQNA 1H1BA 3S69A 1VJ9U 3ATKA 1TGBA 4D9RA 1BBRE 1SGPE 2IOTA 4TPIZ 2QC2A 8GCHG 3SI3H 1FXYA 3KCGH 2FLBH 2GCTB 4ZHAA 2I6SA 5CMXH 2J2UA 1ZSKA 1FY5A 1AFEH 1MUEB 1TNIA 4NGAH 1OYQA 1IQHA 4MNWA 1HXFH 3GCNA 3KQCA 5GJ4B 1MKXH 1C5XB 2FOHA 3TVJB 3LT3A 3SOSA 4RKJB 1A3EH 3RXMA 3RXUA 3RXDA 1C1RA 1G3BA 1UVTH 1O2RA 1DWBH 3GDUA 1O32A 1W10U 1MD7A 4O9VA 1C2DA 3P8OA 1NRQH 4ZKSU 2BD2A 3WY8A 1BTPA 4X1SU 3SNCA 3W94A 1GHYH 1G2LA 1HBTH 4BANB 1SMFE 1TYNA 3GDVA 2O9QA 1YC0A 3MU8A 1K1MA 2NU2E 4YOGA 1O2LA 3Q3XA 1FY8E 1ZTJA 3BTFE 1Y3VA 1DSUA 3JZ2B 1W12U 2FOAA 1GHAG 4KTCA 5HM9A 4XOJA 3LGIA 1BCUH 1ZJDA 1ETSH 1P9SA 1PPEE 1WYKA 1OSSA 1EJMA 1BMAA 2F83A 1CGJE 4U32A 2HPPH 2FTMA 2HLCA 1T8MA 3A81A 4KTSA 3ZZ6A 3UR9A 2AS9A 4ZROA 2ESTE 1LDTT 1GDUA 3P95A 2FODA 1JIRA 4D7GA 2UUFB 3BG4C 1Y8TA 1SI5H 3A89A 5BRRE 3S9BA 4Q80A 3SUEA 4OGXA 4WY3A 3RXAA 1A4WH 2GD4B 2ZI2H 4MG3A 6ESTA 3E90B 1TA6A 2QCYA 5C5OA 4A5TS 3K6ZA 3K2UA 3CENA 1CU1A 1TQ0B 1HB0B 1O2KA 1W7GH 1T7CA 1C4V2 1DFPA 1CVWH 1MBMA 1BMLA 5HXFA 1MKWK 3PB1E 1SFIA 2A32A 2ASUB 1BT7A 1SGEE 1TBZH 1Y59T 2VIQA 1ZHPA 2VWMA 3ZZ5A 2R3YA 3ZYDA 1KTSB 4AGJA 1YM0A 3RUOA 1YCPM 3AAVA 2VWOA 2ZHEH 3ESTA 1UJ1A 2OCVB 3NKKA 3SNEA 4B75A 3SV2H 1GJ4H 5PTPA 4YOJA 2SGPE 2JETC 1FAXA 4IW4E 2CN0H 1SGCA 2JKHA 3K9XB 5LGOA 1MKXK 2F9PA 2H5DA 2GT8A 6CHAB 1SGFA 4NIVA 4CREA 1ZMJA 1MTUA 2CV3A 2FX6A 2ANMH 1V2UT 1AB9C 1NFUA 1EAXA 1SB1H 7ESTE 5EPYA 3FP8E 2ANKH 3M7QA 3PO1C 4WMDA 2FYQA 4A1TA 3S9AA 5K0HA 1CBWB 4MNVA 1IQLA 1AY6H 1BTYA 1QB9A 1O2UA 5L30H 3T62A 1QR3E 4DW2U 1DSTA 2B5TB 4NWLA 2W26A 4Y7BA 1THSH 2G5NA 1IQIA 1CGIE 2ZQ1A 1WTHD 4BNRA 2Z9IA 3PTBA 4OS2A 1RXPA 4MPXA 2O8TA 2BM2A 4A7IB 2ZHWH 1GJAB 2Y5HA 3SN8A 2BXTH 2VIDA 2XC4A 1VCPA 4AFZA 4E06H 1EPTA 5E2PA 2SNVA 3O8BA 3SJKA 3SUGA 2H9HA 3PMJA 4DGJA 5E0JA 1ZR0A 2RG3A 3ODDA 1MQ5A 1AU8A 1W3CA 1JIMA 3STJA 4F4OC 1SGFG 1J9CH 3QTVH 7GCHG 1HV7A 3OU0A 1A7SA 2SGEE 5E0GA 1C1MA 3BTKE 8GCHF 1G37A 5C3NA 4WF8A 3GCOA 1FY3A 1SPJA 2QV1A 1TRYA 3PLKA 3TJNA 2QF3A 1GJ8B 5EW1H 1O3JA 1GHVH 1IQEA 4ZMAH 2FOEA 3BEFB 1HPGA 4YM9A 1K22H 3QWCH 1O2ZA 2BY5X 4CHAB 4WH6A 5DK1A 1TGSZ 3SHAH 2Q6GA 1ELAA 3TK9A 1YYY1 4D8NA 1LQEA 1TBRH 2BMGB 1TGTA 4I31A 1FMGA 2Z3DA 1KXFA 1F7ZA 1SLUB 4ISHH 2A5KA 2WV5A 3E16B 3I78A 3C1KA 4OS1A 1HCGA 3SW2B 3ZZBA 3D49H 3V13A 1HIAA 3AVZA 4IC6A 2HWLB 1XKBC 1D9IA 1WV7H 2PSXA 4Y0ZE 1GI6A 1A3BH 3BTDE 4SGAE 5DP8A 3P17H 3HKJB 1AVXA 2JH0D 4YT7H 1FNIA 3MI4A 1ZGVA 3G01A 4LOYH 1OWDA 2BDCA 3UQOA 4YO9A 3Q00A 5AF9H 3SNAA 4JZDH 5G4BA 2WPHS 4E05H 1IQJA 1BRAA 2ZGBH 2QA9E 1JWTA 4X6PA 3PWBA 5DO4H 2CMYA 1GVZA 4KGAA 2VGCB 1LO6A 1ESBA 3M61U 3HK6B 1TQ7B 3RM2H 3RXQA 3ATMA 1DXPA 3RMLH 1TNLA 1NS3A 1WCZA 3RXOA 5ESBA 2Y5GA 4FUBA 1ZPZA 1G9IE 1S6HA 3GICB 2PKSC 1VITG 1DUAA 3GDSA 1GMDG 4UFEH 2CHAC 9LPRA 3ODFA 1AUTC 1YPKH 1T31A 3SV6A 3M3TA 1H8DH 4AOQA 1IHSH 1T4VH 1BB0B 4TWWA 2AIQA 1SQAA 1YLCA 2BDIA 1TONA 1C1VH 3T25A 1CA0C 2UUYA 4CRCA 4ZUHA 3SU1A 2PWXA 2FLRH 1YPJH 2BQWB 1DX5M 5GPIB 1BRCE 1UTOA 1C5MD 2A5AA 3QGNB 4DIHH 2C4FH 2FESH 3EE0B 3GISB 1EP6A 3HKIB 1GJ5H 1VR1H 3M5NA 2LPRA 4KELA 1OOKB 3UOPA 1HFDA 1AKSB 1S83A 1B7XB 1TALA 2V3HH 1BITA 4D9QA 3ATIA 1EJAA 1LMWB 3E3TA 3M5LA 2FOFA 4ISNA 3NXPA 3KEEA 3QK1A 3MMGA 1B5GH 3QGJA 1C4Y2 3RMNH 2G55A 1SGIB 4H4FA 4O3TA 1AQ7A 1VITH 3SU2A 4Y10E 1L2EA 1C5ZB 4YTAA 2V0BA 1TABE 1C2LA 2UWOA 2PTCE 1V2TT 1O3FA 1GHBF 1BBRH 2FWWA 3TJOA 2B7DH 1ETTH 2Q6FA 5CHAB 1Q3XA 2IPHA 2ZF0H 4WJG2 3P8FA 3M3VA 2O8WA 1CGHA 1LVMA 1LHDH 5L2YH 1Z71A 4INKA 1EPTC 1LCYA 4GAWA 3SBKA 3UWIA 2ANWA 5JBCS 1O3EA 2BDYA 6LPRA 4UEHH 3TH3H 2AYWA 1HAGE 2BLWA 2BLVA 5FCRA 1XVOA 3UNSA 3R0FA 1UMAH 1N8OB 1LVYA 2PFEA 3SU3A 5IDKA 4LZ4B 2ZZUH 1O2QA 1ABJH 1A5IA 4FUFA 1TPOA 1BHXF 1TPPA 4WXVA 4ESTE 1BDAA 3TGKE 3MOCA 1V2MT 1O2NA 3SQHE 1O37A 1O5BB 3CS0A 1EZUC 1MZAA 5K7RA 3KHVA 2ZKSA 1L1JA 3LJJA 3EDXB 4AB8A 1EOLA 2ZNKH 2H5CA 2ZHDA 4R8TB 3RXBA 1HAXB 4O03A 1KXDA 1ID5H 1YPMH 2OC1A 3RLWH 4ABEA 3T27A 1O3DA 2OXSA 1DY9A 5FX6A 1K21H 1DS2E 1LPGB 3E0NB 3RMMH 1EQ9A 2XC0A 3S0NA 1F2SE 1UVPA 4XFQA 1UVOA 3BTWE 3PMBB 3ZVCA 2BQ7B 4ABJA 3TPIZ 1EATA 1QNJA 1P04A 2ZP0H 1KIGH 4I33A 1V2NT 1D6RA 3A7VA 4MVNA 3NUMA 2GKVE 1GHWH 4ZXXH 3O8CA 1C9PA 5AVDA 2EI6A 1KYNA 1YPHC 4E7NA 4GCHG 1MQ6A 1C9TA 2B9LA 3LDXH 1TNGA 4LZ1H 1P57B 1SL3A 2BOKA 3ZZDA 3ZVDA 2TBSA 3ENSB 1FIZA 1C2IA 2BD5A 3FP6E 4RN6A 2ZU1A 2OD3B 1GBAA 2FEQH 3MU5A 2F3CE 1BBRK 3UNRA 1GG6B 4I8GA 2ZGHA 2ZTXA 1TNKA 5A0CA 1VGCC 3RLYH 1KXCA 2HPQH 1PYTD 1HAPH 5C1XA 1VITF 1QB1A 1GMCF 4NZLA 2GV7A 2W7UA 1P3CA 4JZFH 4JYTA 4X6NA 1LHFH 3U69H 2WUCA 3MU0A 4AGKA 2WINI 4BAMB 1QFKH 1P12E 3KGPA 4Y7AA 1MAYA 3BSQA 1X7AC 3VFEA 1WQSA 5HM2A 4FUCA 1DDJA 2BDBA 1MAXA 3RU4E
chains in the Genus database with same CATH superfamily
1PQAA 2P95A 3E91A 1ZYOA 5GIBA 2FOMB 1C1WH 2SGQE 2NU4E 2BX3A 3GCHB 4JMYA 1MABB 1C1SA 2WV4A 1LQDB 3QUMP 4XBDA 4X8VH 3UFAA 3K6YA 1PPCE 5JBAS 2ZIQH 1ZPBA 1SGQE 1NFXA 5I46H 2GMTC 3SZEA 4NWKA 1BA8B 1GJ9B 1J16A 4ABIA 1BMNH 2FI5E 1K1PA 3A85A 2GP9B 4NIWA 3VGCB 3MYWA 3TK6A 2PTNA 4CR9A 2AH4X 3FZZA 1P2JA 1PQ8A 1UK4A 2QGRA 2VIOA 1YKTA 2GCTC 2G8TA 3TGJE 3RC6A 1ESTA 1NO9H 3FKSD 2C3SA 5ETXA 1Y5BT 2AMPA 1C5VA 1O5FH 1COWD 1BMFD 2A1DB 4ZH8A 1MKWH 1ANDA 2ODQA 3T29A 4UDWH 1GBMA 2C8XB 2ZDLA 1AZZA 5FBIA 3LGWA 1GJBB 3HGNA 2FTLE 4AZ2B 3RDZA 1XXFA 5FPYA 3RMOH 5HIYA 1RS0A 1EJNA 2IJD1 1SLXB 2VH6A 5AFYH 5KEDA 1OS8A 2VVVA 3WWFA 2A4OA 3F2HA 1H9HE 3A7YA 3MNSA 5B6OA 2WYJA 4ABDA 2XW9A 1KXAA 3MHWU 3LJOA 3BTEE 4YXWD 1TOCB 3KYGA 1P2KA 4MQAA 3A80A 3EQ0H 1RTFB 1DT2A 2JH5D 4GUXA 1EZXC 3IWMA 2B8OH 4XD7D 3EA8A 1SQRA 5EQRA 1W14U 5E8EH 1BRUP 3L3TA 1PPHE 5EOKA 1P2IA 2V35A 2V6NA 1H8ED 2G51A 2BX4A 1QBVH 4U2WA 1DWCH 1HUTH 1JMOH 2OUAA 4B2CA 1ZMNA 1H4WA 3ZYEA 2OK5A 1GCTB 4GSOA 1AFQB 3BTGE 4FETA 1O5DH 1OWEA 1QA7A 3MNCA 2WYGA 2QN5T 3PV2A 3BTQE 3SJ9A 1XUIA 1O36A 1RFNA 2G52A 2A4RA 1W2KH 2Z9JA 1HAOH 1ZSLA 1BTXA 2NU1E 2A45B 2XBXA 3V12A 5C0TA 1HGTH 2YMSC 2ZFSA 4Y0YE 3SJIA 2FS8A 2STAE 4BAQB 3NPSA 2KAIB 2ZA5A 1EOJA 4O3UA 1V2JT 4KP0A 1GI0A 1W0KD 3ATLA 1AZ8A 3TU7H 5EJZA 1S0QA 2P59A 1CQQA 2Z3EA 3LH3A 1W0ZU 1T8LA 3QX5H 4LK4A 5LPRA 5LPFA 2Q6DA 1O2OA 5EW2H 4JCNA 2FXRA 2XXLA 1TPAE 2QF0A 1EAUA 1DWDH 5T3HA 4GCHF 1O34A 1EB1H 4H6TA 4X8UH 3T26A 2BVXH 5A0BA 3BEUA 2RFKC 2XWBI 1KLTA 2QAAA 1OP2A 2OTVA 2Y7ZA 4FXGH 1HAVA 4TYDA 3CS7A 2ZTYA 3UIRA 3PRBA 3SGBE 4AX9H 3DUXH 3P8GA 2ZCKP 1AKSA 3UTUH 2QXHA 6CHAC 1UVSH 2NU0E 1K1OA 3NCLA 4THNH 4BTUB 2I6QA 2SFAA 4CBNA 1DY8A 2J38A 4NA9H 2YNBA 4HZHA 4UONA 1Q2WA 1MBQA 3TGIE 5A09A 4BAOB 3LONA 2R2WU 1CBWC 2QE7D 2PR3A 5DP7A 2SGDE 1Z7KA 2R0KA 1FIWA 1SR5C 4ACBA 3QLPH 5DPAA 3S7KB 2C8ZB 3RU4D 2F4LA 2FOGA 1SLVB 3OSYA 2V3MA 2YNAA 2ZCLP 3AW0A 1W13U 4ZXYH 4WH8A 2BDAA 3RXJA 4MTBA 4GHTA 3RP2A 1O2TA 5E0HA 2J97A 2P3FH 3N7DA 3E8LA 1L4DA 5FPTA 1AHTH 1E37B 1ELFA 5ESTE 1KTTB 2ZGJA 4DT4A 1O2IA 1V2KT 5CDFE 4WXIA 1E36B 1A61H 3MTYA 1BTHH 1BRBE 1PJPA 4CH2B 1P8VC 5EGMA 3BTTE 1XUJA 1NC6A 2ZGCA 4K1EA 1AIXH 5FAHA 1C1OA 3PROA 4OS7A 2H6MA 1N6YA 1P2MA 3RXKA 1FLEE 5L6NH 4K1SA 2Y81A 3RU4T 1C5NH 3LGTA 3LU9B 5EU8A 4Q7XA 2DE9A 3GY3A 1UK2A 1SQOA 1Y3XA 1DE7H 2J98B 1O33A 2UWPA 2P93A 1KSNA 2GV6A 5LH8A 1O3HA 4X2XA 4SGBE 2A7HA 3HK3B 1H8HD 4NA8A 5C1YA 4ASUD 3TNSA 4TPYA 2ZDMA 1QB6A 1SGTA 1NESE 1AVWA 1Z8RA 1G36A 4B73A 1BTUA 5F53A 3RXHA 3VG8A 1ELEE 1GI5A 5JB8S 1U6QA 3KNXA 4CHAC 2FOBA 3ZZ3A 1Z1IA 1TIOA 1PQ5A 1NN6A 4JZ1A 3GYLB 5JPMH 1C5SA 1P2OA 3O8RA 1WBGB 2TGAA 4AG2A 1UVUH 3RXGA 2GTBA 1VCWA 1YCPK 1G30B 3N7OA 1K1NA 5A2MH 1Q31A 1LKAA 1Y3YA 4WMFA 2PV9B 4HFPB 7KMEH 5E2OA 3DSPA 4K5ZA 5KECA 1O2PA 3E1XB 5FXLA 1OHHD 2A4GA 1JBUH 1C2JA 2BD9A 2G4UA 1Y5AT 4ZHLU 3FANA 1G3DA 1T8OA 1KXEA 2UWLA 2ZFTA 3OX7U 1FONA 3DD2H 1G2MA 3M3SA 4FUGA 4NA7A 1AWFH 1H8IH 5JBBS 3A7ZA 1RTKA 2Z94A 2P8OB 1O3OA 3OY6U 1HJ8A 4MNYA 1ZZZA 4NSYA 3LGUA 1DANH 2VIPA 3A88A 2VIWA 2VGCC 5DP9A 4UFDH 3P92A 1QQUA 3MU4A 4Z6AH 1EZSC 3UUZA 2K0QA 2HGTH 2XCNA 1GGDB 3Q76A 2OQUA 2D8WA 3U8TH 1GHAF 4X6MA 3ZVAA 1BOQA 1BTWA 1UCYE 4JZIA 1OX1A 2QXJA 3URCA 5A8XA 4I8JA 3SO3A 1TGNA 3NRLA 4VGCB 4X1QU 4B2BA 1FX0B 3UPEA 3A8DA 2XBVA 1A0HB 5J4QA 1IHTH 2ZDNA 1GBCA 1BJUA 1O5EH 1KDQB 1Y3UA 1GI3A 1C5RA 1GJ6A 1UTMA 3PMAB 1DXWA 3MH4A 3U1JB 6GCHG 1ELBA 2HRVA 1UTQA 4FUIA 1P02A 1INCA 1GDQA 3RC4A 1TNJA 1GHZA 1EUFA 2BY7X 1J14A 3S9CA 3GOVB 3VXFH 1ANBA 1UO6A 3GYMA 3LH1A 2J92A 2BY9X 2EA3A 1SLWB 4FU7A 1IQFA 3VB5A 2BYAX 5JB9S 2PSYA 1QL9A 1C2MA 2UUKB 1GBDA 3U28C 1TRMA 2WUBA 1ELDE 2OC0A 1WXRA 4Y8ZA 2XNIA 2ODYB 2Z6BD 2W7SA 4INHA 5ABWA 2GGVB 3U9AH 4CRFA 3KQ5A 1VCQA 1O3IA 1QQ4A 4XBCA 5EQQA 3V3MA 1UTJA 4BAHB 2B0FA 4FUJA 3A8BA 3HATH 1HAVB 1W0YH 5EQSA 3RXRA 1MTSA 3ATWA 1C5OH 1E79D 1C5YB 4NSVA 4Y8XA 1KXBA 3ZZAA 1S81A 1SOTA 5CHAC 1O2GH 3MNXA 1XUHA 4U01A 2VJ1A 4OS4A 4LXBH 2KCAA 1GJCB 1NRSH 4F49A 1F5RA 1FZZA 1FN8A 3UREA 2PLXA 4GPGA 4ZHMU 4FUHA 3F2GA 4AC9A 5AFZH 2AMQA 2V3OH 2ZDKA 4I8HA 4JZEH 1OWJA 1O5AB 3MWIU 1P06A 2F43B 3M7UA 1CA0B 1QCPA 1AMHA 1N8OC 1ZHMA 1O3CA 1P10A 5SGAE 4KTUA 3U1IB 1FPHH 1ZHRA 2BTCE 4AFUA 1F5KU 1AE5A 1P2NA 4X1NU 1LPZB 1P0SH 1L1GA 3ZVFA 4Q2KA 2CXVA 2ZPQA 1TFXA 3B9FH 4MLFB 1O30A 3AAUA 1V3XA 3PV4A 1A2CH 2TPIZ 3DHKH 3I77A 3BIUH 5TCCA 3SNDA 1HNEE 2EI8A 1AO5A 2Z9GA 1CO7E 1YBWA 2ZHQH 7GCHF 1TX7A 1LHCH 3NWUA 4FVDA 2AGEX 1TB6H 4ABAA 1XVMA 2P94A 1RGQA 1OWHA 4ISLA 5FPSA 2ZFPH 2XBYA 2R0LA 3RM0H 4FU9A 4BTIB 2YMSD 2KZ4A 4KKDA 1MU8B 5DGJA 3ZZ7A 4Q7ZA 2KAIA 3E0PB 4GHQA 3RC5A 4CR5A 3RXFA 1A46H 3SGAE 4ABHA 1AUJA 3TK5A 3VXEH 3UOUA 3EE7A 2TGTA 4UFGH 1P2QA 2A7JA 2QXGA 3U98H 3R3GB 1QRWA 5TJXA 3AASA 3UR6A 2OC8A 3TNTA 2PUQH 1UTKA 1C5QA 1TGCA 1V2QT 1HJAB 2Y7XA 1DWEH 1IAUA 3PMHB 3E6PH 1E38B 2FP7B 2J4IA 2HVXA 3QO6A 1J8AA 4Y71A 3QZRA 1FV9A 2GZ9A 4K3JA 2TIOA 1MMJN 1C2EA 3UY9A 1PPGE 5A8YA 2AGIX 1C2FA 1GI8B 1GG6C 2EI7A 3OFND 2PKAB 5GNDA 1O2YA 2BZ6H 2FS9A 1QBNA 2STBE 2Z3CA 3F9EA 4X6OA 2XNDD 1MTNB 1O3LA 1TBQH 2RA0A 3GY8A 1C5LH 3T28A 1Z8JB 3FO8D 1RIWC 4K69A 5FL7D 1PQ7A 2WHXA 2XWAA 5JBTA 1QRXA 1T8NA 4YLUA 3D23A 4YZUA 3MO3A 3F1SB 4D7FA 1S85A 3SORA 6GCHF 4Q63A 2THFB 4A6LA 1LHEH 5GDSH 5JDUB 1TX8A 4IN1A 1SSXA 1G3CA 4K8BA 4AFSA 5F8XA 3A86A 3GCHC 2F9UA 4I7YH 2QF4A 4X2VA 5C67A 5HYOA 4A1XA 2HOBA 1GMDF 1O3GA 3F3BA 1DOJA 1WTGH 4PROA 5DP5A 1UTNA 2P16A 2ZDVH 3F6UH 2D26C 3F68H 3OY5U 1WOFA 4YOIA 1K1IA 1HJ9A 1OWIA 3OTJE 2FI3E 2FPZA 1EB2A 2IJOB 1C2KA 1XUGA 4ZKRU 2O8MA 1AWHB 1GBBA 5EIYA 4ZAEA 1QJ7B 1OWKA 1QIXB 2C8WB 1O3NA 3OYPA 1E0FD 1P9UA 2DUCA 3KYFA 4K8YA 2ZU5A 4DVAU 1KMHB 2GDDA 1ACBE 2J98A 1NU9A 2BOHB 3F9GA 4I8KA 3VB7A 3MU1A 1SQTA 1MZDA 1OXGA 4X0WU 1Y5UT 4MPUA 2WPJS 1ZSJA 1SC8U 4B6EA 3B8JA 1AE8H 1NBME 1EXFA 3GY4A 2L74A 1OP0A 2ZFFH 4Y76A 2A2XH 1A5HA 2PGBB 2BZAA 1Z6JH 1GWAA 2F91A 4INLA 4DG4A 4I86A 2XYAA 5DG6A 5EPNA 2M5TA 1MTVA 3LPRA 2QXIA 4UFFH 3P70B 4DT7B 1TPSA 3I29A 3SV8A 1ABIH 1GI4A 3RXCA 5F8TA 3ZV9A 2YOLA 2OBQA 4WMEA 5C20A 3EA7A 3LC5A 4UD9H 1EX3A 1GBFA 1GHXH 1GBLA 2BLQA 3EAJA 4DURA 3ITIA 3ZZ4A 1VKYA 1WAYB 2WPDD 3SQEE 2BLOA 4TWYA 3SHCH 1HAIH 5HGGA 2RDLA 3F0OA 3L33A 1GMHG 3UWJH 5J4SA 3PM3A 3LGVA 2ZU4A 3UNQA 1UTLM 4ZKOU 1JOUB 1GCTC 1AFQC 4IS5A 1AGJA 2Y6TA 2ALVA 3W1EA 2ANYA 2GMTB 2R2MB 2VINA 3DFJA 3AW1A 2BB4A 2F9OA 3BN9A 1S5SA 4BXSA 1BTZA 2VWLA 3U8RH 2TRMA 2FOCA 4ISIH 1LVOA 1WU1A 4IMQA 4AORA 3ZIAD 2ZU2A 1OKXA 3ZV8A 2A4QA 2NU3E 5GWZA 1YPHE 2BD4A 4ISOA 4U30A 2A0QB 1AI8H 1UCYH 3SUFA 3SU6A 2LNCA 1XUFA 1PPBH 3A87A 2CF8H 1A5GH 1V2OT 3MO6A 5EJLA 2A7CA 4AG1A 5DP4A 2RA3A 1KDQA 4NZQA 1O3KA 1O3MA 4TSFD 3WW7A 1PFXC 4HI3A 1HLTH 1ZLRA 5EXMA 1QY6A 4FVBA 3KQBA 2FX4A 1F0UA 3DSGA 2BDGA 2QY0B 1RD3B 5EG4A 2BY6X 5EXNA 2HNTE 4Q7YA 2A2QH 4GVUA 1MCVA 5C94A 1HAYB 2J34A 2XOKD 1ZPCA 3RXEA 1ETRH 3KF2A 1YPGH 3GCTG 1XXDA 3OTPA 3UAIC 2ZO3H 3ZZ9A 1D3PB 1CHGA 1O5CB 4X2WA 1YCPH 5DP6A 1IQGA 1F0RA 1L0ZA 2WPLS 1CT2E 1BIOA 2LP6A 7LPRA 1RTLA 1G32B 2ZTZA 1O2HA 3FOAA 4Z0KA 5DSFA 4YT6H 2UUJB 1CT4E 4CRGA 1TAWA 1C1NA 1UHBB 3A82A 1A0LA 2ULLA 3TLOA 1W11U 1S84A 4XRNA 2YMSB 4AFQA 2TGPZ 1WQVH 1YPEH 1P09A 5HMAA 2AIPA 1N1LA 1C1UH 3QTOH 3TH4H 1F0SA 1QJ1B 3H5CB 3KL6A 3FZDA 2HLDD 3CP7A 1FN6A 1GBTA 1BMMH 1THRH 3RXLA 8LPRA 2ZPRA 1YGCH 2ZG0H 2D1JA 3SU0A 3PYHA 3QDZB 3BG4B 3NK8A 1F92A 4YLQH 2XTTB 3KQDA 1O3PB 2PGQB 1NU7B 5CE1A 1O2VA 2ODPA 3BV9B 8ESTE 1FPCH 1FY1A 1HYLA 1TMBH 1MTWA 2EEKA 3EA9A 1GVKB 3CNRA 2VWNA 4NFEA 1Z8GA 4MNXA 3U8OH 1SGRE 2CF9H 3A83A 5FHTA 2BVRH 2R9PA 1QZ8A 2P3TB 2EC9H 3M5MA 1HXEH 4X1RU 1TWXB 1NBMD 3EYDA 4OM9A 1UCYK 1A1RA 2BD8A 3PWCA 4D76A 3TITA 1ORFA 4E7RG 2P3UB 1PYTC 2W6JD 1J17T 2G4TA 2TGDA 1NRPH 2W3KA 3N99A 1ARBA 4RT1A 4OS6A 3PLBA 1WSSH 4H6SB 4JK5A 1KY9A 3K65B 1SGYE 1JRTA 1TOMH 1C5WB 1SGDE 2NWNA 2XCFA 2Y5FA 4IMZA 1W8BH 4K1TA 1V2PT 3M37A 2OINA 4TY6A 2PW8H 2OBOA 4JYUH 2FDAA 1D6WA 3A84A 2JETB 1CSOE 1FY4A 2QYIA 1LKBA 3SU5A 2VH0A 1V2VT 3B23B 1TMTH 3A8CA 1NM6A 2SGFE 1GHBG 2KFWA 4WWYA 3VEQB 4NG9H 1XM1A 5EJ1A 1GI7B 2O8UA 3L6PA 2WPIS 1AB9B 1QL8A 1L4ZA 3D65E 1KLIH 2OC7A 4B76A 4IGDA 3PO1B 1V2ST 2PUXB 1TE0A 1VZQH 1GMHF 2O8LA 1O5GH 1K0HA 1ZTKA 4A92A 1MH0A 3BEIB 2BY8X 2VIVA 3WWBA 4WVPE 1DICA 5EODA 2ZC9H 1NFYA 1EAWA 1GBJA 4AYVB 1HRTH 1DITH 4XE4A 1ZGIA 1WUNH 1ZOMA 1XX9A 2P8OC 2ZFRH 1GI2A 2DE8A 1VJAU 5A8ZA 4CRDA 1AN1E 1DLKB 1FUJA 5F03A 3VB6A 2VB0A 4ABBA 1E1QD 2GCHG 1HDTH 3JZ1B 4AYYB 1B0EA 1C2GA 2OQ5A 4BXWA 1GGDC 3GY2A 1D3TB 4OS5A 2PKAA 1O35A 1O2JA 5KGOA 1O2MA 1D3QB 4I8LA 1ZRKA 3S7HB 3RXPA 4VGCC 3LIWA 2XC5A 3W95A 1AD8H 1JXPA 2FIRH 3SGQE 1K1LA 1D3DB 1BJVA 2A5IA 2BHGA 2FYRA 4DJZB 1V2WT 1GBEA 1C5TA 3QZQA 5DN6D 1EASA 4MPVA 4YESB 3MFJA 1ELVA 1O2SA 3RXTA 1YP9A 1ELCA 4NIYA 1Z8IB 1ANEA 1PPFE 2BXUH 1ZRBA 5CHBA 1A0JA 1GVLA 2ZU3A 3O8DA 4MPWA 1DLEA 4DIIH 4ASHA 2OLGA 1GI9B 1CT0E 1YY3A 2SNWA 2GX4A 1UTPA 1BUIA 3Q3YA 1GPZA 1P05A 2XBWA 5FBEA 1ELTA 3T2NA 5GCHG 3GCTF 4Y6DA 1ZMLA 1CHOG 1E34B 1T4UH 1LVBA 1DM4B 1EZQA 1MCTA 3LC3A 1G3EA 2ZWLH 3TJUA 2BVSH 2GZ8A 2GZ7A 2J5UA 4J2YB 4QT8C 1RRKA 4RI0A 4P02A 3RXIA 1O3BA 1ARCA 4TY7A 1NFWA 3IG6B 3GY5A 5C1UA 2PHBA 3F2FA 1W0JD 4K2YA 1F5LA 1QA0A 4H42U 4F55A 4RSPA 4NCYA 2RCEA 2H2ZA 2WPKS 1L1NA 1NROH 2KM0A 1LTOA 1K9OE 1FDPA 3Q77A 2AGGX 1K2I1 2CK3D 2C8YB 3SJ8A 1DPOA 2ZECA 5DJ7A 1P01A 1GMCG 3ZZCA 2BD7A 4RT0A 1DUEA 1YLDA 3DT0H 1GL0E 1UW7A 3V7TA 2G5VA 2FI4E 2Q1JA 5T6GA 2WPMS 3DFLA 3P8NA 2H9EH 5C17A 1GI1A 5FCKA 1SHHB 3UQVA 2C90B 2VVCA 2PKSB 3M5OA 1ELGA 4OGYA 2AEIH 2CHAB 2K1QA 3VB4A 1YPLH 2ZHFH 1ANCA 1SVPA 3QN7A 1AVGH 5T6DA 1NPMA 2J95A 3LGYA 2GVFA 1E35B 4IN2A 3ZVEA 2VVUA 1QRZA 1T32A 1RJXB 2BQ6B 4X1PU 3BTME 1N6XA 1Z1JA 1YF4A 2ZEBA 1QGFA 4IBLH 1XMNB 2Y82A 2FM2A 2CJIA 1E1RD 3M35A 1TMUH 4R0IA 1O3AA 4DCDA 2ZDAH 2ZFQH 1W7XH 2G81E 4Z1MD 1S6FA 5BPEA 2CGAA 1JRSA 4Y8YA 4GLYA 3EGKH 3BF6H 3LKWA 1C5PA 2H1UA 4BAKB 3URDA 1MD8A 4CRAA 2ZCHP 4JYVH 3M36A 1IQMA 3MH5A 1HJAC 5HKKD 1BHXB 3TJVA 4J1YA 5L2ZH 3F9FA 2FZZA 2J9NA 3F9HA 5JYIA 1UK3A 2IN2A 1CA8B 3MH6A 3H7OA 3SNBA 2F9BH 1NRRH 3MO9A 1QBOA 3A7WA 3Q3KA 4DY7B 2GCHF 3C27B 3BG8A 9ESTA 1H9IE 8KME2 5DP3A 3NZIA 3T5FH 1S82A 1FAKH 1GDNA 2L6OA 3FP7E 1P3EA 5F8ZA 1OYTH 1C4U2 4DOQA 1EPTB 2BDHA 3SI4H 1ESAA 1PPZA 1C5UA 4CBOA 2HVYB 1FI8A 1LPKB 2XRCA 1V2RT 1V2LT 2V7QD 1C1TA 1MTNC 3RXSA 3VPKA 1B0FA 1Y3WA 4K60A 2AERH 3ZVGA 3AK5A 5H4IB 2BD3A 5FX5A 3VB3A 1P11E 1S0RA 1TX6A 1GJDB 2KCOA 4B1TA 1QJ6B 3GY6A 1KLJH 2JDID 4X2YA 1UHBA 3A7XA 1XUKA 2KCPA 4F48B 4ABGA 1FQ3A 3PTNA 4AB9A 1K28D 5T6FA 1QURH 1SHYA 1J15A 1FJSA 1EAIA 4HTCH 4I32A 1NY22 2W3IA 2Y80A 1GL1A 5GCHF 4CH8B 2JH6D 4NFFA 1CHOF 3OEHD 3PLPA 5I25A 1F0TA 1C1QA 1O0DH 1BZXE 5C2ZA 3ZZ8A 3TH2H 5F6MA 1OPHB 1D4PB 2F9VA 3KQEA 3FVFB 3HGPA 3M7TA 1EKBB 3FFGA 2ALPA 4XBBA 3SU4A 5GXPA 2QIQA 1K1JA 4XSKU 1HIAB 2VNTA 2EY4C 4B2AA 1TA2A 2JJ2D 4FUEA 4ABFA 4B74A 5DKMA 4FUDA 1C2HA 2D2DA 2VU8E 2F9NA 3KIDU 2SGAA 3TIUA 5LPEA 1THPB 2ZPSA 2GT7A 2H9TH 1TLDA 4B71A 3SUDA 2HNTC 2AMDA 3FAOA 3LOXA 4BTTB 4ZKNU 3VGCC 3BIVH 1ZTLA 1YLNA 4FU8A 1XKAC 1RIWB 3V0XA 4XDEA 2FO9A 1GJ7B 2A31A 2HALA 4X8SH 1IQKA 3ELAH 2J94A 3HPTB 1NRNH 1HAHH 1IOEA 3MNBA 5A0AE 1SOZA 3BTHE 1YWUA 1M9UA 1HAZB 1LHGH 3A7TA 1VGCB 4Y11E 4A1VA 1SBWA 1NT1A 1V6DA 1OP8A 3A8AA 1TNHA 1O2XA 1CE5A 2W5EA 4CRBA 4UE7H 2R3UA 1MU6B 3STIA 1O38A 1QHRB 1NZQH 1GCDA 5TCAA 3D62A 1GBHA 1DVAH 1ZJKA 3SV9A 4RKOB 1EP5A 2ZGXH 1O31A 1SFQB 3IITA 3MH7A 4AN7A 4HGCA 1O2WA 1C1PA 3OE7D 1QL7A 2WV9A 1NTPA 3KN2A 1GBIA 2OP9A 1P03A 2GDEH 4O97A 2ZQ2A 4Y79A 2ILNA 3DA9B 1GBKA 2HNTF 5C5NA 2Z9LA 4BOHA 4IC5A 4JK6A 3SJOA 1SG8B 1O39A 4NIXA 3ZVBA 1QTFA 2Z7FE 2Z9KA 1BQYA 3GS9A 1TRNA 3RXVA 4MDSA 5AHGH 5EXLA 4B6FA 2FMJA 5IYTA 2AFQB 3P6ZB 2G00A 1Z6EA 2C93B 3GY7A 4X8TH 3SZNA 1SGNE 3H7TA 3SV7A 1H9LB 4M7GA 1IQNA 1H1BA 3S69A 1VJ9U 3ATKA 1TGBA 4D9RA 1BBRE 1SGPE 2IOTA 4TPIZ 3OAAD 2QC2A 8GCHG 3SI3H 1FXYA 3KCGH 2FLBH 2GCTB 4ZHAA 2I6SA 5CMXH 2J2UA 1ZSKA 1FY5A 1AFEH 1MUEB 1TNIA 4NGAH 1OYQA 1IQHA 4MNWA 1HXFH 3GCNA 3KQCA 5GJ4B 1MKXH 1C5XB 2FOHA 3TVJB 3OEED 3LT3A 3SOSA 4RKJB 1A3EH 3RXMA 3RXUA 3RXDA 1C1RA 1G3BA 1UVTH 1O2RA 1DWBH 4P00A 3GDUA 1O32A 1W10U 1MD7A 4O9VA 1C2DA 3P8OA 2EQNA 1NRQH 4ZKSU 2BD2A 3WY8A 1BTPA 4X1SU 3SNCA 3W94A 1GHYH 1G2LA 1HBTH 4BANB 2AHME 2VBCA 1SMFE 1TYNA 3GDVA 2O9QA 1YC0A 3MU8A 1K1MA 2NU2E 3H09A 4YOGA 1O2LA 3Q3XA 1FY8E 1ZTJA 3BTFE 2PP6A 1Y3VA 1DSUA 3JZ2B 1W12U 2FOAA 1GHAG 4KTCA 5HM9A 4XOJA 3LGIA 1BCUH 1ZJDA 3DCLA 1ETSH 1P9SA 1PPEE 1WYKA 1OSSA 1EJMA 3F0PA 1BMAA 2F83A 1CGJE 4U32A 2HPPH 2FTMA 2HLCA 1T8MA 3A81A 4KTSA 3ZZ6A 3UR9A 2AS9A 4ZROA 5HIZA 2ESTE 1LDTT 5B6LA 1GDUA 3P95A 2FODA 1JIRA 4D7GA 2UUFB 3BG4C 1Y8TA 1SI5H 3A89A 5BRRE 3S9BA 4Q80A 3SUEA 4OGXA 3FN8A 4WY3A 3RXAA 1A4WH 2GD4B 2ZI2H 4MG3A 6ESTA 3E90B 1TA6A 2QCYA 5C5OA 4A5TS 3K6ZA 3K2UA 3CENA 1CU1A 1TQ0B 1HB0B 1O2KA 1W7GH 1T7CA 1C4V2 1DFPA 1CVWH 2RDEA 1MBMA 1BMLA 5HXFA 1MKWK 3PB1E 1SFIA 2A32A 2ASUB 1BT7A 1SGEE 1TBZH 1Y59T 2VIQA 1ZHPA 2VWMA 3ZZ5A 2R3YA 3ZYDA 1KTSB 4AGJA 1YM0A 3RUOA 1YCPM 3AAVA 2VWOA 2ZHEH 3ESTA 1UJ1A 2OCVB 3NKKA 3SNEA 4B75A 3SV2H 1GJ4H 5PTPA 4YOJA 2SGPE 2JETC 1FAXA 4IW4E 2CN0H 1SGCA 2JKHA 4Q4LA 3K9XB 5LGOA 1MKXK 2F9PA 2H5DA 2GT8A 2GJGA 6CHAB 1SGFA 4NIVA 4CREA 1ZMJA 1MTUA 2CV3A 5T1VA 2FX6A 4ZCNA 2ANMH 1V2UT 1AB9C 1NFUA 1EAXA 1SB1H 7ESTE 5EPYA 3FP8E 2ANKH 3M7QA 3PO1C 4WMDA 2FYQA 4A1TA 3S9AA 5K0HA 1CBWB 4MNVA 1IQLA 1AY6H 1BTYA 1QB9A 1O2UA 5L30H 3T62A 1QR3E 4DW2U 1DSTA 2B5TB 4NWLA 2W26A 4Y7BA 1THSH 2G5NA 1IQIA 1CGIE 2ZQ1A 1WTHD 4BNRA 2Z9IA 3PTBA 4OS2A 1RXPA 4MPXA 2O8TA 2BM2A 4A7IB 2ZHWH 1GJAB 2W6ID 2Y5HA 3SN8A 2BXTH 2VIDA 2XC4A 1VCPA 1SKYE 4AFZA 4E06H 1EPTA 5E2PA 2SNVA 3O8BA 3SJKA 3SUGA 2H9HA 3PMJA 4DGJA 5E0JA 2KR7A 1ZR0A 2RG3A 3ODDA 1MQ5A 1AU8A 1W3CA 1JIMA 3STJA 4F4OC 1SGFG 1J9CH 3QTVH 7GCHG 1HV7A 3OU0A 1A7SA 2SGEE 5E0GA 1C1MA 3BTKE 8GCHF 1G37A 5C3NA 4WF8A 3GCOA 1FY3A 1SPJA 2QV1A 1TRYA 2M2AA 3PLKA 3TJNA 2QF3A 4ACAA 1GJ8B 5EW1H 1O3JA 1GHVH 1IQEA 4ZMAH 2FOEA 3BEFB 1HPGA 4YM9A 1K22H 3QWCH 1O2ZA 2BY5X 4CHAB 4WH6A 5DK1A 1TGSZ 3SHAH 2Q6GA 1ELAA 3TK9A 1YYY1 4D8NA 1LQEA 1TBRH 3N7EA 2BMGB 1TGTA 4I31A 1FMGA 2Z3DA 1KXFA 1F7ZA 1SLUB 4ISHH 2A5KA 2WV5A 3E16B 3I78A 3C1KA 4OS1A 1HCGA 3SW2B 3ZZBA 3D49H 3V13A 1HIAA 3AVZA 4IC6A 2HWLB 1XKBC 1D9IA 1WV7H 2PSXA 4Y0ZE 1GI6A 1A3BH 3BTDE 4SGAE 5DP8A 3P17H 3HKJB 1AVXA 2JH0D 4YT7H 1FNIA 3MI4A 1ZGVA 3G01A 4LOYH 1OWDA 2BDCA 3UQOA 4YO9A 3Q00A 5AF9H 3SNAA 4JZDH 5G4BA 2WPHS 4E05H 1IQJA 1BRAA 2ZGBH 2QA9E 1JWTA 4X6PA 3PWBA 5DO4H 2CMYA 1GVZA 4KGAA 2VGCB 1LO6A 1ESBA 3M61U 3HK6B 1TQ7B 5IK2D 3RM2H 3RXQA 3ATMA 1DXPA 3RMLH 1TNLA 1NS3A 1WCZA 3RXOA 5ESBA 2Y5GA 4FUBA 1ZPZA 1G9IE 1S6HA 3GICB 3DSOA 2PKSC 1VITG 1DUAA 3GDSA 1GMDG 4UFEH 2CHAC 9LPRA 3ODFA 1AUTC 1YPKH 1T31A 3SV6A 3M3TA 1H8DH 4AOQA 1IHSH 1T4VH 1BB0B 4TWWA 2AIQA 1SQAA 1YLCA 2BDIA 1TONA 1C1VH 3T25A 1CA0C 2UUYA 4CRCA 4ZUHA 3SU1A 2PWXA 2FLRH 1YPJH 2BQWB 1DX5M 5GPIB 1BRCE 1UTOA 1C5MD 2A5AA 3QGNB 4DIHH 2C4FH 2FESH 3MQKC 3EE0B 3GISB 1EP6A 3HKIB 1GJ5H 1VR1H 3M5NA 2LPRA 4KELA 1OOKB 3UOPA 1HFDA 1AKSB 1S83A 1B7XB 1TALA 2V3HH 1BITA 4D9QA 3ATIA 1EJAA 1LMWB 3E3TA 3M5LA 2FOFA 4ISNA 4HG6A 3NXPA 3KEEA 3QK1A 3MMGA 1B5GH 3QGJA 1C4Y2 3RMNH 2G55A 1SGIB 4H4FA 4O3TA 1AQ7A 1VITH 3SU2A 4Y10E 4FOUC 1L2EA 1C5ZB 4YTAA 2V0BA 1TABE 1C2LA 2UWOA 2PTCE 1V2TT 1O3FA 1GHBF 1BBRH 2FWWA 3TJOA 2B7DH 1ETTH 2Q6FA 5CHAB 1Q3XA 3PV5A 2IPHA 2ZF0H 2WZQA 4WJG2 3P8FA 3M3VA 2O8WA 1CGHA 1EFRD 1LVMA 1LHDH 5L2YH 1Z71A 4INKA 1EPTC 1LCYA 4GAWA 3SBKA 3UWIA 2ANWA 5JBCS 1O3EA 2BDYA 6LPRA 2WSSD 4UEHH 3TH3H 2AYWA 1HAGE 2BLWA 1S6LA 2BLVA 5FCRA 2QF5A 1XVOA 3UNSA 3R0FA 1UMAH 1WDIA 1N8OB 1LVYA 2PFEA 3SU3A 5IDKA 4LZ4B 2ZZUH 1O2QA 1ABJH 3UB0A 1A5IA 4FUFA 1TPOA 2JIZD 1BHXF 1TPPA 4WXVA 4ESTE 1BDAA 3TGKE 3MOCA 1V2MT 1O2NA 3SQHE 1O37A 1O5BB 3CS0A 1EZUC 1MZAA 5K7RA 3KHVA 2ZKSA 1L1JA 3LJJA 3EDXB 4AB8A 1EOLA 2ZNKH 2H5CA 2ZHDA 4R8TB 3RXBA 1HAXB 4O03A 1KXDA 1ID5H 1YPMH 2OC1A 3RLWH 4ABEA 2IPQX 3T27A 1O3DA 2OXSA 1DY9A 5FX6A 1K21H 1DS2E 1LPGB 3E0NB 3RMMH 1EQ9A 2XC0A 2JJ1D 3S0NA 1F2SE 1UVPA 4XFQA 1UVOA 3BTWE 3PMBB 3ZVCA 2BQ7B 4ABJA 3TPIZ 1EATA 1QNJA 1P04A 2ZP0H 1KIGH 3SYJA 4I33A 1V2NT 2LELA 1D6RA 3A7VA 4MVNA 2KX4A 3PRDA 3NUMA 2GKVE 1GHWH 4ZXXH 3O8CA 1C9PA 5AVDA 2EI6A 1KYNA 1YPHC 4E7NA 5C0UA 4GCHG 1MQ6A 1C9TA 2B9LA 3LDXH 1TNGA 4LZ1H 1P57B 1SL3A 2BOKA 3ZZDA 3ZVDA 2TBSA 3ENSB 1FIZA 1C2IA 2BD5A 2KCYA 3FP6E 4RN6A 2ZU1A 2OD3B 1GBAA 2FEQH 3MU5A 2F3CE 1BBRK 3UNRA 1GG6B 4I8GA 2ZGHA 2ZTXA 1TNKA 5A0CA 1VGCC 3RLYH 1KXCA 2HPQH 1PYTD 1HAPH 5C1XA 1VITF 1QB1A 1GMCF 4NZLA 2GV7A 2W7UA 1P3CA 4JZFH 4JYTA 4X6NA 2K8IA 1LHFH 3U69H 4M9FA 2WUCA 3MU0A 4AGKA 2WINI 4BAMB 1QFKH 1P12E 3KGPA 4Y7AA 1MAYA 3BSQA 1X7AC 3VFEA 4TT3D 1WQSA 5HM2A 4FUCA 1DDJA 2BDBA 1MAXA 3RU4E
chains in the Genus database with same CATH topology
1PQAA 2P95A 3E91A 1ZYOA 5GIBA 2FOMB 1C1WH 2SGQE 2NU4E 2BX3A 3GCHB 4JMYA 1C1SA 2WV4A 1LQDB 3QUMP 4XBDA 4X8VH 3UFAA 3K6YA 1PPCE 5JBAS 2ZIQH 1ZPBA 1SGQE 1NFXA 5I46H 2GMTC 4NWKA 1BA8B 1GJ9B 1J16A 4ABIA 1BMNH 2FI5E 1K1PA 3A85A 2GP9B 4NIWA 3VGCB 3MYWA 3TK6A 2PTNA 4CR9A 2AH4X 3FZZA 1P2JA 1PQ8A 1UK4A 2QGRA 2VIOA 1YKTA 2GCTC 2G8TA 3TGJE 3RC6A 1ESTA 1NO9H 2C3SA 5ETXA 1Y5BT 2AMPA 1C5VA 1O5FH 2A1DB 4ZH8A 1MKWH 1ANDA 2ODQA 3T29A 4UDWH 1GBMA 2C8XB 2ZDLA 1AZZA 5FBIA 3LGWA 1GJBB 3HGNA 2FTLE 4AZ2B 3RDZA 1XXFA 5FPYA 3RMOH 1RS0A 1EJNA 1SLXB 2VH6A 5AFYH 1OS8A 2VVVA 2A4OA 1H9HE 3A7YA 3MNSA 5B6OA 2WYJA 4ABDA 2XW9A 1KXAA 3MHWU 3LJOA 3BTEE 1TOCB 1P2KA 4MQAA 3A80A 3EQ0H 1RTFB 1DT2A 2JH5D 4GUXA 1EZXC 3IWMA 2B8OH 3EA8A 5EQRA 1W14U 5E8EH 1BRUP 3L3TA 1PPHE 5EOKA 1P2IA 2V35A 2V6NA 2G51A 2BX4A 1QBVH 4U2WA 1DWCH 1HUTH 1JMOH 2OUAA 4B2CA 1ZMNA 1H4WA 3ZYEA 1GCTB 4GSOA 1AFQB 3BTGE 1O5DH 1OWEA 1QA7A 3MNCA 2WYGA 2QN5T 3BTQE 3SJ9A 1XUIA 1O36A 1RFNA 2G52A 2A4RA 1W2KH 2Z9JA 1HAOH 1ZSLA 1BTXA 2NU1E 2A45B 2XBXA 3V12A 1HGTH 2ZFSA 4Y0YE 3SJIA 2FS8A 2STAE 4BAQB 3NPSA 2KAIB 2ZA5A 1EOJA 4O3UA 1V2JT 4KP0A 1GI0A 3ATLA 1AZ8A 3TU7H 1S0QA 2P59A 1CQQA 2Z3EA 3LH3A 1W0ZU 1T8LA 3QX5H 4LK4A 5LPRA 5LPFA 2Q6DA 1O2OA 5EW2H 4JCNA 2FXRA 2XXLA 1TPAE 2QF0A 1EAUA 1DWDH 5T3HA 4GCHF 1O34A 1EB1H 4H6TA 4X8UH 3T26A 2BVXH 5A0BA 3BEUA 2XWBI 1KLTA 2QAAA 1OP2A 2OTVA 2Y7ZA 4FXGH 1HAVA 4TYDA 3CS7A 2ZTYA 3UIRA 3SGBE 4AX9H 3DUXH 3P8GA 2ZCKP 1AKSA 3UTUH 2QXHA 6CHAC 1UVSH 2NU0E 1K1OA 3NCLA 4THNH 4BTUB 2I6QA 2SFAA 4CBNA 1DY8A 2J38A 4NA9H 2YNBA 4HZHA 4UONA 1Q2WA 1MBQA 3TGIE 5A09A 4BAOB 3LONA 2R2WU 1CBWC 5DP7A 2PR3A 2SGDE 1Z7KA 2R0KA 1FIWA 1SR5C 3QLPH 5DPAA 3S7KB 2C8ZB 3RU4D 1SLVB 2FOGA 3OSYA 2YNAA 2ZCLP 3AW0A 1W13U 4ZXYH 4WH8A 2BDAA 3RXJA 4MTBA 4GHTA 3RP2A 1O2TA 5E0HA 2P3FH 3E8LA 1L4DA 5FPTA 1AHTH 1E37B 1ELFA 5ESTE 1KTTB 2ZGJA 1O2IA 1V2KT 4WXIA 1E36B 1A61H 3MTYA 1BTHH 1BRBE 1PJPA 4CH2B 1P8VC 5EGMA 3BTTE 1XUJA 1NC6A 2ZGCA 4K1EA 1AIXH 5FAHA 1C1OA 3PROA 4OS7A 2H6MA 1N6YA 1P2MA 3RXKA 1FLEE 5L6NH 4K1SA 2Y81A 3RU4T 1C5NH 3LGTA 3LU9B 5EU8A 4Q7XA 2DE9A 3GY3A 1UK2A 1SQOA 1Y3XA 1DE7H 1O33A 2UWPA 2P93A 1KSNA 2GV6A 5LH8A 1O3HA 4X2XA 4SGBE 2A7HA 3HK3B 4NA8A 5C1YA 3TNSA 4TPYA 2ZDMA 1QB6A 1SGTA 1NESE 1AVWA 1Z8RA 1G36A 4B73A 1BTUA 3RXHA 1ELEE 1GI5A 5JB8S 1U6QA 3KNXA 4CHAC 2FOBA 3ZZ3A 1Z1IA 1TIOA 1PQ5A 1NN6A 4JZ1A 3GYLB 5JPMH 1C5SA 1P2OA 3O8RA 1WBGB 2TGAA 4AG2A 1UVUH 3RXGA 2GTBA 1VCWA 1YCPK 1G30B 3N7OA 1K1NA 5A2MH 1Q31A 1LKAA 1Y3YA 4WMFA 2PV9B 4HFPB 7KMEH 5E2OA 4K5ZA 1O2PA 3E1XB 5FXLA 2A4GA 1JBUH 1C2JA 2BD9A 2G4UA 1Y5AT 4ZHLU 3FANA 1G3DA 1T8OA 1KXEA 2UWLA 2ZFTA 3OX7U 1FONA 3DD2H 1G2MA 3M3SA 4FUGA 4NA7A 1AWFH 1H8IH 5JBBS 3A7ZA 1RTKA 2Z94A 2P8OB 1O3OA 3OY6U 1HJ8A 4MNYA 1ZZZA 4NSYA 3LGUA 1DANH 2VIPA 3A88A 2VIWA 2VGCC 5DP9A 4UFDH 3P92A 1QQUA 3MU4A 4Z6AH 1EZSC 3UUZA 2HGTH 2XCNA 1GGDB 3Q76A 2OQUA 2D8WA 3U8TH 1GHAF 4X6MA 3ZVAA 1BOQA 1BTWA 1UCYE 4JZIA 1OX1A 2QXJA 3URCA 5A8XA 4I8JA 3SO3A 1TGNA 4VGCB 4X1QU 4B2BA 3UPEA 3A8DA 2XBVA 1A0HB 5J4QA 1IHTH 2ZDNA 1GBCA 1BJUA 1O5EH 1KDQB 1Y3UA 1GI3A 1C5RA 1GJ6A 1UTMA 3PMAB 1DXWA 3MH4A 3U1JB 6GCHG 1ELBA 2HRVA 1UTQA 4FUIA 1P02A 1INCA 1GDQA 3RC4A 1TNJA 1GHZA 1EUFA 2BY7X 1J14A 3S9CA 3GOVB 3VXFH 1ANBA 1UO6A 3GYMA 3LH1A 2J92A 2BY9X 2EA3A 1SLWB 4FU7A 1IQFA 3VB5A 2BYAX 5JB9S 2PSYA 1QL9A 1C2MA 2UUKB 1GBDA 1TRMA 2WUBA 1ELDE 2OC0A 4Y8ZA 2XNIA 2ODYB 2Z6BD 2W7SA 4INHA 5ABWA 2GGVB 3U9AH 4CRFA 1VCQA 1O3IA 1QQ4A 4XBCA 5EQQA 3V3MA 1UTJA 4BAHB 2B0FA 4FUJA 3A8BA 3HATH 1HAVB 1W0YH 5EQSA 3RXRA 1MTSA 3ATWA 1C5OH 1C5YB 4NSVA 4Y8XA 1KXBA 3ZZAA 1S81A 1SOTA 5CHAC 1O2GH 3MNXA 1XUHA 4U01A 2VJ1A 4OS4A 4LXBH 1GJCB 1NRSH 4F49A 1F5RA 1FZZA 1FN8A 3UREA 2PLXA 4GPGA 4ZHMU 4FUHA 5AFZH 2AMQA 2V3OH 2ZDKA 4I8HA 4JZEH 1OWJA 1O5AB 3MWIU 1P06A 3M7UA 1CA0B 1QCPA 1AMHA 1N8OC 1ZHMA 1O3CA 1P10A 5SGAE 4KTUA 3U1IB 1FPHH 1ZHRA 2BTCE 4AFUA 1F5KU 1AE5A 1P2NA 4X1NU 1LPZB 1P0SH 1L1GA 3ZVFA 4Q2KA 2CXVA 2ZPQA 1TFXA 3B9FH 4MLFB 1O30A 3AAUA 1V3XA 3PV4A 1A2CH 2TPIZ 3DHKH 3I77A 3BIUH 5TCCA 3SNDA 1HNEE 2EI8A 1AO5A 2Z9GA 1CO7E 1YBWA 2ZHQH 7GCHF 1TX7A 1LHCH 3NWUA 4FVDA 2AGEX 1TB6H 4ABAA 1XVMA 2P94A 1RGQA 1OWHA 4ISLA 5FPSA 2ZFPH 2XBYA 2R0LA 3RM0H 4FU9A 4BTIB 4KKDA 1MU8B 5DGJA 3ZZ7A 4Q7ZA 2KAIA 3E0PB 4GHQA 3RC5A 4CR5A 3RXFA 1A46H 3SGAE 4ABHA 1AUJA 3TK5A 3VXEH 3UOUA 2TGTA 4UFGH 1P2QA 2A7JA 2QXGA 3U98H 3R3GB 1QRWA 5TJXA 3AASA 3UR6A 2OC8A 3TNTA 2PUQH 1UTKA 1C5QA 1TGCA 1V2QT 1HJAB 2Y7XA 1DWEH 1IAUA 3PMHB 3E6PH 1E38B 2FP7B 2J4IA 2HVXA 3QO6A 1J8AA 4Y71A 3QZRA 1FV9A 2GZ9A 4K3JA 2TIOA 1MMJN 1C2EA 3UY9A 1PPGE 5A8YA 2AGIX 1C2FA 1GI8B 1GG6C 2EI7A 2PKAB 1O2YA 2BZ6H 2FS9A 1QBNA 2STBE 2Z3CA 3F9EA 4X6OA 1MTNB 1O3LA 1TBQH 2RA0A 3GY8A 1C5LH 3T28A 1Z8JB 1RIWC 4K69A 1PQ7A 2XWAA 5JBTA 1QRXA 1T8NA 4YLUA 3D23A 4YZUA 3MO3A 3F1SB 4D7FA 1S85A 3SORA 6GCHF 2THFB 4A6LA 1LHEH 5GDSH 5JDUB 1TX8A 4IN1A 1SSXA 1G3CA 4K8BA 4AFSA 5F8XA 3A86A 3GCHC 2F9UA 4I7YH 4X2VA 5C67A 5HYOA 4A1XA 2HOBA 1GMDF 1O3GA 1DOJA 1WTGH 4PROA 5DP5A 1UTNA 2P16A 2ZDVH 3F6UH 2D26C 3F68H 3OY5U 1WOFA 4YOIA 1K1IA 1HJ9A 1OWIA 3OTJE 2FI3E 2FPZA 1EB2A 2IJOB 1C2KA 1XUGA 4ZKRU 2O8MA 1AWHB 1GBBA 4ZAEA 1QJ7B 1OWKA 1QIXB 2C8WB 1O3NA 3OYPA 1E0FD 1P9UA 2DUCA 4K8YA 2ZU5A 4DVAU 2GDDA 1ACBE 3F9GA 1NU9A 2BOHB 4I8KA 3VB7A 3MU1A 1SQTA 1MZDA 1OXGA 4X0WU 1Y5UT 4MPUA 2WPJS 1ZSJA 1SC8U 3B8JA 1AE8H 1EXFA 3GY4A 1OP0A 2ZFFH 4Y76A 2A2XH 1A5HA 2PGBB 2BZAA 1Z6JH 1GWAA 2F91A 4INLA 4DG4A 2XYAA 5DG6A 5EPNA 2M5TA 1MTVA 3LPRA 2QXIA 4UFFH 3P70B 4DT7B 1TPSA 3I29A 3SV8A 1ABIH 1GI4A 3RXCA 5F8TA 3ZV9A 2YOLA 2OBQA 4WMEA 5C20A 3EA7A 3LC5A 4UD9H 1EX3A 1GBFA 1GHXH 1GBLA 2BLQA 3EAJA 4DURA 3ITIA 3ZZ4A 1WAYB 3SQEE 2BLOA 4TWYA 3SHCH 1HAIH 5HGGA 2RDLA 3L33A 1GMHG 3UWJH 5J4SA 3PM3A 3LGVA 2ZU4A 3UNQA 1UTLM 4ZKOU 1JOUB 1GCTC 1AFQC 4IS5A 1AGJA 2Y6TA 2ALVA 2ANYA 2GMTB 2R2MB 2VINA 3DFJA 3AW1A 2BB4A 2F9OA 3BN9A 1S5SA 4BXSA 1BTZA 2VWLA 3U8RH 2TRMA 2FOCA 4ISIH 1LVOA 1WU1A 4IMQA 4AORA 2ZU2A 1OKXA 3ZV8A 2A4QA 2NU3E 5GWZA 1YPHE 2BD4A 4ISOA 4U30A 2A0QB 1AI8H 1UCYH 3SUFA 3SU6A 2LNCA 1XUFA 1PPBH 3A87A 2CF8H 1A5GH 1V2OT 3MO6A 4AG1A 2A7CA 5DP4A 2RA3A 1KDQA 4NZQA 1O3KA 1O3MA 1PFXC 4HI3A 1HLTH 1ZLRA 5EXMA 1QY6A 4FVBA 3KQBA 2FX4A 1F0UA 2BDGA 2QY0B 1RD3B 5EG4A 2BY6X 5EXNA 2HNTE 4Q7YA 2A2QH 4GVUA 1MCVA 1HAYB 2J34A 1ZPCA 3RXEA 1ETRH 3KF2A 1YPGH 3GCTG 1XXDA 3ZZ9A 2ZO3H 1D3PB 1CHGA 1O5CB 4X2WA 1YCPH 5DP6A 1IQGA 1F0RA 1L0ZA 2WPLS 1CT2E 1BIOA 7LPRA 1RTLA 1G32B 2ZTZA 1O2HA 4Z0KA 4YT6H 2UUJB 1CT4E 4CRGA 1TAWA 1C1NA 1UHBB 3A82A 1A0LA 2ULLA 3TLOA 1W11U 1S84A 4AFQA 2TGPZ 1WQVH 1YPEH 1P09A 5HMAA 2AIPA 1N1LA 1C1UH 3QTOH 3TH4H 1F0SA 1QJ1B 3H5CB 3KL6A 3FZDA 3CP7A 1FN6A 1GBTA 1BMMH 1THRH 3RXLA 8LPRA 2ZPRA 1YGCH 2ZG0H 2D1JA 3SU0A 3PYHA 3QDZB 3BG4B 3NK8A 1F92A 4YLQH 2XTTB 3KQDA 1O3PB 2PGQB 1NU7B 5CE1A 1O2VA 2ODPA 3BV9B 8ESTE 1FPCH 1FY1A 1HYLA 1TMBH 1MTWA 2EEKA 3EA9A 1GVKB 2VWNA 4NFEA 1Z8GA 4MNXA 3U8OH 1SGRE 2CF9H 3A83A 5FHTA 2BVRH 2R9PA 2P3TB 2EC9H 3M5MA 1HXEH 4X1RU 1TWXB 3EYDA 1UCYK 1A1RA 2BD8A 3PWCA 4D76A 3TITA 1ORFA 4E7RG 2P3UB 1PYTC 1J17T 2G4TA 2TGDA 1NRPH 2W3KA 1ARBA 4OS6A 3PLBA 1WSSH 4H6SB 4JK5A 1KY9A 3K65B 1SGYE 1JRTA 1TOMH 1C5WB 1SGDE 2NWNA 2XCFA 2Y5FA 4IMZA 1W8BH 4K1TA 1V2PT 3M37A 2OINA 4TY6A 2PW8H 2OBOA 4JYUH 2FDAA 1D6WA 3A84A 2JETB 1CSOE 1FY4A 2QYIA 1LKBA 3SU5A 2VH0A 1V2VT 3B23B 1TMTH 3A8CA 1NM6A 2SGFE 1GHBG 4WWYA 3VEQB 4NG9H 1XM1A 1GI7B 2O8UA 3L6PA 2WPIS 1AB9B 1QL8A 1L4ZA 3D65E 1KLIH 2OC7A 4B76A 4IGDA 3PO1B 1V2ST 2PUXB 1TE0A 1VZQH 1GMHF 2O8LA 1O5GH 1ZTKA 4A92A 1MH0A 3BEIB 2BY8X 2VIVA 4WVPE 1DICA 5EODA 2ZC9H 1NFYA 1EAWA 1GBJA 4AYVB 1HRTH 1DITH 4XE4A 1ZGIA 1WUNH 1ZOMA 1XX9A 2P8OC 2ZFRH 1GI2A 2DE8A 1VJAU 5A8ZA 4CRDA 1AN1E 1DLKB 1FUJA 5F03A 3VB6A 2VB0A 4ABBA 2GCHG 1HDTH 3JZ1B 4AYYB 1B0EA 1C2GA 2OQ5A 4BXWA 1GGDC 3GY2A 1D3TB 4OS5A 2PKAA 1O35A 1O2JA 1O2MA 1D3QB 4I8LA 1ZRKA 3S7HB 3RXPA 4VGCC 3LIWA 2XC5A 3W95A 1AD8H 1JXPA 2FIRH 3SGQE 1K1LA