1O2JA

Elaborate manifold of short hydrogen bond arrays mediating binding of active site-directed serine protease inhibitors
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA-TRYPSIN
publication title Elaborate Manifold of Short Hydrogen Bond Arrays Mediating Binding of Active Site-Directed Serine Protease Inhibitors
pubmed doi rcsb
molecule tags Hydrolase
total genus 53
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2003-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1o2jA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1o2jA02
3STJA 7LPRA 3SHAH 1S6HA 2BYAX 3OSYA 4X8SH 1EJAA 4NZLA 1J17T 1KXBA 2AYWA 1O3BA 1XVMA 1GBEA 2NU4E 3SNEA 3RM0H 4INLA 3SUEA 1HAPH 3TNTA 4D7FA 1O2MA 2BOKA 1O5CB 1GI2A 2JH6D 2PW8H 1OX1A 3BTEE 2QGRA 4JZIA 1INCA 2HGTH 1LKBA 3BSQA 4AN7A 3RXHA 3A7TA 1TX7A 2FS8A 3RXTA 3ZZ4A 2O8MA 3FAOA 2PKAA 5EGMA 1FPHH 1THPB 1IQFA 1A3BH 1P9SA 4PROA 4UFEH 4Y8ZA 3PB1E 2PLXA 2FI4E 5A09A 1ZJKA 1YC0A 4LZ1H 5F8ZA 3UQOA 2BD7A 1F5RA 3I78A 3EA7A 5ESBA 1SGTA 1S83A 5HMAA 4YOJA 1AN1E 1GJ8B 2BQ6B 1Z7KA 2A4QA 4A7IB 1ZPZA 1GCTB 1C4Y2 2XBYA 5GXPA 3PM3A 1ZMJA 1QR3E 2BVSH 2QXIA 1ELTA 4MNXA 3UWIA 4IW4E 5CHAC 1OKXA 3UNQA 6GCHF 2CF9H 3VEQB 1O2WA 1SI5H 1GDQA 3LGTA 3UTUH 1BTWA 1BTHH 2W26A 2BZAA 1IQGA 3TITA 1SC8U 4AYVB 4X1RU 1EAIA 3NZIA 6LPRA 1CHOF 2C90B 1G32B 1P2QA 1FXYA 5EPYA 5HGGA 4CREA 3I77A 2WPKS 4X6OA 1QBVH 1VITG 3S9BA 1A46H 3H7TA 2AGGX 1GBBA 2HNTC 1O2QA 1KLTA 3A81A 5AVDA 1TA2A 1RIWC 3FFGA 1O2TA 1BA8B 2CXVA 1DXWA 4E05H 2FTLE 2Z3DA 1PPBH 1PFXC 3PMBB 1FQ3A 2AMPA 3GY7A 4HGCA 1O3JA 4Y76A 1BJVA 1LMWB 2KAIB 3GDSA 5A0AE 1GBMA 1FAXA 3GCTF 4RKOB 1UMAH 1NRNH 2R0KA 4ISNA 3GY2A 4KELA 4OS5A 2R3YA 3MNCA 3MYWA 2OQUA 4ZHAA 2D26C 2ZQ1A 3SI4H 4Y0YE 3LIWA 1ORFA 4ISIH 1BCUH 1NY22 1NU9A 3ZZ6A 1NRPH 1XUKA 3K9XB 1F0SA 2BY7X 2ZEBA 2ZFTA 2ZIQH 1BTXA 1K1PA 1VCPA 4AORA 1G2LA 2FODA 3L33A 1WUNH 5DP7A 1Y59T 2FOMB 1F0UA 8KME2 1RJXB 2BX4A 1MUEB 1VJ9U 1PYTC 2ZGHA 2C8YB 4A92A 5C1XA 1DUEA 3FZDA 4SGBE 1OPHB 1N8OB 3B23B 3M5OA 1ANCA 3SNBA 1QRWA 1TOMH 1Y3WA 2VWOA 1K22H 1NFYA 2UWOA 4ZKSU 2AMQA 1S0QA 3A7VA 4ABBA 1MBMA 1H9IE 3EA9A 1O3AA 1OWEA 3VGCB 3UWJH 2BY8X 2OBQA 2ZDAH 1CBWB 5DPAA 2UUJB 2QV1A 3U8TH 3KF2A 1ZZZA 1GMHF 1UTMA 1YCPM 3PMJA 1PJPA 1DWDH 4MTBA 4MNVA 3T28A 3BG4B 1ID5H 2TRMA 1O34A 1DANH 2BLQA 1TOCB 5GDSH 2ZFQH 4AG2A 1VCQA 3A7WA 1O35A 1GI6A 1EZQA 3E90B 1SHHB 2ZA5A 3KIDU 3D65E 2VVCA 4A5TS 2W3KA 1FPCH 2ZFRH 3K65B 1HAOH 1HIAB 2ZG0H 1XMNB 1XX9A 2BLWA 3LPRA 1SGQE 3ENSB 3RMOH 4ABEA 1FIWA 2FX6A 3LH3A 3OY6U 3P8FA 3ZZDA 3TK5A 3A80A 5JB9S 3BTQE 4O3TA 2JETC 2PSYA 1O2VA 4GCHF 2HWLB 5LPEA 1AQ7A 1XKAC 5PTPA 3RXOA 1PPFE 2PHBA 1ELBA 1P10A 4K1SA 2NU1E 2TGTA 2BD4A 1NT1A 2TGAA 2PUQH 1YPMH 3ATKA 4LK4A 5F03A 1LHEH 2Y5FA 4GAWA 1ETRH 3BTGE 1K1LA 1C2FA 3STIA 4GPGA 1ELDE 1AKSA 2BB4A 4BAMB 1BT7A 1P2KA 1ARCA 1GBJA 1K1NA 4Y6DA 1GBKA 2FLBH 3PYHA 2FX4A 1EZUC 4JK5A 1V2PT 2ZECA 4NA8A 4WMDA 3KN2A 4FUFA 1P2IA 1E37B 1GBCA 3H5CB 1YPEH 1F5KU 1Y3VA 1Z1JA 1KLIH 1GJ5H 1FONA 5K0HA 3E0PB 1Z8IB 3F68H 1ETSH 3A8BA 1CT0E 1O2ZA 2RCEA 3MTYA 1KY9A 1C5OH 2FESH 2FOEA 4OS7A 3HKIB 4U32A 1SGNE 3S7KB 1AUTC 4FVBA 1GMCG 2QXGA 1ACBE 2G52A 3TGKE 1A0HB 2ZGJA 3M5LA 1SGIB 1UTKA 2GZ7A 1HNEE 4IGDA 4B1TA 1KXEA 1WOFA 4MPVA 1D3PB 1CU1A 1ZYOA 5EXNA 2Q6DA 3Q77A 5FPSA 5GPIB 2ZTXA 1LPGB 2P16A 5C20A 1TX6A 3A7XA 1UTPA 2CN0H 2Y5HA 3NK8A 3NXPA 3FP7E 2WUCA 2A45B 3HK3B 3KEEA 1NS3A 1TBRH 3QK1A 1GHXH 1CQQA 2ZZUH 3CS7A 3RC5A 1AFQC 1ELAA 5DKMA 2ZDNA 4KP0A 1DX5M 1NRSH 1Z6EA 1O3KA 4ZUHA 3ZZ7A 3SU3A 1KIGH 2PUXB 5C2ZA 1H9LB 1TNLA 1FN6A 4ZKRU 3HGNA 5DP9A 1QQ4A 1ESTA 5H4IB 1A7SA 1KYNA 1YPKH 2G55A 2TPIZ 2ZPQA 2QAAA 1T8MA 3B9FH 1A5IA 3EE0B 3VB4A 1C1UH 9LPRA 2H9HA 2OLGA 1BHXB 2ZPSA 1ZTLA 1P02A 2PSXA 1J14A 1ELVA 3QTOH 4NA7A 4HFPB 2XRCA 1HXEH 3SQEE 2ZU3A 5EW1H 2VIOA 1HJ8A 1NFXA 1QGFA 3C27B 2A5IA 4RKJB 1O36A 3A84A 2FI5E 5C5NA 3GOVB 3KQEA 5CMXH 1C5QA 1U6QA 1EAXA 5A0CA 4YOGA 3RP2A 1GDUA 1O3CA 5DJ7A 2PTCE 4D7GA 1ABIH 3LONA 4D9QA 1SLUB 4FUGA 5T6FA 1L2EA 1W2KH 1GVZA 3BTKE 5EXMA 1NRRH 2TGDA 3W94A 1FDPA 2P94A 5JPMH 4DVAU 2ZKSA 1ZGVA 1EKBB 1AB9B 1XXFA 2P59A 3T5FH 1QJ6B 3V7TA 4AYYB 4JCNA 1SHYA 2GGVB 1NFWA 2VNTA 2EI6A 1TYNA 1SFIA 2ZFPH 1G30B 4TPIZ 3T26A 3BTFE 4ABFA 4FUCA 4FXGH 1BIOA 4NG9H 3GCHC 4BAHB 1HV7A 4I8KA 4ZROA 4Y8YA 1GI3A 1UHBB 3GY5A 2O9QA 2V0BA 3UOPA 1QB1A 1HBTH 3E0NB 2CF8H 1C2KA 2VIQA 3NPSA 3FP8E 4U2WA 3SO3A 1N1LA 3RXQA 1TNGA 3QO6A 4INHA 2V3OH 2DE9A 3RLWH 1C5NH 3RXLA 1AMHA 2EC9H 2ZGXH 3SUFA 2ODQA 2P3UB 2BD8A 5E0GA 5HM2A 1WBGB 1HB0B 1P2MA 3U69H 1GG6C 3RXCA 1DY8A 1LO6A 1GVLA 3ZYDA 3SJ9A 1WQSA 1SMFE 1GDNA 3FP6E 3E3TA 4X8UH 1RTKA 4OS1A 1A0LA 1L0ZA 4FUBA 3MU4A 1XUGA 1W13U 3BTWE 1L4ZA 2FXRA 1BJUA 2VWMA 1JRTA 2PGQB 4X1QU 4ABDA 2V35A 2ALPA 4QT8C 1UCYE 5L30H 1QNJA 1HYLA 5FXLA 2Z3CA 3ZVCA 4UFFH 3TJVA 1YPJH 1YM0A 1DSUA 1C5TA 2SNWA 2ODPA 4H6SB 4YTAA 5A0BA 3LJJA 1OS8A 2C8WB 2OC7A 3MMGA 1QL8A 4O03A 4CHAC 2R2MB 1JWTA 1PPHE 2RG3A 2VGCB 5FCKA 1C9TA 1NROH 1LPZB 1DE7H 1P12E 1HAIH 3Q3YA 1HXFH 1GJAB 3KGPA 3UNSA 2FOHA 2VVUA 4LZ4B 1D3QB 4XSKU 1JRSA 2AGIX 1Z8GA 3HPTB 2B9LA 3SNCA 3PLBA 3P70B 3TJNA 2BX3A 1O2RA 1AHTH 2ANYA 1D6WA 2GCTC 4NWKA 4BAQB 1NRQH 1T31A 5TCCA 1RIWB 1GJ4H 1JBUH 1HDTH 1O3OA 2VH0A 3QUMP 1GI5A 4FU8A 1Y8TA 1EOLA 1VZQH 2G00A 3ODDA 3ZV8A 1YCPH 3MH6A 4WMEA 3TK6A 5FBIA 1S0RA 5F6MA 1T8LA 2IPHA 5ABWA 2XCFA 1IHTH 3IG6B 9ESTA 4DJZB 4K8BA 4WY3A 3BTHE 3ZZ5A 1E38B 1FNIA 4TPYA 1C2EA 5F8TA 3PROA 1B0FA 1AE8H 1HFDA 4YT7H 2EA3A 2F83A 2VIDA 4K60A 1MTUA 4HTCH 1BRCE 3PTNA 2J92A 1Q2WA 4X8VH 2OINA 1THRH 3PO1C 2KAIA 2QY0B 3RXBA 5G4BA 3PLPA 1GMDF 1JXPA 1YCPK 3M5NA 1AWHB 2Y82A 1D6RA 3PWBA 5T3HA 5ETXA 3GYLB 1ZMLA 3SZNA 4UFGH 4I8HA 1ZHMA 3DD2H 5E0JA 4ZKNU 3M7UA 2A7JA 2VIWA 1EOJA 3MO9A 4Y7AA 3GCOA 4NGAH 5GWZA 2ANKH 2UUFB 1E0FD 2FOGA 1SBWA 3UOUA 4ESTE 4NCYA 3Q3XA 4ISLA 2H2ZA 3UQVA 1QB9A 1C2HA 2C8XB 4JK6A 1A5HA 1V6DA 2CMYA 5JBCS 1K1JA 2P95A 2ZHFH 4CR9A 5JBAS 1CO7E 3SN8A 1B5GH 2NU3E 1LCYA 1GHVH 1BQYA 3M7QA 4WWYA 3NWUA 4NWLA 1GCDA 4Y71A 4NA9H 1C2JA 1C1SA 3QTVH 4DIHH 1EQ9A 1CA0C 1TX8A 1EJNA 4A1TA 3MU8A 3VXFH 3BN9A 2K1QA 2GDDA 1C1RA 4DW2U 3BG8A 5T6GA 3AW0A 2XBXA 2FEQH 1SQAA 1THSH 2A0QB 1E36B 4MNYA 4CRBA 4ZHLU 1TNHA 2BDIA 2BOHB 2VB0A 3SJ8A 3SNDA 2GV7A 5JB8S 3TGIE 5E0HA 3QLPH 2WV5A 3ZVBA 1L1NA 1G3BA 1GBDA 2V3HH 4RSPA 3ZVGA 2CHAC 5C3NA 1ZSKA 4X2WA 3F9HA 4XOJA 1TRNA 3Q76A 1C1MA 1N6YA 3KQDA 5FHTA 3DHKH 4FUIA 4IS5A 4Q7ZA 4GCHG 4ISOA 4FVDA 7ESTE 1MQ6A 1XUJA 2VIVA 4UE7H 4MPXA 3TH3H 1GJCB 1JIRA 4X1NU 3ZZBA 1AZZA 2Q6GA 1SL3A 1HIAA 1VGCC 3DUXH 2ZO3H 3SV8A 3TJOA 1AIXH 3AASA 1FI8A 1IOEA 4NFFA 3GY3A 1BBRE 4WVPE 4HZHA 1GGDB 3SU2A 1ANDA 4XBCA 3TIUA 1C5RA 2ULLA 5EXLA 3M61U 4B73A 8GCHF 1DDJA 2GZ9A 3T62A 1TMTH 2Z9GA 1AWFH 1V2WT 1NC6A 1IHSH 3O8DA 1MTSA 4FUJA 1HJAC 3QX5H 5BRRE 2BHGA 2CJIA 4I33A 2BDAA 1ZGIA 2C93B 1NESE 1GBFA 2AMDA 5I25A 1EPTA 2J9NA 2I6SA 4DG4A 5HXFA 4IMZA 1BRBE 3N7OA 1GPZA 2P8OB 2QF0A 1UTNA 7GCHF 2Z3EA 2HPQH 2IOTA 4BAKB 5L6NH 2AERH 1TGNA 2A4OA 5FCRA 4AFZA 1L1GA 2Z6BD 3QWCH 3SJOA 2FPZA 3R3GB 1EX3A 1UVSH 2TGPZ 4A1VA 1O2NA 3GDUA 1NN6A 1O33A 1O3IA 3KCGH 1PPGE 4MG3A 1J9CH 1F92A 1T8OA 2ASUB 1DOJA 1V2RT 2UUKB 2XBVA 1QB6A 2YNAA 1TPPA 1V2QT 4ABJA 1VR1H 3F9FA 1GBLA 4O3UA 4Z0KA 2ZQ2A 1YP9A 2H5CA 1ZOMA 3MWIU 1V2VT 2ZHEH 2A5KA 1BRUP 2IN2A 2PKAB 1GHAF 1EB1H 2ANWA 2XTTB 2SGQE 1TQ0B 1UTOA 3O8BA 2ZFFH 4VGCB 1O3PB 1MU6B 1F5LA 4OGYA 1UK4A 2G51A 1P04A 1BHXF 3SW2B 3K6ZA 3PMAB 1O2HA 1RGQA 3GY6A 1C1OA 1V2OT 1SGEE 2B0FA 1AVWA 2ESTE 2QCYA 4WF8A 4BTUB 1PYTD 3QGNB 1SLWB 1OSSA 4CRAA 5A8XA 2UWPA 1DT2A 1SOZA 1T32A 4XFQA 1TQ7B 4I8GA 5EW2H 2ZU4A 3MU1A 2QIQA 1JIMA 4UONA 1SGFA 2GMTC 1O39A 2Q6FA 4ABGA 3OX7U 3KHVA 3QDZB 1TPOA 4O9VA 3L6PA 2C3SA 2XXLA 4NZQA 4Q7YA 2H5DA 2FS9A 3QGJA 1C5XB 4BTIB 2ZU1A 4OS6A 2ILNA 2ZTYA 1XVOA 1F7ZA 1Y3UA 2BQ7B 3SV6A 1XM1A 3EA8A 1O3HA 1C1TA 2VJ1A 3KQCA 2GDEH 1HUTH 2H1UA 3OU0A 2ZC9H 5DK1A 2JKHA 4KTCA 1P57B 4CRCA 2QXJA 2F9NA 1PQAA 2WUBA 3ZVAA 1AVGH 3TPIZ 1P03A 4BOHA 1GCTC 3SI3H 1DLEA 4AFUA 2IJOB 3T29A 4B74A 2JH0D 4YESB 1OWHA 3EGKH 3BV9B 1IQIA 1LHCH 1T4VH 4TWYA 1MTNC 1TBZH 1O3MA 1UVUH 1TONA 1KLJH 1S6FA 2AH4X 3IWMA 4YLQH 2A32A 1D9IA 1GI9B 4MQAA 1E34B 2VIPA 3LC3A 1C4U2 1O2KA 4WXIA 5CE1A 4Y79A 2M5TA 3LGVA 3MOCA 1DPOA 3RXAA 2XNIA 3FZZA 3VFEA 1AUJA 1OP8A 1HGTH 1SGCA 2Y81A 3VB7A 1MH0A 1FLEE 1SGDE 3M3TA 2O8TA 1LDTT 3ZZ3A 1SOTA 2RA0A 2A31A 4ZXXH 1HAHH 1Z1IA 1Q31A 3ZVFA 1GI8B 1XUHA 1UVOA 2WV4A 2BDYA 1RTFB 4MPWA 5ESTE 3SHCH 2F91A 4Q2KA 5FAHA 4CRGA 2A7HA 1LVBA 1DS2E 1TRYA 1P2JA 1A61H 3SNAA 2SGPE 2FOAA 1H8IH 7KMEH 1TNKA 4CHAB 2ZGCA 3E8LA 3S7HB 1KDQB 4MVNA 3JZ2B 1A2CH 1SQTA 1BZXE 1MMJN 2D8WA 2TBSA 1GI4A 3ITIA 6CHAB 1EP5A 4Q7XA 1TE0A 2B8OH 3TK9A 4R0IA 1HLTH 1K1IA 1P06A 1V2MT 2BXTH 2GCHF 5TJXA 4WXVA 2GCTB 2TIOA 2ZCKP 5SGAE 1CT2E 1WCZA 3TVJB 1DY9A 1YPHE 2ZWLH 1V2KT 2PR3A 1CGHA 4WH8A 2F9BH 1C5YB 2WPMS 4D76A 4YM9A 1YPLH 2OD3B 2ZCLP 1MKXH 1O2LA 2HPPH 1N8OC 2FM2A 3RC4A 1Z71A 5DP8A 5GJ4B 2BZ6H 1C5MD 1A4WH 1BTZA 2GD4B 2XWAA 1LKAA 2J38A 2GKVE 1SFQB 1GL0E 1BTUA 3O8CA 3URDA 3SOSA 4MNWA 1HAVA 3BEIB 1BMLA 1ZSJA 1S81A 3UNRA 1TMBH 1DSTA 1Z6JH 2BDGA 3V3MA 1W0ZU 1KSNA 2Z7FE 1QRZA 1WYKA 4B2AA 1TRMA 1FY5A 1H8DH 3CS0A 4TY6A 3BG4C 4F49A 3LGYA 3GYMA 3UREA 5AF9H 1BMAA 1FUJA 3SU4A 4E7NA 1TPAE 1EZSC 2G8TA 2RDLA 4CR5A 4I7YH 1DUAA 5LPFA 1GBHA 3P8NA 4D9RA 4JYTA 5EU8A 3RXFA 1V2LT 3PO1B 4FUDA 1BBRH 4JMYA 1MKXK 3MO6A 1KTTB 1GWAA 3LGWA 1TWXB 2F9VA 2R3UA 4GSOA 4NIXA 2STBE 3MHWU 1IQMA 5GIBA 1IQJA 4NFEA 4YOIA 4K8YA 1O2YA 2Y6TA 1W7GH 1OYTH 4BAOB 3ESTA 4IC6A 1W12U 3UFAA 1C2IA 1GBAA 1CT4E 1GVKB 2D2DA 2FOCA 2XWBI 1C2GA 4J2YB 2QC2A 3A82A 2BY6X 4B2CA 3SUGA 1EPTC 4AB9A 2XW9A 4I32A 4NSVA 3LJOA 3P6ZB 2ZNKH 1C1PA 4D8NA 1ARBA 4JZEH 1TGCA 1AO5A 4KGAA 3AAUA 1DWCH 3MNXA 5AFZH 1OXGA 2W5EA 3SJKA 1OWJA 2QN5T 2Q1JA 1BBRK 1TB6H 2GTBA 2BXUH 1HRTH 3LT3A 2Y80A 2AIQA 3RXUA 1TNIA 3UUZA 2ZDVH 1GMCF 1FY4A 1TGSZ 1XUIA 3ATMA 1RRKA 3TGJE 1KXDA 4JYVH 2EI8A 4GHTA 2OBOA 2G81E 2OC8A 5E8EH 1O37A 3TJUA 4CH2B 3LOXA 1JOUB 4Y8XA 2YNBA 5AFYH 1IQNA 1PPCE 4K3JA 1UVTH 2GZ8A 5CHAB 3MFJA 2O8UA 1FIZA 2BVRH 2F9UA 3IITA 1OWDA 2XBWA 1D3TB 1MTVA 1GI0A 5LGOA 3ZZ8A 2OQ5A 3VPKA 1C5WB 6GCHG 4IMQA 1VCWA 4UEHH 3UY9A 1M9UA 5FPTA 4DOQA 2LPRA 2STAE 1FAKH 2Y7ZA 1SLXB 1W7XH 2F9OA 3RXDA 1O2XA 1SGYE 2BTCE 1CHOG 2HNTE 2HRVA 3V0XA 2NU2E 3A86A 2FI3E 4DIIH 3NUMA 1S5SA 4DGJA 1HAGE 1IQKA 4OS4A 5FX5A 2AIPA 3DT0H 2QXHA 4THNH 2SNVA 4E06H 1KXCA 3SU5A 2H9EH 1ZHRA 3M3SA 1K28D 3RXMA 2ZP0H 3B8JA 3SV7A 3BIUH 2GP9B 8GCHG 1D4PB 3RXKA 1QJ1B 1WU1A 1HJAB 5DP3A 1T4UH 2PV9B 1ZTKA 1LVMA 1YYY1 4JZ1A 3E6PH 2BMGB 4FU7A 1AE5A 2A5AA 3GCTG 1KXAA 1TBQH 4KKDA 1CGIE 4UD9H 1PPZA 4I8JA 1O3GA 1AGJA 2QYIA 4BNRA 3C1KA 5AHGH 2J94A 1ZRBA 2BVXH 2GX4A 1ZPBA 3RXRA 1DLKB 2ZHQH 1ELEE 3ZYEA 3KQBA 4AFQA 5JBBS 1EJMA 2W3IA 1K1MA 7GCHG 1P9UA 1QIXB 3PWCA 1TALA 1DXPA 1QQUA 5JDUB 1S84A 1W10U 1O3FA 3SU6A 4K1EA 4F4OC 1WV7H 1MTWA 1O30A 5GCHF 3UPEA 3F9EA 4LXBH 1LQEA 3SV9A 3ZZ9A 4GLYA 1ZHPA 1AB9C 1LQDB 1Y3XA 2BLOA 2R0LA 1AVXA 1SLVB 1GI1A 5TCAA 1EATA 1QJ7B 1QL9A 3BEUA 2C4FH 3M35A 4X1PU 3VB5A 1IAUA 4K1TA 2J4IA 3P17H 1G3DA 4JZDH 3TH2H 1UO6A 3VB3A 5FPYA 2WPHS 4AGKA 1HAYB 4ZMAH 3D62A 1O2JA 3WY8A 4MDSA 1NU7B 1WAYB 3H7OA 2UUYA 1SGFG 1P0SH 1ESBA 1FY1A 3A85A 4ABHA 1V2UT 1ABJH 1BITA 2FIRH 2GT7A 2WYJA 1Z8RA 2FO9A 1O5AB 3RLYH 4DT7B 1X7AC 1QRXA 1V2NT 1GMHG 4RN6A 2GMTB 2OTVA 1Y5BT 2G5NA 1J16A 3A87A 3HK6B 5E2PA 1P2NA 3RMLH 2WYGA 3A7ZA 3HGPA 3VB6A 5EG4A 3U98H 3TNSA 1EXFA 2J34A 3RU4D 4ZAEA 3T27A 1CHGA 1ZLRA 2ZU5A 1GI7B 5IDKA 5DGJA 1PQ8A 3ATLA 1UVPA 4OGXA 1ZSLA 3FANA 4H4FA 1GJ9B 1XUFA 2JETB 3D23A 1LTOA 1QFKH 1J8AA 1O2GH 2FZZA 1W8BH 4ABAA 1BMNH 1J15A 3MI4A 3MNSA 4CRFA 5DO4H 4IN1A 2HOBA 2B5TB 3BTDE 4BXWA 2LNCA 3QZRA 3RXEA 3UR9A 2SFAA 3L3TA 2Z9KA 1GHWH 1O5EH 1C9PA 1AU8A 5DP5A 2F3CE 1ZPCA 1MTNB 2VGCC 5C5OA 5B6OA 1BUIA 1BRAA 2Z9JA 1TABE 2Z9LA 2FP7B 3A83A 1O5FH 2FLRH 1BTYA 1Q3XA 5HM9A 4SGAE 4NIYA 1TLDA 2VVVA 1B7XB 1C4V2 1O3EA 1TIOA 2PKSC 3SORA 1GL1A 1QURH 3K6YA 3GDVA 2FWWA 1C5SA 4YT6H 2PGBB 1YLCA 1Y3YA 4KTUA 3UIRA 2D1JA 1S85A 3RXVA 2BY5X 4KTSA 3M3VA 3R0FA 4X2VA 3ZZAA 3RXPA 2ZGBH 3VXEH 3RMMH 1O2PA 1SQOA 2G5VA 3ZZCA 1MZAA 1WSSH 1GHBF 1F0RA 1O0DH 1Z8JB 1VITH 4GVUA 4BANB 3A8DA 3A8CA 2V6NA 3SGAE 4AX9H 1PPEE 2A4GA 1A0JA 1AFQB 2EI7A 1A1RA 4DY7B 4Y10E 1F0TA 5F8XA 2ZDKA 3GCNA 1AI8H 1CSOE 5IYTA 1GJ7B 1TGTA 1RFNA 1RXPA 1ZR0A 4NIVA 3PTBA 4X6PA 3M7TA 1EZXC 5A2MH 2SGFE 2I6QA 6ESTA 4ZHMU 1YPGH 2R2WU 1LHFH 1P09A 4H6TA 1QL7A 3BTME 1UK3A 2HALA 1C1QA 4TWWA 4YLUA 3SBKA 1ETTH 1EASA 3E1XB 3JZ1B 4NSYA 4X0WU 2A2QH 4ZH8A 2A1DB 2NWNA 3ZVDA 4AG1A 3I29A 1VJAU 2GCHG 1NM6A 4TY7A 4B2BA 1GJBB 4H42U 3LU9B 1BTPA 3RXGA 1W3CA 3LC5A 1C5PA 3GISB 1WTGH 1ZRKA 1W14U 2DUCA 3E16B 1UCYH 1H4WA 4UDWH 3P8GA 3HATH 5LH8A 1OP0A 1TFXA 1KDQA 3RM2H 1C5VA 3EAJA 2XC4A 5EODA 4XBDA 1XXDA 3UR6A 1O38A 5L2YH 4FU9A 2QA9E 3RMNH 3OYPA 1C2MA 3NKKA 2A4RA 1AD8H 3RUOA 1TGBA 1B0EA 2HLCA 1H1BA 1SSXA 1BMMH 1N6XA 1C2DA 1EB2A 2THFB 1ANEA 4AOQA 1G3CA 2XC0A 4X1SU 3A88A 1L4DA 2W7SA 3GCHB 2YOLA 1GHYH 1G3EA 1QA0A 1GJDB 1BB0B 2AFQB 2WPIS 4IC5A 2O8WA 1C5ZB 2NU0E 3CENA 5K7RA 1UCYK 5HYOA 1RTLA 3T25A 3SGBE 1MKWH 1ZJDA 1CA8B 3BEFB 4Q80A 1DITH 3CP7A 4CBOA 3PMHB 3MU5A 2SGDE 1H9HE 3SU1A 2Z94A 1K9OE 1YBWA 4OS2A 1OYQA 1LVOA 1VITF 1MZDA 4K69A 5DP4A 1K1OA 4WH6A 2FYQA 5EQSA 3NCLA 1FZZA 5EOKA 1FV9A 3SV2H 1EPTB 1Y5AT 2WPLS 5DP6A 4U01A 1RS0A 1GG6B 4YO9A 2WPJS 5DG6A 4XDEA 1DICA 4Z6AH 3ATWA 1NTPA 1O3NA 3TLOA 1BOQA 1PQ7A 1GGDC 2ALVA 1UHBA 1YF4A 3Q00A 5J4SA 3GY8A 4DCDA 1BDAA 1FMGA 2J95A 3LGUA 3A8AA 1ESAA 1MKWK 3MH7A 4UFDH 2FYRA 1HCGA 1O2IA 3E91A 4A1XA 1SGPE 2OCVB 3S69A 1QBNA 2C8ZB 1P01A 2BDBA 4X6MA 1FY3A 4FUEA 3S0NA 3O8RA 5FX6A 2Y5GA 2FMJA 2P8OC 2VWNA 2AGEX 2PTNA 4B75A 2GVFA 1DM4B 1GHZA 1O5BB 3ELAH 1YGCH 2ZCHP 3RC6A 1P3CA 4Y11E 1TNJA 1L1JA 1NPMA 4BXSA 3SQHE 1UK2A 3MH4A 4MPUA 1NFUA 2BDHA 2OUAA 1SPJA 2BD5A 1C2LA 3M36A 5C1UA 2VINA 3URCA 3EDXB 1UTQA 1CE5A 3DFJA 1OOKB 1GBIA 4M7GA 1KXFA 1P2OA 1V2TT 2HNTF 3LDXH 1OP2A 3BIVH 2H6MA 2UWLA 4XE4A 2CGAA 3SGQE 2WINI 2J2UA 4JYUH 4VGCC 3RXSA 1CGJE 2P93A 2ODYB 2ZPRA 3FVFB 3VGCC 2OXSA 1O2OA 2ZHDA 2SGEE 1CBWC 5JBTA 5BPEA 3S9AA 3MO3A 1KTSB 4IBLH 4X2XA 4INKA 1V3XA 1MU8B 3SUDA 3RU4T 1WTHD 4HI3A 1O5GH 3TU7H 3U1JB 3PV4A 2ZDMA 1A5GH 2GV6A 4MLFB 4J1YA 2PWXA 2ANMH 2A7CA 5FBEA 1AKSB 2RA3A 5T6DA 1O5DH 3KNXA 8ESTE 2VU8E 2BDCA 4GUXA 1SGRE 1LVYA 2FOBA 4CRDA 2G4TA 4IN2A 4XBBA 2OC0A 2ZI2H 4AZ2B 4LOYH 4AFSA 2P3FH 2P3TB 2VWLA 5GCHG 3U8OH 4GHQA 2XYAA 1GMDG 1ELFA 3AW1A 3P8OA 3PLKA 3W95A 1QA7A 1AZ8A 4TYDA 2AEIH 1W0YH 1OWKA 4NIWA 1O3DA 2BQWB 5JYIA 3QZQA 4K5ZA 2BLVA 5C67A 2SGAA 3OY5U 3RXIA 2W7UA 4A6LA 1YKTA 3OTJE 1G2MA 1CVWH 2R9PA 4O97A 4X6NA 5LPRA 4CBNA 3RU4E 1NZQH 1ZTJA 5I46H 4Y7BA 1QTFA 3DFLA 1UTJA 3A7YA 5A8ZA 1SR5C 2HVXA 1C5UA 1O2SA 3MU0A 3HKJB 1CA0B 1O32A 4JZFH 1HJ9A 1ELCA 3T2NA 2PFEA 4ZKOU 3MNBA 2ZF0H 2BM2A 2Z9IA 3DA9B 2ZDLA 3EQ0H 1AFEH 3AAVA 1P11E 3EYDA 1K2I1 4ISHH 1TA6A 1TAWA 3SJIA 1A3EH 1ELGA 1P05A 5L2ZH 2GT8A 2F9PA 3LH1A 1DVAH 3RDZA 1HAZB 1O31A 2CV3A 2Y7XA 2G4UA 3SU0A 2BD2A 1QCPA 2QF3A 2CHAB 5C1YA 1QY6A 3S9CA 5A8YA 5J4QA 1TMUH 3BTTE 1DWBH 3M5MA 4WJG2 1V2JT 2B7DH 1G36A 2EEKA 1UJ1A 2DE8A 4AGJA 2FDAA 3KL6A 1S82A 3U9AH 1MCTA 4X8TH 1K21H 3ATIA 1EAWA 1DWEH 5EQQA 1FN8A 3F6UH 1SB1H 2H9TH 1P3EA 1AY6H 3P92A 1T8NA 1VGCB 1WQVH 1FY8E 3ODFA 1QBOA 4ASHA 3ZVEA 4AB8A 1RD3B 1F2SE 5EPNA 3M37A 4BTTB 1NO9H 1MBQA 6CHAC 1HAVB 1G9IE 1MQ5A 1O2UA 1T7CA 3F1SB 2BD9A 1LPKB 3V13A 2ZTZA 2PKSB 4YZUA 1EAUA 1UTLM 1HAXB 1MAXA 1JMOH 4FUHA 3U1IB 1YLDA 1QHRB 4DURA 1Y5UT 1YPHC 3LKWA 1P8VC 2BY9X 3ZV9A 2FTMA 1MAYA 4B71A 4CH8B 1W11U 2ZU2A 1O3LA 1LHDH 4E7RG 1OWIA 1V2ST 2XCNA 2O8LA 1MCVA 4X2YA 2JH5D 1TPSA 2ZFSA 2ZHWH 3U8RH 1EUFA 3BF6H 1EP6A 8LPRA 5E2OA 3GICB 2XC5A 3G01A 1XKBC 3GY4A 2BD3A 3Q3KA 4R8TB 2A2XH 1E35B 1GJ6A 1ZMNA 2FOFA 1GHBG 3RXJA 1IQLA 2AS9A 2OP9A 1GBTA 1HPGA 4B76A 2VH6A 4ABIA 3F9GA 1SVPA 2OC1A 3MH5A 1DFPA 1IQHA 4U30A 5EQRA 1C5LH 1C1NA 3A89A 1ANBA 3LGIA 1LHGH 1IQEA 1FJSA 1C1VH 1MD8A 1D3DB 3P95A 3D49H 1G37A 3V12A 3QN7A 4ZXYH 3K2UA 4I8LA 3TH4H 1PQ5A 4WMFA 1GHAG 1SG8B 1MD7A 1C1WH 3AVZA 4I31A 4Y0ZE 4K2YA
chains in the Genus database with same CATH superfamily
3STJA 7LPRA 3SHAH 1S6HA 2BYAX 3OSYA 4X8SH 1EJAA 4NZLA 1J17T 1KXBA 2AYWA 1O3BA 1XVMA 1GBEA 2NU4E 3SNEA 3RM0H 4INLA 3SUEA 1HAPH 3TNTA 4D7FA 1O2MA 2BOKA 1O5CB 1GI2A 2JH6D 2PW8H 1OX1A 3BTEE 2QGRA 5CDFE 4JZIA 1INCA 2HGTH 1LKBA 3BSQA 4AN7A 3RXHA 3A7TA 1TX7A 2FS8A 3RXTA 3ZZ4A 2O8MA 3FAOA 2PKAA 5EGMA 1FPHH 1THPB 1IQFA 1A3BH 1P9SA 4PROA 4UFEH 4Y8ZA 3PB1E 2PLXA 2FI4E 5A09A 1ZJKA 1YC0A 4LZ1H 5F8ZA 3UQOA 2BD7A 1F5RA 3I78A 3EA7A 5ESBA 1SGTA 1S83A 5HMAA 4YOJA 1AN1E 1GJ8B 2BQ6B 1Z7KA 2A4QA 4A7IB 1ZPZA 1GCTB 1C4Y2 2XBYA 5GXPA 3PM3A 1ZMJA 1QR3E 2BVSH 2QXIA 1ELTA 4MNXA 3UWIA 4IW4E 5CHAC 1OKXA 4XD7D 3UNQA 6GCHF 2CF9H 2QE7D 3VEQB 1O2WA 1SI5H 1GDQA 3LGTA 3UTUH 1BTWA 1BTHH 2W26A 2BZAA 1IQGA 3TITA 1SC8U 4AYVB 3OEHD 1EAIA 3NZIA 4X1RU 1CHOF 6LPRA 2C90B 1G32B 4B6EA 1P2QA 1FXYA 5EPYA 5HGGA 4CREA 3I77A 2WPKS 4X6OA 1QBVH 1VITG 3S9BA 1A46H 3H7TA 2AGGX 1GBBA 2HNTC 1O2QA 1KLTA 3A81A 5AVDA 1TA2A 1RIWC 2K8IA 3FFGA 1O2TA 4Q63A 1BA8B 2CXVA 1DXWA 4E05H 2FTLE 2Z3DA 1PPBH 2J97A 2WZQA 1PFXC 3PMBB 1FQ3A 2AMPA 3GY7A 3OTPA 4HGCA 1O3JA 4Y76A 1BJVA 1LMWB 2KAIB 3GDSA 5A0AE 1GBMA 1FAXA 3GCTF 4RKOB 1UMAH 1NRNH 2R0KA 4ISNA 3GY2A 4KELA 4OS5A 2R3YA 3MNCA 3MYWA 2OQUA 4ZHAA 2D26C 2ZQ1A 3SI4H 4Y0YE 3LIWA 1ORFA 4ISIH 1BCUH 1NY22 1NU9A 3ZZ6A 1NRPH 3PRDA 1XUKA 3K9XB 1F0SA 2BY7X 2ZEBA 2ZFTA 2ZIQH 1BTXA 1K1PA 1VCPA 4AORA 1G2LA 2FODA 3L33A 1WUNH 5DP7A 1Y59T 2FOMB 1F0UA 8KME2 1RJXB 2BX4A 1MUEB 1VJ9U 1PYTC 2ZGHA 2C8YB 4A92A 5C1XA 1DUEA 3FZDA 4SGBE 1OPHB 1N8OB 3B23B 3M5OA 1ANCA 1FX0B 3SNBA 1QRWA 1TOMH 1Y3WA 2VWOA 1K22H 1NFYA 2UWOA 4ZKSU 2AMQA 1S0QA 3A7VA 4ABBA 1MBMA 1H9IE 3EA9A 1O3AA 1OWEA 5EJLA 3VGCB 3UWJH 2BY8X 2KM0A 2OBQA 2ZDAH 1CBWB 5DPAA 2UUJB 2QV1A 3U8TH 3KF2A 1ZZZA 1GMHF 1UTMA 1YCPM 3PMJA 1PJPA 1DWDH 4MTBA 4MNVA 1SKYE 3T28A 3BG4B 3UB0A 1ID5H 2TRMA 1O34A 1DANH 2BLQA 1TOCB 5GDSH 2ZFQH 4AG2A 1VCQA 1YWUA 3A7WA 1O35A 1GI6A 1EZQA 3E90B 1SHHB 2ZA5A 3KIDU 3D65E 2VVCA 4A5TS 2W3KA 1FPCH 2ZFRH 3K65B 1HAOH 1HIAB 2ZG0H 1XMNB 1XX9A 2BLWA 3LPRA 1SGQE 3ENSB 3RMOH 4ABEA 1FIWA 2FX6A 3LH3A 3OY6U 3P8FA 3ZZDA 3TK5A 3A80A 5JB9S 3BTQE 4O3TA 2JETC 2PSYA 1O2VA 4GCHF 2HWLB 5LPEA 1AQ7A 1XKAC 5PTPA 3RXOA 1PPFE 2PHBA 1ELBA 1P10A 3PV2A 4K1SA 2NU1E 2TGTA 2BD4A 1NT1A 2TGAA 2PUQH 1YPMH 3ATKA 4LK4A 5F03A 1LHEH 2Y5FA 4GAWA 2OK5A 1ETRH 3BTGE 1K1LA 1C2FA 3STIA 4GPGA 1ELDE 1AKSA 2BB4A 4BAMB 1BT7A 1P2KA 1ARCA 1GBJA 1K1NA 3PV5A 4Y6DA 1GBKA 2FLBH 3PYHA 2FX4A 1EZUC 4JK5A 1V2PT 2ZECA 4NA8A 4WMDA 2YMSC 3KN2A 4FUFA 1P2IA 1E37B 2J98B 1GBCA 3H5CB 1YPEH 1F5KU 1Y3VA 1Z1JA 1KLIH 3PRBA 1GJ5H 1FONA 5K0HA 3E0PB 1Z8IB 2F43B 3F68H 1ETSH 3A8BA 1CT0E 1O2ZA 2RCEA 3MTYA 1KY9A 1C5OH 2FESH 2FOEA 4OS7A 3HKIB 4U32A 1SGNE 3S7KB 1AUTC 4FVBA 1GMCG 2QXGA 1ACBE 2G52A 3TGKE 1A0HB 2ZGJA 3M5LA 1SGIB 1UTKA 2GZ7A 1HNEE 4IGDA 4B1TA 1KXEA 1WOFA 4MPVA 1D3PB 1CU1A 1ZYOA 5EXNA 2Q6DA 3Q77A 5FPSA 5GPIB 2ZTXA 1LPGB 2CK3D 2P16A 5C20A 1TX6A 3A7XA 1UTPA 2CN0H 2Y5HA 3NK8A 3NXPA 3FP7E 2WUCA 2A45B 3HK3B 3KEEA 1NS3A 1TBRH 3QK1A 1GHXH 1CQQA 2ZZUH 3CS7A 3RC5A 1AFQC 1ELAA 5DKMA 3OAAD 2ZDNA 1S6LA 1DX5M 4KP0A 1NRSH 1Z6EA 1O3KA 4ZUHA 3ZZ7A 3SU3A 1KIGH 2PUXB 5C2ZA 1H9LB 1TNLA 1FN6A 4ZKRU 3HGNA 5DP9A 1QQ4A 1ESTA 5H4IB 1A7SA 1KYNA 1YPKH 3N7DA 2G55A 2TPIZ 3OEED 2ZPQA 2QAAA 1T8MA 3B9FH 1A5IA 3EE0B 3VB4A 1C1UH 9LPRA 2H9HA 2OLGA 1BHXB 2ZPSA 1ZTLA 1P02A 2PSXA 1J14A 1ELVA 3QTOH 4NA7A 4HFPB 2XRCA 1HXEH 3SQEE 2ZU3A 5EW1H 2VIOA 1HJ8A 1NFXA 1QGFA 3C27B 2A5IA 4RKJB 1O36A 3A84A 1W0JD 2FI5E 5C5NA 3GOVB 3KQEA 5CMXH 1C5QA 3MQKC 1U6QA 1EAXA 5A0CA 4YOGA 3RP2A 1GDUA 1O3CA 5DJ7A 2PTCE 4D7GA 4AFZA 1ABIH 3LONA 4D9QA 1SLUB 4FUGA 5T6FA 1L2EA 1W2KH 1GVZA 3BTKE 5EXMA 1NRRH 2TGDA 3W94A 1FDPA 2P94A 5JPMH 4DVAU 2ZKSA 1ZGVA 1EKBB 1AB9B 1XXFA 2P59A 3T5FH 1QJ6B 3V7TA 4AYYB 4JCNA 5DN6D 1SHYA 2GGVB 1NFWA 2VNTA 2EI6A 1TYNA 1SFIA 2ZFPH 1G30B 4TPIZ 3T26A 3BTFE 4ABFA 2WSSD 4FUCA 4FXGH 1BIOA 4NG9H 3GCHC 4BAHB 1HV7A 4I8KA 4ZROA 4Y8YA 1GI3A 1UHBB 3GY5A 2O9QA 2V0BA 3UOPA 1QB1A 1HBTH 3E0NB 2CF8H 1C2KA 2VIQA 3NPSA 3FP8E 4U2WA 3SO3A 1N1LA 3RXQA 4Q4LA 1TNGA 3QO6A 4INHA 2V3OH 2DE9A 3RLWH 1C5NH 3RXLA 1AMHA 2EC9H 2ZGXH 3SUFA 2ODQA 2P3UB 2BD8A 5E0GA 5HM2A 1WBGB 1HB0B 1P2MA 3U69H 1GG6C 3RXCA 1DY8A 1LO6A 1GVLA 3ZYDA 3SJ9A 1WQSA 1SMFE 1GDNA 3FP6E 3E3TA 4X8UH 1RTKA 4OS1A 1A0LA 1L0ZA 4FUBA 3MU4A 1XUGA 1W13U 3BTWE 1L4ZA 2FXRA 1BJUA 2VWMA 1JRTA 2PGQB 4X1QU 4ABDA 2V35A 2ALPA 4QT8C 1UCYE 5L30H 1QNJA 2AHME 1HYLA 5FXLA 2Z3CA 3ZVCA 4UFFH 3TJVA 1YPJH 1YM0A 1DSUA 1C5TA 2SNWA 2ODPA 4H6SB 4YTAA 5A0BA 3LJJA 1OS8A 2L74A 2C8WB 2OC7A 3MMGA 1QL8A 4O03A 4CHAC 2R2MB 1JWTA 1PPHE 2RG3A 2VGCB 5FCKA 3VG8A 1C9TA 1NROH 1LPZB 1DE7H 1P12E 1HAIH 3Q3YA 1HXFH 1GJAB 3KGPA 3UNSA 2FOHA 2VVUA 4LZ4B 1D3QB 1KMHB 4XSKU 1JRSA 2AGIX 1Z8GA 3HPTB 2B9LA 3SNCA 3PLBA 3P70B 3TJNA 2BX3A 1O2RA 1AHTH 2ANYA 1D6WA 2GCTC 4NWKA 4BAQB 1NRQH 1T31A 5TCCA 1RIWB 1GJ4H 1JBUH 1HDTH 1O3OA 2VH0A 3QUMP 1GI5A 4FU8A 1Y8TA 1EOLA 1VZQH 2G00A 3ODDA 3ZV8A 1YCPH 3MH6A 4WMEA 3TK6A 5FBIA 1S0RA 5F6MA 1T8LA 2IPHA 2V7QD 5ABWA 2XCFA 2QF4A 1IHTH 3IG6B 9ESTA 4DJZB 4K8BA 4WY3A 3BTHE 4RI0A 3ZZ5A 1E38B 4DT4A 1FNIA 4TPYA 1C2EA 5CHBA 3PROA 5F8TA 1B0FA 1AE8H 1HFDA 4YT7H 2EA3A 2F83A 2VIDA 4K60A 1MTUA 4HTCH 1BRCE 3PTNA 2J92A 4HG6A 1Q2WA 4X8VH 2OINA 1THRH 3PO1C 1QZ8A 2KAIA 2QY0B 3RXBA 5G4BA 3PLPA 1GMDF 1JXPA 1YCPK 3M5NA 1AWHB 2Y82A 1D6RA 3PWBA 5T3HA 5ETXA 3F2HA 3GYLB 1ZMLA 3SZNA 4UFGH 4I8HA 1ZHMA 3DD2H 5E0JA 4ZKNU 3M7UA 2A7JA 1NBMD 1WXRA 2VIWA 1EOJA 3MO9A 4Y7AA 3GCOA 4NGAH 5GWZA 2ANKH 2UUFB 1E0FD 2FOGA 1SBWA 3UOUA 4ESTE 4NCYA 3Q3XA 4ISLA 2H2ZA 3UQVA 1QB9A 1C2HA 2C8XB 4JK6A 1A5HA 1V6DA 2CMYA 5JBCS 1K1JA 2P95A 2ZHFH 4CR9A 5JBAS 1CO7E 3SN8A 1B5GH 2NU3E 1LCYA 1GHVH 1BQYA 3M7QA 4WWYA 3NWUA 4NWLA 1GCDA 4Y71A 4NA9H 1C2JA 1C1SA 3QTVH 4DIHH 3SYJA 1EQ9A 1CA0C 1TX8A 2GJGA 5HIZA 1EJNA 4A1TA 3MU8A 3VXFH 3BN9A 2K1QA 2GDDA 1C1RA 4DW2U 3BG8A 5T6GA 5C17A 3AW0A 2XBXA 2FEQH 1SQAA 1THSH 2A0QB 1E36B 4MNYA 4CRBA 4ZHLU 1TNHA 2BDIA 2BOHB 2VB0A 3SJ8A 3SNDA 2GV7A 5JB8S 3TGIE 5E0HA 3QLPH 2WV5A 3ZVBA 1L1NA 1G3BA 1GBDA 2V3HH 4RSPA 3ZVGA 2CHAC 5C3NA 1ZSKA 4X2WA 3F9HA 4XOJA 1TRNA 3Q76A 1C1MA 1N6YA 3KQDA 5FHTA 3DHKH 4FUIA 4IS5A 4Q7ZA 2KCAA 4GCHG 4ISOA 4FVDA 7ESTE 1MQ6A 5HKKD 1XUJA 2VIVA 4UE7H 4MPXA 3TH3H 1GJCB 1JIRA 4X1NU 3ZZBA 1AZZA 2Q6GA 1SL3A 1HIAA 1VGCC 3DUXH 2ZO3H 3SV8A 3TJOA 1H8ED 1AIXH 3AASA 1FI8A 1IOEA 4NFFA 3GY3A 1BBRE 4WVPE 4HZHA 1GGDB 3SU2A 1ANDA 4XBCA 3TIUA 1C5RA 2ULLA 5EXLA 3M61U 4B73A 8GCHF 1DDJA 2GZ9A 3T62A 1TMTH 2Z9GA 1AWFH 1V2WT 1E1QD 1NC6A 1IHSH 3O8DA 1MTSA 4FUJA 1HJAC 3QX5H 5BRRE 1E79D 2BHGA 2CJIA 4I33A 2BDAA 1ZGIA 2C93B 1NESE 1GBFA 2AMDA 5I25A 1EPTA 2J9NA 2I6SA 4DG4A 5HXFA 4IMZA 5HIYA 1BRBE 3N7OA 1GPZA 2P8OB 2QF0A 1UTNA 7GCHF 2Z3EA 2HPQH 2IOTA 4BAKB 5L6NH 2AERH 1TGNA 2A4OA 5FCRA 2J98A 1L1GA 2Z6BD 3QWCH 3SJOA 2FPZA 3R3GB 1EX3A 1UVSH 2TGPZ 4A1VA 1O2NA 3GDUA 1NN6A 1O33A 1O3IA 3KCGH 3FKSD 1PPGE 4MG3A 1J9CH 1F92A 1T8OA 2ASUB 1DOJA 1H8HD 1V2RT 2UUKB 2XBVA 1QB6A 2YNAA 1TPPA 3NRLA 1V2QT 4FOUC 4ABJA 1VR1H 1EFRD 3F9FA 1GBLA 4O3UA 4Z0KA 2ZQ2A 1YP9A 2H5CA 1ZOMA 3MWIU 1V2VT 2ZHEH 2A5KA 1BRUP 2IN2A 2PKAB 1GHAF 1EB1H 2ANWA 2XTTB 2SGQE 1TQ0B 1UTOA 3O8BA 2ZFFH 4VGCB 1O3PB 1MU6B 1F5LA 4OGYA 1UK4A 2G51A 1P04A 1BHXF 3SW2B 3K6ZA 3PMAB 1O2HA 1RGQA 3GY6A 1C1OA 1V2OT 1SGEE 2B0FA 1AVWA 2ESTE 3F2FA 2QCYA 4WF8A 4BTUB 1PYTD 5EJ1A 3QGNB 1SLWB 1OSSA 4CRAA 5A8XA 2UWPA 1DT2A 1SOZA 1T32A 4XFQA 1TQ7B 4I8GA 5EW2H 2ZU4A 3MU1A 2QIQA 1JIMA 4UONA 1SGFA 2GMTC 1O39A 2Q6FA 4ABGA 3OX7U 3KHVA 3QDZB 1TPOA 4O9VA 3L6PA 2C3SA 2XXLA 4NZQA 4Q7YA 2H5DA 2FS9A 3QGJA 1C5XB 4BTIB 2ZU1A 4OS6A 2ILNA 2ZTYA 1XVOA 1F7ZA 1Y3UA 2BQ7B 3SV6A 1XM1A 3EA8A 1O3HA 1C1TA 2VJ1A 3H09A 3KQCA 2GDEH 1HUTH 2H1UA 3CNRA 3OU0A 2ZC9H 5KEDA 5DK1A 2JKHA 4KTCA 1P57B 4CRCA 2QXJA 2F9NA 1PQAA 2WUBA 3DCLA 3ZVAA 1AVGH 3TPIZ 1P03A 4BOHA 1GCTC 3SI3H 1DLEA 4AFUA 3N99A 3DSPA 2IJOB 3T29A 4B74A 5DSFA 2JH0D 4YESB 4F48B 1OWHA 3EGKH 3BV9B 1IQIA 1LHCH 1T4VH 3F0PA 4TWYA 1MTNC 1TBZH 1O3MA 1UVUH 1TONA 1KLJH 1S6FA 2AH4X 3IWMA 4YLQH 2A32A 1D9IA 1GI9B 4MQAA 1E34B 2RFKC 2VIPA 3N7EA 3LC3A 2KR7A 1C4U2 1O2KA 4WXIA 5CE1A 4Y79A 2M5TA 3LGVA 3MOCA 1DPOA 3RXAA 2XNIA 3FZZA 3VFEA 1AUJA 1OP8A 1HGTH 1SGCA 2Y81A 3VB7A 1E1RD 1MH0A 1FLEE 1SGDE 3M3TA 2O8TA 1LDTT 2YMSD 3ZZ3A 1SOTA 2RA0A 2A31A 4ZXXH 1HAHH 1Z1IA 1Q31A 3ZVFA 1GI8B 1XUHA 1UVOA 2WV4A 2BDYA 1RTFB 4MPWA 5ESTE 3SHCH 2F91A 4Q2KA 5FAHA 3FO8D 4CRGA 2A7HA 1LVBA 1DS2E 1TRYA 1P2JA 1A61H 3SNAA 2SGPE 2FOAA 1H8IH 7KMEH 1TNKA 4CHAB 2ZGCA 3E8LA 3S7HB 1KDQB 4MVNA 3JZ2B 1A2CH 1SQTA 1BZXE 1MMJN 2D8WA 2TBSA 1GI4A 3ITIA 6CHAB 1EP5A 4Q7XA 1TE0A 2B8OH 3TK9A 2V3MA 4R0IA 1HLTH 1K1IA 1P06A 1V2MT 2BXTH 2GCHF 5TJXA 4WXVA 3F3BA 2GCTB 2TIOA 2ZCKP 5SGAE 1CT2E 1WCZA 3TVJB 1DY9A 1YPHE 2ZWLH 1V2KT 2PR3A 1CGHA 4WH8A 2F9BH 3ZIAD 1C5YB 2WPMS 4D76A 4YM9A 1YPLH 2OD3B 2ZCLP 1MKXH 1O2LA 2VBCA 2HPPH 1N8OC 2K0QA 2FM2A 3RC4A 1Z71A 5DP8A 5GJ4B 2BZ6H 1C5MD 1A4WH 1BTZA 2GD4B 2XWAA 1LKAA 2J38A 2GKVE 1SFQB 1GL0E 1BTUA 3O8CA 3URDA 3SOSA 4MNWA 1HAVA 3BEIB 1BMLA 1ZSJA 1S81A 3UNRA 1TMBH 2KZ4A 1DSTA 1Z6JH 2BDGA 3V3MA 1W0ZU 1KSNA 2Z7FE 1QRZA 3F2GA 1WYKA 4B2AA 1NBME 1TRMA 1FY5A 1H8DH 3CS0A 4TY6A 2HVYB 3BG4C 4F49A 3LGYA 3GYMA 3UREA 5AF9H 1BMAA 1FUJA 3SU4A 4E7NA 1TPAE 1EZSC 2G8TA 2RDLA 4CR5A 4I7YH 1DUAA 5LPFA 1GBHA 3P8NA 4D9RA 4JYTA 5EU8A 3RXFA 1V2LT 3PO1B 4FUDA 1BBRH 4JMYA 1MKXK 3MO6A 1KTTB 1GWAA 1VKYA 3LGWA 1TWXB 2F9VA 2R3UA 4GSOA 4NIXA 2STBE 3MHWU 1IQMA 5GIBA 1IQJA 4M9FA 4NFEA 4YOIA 4K8YA 1O2YA 2Y6TA 1W7GH 1OYTH 4BAOB 3ESTA 2PP6A 4IC6A 1W12U 3UFAA 1C2IA 4ASUD 1GBAA 1CT4E 1GVKB 2D2DA 2FOCA 2XWBI 1C2GA 4J2YB 2QC2A 3A82A 2BY6X 4B2CA 3SUGA 4FETA 1K0HA 1EPTC 4AB9A 2XW9A 4I32A 4NSVA 5IK2D 3LJOA 3P6ZB 2ZNKH 1C1PA 4D8NA 1ARBA 4JZEH 1TGCA 3KQ5A 1AO5A 4KGAA 3AAUA 1DWCH 3MNXA 5AFZH 1OXGA 2W5EA 3SJKA 1OWJA 2QN5T 2Q1JA 1BBRK 1TB6H 2GTBA 2BXUH 1HRTH 3LT3A 2Y80A 2AIQA 3RXUA 1TNIA 3UUZA 2ZDVH 1GMCF 1FY4A 1TGSZ 1XUIA 3ATMA 1RRKA 3TGJE 1KXDA 4JYVH 2EI8A 4GHTA 2OBOA 2G81E 2OC8A 5E8EH 1O37A 3TJUA 4CH2B 3LOXA 1JOUB 4Y8XA 2YNBA 5AFYH 1IQNA 1PPCE 4K3JA 1UVTH 2GZ8A 5CHAB 3MFJA 2O8UA 1FIZA 2BVRH 2F9UA 3IITA 1OWDA 2XBWA 2XOKD 1D3TB 4ACAA 1MTVA 1GI0A 5LGOA 3ZZ8A 2OQ5A 3VPKA 1C5WB 6GCHG 4IMQA 1VCWA 4UEHH 3UY9A 1M9UA 5FPTA 4DOQA 2LPRA 2STAE 1FAKH 2Y7ZA 1SLXB 1W7XH 2F9OA 3RXDA 1O2XA 1SGYE 2BTCE 1CHOG 2HNTE 2HRVA 3V0XA 2NU2E 3A86A 2FI3E 4DIIH 3NUMA 1S5SA 4DGJA 1HAGE 1IQKA 4OS4A 5FX5A 2AIPA 3DT0H 4OM9A 2QXHA 4THNH 2SNVA 4E06H 1KXCA 3SU5A 2H9EH 1ZHRA 3M3SA 1K28D 2IPQX 3RXMA 2ZP0H 3B8JA 3SV7A 3BIUH 2GP9B 8GCHG 1D4PB 3RXKA 1QJ1B 1WU1A 1HJAB 5DP3A 1T4UH 2PV9B 1ZTKA 1LVMA 1YYY1 4I86A 4JZ1A 3E6PH 2BMGB 4FU7A 1AE5A 2A5AA 3GCTG 1KXAA 1TBQH 4KKDA 2LP6A 1CGIE 4UD9H 1PPZA 4I8JA 1O3GA 1AGJA 3UAIC 2QYIA 4BNRA 3C1KA 5AHGH 2J94A 1ZRBA 2BVXH 2GX4A 1ZPBA 3RXRA 1DLKB 2ZHQH 1ELEE 3ZYEA 3KQBA 4AFQA 5JBBS 1EJMA 2W3IA 1K1MA 7GCHG 1P9UA 1QIXB 3PWCA 1TALA 1DXPA 1QQUA 5JDUB 1S84A 5EJZA 1W10U 1O3FA 5C0TA 3SU6A 4K1EA 4F4OC 1WV7H 1MTWA 1O30A 2HLDD 5GCHF 4YXWD 3UPEA 3F9EA 4LXBH 1LQEA 3SV9A 3ZZ9A 4GLYA 1ZHPA 1AB9C 1LQDB 1Y3XA 2BLOA 2R0LA 3FOAA 1AVXA 1SLVB 2JJ2D 1GI1A 5TCAA 1EATA 1QJ7B 1QL9A 3BEUA 2C4FH 3M35A 4X1PU 3VB5A 1IAUA 4K1TA 2J4IA 3P17H 1G3DA 4JZDH 3TH2H 1UO6A 3VB3A 5FPYA 2WPHS 2IJD1 4AGKA 1HAYB 4ZMAH 3D62A 1O2JA 3WY8A 4MDSA 1NU7B 1WAYB 3H7OA 2UUYA 1SGFG 4RT1A 4B6FA 1P0SH 1ESBA 1FY1A 3A85A 4ABHA 1V2UT 1ABJH 1BITA 2FIRH 2GT7A 2WYJA 1Z8RA 2FO9A 1O5AB 3RLYH 4DT7B 1X7AC 1QRXA 1V2NT 2F4LA 1GMHG 4RN6A 2GMTB 2OTVA 1Y5BT 2G5NA 1J16A 3A87A 3HK6B 5E2PA 1P2NA 1UW7A 3RMLH 2WYGA 3A7ZA 3HGPA 3VB6A 5EG4A 3U98H 3TNSA 1EXFA 2J34A 3RU4D 4ZAEA 3T27A 1CHGA 1ZLRA 2ZU5A 1GI7B 5IDKA 5DGJA 1PQ8A 3ATLA 1UVPA 4OGXA 1ZSLA 3FANA 4H4FA 1GJ9B 1XUFA 2JETB 3D23A 1LTOA 1QFKH 1J8AA 1O2GH 2FZZA 1W8BH 4ABAA 1BMNH 1J15A 3MI4A 3MNSA 4CRFA 3SZEA 5DO4H 4IN1A 2HOBA 2WPDD 2B5TB 3BTDE 4BXWA 2LNCA 3QZRA 3RXEA 3UR9A 2SFAA 2RDEA 5F53A 3L3TA 2Z9KA 2M2AA 1GHWH 1O5EH 1C9PA 1AU8A 5DP5A 2F3CE 5KGOA 1ZPCA 2W6ID 1MTNB 2VGCC 5C5OA 5B6OA 2YMSB 1BUIA 1BRAA 2Z9JA 1TABE 2Z9LA 2JDID 2KCYA 2FP7B 3A83A 1O5FH 2FLRH 1BTYA 1Q3XA 5HM9A 3OFND 4SGAE 4NIYA 1TLDA 2VVVA 4F55A 1B7XB 1C4V2 1O3EA 1TIOA 2PKSC 3SORA 1GL1A 1QURH 3K6YA 3GDVA 2FWWA 1C5SA 3EE7A 2PGBB 4YT6H 1YLCA 1Y3YA 2WHXA 4KTUA 3UIRA 2D1JA 1S85A 3RXVA 2BY5X 4KTSA 3M3VA 3R0FA 4X2VA 3ZZAA 3RXPA 2ZGBH 3VXEH 3RMMH 1O2PA 2JJ1D 1SQOA 2G5VA 3ZZCA 1MZAA 4TT3D 1WSSH 1GHBF 1F0RA 1O0DH 1Z8JB 1VITH 4GVUA 4BANB 3A8DA 3A8CA 2V6NA 3SGAE 4AX9H 1PPEE 2A4GA 1A0JA 1AFQB 2EI7A 1A1RA 4DY7B 4Y10E 1F0TA 5F8XA 5FL7D 2ZDKA 3GCNA 1AI8H 1CSOE 5IYTA 1GJ7B 1TGTA 1RFNA 3U28C 1RXPA 1ZR0A 4NIVA 3PTBA 4X6PA 3M7TA 1EZXC 5A2MH 2SGFE 2I6QA 6ESTA 3KYFA 4ZHMU 1YPGH 2R2WU 1LHFH 1P09A 4H6TA 4P02A 1QL7A 3BTME 1UK3A 2HALA 1C1QA 4TWWA 4YLUA 3SBKA 1ETTH 1EASA 3E1XB 3JZ1B 4NSYA 4X0WU 2A2QH 4ZH8A 2A1DB 2NWNA 4ZCNA 3ZVDA 4AG1A 3I29A 1VJAU 2GCHG 1NM6A 4TY7A 4B2BA 1GJBB 4H42U 3LU9B 1BTPA 3RXGA 1W3CA 3LC5A 1C5PA 3GISB 1WTGH 1ZRKA 1W14U 2DUCA 3E16B 1UCYH 1H4WA 4UDWH 3P8GA 2KCPA 3HATH 5LH8A 1OP0A 1TFXA 1KDQA 3RM2H 5EIYA 1C5VA 3EAJA 2XC4A 5EODA 4XBDA 1XXDA 3UR6A 1O38A 5L2YH 3DSOA 4XRNA 2W6JD 4FU9A 2QA9E 2LELA 3RMNH 3OYPA 1C2MA 3NKKA 2A4RA 1AD8H 1BMFD 3RUOA 1TGBA 1B0EA 2HLCA 1H1BA 1SSXA 1BMMH 1N6XA 1C2DA 1EB2A 2THFB 1ANEA 2L6OA 4AOQA 1G3CA 2XC0A 4X1SU 3A88A 1L4DA 2W7SA 3GCHB 2YOLA 1GHYH 1G3EA 1QA0A 1GJDB 1BB0B 2AFQB 2WPIS 4IC5A 2O8WA 1C5ZB 2NU0E 3CENA 5K7RA 1UCYK 5HYOA 1RTLA 3T25A 3SGBE 1MKWH 1ZJDA 1CA8B 2J5UA 3BEFB 4Q80A 3AK5A 1DITH 3CP7A 4CBOA 3PMHB 3MU5A 2SGDE 1H9HE 3SU1A 2Z94A 1K9OE 1YBWA 4OS2A 1OYQA 1LVOA 1VITF 1MZDA 4K69A 5DP4A 1K1OA 4WH6A 2FYQA 5EQSA 3NCLA 1FZZA 5EOKA 1FV9A 3SV2H 1EPTB 1Y5AT 2WPLS 5DP6A 4U01A 1RS0A 1GG6B 4YO9A 2WPJS 5DG6A 4XDEA 1DICA 4Z6AH 3ATWA 3WW7A 1NTPA 1O3NA 3TLOA 1BOQA 1PQ7A 1GGDC 2ALVA 1UHBA 2EY4C 1YF4A 3Q00A 2KFWA 2XNDD 5J4SA 3GY8A 3W1EA 4DCDA 1BDAA 1FMGA 2J95A 3LGUA 3KYGA 3A8AA 1ESAA 1MKWK 3MH7A 4UFDH 2FYRA 1HCGA 1O2IA 3E91A 2KCOA 4A1XA 1SGPE 2OCVB 3S69A 1QBNA 1WDIA 2C8ZB 1P01A 2BDBA 4X6MA 1FY3A 4FUEA 3WWFA 3S0NA 1YLNA 3O8RA 5FX6A 2Y5GA 2FMJA 2P8OC 2VWNA 2AGEX 2PTNA 4B75A 2GVFA 4Z1MD 1OHHD 1DM4B 1GHZA 1O5BB 3ELAH 1YGCH 2ZCHP 3RC6A 1P3CA 4Y11E 1TNJA 3DSGA 1L1JA 1NPMA 4BXSA 3SQHE 1UK2A 5C0UA 3MH4A 4MPUA 1NFUA 2BDHA 2OUAA 1SPJA 5GNDA 2BD5A 1C2LA 3M36A 5C1UA 2VINA 3URCA 2JIZD 3EDXB 1UTQA 1CE5A 3DFJA 1OOKB 1GBIA 4M7GA 3WWBA 1KXFA 1P2OA 1V2TT 2HNTF 3LDXH 1OP2A 3BIVH 2H6MA 2UWLA 4XE4A 2CGAA 3SGQE 2WINI 2J2UA 4JYUH 4VGCC 3RXSA 1CGJE 2P93A 2ODYB 2ZPRA 3FVFB 3VGCC 2OXSA 1O2OA 2ZHDA 1SQRA 2SGEE 1CBWC 5JBTA 5BPEA 3S9AA 3MO3A 1KTSB 4IBLH 4X2XA 4INKA 1V3XA 1MU8B 3SUDA 3RU4T 1WTHD 4HI3A 1O5GH 3TU7H 5B6LA 3U1JB 3PV4A 2ZDMA 1A5GH 2GV6A 4MLFB 4J1YA 2PWXA 2ANMH 2A7CA 5FBEA 1AKSB 2RA3A 5T6DA 1O5DH 3KNXA 8ESTE 2VU8E 2BDCA 4GUXA 1SGRE 1LVYA 2FOBA 4CRDA 2G4TA 4IN2A 4XBBA 2OC0A 2ZI2H 4AZ2B 4LOYH 4AFSA 2P3FH 2P3TB 2VWLA 5GCHG 3U8OH 4GHQA 2XYAA 1GMDG 1ELFA 3AW1A 3P8OA 3PLKA 3W95A 1QA7A 1AZ8A 4TYDA 2AEIH 1W0YH 1OWKA 4NIWA 1O3DA 1YY3A 2BQWB 3QZQA 5JYIA 4K5ZA 2BLVA 5C67A 2SGAA 4P00A 3OY5U 3RXIA 2W7UA 4A6LA 1YKTA 3F0OA 3OTJE 1G2MA 1CVWH 2R9PA 4O97A 4X6NA 2QF5A 5LPRA 4CBNA 3RU4E 1NZQH 1ZTJA 5I46H 4Y7BA 1QTFA 3DFLA 1UTJA 3A7YA 5A8ZA 1SR5C 2HVXA 1C5UA 1O2SA 3MU0A 3HKJB 1CA0B 1O32A 4JZFH 1HJ9A 1ELCA 3OE7D 2PFEA 3T2NA 4ZKOU 3MNBA 2ZF0H 2BM2A 2Z9IA 3DA9B 2ZDLA 3EQ0H 1AFEH 3AAVA 1P11E 3EYDA 5KECA 1K2I1 4ISHH 1TA6A 1TAWA 3SJIA 1A3EH 1ELGA 1P05A 5L2ZH 2GT8A 2F9PA 3LH1A 1DVAH 3RDZA 1HAZB 1O31A 1COWD 2CV3A 2Y7XA 2G4UA 3SU0A 2BD2A 1QCPA 2QF3A 2CHAB 5C1YA 1QY6A 3S9CA 5A8YA 5J4QA 1TMUH 3BTTE 1DWBH 3M5MA 4WJG2 1V2JT 5C94A 2B7DH 1G36A 2EEKA 1UJ1A 2DE8A 4AGJA 2FDAA 3KL6A 1S82A 3U9AH 1MCTA 4X8TH 1K21H 3ATIA 1EAWA 1DWEH 5EQQA 1FN8A 3FN8A 3F6UH 1SB1H 2H9TH 4ACBA 1P3EA 1AY6H 3P92A 1T8NA 1VGCB 1WQVH 1FY8E 3ODFA 1QBOA 4ASHA 3ZVEA 4AB8A 1RD3B 1F2SE 5EPNA 3M37A 4BTTB 1NO9H 1MBQA 6CHAC 1HAVB 1G9IE 1MQ5A 1O2UA 1T7CA 3F1SB 2BD9A 1LPKB 3V13A 2ZTZA 2PKSB 4YZUA 2KX4A 1EAUA 1UTLM 1HAXB 1MAXA 1JMOH 4FUHA 3U1IB 1YLDA 1QHRB 4DURA 1Y5UT 1YPHC 3LKWA 1P8VC 2EQNA 2BY9X 3ZV9A 2FTMA 1MAYA 4B71A 4CH8B 1W11U 2ZU2A 1O3LA 1LHDH 4E7RG 1OWIA 1V2ST 2XCNA 2O8LA 1MCVA 4X2YA 2JH5D 1TPSA 2ZFSA 2ZHWH 3U8RH 4AC9A 1EUFA 3BF6H 1EP6A 8LPRA 5E2OA 3GICB 2XC5A 1W0KD 3G01A 1XKBC 3GY4A 2BD3A 3Q3KA 4R8TB 2A2XH 1E35B 1GJ6A 1ZMNA 2FOFA 4TSFD 1GHBG 3RXJA 1IQLA 5T1VA 3GS9A 2AS9A 2OP9A 1GBTA 1HPGA 4B76A 2VH6A 4ABIA 3F9GA 1SVPA 2OC1A 3MH5A 1DFPA 1IQHA 4U30A 5EQRA 1C5LH 1C1NA 3A89A 1ANBA 3LGIA 1LHGH 1IQEA 1FJSA 2WV9A 1C1VH 1MD8A 1D3DB 3P95A 3D49H 1G37A 3V12A 3QN7A 4RT0A 4ZXYH 3K2UA 4I8LA 1MABB 3TH4H 1PQ5A 4WMFA 1GHAG 1SG8B 1MD7A 1C1WH 3AVZA 4I31A 4Y0ZE 4K2YA
chains in the Genus database with same CATH topology
3STJA 7LPRA 3SHAH 1S6HA 2BYAX 3OSYA 4X8SH 1EJAA 4NZLA 1J17T 1KXBA 2AYWA 1O3BA 1XVMA 1GBEA 2NU4E 3SNEA 3RM0H 4INLA 3SUEA 1HAPH 3TNTA 4D7FA 1O2MA 2BOKA 1O5CB 1GI2A 2JH6D 2PW8H 1OX1A 3BTEE 2QGRA 4JZIA 1INCA 2HGTH 1LKBA 3BSQA 4AN7A 3RXHA 3A7TA 1TX7A 2FS8A 3RXTA 3ZZ4A 2O8MA 3FAOA 2PKAA 5EGMA 1FPHH 1THPB 1IQFA 1A3BH 1P9SA 4PROA 4UFEH 4Y8ZA 3PB1E 2PLXA 2FI4E 5A09A 1ZJKA 1YC0A 4LZ1H 5F8ZA 3UQOA 2BD7A 1F5RA 3I78A 3EA7A 5ESBA 1SGTA 1S83A 5HMAA 4YOJA 1AN1E 1GJ8B 2BQ6B 1Z7KA 2A4QA 4A7IB 1ZPZA 1GCTB 1C4Y2 2XBYA 5GXPA 3PM3A 1ZMJA 1QR3E 2BVSH 2QXIA 1ELTA 4MNXA 3UWIA 4IW4E 5CHAC 1OKXA 3UNQA 6GCHF 2CF9H 3VEQB 1O2WA 1SI5H 1GDQA 3LGTA 3UTUH 1BTWA 1BTHH 2W26A 2BZAA 1IQGA 3TITA 1SC8U 4AYVB 4X1RU 1EAIA 3NZIA 6LPRA 1CHOF 2C90B 1G32B 1P2QA 1FXYA 5EPYA 5HGGA 4CREA 3I77A 2WPKS 4X6OA 1QBVH 1VITG 3S9BA 1A46H 3H7TA 2AGGX 1GBBA 2HNTC 1O2QA 1KLTA 3A81A 5AVDA 1TA2A 1RIWC 3FFGA 1O2TA 1BA8B 2CXVA 1DXWA 4E05H 2FTLE 2Z3DA 1PPBH 1PFXC 3PMBB 1FQ3A 2AMPA 3GY7A 4HGCA 1O3JA 4Y76A 1BJVA 1LMWB 2KAIB 3GDSA 5A0AE 1GBMA 1FAXA 3GCTF 4RKOB 1UMAH 1NRNH 2R0KA 4ISNA 3GY2A 4KELA 4OS5A 2R3YA 3MNCA 3MYWA 2OQUA 4ZHAA 2D26C 2ZQ1A 3SI4H 4Y0YE 3LIWA 1ORFA 4ISIH 1BCUH 1NY22 1NU9A 3ZZ6A 1NRPH 1XUKA 3K9XB 1F0SA 2BY7X 2ZEBA 2ZFTA 2ZIQH 1BTXA 1K1PA 1VCPA 4AORA 1G2LA 2FODA 3L33A 1WUNH 5DP7A 1Y59T 2FOMB 1F0UA 8KME2 1RJXB 2BX4A 1MUEB 1VJ9U 1PYTC 2ZGHA 2C8YB 4A92A 5C1XA 1DUEA 3FZDA 4SGBE 1OPHB 1N8OB 3B23B 3M5OA 1ANCA 3SNBA 1QRWA 1TOMH 1Y3WA 2VWOA 1K22H 1NFYA 2UWOA 4ZKSU 2AMQA 1S0QA 3A7VA 4ABBA 1MBMA 1H9IE 3EA9A 1O3AA 1OWEA 3VGCB 3UWJH 2BY8X 2OBQA 2ZDAH 1CBWB 5DPAA 2UUJB 2QV1A 3U8TH 3KF2A 1ZZZA 1GMHF 1UTMA 1YCPM 3PMJA 1PJPA 1DWDH 4MTBA 4MNVA 3T28A 3BG4B 1ID5H 2TRMA 1O34A 1DANH 2BLQA 1TOCB 5GDSH 2ZFQH 4AG2A 1VCQA 3A7WA 1O35A 1GI6A 1EZQA 3E90B 1SHHB 2ZA5A 3KIDU 3D65E 2VVCA 4A5TS 2W3KA 1FPCH 2ZFRH 3K65B 1HAOH 1HIAB 2ZG0H 1XMNB 1XX9A 2BLWA 3LPRA 1SGQE 3ENSB 3RMOH 4ABEA 1FIWA 2FX6A 3LH3A 3OY6U 3P8FA 3ZZDA 3TK5A 3A80A 5JB9S 3BTQE 4O3TA 2JETC 2PSYA 1O2VA 4GCHF 2HWLB 5LPEA 1AQ7A 1XKAC 5PTPA 3RXOA 1PPFE 2PHBA 1ELBA 1P10A 4K1SA 2NU1E 2TGTA 2BD4A 1NT1A 2TGAA 2PUQH 1YPMH 3ATKA 4LK4A 5F03A 1LHEH 2Y5FA 4GAWA 1ETRH 3BTGE 1K1LA 1C2FA 3STIA 4GPGA 1ELDE 1AKSA 2BB4A 4BAMB 1BT7A 1P2KA 1ARCA 1GBJA 1K1NA 4Y6DA 1GBKA 2FLBH 3PYHA 2FX4A 1EZUC 4JK5A 1V2PT 2ZECA 4NA8A 4WMDA 3KN2A 4FUFA 1P2IA 1E37B 1GBCA 3H5CB 1YPEH 1F5KU 1Y3VA 1Z1JA 1KLIH 1GJ5H 1FONA 5K0HA 3E0PB 1Z8IB 3F68H 1ETSH 3A8BA 1CT0E 1O2ZA 2RCEA 3MTYA 1KY9A 1C5OH 2FESH 2FOEA 4OS7A 3HKIB 4U32A 1SGNE 3S7KB 1AUTC 4FVBA 1GMCG 2QXGA 1ACBE 2G52A 3TGKE 1A0HB 2ZGJA 3M5LA 1SGIB 1UTKA 2GZ7A 1HNEE 4IGDA 4B1TA 1KXEA 1WOFA 4MPVA 1D3PB 1CU1A 1ZYOA 5EXNA 2Q6DA 3Q77A 5FPSA 5GPIB 2ZTXA 1LPGB 2P16A 5C20A 1TX6A 3A7XA 1UTPA 2CN0H 2Y5HA 3NK8A 3NXPA 3FP7E 2WUCA 2A45B 3HK3B 3KEEA 1NS3A 1TBRH 3QK1A 1GHXH 1CQQA 2ZZUH 3CS7A 3RC5A 1AFQC 1ELAA 5DKMA 2ZDNA 4KP0A 1DX5M 1NRSH 1Z6EA 1O3KA 4ZUHA 3ZZ7A 3SU3A 1KIGH 2PUXB 5C2ZA 1H9LB 1TNLA 1FN6A 4ZKRU 3HGNA 5DP9A 1QQ4A 1ESTA 5H4IB 1A7SA 1KYNA 1YPKH 2G55A 2TPIZ 2ZPQA 2QAAA 1T8MA 3B9FH 1A5IA 3EE0B 3VB4A 1C1UH 9LPRA 2H9HA 2OLGA 1BHXB 2ZPSA 1ZTLA 1P02A 2PSXA 1J14A 1ELVA 3QTOH 4NA7A 4HFPB 2XRCA 1HXEH 3SQEE 2ZU3A 5EW1H 2VIOA 1HJ8A 1NFXA 1QGFA 3C27B 2A5IA 4RKJB 1O36A 3A84A 2FI5E 5C5NA 3GOVB 3KQEA 5CMXH 1C5QA 1U6QA 1EAXA 5A0CA 4YOGA 3RP2A 1GDUA 1O3CA 5DJ7A 2PTCE 4D7GA 1ABIH 3LONA 4D9QA 1SLUB 4FUGA 5T6FA 1L2EA 1W2KH 1GVZA 3BTKE 5EXMA 1NRRH 2TGDA 3W94A 1FDPA 2P94A 5JPMH 4DVAU 2ZKSA 1ZGVA 1EKBB 1AB9B 1XXFA 2P59A 3T5FH 1QJ6B 3V7TA 4AYYB 4JCNA 1SHYA 2GGVB 1NFWA 2VNTA 2EI6A 1TYNA 1SFIA 2ZFPH 1G30B 4TPIZ 3T26A 3BTFE 4ABFA 4FUCA 4FXGH 1BIOA 4NG9H 3GCHC 4BAHB 1HV7A 4I8KA 4ZROA 4Y8YA 1GI3A 1UHBB 3GY5A 2O9QA 2V0BA 3UOPA 1QB1A 1HBTH 3E0NB 2CF8H 1C2KA 2VIQA 3NPSA 3FP8E 4U2WA 3SO3A 1N1LA 3RXQA 1TNGA 3QO6A 4INHA 2V3OH 2DE9A 3RLWH 1C5NH 3RXLA 1AMHA 2EC9H 2ZGXH 3SUFA 2ODQA 2P3UB 2BD8A 5E0GA 5HM2A 1WBGB 1HB0B 1P2MA 3U69H 1GG6C 3RXCA 1DY8A 1LO6A 1GVLA 3ZYDA 3SJ9A 1WQSA 1SMFE 1GDNA 3FP6E 3E3TA 4X8UH 1RTKA 4OS1A 1A0LA 1L0ZA 4FUBA 3MU4A 1XUGA 1W13U 3BTWE 1L4ZA 2FXRA 1BJUA 2VWMA 1JRTA 2PGQB 4X1QU 4ABDA 2V35A 2ALPA 4QT8C 1UCYE 5L30H 1QNJA 1HYLA 5FXLA 2Z3CA 3ZVCA 4UFFH 3TJVA 1YPJH 1YM0A 1DSUA 1C5TA 2SNWA 2ODPA 4H6SB 4YTAA 5A0BA 3LJJA 1OS8A 2C8WB 2OC7A 3MMGA 1QL8A 4O03A 4CHAC 2R2MB 1JWTA 1PPHE 2RG3A 2VGCB 5FCKA 1C9TA 1NROH 1LPZB 1DE7H 1P12E 1HAIH 3Q3YA 1HXFH 1GJAB 3KGPA 3UNSA 2FOHA 2VVUA 4LZ4B 1D3QB 4XSKU 1JRSA 2AGIX 1Z8GA 3HPTB 2B9LA 3SNCA 3PLBA 3P70B 3TJNA 2BX3A 1O2RA 1AHTH 2ANYA 1D6WA 2GCTC 4NWKA 4BAQB 1NRQH 1T31A 5TCCA 1RIWB 1GJ4H 1JBUH 1HDTH 1O3OA 2VH0A 3QUMP 1GI5A 4FU8A 1Y8TA 1EOLA 1VZQH 2G00A 3ODDA 3ZV8A 1YCPH 3MH6A 4WMEA 3TK6A 5FBIA 1S0RA 5F6MA 1T8LA 2IPHA 5ABWA 2XCFA 1IHTH 3IG6B 9ESTA 4DJZB 4K8BA 4WY3A 3BTHE 3ZZ5A 1E38B 1FNIA 4TPYA 1C2EA 5F8TA 3PROA 1B0FA 1AE8H 1HFDA 4YT7H 2EA3A 2F83A 2VIDA 4K60A 1MTUA 4HTCH 1BRCE 3PTNA 2J92A 1Q2WA 4X8VH 2OINA 1THRH 3PO1C 2KAIA 2QY0B 3RXBA 5G4BA 3PLPA 1GMDF 1JXPA 1YCPK 3M5NA 1AWHB 2Y82A 1D6RA 3PWBA 5T3HA 5ETXA 3GYLB 1ZMLA 3SZNA 4UFGH 4I8HA 1ZHMA 3DD2H 5E0JA 4ZKNU 3M7UA 2A7JA 2VIWA 1EOJA 3MO9A 4Y7AA 3GCOA 4NGAH 5GWZA 2ANKH 2UUFB 1E0FD 2FOGA 1SBWA 3UOUA 4ESTE 4NCYA 3Q3XA 4ISLA 2H2ZA 3UQVA 1QB9A 1C2HA 2C8XB 4JK6A 1A5HA 1V6DA 2CMYA 5JBCS 1K1JA 2P95A 2ZHFH 4CR9A 5JBAS 1CO7E 3SN8A 1B5GH 2NU3E 1LCYA 1GHVH 1BQYA 3M7QA 4WWYA 3NWUA 4NWLA 1GCDA 4Y71A 4NA9H 1C2JA 1C1SA 3QTVH 4DIHH 1EQ9A 1CA0C 1TX8A 1EJNA 4A1TA 3MU8A 3VXFH 3BN9A 2K1QA 2GDDA 1C1RA 4DW2U 3BG8A 5T6GA 3AW0A 2XBXA 2FEQH 1SQAA 1THSH 2A0QB 1E36B 4MNYA 4CRBA 4ZHLU 1TNHA 2BDIA 2BOHB 2VB0A 3SJ8A 3SNDA 2GV7A 5JB8S 3TGIE 5E0HA 3QLPH 2WV5A 3ZVBA 1L1NA 1G3BA 1GBDA 2V3HH 4RSPA 3ZVGA 2CHAC 5C3NA 1ZSKA 4X2WA 3F9HA 4XOJA 1TRNA 3Q76A 1C1MA 1N6YA 3KQDA 5FHTA 3DHKH 4FUIA 4IS5A 4Q7ZA 4GCHG 4ISOA 4FVDA 7ESTE 1MQ6A 1XUJA 2VIVA 4UE7H 4MPXA 3TH3H 1GJCB 1JIRA 4X1NU 3ZZBA 1AZZA 2Q6GA 1SL3A 1HIAA 1VGCC 3DUXH 2ZO3H 3SV8A 3TJOA 1AIXH 3AASA 1FI8A 1IOEA 4NFFA 3GY3A 1BBRE 4WVPE 4HZHA 1GGDB 3SU2A 1ANDA 4XBCA 3TIUA 1C5RA 2ULLA 5EXLA 3M61U 4B73A 8GCHF 1DDJA 2GZ9A 3T62A 1TMTH 2Z9GA 1AWFH 1V2WT 1NC6A 1IHSH 3O8DA 1MTSA 4FUJA 1HJAC 3QX5H 5BRRE 2BHGA 2CJIA 4I33A 2BDAA 1ZGIA 2C93B 1NESE 1GBFA 2AMDA 5I25A 1EPTA 2J9NA 2I6SA 4DG4A 5HXFA 4IMZA 1BRBE 3N7OA 1GPZA 2P8OB 2QF0A 1UTNA 7GCHF 2Z3EA 2HPQH 2IOTA 4BAKB 5L6NH 2AERH 1TGNA 2A4OA 5FCRA 4AFZA 1L1GA 2Z6BD 3QWCH 3SJOA 2FPZA 3R3GB 1EX3A 1UVSH 2TGPZ 4A1VA 1O2NA 3GDUA 1NN6A 1O33A 1O3IA 3KCGH 1PPGE 4MG3A 1J9CH 1F92A 1T8OA 2ASUB 1DOJA 1V2RT 2UUKB 2XBVA 1QB6A 2YNAA 1TPPA 1V2QT 4ABJA 1VR1H 3F9FA 1GBLA 4O3UA 4Z0KA 2ZQ2A 1YP9A 2H5CA 1ZOMA 3MWIU 1V2VT 2ZHEH 2A5KA 1BRUP 2IN2A 2PKAB 1GHAF 1EB1H 2ANWA 2XTTB 2SGQE 1TQ0B 1UTOA 3O8BA 2ZFFH 4VGCB 1O3PB 1MU6B 1F5LA 4OGYA 1UK4A 2G51A 1P04A 1BHXF 3SW2B 3K6ZA 3PMAB 1O2HA 1RGQA 3GY6A 1C1OA 1V2OT 1SGEE 2B0FA 1AVWA 2ESTE 2QCYA 4WF8A 4BTUB 1PYTD 3QGNB 1SLWB 1OSSA 4CRAA 5A8XA 2UWPA 1DT2A 1SOZA 1T32A 4XFQA 1TQ7B 4I8GA 5EW2H 2ZU4A 3MU1A 2QIQA 1JIMA 4UONA 1SGFA 2GMTC 1O39A 2Q6FA 4ABGA 3OX7U 3KHVA 3QDZB 1TPOA 4O9VA 3L6PA 2C3SA 2XXLA 4NZQA 4Q7YA 2H5DA 2FS9A 3QGJA 1C5XB 4BTIB 2ZU1A 4OS6A 2ILNA 2ZTYA 1XVOA 1F7ZA 1Y3UA 2BQ7B 3SV6A 1XM1A 3EA8A 1O3HA 1C1TA 2VJ1A 3KQCA 2GDEH 1HUTH 2H1UA 3OU0A 2ZC9H 5DK1A 2JKHA 4KTCA 1P57B 4CRCA 2QXJA 2F9NA 1PQAA 2WUBA 3ZVAA 1AVGH 3TPIZ 1P03A 4BOHA 1GCTC 3SI3H 1DLEA 4AFUA 2IJOB 3T29A 4B74A 2JH0D 4YESB 1OWHA 3EGKH 3BV9B 1IQIA 1LHCH 1T4VH 4TWYA 1MTNC 1TBZH 1O3MA 1UVUH 1TONA 1KLJH 1S6FA 2AH4X 3IWMA 4YLQH 2A32A 1D9IA 1GI9B 4MQAA 1E34B 2VIPA 3LC3A 1C4U2 1O2KA 4WXIA 5CE1A 4Y79A 2M5TA 3LGVA 3MOCA 1DPOA 3RXAA 2XNIA 3FZZA 3VFEA 1AUJA 1OP8A 1HGTH 1SGCA 2Y81A 3VB7A 1MH0A 1FLEE 1SGDE 3M3TA 2O8TA 1LDTT 3ZZ3A 1SOTA 2RA0A 2A31A 4ZXXH 1HAHH 1Z1IA 1Q31A 3ZVFA 1GI8B 1XUHA 1UVOA 2WV4A 2BDYA 1RTFB 4MPWA 5ESTE 3SHCH 2F91A 4Q2KA 5FAHA 4CRGA 2A7HA 1LVBA 1DS2E 1TRYA 1P2JA 1A61H 3SNAA 2SGPE 2FOAA