1O2JA

Elaborate manifold of short hydrogen bond arrays mediating binding of active site-directed serine protease inhibitors
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA-TRYPSIN
publication title Elaborate Manifold of Short Hydrogen Bond Arrays Mediating Binding of Active Site-Directed Serine Protease Inhibitors
pubmed doi rcsb
molecule tags Hydrolase
total genus 53
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2003-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1o2jA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1o2jA02
4MLFB 1P3EA 2A7HA 3TGKE 2G81E 1GBAA 3BIVH 2FPZA 3FVFB 3SU0A 4UEHH 4JZIA 1HUTH 1DWEH 3RXIA 4TPIZ 1NROH 2VGCB 1IQNA 5AFZH 1GI2A 1EPTA 3QO6A 2Z6BD 2J94A 4Y79A 4NA9H 1LQEA 4XE4A 4K69A 2QXIA 5FHTA 3ZZAA 1CT2E 3VXEH 1GHXH 1F0RA 2W7UA 3RXLA 1IQHA 1C1OA 1TBRH 3ZVFA 1TBQH 2ZA5A 1CT4E 4M7GA 2GV7A 1UO6A 2G51A 1OWHA 1GG6B 4NA8A 1O2XA 1O32A 2VJ1A 1TPSA 2A31A 3RXMA 1IQIA 2ZHDA 1D3DB 1J17T 1FAKH 3U1JB 1GVZA 1LHDH 1SGRE 1A3BH 1UMAH 1RIWC 1TOMH 2BY5X 4Q7YA 1A0HB 4UFFH 1WTGH 5ESBA 1IHTH 4TY7A 2Z3EA 4AYYB 1QBNA 1V2ST 5DG6A 1W0ZU 5FCRA 3SI3H 1GBJA 4BTIB 2LPRA 1P09A 1DPOA 2FI4E 1EJAA 1DFPA 1GBKA 4Y11E 3AW1A 2PHBA 1O5DH 4O3TA 3UOPA 1QHRB 4ZHAA 1UVOA 4BOHA 1XUHA 1CO7E 3NWUA 1BTZA 1C2FA 2CN0H 2AGIX 1K21H 2FZZA 8KME2 1WSSH 5A8ZA 1BRBE 1BZXE 1NESE 1O5EH 5EU8A 1O3PB 1W8BH 3ATMA 2WPKS 3GDUA 4AFUA 2FDAA 1ZRKA 5GDSH 4JK6A 1O3EA 1OX1A 2ZPRA 3M3SA 3ATWA 1CT0E 3P8FA 1EOJA 3SV8A 1AE5A 1PYTD 2J9NA 4THNH 5CHAB 3HKJB 1O2HA 2G00A 2ULLA 2VWOA 1O2UA 5FBIA 1AU8A 3LH3A 2Q1JA 1BJUA 1AQ7A 1SLUB 4I8JA 4AG2A 1L1JA 3PMAB 3S0NA 3SU2A 1XUFA 2GZ9A 2XBXA 1T4UH 2ZCKP 1DLKB 1GCTC 3LPRA 4IC6A 3BTME 2PKSB 1BT7A 1Q31A 1G2LA 2BZAA 1CA0C 2FX6A 5GPIB 1GJ5H 1NFUA 1NPMA 3EA7A 1BBRE 2FP7B 1BBRH 1C5RA 1KDQB 3BEIB 1AFQC 1C1RA 3SV6A 1TMBH 1LVMA 2Y5GA 1DANH 3FAOA 3E6PH 3PMJA 1G3CA 4YT6H 3T25A 1C4V2 1WYKA 4OS7A 1AB9B 4AFSA 2ZDKA 3RC4A 4ZKOU 1NRNH 9LPRA 2ZFQH 1W7GH 4AZ2B 1D4PB 1P04A 7ESTE 3FZDA 3P8OA 2ANYA 4CRDA 1QB6A 4MPWA 2F91A 2HPPH 3ATKA 1FJSA 2WYJA 1S6HA 1E0FD 3ODDA 2ZHQH 3ZVDA 3BTTE 2OINA 4J1YA 1FY8E 2JH6D 2P3FH 5E0GA 1O3KA 3C27B 4JYUH 2ZTXA 1LHGH 1O3LA 1O3CA 3AW0A 4UDWH 1OWJA 4HFPB 1AHTH 2JKHA 1YPJH 1HAOH 1FXYA 4X1RU 2ALPA 1H9HE 1EATA 3E0PB 4WH8A 1TNHA 4TY6A 1ELAA 1NFYA 1JRTA 1P02A 3QUMP 1C5ZB 3F1SB 1NRPH 1YPGH 1DSTA 3RXBA 1IHSH 1YPMH 2UUJB 2UUYA 1ZRBA 1TA6A 3MI4A 3QTOH 4GHQA 2D26C 1FPCH 1HBTH 3P6ZB 1V2VT 3RMOH 3SHCH 1KTTB 1UCYK 1C2GA 1EJMA 1C4Y2 2Y7ZA 1A0LA 3L33A 1A7SA 5JBAS 5K0HA 1TFXA 1MTWA 1A5IA 1EAIA 1LO6A 4OS1A 4I8LA 5HM9A 3UPEA 3E1XB 2JETC 3D62A 1ZSJA 3ZVBA 1V2UT 1P10A 1O39A 3ELAH 5JB8S 1DITH 1O3NA 1O3MA 1GBEA 3A80A 3SI4H 1QURH 4GLYA 1F5LA 4U01A 1OWDA 1SR5C 2ANWA 3PMHB 5GJ4B 2D1JA 2OUAA 5FX5A 1GL0E 4UONA 2AS9A 3HK6B 3PLBA 1UTLM 1KXDA 1A5HA 4B73A 2ZEBA 2GMTB 1AMHA 2CHAB 2QXJA 3E16B 1KYNA 3ZVGA 2VGCC 2OLGA 4X6NA 3VB4A 4ISLA 4MQAA 3LGTA 2ZTYA 5E0JA 4XSKU 1C1MA 1S82A 2BQWB 1HJ9A 1X7AC 1NS3A 1BB0B 1MTSA 5E2OA 1IQKA 3MHWU 4X6PA 1WU1A 2HNTC 1ETRH 3NUMA 5GIBA 3ZZDA 3TGIE 1K1JA 4AGKA 4DW2U 1GG6C 4ISHH 1CU1A 2CF9H 5A0BA 3PWCA 5T6FA 2W26A 1EXFA 4AB9A 1C2MA 5HM2A 3LONA 5EODA 2ZCHP 3BIUH 3LJOA 1P05A 1GI0A 4ZHMU 4ABEA 3F9HA 3TU7H 1XVOA 1TPOA 1FAXA 2A5IA 2TBSA 5C3NA 2H9EH 3PTNA 1TNLA 1MZAA 2SFAA 4B1TA 1LPGB 1L2EA 3RXDA 3NXPA 4ISIH 5A8XA 1TRNA 1K2I1 2Q6DA 3UWIA 2RCEA 4X2XA 1TLDA 3H7TA 1C5VA 4DOQA 1EQ9A 2Z9IA 1P2JA 3V3MA 1QL7A 4Z0KA 1ZLRA 1KDQA 4Q80A 5T6DA 2AIPA 1YLDA 2VVVA 3KN2A 2HNTE 2PW8H 3M35A 3LGWA 4INLA 1SOTA 1ZZZA 3IWMA 2XBVA 1GHAG 2VB0A 1ORFA 1G3DA 1EAUA 1ARCA 4CRGA 1OS8A 4Q7XA 4Y76A 1SVPA 4OS6A 2HLCA 2FOEA 2Q6FA 2J4IA 1Y3VA 1G9IE 2CJIA 2BDIA 1J14A 5JPMH 1XUGA 1ELVA 1SQTA 1W11U 1XMNB 1TGTA 2A4OA 1MBQA 1ZPZA 3U9AH 5CHAC 1ELGA 1HYLA 1GBFA 5LPEA 1D6RA 1O3IA 1V2NT 1PPGE 1AIXH 1DLEA 5CE1A 2VIDA 1FDPA 4ZKSU 2BY6X 1QL9A 1Z8RA 3BG4B 5JBTA 1TONA 1BTUA 1C1VH 4MNXA 4NIVA 4JMYA 4AX9H 1LQDB 1GBHA 1TABE 1J8AA 1UTOA 3P8GA 4YOJA 5FX6A 1UVTH 4NSYA 2PKSC 1S85A 5DP9A 3HGNA 1GVLA 2ZGCA 1FY5A 1NC6A 1KTSB 1ZJKA 1AE8H 3KHVA 3K2UA 3U8RH 3FP7E 4B71A 3SQHE 1N6YA 2Y6TA 1EB2A 4GVUA 1C2JA 1NU9A 1AB9C 4X1QU 5EW2H 1FY1A 2WUCA 1UK2A 1BTXA 2RA0A 1LPZB 5LPFA 1E34B 5TCAA 2ZIQH 1INCA 5ETXA 2AERH 1OYQA 5A8YA 4LOYH 1TGSZ 1ZMNA 1L0ZA 5FBEA 1GPZA 2BHGA 3TIUA 3MO9A 4HGCA 4ZKNU 1EAXA 1B0EA 1GMHG 4K2YA 2OTVA 1O0DH 3SV9A 2C8WB 2BOKA 1XX9A 5JBBS 5L6NH 1GCTB 3SU5A 1GI6A 1TWXB 1Y3UA 1MU6B 1QCPA 1V2WT 1TMTH 1JOUB 3RXHA 2P94A 2QV1A 3GY4A 4TWWA 3SO3A 1BHXB 4NWKA 1O5CB 3MTYA 3S7HB 4JYVH 1HNEE 4AOQA 2AH4X 5EXLA 4CH8B 1S84A 2ZCLP 1C2IA 1NFWA 1GMHF 1GBMA 3GDSA 1BMAA 2NU4E 1SLWB 2PFEA 2VVUA 3DD2H 1GHYH 1YCPK 4MPXA 2ANKH 3PROA 2R9PA 2OQ5A 2OXSA 3ZYEA 1ZHPA 1Y3WA 2A4QA 1V2JT 2WPJS 3A7WA 2AIQA 1GJ9B 3MOCA 3MMGA 1GCDA 1PPCE 2H5DA 2VIOA 1XUIA 2BZ6H 4Y7AA 1SSXA 4WWYA 2O8WA 3RXEA 2J2UA 1ZJDA 3ZZ5A 2TGPZ 4WMFA 4LK4A 1TPAE 1UK4A 5A0CA 2ZDAH 1GJAB 2BD3A 1Y8TA 3RXGA 1Z8GA 1QQ4A 2HPQH 1YP9A 3OY6U 2GT8A 4JCNA 2BY7X 1W10U 1GI9B 1NM6A 2FOGA 1C2DA 3QK1A 2SNVA 1C1PA 3TH3H 1SMFE 2BD2A 1DS2E 2CHAC 1W12U 4KELA 2PV9B 3Q3XA 2BDAA 5F8XA 1AI8H 1BUIA 4ABGA 2Y82A 1TX7A 3GOVB 1V2OT 1SGFA 1GGDB 4YT7H 1T8MA 3FP8E 1SL3A 3MWIU 1UTPA 2XNIA 1O2KA 1NO9H 3M3VA 4WJG2 1Z8JB 3M7QA 1HGTH 2CGAA 2VIVA 1BTHH 1VR1H 3ESTA 1DSUA 2F9UA 1K22H 1O33A 2AMDA 1AGJA 1UTNA 1GBIA 4IMQA 1FI8A 3DFJA 2B5TB 3ZYDA 3VB3A 3PLPA 1OP8A 1V2KT 1B7XB 3SJ9A 4B2AA 4Y0ZE 1CE5A 1UCYE 1YF4A 3OY5U 1C5SA 1UCYH 4NA7A 1XM1A 4RSPA 3C1KA 3MNCA 1V2TT 3F9EA 3GICB 3QN7A 3EE0B 1O2RA 4YZUA 1FIWA 1WQVH 1MAYA 1ETTH 2ZFPH 1V2RT 2OD3B 2F9VA 1IQJA 3BTFE 3M5MA 2EC9H 1WV7H 2ZGXH 1O2WA 1KXEA 3UY9A 3P92A 4X6MA 3ZZ9A 1YPLH 2QF0A 3HPTB 4DJZB 1CBWB 1HXFH 2ZU5A 3VGCC 1QB9A 1QL8A 5DJ7A 1DY8A 4INHA 2ALVA 2ODPA 1E36B 3A88A 4Y8YA 1VJ9U 2GVFA 2XBYA 2GP9B 2PSYA 1O36A 1F0UA 2A45B 1MD7A 4X1NU 3SNDA 3FFGA 1BMMH 2O9QA 2P8OB 3BN9A 4J2YB 1LKBA 1A1RA 1V2PT 3SBKA 1BMLA 1YPHC 3KF2A 5GXPA 4DGJA 3Q3KA 4OS5A 3N7OA 4K8BA 2ZQ1A 3KCGH 3RC5A 3BG4C 2HNTF 1MTVA 2BOHB 3LT3A 1FY4A 2ODYB 3SZNA 4NSVA 1TYNA 2OBQA 2H6MA 1C1TA 2B8OH 2QN5T 2XW9A 1S6FA 1QBVH 1AKSB 1GBCA 1C2HA 4AGJA 1SPJA 3RU4E 1GDUA 2BDYA 1TGNA 3D49H 2SGEE 2R0KA 3MH5A 1AD8H 2NU1E 1ZHRA 2Z9GA 2Z9JA 1YCPM 5I25A 2EI6A 3UFAA 2QGRA 2AGGX 2LNCA 1O2QA 3HK3B 1XVMA 3A7XA 5F6MA 1DT2A 2GCTC 4R8TB 1ZMLA 3L6PA 1MBMA 1K28D 2G5NA 3GCNA 2QCYA 1O2NA 3BTKE 3LKWA 4CRFA 3CP7A 4NGAH 3SHAH 2BDCA 2BX3A 1ESBA 4NWLA 2FM2A 3A7VA 4XOJA 4Y8XA 1AFEH 1AO5A 2FMJA 2DE8A 4X2VA 3RXJA 4INKA 1A46H 4F4OC 1SHYA 1GHZA 1TIOA 1YYY1 2R3UA 3SUFA 2RG3A 4I31A 3UNSA 3VFEA 5F8TA 2AYWA 1GI7B 5DP5A 3VB5A 4IN2A 3SGBE 1ANBA 4NFFA 3PV4A 1TE0A 3MU1A 1ELTA 4MNVA 4ZAEA 5T3HA 4BXSA 1S0RA 2QF3A 1HAHH 4BAKB 1XXDA 3T27A 3RM0H 1YM0A 2IN2A 2BX4A 1TB6H 1XKAC 3D65E 1Q2WA 1FN6A 3HATH 2ILNA 1W7XH 2PSXA 2A2QH 5A2MH 1DUEA 4FVBA 3A8CA 3A8AA 1XXFA 1ELCA 3SU6A 1O30A 1ELFA 1ABIH 1UHBB 1O3AA 1QY6A 3SNAA 4BAQB 3BTHE 1HAGE 3RXQA 1HAXB 1QB1A 5F8ZA 1H9IE 5BRRE 2C8YB 3KL6A 1TMUH 1T8LA 5HMAA 2QAAA 4E7NA 5CMXH 1RJXB 4ZROA 1C1SA 5EXNA 2VIWA 1DWDH 2A4GA 2ZC9H 3SOSA 1NY22 2BMGB 3H7OA 3ZZ7A 5T6GA 3ZVCA 1MKWK 4DIHH 4ZXYH 2ZFSA 3EYDA 2M5TA 2SGAA 3LOXA 4U30A 3U8OH 1TQ7B 5BPEA 2FX4A 4CH2B 3RXOA 2DUCA 1C5PA 1O3FA 3LGIA 8ESTE 4F49A 3TGJE 1RGQA 3ZZ4A 4ZUHA 1HLTH 8LPRA 1AZZA 1GGDC 2PTCE 4ABBA 4Y8ZA 3SW2B 1ZYOA 1GI3A 1QRWA 2D2DA 3E8LA 5F03A 3UWJH 2ZFRH 8GCHG 1HDTH 1W14U 1PFXC 2FOHA 4I8GA 4BAMB 1HAIH 2R2MB 3UR9A 5I46H 1KSNA 2P3UB 1C5XB 3ZZ6A 1YCPH 2QC2A 1ZOMA 1ZSLA 1SFIA 1TNJA 3RXFA 2NWNA 4QT8C 3LDXH 4IGDA 3PMBB 1DE7H 1OWKA 3A7TA 4D76A 3KNXA 2GX4A 3A8DA 2ZGHA 1F2SE 1O3HA 1C4U2 1OKXA 1V6DA 3TK5A 8GCHF 1OSSA 1AKSA 3BTDE 2QYIA 1U6QA 4CR5A 1BOQA 1HJ8A 3RC6A 1Z7KA 4FU9A 1HAZB 1N6XA 1S81A 2UWLA 1TOCB 1C5YB 1F5KU 4OS4A 5FPSA 3SGQE 1G2MA 2Q6GA 1RTKA 2BD4A 1PQ8A 4MTBA 1AY6H 3UREA 1ESTA 1DWBH 1EKBB 1O5AB 2WINI 1OYTH 1EOLA 1P01A 1SC8U 1QNJA 1BRCE 1O2MA 5HYOA 2Z3DA 2OC7A 1CBWC 3DFLA 1C1WH 2O8TA 3RP2A 3H5CB 3G01A 3SNCA 1CGIE 2FLBH 5HGGA 1JIRA 2BYAX 3BSQA 5GCHG 6LPRA 2V3OH 3SN8A 1D9IA 3LGVA 3URCA 3ATLA 1WCZA 1YC0A 7LPRA 3ZV8A 2BDBA 2P8OC 1P9SA 2BLOA 2O8MA 1JXPA 3D23A 1QRZA 1BRAA 1O35A 2EEKA 2AGEX 3STJA 3E0NB 3A89A 1SGIB 1ZMJA 1NRQH 1S5SA 3DHKH 1AVWA 1GMCG 1LVBA 1TX6A 2J34A 1IQEA 3URDA 2O8UA 4AB8A 4ABIA 1KLIH 3GY3A 5GCHF 3FZZA 4BTTB 1CQQA 2HOBA 4OGYA 3V0XA 1YPKH 2A32A 4B2BA 3KQDA 1PYTC 2W3KA 5C5OA 4CHAC 1SQAA 3OX7U 3MU5A 2F9OA 3R3GB 1QIXB 2BY9X 3LC3A 1JBUH 1C1UH 3VGCB 5DPAA 1D3QB 2F83A 2W7SA 1UTQA 4VGCB 1SGFG 6ESTA 1H8IH 2BB4A 3T28A 3V7TA 3DT0H 1O3JA 1KY9A 1PPHE 1UHBA 3QZQA 1GMCF 1XUKA 3KQBA 4X8TH 2A1DB 1Z1IA 1Y3XA 3FP6E 1FNIA 4E05H 2PKAB 2TGTA 3SGAE 4X1SU 1GJ7B 2ZDVH 3EDXB 5JBCS 3DA9B 1ID5H 1O2OA 3ODFA 4X2YA 5IYTA 1KLJH 3KQCA 1H9LB 5JDUB 1F0TA 5E0HA 1TAWA 3M7TA 1LTOA 1F5RA 1T8OA 3M7UA 1C5TA 5IDKA 1TNIA 1Y3YA 1HV7A 3GYLB 4BANB 2XXLA 5HXFA 3GCOA 2H5CA 4FUBA 1P57B 1TALA 4FVDA 1RTFB 4KP0A 4NIXA 4BAHB 3ATIA 3IG6B 3O8DA 3TLOA 1FZZA 1TGCA 3LGUA 2ZWLH 1W0YH 3PTBA 3RU4D 3RXUA 2WPHS 2ZPSA 1MH0A 2VWLA 1J16A 1T4VH 2GCTB 2NU2E 2FO9A 2TIOA 3K6ZA 2ZDMA 4IC5A 3RMMH 2YNAA 3KIDU 2ZKSA 1PQ5A 1O2JA 1P2NA 1WOFA 3I29A 1EP6A 1G37A 2OP9A 5B6OA 1N1LA 1P8VC 1O2VA 1K1PA 3A84A 3MNBA 4X8SH 5C1UA 1BCUH 1MQ6A 1NRRH 4RKJB 1ACBE 1GHWH 1ELEE 1O3GA 1CA8B 2F9NA 4MG3A 4HZHA 5AFYH 3QGJA 2CV3A 1SGCA 1HFDA 3UNRA 2ZO3H 4NG9H 4BTUB 1JRSA 3Q00A 4AN7A 1UJ1A 1VGCC 2VU8E 1GI8B 2GTBA 2FS9A 4A6LA 4DG4A 3S69A 1RD3B 3E90B 4NZQA 3T2NA 1VJAU 3LH1A 6CHAB 1IQFA 1P2KA 2DE9A 1ESAA 1V3XA 4ZXXH 3UQOA 1HAVB 2ZPQA 2F3CE 4JZDH 4U2WA 1E35B 1O3OA 1IAUA 2BD9A 2P93A 2BLVA 3UQVA 1CVWH 1TRYA 5DP4A 3KQEA 3TJNA 1WAYB 4KGAA 5ESTE 1W2KH 3S9AA 1SG8B 3RM2H 4X8VH 1G3BA 3K65B 2ANMH 2QXGA 4A92A 1GVKB 1FMGA 2FI3E 1SGTA 3SORA 1ANCA 1HAYB 2NU0E 1L1NA 1NRSH 4XBDA 3SUEA 3RXKA 1BHXF 1G30B 4XBCA 2TGDA 2VH0A 3RMNH 3BTQE 2C4FH 2UUKB 3RLYH 4ZMAH 5JYIA 1GDQA 1VCQA 3A7YA 4DVAU 3IITA 4H4FA 2FODA 4AYVB 1M9UA 3MNSA 3GCHB 5EXMA 3EAJA 2Y5FA 3ZVAA 4YOGA 1C2KA 4ABAA 2AMQA 3B9FH 3QX5H 1QFKH 1Z1JA 1BDAA 1AUTC 1BMNH 2C3SA 3GISB 3A7ZA 2UWPA 1K1LA 4JYTA 2SGDE 5TJXA 1GJ6A 3A82A 1ZPCA 2XC5A 3T29A 4I8HA 1LVYA 1LKAA 2GZ7A 1NFXA 1ZTJA 1NU7B 1CGJE 1MKWH 1MZDA 4UFDH 3RXRA 3W94A 1GBTA 3EA8A 2SGQE 1BRUP 1AWFH 5A0AE 3ZZ3A 1O3BA 2XCFA 2H2ZA 2G5VA 4I33A 1IQMA 5A09A 4JZ1A 1P2OA 2PKAA 3B8JA 1T31A 1H4WA 3O8BA 3F6UH 3S9BA 3SJKA 2JH5D 4I7YH 1RRKA 1GDNA 4GAWA 1QTFA 5DO4H 2BDHA 1GHBF 2HVXA 2STAE 2Z7FE 4A1VA 1LCYA 1DVAH 3P70B 1O2TA 2VNTA 3SU4A 4X6OA 4A1TA 4B74A 2FYRA 4A1XA 3M36A 2Z94A 1N8OB 1ABJH 1TGBA 2P16A 3SU1A 2THFB 1P2MA 1EZSC 2A5AA 6GCHF 3QGNB 3T62A 1GI1A 5E8EH 1YBWA 3E91A 4ESTE 3HKIB 3TNTA 2BD5A 2OQUA 3MO6A 2SGPE 4AFZA 4NZLA 3T26A 5DP3A 2HALA 3STIA 3TH4H 3RU4T 1XKBC 1E38B 5H4IB 4WMDA 1BA8B 2WPMS 1O2ZA 2XBWA 2EA3A 4WH6A 7GCHF 5JB9S 1OOKB 3A86A 2ZDNA 4DY7B 1MTNB 1F7ZA 1QJ1B 2ZDLA 5L30H 2PGQB 2B0FA 1O2SA 3ZZBA 9ESTA 2D8WA 2KAIB 1C2LA 1C5OH 4VGCC 2ZI2H 1BTPA 1EP5A 3GCTF 3HGPA 4KKDA 3QLPH 4CRAA 3GY8A 2GT7A 5FCKA 2ZGJA 3LC5A 3ZZCA 2Z9LA 1FUJA 3TK6A 2FOMB 1MCTA 4YM9A 1O3DA 3SV2H 1FIZA 1PQAA 1THRH 1GL1A 2FTMA 2GD4B 3M3TA 5PTPA 5LPRA 4GSOA 3U69H 2FIRH 3FANA 4KTSA 1LPKB 2XCNA 4FUIA 2J95A 3NCLA 1Y59T 3EQ0H 2BLWA 2G4TA 1O2GH 3NPSA 5C67A 1HAPH 5EW1H 1P9UA 3GYMA 1SQOA 4UFEH 1AVGH 3TH2H 2WV4A 3P17H 3A8BA 1KLTA 1PPEE 2Z9KA 3QTVH 4OS2A 1A5GH 1YPEH 3A85A 4I32A 1HAVA 4CHAB 2BXTH 2XWBI 4WVPE 2XWAA 5C1YA 4A5TS 2H1UA 1C2EA 2WPIS 1GI5A 5DP8A 1NZQH 4KTUA 2ZU2A 4CREA 3ZZ8A 3A81A 3L3TA 3KGPA 1D3PB 4D8NA 3OTJE 4K1TA 4B75A 3MO3A 2A2XH 3ZVEA 4XDEA 3K9XB 2W5EA 1UVPA 1YPHE 3CS7A 5DP6A 1O31A 3UNQA 4RKOB 4YLQH 4YOIA 2VH6A 4CBNA 1EPTC 1PJPA 2C8XB 1HB0B 1LVOA 1GWAA 5FAHA 4O9VA 1C5MD 3M5OA 5AF9H 3EGKH 1S83A 1P3CA 1FV9A 3VEQB 2BQ7B 5L2ZH 2WUBA 2HWLB 5C1XA 4TWYA 2ZHFH 3BG8A 5EGMA 1QR3E 1ANDA 2BQ6B 2UUFB 4K3JA 2OC8A 1B5GH 3V13A 1MU8B 4WXIA 2ZQ2A 1P06A 3M37A 3UUZA 6CHAC 2BVRH 5DGJA 2ZFTA 2BXUH 3MNXA 4FUEA 2FS8A 2XTTB 4HTCH 1SI5H 4BXWA 5AVDA 3LU9B 4AG1A 3S9CA 1OP2A 1DXPA 4X0WU 4Y10E 3T5FH 2XRCA 1KXAA 1MCVA 4A7IB 3BF6H 2QXHA 1HJAB 3UR6A 3R0FA 4FU8A 1D3TB 4CBOA 2FOFA 4ZH8A 3U98H 4MNYA 3GY6A 2IOTA 2V0BA 2RA3A 1SLVB 1W13U 1C5WB 3SV7A 1ETSH 4K60A 3RMLH 1Y5AT 1C5LH 5C5NA 2PUXB 4K8YA 3MU0A 1VITH 1L4ZA 1O2YA 4DIIH 2PTNA 4MVNA 1QJ7B 4MDSA 5G4BA 2P95A 2CXVA 1HPGA 1F0SA 1VGCB 1C5NH 4SGBE 1Z6EA 4JZEH 5FPTA 3V12A 1ZGVA 4O3UA 1NN6A 1LMWB 2IJOB 1HXEH 1QQUA 1K1MA 4NCYA 4IW4E 2BD7A 3GCHC 1DOJA 4ABFA 1WQSA 4D9RA 1P2IA 3GY2A 1SGYE 3MYWA 4ISNA 1GMDG 1QRXA 1TQ0B 3TJOA 3TITA 4DT7B 3ENSB 1SB1H 4BAOB 1B0FA 2OCVB 4IN1A 5ABWA 1MD8A 1C9PA 1GJDB 3BEFB 4JK5A 3U8TH 1P03A 2BTCE 1TA2A 5LH8A 3AASA 2R2WU 3O8RA 2WV5A 2H9TH 5DP7A 1Y5UT 3PO1B 2KAIA 1C9TA 2VIQA 5EOKA 1EJNA 1DUAA 4X1PU 3RXAA 1TNGA 1EZQA 5K7RA 1UVSH 1VCWA 2FESH 1UK3A 1P2QA 1Z71A 3EA9A 1GMDF 4B76A 3F9GA 2ZNKH 1DDJA 1BIOA 4ZHLU 2FOBA 4NIYA 4Y7BA 5DK1A 1H1BA 2GGVB 2Y81A 3TVJB 2PUQH 3S7KB 2ZG0H 2J38A 2UWOA 1H8DH 1GBBA 4UD9H 1FLEE 1GI4A 4B2CA 3MH4A 2FYQA 1T32A 1MKXK 1J9CH 4TPYA 1PQ7A 1WBGB 4ASHA 1GJBB 1K1OA 2P59A 2QIQA 5EPYA 1O2LA 3A83A 1DXWA 1RFNA 1N8OC 3TJVA 1LHCH 2P3TB 5E2PA 5EG4A 1CSOE 4Y71A 4LZ4B 4IMZA 3AAUA 2FLRH 1ELDE 1SLXB 3RXTA 5GWZA 4D9QA 1ELBA 2GZ8A 2TPIZ 2B9LA 1C1QA 3SJIA 4H6SB 2ZECA 3JZ1B 3VXFH 2B7DH 1AN1E 1SGNE 1UVUH 1HIAB 2R3YA 1A4WH 2PLXA 2VIPA 2K1QA 1Z6JH 1AZ8A 1O5GH 2ZGBH 2ZTZA 4AFQA 3RXPA 3BTWE 1THSH 2GKVE 2G4UA 4O97A 3M5NA 1MTNC 2ASUB 2PR3A 3OSYA 4AORA 2WPLS 5L2YH 3F9FA 1TPPA 1VCPA 4ZKRU 3MH6A 3O8CA 2TRMA 1A3EH 2FTLE 3MU8A 4FUDA 1KXCA 2VINA 3M5LA 3QDZB 4ABJA 4YTAA 4UE7H 2SNWA 1EASA 1LHEH 4I8KA 3RLWH 3W95A 2F9BH 3MH7A 5AHGH 2A4RA 4MPUA 3SQEE 3PM3A 3UTUH 1OWEA 3AVZA 3OYPA 2GCHG 4GCHG 4DURA 1IOEA 3SU3A 1JIMA 2SGFE 2XYAA 1TX8A 1EAWA 1K1NA 1DX5M 3E3TA 2CMYA 1UTMA 4E06H 3P8NA 1TRMA 4R0IA 1O5FH 2JH0D 4HI3A 1DM4B 4Z6AH 1BJVA 3K6YA 1MMJN 1RXPA 3MU4A 4D7FA 1E37B 1FONA 5EQSA 2HRVA 3LIWA 4LXBH 1Q3XA 4FUGA 1A61H 1EUFA 1G3EA 1ZSKA 1MTUA 4FUFA 2GCHF 4GCHF 3P95A 4PROA 4U32A 1ARBA 3QZRA 1UTJA 4DCDA 3NK8A 3SNEA 2O8LA 3UIRA 1F92A 1MQ5A 4IS5A 3F68H 1K1IA 4MNWA 2EI7A 2ZU3A 1OXGA 4NIWA 4K1EA 1CHGA 4UFGH 4O03A 1BITA 4Y6DA 4FUJA 2VVCA 2I6QA 1Y5BT 1ZGIA 1A0JA 3CS0A 1W3CA 1V2LT 5J4QA 1GJCB 3PB1E 1SBWA 1D6WA 3SJ8A 4GHTA 4Y0YE 1IQGA 2IPHA 2G52A 1G32B 1NTPA 3NZIA 2A7JA 2F9PA 3BEUA 5C20A 1OWIA 1FPHH 1LHFH 2ZU4A 1RIWB 1ZPBA 1GBLA 2ESTE 3LJJA 3MFJA 1ZHMA 1THPB 4XBBA 3RXCA 1BBRK 1GHAF 1KXFA 2ZHEH 4WXVA 3GY5A 1ZTLA 2YNBA 1SGEE 1PPZA 3RXVA 3LGYA 3GY7A 4MPVA 1HJAC 4ABDA 2VWMA 2AEIH 2OBOA 1GHVH 1C1NA 2BM2A 1EB1H 5C2ZA 2BD8A 1SGPE 1C5UA 4GUXA 4FU7A 3OU0A 1PPFE 1EPTB 3RUOA 3VB7A 2ZU1A 4SGAE 3VB6A 1HCGA 1SOZA 1EX3A 4H6TA 2V3HH 4WF8A 1A2CH 2BLQA 2Y7XA 1C5QA 1JMOH 4Q2KA 1RTLA 4BNRA 1VITG 3M61U 4E7RG 2STBE 4H42U 4ISOA 1P11E 1VZQH 1L1GA 1YGCH 2GDDA 1QGFA 1GJ4H 1PPBH 1SGQE 2TGAA 2ZZUH 2C90B 2CF8H 2VWNA 2Z3CA 3I77A 1L4DA 3Q77A 2ODQA 4LZ1H 3SNBA 2G8TA 4XFQA 1LDTT 1FN8A 4CR9A 1ZR0A 1XUJA 2FXRA 2H9HA 3Q3YA 5LGOA 2RDLA 2W3IA 3ZV9A 3U1IB 2ZF0H 2BDGA 1VITF 1O2PA 1HIAA 1SHHB 5EPNA 1OPHB 1ANEA 3QWCH 5DKMA 3WY8A 3PLKA 3TJUA 7KMEH 4K1SA 1CA0B 2Y80A 4WY3A 2XC0A 2QA9E 3PO1C 1P12E 1AFQB 2GV6A 2XC4A 1AVXA 4GPGA 3PYHA 2QY0B 4WMEA 1O34A 1Z8IB 3ITIA 3KEEA 1K9OE 2C93B 3B23B 4OGXA 4JZFH 2R0LA 2HGTH 1OP0A 2EI8A 4YO9A 2G55A 3AAVA 4KTCA 2OC0A 1O38A 2A7CA 2OC1A 3SJOA 2NU3E 1NT1A 3I78A 4D7GA 1AWHB 1CHOG 3UOUA 2FWWA 5EQQA 4ABHA 2AMPA 2ZHWH 2FEQH 2WYGA 1YKTA 5FPYA 1QBOA 2BY8X 2A5KA 1BQYA 1BTWA 1GBDA 2ZP0H 1AUJA 3SUDA 1KXBA 5SGAE 1TNKA 2FI5E 1P0SH 3SUGA 1FQ3A 3DUXH 2J92A 5EQRA 3TNSA 3JZ2B 4RN6A 2PWXA 2FOCA 1T8NA 1BTYA 1V2QT 3A87A 1G36A 1QJ6B 1UTKA 4X2WA 1V2MT 1GHBG 5FXLA 1EZUC 2C8ZB 3RXSA 3PWBA 1KIGH 1CHOF 3GDVA 1O2IA 4K5ZA 1T7CA 3TPIZ 1WUNH 2V6NA 4FUCA 1DWCH 4CRBA 3BTEE 2AFQB 4NFEA 2PGBB 3Q76A 1SGDE 2GMTC 4YESB 6GCHG 1FY3A 1TBZH 3VPKA 1DICA 1JWTA 4CRCA 4FXGH 1SFQB 2I6SA 3RDZA 2ZFFH 5J4SA 1EZXC 2V35A 1ZTKA 2GDEH 4IBLH 1J15A 5TCCA 3CENA 1MUEB 2Y5HA 3BTGE 1WTHD 1RS0A 2FOAA 7GCHG 2BVSH 1S0QA 1YLCA 1IQLA 1MAXA 4X8UH 1CGHA 4YLUA 2BVXH 2YOLA 1GJ8B 3GCTG 3BV9B 3NKKA 4TYDA 1O5BB 1QA0A 2JETB 3TK9A 1DY9A 1QA7A 1HRTH 1MKXH 4Q7ZA 1O37A 2A0QB 4FUHA
chains in the Genus database with same CATH superfamily
4MLFB 1P3EA 2A7HA 3TGKE 2G81E 1GBAA 3BIVH 2FPZA 3FVFB 3SU0A 4UEHH 4B6FA 2JIZD 4JZIA 1HUTH 1DWEH 3RXIA 4TPIZ 1NROH 2VGCB 1IQNA 5AFZH 1GI2A 1EPTA 3QO6A 2Z6BD 2J94A 3EE7A 4Y79A 4NA9H 1LQEA 4XE4A 4K69A 2QXIA 5FHTA 3ZZAA 1CT2E 3VXEH 1GHXH 1F0RA 2W7UA 3RXLA 1IQHA 1C1OA 1TBRH 2XNDD 3ZVFA 1TBQH 2ZA5A 1CT4E 4M7GA 4F55A 2GV7A 1UO6A 2G51A 2L6OA 1OWHA 1GG6B 4NA8A 1O2XA 1O32A 2VJ1A 1TPSA 2A31A 1W0JD 3RXMA 1IQIA 2ZHDA 1D3DB 1J17T 3U28C 2W6ID 1FAKH 3U1JB 1GVZA 1LHDH 1SGRE 1A3BH 1UMAH 3VG8A 1RIWC 1TOMH 2BY5X 4Q7YA 1A0HB 4UFFH 1WTGH 5ESBA 1IHTH 4TY7A 2Z3EA 4AYYB 1QBNA 1V2ST 2K8IA 5DG6A 1W0ZU 5FCRA 3SI3H 1GBJA 4P02A 4BTIB 2LPRA 1P09A 1DPOA 2FI4E 1EJAA 1DFPA 1GBKA 4Y11E 3AW1A 2PHBA 1O5DH 4O3TA 3UOPA 1QHRB 4ZHAA 1UVOA 4BOHA 1XUHA 1CO7E 3NWUA 1BTZA 1C2FA 2CN0H 2AGIX 1K21H 2FZZA 8KME2 1WSSH 5A8ZA 1BRBE 1BZXE 1NESE 2HVYB 1O5EH 5EU8A 1O3PB 1W8BH 2RFKC 3ATMA 2WPKS 3GDUA 4AFUA 2FDAA 1ZRKA 5GDSH 4JK6A 1O3EA 1OX1A 2ZPRA 3M3SA 5C17A 3ATWA 1CT0E 3P8FA 1EOJA 3SV8A 1AE5A 1PYTD 2J9NA 4THNH 5CHAB 3HKJB 1O2HA 2G00A 2ULLA 2VWOA 1O2UA 5FBIA 1AU8A 3LH3A 2Q1JA 1BJUA 3OE7D 1AQ7A 1SLUB 4I8JA 4AG2A 1L1JA 3PMAB 3S0NA 3SU2A 1XUFA 2GZ9A 2XBXA 1T4UH 2ZCKP 1DLKB 1GCTC 3LPRA 4IC6A 3BTME 2PKSB 1BT7A 1Q31A 1G2LA 2BZAA 1CA0C 2FX6A 5GPIB 1GJ5H 1NFUA 1NPMA 3EA7A 1BBRE 4RT0A 2FP7B 1BBRH 1C5RA 1KDQB 3BEIB 1AFQC 1C1RA 3SV6A 1TMBH 1LVMA 2Y5GA 3N99A 1DANH 3FAOA 3E6PH 3PMJA 1G3CA 4YT6H 3T25A 1C4V2 1WYKA 4OS7A 1AB9B 4AFSA 1YY3A 2ZDKA 3RC4A 4ZKOU 1NRNH 9LPRA 2ZFQH 1W7GH 4AZ2B 1D4PB 4RI0A 1P04A 7ESTE 3FZDA 3P8OA 4ACAA 2ANYA 4CRDA 1QB6A 4MPWA 2F91A 2HPPH 3ATKA 1FJSA 2WYJA 1S6HA 1E0FD 3ODDA 2ZHQH 3ZVDA 3BTTE 2OINA 4ASUD 1MABB 4J1YA 1FY8E 2JH6D 2P3FH 5E0GA 4AC9A 1O3KA 3C27B 4JYUH 3AK5A 2ZTXA 1LHGH 1O3LA 1O3CA 3AW0A 4UDWH 1OWJA 4HFPB 1AHTH 2JKHA 1YPJH 1HAOH 1FXYA 4X1RU 2J97A 2ALPA 1H9HE 1EATA 3E0PB 4WH8A 1TNHA 3KQ5A 4TY6A 1ELAA 1NFYA 1JRTA 1P02A 2F43B 3QUMP 1C5ZB 3F1SB 1NRPH 1YPGH 1DSTA 3RXBA 1IHSH 1YPMH 2UUJB 2UUYA 1ZRBA 1TA6A 3MI4A 3QTOH 4GHQA 2D26C 1FPCH 1HBTH 3P6ZB 4XRNA 1V2VT 3RMOH 3SHCH 1KTTB 1UCYK 1C2GA 1EJMA 1C4Y2 2Y7ZA 1A0LA 3L33A 1A7SA 5JBAS 5K0HA 1TFXA 5C94A 1MTWA 1A5IA 1EAIA 1LO6A 4OS1A 3FO8D 1S6LA 4I8LA 5HM9A 3UPEA 3E1XB 2JETC 3D62A 1ZSJA 3ZVBA 1V2UT 4I86A 1P10A 1O39A 3ELAH 5JB8S 1DITH 1O3NA 1O3MA 1GBEA 3A80A 3SI4H 1QURH 4GLYA 1F5LA 4U01A 4Z1MD 1OWDA 1SR5C 2ANWA 3PMHB 5GJ4B 2D1JA 2OUAA 5FX5A 1GL0E 4UONA 2AS9A 3HK6B 3PLBA 1UTLM 1KXDA 1A5HA 4B73A 2ZEBA 2GMTB 1AMHA 2CHAB 2QXJA 3E16B 1KYNA 3ZVGA 2VGCC 2OLGA 4X6NA 3VB4A 4ISLA 4MQAA 3LGTA 2ZTYA 5E0JA 4XSKU 1C1MA 1S82A 2BQWB 1HJ9A 1X7AC 3FOAA 1NS3A 5F53A 1BB0B 1MTSA 5E2OA 1IQKA 3MHWU 4X6PA 1WU1A 2HNTC 1ETRH 3NUMA 1SQRA 5GIBA 3ZZDA 3TGIE 1K1JA 4AGKA 4DW2U 1GG6C 4ISHH 1CU1A 2CF9H 5A0BA 3PWCA 5T6FA 2W26A 1EXFA 4AB9A 1C2MA 5HM2A 3LONA 5EODA 2ZCHP 3BIUH 3LJOA 1P05A 1GI0A 4ZHMU 4ABEA 3F9HA 3TU7H 1XVOA 1TPOA 1FAXA 2A5IA 2TBSA 5C3NA 2H9EH 3PTNA 1TNLA 1MZAA 2SFAA 4B1TA 1LPGB 2YMSD 1L2EA 1WDIA 2CK3D 3RXDA 3NXPA 4ISIH 5A8XA 1TRNA 1K2I1 2Q6DA 3UWIA 2RCEA 4X2XA 1TLDA 3H7TA 1C5VA 4DOQA 1EQ9A 2Z9IA 1P2JA 3V3MA 1QL7A 4Z0KA 1ZLRA 1KDQA 4Q80A 5T6DA 2AIPA 1YLDA 2VVVA 3KN2A 2HNTE 2PW8H 3M35A 3LGWA 4INLA 1SOTA 1ZZZA 3IWMA 2XBVA 1GHAG 2VB0A 1ORFA 1G3DA 1EAUA 1ARCA 4CRGA 1OS8A 4Q7XA 4Y76A 1SVPA 4OS6A 5C0TA 2HLCA 2FOEA 2Q6FA 2J4IA 1Y3VA 1G9IE 2CJIA 2BDIA 1J14A 5JPMH 1XUGA 1ELVA 1SQTA 1W11U 1XMNB 1TGTA 2A4OA 1MBQA 1ZPZA 3U9AH 5CHAC 1ELGA 1HYLA 1GBFA 5LPEA 1D6RA 1O3IA 1V2NT 1PPGE 1AIXH 1DLEA 5CE1A 2VIDA 1FDPA 2M2AA 4ZKSU 2BY6X 1QL9A 1Z8RA 3BG4B 3W1EA 5JBTA 1TONA 1BTUA 1C1VH 4MNXA 4NIVA 4JMYA 4AX9H 1LQDB 1GBHA 1TABE 1J8AA 1WXRA 1UTOA 3P8GA 4YOJA 5FX6A 1UVTH 4NSYA 2PKSC 1S85A 5DP9A 3HGNA 1GVLA 2ZGCA 1FY5A 1NC6A 1KTSB 1ZJKA 1AE8H 3KHVA 3K2UA 3U8RH 3FP7E 1VKYA 4B71A 3SQHE 1N6YA 2QF5A 2Y6TA 1EB2A 4GVUA 1C2JA 1NU9A 4RT1A 1AB9C 4X1QU 5EW2H 1FY1A 2WUCA 1UK2A 1BTXA 2RA0A 1LPZB 5LPFA 1E34B 5TCAA 3NRLA 2ZIQH 1INCA 5ETXA 2AERH 1OYQA 5A8YA 4LOYH 1TGSZ 1ZMNA 3WWFA 1L0ZA 4DT4A 5FBEA 1GPZA 2BHGA 3TIUA 3MO9A 4HGCA 4ZKNU 1EAXA 1B0EA 1GMHG 4K2YA 2OTVA 1O0DH 3SV9A 2C8WB 2BOKA 1XX9A 2LELA 5JBBS 5L6NH 1BMFD 1GCTB 3SU5A 1GI6A 1TWXB 1Y3UA 1MU6B 1QCPA 1V2WT 1TMTH 1JOUB 3RXHA 5HIYA 2P94A 2QV1A 3GY4A 4TWWA 2L74A 3SO3A 1BHXB 4NWKA 1O5CB 3MTYA 3S7HB 4JYVH 1HNEE 4AOQA 2AH4X 5EXLA 4CH8B 1S84A 2ZCLP 1C2IA 1NFWA 1GMHF 1GBMA 3GDSA 1BMAA 2NU4E 1SLWB 2PFEA 2VVUA 3DD2H 1GHYH 1YCPK 4MPXA 2ANKH 3PROA 2R9PA 2OQ5A 2OXSA 3ZYEA 1ZHPA 1Y3WA 2A4QA 5C0UA 1V2JT 2WPJS 3A7WA 4XD7D 2AIQA 1GJ9B 3MOCA 3MMGA 1GCDA 1PPCE 2H5DA 2VIOA 1XUIA 2BZ6H 4Y7AA 1SSXA 4WWYA 2O8WA 3RXEA 2J2UA 1ZJDA 2JDID 3ZZ5A 2TGPZ 4WMFA 4LK4A 1TPAE 1UK4A 5A0CA 2ZDAH 5DN6D 1GJAB 2BD3A 1Y8TA 3RXGA 1Z8GA 1QQ4A 2HPQH 1YP9A 3OY6U 2GT8A 4JCNA 2BY7X 1W10U 1GI9B 1NM6A 2FOGA 1C2DA 3QK1A 2SNVA 1C1PA 3TH3H 1SMFE 2BD2A 1DS2E 2CHAC 1W12U 4KELA 2PV9B 3Q3XA 2BDAA 5F8XA 1AI8H 1BUIA 4ABGA 2Y82A 1TX7A 3GOVB 1V2OT 1SGFA 1GGDB 4YT7H 1T8MA 3FP8E 4FOUC 1SL3A 3MWIU 1UTPA 2XNIA 2KCPA 1O2KA 1NO9H 3FN8A 3M3VA 4WJG2 1Z8JB 3M7QA 1HGTH 2CGAA 2VIVA 1BTHH 1VR1H 3ESTA 1DSUA 2F9UA 1K22H 1O33A 2AMDA 1AGJA 1UTNA 1GBIA 4IMQA 1FI8A 3F2FA 3DFJA 1OHHD 2B5TB 3VB3A 3ZYDA 3PLPA 1OP8A 1V2KT 1B7XB 3SJ9A 4B2AA 4Y0ZE 1CE5A 1UCYE 1YF4A 3OY5U 4Q4LA 1C5SA 1UCYH 4NA7A 1XM1A 4RSPA 3C1KA 3MNCA 1V2TT 3F9EA 3GICB 3QN7A 3EE0B 1O2RA 4YZUA 1FIWA 1WQVH 2JJ1D 1MAYA 1ETTH 2ZFPH 1V2RT 2OD3B 2F9VA 2K0QA 1IQJA 3BTFE 3M5MA 2EC9H 1WV7H 2ZGXH 1O2WA 1KXEA 3UY9A 3P92A 4X6MA 3ZZ9A 4ACBA 5EJLA 1YPLH 2QF0A 3HPTB 4DJZB 1CBWB 1HXFH 2ZU5A 3VGCC 1QB9A 1QL8A 1E79D 5DJ7A 1DY8A 4INHA 2ALVA 2ODPA 1E36B 3A88A 4Y8YA 1VJ9U 2GVFA 2XBYA 2GP9B 2PSYA 1O36A 1F0UA 1K0HA 2IPQX 2A45B 3UAIC 1MD7A 4X1NU 3SNDA 3FFGA 1BMMH 2O9QA 1KMHB 3WW7A 2P8OB 3BN9A 4J2YB 1LKBA 1A1RA 1V2PT 3SBKA 1BMLA 1YPHC 3KF2A 5GXPA 4DGJA 3Q3KA 4OS5A 3N7OA 4K8BA 2ZQ1A 3KCGH 3RC5A 3BG4C 2HNTF 1MTVA 2BOHB 3LT3A 3DSOA 1FY4A 2ODYB 2RDEA 3SZNA 4NSVA 1FX0B 1TYNA 2OBQA 2H6MA 1C1TA 2B8OH 2QN5T 2XW9A 1S6FA 1QBVH 1AKSB 3OEHD 1GBCA 1C2HA 4AGJA 1SPJA 3RU4E 1GDUA 2BDYA 1TGNA 3D49H 2SGEE 5DSFA 2R0KA 3MH5A 1AD8H 2NU1E 1ZHRA 2Z9GA 2Z9JA 1YCPM 5I25A 2EI6A 3UFAA 2QGRA 2AGGX 2LNCA 1O2QA 3HK3B 1XVMA 3A7XA 5F6MA 1DT2A 2GCTC 4R8TB 1ZMLA 3L6PA 1MBMA 1K28D 5KEDA 2G5NA 3GCNA 2QCYA 1O2NA 3BTKE 2PP6A 3LKWA 4CRFA 3CP7A 4NGAH 3SHAH 2BDCA 2BX3A 1ESBA 4NWLA 2FM2A 3A7VA 4XOJA 2QE7D 4Y8XA 3KYFA 1AFEH 1AO5A 2FMJA 2DE8A 4X2VA 3RXJA 4INKA 1A46H 2GJGA 2EY4C 4F4OC 1SHYA 1GHZA 1TIOA 1YYY1 2R3UA 3SUFA 2RG3A 4I31A 4TSFD 3UNSA 3VFEA 5F8TA 2AYWA 1GI7B 5DP5A 3VB5A 4IN2A 3SGBE 1ANBA 4NFFA 3PV4A 1TE0A 3MU1A 1ELTA 4MNVA 4ZAEA 3GS9A 5T3HA 4BXSA 1S0RA 2QF3A 1HAHH 4BAKB 1XXDA 3T27A 3RM0H 1YM0A 2IN2A 2BX4A 1TB6H 3PV2A 1XKAC 3D65E 1Q2WA 1FN6A 3HATH 2ILNA 1W7XH 2PSXA 2A2QH 5A2MH 1DUEA 5EJZA 4FVBA 3A8CA 3A8AA 1XXFA 1ELCA 3SU6A 1O30A 1ELFA 1ABIH 1UHBB 1O3AA 1QY6A 3SNAA 4BAQB 3BTHE 1HAGE 3RXQA 1HAXB 1QB1A 5F8ZA 1H9IE 5BRRE 2C8YB 3KL6A 1TMUH 1T8LA 5HMAA 2QAAA 4E7NA 5CMXH 1RJXB 4ZROA 1C1SA 5EXNA 2VIWA 1DWDH 2A4GA 2ZC9H 3SOSA 1NY22 2BMGB 3H7OA 3OAAD 3ZZ7A 1UW7A 5T6GA 2KFWA 3ZVCA 1MKWK 4DIHH 4ZXYH 2ZFSA 3EYDA 2M5TA 2SGAA 3LOXA 4U30A 3U8OH 1TQ7B 5BPEA 2FX4A 2J98B 5T1VA 4CH2B 3RXOA 2DUCA 1C5PA 1O3FA 3DSPA 3LGIA 8ESTE 4F49A 3TGJE 3WWBA 1RGQA 3ZZ4A 4ZUHA 1HLTH 8LPRA 1AZZA 1GGDC 2PTCE 4ABBA 4Y8ZA 3SW2B 1COWD 1ZYOA 2XOKD 1GI3A 1QRWA 1YLNA 2D2DA 3E8LA 5F03A 3UWJH 2ZFRH 8GCHG 1EFRD 1HDTH 1W14U 1PFXC 2FOHA 4I8GA 4BAMB 1HAIH 2R2MB 3UR9A 5I46H 1KSNA 2P3UB 1C5XB 3ZZ6A 1YCPH 2QC2A 1ZOMA 1ZSLA 1SFIA 1TNJA 3RXFA 2NWNA 4QT8C 3LDXH 4IGDA 3PMBB 1DE7H 1OWKA 3A7TA 4D76A 3KNXA 2GX4A 3A8DA 2ZGHA 1F2SE 5GNDA 1O3HA 1C4U2 1OKXA 1V6DA 4FETA 3TK5A 8GCHF 1OSSA 1AKSA 3BTDE 2QYIA 1U6QA 4CR5A 1BOQA 1HJ8A 3RC6A 1Z7KA 4FU9A 1HAZB 1N6XA 1S81A 2UWLA 1TOCB 1C5YB 1F5KU 4OS4A 5FPSA 3SGQE 1G2MA 2Q6GA 1RTKA 2BD4A 1PQ8A 4MTBA 1AY6H 3UREA 1ESTA 1DWBH 1EKBB 1O5AB 2WINI 1OYTH 1EOLA 1P01A 1SC8U 1QNJA 1BRCE 1O2MA 5HYOA 2Z3DA 2OC7A 5B6LA 1CBWC 3DFLA 1C1WH 2O8TA 3RP2A 3H5CB 3G01A 3SNCA 1CGIE 2FLBH 5HGGA 1JIRA 2BYAX 3BSQA 5GCHG 6LPRA 3ZIAD 2V3OH 3SN8A 1D9IA 3LGVA 3URCA 3ATLA 1WCZA 1YC0A 7LPRA 3ZV8A 2BDBA 2P8OC 1P9SA 2BLOA 2O8MA 1JXPA 3D23A 1QRZA 1BRAA 1O35A 2EEKA 2AGEX 3STJA 3E0NB 3A89A 1SGIB 1ZMJA 1NRQH 1S5SA 3DHKH 1AVWA 1GMCG 1LVBA 1TX6A 2J34A 1IQEA 3URDA 2O8UA 4AB8A 4ABIA 1KLIH 3GY3A 5GCHF 3FZZA 4BTTB 1CQQA 2HOBA 4OGYA 3V0XA 1YPKH 2A32A 4B2BA 3KQDA 1PYTC 2W3KA 5C5OA 4CHAC 1SQAA 3OX7U 3MU5A 2F9OA 3R3GB 1QIXB 2BY9X 3LC3A 1JBUH 1C1UH 2WHXA 3VGCB 5DPAA 1D3QB 2F83A 2W7SA 1UTQA 4VGCB 1SGFG 6ESTA 1H8IH 2BB4A 3T28A 3V7TA 3DT0H 1O3JA 1KY9A 1PPHE 1UHBA 3PV5A 1GMCF 1XUKA 3KQBA 3QZQA 4X8TH 2A1DB 1Z1IA 1Y3XA 3FP6E 3F3BA 3PRDA 1FNIA 4E05H 2PKAB 2TGTA 3SGAE 4X1SU 1GJ7B 2ZDVH 3EDXB 5JBCS 3DA9B 1ID5H 1O2OA 3ODFA 4X2YA 5IYTA 1KLJH 3KQCA 1H9LB 5JDUB 1F0TA 5E0HA 1TAWA 3M7TA 1LTOA 4YXWD 1F5RA 1T8OA 3M7UA 1C5TA 2KR7A 1TNIA 5IDKA 1Y3YA 1HV7A 3GYLB 4BANB 2XXLA 5HXFA 3GCOA 2H5CA 4FUBA 1P57B 2J98A 1TALA 4FVDA 1RTFB 4KP0A 4NIXA 4BAHB 3ATIA 3IG6B 3O8DA 3TLOA 1FZZA 1TGCA 3LGUA 2ZWLH 1W0YH 3PTBA 3RU4D 3RXUA 2WPHS 2ZPSA 4HG6A 3UB0A 1MH0A 2VWLA 1J16A 1T4VH 2GCTB 2NU2E 2FO9A 2TIOA 3K6ZA 2ZDMA 4IC5A 3RMMH 3OFND 2YNAA 3KIDU 2ZKSA 1PQ5A 1O2JA 1P2NA 1WOFA 3I29A 1EP6A 1G37A 2OP9A 5B6OA 2LP6A 1N1LA 1P8VC 1O2VA 1K1PA 3A84A 3MNBA 4X8SH 5C1UA 1BCUH 1MQ6A 1NRRH 4RKJB 1ACBE 1GHWH 1ELEE 1O3GA 1CA8B 2F9NA 4MG3A 4HZHA 5AFYH 3QGJA 3CNRA 2CV3A 1SGCA 1HFDA 5KGOA 3UNRA 2ZO3H 4NG9H 4BTUB 1JRSA 3Q00A 4AN7A 1UJ1A 1VGCC 2VU8E 1GI8B 2GTBA 2FS9A 4A6LA 4DG4A 3S69A 1RD3B 3E90B 4NZQA 3T2NA 1VJAU 3LH1A 6CHAB 1IQFA 1P2KA 2DE9A 1ESAA 1V3XA 4ZXXH 3FKSD 3UQOA 1HAVB 2ZPQA 2F3CE 4JZDH 4U2WA 1E35B 1O3OA 1IAUA 2BD9A 2P93A 2BLVA 3UQVA 1CVWH 1TRYA 5DP4A 3KQEA 2JJ2D 3TJNA 1WAYB 4KGAA 5ESTE 1W2KH 3S9AA 1SG8B 3RM2H 4X8VH 1G3BA 3K65B 2ANMH 2QXGA 4A92A 1GVKB 1FMGA 2FI3E 1SGTA 3SORA 1ANCA 1HAYB 2NU0E 1L1NA 2KCAA 1NRSH 4XBDA 3SUEA 3RXKA 3OTPA 1BHXF 1G30B 4XBCA 2TGDA 2VH0A 3RMNH 3BTQE 2C4FH 2UUKB 3RLYH 2V7QD 4ZMAH 5JYIA 5CHBA 1GDQA 1VCQA 3A7YA 4DVAU 3IITA 4H4FA 2FODA 4AYVB 1M9UA 3MNSA 3GCHB 5EXMA 3EAJA 2Y5FA 3ZVAA 4YOGA 1C2KA 4ABAA 2AMQA 3B9FH 3QX5H 1QFKH 1Z1JA 1BDAA 1AUTC 1BMNH 2C3SA 3GISB 3A7ZA 2UWPA 2F4LA 1K1LA 4JYTA 2SGDE 5TJXA 1GJ6A 3A82A 1ZPCA 2XC5A 3T29A 4I8HA 1LVYA 1LKAA 2GZ7A 1NFXA 1ZTJA 1NU7B 1CGJE 1MKWH 1MZDA 4UFDH 3RXRA 1E1QD 3W94A 1GBTA 3EA8A 4M9FA 2SGQE 1BRUP 1AWFH 5A0AE 3ZZ3A 1O3BA 2XCFA 2H2ZA 2G5VA 4I33A 1IQMA 5A09A 4JZ1A 1P2OA 2KX4A 2PKAA 3B8JA 1T31A 1H4WA 3O8BA 3F6UH 3S9BA 3SJKA 2JH5D 4I7YH 1RRKA 1GDNA 4GAWA 1QTFA 5DO4H 2BDHA 1GHBF 2HVXA 2STAE 2Z7FE 4A1VA 1LCYA 1DVAH 3P70B 1O2TA 2VNTA 3SU4A 4X6OA 4A1TA 4B74A 2FYRA 4A1XA 3M36A 2Z94A 1N8OB 1ABJH 1TGBA 2P16A 3SU1A 2THFB 1P2MA 1EZSC 2A5AA 6GCHF 3QGNB 3T62A 1GI1A 5E8EH 1YBWA 3E91A 4ESTE 3HKIB 3TNTA 2BD5A 2OQUA 3MO6A 2SGPE 4AFZA 4NZLA 3T26A 5DP3A 2HALA 3STIA 3TH4H 3RU4T 1XKBC 1E38B 5H4IB 4WMDA 1BA8B 2WPMS 1O2ZA 2XBWA 2EA3A 4WH6A 7GCHF 5JB9S 1OOKB 3A86A 2ZDNA 4DY7B 4OM9A 1MTNB 3KYGA 1F7ZA 1QJ1B 2ZDLA 5L30H 2PGQB 2B0FA 1O2SA 3ZZBA 9ESTA 2D8WA 2KAIB 1C2LA 1C5OH 4VGCC 2ZI2H 1BTPA 1EP5A 3GCTF 3HGPA 4KKDA 3QLPH 4CRAA 3GY8A 2GT7A 5FCKA 3SZEA 2ZGJA 3LC5A 3ZZCA 2Z9LA 1FUJA 3TK6A 2FOMB 1MCTA 4YM9A 1O3DA 3SV2H 1FIZA 1PQAA 1THRH 1GL1A 2FTMA 2GD4B 3M3TA 5PTPA 5LPRA 4GSOA 3U69H 2FIRH 3FANA 4KTSA 1QZ8A 1LPKB 2XCNA 4FUIA 2J95A 3NCLA 1Y59T 3EQ0H 2BLWA 2G4TA 2J5UA 1O2GH 3NPSA 5C67A 1HAPH 5EW1H 1P9UA 3GYMA 1SQOA 4UFEH 1AVGH 3TH2H 2WV4A 3P17H 3A8BA 1KLTA 1PPEE 2Z9KA 3QTVH 4OS2A 1A5GH 1YPEH 3A85A 4I32A 1HAVA 4CHAB 2BXTH 2XWBI 4WVPE 2XWAA 4F48B 5C1YA 4A5TS 2H1UA 4ZCNA 1C2EA 2WPIS 1GI5A 2EQNA 5DP8A 1NZQH 4KTUA 2ZU2A 4CREA 3ZZ8A 3A81A 3L3TA 3KGPA 1D3PB 4D8NA 3OTJE 4P00A 4K1TA 4B75A 3MO3A 2A2XH 3ZVEA 4XDEA 3K9XB 2W5EA 1UVPA 2OK5A 1YPHE 3CS7A 2KCYA 5DP6A 1O31A 3UNQA 4RKOB 4YLQH 4YOIA 2VH6A 4CBNA 5HIZA 1EPTC 1PJPA 2C8XB 1NBME 1HB0B 1LVOA 1GWAA 5FAHA 4O9VA 1C5MD 3M5OA 5AF9H 3EGKH 1S83A 1P3CA 1FV9A 3VEQB 2BQ7B 3PRBA 5L2ZH 2WUBA 2HWLB 5C1XA 4TWYA 2ZHFH 5FL7D 3BG8A 5EGMA 1QR3E 1ANDA 2BQ6B 2UUFB 4K3JA 2OC8A 1B5GH 3V13A 1MU8B 4WXIA 2ZQ2A 1P06A 3M37A 3UUZA 6CHAC 2BVRH 5DGJA 2ZFTA 2BXUH 3MNXA 4FUEA 2FS8A 2XTTB 4HTCH 1SI5H 4BXWA 5AVDA 3LU9B 4AG1A 3S9CA 1OP2A 1DXPA 4X0WU 4Y10E 3T5FH 2XRCA 1KXAA 1MCVA 4A7IB 3BF6H 2QXHA 1HJAB 3UR6A 3R0FA 4FU8A 1D3TB 4CBOA 2FOFA 4ZH8A 3U98H 4MNYA 3GY6A 2IOTA 2V0BA 2RA3A 1SLVB 1W13U 1C5WB 3SV7A 1ETSH 4K60A 3RMLH 1Y5AT 3DCLA 1C5LH 5C5NA 2PUXB 4K8YA 3MU0A 3SYJA 1VITH 1L4ZA 1O2YA 4DIIH 2PTNA 4MVNA 1QJ7B 4MDSA 5G4BA 2P95A 2CXVA 1HPGA 1F0SA 1VGCB 1C5NH 4SGBE 1Z6EA 4JZEH 5EIYA 5FPTA 3V12A 1ZGVA 4O3UA 1NN6A 1LMWB 2IJOB 1HXEH 1QQUA 1K1MA 4NCYA 4IW4E 2BD7A 3GCHC 1DOJA 4ABFA 1WQSA 4D9RA 5EJ1A 1P2IA 3GY2A 1SGYE 3MYWA 4ISNA 1GMDG 1QRXA 1TQ0B 3TJOA 3TITA 4DT7B 3ENSB 1SB1H 4BAOB 1B0FA 2OCVB 4IN1A 5ABWA 1MD8A 1C9PA 1GJDB 3BEFB 4JK5A 3U8TH 1P03A 2BTCE 1TA2A 5LH8A 3AASA 2R2WU 3O8RA 2WV5A 2H9TH 5DP7A 1Y5UT 3PO1B 2KAIA 1C9TA 2VIQA 5EOKA 1EJNA 1DUAA 4X1PU 3RXAA 1TNGA 1EZQA 5K7RA 1UVSH 1VCWA 2FESH 1UK3A 1P2QA 1Z71A 3EA9A 1GMDF 4B76A 3F9GA 2ZNKH 1DDJA 1BIOA 4ZHLU 2FOBA 4NIYA 4Y7BA 5DK1A 1H1BA 2GGVB 2Y81A 3TVJB 2PUQH 3S7KB 2ZG0H 2J38A 2UWOA 1H8DH 1GBBA 4UD9H 1FLEE 1GI4A 4B2CA 3MH4A 2FYQA 1T32A 1MKXK 1J9CH 4TPYA 1PQ7A 1WBGB 4ASHA 1GJBB 1K1OA 2P59A 2QIQA 5EPYA 1O2LA 3A83A 1DXWA 1RFNA 1N8OC 3TJVA 1LHCH 5IK2D 2P3TB 5E2PA 5EG4A 1CSOE 2WV9A 4Y71A 4LZ4B 4IMZA 3AAUA 2FLRH 1ELDE 1SLXB 3RXTA 5GWZA 4D9QA 1ELBA 2GZ8A 2TPIZ 2B9LA 1C1QA 3SJIA 4H6SB 4TT3D 2ZECA 3JZ1B 3VXFH 2B7DH 1AN1E 1SGNE 1UVUH 1HIAB 2R3YA 1A4WH 2PLXA 2VIPA 2K1QA 1Z6JH 2YMSB 1AZ8A 1O5GH 2ZGBH 2ZTZA 4AFQA 3RXPA 3BTWE 1THSH 2GKVE 2G4UA 4O97A 3MQKC 3M5NA 1MTNC 2ASUB 2PR3A 3OSYA 4AORA 2WPLS 5L2YH 3F9FA 3F2HA 1TPPA 1VCPA 4ZKRU 3MH6A 3O8CA 5HKKD 2TRMA 1A3EH 2FTLE 3MU8A 4FUDA 1KXCA 2VINA 3M5LA 3QDZB 4ABJA 4YTAA 4UE7H 2SNWA 1EASA 1LHEH 4I8KA 3RLWH 3W95A 2F9BH 3MH7A 2KZ4A 5AHGH 2A4RA 4MPUA 3SQEE 3PM3A 3UTUH 1OWEA 3AVZA 3OYPA 2GCHG 4GCHG 4DURA 2WPDD 1IOEA 3SU3A 1JIMA 2SGFE 2XYAA 1TX8A 1EAWA 1K1NA 1DX5M 3E3TA 2CMYA 1UTMA 3F0PA 4E06H 3P8NA 1TRMA 4R0IA 1O5FH 2JH0D 4HI3A 1DM4B 4Z6AH 1BJVA 3K6YA 1MMJN 1RXPA 3MU4A 4D7FA 1E37B 1FONA 5EQSA 2HRVA 3LIWA 4LXBH 1Q3XA 4FUGA 1A61H 1EUFA 1G3EA 1ZSKA 1MTUA 3OEED 4FUFA 2GCHF 4GCHF 3P95A 4PROA 4U32A 1ARBA 3QZRA 1UTJA 4DCDA 3NK8A 4Q63A 3SNEA 2O8LA 3UIRA 1F92A 1MQ5A 4IS5A 3F68H 1K1IA 4MNWA 2EI7A 2QF4A 2ZU3A 1OXGA 3DSGA 4NIWA 4K1EA 1CHGA 4UFGH 4O03A 1BITA 4Y6DA 4FUJA 5CDFE 2VVCA 2I6QA 1Y5BT 1ZGIA 2KCOA 1A0JA 3CS0A 1W3CA 1V2LT 5J4QA 1GJCB 3PB1E 1SBWA 1H8HD 1D6WA 3SJ8A 4GHTA 4Y0YE 1IQGA 2IPHA 2AHME 2G52A 1G32B 1NTPA 3NZIA 2A7JA 2F9PA 3BEUA 5C20A 1OWIA 1FPHH 1LHFH 2ZU4A 1RIWB 1ZPBA 1GBLA 2ESTE 3LJJA 3MFJA 1ZHMA 1THPB 4XBBA 3RXCA 1BBRK 1GHAF 1KXFA 2ZHEH 4WXVA 3GY5A 1ZTLA 2YNBA 1SGEE 1PPZA 3RXVA 3LGYA 3GY7A 4MPVA 1HJAC 4ABDA 2VWMA 2AEIH 2OBOA 1GHVH 1C1NA 2BM2A 1EB1H 5C2ZA 2BD8A 1SGPE 1C5UA 4GUXA 4FU7A 3OU0A 1PPFE 1EPTB 3RUOA 3VB7A 2ZU1A 4SGAE 1W0KD 3VB6A 1HCGA 1SOZA 1EX3A 2HLDD 4H6TA 2V3HH 4WF8A 1A2CH 2BLQA 2Y7XA 1NBMD 1C5QA 1JMOH 2KM0A 3N7EA 4Q2KA 1RTLA 4BNRA 1VITG 3M61U 4E7RG 2STBE 4H42U 4ISOA 1P11E 1VZQH 1L1GA 1YGCH 2GDDA 1QGFA 1GJ4H 1PPBH 1SGQE 2TGAA 2ZZUH 2C90B 2CF8H 2VWNA 2Z3CA 3I77A 1L4DA 3Q77A 2ODQA 4LZ1H 3SNBA 2G8TA 4XFQA 1LDTT 1FN8A 4CR9A 3F0OA 1ZR0A 1XUJA 2FXRA 2W6JD 2H9HA 2WZQA 3Q3YA 5LGOA 2RDLA 2W3IA 3ZV9A 3U1IB 2ZF0H 2BDGA 1VITF 1O2PA 1HIAA 1SHHB 5EPNA 1OPHB 1ANEA 3QWCH 5DKMA 3WY8A 3PLKA 3TJUA 7KMEH 4K1SA 1CA0B 2Y80A 4WY3A 2XC0A 2QA9E 3PO1C 1P12E 1AFQB 2GV6A 4B6EA 2XC4A 1AVXA 4GPGA 3PYHA 2QY0B 4WMEA 1O34A 1Z8IB 3ITIA 3KEEA 1K9OE 1YWUA 2C93B 3B23B 4OGXA 4JZFH 2R0LA 2HGTH 1OP0A 2EI8A 3N7DA 3F2GA 4YO9A 2G55A 3AAVA 4KTCA 2OC0A 1O38A 2A7CA 2OC1A 3SJOA 2NU3E 1NT1A 3I78A 2V3MA 3H09A 4D7GA 1AWHB 1CHOG 3UOUA 2FWWA 5EQQA 4ABHA 2AMPA 2ZHWH 2FEQH 2WYGA 1YKTA 5FPYA 1QBOA 2BY8X 2A5KA 1BQYA 1BTWA 1GBDA 2ZP0H 1AUJA 3SUDA 1KXBA 5SGAE 1TNKA 2FI5E 1P0SH 3SUGA 1FQ3A 3DUXH 2J92A 5EQRA 3TNSA 3JZ2B 4RN6A 2PWXA 2FOCA 1T8NA 1BTYA 1V2QT 2WSSD 1G36A 3A87A 1QJ6B 1UTKA 4X2WA 1V2MT 1GHBG 5FXLA 1EZUC 2C8ZB 3RXSA 3PWBA 1KIGH 1CHOF 2YMSC 3GDVA 1O2IA 4K5ZA 1H8ED 2IJD1 1T7CA 3TPIZ 1WUNH 2V6NA 4FUCA 1DWCH 4CRBA 3BTEE 5KECA 2AFQB 4NFEA 2PGBB 3Q76A 1SGDE 2GMTC 4YESB 6GCHG 1FY3A 1SKYE 2VBCA 1TBZH 3VPKA 1DICA 1JWTA 4CRCA 4FXGH 1SFQB 2I6SA 3RDZA 2ZFFH 5J4SA 1EZXC 2V35A 1ZTKA 2GDEH 4IBLH 1J15A 5TCCA 3CENA 1MUEB 2Y5HA 3BTGE 1WTHD 1RS0A 2FOAA 7GCHG 2BVSH 1S0QA 1YLCA 1IQLA 1MAXA 4X8UH 1CGHA 4YLUA 2BVXH 2YOLA 1GJ8B 3GCTG 3BV9B 3NKKA 1E1RD 4TYDA 1O5BB 1QA0A 2JETB 3TK9A 1DY9A 1QA7A 1HRTH 1MKXH 4Q7ZA 1O37A 2A0QB 4FUHA
chains in the Genus database with same CATH topology
4MLFB 1P3EA 2A7HA 3TGKE 2G81E 1GBAA 3BIVH 2FPZA 3FVFB 3SU0A 4UEHH 4JZIA 1HUTH 1DWEH 3RXIA 4TPIZ 1NROH 2VGCB 1IQNA 5AFZH 1GI2A 1EPTA 3QO6A 2Z6BD 2J94A 4Y79A 4NA9H 1LQEA 4XE4A 4K69A 2QXIA 5FHTA 3ZZAA 1CT2E 3VXEH 1GHXH 1F0RA 2W7UA 3RXLA 1IQHA 1C1OA 1TBRH 3ZVFA 1TBQH 2ZA5A 1CT4E 4M7GA 2GV7A 1UO6A 2G51A 1OWHA 1GG6B 4NA8A 1O2XA 1O32A 2VJ1A 1TPSA 2A31A 3RXMA 1IQIA 2ZHDA 1D3DB 1J17T 1FAKH 3U1JB 1GVZA 1LHDH 1SGRE 1A3BH 1UMAH 1RIWC 1TOMH 2BY5X 4Q7YA 1A0HB 4UFFH 1WTGH 5ESBA 1IHTH 4TY7A 2Z3EA 4AYYB 1QBNA 1V2ST 5DG6A 1W0ZU 5FCRA 3SI3H 1GBJA 4BTIB 2LPRA 1P09A 1DPOA 2FI4E 1EJAA 1DFPA 1GBKA 4Y11E 3AW1A 2PHBA 1O5DH 4O3TA 3UOPA 1QHRB 4ZHAA 1UVOA 4BOHA 1XUHA 1CO7E 3NWUA 1BTZA 1C2FA 2CN0H 2AGIX 1K21H 2FZZA 8KME2 1WSSH 5A8ZA 1BRBE 1BZXE 1NESE 1O5EH 5EU8A 1O3PB 1W8BH 3ATMA 2WPKS 3GDUA 4AFUA 2FDAA 1ZRKA 5GDSH 4JK6A 1O3EA 1OX1A 2ZPRA 3M3SA 3ATWA 1CT0E 3P8FA 1EOJA 3SV8A 1AE5A 1PYTD 2J9NA 4THNH 5CHAB 3HKJB 1O2HA 2G00A 2ULLA 2VWOA 1O2UA 5FBIA 1AU8A 3LH3A 2Q1JA 1BJUA 1AQ7A 1SLUB 4I8JA 4AG2A 1L1JA 3PMAB 3S0NA 3SU2A 1XUFA 2GZ9A 2XBXA 1T4UH 2ZCKP 1DLKB 1GCTC 3LPRA 4IC6A 3BTME 2PKSB 1BT7A 1Q31A 1G2LA 2BZAA 1CA0C 2FX6A 5GPIB 1GJ5H 1NFUA 1NPMA 3EA7A 1BBRE 2FP7B 1BBRH 1C5RA 1KDQB 3BEIB 1AFQC 1C1RA 3SV6A 1TMBH 1LVMA 2Y5GA 1DANH 3FAOA 3E6PH 3PMJA 1G3CA 4YT6H 3T25A 1C4V2 1WYKA 4OS7A 1AB9B 4AFSA 2ZDKA 3RC4A 4ZKOU 1NRNH 9LPRA 2ZFQH 1W7GH 4AZ2B 1D4PB 1P04A 7ESTE 3FZDA 3P8OA 2ANYA 4CRDA 1QB6A 4MPWA 2F91A 2HPPH 3ATKA 1FJSA 2WYJA 1S6HA 1E0FD 3ODDA 2ZHQH 3ZVDA 3BTTE 2OINA 4J1YA 1FY8E 2JH6D 2P3FH 5E0GA 1O3KA 3C27B 4JYUH 2ZTXA 1LHGH 1O3LA 1O3CA 3AW0A 4UDWH 1OWJA 4HFPB 1AHTH 2JKHA 1YPJH 1HAOH 1FXYA 4X1RU 2ALPA 1H9HE 1EATA 3E0PB 4WH8A 1TNHA 4TY6A 1ELAA 1NFYA 1JRTA 1P02A 3QUMP 1C5ZB 3F1SB 1NRPH 1YPGH 1DSTA 3RXBA 1IHSH 1YPMH 2UUJB 2UUYA 1ZRBA 1TA6A 3MI4A 3QTOH 4GHQA 2D26C 1FPCH 1HBTH 3P6ZB 1V2VT 3RMOH 3SHCH 1KTTB 1UCYK 1C2GA 1EJMA 1C4Y2 2Y7ZA 1A0LA 3L33A 1A7SA 5JBAS 5K0HA 1TFXA 1MTWA 1A5IA 1EAIA 1LO6A 4OS1A 4I8LA 5HM9A 3UPEA 3E1XB 2JETC 3D62A 1ZSJA 3ZVBA 1V2UT 1P10A 1O39A 3ELAH 5JB8S 1DITH 1O3NA 1O3MA 1GBEA 3A80A 3SI4H 1QURH 4GLYA 1F5LA 4U01A 1OWDA 1SR5C 2ANWA 3PMHB 5GJ4B 2D1JA 2OUAA 5FX5A 1GL0E 4UONA 2AS9A 3HK6B 3PLBA 1UTLM 1KXDA 1A5HA 4B73A 2ZEBA 2GMTB 1AMHA 2CHAB 2QXJA 3E16B 1KYNA 3ZVGA 2VGCC 2OLGA 4X6NA 3VB4A 4ISLA 4MQAA 3LGTA 2ZTYA 5E0JA 4XSKU 1C1MA 1S82A 2BQWB 1HJ9A 1X7AC 1NS3A 1BB0B 1MTSA 5E2OA 1IQKA 3MHWU 4X6PA 1WU1A 2HNTC 1ETRH 3NUMA 5GIBA 3ZZDA 3TGIE 1K1JA 4AGKA 4DW2U 1GG6C 4ISHH 1CU1A 2CF9H 5A0BA 3PWCA 5T6FA 2W26A 1EXFA 4AB9A 1C2MA 5HM2A 3LONA 5EODA 2ZCHP 3BIUH 3LJOA 1P05A 1GI0A 4ZHMU 4ABEA 3F9HA 3TU7H 1XVOA 1TPOA 1FAXA 2A5IA 2TBSA 5C3NA 2H9EH 3PTNA 1TNLA 1MZAA 2SFAA 4B1TA 1LPGB 1L2EA 3RXDA 3NXPA 4ISIH 5A8XA 1TRNA 1K2I1 2Q6DA 3UWIA 2RCEA 4X2XA 1TLDA 3H7TA 1C5VA 4DOQA 1EQ9A 2Z9IA 1P2JA 3V3MA 1QL7A 4Z0KA 1ZLRA 1KDQA 4Q80A 5T6DA 2AIPA 1YLDA 2VVVA 3KN2A 2HNTE 2PW8H 3M35A 3LGWA 4INLA 1SOTA 1ZZZA 3IWMA 2XBVA 1GHAG 2VB0A 1ORFA 1G3DA 1EAUA 1ARCA 4CRGA 1OS8A 4Q7XA 4Y76A 1SVPA 4OS6A 2HLCA 2FOEA 2Q6FA 2J4IA 1Y3VA 1G9IE 2CJIA 2BDIA 1J14A 5JPMH 1XUGA 1ELVA 1SQTA 1W11U 1XMNB 1TGTA 2A4OA 1MBQA 1ZPZA 3U9AH 5CHAC 1ELGA 1HYLA 1GBFA 5LPEA 1D6RA 1O3IA 1V2NT 1PPGE 1AIXH 1DLEA 5CE1A 2VIDA 1FDPA 4ZKSU 2BY6X 1QL9A 1Z8RA 3BG4B 5JBTA 1TONA 1BTUA 1C1VH 4MNXA 4NIVA 4JMYA 4AX9H 1LQDB 1GBHA 1TABE 1J8AA 1UTOA 3P8GA 4YOJA 5FX6A 1UVTH 4NSYA 2PKSC 1S85A 5DP9A 3HGNA 1GVLA 2ZGCA 1FY5A 1NC6A 1KTSB 1ZJKA 1AE8H 3KHVA 3K2UA 3U8RH 3FP7E 4B71A 3SQHE 1N6YA 2Y6TA 1EB2A 4GVUA 1C2JA 1NU9A 1AB9C 4X1QU 5EW2H 1FY1A 2WUCA 1UK2A 1BTXA 2RA0A 1LPZB 5LPFA 1E34B 5TCAA 2ZIQH 1INCA 5ETXA 2AERH 1OYQA 5A8YA 4LOYH 1TGSZ 1ZMNA 1L0ZA 5FBEA 1GPZA 2BHGA 3TIUA 3MO9A 4HGCA 4ZKNU 1EAXA 1B0EA 1GMHG 4K2YA 2OTVA 1O0DH 3SV9A 2C8WB 2BOKA 1XX9A 5JBBS 5L6NH 1GCTB 3SU5A 1GI6A 1TWXB 1Y3UA 1MU6B 1QCPA 1V2WT 1TMTH 1JOUB 3RXHA 2P94A 2QV1A 3GY4A 4TWWA 3SO3A 1BHXB 4NWKA 1O5CB 3MTYA 3S7HB 4JYVH 1HNEE 4AOQA 2AH4X 5EXLA 4CH8B 1S84A 2ZCLP 1C2IA 1NFWA 1GMHF 1GBMA 3GDSA 1BMAA 2NU4E 1SLWB 2PFEA 2VVUA 3DD2H 1GHYH 1YCPK 4MPXA 2ANKH 3PROA 2R9PA 2OQ5A 2OXSA 3ZYEA 1ZHPA 1Y3WA 2A4QA 1V2JT 2WPJS 3A7WA 2AIQA 1GJ9B 3MOCA 3MMGA 1GCDA 1PPCE 2H5DA 2VIOA 1XUIA 2BZ6H 4Y7AA 1SSXA 4WWYA 2O8WA 3RXEA 2J2UA 1ZJDA 3ZZ5A 2TGPZ 4WMFA 4LK4A 1TPAE 1UK4A 5A0CA 2ZDAH 1GJAB 2BD3A 1Y8TA 3RXGA 1Z8GA 1QQ4A 2HPQH 1YP9A 3OY6U 2GT8A 4JCNA 2BY7X 1W10U 1GI9B 1NM6A 2FOGA 1C2DA 3QK1A 2SNVA 1C1PA 3TH3H 1SMFE 2BD2A 1DS2E 2CHAC 1W12U 4KELA 2PV9B 3Q3XA 2BDAA 5F8XA 1AI8H 1BUIA 4ABGA 2Y82A 1TX7A 3GOVB 1V2OT 1SGFA 1GGDB 4YT7H 1T8MA 3FP8E 1SL3A 3MWIU 1UTPA 2XNIA 1O2KA 1NO9H 3M3VA 4WJG2 1Z8JB 3M7QA 1HGTH 2CGAA 2VIVA 1BTHH 1VR1H 3ESTA 1DSUA 2F9UA 1K22H 1O33A 2AMDA 1AGJA 1UTNA 1GBIA 4IMQA 1FI8A 3DFJA 2B5TB 3ZYDA 3VB3A 3PLPA 1OP8A 1V2KT 1B7XB 3SJ9A 4B2AA 4Y0ZE 1CE5A 1UCYE 1YF4A 3OY5U 1C5SA 1UCYH 4NA7A 1XM1A 4RSPA 3C1KA 3MNCA 1V2TT 3F9EA 3GICB 3QN7A 3EE0B 1O2RA 4YZUA 1FIWA 1WQVH 1MAYA 1ETTH 2ZFPH 1V2RT 2OD3B 2F9VA 1IQJA 3BTFE 3M5MA 2EC9H 1WV7H 2ZGXH 1O2WA 1KXEA 3UY9A 3P92A 4X6MA 3ZZ9A 1YPLH 2QF0A 3HPTB 4DJZB 1CBWB 1HXFH 2ZU5A 3VGCC 1QB9A 1QL8A 5DJ7A 1DY8A 4INHA 2ALVA 2ODPA 1E36B 3A88A 4Y8YA 1VJ9U 2GVFA 2XBYA 2GP9B 2PSYA 1O36A 1F0UA 2A45B 1MD7A 4X1NU 3SNDA 3FFGA 1BMMH 2O9QA 2P8OB 3BN9A 4J2YB 1LKBA 1A1RA 1V2PT 3SBKA 1BMLA 1YPHC 3KF2A 5GXPA 4DGJA 3Q3KA 4OS5A 3N7OA 4K8BA 2ZQ1A 3KCGH 3RC5A 3BG4C 2HNTF 1MTVA 2BOHB 3LT3A 1FY4A 2ODYB 3SZNA 4NSVA 1TYNA 2OBQA 2H6MA 1C1TA 2B8OH 2QN5T 2XW9A 1S6FA 1QBVH 1AKSB 1GBCA 1C2HA 4AGJA 1SPJA 3RU4E 1GDUA 2BDYA 1TGNA 3D49H 2SGEE 2R0KA 3MH5A 1AD8H 2NU1E 1ZHRA 2Z9GA 2Z9JA 1YCPM 5I25A 2EI6A 3UFAA 2QGRA 2AGGX 2LNCA 1O2QA 3HK3B 1XVMA 3A7XA 5F6MA 1DT2A 2GCTC 4R8TB 1ZMLA 3L6PA 1MBMA 1K28D 2G5NA 3GCNA 2QCYA 1O2NA 3BTKE 3LKWA 4CRFA 3CP7A 4NGAH 3SHAH 2BDCA 2BX3A 1ESBA 4NWLA 2FM2A 3A7VA 4XOJA 4Y8XA 1AFEH 1AO5A 2FMJA 2DE8A 4X2VA 3RXJA 4INKA 1A46H 4F4OC 1SHYA 1GHZA 1TIOA 1YYY1 2R3UA 3SUFA 2RG3A 4I31A 3UNSA 3VFEA 5F8TA 2AYWA 1GI7B 5DP5A 3VB5A 4IN2A 3SGBE 1ANBA 4NFFA 3PV4A 1TE0A 3MU1A 1ELTA 4MNVA 4ZAEA 5T3HA 4BXSA 1S0RA 2QF3A 1HAHH 4BAKB 1XXDA 3T27A 3RM0H 1YM0A 2IN2A 2BX4A 1TB6H 1XKAC 3D65E 1Q2WA 1FN6A 3HATH 2ILNA 1W7XH 2PSXA 2A2QH 5A2MH 1DUEA 4FVBA 3A8CA 3A8AA 1XXFA 1ELCA 3SU6A 1O30A 1ELFA 1ABIH 1UHBB 1O3AA 1QY6A 3SNAA 4BAQB 3BTHE 1HAGE 3RXQA 1HAXB 1QB1A 5F8ZA 1H9IE 5BRRE 2C8YB 3KL6A 1TMUH 1T8LA 5HMAA 2QAAA 4E7NA 5CMXH 1RJXB 4ZROA 1C1SA 5EXNA 2VIWA 1DWDH 2A4GA 2ZC9H 3SOSA 1NY22 2BMGB 3H7OA 3ZZ7A 5T6GA 3ZVCA 1MKWK 4DIHH 4ZXYH 2ZFSA 3EYDA 2M5TA 2SGAA 3LOXA 4U30A 3U8OH 1TQ7B 5BPEA 2FX4A 4CH2B 3RXOA 2DUCA 1C5PA 1O3FA 3LGIA 8ESTE 4F49A 3TGJE 1RGQA 3ZZ4A 4ZUHA 1HLTH 8LPRA 1AZZA 1GGDC 2PTCE 4ABBA 4Y8ZA 3SW2B 1ZYOA 1GI3A 1QRWA 2D2DA 3E8LA 5F03A 3UWJH 2ZFRH 8GCHG 1HDTH 1W14U 1PFXC 2FOHA 4I8GA 4BAMB 1HAIH 2R2MB 3UR9A 5I46H 1KSNA 2P3UB 1C5XB 3ZZ6A 1YCPH 2QC2A 1ZOMA 1ZSLA 1SFIA 1TNJA 3RXFA 2NWNA 4QT8C 3LDXH 4IGDA 3PMBB 1DE7H 1OWKA 3A7TA 4D76A 3KNXA 2GX4A 3A8DA 2ZGHA 1F2SE 1O3HA 1C4U2 1OKXA 1V6DA 3TK5A 8GCHF 1OSSA 1AKSA 3BTDE 2QYIA 1U6QA 4CR5A 1BOQA 1HJ8A 3RC6A 1Z7KA 4FU9A 1HAZB 1N6XA 1S81A 2UWLA 1TOCB 1C5YB 1F5KU 4OS4A 5FPSA 3SGQE 1G2MA 2Q6GA 1RTKA 2BD4A 1PQ8A 4MTBA 1AY6H 3UREA 1ESTA 1DWBH 1EKBB 1O5AB 2WINI 1OYTH 1EOLA 1P01A 1SC8U 1QNJA 1BRCE 1O2MA 5HYOA 2Z3DA 2OC7A 1CBWC 3DFLA 1C1WH 2O8TA 3RP2A 3H5CB 3G01A 3SNCA 1CGIE 2FLBH 5HGGA 1JIRA 2BYAX 3BSQA 5GCHG 6LPRA 2V3OH 3SN8A 1D9IA 3LGVA 3URCA 3ATLA 1WCZA 1YC0A 7LPRA 3ZV8A 2BDBA 2P8OC 1P9SA 2BLOA 2O8MA 1JXPA 3D23A 1QRZA 1BRAA 1O35A 2EEKA 2AGEX 3STJA 3E0NB 3A89A 1SGIB 1ZMJA 1NRQH 1S5SA 3DHKH 1AVWA 1GMCG 1LVBA 1TX6A 2J34A 1IQEA 3URDA 2O8UA 4AB8A 4ABIA 1KLIH 3GY3A 5GCHF 3FZZA 4BTTB 1CQQA 2HOBA 4OGYA 3V0XA 1YPKH 2A32A 4B2BA 3KQDA 1PYTC 2W3KA 5C5OA 4CHAC 1SQAA 3OX7U 3MU5A 2F9OA 3R3GB 1QIXB 2BY9X 3LC3A 1JBUH 1C1UH 3VGCB 5DPAA 1D3QB 2F83A 2W7SA 1UTQA 4VGCB 1SGFG 6ESTA 1H8IH 2BB4A 3T28A 3V7TA 3DT0H