3KEEA

Hcv ns3/ns4a complexed with non-covalent macrocyclic compound tmc435
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
178
structure length
178
Chain Sequence
ITAYSQQTRGLLGCIITSLTGRDKNQVEGEVQVVSTATQSFLATCVNGVCWTVYHGAGSKTLAGPKGPITQMYTNVDQDLVGWQAPPGARSLTPCTCGSSDLYLVTRHADVIPVRRRGDSRGSLLSPRPVSYLKGSSGGPLLCPSGHAVGIFRAAVCTRGVAKAVDFVPVESMETTMR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Genome polyprotein
publication title Induced-Fit Binding of the Macrocyclic Noncovalent Inhibitor TMC435 to its HCV NS3/NS4A Protease Target
pubmed doi rcsb
source organism Hepatitis c virus
molecule tags Hydrolase
total genus 43
structure length 178
sequence length 178
chains with identical sequence B, C, D
ec nomenclature ec 3.4.21.98: Hepacivirin.
pdb deposition date 2009-10-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02907 Peptidase_S29 Hepatitis C virus NS3 protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3keeA02
2.40.10.120 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 3keeA01
4ABFA 1TNKA 9ESTA 1GMDG 1ELEE 4KP0A 1TNHA 5C3NA 5TCAA 1Z6EA 1P05A 1UTMA 3PWBA 1TNLA 3P8OA 2VVVA 2G81E 1EP5A 3GISB 1ZPBA 1K22H 2OLGA 1EZXC 2XTTB 4FVBA 3K2UA 4D9QA 3HPTB 1ZTLA 4FUIA 3ZZDA 1DWEH 2D2DA 3RU4E 4X2WA 3MWIU 5JBCS 3SYJA 1SQTA 3SQEE 1VZQH 1BUIA 1OWEA 4FUGA 1SGEE 3D62A 1ZJDA 1CT4E 1OWJA 5ETXA 5DKMA 3MO6A 3HK6B 2XC5A 2PTNA 1HYLA 1LHCH 2BLOA 2PV9B 1GBCA 3LC5A 2BB4A 1PPFE 1AFQB 1YPMH 1GJBB 2ZA5A 6LPRA 2AGGX 1CT0E 1F5LA 4Y0ZE 4WVPE 4YZUA 5DP3A 1NRSH 2UUFB 1BQYA 1C4V2 4ABAA 1DS2E 2BQ6B 1M9UA 4WF8A 4NCYA 2F9PA 3STJA 2Q6GA 1QQ4A 5JDUB 3GY7A 1LHFH 4AFQA 1NY22 4DIHH 1S5SA 5E2OA 3URCA 1HAGE 3A85A 3I29A 1GHWH 2A4QA 1KTTB 4AFSA 3C27B 2AERH 5GXPA 5EW1H 1ARCA 3LJOA 2BOHB 3W94A 3FZZA 1TLDA 3A7VA 1C2EA 4YT6H 1IQFA 4AFUA 1L2EA 1P8VC 4JZIA 4AB8A 3C1KA 2CF9H 3O8DA 3K6ZA 2R2WU 1Y3YA 1FIWA 2TRMA 1V2MT 2AGIX 2P3TB 5DP9A 4RKJB 1KLJH 1YGCH 2XCFA 3SOSA 1GCTB 1GHXH 5DO4H 2OXSA 1SGPE 2C8XB 2TGAA 2XRCA 2ZFSA 3AW1A 3B8JA 3VGCB 4WMDA 1C1MA 3UFAA 5H4IB 1BB0B 1TOCB 2GD4B 5ESBA 5DJ7A 2ZPQA 1UTNA 4CRAA 1SR5C 2F9BH 3M35A 3LH1A 1F5RA 3M5MA 3OY6U 5DP5A 2IJOB 2BD7A 4Y8XA 5GNDA 1SG8B 1TA6A 4XFQA 1EQ9A 2J34A 1GDNA 3FZDA 1CVWH 2A5AA 1L0ZA 4CRBA 4NA8A 3H5CB 3P6ZB 3SO3A 3RXAA 1SL3A 3A8AA 5K0HA 2XBWA 3S7HB 2PKSB 4ZXYH 1VCWA 2Z9JA 4RN6A 1Z6JH 4U01A 5HM9A 1WBGB 1C5ZB 1AGJA 2VIVA 3E3TA 1O2NA 2P59A 1HPGA 1QJ1B 5FX6A 3TJUA 1D3TB 1LVMA 3RXLA 1TGBA 1HIAB 1UO6A 5T3HA 2ASUB 4HGCA 4AX9H 4B6FA 1O2JA 2AS9A 3A83A 1UCYE 2EC9H 2NU2E 1C1TA 1DITH 2PWXA 1O34A 3RXQA 3V12A 1EJAA 3EQ0H 1QRXA 5AHGH 3EYDA 3GYMA 3JZ1B 1GI2A 1VR1H 1C2MA 1HIAA 1BTPA 2SNVA 3BTWE 1BBRK 2ZTXA 3RMMH 1SGYE 4ABHA 2G8TA 4D8NA 4R0IA 3ATLA 1B5GH 1W11U 1OP0A 1LQDB 1OP2A 4IBLH 4ISLA 2ZEBA 2FX4A 2BVRH 4I8JA 1TQ7B 1GI5A 1ELCA 1O3HA 2HNTF 4HZHA 2ZHWH 1E0FD 1KXBA 1HAYB 1MTVA 3P95A 5B6OA 3GY6A 1MKWK 2QAAA 1O2LA 3MU0A 4Y76A 1GHYH 1AE8H 4UFDH 1CU1A 1O5GH 2BD3A 2ZFRH 2Y81A 1AUTC 1E36B 1SBWA 1FJSA 1G30B 1QA7A 3GY3A 2ILNA 1YC0A 2G5VA 1Z1IA 1E38B 5LH8A 4NIXA 4NIWA 4Y79A 7GCHF 2A4GA 1GJ7B 1XUJA 1UVTH 1ELVA 1C2GA 2CMYA 1AZ8A 1O38A 4NIVA 1IQGA 3Q77A 3LGYA 2BY7X 1KDQA 3NPSA 5LPRA 2R9PA 3LGWA 3CP7A 5A0AE 2BMGB 5E0JA 3QUMP 2ZNKH 1AO5A 4B2CA 2QIQA 4Y7BA 1O2TA 4BAKB 2H1UA 3TJOA 3IG6B 3UOPA 4NFEA 1KSNA 1HAVB 2BX3A 2QF0A 1O35A 3EAJA 5IYTA 5FBIA 4KKDA 5FCKA 4X1NU 2BY8X 4CRDA 3GY5A 1O2ZA 1V2PT 1GMCF 1YCPK 1G3CA 5EQQA 1O3JA 4JZEH 3T29A 2HNTC 7KMEH 4F49A 1HAVA 1JRTA 1MD7A 4CREA 4XOJA 2WPJS 3U1IB 1FY1A 1AB9B 1IQIA 3K6YA 2R2MB 1QBNA 3KHVA 3ATMA 2ODPA 3K65B 3A81A 2V3OH 3SU6A 1J17T 2GMTC 3M3SA 1Q31A 1GBFA 3RMNH 4DJZB 1D3QB 1TYNA 1KXAA 1F5KU 5EXLA 5AVDA 1RRKA 4SGBE 2AIQA 1NRRH 2BVXH 1ABJH 1YCPH 3F9FA 1O3KA 5B6LA 3BTKE 2XNIA 2DE8A 1HAZB 4ABDA 1HB0B 1XVOA 3KNXA 3KGPA 3E0PB 2SGDE 2O9QA 2FTLE 1Z8IB 3LC3A 3RXRA 1C5UA 1NU9A 3PB1E 1TMUH 1JBUH 2O8LA 1GGDB 1MCVA 3U69H 3H09A 1VITG 1UTQA 1YCPM 2Z9KA 4CRFA 1TBZH 1ESTA 3N7OA 1BHXF 1Y3XA 4K8BA 5E0HA 1Y3WA 4B2AA 3GDVA 5JPMH 5LPFA 5EPNA 3RXMA 2F9UA 1DPOA 2O8UA 5A0CA 1L1GA 3GCTF 4AOQA 5L30H 3S69A 1AQ7A 3MU5A 2BLVA 1IQHA 2OCVB 2PLXA 1EPTC 1MAYA 8ESTE 1F2SE 1UK2A 3VEQB 2RDLA 1V2VT 2A7CA 1S6FA 2WINI 1Y59T 3ZV9A 3MH6A 4XE4A 4FVDA 3OSYA 3M61U 2PHBA 4DY7B 4MDSA 3ELAH 1K1NA 2AH4X 2ZQ1A 1P2MA 2J4IA 1HRTH 3KQEA 1ZHPA 1AKSA 3A89A 1HXFH 1TX8A 2C8WB 1C9PA 2ZF0H 4H6TA 3OTPA 1B0FA 1P2JA 3GCNA 2FMJA 1WUNH 1CA0C 3BEIB 3BTTE 2FLRH 1HJAC 2FXRA 3NWUA 4FUFA 1FAKH 1NT1A 3NKKA 4JZDH 4AGKA 1QB1A 1E35B 1C1VH 2FIRH 5T1VA 3V3MA 4MVNA 1QJ7B 4INHA 3UQVA 1BOQA 1GL1A 1SVPA 3RXJA 1YYY1 2ZC9H 3R3GB 2P16A 2RA0A 5JBBS 3V0XA 2A7JA 3SI3H 1G2MA 2EI7A 3RC6A 1O2UA 2BQ7B 1O37A 1OXGA 1W3CA 2Z9LA 3SJIA 2EI6A 4D7FA 1QHRB 3AVZA 3SNBA 3Q76A 3EE0B 4X8TH 1FUJA 1WYKA 3LU9B 4YOGA 1GJ6A 1NPMA 1XMNB 2GX4A 1C4Y2 5L2ZH 1MQ5A 3MU1A 1MBQA 4VGCC 1XUFA 1YPHC 1AVWA 6CHAB 4HI3A 1NM6A 3KEEA 1SQOA 2VWNA 4ISHH 4M7GA 1HLTH 3ZZ9A 5HYOA 4JYUH 2H5DA 1QL8A 2VGCB 1CA8B 4X6MA 4K69A 1LPKB 2PUQH 3A84A 3BG4B 3NUMA 3P92A 1N8OC 1HJ8A 4I8LA 5EODA 3MFJA 3SU2A 2QV1A 2BHGA 2BD8A 1MUEB 5C1UA 4GAWA 3DHKH 4X6NA 5K7RA 2OBOA 2C4FH 4NG9H 1OYQA 1NFXA 5FXLA 1Z1JA 1K21H 2BX4A 1K1OA 4MNWA 4WWYA 3LJJA 8GCHG 4MNXA 1F0TA 3SBKA 4BTUB 3TH4H 5AFYH 3GCOA 1XUGA 4FU9A 1GPZA 1V2NT 2C90B 1D6RA 2BY9X 1WAYB 2ZDLA 1A5HA 2BXTH 1TGSZ 4ABEA 3Q3YA 2W7UA 3MH5A 4ABIA 1EOLA 4FU7A 1G37A 3SNDA 3AAVA 3ODDA 2GCHG 3KQCA 1T8LA 2CV3A 3RXCA 1BRUP 1O2VA 1QY6A 3TJVA 4BXSA 2PTCE 3UIRA 3DFJA 1O3NA 4TWWA 3MMGA 3ZVBA 4WJG2 1QRZA 2PGBB 1PPCE 1P10A 1Y5BT 2OC8A 2WV9A 2ZDAH 2CJIA 2Z3DA 4ZKOU 2ZFPH 5IDKA 4A1VA 1UK3A 1GJ9B 2WPHS 1ID5H 1K1PA 2J38A 1JMOH 1SLUB 2BDAA 1C5TA 1FNIA 1O5FH 3RLWH 1AIXH 1P9UA 4H42U 4BAHB 3DFLA 4GUXA 4X1QU 1YPKH 4ISOA 4WMFA 1DICA 3UNQA 1ORFA 1ZPCA 4BTTB 1SI5H 3ATIA 2VIQA 3SHCH 1OWHA 2BY6X 1BIOA 2A7HA 2KAIB 1MZDA 2OINA 4ZAEA 1Z8GA 3KN2A 4LXBH 2BYAX 1UVSH 1MKXH 4FUBA 3UOUA 3MYWA 3WY8A 1P09A 1NTPA 3LPRA 5I25A 1RTFB 3PO1C 3MU4A 1DUAA 1P03A 2JH5D 1GJ4H 1FY8E 2F9OA 1UTOA 1O2YA 1RIWC 1FZZA 1NFWA 2FOFA 1E37B 2SGEE 2FP7B 1IHTH 3M5OA 3BTME 3SV2H 2H2ZA 1SOZA 3BTQE 2A5KA 2SGPE 4KELA 1DWCH 1S82A 1GI8B 2IOTA 2HWLB 1SGNE 4X6PA 5GJ4B 5EOKA 1S6HA 2B0FA 3RP2A 5E8EH 2Z7FE 1SGIB 3SGQE 3UWJH 1H9HE 2V6NA 3S9AA 3SGBE 2XC0A 1GJDB 4UONA 3P8FA 3ZVAA 2TGTA 1JIRA 2GT7A 2R0KA 1GVZA 1HJ9A 2QN5T 2STAE 2ZPSA 3MO9A 3H7TA 3PMAB 3T26A 3P17H 3ZV8A 1TBRH 1IQJA 3QGNB 4Y10E 5FBEA 1YBWA 5T6FA 1GI9B 4A5TS 2GTBA 2G52A 4MNVA 1GHBG 3M5LA 1O2RA 4IC6A 5DPAA 1A46H 2F91A 3P8GA 2ZTZA 3QX5H 1O30A 1C1QA 3B23B 2WV4A 1TPPA 2TIOA 1P2OA 1DWBH 1OWIA 2OQUA 2C8ZB 1PJPA 3FAOA 3STIA 2WZQA 5A8XA 4NWKA 1P04A 1AWFH 2ZDNA 3TGKE 1GG6C 1TFXA 1RXPA 1PPGE 2JETC 1MU8B 1MTNC 4BAOB 4LZ1H 1H8DH 1EZQA 1A7SA 2FO9A 1GMHF 4JZFH 4WY3A 4Y11E 3BTEE 3V7TA 3U1JB 1LVOA 2UWLA 2QCYA 1ELGA 1FY3A 3K9XB 4B75A 1FV9A 1HAIH 1AFEH 3A7TA 1TBQH 4Y8YA 1O2IA 1RS0A 2PKAB 3T5FH 6GCHG 2XWAA 3SUFA 4ESTE 1DM4B 1VITH 2A1DB 2ZHFH 4X1RU 4NSVA 1BMMH 5EW2H 3LGVA 1O31A 1SFQB 3MHWU 1NFYA 2FESH 3SQHE 4OS4A 3QO6A 1C5YB 2VVCA 1Y8TA 4NWLA 1V3XA 4DG4A 1TB6H 4CRCA 1SGDE 1ZMJA 2Y5FA 1Y5UT 1BTXA 2WUCA 2GCTB 3PMBB 1ANDA 4K1EA 4KTSA 1O2HA 2ESTE 1QRWA 3RXDA 1O5CB 4X1SU 5F8TA 3A80A 2O8MA 4FUDA 2XYAA 1F0UA 4OS5A 2A45B 1CO7E 1OKXA 1ETRH 1T8MA 1NRNH 4NA9H 1O2OA 1JIMA 2QC2A 5FPTA 2ZGJA 1V2RT 2BZ6H 4ISNA 2PGQB 1T32A 2H5CA 3M36A 1C9TA 1TPSA 1GBBA 3UWIA 4E7RG 2PSXA 1BJVA 3L33A 1XX9A 1KIGH 2XBXA 2ZGCA 1EAIA 2H9TH 4I33A 3P70B 1SSXA 1P01A 5C5OA 4Y0YE 4B1TA 3MNSA 1QTFA 1O5EH 3F9EA 5GPIB 1UHBB 1W0YH 2HGTH 4MNYA 1EJNA 1P11E 3T25A 5JB9S 4E05H 4NSYA 1N1LA 1ZR0A 3QDZB 1EUFA 2GT8A 3EDXB 3RXIA 1XXFA 4I7YH 2VWOA 1GMDF 4JZ1A 4XBBA 1UHBA 1WOFA 3ZVDA 3AASA 5DK1A 3MH4A 3JZ2B 1TGTA 2ZHDA 2J9NA 3U8TH 1GBAA 1ZTJA 2R3UA 5EXNA 2GVFA 1C5PA 1CQQA 2CXVA 3VGCC 3T28A 1AU8A 1S84A 4XBDA 4AG1A 2PFEA 2LNCA 3LOXA 5FCRA 3Q3XA 1TRMA 1A0HB 1C2HA 2BOKA 1QR3E 4IMQA 1EB1H 1BTHH 2AGEX 3TK6A 1V2LT 1TPOA 4GHQA 5F6MA 1PYTC 3KIDU 2GKVE 1HAPH 3GY8A 1MD8A 1MH0A 1O2PA 2OD3B 1KXDA 1Q2WA 1EB2A 1YKTA 3VB4A 3GCHC 5G4BA 4NZQA 1IAUA 2DE9A 3IITA 3VXEH 1ELTA 2G4UA 2ZFTA 1K1LA 2JH6D 3ZZCA 1Z8RA 5HMAA 2ZFFH 3TLOA 1BTUA 3D65E 1W8BH 3QZRA 1BBRH 1UMAH 1O2WA 3ZZ4A 3PWCA 2VH6A 4IGDA 3QTVH 1A3EH 1QIXB 3I78A 4AZ2B 1KTSB 1ZSKA 1YP9A 1OYTH 1O5DH 1EKBB 4OS7A 5GIBA 4DURA 3QTOH 3URDA 3LKWA 3CENA 1ACBE 1O2GH 1LMWB 3BSQA 1MKWH 2P3UB 2ODQA 3SZNA 4B73A 3F68H 1DY8A 1JRSA 1GI6A 1BTWA 1QQUA 1QJ6B 2ZI2H 3E16B 1K1MA 1P2IA 1AMHA 1O3IA 2JKHA 3GICB 1SLWB 1A61H 4MLFB 1QL9A 3TITA 1MMJN 1YPLH 1O3PB 2SGQE 1PQ8A 2VIOA 1GJ8B 1EX3A 2J94A 4I32A 4O03A 3VPKA 2C8YB 2QGRA 3ZZAA 2Z3EA 1A5IA 2GGVB 1LTOA 4XSKU 2BDGA 4Y7AA 4BOHA 1SGRE 1SGFG 3VXFH 2ANWA 2P93A 1NZQH 4OGYA 4DVAU 1O5BB 2FI3E 3OYPA 1C4U2 3BEFB 1MQ6A 5T6DA 1D3PB 1LQEA 1CGHA 2ZHEH 4ISIH 1H8IH 3A7ZA 5GCHG 3E90B 1W7XH 1LPGB 1CE5A 1WV7H 3D49H 3NZIA 1V2WT 5ABWA 1ELFA 1L1NA 1WQVH 2ZHQH 4X2XA 1HNEE 3HKJB 7LPRA 3F1SB 4OGXA 1GI1A 1C5WB 4YLUA 1EAWA 3PV2A 3ESTA 4X6OA 3ZVCA 4MTBA 1GHAG 4X8SH 3SUDA 2ZIQH 2A0QB 2BD4A 2HALA 1QBOA 1CA0B 1VGCC 3PYHA 3UPEA 2OC0A 1HJAB 3SNEA 1DY9A 3TU7H 2FM2A 1O33A 3FP7E 3LONA 5TJXA 2QF3A 1FAXA 1TE0A 2F83A 4D76A 1LO6A 1XM1A 4GHTA 4NFFA 1GL0E 2M5TA 1CHGA 3CS0A 2PW8H 1O36A 1WQSA 2FOBA 3F9GA 1W2KH 1SMFE 4FXGH 1HUTH 2Y5HA 3T62A 1AB9C 1H1BA 2GDDA 1WCZA 1CSOE 1ZHRA 3RC5A 3A7WA 4BAMB 1HV7A 3ZZ6A 1YF4A 3SV7A 2NWNA 3M7UA 3QZQA 4WH6A 2FOHA 3SU4A 2ZP0H 1SHHB 1ETSH 1RJXB 4GCHG 1A4WH 4CH2B 1DXWA 1K1JA 1O2SA 4JCNA 4D9RA 2BDHA 1JOUB 1AVXA 2WHXA 4VGCB 2ZQ2A 4A7IB 3O8BA 4B6EA 1BMNH 2FEQH 4JK5A 2VU8E 2EEKA 1IQNA 3RMOH 3IWMA 2OK5A 1UVOA 3UTUH 1INCA 1ZSJA 3ZVGA 5HGGA 2Q1JA 1GDUA 1ZJKA 1G9IE 1GBJA 1TAWA 3M5NA 3W95A 2HPPH 1QNJA 2I6QA 1FXYA 1ZYOA 1TOMH 4IN1A 1EATA 4NIYA 4ZHLU 4ZMAH 8LPRA 2BD9A 1SGQE 1D6WA 4J2YB 5E0GA 4OM9A 5FX5A 1V2QT 1GBDA 3MNBA 2HOBA 5HXFA 2RCEA 4THNH 2R3YA 1ZHMA 1BTYA 1TIOA 1HAOH 4QT8C 1NROH 4YOIA 1ANBA 4TPIZ 1C5OH 5DP4A 4I8GA 1GJ5H 8KME2 1BBRE 1D9IA 3RXEA 1H4WA 1MTSA 3TGJE 5FAHA 3UREA 1CGIE 3LIWA 2K1QA 2A2QH 3SORA 1GVKB 2BDIA 1C1UH 1TGCA 2ZU2A 1AZZA 1BRCE 1OWDA 1ZGIA 2UUKB 5FPSA 1AE5A 1P57B 1P2QA 5BPEA 1H9IE 3LH3A 4JYVH 1EXFA 3O8CA 5C1YA 1ZRKA 1V2OT 4AGJA 1S0QA 1SGFA 4X2YA 5T6GA 2THFB 2BZAA 3RXSA 1S81A 1EAUA 3UUZA 5DP6A 3PLKA 2F3CE 1C2IA 1TALA 2NU4E 2VVUA 3TNSA 1P12E 3A7YA 1WXRA 5CHAC 3AAUA 2XW9A 1FY5A 1C1RA 4WH8A 1QGFA 2PR3A 1GBIA 3ATKA 1VITF 3DA9B 1GBLA 3ZVEA 3EA7A 2ALVA 1G32B 1XUHA 2BDBA 1V2TT 3TNTA 2Z6BD 4Y8ZA 1TNGA 4X1PU 4YM9A 4BTIB 4H4FA 1FQ3A 4UDWH 5HM2A 4YO9A 1DX5M 1O2KA 2VGCC 3D23A 1UVUH 1C1SA 3T27A 3VB7A 2ZTYA 1J8AA 1ZTKA 3TGIE 2CHAC 2ZDMA 5A2MH 5DG6A 4ZXXH 1FPHH 3BG4C 3UNSA 4K1TA 1PQAA 1FPCH 1LKBA 1ZMNA 2GV7A 4TY6A 5EU8A 1UK4A 3SV8A 2J92A 2H9HA 4IW4E 1HFDA 3F6UH 3SN8A 9LPRA 7ESTE 2WV5A 3M7QA 4YLQH 3PM3A 3BV9B 3P8NA 4AB9A 4AG2A 1KY9A 1A0JA 2W26A 4CBOA 2VIPA 3M7TA 1AN1E 4ASHA 2TGPZ 3BTHE 4Q80A 3SW2B 1O0DH 3TH3H 1SGCA 1UTKA 1EAXA 2NU1E 3A7XA 2WYJA 2ZWLH 4E06H 3E1XB 1G3DA 3M3VA 1ELBA 2VIDA 2ODYB 4HTCH 2JH0D 4WXVA 1P3EA 1LPZB 1T7CA 1ZZZA 4ZROA 1A3BH 2P8OC 2RA3A 1C1OA 2UWOA 2AMDA 2BXUH 1YLCA 1RD3B 1P3CA 1W10U 2ALPA 3FVFB 4U30A 3TK9A 3SJOA 5E2PA 4IS5A 1THRH 1OSSA 2W3IA 1CBWC 2WYGA 5ESTE 1O3AA 2KAIA 1DXPA 3TIUA 1QB6A 1THSH 4AFZA 4XBCA 2VWMA 2TGDA 2W7SA 3O8RA 1FLEE 3R0FA 1Y5AT 5C20A 1BTZA 4A6LA 3SU5A 1O3OA 2FYRA 4ABJA 2VJ1A 3QGJA 1U6QA 1O2MA 1N6YA 2ZG0H 3SHAH 4M9FA 3U8RH 3ZYEA 1C2JA 1SGTA 4Q7XA 2SGFE 1EP6A 1GG6B 3V13A 1BCUH 2XBYA 2JETB 3BN9A 1S85A 2A31A 4X0WU 5FPYA 1LHDH 1VJ9U 2WPLS 4ZH8A 1OWKA 4IMZA 5I46H 1FN6A 3E6PH 3MNXA 1EJMA 1B0EA 2QA9E 2ZCLP 3M3TA 3U8OH 4RI0A 1ESAA 3A8BA 3RM2H 1BA8B 2HNTE 4LZ4B 2XC4A 1TONA 8GCHF 1MBMA 2Z94A 3ATWA 2BLQA 4B71A 1ABIH 1FONA 2OBQA 5A0BA 4ZKNU 1P2KA 1GI3A 4CHAC 3ZZBA 1PQ7A 2ZFQH 4MPUA 2FOEA 2OTVA 2HPQH 5CMXH 1ARBA 1C5MD 2XXLA 1O2QA 2AYWA 1BRBE 2FS9A 5EG4A 2GCHF 1O3MA 3OX7U 1C5VA 1GBTA 1TPAE 2H6MA 3RXFA 5JYIA 4DOQA 1W7GH 1BZXE 2IN2A 2AMPA 1CHOG 3BG8A 1O3BA 2ZU4A 3PLBA 2GDEH 3E91A 3FFGA 2ZKSA 2BDYA 2ZDVH 1QURH 3KF2A 2W3KA 3ZZ8A 1O3DA 1V2ST 2PUXB 3PTBA 4CBNA 4YOJA 1NS3A 1IQKA 3RU4T 5AFZH 3OY5U 2ANMH 2UWPA 3UR6A 1UVPA 1XKAC 2Q6DA 3ZYDA 1YPEH 3LGIA 1C1WH 1SB1H 4UE7H 2DUCA 3A8DA 2GP9B 3SU0A 1G3EA 5SGAE 1J9CH 3GDSA 3G01A 4DIIH 3PTNA 5C5NA 4O3TA 1A2CH 7GCHG 1PPBH 1T4VH 1MAXA 4FUJA 2PKAA 1KXCA 1X7AC 1XVMA 1DLEA 1IOEA 4O97A 2ANYA 1NRQH 2FOAA 4JMYA 3TK5A 1TNJA 1GI7B 1DDJA 3LT3A 5LGOA 1EZUC 2TBSA 1KLTA 2AIPA 1HAXB 2OQ5A 2QXHA 3Q3KA 2PSYA 1HAHH 1N6XA 4R8TB 1EASA 2SGAA 1TMTH 1AFQC 2HRVA 1IQLA 6ESTA 3LDXH 4AYYB 1ZGVA 1L1JA 4I31A 1GI4A 2O8TA 1TMBH 4UFEH 1T8OA 2BY5X 1LVBA 5A09A 1EOJA 1L4DA 4TY7A 4MPVA 3GOVB 1GMCG 1Z8JB 3SJ8A 1NFUA 1OP8A 1QA0A 4Q2KA 4DCDA 4YT7H 1K9OE 1YM0A 1V2KT 2QXIA 5C2ZA 3SJ9A 1TWXB 2GV6A 3S0NA 1GI0A 4ZHAA 3SNAA 1FY4A 2ZGBH 1GHVH 3PV5A 1LHGH 2QY0B 3GY4A 5EPYA 2Y5GA 1AD8H 2VIWA 1D3DB 2A2XH 3GCHB 1DSUA 1IQEA 1O2XA 1F0RA 1XUIA 1F7ZA 3MH7A 1TABE 1LHEH 2WPMS 2GCTC 4ABBA 2ZDKA 2TPIZ 2F9NA 4OS6A 2YOLA 3ZZ7A 4DW2U 1TRYA 4UFFH 2BD5A 1GCTC 4BAQB 1GHBF 2Q6FA 1C2FA 3RLYH 4U2WA 5DP8A 5JBAS 1YPHE 4AYVB 3AK5A 1W0ZU 5DP7A 4OS1A 4ABGA 4Y6DA 3QK1A 1ZLRA 1SLXB 1YPGH 2J2UA 3E8LA 4GVUA 2G5NA 1WU1A 4INKA 1J15A 4NZLA 3E0NB 3S9BA 1NU7B 2AEIH 1FIZA 1G3BA 3FP8E 1MCTA 1AVGH 4FUEA 1GCDA 3GCTG 1GJAB 1O3GA 2PKSC 2B9LA 2QYIA 4TPYA 3EA9A 1DWDH 2I6SA 1K1IA 1CHOF 1HDTH 2ZGXH 5JBTA 3CS7A 5A8ZA 1NESE 4BXWA 4NGAH 4B76A 6GCHF 5PTPA 1FI8A 3UNRA 1TQ0B 1PPZA 2ULLA 3OU0A 2YNBA 3UY9A 3BIVH 4TWYA 1KDQB 1BJUA 1P02A 1PPEE 2ZGHA 5AF9H 1TGNA 3SI4H 2BM2A 5L2YH 2GMTB 3MU8A 5J4SA 1TNIA 1ZOMA 2B7DH 4ZUHA 1O3FA 3GYLB 2GZ9A 2XBVA 3BF6H 1NC6A 3VB5A 1HCGA 3BIUH 1BT7A 1C5XB 4B2BA 1RTLA 1QB9A 3QWCH 1BRAA 1FN8A 1T31A 1C2LA 1GBEA 3TPIZ 1T4UH 4JYTA 2F9VA 1NO9H 2OC7A 1MU6B 2WPKS 3PMHB 1KXFA 1SLVB 2UUYA 3U9AH 1C2KA 2LPRA 1C1PA 2XWBI 4FU8A 2ZU3A 4K3JA 4PROA 1OX1A 4I8HA 3VB6A 1VGCB 1BITA 3L6PA 3OTJE 1NRPH 4AN7A 1P0SH 3L3TA 1C5NH 3RDZA 2P3FH 3KQDA 2G55A 2B8OH 3S9CA 5GDSH 2FS8A 2FTMA 1T8NA 4XDEA 3SU1A 2Z3CA 2SFAA 1FMGA 2OUAA 1EPTB 2BTCE 5J4QA 3SGAE 2ZECA 1S83A 1P06A 1L4ZA 4Q7ZA 2FLBH 1ANCA 4K60A 5GWZA 4A1XA 4INLA 4GLYA 4Z6AH 2XCNA 1O5AB 1IHSH 4K2YA 5EXMA 5EQRA 2C3SA 1ZRBA 3TJNA 1EPTA 3EGKH 1O32A 4BANB 2EA3A 1ELAA 4CH8B 4J1YA 1THPB 2Y7ZA 1O39A 2FODA 1DANH 2GZ7A 4K8YA 4X8VH 3SUGA 2FPZA 3UR9A 1P9SA 1DE7H 3HGPA 1KLIH 1GWAA 3BTDE 2GZ8A 3T2NA 3RC4A 1A0LA 5DGJA 1Z71A 4D7GA 3SV6A 1HBTH 1Y3VA 2VINA 3NCLA 4GPGA 3S7KB 1TX6A 4GSOA 5LPEA 2D8WA 3TVJB 2B5TB 5EGMA 1DFPA 2AMQA 4RKOB 2BDCA 2CGAA 1BHXB 4Q7YA 3U98H 3BEUA 5BRRE 1PYTD 3QLPH 1G36A 1GVLA 1LVYA 1MTUA 2FDAA 1C5RA 2ZPRA 1GHZA 2CF8H 3LGUA 1AKSB 2Y6TA 2AFQB 4F4OC 2FOMB 4HFPB 4MQAA 1Q3XA 2G4TA 2O8WA 3RXPA 4LK4A 4DT7B 1ZMLA 1DVAH 4KTUA 4SGAE 1A5GH 4FUHA 4OS2A 3A82A 2VH0A 2IPHA 3BTGE 5EQSA 3VB3A 3GDUA 1O3EA 1V2UT 2STBE 4UEHH 4Y71A 1N8OB 3DUXH 1GDQA 1D4PB 1K28D 1GGDC 2FZZA 1SHYA 1SPJA 4K1SA 5JB8S 2H9EH 3HKIB 1O3LA 3RXUA 1HGTH 1V2JT 2ZCKP 3RMLH 5C1XA 3HGNA 1V6DA 1NN6A 1FDPA 1PFXC 1QL7A 1BMLA 4MPXA 3MO3A 4I8KA 2F4LA 2NU0E 1PPHE 1C5QA 3RXHA 3TH2H 1SOTA 1HXEH 4IN2A 1UTLM 3VFEA 3HK3B 2P95A 2BVSH 3AW0A 1C1NA 5CHAB 1VJAU 3MTYA 1KXEA 4JK6A 2FOCA 3A8CA 4B74A 4MPWA 3DT0H 4IC5A 4RSPA 4X2VA 1UTJA 2G00A 3B9FH 3RXTA 4NA7A 2YNAA 1LCYA 2C93B 4H6SB 5A8YA 4KTCA 3F9HA 1DLKB 2Y7XA 3LGTA 3ZZ3A 3BTFE 1UTPA 4E7NA 1ETTH 5GCHF 2HVXA 1W12U 1OPHB 4CR5A 5FHTA 2A4OA 2BQWB 2V0BA 3MI4A 3KL6A 4A92A 1XUKA 1TRNA 3RU4D 4CRGA 1QBVH 1WTHD 2CHAB 1OOKB 1AHTH 2VB0A 1DT2A 1RFNA 4K5ZA 5CE1A 1P2NA 1AUJA 2J95A 2V35A 3GY2A 1ZPZA 1GHAF 5F03A 1DSTA 2ZO3H 1XXDA 1A1RA 1GBMA 1MZAA 2OC1A 2Z9IA 3A86A 1F92A 2SNWA 1C2DA 1J16A 1Z7KA 2ZCHP 1AWHB 1BDAA 3FP6E 3KQBA 1SC8U 2CN0H 1W13U 3SV9A 1TX7A 1DUEA 2ANKH 1SQAA 1ESBA 2BD2A 1AI8H 1OS8A 6CHAC 3SZEA 3QN7A 1MTWA 2Y82A 1BMAA 1S0RA 2D1JA 1SFIA 2HLCA 5C67A 1XKBC 2P8OB 2FI4E 2W5EA 1CT2E 2QXGA 1G2LA 1IQMA 4BNRA 2RG3A 3SU3A 2VNTA 3PO1B 1C5SA 1F0SA 4O9VA 1J14A 1CBWB 1RIWB 2A32A 1GMHG 4ZKSU 3RUOA 2R0LA 1KYNA 4UD9H 5F8ZA 3ZVFA 1GBHA 1LDTT 4GCHF 1ZSLA 3SUEA 1DOJA 1YLDA 4MG3A 5L6NH 4AORA 3MOCA 5TCCA 4WMEA 3UQOA 2OP9A 4ZKRU 2FX6A 1UCYK 3PMJA 2FOGA 2G51A 1GJCB 3RXOA 2A5IA 1MKXK 3PLPA 2QXJA 4UFGH 1QCPA 1EZSC 3RXKA 1B7XB 1H9LB 4YESB 1K2I1 1E34B 2ZU5A 1GBKA 3A87A 4A1TA 4Z0KA 2FYQA 3RXVA 1VCPA 3SNCA 3FANA 4O3UA 4YTAA 2A4RA 3PROA 3Q00A 1VCQA 1YPJH 1C5LH 1CGJE 1WTGH 3RXBA 3KCGH 1PQ5A 3SJKA 3NK8A 3H7OA 1JWTA 1ELDE 2Y80A 4KGAA 3I77A 3ODFA 2FWWA 1AY6H 1RTKA 1O3CA 2D26C 2IJD1 4FUCA 2WPIS 1ANEA 2BLWA 1UCYH 2P94A 1JXPA 2ZU1A 4TYDA 2ZZUH 3ITIA 1UJ1A 2V3HH 2Z9GA 3EA8A 3RM0H 3NXPA 3ZZ5A 2UUJB 4WXIA 3DD2H 1TA2A 4CHAB 2FI5E 4U32A 2NU3E 1MTNB 3ENSB 3RXGA 2VBCA 2EI8A 1LKAA 2WUBA 3A88A 3MNCA 5F8XA 1W14U 3PV4A 2VWLA 4X8UH 4DGJA 4LOYH 1Y3UA 4ZHMU 1QFKH 4CR9A 3M37A 1WSSH 1RGQA 3HATH
chains in the Genus database with same CATH superfamily
4ABFA 1TNKA 9ESTA 1GMDG 4AC9A 1ELEE 4KP0A 1TNHA 5C3NA 5TCAA 1Z6EA 1P05A 1UTMA 3PWBA 1TNLA 3P8OA 2VVVA 2G81E 1EP5A 3GISB 1ZPBA 1K22H 2OLGA 1EZXC 2XTTB 4FVBA 3K2UA 4D9QA 3HPTB 1ZTLA 4FUIA 3ZZDA 1DWEH 2D2DA 3RU4E 4X2WA 3MWIU 5JBCS 3SYJA 1SQTA 3SQEE 1VZQH 1BUIA 1OWEA 4FUGA 1SGEE 3D62A 1ZJDA 1CT4E 1OWJA 5ETXA 5DKMA 3MO6A 3HK6B 2XC5A 2PTNA 1HYLA 1LHCH 2BLOA 2PV9B 3FN8A 1GBCA 3LC5A 2BB4A 3DSOA 1PPFE 1AFQB 1YPMH 1GJBB 2ZA5A 6LPRA 2AGGX 1CT0E 1F5LA 4Y0ZE 4WVPE 4YZUA 5DP3A 1NRSH 2QE7D 2UUFB 1BQYA 1C4V2 4ABAA 1DS2E 2BQ6B 1M9UA 4WF8A 4NCYA 2F9PA 3STJA 2Q6GA 1QQ4A 5JDUB 3GY7A 1LHFH 4AFQA 1NY22 4DIHH 1S5SA 5E2OA 3URCA 1HAGE 3A85A 3I29A 1GHWH 2A4QA 5HIZA 1KTTB 4AFSA 3C27B 2AERH 5GXPA 5EW1H 1ARCA 3LJOA 2CK3D 2BOHB 3W94A 3FZZA 1TLDA 3A7VA 1C2EA 4YT6H 1IQFA 4AFUA 1L2EA 1P8VC 4JZIA 4AB8A 3C1KA 2CF9H 3O8DA 3K6ZA 2R2WU 1Y3YA 1FIWA 2TRMA 1V2MT 2AGIX 2P3TB 5DP9A 4RKJB 3W1EA 1KLJH 1YGCH 2XCFA 3SOSA 1GCTB 1GHXH 5DO4H 2OXSA 1SGPE 2RFKC 2C8XB 2TGAA 2XRCA 2ZFSA 3AW1A 3B8JA 3VGCB 4WMDA 1C1MA 3UFAA 5H4IB 1BB0B 1TOCB 2GD4B 5ESBA 5DJ7A 2ZPQA 1UTNA 4CRAA 1SR5C 2F9BH 3M35A 3LH1A 1F5RA 3M5MA 3OY6U 5DP5A 2IJOB 2BD7A 4Y8XA 5GNDA 1SG8B 1TA6A 4XFQA 1EQ9A 2J34A 1GDNA 3FZDA 1CVWH 2A5AA 1L0ZA 4CRBA 4NA8A 3H5CB 3P6ZB 3SO3A 3RXAA 1SL3A 3A8AA 5K0HA 2XBWA 3S7HB 2PKSB 4ZXYH 1VCWA 2Z9JA 4RN6A 1Z6JH 4U01A 5HM9A 1WBGB 1C5ZB 1AGJA 2VIVA 3E3TA 3KQ5A 1O2NA 2P59A 1HPGA 1QJ1B 5FX6A 3TJUA 1D3TB 1LVMA 3RXLA 1TGBA 1HIAB 1UO6A 5T3HA 2ASUB 4HGCA 4AX9H 4B6FA 1O2JA 2AS9A 2PP6A 3A83A 1UCYE 2EC9H 2NU2E 1C1TA 1DITH 2PWXA 1O34A 3RXQA 3V12A 1EJAA 3EQ0H 1QRXA 5AHGH 3EYDA 3GYMA 3JZ1B 2J5UA 1GI2A 1VR1H 1C2MA 1HIAA 1BTPA 2SNVA 3BTWE 1BBRK 2ZTXA 3RMMH 4XRNA 1SGYE 4ABHA 2G8TA 4D8NA 4R0IA 3ATLA 1B5GH 1W11U 1OP0A 1LQDB 1OP2A 4IBLH 4ISLA 2ZEBA 2FX4A 2BVRH 4I8JA 1TQ7B 1GI5A 1ELCA 1O3HA 2HNTF 4HZHA 2ZHWH 1E0FD 1KXBA 1HAYB 1MTVA 3P95A 5B6OA 3GY6A 1MKWK 2QAAA 1O2LA 3MU0A 4Y76A 1GHYH 1AE8H 4F48B 4UFDH 1CU1A 1O5GH 2BD3A 2ZFRH 2Y81A 4HG6A 1AUTC 1E36B 1SBWA 1FJSA 1G30B 1QA7A 3GY3A 1VKYA 2ILNA 1YC0A 2G5VA 1Z1IA 1E38B 5LH8A 4NIXA 4NIWA 4Y79A 7GCHF 2A4GA 1GJ7B 1XUJA 1UVTH 1ELVA 1C2GA 2CMYA 1AZ8A 1O38A 4NIVA 1IQGA 3Q77A 1SKYE 3LGYA 2BY7X 1KDQA 3NPSA 5LPRA 2R9PA 3LGWA 3CP7A 5A0AE 2BMGB 5E0JA 3QUMP 2ZNKH 1AO5A 4B2CA 2QIQA 4Y7BA 1O2TA 4BAKB 2H1UA 3TJOA 3IG6B 3UOPA 4NFEA 1KSNA 1HAVB 2BX3A 2QF0A 1O35A 3EAJA 5IYTA 5FBIA 4KKDA 5FCKA 4X1NU 2BY8X 1OHHD 4CRDA 3GY5A 1O2ZA 1V2PT 1GMCF 5DSFA 1YCPK 1G3CA 5EQQA 1O3JA 4JZEH 3T29A 2HNTC 7KMEH 4F49A 1HAVA 1JRTA 1MD7A 4CREA 4XOJA 2WPJS 3U1IB 1FY1A 1AB9B 1IQIA 3K6YA 2R2MB 1QBNA 3KHVA 3ATMA 3PRBA 2ODPA 3K65B 3A81A 2V3OH 3SU6A 1J17T 2GMTC 3M3SA 1Q31A 1GBFA 3RMNH 4DJZB 1D3QB 1TYNA 1KXAA 1F5KU 5EXLA 5AVDA 1RRKA 4SGBE 2AIQA 1NRRH 2BVXH 1ABJH 1YCPH 3F9FA 1O3KA 5B6LA 3BTKE 2XNIA 2DE8A 1HAZB 4ABDA 4Z1MD 1HB0B 1XVOA 3KNXA 3KGPA 3E0PB 2SGDE 2O9QA 2FTLE 1Z8IB 3LC3A 3RXRA 1C5UA 1NU9A 3PB1E 1TMUH 1JBUH 2O8LA 1GGDB 1MCVA 3U69H 3H09A 1VITG 1UTQA 1YCPM 2Z9KA 5EJ1A 4CRFA 1TBZH 1ESTA 3N7OA 1BHXF 1Y3XA 4K8BA 5E0HA 1Y3WA 4B2AA 3GDVA 5JPMH 5LPFA 4RT0A 5EPNA 3RXMA 2F9UA 1DPOA 2O8UA 5A0CA 1L1GA 3GCTF 4AOQA 5L30H 3S69A 1AQ7A 2L74A 2BLVA 1IQHA 3MU5A 2OCVB 2PLXA 1EPTC 1E1QD 1MAYA 8ESTE 1F2SE 1UK2A 3VEQB 2RDLA 1V2VT 2A7CA 1YLNA 1S6FA 2WINI 1Y59T 3ZV9A 3MH6A 4XE4A 4FVDA 3OSYA 3M61U 2PHBA 4DY7B 4MDSA 3ELAH 1K1NA 2AH4X 2ZQ1A 1P2MA 2J4IA 1HRTH 3KQEA 1ZHPA 1AKSA 3A89A 1HXFH 1TX8A 2C8WB 1C9PA 2ZF0H 4H6TA 3OTPA 1B0FA 2F43B 1P2JA 3GCNA 2FMJA 1WUNH 1CA0C 3BEIB 3BTTE 2FLRH 1HJAC 2FXRA 2AHME 3NWUA 4FUFA 1FAKH 1NT1A 3NKKA 4JZDH 4AGKA 1QB1A 5F53A 1E35B 1C1VH 1UW7A 2FIRH 5T1VA 3V3MA 4MVNA 1QJ7B 4INHA 3UQVA 2JJ2D 1BOQA 1GL1A 1SVPA 3RXJA 1YYY1 2ZC9H 3R3GB 2P16A 2RA0A 5JBBS 3V0XA 2A7JA 3SI3H 1G2MA 1KMHB 2EI7A 3RC6A 1O2UA 2BQ7B 1O37A 1OXGA 1W3CA 2Z9LA 3SJIA 2EI6A 4D7FA 1QHRB 3AVZA 3SNBA 3Q76A 3EE0B 4X8TH 1FUJA 1WYKA 3LU9B 4YOGA 1GJ6A 1NPMA 1XMNB 2GX4A 1C4Y2 5L2ZH 1MQ5A 3MU1A 1MBQA 4VGCC 1XUFA 1YPHC 1AVWA 6CHAB 4HI3A 1NM6A 3KEEA 1SQOA 2VWNA 4ISHH 4M7GA 1HLTH 3ZZ9A 5HYOA 4JYUH 2H5DA 1QL8A 2VGCB 3N99A 1CA8B 4X6MA 4K69A 1LPKB 2PUQH 3A84A 3BG4B 3NUMA 3P92A 1N8OC 1HJ8A 4I8LA 5EJZA 5EODA 3MFJA 3SU2A 2J98A 2WSSD 2QV1A 2BHGA 2BD8A 1MUEB 5C1UA 4GAWA 3DHKH 4X6NA 5K7RA 2OBOA 2C4FH 4NG9H 1OYQA 1NFXA 5FXLA 1Z1JA 1K21H 2BX4A 1K1OA 4MNWA 4WWYA 3LJJA 8GCHG 4MNXA 1F0TA 3SBKA 4BTUB 3TH4H 5AFYH 3GCOA 1XUGA 4FU9A 1GPZA 1V2NT 2C90B 1D6RA 2BY9X 1WAYB 2ZDLA 1A5HA 3UAIC 2BXTH 1YWUA 1TGSZ 4Q63A 4ABEA 3Q3YA 2W7UA 3MH5A 4ABIA 1EOLA 4FU7A 1G37A 3SNDA 3AAVA 3ODDA 2GCHG 2YMSB 3KQCA 1COWD 1T8LA 2CV3A 3RXCA 1BRUP 1O2VA 1QY6A 2HVYB 3TJVA 4BXSA 2PTCE 3UIRA 3DFJA 1O3NA 4TWWA 3MMGA 3ZVBA 4WJG2 1QRZA 2PGBB 1PPCE 1P10A 1Y5BT 2OC8A 2WV9A 2ZDAH 3PRDA 2CJIA 2Z3DA 4ZKOU 2ZFPH 5IDKA 4A1VA 1UK3A 1GJ9B 2WPHS 1ID5H 1K1PA 3DSGA 2J38A 1JMOH 1SLUB 4DT4A 2BDAA 1C5TA 1FNIA 1O5FH 3RLWH 1AIXH 1P9UA 4H42U 4BAHB 3DFLA 5KEDA 4GUXA 4X1QU 1YPKH 4ISOA 4WMFA 1DICA 3UNQA 1ORFA 1ZPCA 4BTTB 1SI5H 3ATIA 2VIQA 3SHCH 1OWHA 2BY6X 1BIOA 2A7HA 2KAIB 1MZDA 2OINA 4ZAEA 1Z8GA 3KN2A 4LXBH 2BYAX 1UVSH 1MKXH 4FUBA 3UOUA 3MYWA 3WY8A 1P09A 1NTPA 3LPRA 5EIYA 5I25A 1RTFB 2K8IA 3PO1C 3MU4A 1DUAA 1P03A 2JH5D 1GJ4H 1FY8E 2F9OA 1UTOA 1O2YA 1RIWC 1FZZA 1NFWA 2FOFA 1E37B 2SGEE 2FP7B 1IHTH 3M5OA 3BTME 3SV2H 2H2ZA 1SOZA 3BTQE 2A5KA 2SGPE 4KELA 1DWCH 1S82A 1GI8B 2IOTA 2HWLB 1SGNE 4X6PA 5GJ4B 5EOKA 1S6HA 2B0FA 3RP2A 5E8EH 2Z7FE 1SGIB 3SGQE 3UWJH 1H9HE 2V6NA 3S9AA 3SGBE 2XC0A 1GJDB 4UONA 3P8FA 3ZVAA 2TGTA 1JIRA 2GT7A 2R0KA 1GVZA 1HJ9A 2QN5T 1MABB 2STAE 2ZPSA 3MO9A 3H7TA 3VG8A 3PMAB 3T26A 3P17H 3ZV8A 1TBRH 1IQJA 3QGNB 4Y10E 5FBEA 1YBWA 5T6FA 1GI9B 4A5TS 2GTBA 2G52A 4MNVA 1GHBG 3M5LA 1O2RA 4IC6A 5DPAA 1A46H 2F91A 3P8GA 2ZTZA 3QX5H 1O30A 4P00A 1C1QA 3B23B 2WV4A 1TPPA 1WDIA 2TIOA 1P2OA 1DWBH 1OWIA 2OQUA 2C8ZB 1PJPA 3FAOA 3STIA 2WZQA 1H8HD 5A8XA 4NWKA 1P04A 2KZ4A 2LELA 1AWFH 2ZDNA 3TGKE 1GG6C 1TFXA 1RXPA 1PPGE 2JETC 1MU8B 1MTNC 4BAOB 4LZ1H 1H8DH 1EZQA 1A7SA 2FO9A 1GMHF 4JZFH 4WY3A 4Y11E 3BTEE 3V7TA 3U1JB 1LVOA 2UWLA 2QCYA 1ELGA 1FY3A 3K9XB 4B75A 1FV9A 1HAIH 1AFEH 3A7TA 1TBQH 4Y8YA 1O2IA 1RS0A 2PKAB 3T5FH 6GCHG 2XWAA 3SUFA 4ESTE 1DM4B 1VITH 2A1DB 2ZHFH 4X1RU 4NSVA 1BMMH 5EW2H 3LGVA 1O31A 1SFQB 3MHWU 1NFYA 2FESH 3SQHE 4OS4A 3QO6A 1C5YB 2VVCA 1Y8TA 4NWLA 1V3XA 4DG4A 1TB6H 4CRCA 1SGDE 1ZMJA 2Y5FA 1Y5UT 1BTXA 2WUCA 2GCTB 3PMBB 1ANDA 4K1EA 2KFWA 4KTSA 1O2HA 2ESTE 1QRWA 3RXDA 1O5CB 4X1SU 5F8TA 3A80A 2O8MA 4FUDA 2XYAA 2QF5A 4ASUD 1F0UA 4OS5A 2A45B 1CO7E 1OKXA 1ETRH 1T8MA 2YMSD 1NRNH 4NA9H 1O2OA 1JIMA 2QC2A 5FPTA 2ZGJA 1V2RT 2BZ6H 2M2AA 4ISNA 2PGQB 1T32A 2H5CA 3M36A 1C9TA 1TPSA 3EE7A 1GBBA 3UWIA 4E7RG 2PSXA 1BJVA 3L33A 1XX9A 1KIGH 2XBXA 2ZGCA 3F2GA 1EAIA 2H9TH 4I33A 3P70B 1SSXA 1P01A 5C5OA 4Y0YE 4B1TA 3MNSA 1QTFA 1O5EH 3F9EA 5GPIB 1UHBB 1W0YH 2HGTH 4MNYA 1EJNA 1P11E 3CNRA 3KYGA 3T25A 5JB9S 4E05H 4NSYA 1N1LA 1ZR0A 3QDZB 1EUFA 2GT8A 3EDXB 3GS9A 3RXIA 1XXFA 4I7YH 2VWOA 1GMDF 4JZ1A 4XBBA 1UHBA 4RT1A 1WOFA 3ZVDA 3AASA 5HKKD 5DK1A 3MH4A 3JZ2B 1TGTA 2ZHDA 2J9NA 3U8TH 1GBAA 1ZTJA 2R3UA 5EXNA 2GVFA 1C5PA 1CQQA 2CXVA 3VGCC 3T28A 1AU8A 1S84A 4XBDA 4AG1A 3N7EA 2PFEA 2LNCA 3LOXA 5FCRA 3Q3XA 1TRMA 1A0HB 1C2HA 2BOKA 1QR3E 4IMQA 1EB1H 1BTHH 2AGEX 3TK6A 1V2LT 1TPOA 4GHQA 5F6MA 1PYTC 3KIDU 2GKVE 1HAPH 3GY8A 1MD8A 1MH0A 1O2PA 2OD3B 1KXDA 1Q2WA 1EB2A 1YKTA 3VB4A 3GCHC 5G4BA 4NZQA 1IAUA 2DE9A 3IITA 3VXEH 1ELTA 2G4UA 2ZFTA 1K1LA 2JH6D 3ZZCA 1Z8RA 5HMAA 2ZFFH 3TLOA 1BTUA 1FX0B 3D65E 1W8BH 2KCAA 3QZRA 1BBRH 1UMAH 1O2WA 3ZZ4A 3PWCA 2VH6A 4IGDA 3OAAD 3QTVH 1A3EH 1QIXB 3I78A 4AZ2B 1KTSB 1ZSKA 1YP9A 1OYTH 5C0UA 1O5DH 1EKBB 4OS7A 5GIBA 4DURA 3QTOH 3URDA 3LKWA 4ACBA 3CENA 1ACBE 1O2GH 3F0OA 1LMWB 3BSQA 1MKWH 2P3UB 1E79D 2ODQA 3SZNA 4B73A 3F68H 1DY8A 1JRSA 1GI6A 1BTWA 1QQUA 1QJ6B 2ZI2H 3E16B 1K1MA 1P2IA 1AMHA 1O3IA 2JKHA 3OEHD 3GICB 1SLWB 1A61H 4MLFB 1QL9A 3TITA 1MMJN 1YPLH 1O3PB 2SGQE 1PQ8A 2VIOA 1GJ8B 1EX3A 2J94A 4I32A 4O03A 3VPKA 2C8YB 2QGRA 3ZZAA 2Z3EA 1W0KD 1A5IA 2GGVB 1LTOA 4XSKU 2BDGA 4Y7AA 4BOHA 1SGRE 1SGFG 4FETA 3VXFH 2ANWA 2P93A 1NZQH 4OGYA 4DVAU 1O5BB 2FI3E 3OYPA 1C4U2 3BEFB 1MQ6A 5T6DA 1D3PB 1LQEA 1CGHA 2ZHEH 4ISIH 1H8IH 3A7ZA 5GCHG 3E90B 1W7XH 5HIYA 1LPGB 1CE5A 1WV7H 3D49H 3NZIA 1V2WT 5ABWA 1ELFA 1L1NA 1WQVH 2ZHQH 4X2XA 1HNEE 3HKJB 7LPRA 3F1SB 4OGXA 1GI1A 1C5WB 4YLUA 1EAWA 3PV2A 3ESTA 4X6OA 3ZVCA 2W6JD 4MTBA 1GHAG 4X8SH 3SUDA 2ZIQH 3OE7D 2A0QB 2BD4A 2HALA 1QBOA 1CA0B 1VGCC 3PYHA 3UPEA 2OC0A 1HJAB 3SNEA 1DY9A 3TU7H 2FM2A 1O33A 3FP7E 3LONA 5TJXA 2QF3A 1FAXA 1TE0A 2F83A 4D76A 1LO6A 1XM1A 4GHTA 4NFFA 1GL0E 2M5TA 1CHGA 3U28C 3CS0A 2PW8H 1O36A 1WQSA 2FOBA 3F9GA 1W2KH 1SMFE 4FXGH 1HUTH 2Y5HA 3T62A 1AB9C 1H1BA 2GDDA 1WCZA 1CSOE 1ZHRA 3RC5A 4P02A 3A7WA 4BAMB 1HV7A 3ZZ6A 1YF4A 2W6ID 2XNDD 3SV7A 2NWNA 3M7UA 3QZQA 4WH6A 2FOHA 3SU4A 2K0QA 2ZP0H 1SHHB 1ETSH 1RJXB 4GCHG 1A4WH 4CH2B 1DXWA 1K1JA 1O2SA 4JCNA 4D9RA 2BDHA 1JOUB 1AVXA 2WHXA 4VGCB 2ZQ2A 4A7IB 3O8BA 1QZ8A 4B6EA 1BMNH 2FEQH 4JK5A 2VU8E 2EEKA 1IQNA 3RMOH 3IWMA 2OK5A 1UVOA 3UTUH 1INCA 1ZSJA 3ZVGA 5HGGA 2Q1JA 1GDUA 1ZJKA 1G9IE 1GBJA 1TAWA 3M5NA 3W95A 2HPPH 3F0PA 1QNJA 2I6QA 1FXYA 4F55A 1ZYOA 1TOMH 4IN1A 1EATA 4NIYA 4ZHLU 4ZMAH 8LPRA 2BD9A 1SGQE 1D6WA 4J2YB 5E0GA 4OM9A 2HLDD 5FX5A 1V2QT 1GBDA 3MNBA 2HOBA 5HXFA 2RCEA 4THNH 2R3YA 1ZHMA 1BTYA 1TIOA 5C94A 1HAOH 4QT8C 1NROH 4YOIA 1ANBA 4TPIZ 1C5OH 5DP4A 4I8GA 1GJ5H 8KME2 1BBRE 3F3BA 1D9IA 3RXEA 1H4WA 1MTSA 3TGJE 5FAHA 3UREA 1CGIE 3LIWA 2K1QA 2A2QH 3SORA 1GVKB 2KR7A 2BDIA 1C1UH 1TGCA 2ZU2A 1AZZA 1BRCE 1OWDA 1ZGIA 2UUKB 5EJLA 5FPSA 1AE5A 1P57B 1P2QA 5BPEA 1H9IE 3LH3A 4JYVH 1EXFA 3O8CA 5C1YA 1ZRKA 1V2OT 2KM0A 4AGJA 5CHBA 1S0QA 1SGFA 4X2YA 5T6GA 2THFB 2BZAA 3RXSA 5C0TA 1S81A 1EAUA 3UUZA 5DP6A 3PLKA 2F3CE 1C2IA 1TALA 2NU4E 2VVUA 3TNSA 1P12E 3A7YA 1WXRA 5CHAC 3AAUA 2XW9A 1FY5A 1C1RA 4WH8A 1QGFA 2PR3A 1GBIA 3ATKA 3DCLA 1VITF 3DA9B 1GBLA 2JJ1D 3ZVEA 1SQRA 3EA7A 2ALVA 1G32B 1XUHA 2BDBA 1V2TT 3TNTA 2Z6BD 4Y8ZA 1TNGA 3OFND 4X1PU 4YM9A 4BTIB 4H4FA 1FQ3A 4UDWH 5HM2A 4YO9A 1DX5M 1O2KA 2VGCC 2JDID 3D23A 1UVUH 1C1SA 3T27A 3VB7A 2ZTYA 1J8AA 1ZTKA 3TGIE 2CHAC 2ZDMA 5A2MH 5DG6A 4ZXXH 1FPHH 3BG4C 3UNSA 4K1TA 1PQAA 1FPCH 1LKBA 1ZMNA 2GV7A 4TY6A 5EU8A 1UK4A 3SV8A 2J92A 2H9HA 4IW4E 1HFDA 3F6UH 3SN8A 9LPRA 7ESTE 2WV5A 3M7QA 4YLQH 3PM3A 3BV9B 3P8NA 4AB9A 4AG2A 1KY9A 1A0JA 2W26A 4CBOA 2VIPA 3M7TA 1AN1E 4ASHA 2TGPZ 3BTHE 4Q80A 3SW2B 1O0DH 3TH3H 1SGCA 1UTKA 1EAXA 2NU1E 3A7XA 2WYJA 2ZWLH 4E06H 3E1XB 1G3DA 3M3VA 1ELBA 2VIDA 3NRLA 2ODYB 4HTCH 2JH0D 4WXVA 1P3EA 1K0HA 1LPZB 1T7CA 1ZZZA 4ZROA 1A3BH 2P8OC 2RA3A 1C1OA 2UWOA 2AMDA 2BXUH 5KECA 1YLCA 1RD3B 1P3CA 1W10U 2ALPA 2LP6A 3FVFB 4U30A 3TK9A 5CDFE 3SJOA 5E2PA 4IS5A 1THRH 1OSSA 2W3IA 1CBWC 2WYGA 5ESTE 1O3AA 3N7DA 2KAIA 1DXPA 3TIUA 1QB6A 1THSH 2EQNA 4AFZA 4XBCA 2VWMA 2TGDA 2W7SA 3O8RA 1FLEE 3R0FA 1Y5AT 4YXWD 5C20A 1BTZA 4A6LA 3SU5A 1O3OA 2FYRA 4ABJA 2VJ1A 3QGJA 1U6QA 1O2MA 1N6YA 2ZG0H 3SHAH 4M9FA 3U8RH 3ZYEA 1C2JA 1SGTA 4Q7XA 2SGFE 1EP6A 1GG6B 3V13A 1BCUH 2XBYA 2JETB 3BN9A 1S85A 2A31A 4X0WU 5FPYA 1LHDH 1VJ9U 2WPLS 4ZH8A 1OWKA 4IMZA 5I46H 1FN6A 3E6PH 3MNXA 1EJMA 1B0EA 2QA9E 2ZCLP 3M3TA 3U8OH 4RI0A 1ESAA 3A8BA 3RM2H 1BA8B 2HNTE 4LZ4B 2XC4A 1TONA 8GCHF 1MBMA 2Z94A 3ATWA 2BLQA 4B71A 1ABIH 1FONA 2OBQA 3ZIAD 5A0BA 4ZKNU 1P2KA 1GI3A 4CHAC 3ZZBA 1PQ7A 2ZFQH 4MPUA 2FOEA 2OTVA 2HPQH 5CMXH 1ARBA 1C5MD 2XXLA 1O2QA 2AYWA 1BRBE 2FS9A 5EG4A 2GCHF 1O3MA 3OX7U 1C5VA 1GBTA 1TPAE 2H6MA 3RXFA 5JYIA 4DOQA 1W7GH 1BZXE 2IN2A 2AMPA 1CHOG 3BG8A 1O3BA 2ZU4A 3PLBA 2GDEH 3E91A 3FFGA 2ZKSA 2BDYA 2ZDVH 1QURH 3KF2A 2W3KA 3ZZ8A 1O3DA 1V2ST 2PUXB 3PTBA 2RDEA 4CBNA 4YOJA 1NS3A 1IQKA 3RU4T 5AFZH 3OY5U 2ANMH 2UWPA 3UR6A 1UVPA 1XKAC 2Q6DA 3ZYDA 1YPEH 3LGIA 1C1WH 1SB1H 4UE7H 2DUCA 3A8DA 2GP9B 3SU0A 1G3EA 5SGAE 4FOUC 1J9CH 3GDSA 2QF4A 3G01A 4DIIH 3PTNA 5C5NA 4O3TA 1A2CH 7GCHG 1PPBH 1T4VH 1MAXA 4FUJA 2PKAA 1KXCA 1X7AC 1XVMA 1DLEA 1IOEA 4O97A 2ANYA 1NRQH 2FOAA 1S6LA 4JMYA 3TK5A 1TNJA 1GI7B 1W0JD 1DDJA 3LT3A 5LGOA 1EZUC 2TBSA 1KLTA 2AIPA 1HAXB 2OQ5A 2QXHA 3Q3KA 2PSYA 1HAHH 1N6XA 4R8TB 1EASA 2J97A 2SGAA 1TMTH 1AFQC 2HRVA 1IQLA 6ESTA 3LDXH 4AYYB 1ZGVA 1L1JA 4I31A 1GI4A 2O8TA 1TMBH 4UFEH 1T8OA 2BY5X 1LVBA 5A09A 1EOJA 1L4DA 2WPDD 4TY7A 1BMFD 4MPVA 3GOVB 1GMCG 1Z8JB 3SJ8A 1NFUA 1OP8A 1QA0A 3FKSD 4Q2KA 4DCDA 4YT7H 1K9OE 1YM0A 1V2KT 2QXIA 5C2ZA 3SJ9A 1TWXB 2GV6A 3S0NA 1GI0A 4ZHAA 3SNAA 1FY4A 2ZGBH 1GHVH 3PV5A 1LHGH 2QY0B 3GY4A 4XD7D 2KCOA 5EPYA 2Y5GA 1AD8H 2VIWA 1D3DB 2A2XH 3GCHB 1DSUA 1IQEA 1E1RD 1O2XA 1F0RA 1XUIA 1F7ZA 3MH7A 1TABE 1LHEH 2WPMS 2GCTC 4ABBA 2ZDKA 2TPIZ 2F9NA 4OS6A 2YOLA 3ZZ7A 4DW2U 1TRYA 4UFFH 5DN6D 2BD5A 1GCTC 4BAQB 1GHBF 2Q6FA 1C2FA 3RLYH 4U2WA 5DP8A 5JBAS 1YPHE 4AYVB 3AK5A 1W0ZU 5DP7A 2GJGA 4OS1A 4ABGA 4Y6DA 3QK1A 1ZLRA 1SLXB 1YPGH 2J2UA 3E8LA 4GVUA 2G5NA 1WU1A 4INKA 1J15A 4NZLA 3UB0A 3E0NB 3S9BA 1NU7B 2AEIH 1FIZA 1G3BA 3FP8E 1MCTA 1AVGH 4FUEA 1GCDA 3GCTG 1GJAB 1O3GA 2PKSC 2B9LA 2QYIA 4TPYA 3EA9A 1DWDH 2I6SA 1K1IA 1CHOF 1HDTH 2ZGXH 1NBMD 5JBTA 3CS7A 5A8ZA 1NESE 2KCYA 4BXWA 4NGAH 4B76A 6GCHF 5PTPA 1FI8A 3UNRA 1TQ0B 1PPZA 2ULLA 3OU0A 2YNBA 3UY9A 3BIVH 4TWYA 1KDQB 1BJUA 1YY3A 1P02A 1PPEE 2ZGHA 4I86A 5AF9H 1TGNA 3SI4H 2BM2A 5L2YH 2GMTB 3MU8A 5J4SA 1TNIA 1ZOMA 2B7DH 4ZUHA 1O3FA 3GYLB 2GZ9A 2XBVA 3BF6H 1NC6A 3VB5A 1HCGA 3BIUH 2KX4A 1BT7A 1C5XB 4B2BA 1RTLA 1QB9A 3QWCH 2V3MA 1BRAA 1FN8A 1T31A 1C2LA 1GBEA 3TPIZ 1T4UH 4JYTA 2F9VA 1NO9H 2OC7A 1H8ED 1MU6B 2WPKS 3PMHB 1KXFA 1SLVB 2UUYA 3U9AH 1C2KA 2LPRA 1C1PA 2XWBI 4FU8A 2ZU3A 4K3JA 3OEED 1OX1A 4PROA 4I8HA 3VB6A 1VGCB 1BITA 3L6PA 3OTJE 1NRPH 4AN7A 1P0SH 3L3TA 1C5NH 3RDZA 5IK2D 2IPQX 2P3FH 3KQDA 2G55A 2B8OH 3S9CA 5GDSH 2FS8A 3DSPA 2FTMA 1T8NA 4XDEA 3SU1A 2Z3CA 2SFAA 1FMGA 3FOAA 2OUAA 1EPTB 2BTCE 5J4QA 3SGAE 2ZECA 1S83A 1P06A 1L4ZA 4Q7ZA 2FLBH 1ANCA 4K60A 5GWZA 4A1XA 3WW7A 4INLA 4GLYA 4Z6AH 2XCNA 1O5AB 1IHSH 2L6OA 4K2YA 5EXMA 5EQRA 2C3SA 1ZRBA 3TJNA 1EPTA 3EGKH 1O32A 4BANB 2EA3A 1ELAA 4CH8B 4J1YA 1THPB 2Y7ZA 1O39A 2FODA 1DANH 2GZ7A 4K8YA 4X8VH 3SUGA 2FPZA 3UR9A 1P9SA 1DE7H 3HGPA 1KLIH 1GWAA 3BTDE 2GZ8A 5FL7D 3T2NA 3RC4A 1A0LA 5DGJA 1Z71A 4D7GA 3SV6A 1HBTH 1Y3VA 2VINA 3NCLA 4GPGA 3S7KB 1TX6A 4GSOA 5LPEA 2D8WA 2KCPA 2B5TB 5EGMA 3TVJB 1DFPA 2AMQA 4RKOB 2BDCA 2CGAA 1BHXB 4Q7YA 3U98H 3BEUA 5BRRE 1PYTD 3QLPH 1G36A 1GVLA 1LVYA 1MTUA 2FDAA 1C5RA 2ZPRA 1GHZA 2CF8H 3LGUA 1AKSB 2Y6TA 2AFQB 4F4OC 2FOMB 4TSFD 4HFPB 4MQAA 1Q3XA 2G4TA 2O8WA 4TT3D 3RXPA 3MQKC 4LK4A 4DT7B 1ZMLA 1DVAH 4KTUA 2EY4C 4SGAE 1A5GH 4FUHA 4OS2A 3A82A 2VH0A 2IPHA 3BTGE 5EQSA 3VB3A 3GDUA 1O3EA 1V2UT 2STBE 4UEHH 4Y71A 1N8OB 3DUXH 3WWBA 1GDQA 1D4PB 1K28D 1GGDC 1EFRD 1SHYA 1SPJA 2FZZA 4K1SA 5JB8S 2H9EH 3HKIB 1O3LA 3RXUA 1HGTH 1V2JT 2ZCKP 3RMLH 5C1XA 3HGNA 4Q4LA 1V6DA 1NN6A 1FDPA 1PFXC 1QL7A 1BMLA 4MPXA 3MO3A 4I8KA 2F4LA 2NU0E 1NBME 1PPHE 1C5QA 3RXHA 3TH2H 1SOTA 1HXEH 4IN2A 1UTLM 3VFEA 3HK3B 2P95A 2BVSH 3AW0A 1C1NA 5CHAB 1VJAU 3MTYA 1KXEA 4JK6A 2FOCA 3A8CA 4B74A 4MPWA 3DT0H 4IC5A 4RSPA 4X2VA 1UTJA 2G00A 3B9FH 3RXTA 4NA7A 2YNAA 1LCYA 2C93B 4H6SB 5A8YA 4KTCA 3F9HA 1DLKB 2Y7XA 3LGTA 3ZZ3A 2J98B 1UTPA 3BTFE 4E7NA 1ETTH 5GCHF 2HVXA 1W12U 1OPHB 4CR5A 5FHTA 2A4OA 2BQWB 2V0BA 3MI4A 3KL6A 4A92A 1XUKA 1TRNA 3RU4D 4CRGA 1QBVH 1WTHD 2CHAB 1OOKB 1AHTH 2VB0A 1DT2A 3KYFA 1RFNA 4K5ZA 5CE1A 1P2NA 1AUJA 2J95A 2V35A 3GY2A 1ZPZA 4ZCNA 1GHAF 5F03A 1DSTA 2ZO3H 2JIZD 1XXDA 1A1RA 1GBMA 1MZAA 3F2FA 2OC1A 2Z9IA 3A86A 1F92A 2SNWA 1C2DA 1J16A 1Z7KA 2ZCHP 1AWHB 1BDAA 3FP6E 3KQBA 1SC8U 2CN0H 1W13U 3SV9A 1TX7A 1DUEA 2ANKH 1SQAA 1ESBA 2BD2A 1AI8H 1OS8A 3SZEA 6CHAC 3QN7A 1MTWA 2Y82A 1BMAA 1S0RA 2D1JA 1SFIA 2HLCA 5C67A 1XKBC 2P8OB 2FI4E 2W5EA 1CT2E 2QXGA 1G2LA 1IQMA 4BNRA 2RG3A 2V7QD 5KGOA 3SU3A 2VNTA 3PO1B 1C5SA 1F0SA 4O9VA 1J14A 1CBWB 3FO8D 1RIWB 2A32A 1GMHG 4ZKSU 3RUOA 2R0LA 1KYNA 4UD9H 5F8ZA 3ZVFA 1GBHA 1LDTT 4GCHF 1ZSLA 3SUEA 1DOJA 1YLDA 4MG3A 5L6NH 4AORA 3MOCA 5TCCA 4WMEA 3UQOA 2OP9A 4ZKRU 2FX6A 1UCYK 3PMJA 2FOGA 2G51A 1GJCB 3RXOA 2A5IA 1MKXK 3PLPA 2QXJA 4UFGH 1QCPA 1EZSC 3RXKA 1B7XB 1H9LB 4YESB 1K2I1 1E34B 5C17A 2ZU5A 1GBKA 3A87A 4A1TA 4Z0KA 2FYQA 3RXVA 1VCPA 3SNCA 3FANA 4O3UA 4YTAA 2A4RA 3PROA 3Q00A 1VCQA 1YPJH 1C5LH 1CGJE 1WTGH 3RXBA 3F2HA 4ACAA 3KCGH 1PQ5A 3SJKA 3NK8A 3H7OA 1JWTA 1ELDE 2Y80A 4KGAA 3I77A 3ODFA 2FWWA 1AY6H 1RTKA 1O3CA 2D26C 2YMSC 2IJD1 4FUCA 2WPIS 1ANEA 2BLWA 1UCYH 2P94A 1JXPA 2ZU1A 4TYDA 2ZZUH 3ITIA 1UJ1A 2V3HH 2Z9GA 3EA8A 3RM0H 3NXPA 3ZZ5A 2UUJB 4WXIA 3DD2H 1TA2A 4CHAB 2FI5E 4U32A 2NU3E 1MTNB 3WWFA 3ENSB 2VBCA 3RXGA 2EI8A 1LKAA 2WUBA 3A88A 3MNCA 5F8XA 1W14U 2XOKD 3PV4A 2VWLA 4X8UH 4DGJA 4LOYH 1Y3UA 4ZHMU 1QFKH 4CR9A 3M37A 1WSSH 1RGQA 3HATH
chains in the Genus database with same CATH topology
4ABFA 1TNKA 9ESTA 1GMDG 1ELEE 4KP0A 1TNHA 5C3NA 5TCAA 1Z6EA 1P05A 1UTMA 3PWBA 1TNLA 3P8OA 2VVVA 2G81E 1EP5A 3GISB 1ZPBA 1K22H 2OLGA 1EZXC 2XTTB 4FVBA 3K2UA 4D9QA 3HPTB 1ZTLA 4FUIA 3ZZDA 1DWEH 2D2DA 3RU4E 4X2WA 3MWIU 5JBCS 3SYJA 1SQTA 3SQEE 1VZQH 1BUIA 1OWEA 4FUGA 1SGEE 3D62A 1ZJDA 1CT4E 1OWJA 5ETXA 5DKMA 3MO6A 3HK6B 2XC5A 2PTNA 1HYLA 1LHCH 2BLOA 2PV9B 3FN8A 1GBCA 3LC5A 2BB4A 3DSOA 1PPFE 1AFQB 1YPMH 1GJBB 2ZA5A 6LPRA 2AGGX 1CT0E 1F5LA 4Y0ZE 4WVPE 4YZUA 5DP3A 1NRSH 2UUFB 2QE7D 1BQYA 1C4V2 4ABAA 1DS2E 2BQ6B 1M9UA 4WF8A 4NCYA 2F9PA 3STJA 2Q6GA 1QQ4A 5JDUB 3GY7A 1LHFH 4AFQA 1NY22 4DIHH 1S5SA 5E2OA 3URCA 1HAGE 3A85A 3I29A 1GHWH 2A4QA 1KTTB 4AFSA 3C27B 2AERH 5GXPA 5EW1H 1ARCA 3LJOA 2CK3D 2BOHB 3W94A 3FZZA 1TLDA 3A7VA 1C2EA 4YT6H 1IQFA 4AFUA 1L2EA 1P8VC 4JZIA 4AB8A 3C1KA 2CF9H 3O8DA 3K6ZA 2R2WU 1Y3YA 1FIWA 2TRMA 1V2MT 2AGIX 2P3TB 5DP9A 4RKJB 3W1EA 1KLJH 1YGCH 2XCFA 3SOSA 1GCTB 1GHXH 5DO4H 2OXSA 1SGPE 2C8XB 2TGAA 2XRCA 2ZFSA 3AW1A 3B8JA 3VGCB 4WMDA 1C1MA 3UFAA 5H4IB 1BB0B 1TOCB 2GD4B 5ESBA 5DJ7A 2ZPQA 1UTNA 4CRAA 1SR5C 2F9BH 3M35A 3LH1A 1F5RA 3M5MA 3OY6U 5DP5A 2IJOB 2BD7A 4Y8XA 5GNDA 1SG8B 1TA6A 4XFQA 1EQ9A 2J34A 1GDNA 3FZDA 1CVWH 2A5AA 1L0ZA 4CRBA 4NA8A 3H5CB 3P6ZB 3SO3A 3RXAA 1SL3A 3A8AA 5K0HA 2XBWA 3S7HB 2PKSB 4ZXYH 1VCWA 2Z9JA 4RN6A 1Z6JH 4U01A 5HM9A 1WBGB 1C5ZB 1AGJA 2VIVA 3E3TA 1O2NA 2P59A 1HPGA 1QJ1B 5FX6A 3TJUA 1D3TB 1LVMA 3RXLA 1TGBA 1HIAB 1UO6A 5T3HA 2ASUB 4HGCA 4AX9H 4B6FA 1O2JA 2AS9A 3A83A 1UCYE 2EC9H 2NU2E 1C1TA 1DITH 2PWXA 1O34A 3RXQA 3V12A 1EJAA 3EQ0H 1QRXA 5AHGH 3EYDA 3GYMA 3JZ1B 2J5UA 1GI2A 1VR1H 1C2MA 1HIAA 1BTPA 2SNVA 3BTWE 1BBRK 2ZTXA 3RMMH 1SGYE 4ABHA 2G8TA 4D8NA 4R0IA 3ATLA 1B5GH 1W11U 1OP0A 1LQDB 1OP2A 4IBLH 4ISLA 2ZEBA 2FX4A 2BVRH 4I8JA 1TQ7B 1GI5A 1ELCA 1O3HA 2HNTF 4HZHA 2ZHWH 1E0FD 1KXBA 1HAYB 1MTVA 3P95A 5B6OA 3GY6A 1MKWK 2QAAA 1O2LA 3MU0A 4Y76A 1GHYH 1AE8H 4UFDH 1CU1A 1O5GH 2BD3A 2ZFRH 2Y81A 1AUTC 1E36B 1SBWA 1FJSA 1G30B 1QA7A 3GY3A 2ILNA 1YC0A 2G5VA 1Z1IA 1E38B 5LH8A 4NIXA 4NIWA 4Y79A 7GCHF 2A4GA 1GJ7B 1XUJA 1UVTH 1ELVA 1C2GA 2CMYA 1AZ8A 1O38A 4NIVA 1IQGA 3Q77A 3LGYA 1SKYE 2BY7X 1KDQA 3NPSA 5LPRA 2R9PA 3LGWA 3CP7A 5A0AE 2BMGB 5E0JA 3QUMP 2ZNKH 1AO5A 4B2CA 2QIQA 4Y7BA 1O2TA 4BAKB 2H1UA 3TJOA 3IG6B 3UOPA 4NFEA 1KSNA 1HAVB 2BX3A 2QF0A 1O35A 3EAJA 5IYTA 5FBIA 4KKDA 5FCKA 4X1NU 2BY8X 1OHHD 4CRDA 3GY5A 1O2ZA 1V2PT 1GMCF 5DSFA 1YCPK 1G3CA 5EQQA 1O3JA 4JZEH 3T29A 2HNTC 7KMEH 4F49A 1HAVA 1JRTA 1MD7A 4CREA 4XOJA 2WPJS 3U1IB 1FY1A 1AB9B 1IQIA 3K6YA 2R2MB 1QBNA 3KHVA 3ATMA 3PRBA 2ODPA 3K65B 3A81A 2V3OH 3SU6A 1J17T 2GMTC 3M3SA 1Q31A 1GBFA 3RMNH 4DJZB 1D3QB 1TYNA 1KXAA 1F5KU 5EXLA 5AVDA 1RRKA 4SGBE 2AIQA 1NRRH 2BVXH 1ABJH 1YCPH 3F9FA 1O3KA 5B6LA 3BTKE 2XNIA 2DE8A 1HAZB 4ABDA 4Z1MD 1HB0B 1XVOA 3KNXA 3KGPA 3E0PB 2SGDE 2O9QA 2FTLE 1Z8IB 3LC3A 3RXRA 1C5UA 1NU9A 3PB1E 1TMUH 1JBUH 2O8LA 1GGDB 1MCVA 3U69H 3H09A 1VITG 1UTQA 1YCPM 2Z9KA 4CRFA 1TBZH 1ESTA 3N7OA 1BHXF 1Y3XA 4K8BA 5E0HA 1Y3WA 4B2AA 3GDVA 5JPMH 5LPFA 5EPNA 3RXMA 2F9UA 1DPOA 2O8UA 5A0CA 1L1GA 3GCTF 4AOQA 5L30H 3S69A 1AQ7A 3MU5A 2BLVA 1IQHA 2OCVB 2PLXA 1EPTC 1E1QD 1MAYA 8ESTE 1F2SE 1UK2A 3VEQB 2RDLA 1V2VT 2A7CA 1S6FA 2WINI 1Y59T 3ZV9A 3MH6A 4XE4A 4FVDA 3OSYA 3M61U 2PHBA 4DY7B 4MDSA 3ELAH 1K1NA 2AH4X 2ZQ1A 1P2MA 2J4IA 1HRTH 3KQEA 1ZHPA 1AKSA 3A89A 1HXFH 1TX8A 2C8WB 1C9PA 2ZF0H 4H6TA 3OTPA 1B0FA 2F43B 1P2JA 3GCNA 2FMJA 1WUNH 1CA0C 3BEIB 3BTTE 2FLRH 1HJAC 2FXRA 3NWUA 2AHME 4FUFA 1FAKH 1NT1A 3NKKA 4JZDH 4AGKA 1QB1A 5F53A 1E35B 1C1VH 2FIRH 5T1VA 3V3MA 4MVNA 1QJ7B 4INHA 3UQVA 2JJ2D 1BOQA 1GL1A 1SVPA 3RXJA 1YYY1 2ZC9H 3R3GB 2P16A 2RA0A 5JBBS 3V0XA 2A7JA 3SI3H 1G2MA 1KMHB 2EI7A 3RC6A 1O2UA 2BQ7B 1O37A 1OXGA 1W3CA 2Z9LA 3SJIA 2EI6A 4D7FA 1QHRB 3AVZA 3SNBA 3Q76A 3EE0B 4X8TH 1FUJA 1WYKA 3LU9B 4YOGA 1GJ6A 1NPMA 1XMNB 2GX4A 1C4Y2 5L2ZH 1MQ5A 3MU1A 1MBQA 4VGCC 1XUFA 1YPHC 1AVWA 6CHAB 4HI3A 1NM6A 3KEEA 1SQOA 2VWNA 4ISHH 4M7GA 1HLTH 3ZZ9A 5HYOA 4JYUH 2H5DA 1QL8A 2VGCB 3N99A 1CA8B 4X6MA 4K69A 1LPKB 2PUQH 3A84A 3BG4B 3NUMA 3P92A 1N8OC 1HJ8A 4I8LA 5EODA 3MFJA 3SU2A 2WSSD 2QV1A 2BHGA 2BD8A 1MUEB 5C1UA 4GAWA 3DHKH 4X6NA 5K7RA 2OBOA 2C4FH 4NG9H 1OYQA 1NFXA 5FXLA 1Z1JA 1K21H 2BX4A 1K1OA 4MNWA 4WWYA 3LJJA 8GCHG 4MNXA 1F0TA 3SBKA 4BTUB 3TH4H 5AFYH 3GCOA 1XUGA 4FU9A 1GPZA 1V2NT 2C90B 1D6RA 2BY9X 1WAYB 2ZDLA 1A5HA 2BXTH 1TGSZ 4Q63A 4ABEA 3Q3YA 2W7UA 3MH5A 4ABIA 1EOLA 4FU7A 1G37A 3SNDA 3AAVA 3ODDA 2GCHG 2YMSB 3KQCA 1COWD 1T8LA 2CV3A 3RXCA 1BRUP 1O2VA 1QY6A 3TJVA 4BXSA 2PTCE 3UIRA 3DFJA 1O3NA 4TWWA 3MMGA 3ZVBA 4WJG2 1QRZA 2PGBB 1PPCE 1P10A 1Y5BT 2OC8A 2WV9A 2ZDAH 3PRDA 2CJIA 2Z3DA 4ZKOU 2ZFPH 5IDKA 4A1VA 1UK3A 1GJ9B 2WPHS 1ID5H 1K1PA 2J38A 1JMOH 1SLUB 4DT4A 2BDAA 1C5TA 1FNIA 1O5FH 3RLWH 1AIXH 1P9UA 4H42U 4BAHB 3DFLA 4GUXA 4X1QU 1YPKH 4ISOA 4WMFA 1DICA 3UNQA 1ORFA 1ZPCA 4BTTB 1SI5H 3ATIA 2VIQA 3SHCH 1OWHA 2BY6X 1BIOA 2A7HA 2KAIB 1MZDA 2OINA 4ZAEA 1Z8GA 3KN2A 4LXBH 2BYAX 1UVSH 1MKXH 4FUBA 3UOUA 3MYWA 3WY8A 1P09A 1NTPA 3LPRA 5I25A 1RTFB 2K8IA 3PO1C 3MU4A 1DUAA 1P03A 2JH5D 1GJ4H 1FY8E 2F9OA 1UTOA 1O2YA 1RIWC 1FZZA 1NFWA 2FOFA 1E37B 2SGEE 2FP7B 1IHTH 3M5OA 3BTME 3SV2H 2H2ZA 1SOZA 3BTQE 2A5KA 2SGPE 4KELA 1DWCH 1S82A 1GI8B 2IOTA 2HWLB 1SGNE 4X6PA 5GJ4B 5EOKA 1S6HA 2B0FA 3RP2A 5E8EH 2Z7FE 1SGIB 3SGQE 3UWJH 1H9HE 2V6NA 3S9AA 3SGBE 2XC0A 1GJDB 4UONA 3P8FA 3ZVAA 2TGTA 1JIRA 2GT7A 2R0KA 1GVZA 1HJ9A 2QN5T 1MABB 2STAE 2ZPSA 3MO9A 3H7TA 3VG8A 3PMAB 3T26A 3P17H 3ZV8A 1TBRH 1IQJA 3QGNB 4Y10E 5FBEA 1YBWA 5T6FA 1GI9B 4A5TS 2GTBA 2G52A 4MNVA 1GHBG 3M5LA 1O2RA 4IC6A 5DPAA 1A46H 2F91A 3P8GA 2ZTZA 3QX5H 1O30A 1C1QA 3B23B 2WV4A 1TPPA 2TIOA 1P2OA 1DWBH 1OWIA 2OQUA 2C8ZB 1PJPA 3FAOA 3STIA 2WZQA 1H8HD 5A8XA 4NWKA 1P04A 2KZ4A 2LELA 1AWFH 2ZDNA 3TGKE 1GG6C 1TFXA 1RXPA 1PPGE 2JETC 1MU8B 1MTNC 4BAOB 4LZ1H 1H8DH 1EZQA 1A7SA 2FO9A 1GMHF 4JZFH 4WY3A 4Y11E 3BTEE 3V7TA 3U1JB 1LVOA 2UWLA 2QCYA 1ELGA 1FY3A 3K9XB 4B75A 1FV9A 1HAIH 1AFEH 3A7TA 1TBQH 4Y8YA 1O2IA 1RS0A 2PKAB 3T5FH 6GCHG 2XWAA 3SUFA 4ESTE 1DM4B 1VITH 2A1DB 2ZHFH 4X1RU 4NSVA 1BMMH 5EW2H 3LGVA 1O31A 1SFQB 3MHWU 1NFYA 2FESH 3SQHE 4OS4A 3QO6A 1C5YB 2VVCA 1Y8TA 4NWLA 1V3XA 4DG4A 1TB6H 4CRCA 1SGDE 1ZMJA 2Y5FA 1Y5UT 1BTXA 2WUCA 2GCTB 3PMBB 1ANDA 4K1EA 2KFWA 4KTSA 1O2HA 2ESTE 1QRWA 3RXDA 1O5CB 4X1SU 5F8TA 3A80A 2O8MA 4FUDA 2XYAA 2QF5A 4ASUD 1F0UA 4OS5A 2A45B 1CO7E 1OKXA 1ETRH 1T8MA 2YMSD 1NRNH 4NA9H 1O2OA 1JIMA 2QC2A 5FPTA 2ZGJA 1V2RT 2BZ6H 2M2AA 4ISNA 2PGQB 1T32A 2H5CA 3M36A 1C9TA 1TPSA 1GBBA 3UWIA 4E7RG 2PSXA 1BJVA 3L33A 1XX9A 1KIGH 2XBXA 2ZGCA 3F2GA 1EAIA 2H9TH 4I33A 3P70B 1SSXA 1P01A 5C5OA 4Y0YE 4B1TA 3MNSA 1QTFA 1O5EH 3F9EA 5GPIB 1UHBB 1W0YH 2HGTH 4MNYA 1EJNA 1P11E 3T25A 5JB9S 4E05H 4NSYA 1N1LA 1ZR0A 3QDZB 1EUFA 2GT8A 3EDXB 3GS9A 3RXIA 1XXFA 4I7YH 2VWOA 1GMDF 4JZ1A 4XBBA 1UHBA 1WOFA 3ZVDA 3AASA 5HKKD 5DK1A 3MH4A 3JZ2B 1TGTA 2ZHDA 2J9NA 3U8TH 1GBAA 1ZTJA 2R3UA 5EXNA 2GVFA 1C5PA 1CQQA 2CXVA 3VGCC 3T28A 1AU8A 1S84A 4XBDA 4AG1A 3N7EA 2PFEA 2LNCA 3LOXA 5FCRA 3Q3XA 1TRMA 1A0HB 1C2HA 2BOKA 1QR3E 4IMQA 1EB1H 1BTHH 2AGEX 3TK6A 1V2LT 1TPOA 4GHQA 5F6MA 1PYTC 3KIDU 2GKVE 1HAPH 3GY8A 1MD8A 1MH0A 1O2PA 2OD3B 1KXDA 1Q2WA 1EB2A 1YKTA 3VB4A 3GCHC 5G4BA 4NZQA 1IAUA 2DE9A 3IITA 3VXEH 1ELTA 2G4UA 2ZFTA 1K1LA 2JH6D 3ZZCA 1Z8RA 5HMAA 2ZFFH 3TLOA 1BTUA 1FX0B 3D65E 1W8BH 3QZRA 2KCAA 1BBRH 1UMAH 1O2WA 3ZZ4A 3PWCA 2VH6A 4IGDA 3OAAD 3QTVH 1A3EH 1QIXB 3I78A 4AZ2B 1KTSB 1ZSKA 1YP9A 1OYTH 5C0UA 1O5DH 1EKBB 4OS7A 5GIBA 4DURA 3QTOH 3URDA 3LKWA 3CENA 1ACBE 1O2GH 3F0OA 1LMWB 3BSQA 1MKWH 2P3UB 1E79D 2ODQA 3SZNA 4B73A 3F68H 1DY8A 1JRSA 1GI6A 1BTWA 1QQUA 1QJ6B 2ZI2H 3E16B 1K1MA 1P2IA 1AMHA 1O3IA 2JKHA 3OEHD 3GICB 1SLWB 1A61H 4MLFB 1QL9A 3TITA 1MMJN 1YPLH 1O3PB 2SGQE 1PQ8A 2VIOA 1GJ8B