3KEEA

Hcv ns3/ns4a complexed with non-covalent macrocyclic compound tmc435
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
178
structure length
178
Chain Sequence
ITAYSQQTRGLLGCIITSLTGRDKNQVEGEVQVVSTATQSFLATCVNGVCWTVYHGAGSKTLAGPKGPITQMYTNVDQDLVGWQAPPGARSLTPCTCGSSDLYLVTRHADVIPVRRRGDSRGSLLSPRPVSYLKGSSGGPLLCPSGHAVGIFRAAVCTRGVAKAVDFVPVESMETTMR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Genome polyprotein
publication title Induced-Fit Binding of the Macrocyclic Noncovalent Inhibitor TMC435 to its HCV NS3/NS4A Protease Target
pubmed doi rcsb
source organism Hepatitis c virus
total genus 43
structure length 178
sequence length 178
chains with identical sequence B, C, D
ec nomenclature ec 3.4.21.98: Hepacivirin.
pdb deposition date 2009-10-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02907 Peptidase_S29 Hepatitis C virus NS3 protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3keeA02
2.40.10.120 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 3keeA01
1FY4A 1UO6A 1GHWH 2ZHDA 3Q77A 2H5DA 1TE0A 1XUJA 1A7SA 2GV6A 3QO6A 1VITH 2WZQA 3U69H 1QBOA 2P16A 4Z0KA 1A46H 1HXEH 2FWWA 1NRRH 1F5RA 4X1SU 2J34A 2O8WA 3GCHC 1L1JA 1C9PA 1DOJA 1NFWA 4X1NU 1ELTA 1A0JA 1S83A 2BQ7B 2ZDKA 3VGCC 4DJZB 5HM9A 2ZIQH 1CGJE 1KSNA 2HNTF 1CSOE 4OS5A 1DXPA 1QL8A 2XBXA 1DUAA 4FUGA 4E7NA 1B0FA 3LH3A 3KCGH 1TRNA 3PMJA 4AOQA 1KYNA 1QB1A 1Y59T 1AWHB 3GISB 4X6PA 3ZVEA 3AK5A 2A31A 1MKWH 3OSYA 1O38A 4MG3A 2ZGHA 3AW1A 1O5DH 2O8LA 1UJ1A 1V2PT 2FYQA 3PTNA 5C1XA 4U2WA 1GI9B 1FNIA 1HAIH 2ZQ2A 2ZU5A 2BLOA 1V2WT 1HJ8A 1TFXA 2ZGXH 4KP0A 1C2GA 3QN7A 4NG9H 5TCAA 3BTQE 3SU3A 5EW2H 2B7DH 2ANYA 2CF9H 2EA3A 2PTNA 1D6RA 1IQNA 1HJAB 1NFXA 2ODYB 4B2BA 2UUJB 3M5OA 3R0FA 1H9HE 2HWLB 3TIUA 1E37B 2HALA 3VXEH 3GDVA 5C5OA 3HKJB 1C1QA 3NCLA 1C1RA 5J4SA 2B0FA 1JRTA 1VR1H 1QFKH 3A8CA 3OY5U 3H7OA 1ANCA 5DP7A 4Y8ZA 3BSQA 4DY7B 2Q6GA 1IQKA 1QRWA 2SNWA 2ZGCA 3LC3A 1SQOA 2WPMS 4X2YA 2PFEA 1TX7A 1ZHMA 5I25A 1YPHE 5G4BA 2SGFE 2Z3DA 1P2NA 3P8NA 1SBWA 2C3SA 1DWEH 4MLFB 2WHXA 4X8UH 2FOAA 1GBIA 1RGQA 1QRXA 2RG3A 2EI8A 2W26A 4YT7H 4Q7YA 3BTDE 1BTYA 2FI5E 2H1UA 3H5CB 3T28A 5ETXA 2FOBA 2QY0B 3TVJB 1O36A 1YPJH 4NSVA 4U01A 1OP0A 3V7TA 1OWKA 1TBRH 2JETB 2A32A 1YM0A 3FZDA 3KHVA 3RLYH 4O97A 3KQBA 1TRYA 3ODFA 5DKMA 1MBMA 3BTHE 1V2UT 2ZI2H 1ID5H 1ZYOA 3R3GB 1BJUA 5B6OA 5E2PA 4YZUA 5TCCA 1W3CA 5GNDA 4JYVH 4ZROA 1PPZA 2NU4E 3SJ9A 3FANA 3ZVFA 1JBUH 3K2UA 1Z8GA 2H5CA 3KGPA 3VB4A 1TOMH 1CU1A 3RMOH 3RM0H 4I8HA 1GDUA 1HUTH 1WUNH 2JETC 3E16B 2Q6DA 4K2YA 1FY3A 1AUTC 1GMCF 5LPRA 1NRNH 5EXNA 3A84A 2GT7A 1G37A 3U9AH 5A0BA 1O2YA 4BAHB 2Z9KA 1KXCA 3ZZDA 4J1YA 1INCA 2G52A 1S6HA 1O2TA 4RKOB 1MTVA 4ASHA 1C2KA 3SGQE 2C8ZB 5EPYA 3SJOA 1BITA 1ELAA 2QXIA 2OK5A 2OUAA 1UTKA 2P93A 1C1UH 1DY8A 2HVXA 1TABE 3SU4A 5HGGA 1WCZA 3NK8A 4I33A 2PTCE 2ESTE 4PROA 5ESBA 1G9IE 1LHEH 4Q2KA 1XXDA 2FX4A 1KXDA 1UMAH 1GI1A 3V3MA 3ZVDA 1AVXA 1GBAA 1O3AA 1BMMH 3GY2A 4F49A 3RXTA 2AMPA 1F0SA 1UVUH 3A86A 3VB7A 2Y6TA 4NA8A 1K2I1 1V2JT 4CRFA 4MVNA 3O8RA 5F8TA 3EGKH 1EOJA 2I6QA 1YPLH 3LH1A 5DGJA 1O3OA 3SHAH 7ESTE 4B74A 3MH5A 1O3JA 1OYTH 1QNJA 3GY8A 3LGIA 4ABIA 4CHAB 5F6MA 2VNTA 5A0CA 2G5NA 1VCPA 4HFPB 5AFZH 1O5CB 1AI8H 4OS4A 2ZNKH 4ZKRU 3A7ZA 3RC5A 1O5AB 3UY9A 3UOPA 1V6DA 2Y5GA 2VVVA 4CH2B 1W14U 2QA9E 4KGAA 3BIVH 1ESTA 3VB3A 2ZPRA 1PJPA 1TMTH 1RTKA 2DUCA 3A8AA 3JZ1B 4I8LA 1O2JA 4MPXA 4CHAC 4D76A 1DLKB 1OXGA 3A83A 2WPLS 3BTTE 3PLKA 1JXPA 3URDA 1GL0E 1FIWA 2ZWLH 2WPJS 1EZSC 1MH0A 2A5KA 2Z9JA 1HIAB 1QB6A 1WSSH 3L33A 1QBNA 2HNTE 3SU2A 3T62A 2XC4A 1OPHB 3M3VA 4TWYA 1EP5A 3ZZ4A 2JH0D 2Z3CA 5FHTA 3URCA 1AVGH 4NIVA 1OP2A 5FXLA 1D4PB 2D2DA 3VPKA 5JYIA 3UQVA 1G30B 2FOHA 3PYHA 2Y5HA 2XTTB 1BOQA 1DXWA 1LKBA 1UVOA 1FV9A 4SGAE 2G51A 4AZ2B 2W5EA 3ITIA 4Q7XA 1OYQA 3E90B 3RP2A 2F9PA 3MO3A 1SFIA 4BTUB 3A89A 2FOFA 2BD2A 1ZGIA 3BG8A 1JIMA 1C2MA 3QLPH 2PR3A 3F1SB 4F4OC 1KXAA 3TH3H 1KDQB 2AIQA 1QJ6B 1BDAA 1V2NT 3BN9A 1VCWA 3TPIZ 3QDZB 1MCTA 4CRDA 2ALVA 2BM2A 4X6NA 4ABGA 2BDGA 4XOJA 2FYRA 5L6NH 2OXSA 2PV9B 1HAXB 1NPMA 1C5WB 1C5UA 1ABJH 3NKKA 3SNBA 1OWEA 1GDNA 1TGNA 2Q1JA 1WU1A 1K1MA 2H6MA 3NZIA 1LO6A 2XXLA 5T6GA 1FY1A 2FTMA 4ZUHA 1QURH 3MH7A 4LZ4B 1YCPM 1C1SA 1GJAB 1AD8H 1P03A 1IHSH 4TPIZ 1DICA 3BEIB 3Q00A 3WY8A 1BHXB 3DA9B 3RXJA 3PWCA 4K8YA 4DT7B 1A61H 1GI8B 1GHVH 4Y79A 3KF2A 4KKDA 4B6EA 2VIVA 1ACBE 1ELCA 1J14A 4DIIH 2PGBB 1E38B 3MU1A 2AIPA 3HPTB 6ESTA 2ZECA 4ABHA 1AGJA 2ZTZA 1QQ4A 1WXRA 1LPZB 5GCHG 1SLWB 4FUDA 3K6YA 1CBWB 1JOUB 3P92A 3GY4A 2ZU4A 3ATLA 1THRH 4Y7BA 2ZFSA 1PQAA 1QBVH 2HOBA 3LJJA 3RXHA 1C2IA 2BX3A 1XMNB 2QAAA 4B73A 4B75A 3VFEA 3RU4E 4TY7A 2YNAA 1C5RA 3UR9A 3GICB 4ABEA 1KXEA 2XCFA 1T8NA 1C1OA 2A5AA 1MQ5A 1DSTA 1EJAA 3Q3YA 2SNVA 4FU8A 3A7WA 3EDXB 3LT3A 4Y0ZE 2VU8E 3S9BA 1CBWC 3RDZA 3O8BA 5AHGH 2D26C 1KIGH 1H4WA 3Q3XA 2UUKB 3SI3H 1HAGE 4ABFA 2CGAA 2BY9X 1GJ7B 4B2CA 3M5MA 1D3DB 4DURA 2F4LA 2Z9GA 1QTFA 1EXFA 4YOGA 2BY5X 1HV7A 2GP9B 3LPRA 4ABBA 4I8KA 3UTUH 4XBBA 1V2QT 2D1JA 1G32B 1BHXF 1NN6A 1YP9A 2Y82A 2ZFFH 4JK6A 1EASA 2GMTB 2FS8A 4BAOB 2ZF0H 4UE7H 2GD4B 4B1TA 3M36A 1LHFH 4WMDA 2J9NA 2ZPQA 1NESE 1O5FH 2Z9IA 2ZFRH 4I32A 1BMLA 4AFUA 4K69A 1YPGH 2ZGJA 2GKVE 1C1WH 3VEQB 1GBCA 1BTZA 3E0PB 1HIAA 3UNQA 1LMWB 1K1NA 4I8GA 4XE4A 1FLEE 1CA8B 4O9VA 4CRCA 2FOCA 2ZU1A 1ZMJA 5EU8A 4ZAEA 1Y3UA 2FODA 4CRGA 1NZQH 4ZKNU 3AASA 1N1LA 2GMTC 1XUKA 4IMQA 3B23B 2V35A 1K9OE 1P11E 1RD3B 1OKXA 1P12E 1IAUA 1YKTA 5A8XA 3BV9B 2XBWA 3VXFH 3TU7H 3SO3A 4O3UA 5FX6A 1E34B 2QXHA 3STJA 4WMFA 2BHGA 1KY9A 1T32A 2AEIH 1NC6A 3FAOA 1DS2E 1KDQA 4UONA 5B6LA 1EKBB 2VIQA 3GYLB 1TWXB 2VGCB 3PB1E 1SL3A 1HJ9A 1ZMLA 3BTME 2FI4E 2ZHEH 2VBCA 2ZP0H 3C27B 4ISNA 3F9FA 2FDAA 1Z7KA 5FBEA 3GY7A 4FXGH 1GI4A 2BDYA 1HAHH 1O2MA 1ZHPA 3E3TA 3MO6A 1OS8A 5J4QA 2AS9A 4YESB 4DG4A 1SGDE 4WMEA 4GHTA 2VIOA 5AF9H 5DP4A 4MNXA 2Y7XA 1C2LA 1V2ST 2FTLE 3RMLH 3M3SA 2VGCC 2XWAA 2P3TB 1GHBG 1AFQB 8KME2 1A5HA 3RXSA 4JZDH 1O5EH 4U32A 4BXWA 1C5QA 1DWCH 1TNHA 1BBRK 1SVPA 5T3HA 3SGAE 1YCPK 2FPZA 3MHWU 1EAUA 1F92A 4INHA 2EEKA 1FUJA 2PUQH 4MPUA 3U1IB 5DO4H 5BRRE 4GLYA 1UK3A 3SJKA 3T26A 5T6FA 3LGTA 2ZCHP 1F0RA 3S9AA 1HCGA 5FPSA 3TJNA 4ZMAH 1F0TA 2PLXA 2ZCLP 1AFQC 1YBWA 2Z3EA 8GCHG 1EJNA 3AVZA 5DG6A 2QGRA 3K65B 4ISLA 1GBEA 1T8OA 4A7IB 5C1YA 1O2XA 2QXJA 2OC0A 5DP5A 1G3CA 4H42U 5LPEA 1GHYH 1UCYH 3MH4A 2AH4X 2BVXH 1NY22 2CMYA 1XVOA 7GCHF 1C2HA 1CA0B 4B2AA 1F5KU 1RS0A 1G3BA 4K1TA 2XC0A 3ZZ3A 2VIWA 1T8MA 4I31A 4IN1A 4M9FA 1LCYA 1PPGE 1ZHRA 3JZ2B 1P2IA 1W0YH 4FU7A 4Y6DA 3EYDA 1IQGA 1YC0A 4H4FA 3FZZA 1YGCH 5A09A 4VGCB 2W3IA 2ZQ1A 1MKXK 1PQ7A 3E6PH 2BXUH 5I46H 3U8TH 1ZJKA 1GVLA 3UNSA 1QA7A 1SLXB 1Z8IB 3OTPA 1CA0C 2BYAX 1XKAC 3SHCH 1W10U 2P94A 4OGXA 3MU0A 3BIUH 1P57B 1L4ZA 1PPHE 4ZXXH 4JZFH 3D49H 3GDSA 3U98H 2WINI 3SQEE 3SUFA 1P09A 2G00A 4TPYA 2TIOA 2F9BH 1HAYB 1C2JA 1ZTKA 1TMUH 2OINA 4Q7ZA 4ZXYH 1AU8A 1NU9A 1O5GH 5GCHF 1EP6A 4K1EA 1O5BB 4VGCC 1U6QA 2Y7ZA 2GGVB 1O3PB 1O0DH 3BTEE 1FN6A 4RI0A 1O3KA 2WV4A 1O2RA 4X2WA 3I78A 4A6LA 1C4U2 1HDTH 1Y3WA 2GCTC 2SFAA 3BEUA 4BTIB 5E0GA 1GMHG 2A5IA 3MU4A 1JIRA 3STIA 5FPYA 1TX6A 1UHBB 1K28D 4DCDA 5H4IB 1EAIA 4Q80A 2IOTA 1XUHA 5C1UA 4LOYH 1Q3XA 4WY3A 1EZQA 1HLTH 3OX7U 1S6FA 1HAZB 2Y80A 1ESBA 1DPOA 1K21H 3T29A 1HAPH 4NWLA 2C8XB 1V2MT 1BA8B 1IOEA 4K60A 1Y8TA 1YLDA 1OP8A 2P8OB 1YF4A 4MNYA 3RXBA 1QCPA 1GG6B 1SI5H 1O3MA 2ZEBA 4BNRA 3NXPA 4AB8A 3SV9A 4XSKU 1ETSH 2RCEA 1J9CH 1TPSA 4Z6AH 3CS0A 1FAXA 3C1KA 1MU6B 1CHOG 2OLGA 4MPWA 1O3FA 1EPTC 3IWMA 1UTJA 3TLOA 3TK6A 2A4QA 5GWZA 4DW2U 3RUOA 5JBCS 4BAQB 1AWFH 1C1MA 3AAUA 9LPRA 3RXEA 4Y11E 3T2NA 3GY5A 4Y71A 1P02A 2P95A 3ENSB 2P8OC 4MNVA 1GG6C 3SUDA 2VJ1A 1P8VC 1XUFA 1O2IA 1P3CA 2GCHG 3BTWE 2ZPSA 4UDWH 1TALA 1O3NA 1IQJA 1ELDE 1AE8H 3KIDU 3S7HB 1GWAA 4TY6A 1ZPCA 1PPBH 1CT0E 2I6SA 1DDJA 3SI4H 1OX1A 4Y10E 1SGRE 4CRAA 1ZMNA 4K1SA 2GDEH 2V3OH 3E91A 5AVDA 1P2KA 1SMFE 4NA9H 2GDDA 1ELFA 1DM4B 3IITA 4E05H 1LHDH 3TK9A 2UWLA 3PROA 2G55A 3ZZAA 3T25A 1DSUA 3SU5A 3A7VA 1QA0A 3SNAA 4FUHA 2A2QH 1UCYE 3O8DA 1C2DA 1YLCA 1IQMA 5JBTA 4UFFH 4AB9A 5TJXA 1IQLA 2XBVA 3Q76A 5DK1A 1N6YA 2FOMB 3LGUA 3QZRA 2A4RA 1GL1A 3UWIA 3KQEA 1O35A 2OC1A 2FESH 4CRBA 4WH8A 5IDKA 2FEQH 3NWUA 1TRMA 1NRQH 2A1DB 3F68H 1LQEA 1SOTA 4A1VA 1GMDG 2ZHFH 4NFEA 3SN8A 5DP8A 4CBOA 4GSOA 1AHTH 4B71A 3ZZ8A 1SLUB 3RXRA 2Z7FE 1K1LA 4NIWA 3SW2B 1TPAE 1Z8JB 3GY6A 4J2YB 5CHAB 2AYWA 3S69A 2V0BA 3MH6A 2ZTYA 1O3DA 1ZZZA 3B8JA 3M61U 3RXIA 2HPQH 2BOHB 4OS1A 1MKWK 4RSPA 3SUGA 1SGIB 3LC5A 3MTYA 1W13U 2BQWB 2B5TB 2BVRH 1P9SA 4KELA 4I7YH 1A0LA 1MU8B 4UFEH 1QHRB 4ZHAA 5LPFA 2ALPA 3M35A 3TJUA 3UPEA 1FAKH 3A8BA 4K8BA 1UTNA 1BTPA 4BANB 1QQUA 1FY8E 1ZOMA 1ARCA 3DFJA 2OCVB 4MNWA 1V3XA 4WVPE 1WV7H 2VINA 2CHAB 3I77A 1O33A 1TPOA 5CHAC 8GCHF 1O2PA 3RC4A 4HI3A 2GVFA 1XUIA 4THNH 3SJ8A 1B0EA 4CR5A 1P2QA 1BJVA 1ANBA 1RRKA 4X8SH 3V0XA 4YO9A 1WYKA 1PFXC 2ZTXA 2ZHWH 1C5OH 3RC6A 1UHBA 2XNIA 5DP9A 2BD7A 1KLIH 2TGPZ 1DWDH 2VH6A 2VB0A 2FMJA 3EE0B 2TGAA 1LQDB 3ZZ5A 8ESTE 1K1PA 3SV7A 1LPKB 2Z94A 4IC6A 1TNJA 3LGYA 4AYVB 4AX9H 8LPRA 3QTOH 3EA7A 1NFYA 1AKSB 1OWIA 5FX5A 5F8XA 2CHAC 1XKBC 4WXIA 1HB0B 5JPMH 1QJ7B 3SV2H 1ELEE 2ZDMA 3T5FH 4BAMB 4NSYA 2FLBH 1SQAA 1SGFG 1TYNA 1MZDA 1LTOA 1TNGA 3M5LA 4KTUA 4NA7A 2QCYA 1A3BH 2J92A 3SU0A 4OGYA 4JCNA 3MWIU 2ZKSA 1O2WA 2TBSA 2UWOA 4CR9A 2GX4A 4INKA 1YPKH 2TPIZ 1GCTB 2J95A 1AUJA 2PSYA 1WBGB 2J38A 1DE7H 3BF6H 1XVMA 2BDHA 4JZ1A 3TGJE 2W7SA 3A85A 3CP7A 4ZKOU 1M9UA 5L30H 3FP6E 2BDBA 2ANWA 1G2LA 3PV2A 2BY6X 3EA8A 1BBRH 1ZJDA 3DHKH 1YCPH 2TGDA 3D23A 2ZFQH 2GZ9A 2BMGB 3QZQA 2PWXA 1IHTH 2BXTH 2RDLA 3QGJA 1ESAA 1GCTC 1MAYA 1GJ6A 1GMHF 2A7JA 1RJXB 1LHGH 2ZDVH 2CV3A 1TNIA 1G2MA 2D8WA 2WYJA 3UREA 1MTWA 2P3FH 2WPIS 2VWOA 3OU0A 1SOZA 1TGCA 3PTBA 3RXMA 3VB5A 3AAVA 1LVBA 1LDTT 2PKSB 3D62A 4RN6A 1SGNE 2BD8A 5EQQA 2FP7B 4FUCA 2VVUA 1MMJN 1KXFA 2M5TA 4GCHG 3VB6A 3LONA 1GI7B 1UTPA 1IQEA 4WWYA 1GBDA 2QIQA 2EC9H 3SBKA 1GHZA 3UQOA 2CJIA 3MU5A 1ELGA 2FOEA 1H8IH 1C1VH 1SPJA 3V12A 4FUEA 2R0KA 1C2EA 1O2HA 1W7GH 4XFQA 4ABDA 4UFDH 4AFQA 3SORA 4AGKA 5EODA 1NRPH 1V2LT 2ZGBH 3DT0H 2WV9A 2PKSC 4AFZA 3SU1A 2Y5FA 3ODDA 1PYTD 4IGDA 3ELAH 3LKWA 4FUIA 2G8TA 2BD5A 1AE5A 1FZZA 1EATA 1GBBA 1P0SH 2GCHF 4INLA 4OS6A 2AGEX 2ZZUH 3ZVBA 1H1BA 1W8BH 4YLQH 3SV6A 3MNBA 3M5NA 1C5VA 1C5NH 1A2CH 3BG4C 4ZHMU 2ZC9H 3K9XB 4ISIH 4D9QA 1ZPZA 2ANKH 1O32A 5JBAS 1MD7A 1O3GA 5C3NA 1EX3A 1CGIE 3F9EA 3SOSA 5DP6A 2BD9A 2BZ6H 2OD3B 1VGCB 4KTSA 1K1JA 3SJIA 3MO9A 5JB8S 2A7HA 2A0QB 1O3LA 2BY8X 3RLWH 1J15A 1ANEA 1NU7B 1TLDA 1THSH 2QF3A 1LVYA 1SGQE 4M7GA 1ZR0A 1T7CA 1SC8U 3HGNA 3QGNB 1DANH 4D8NA 1Z6EA 4BTTB 1GMCG 2QF0A 4YOJA 5SGAE 1ZTLA 3UFAA 1S85A 4NZLA 2BB4A 4FVBA 1C5SA 1P2MA 1XXFA 3W94A 5DPAA 1IQIA 1KLJH 2B9LA 1O2VA 1FN8A 5FCKA 1VGCC 1WAYB 1K22H 1TGSZ 1D6WA 2O8TA 3TK5A 3S9CA 4IS5A 1AKSA 1E36B 2BD4A 1DX5M 1GHAG 2EI6A 3M7TA 1QL9A 2SGPE 1GMDF 2STAE 1O3IA 2OC7A 1C5MD 1GJ5H 4DVAU 1DT2A 1TNLA 3ZVGA 3B9FH 1TA6A 4X2XA 1H8DH 3HKIB 2J2UA 1DLEA 1C4Y2 4NGAH 2OC8A 3ATMA 3RXVA 4CREA 1C5YB 1GJBB 2A45B 3TJOA 3SNEA 2XW9A 4X6OA 4IW4E 4CH8B 4ISHH 3RXKA 2LNCA 4MTBA 1TX8A 1ZSLA 2QC2A 1B7XB 3P8OA 3MNCA 4X1RU 1PPEE 3V13A 2ZHQH 1ZLRA 5EXMA 1LVOA 4E7RG 1HGTH 2A4GA 4A5TS 2SGDE 1XM1A 1ETRH 4X1QU 1AQ7A 3RXDA 1GBJA 2BVSH 1W11U 1A5GH 4YM9A 1VJ9U 1ELBA 1Z1JA 5F8ZA 1CT4E 1OWHA 1GBHA 1QJ1B 4CBNA 3UWJH 1ABIH 1TGTA 1W2KH 4FUFA 1C2FA 4YOIA 2AERH 1V2RT 1QR3E 4NFFA 1YYY1 5C5NA 1DUEA 3BTFE 2JH5D 3O8CA 1V2OT 4X0WU 2QYIA 4BXSA 5LH8A 2UUYA 2HRVA 1LKAA 2OQUA 2VWNA 4HTCH 1C5TA 1G3EA 1HNEE 2O9QA 3SQHE 3S7KB 1FJSA 1SHHB 2A4OA 4B6FA 4GHQA 3TJVA 3RXCA 2ODQA 5EQSA 4FU9A 2YNBA 3SUEA 1LPGB 4HZHA 1LHCH 2FZZA 1Z71A 3HK6B 1CVWH 1W0ZU 1HRTH 3HK3B 1SG8B 4NWKA 1O2NA 2JH6D 1CGHA 1SGPE 3P8FA 6LPRA 1WQVH 1ANDA 2STBE 2ZFTA 3A7YA 3UOUA 2BDCA 2IN2A 3W95A 4X8TH 1L0ZA 2BLWA 3A81A 3A80A 3LIWA 5PTPA 1ZRBA 1BTUA 5HM2A 3ZZBA 2YOLA 5FAHA 4UFGH 3ESTA 1FQ3A 2TRMA 1TA2A 4FUBA 1FI8A 2XYAA 2GCTB 3M7UA 1MD8A 3GOVB 3RXQA 2ASUB 3MOCA 1OSSA 1GJ9B 2R2MB 4ABAA 1TB6H 3A88A 1GJCB 3KQDA 1GI5A 2RA3A 3LDXH 2CF8H 1FIZA 2H9HA 2B8OH 1UTOA 2QV1A 4MPVA 1BMNH 5GIBA 2HGTH 1UTMA 5HYOA 1GHXH 1GBTA 2IPHA 5HMAA 4IMZA 1ZPBA 1QB9A 1K1IA 4GCHF 1ZGVA 2ZA5A 3GCTG 4AG1A 1Z1IA 1QGFA 1O2KA 2P3UB 3RXAA 4GAWA 2ULLA 3Q3KA 1GJ8B 1QL7A 1AVWA 1N8OB 2R0LA 5A8YA 1SB1H 1EPTB 1EZXC 1AIXH 1KTSB 4Y7AA 4HGCA 1SQTA 5E2OA 4A1XA 2V3HH 4ZHLU 3RU4D 1O37A 5T6DA 1HJAC 2ZDNA 2CXVA 5EW1H 3GYMA 1PQ5A 3QTVH 2PSXA 3HATH 1H9IE 1FDPA 1LVMA 5FCRA 5FBIA 1EZUC 4JMYA 3A7XA 2H9EH 3OTJE 2G4UA 5EG4A 4IC5A 3PMAB 1GPZA 3PWBA 1SGFA 1F5LA 4LXBH 2VVCA 1TBQH 3L3TA 1QRZA 1L2EA 2ZG0H 2SGEE 2A2XH 4B76A 1N8OC 2NWNA 4I8JA 5E8EH 2IJD1 1MTNB 3T27A 5CMXH 2WUCA 5GJ4B 4U30A 5A0AE 3P8GA 3F9GA 2FS9A 4DOQA 1AZ8A 2C8YB 4BOHA 2O8MA 3RXGA 3F9HA 3SNCA 1SHYA 3RMMH 1G3DA 2UWPA 2RA0A 1D3PB 7LPRA 2R3YA 2AGGX 1NTPA 1C1PA 1GBKA 1MTNC 3G01A 1TMBH 2QN5T 2W7UA 3GY3A 2OBQA 3UUZA 2HLCA 4IN2A 3RXPA 6GCHG 2AFQB 1L4DA 5E0JA 1TQ0B 4ESTE 1A4WH 1Y3VA 2R9PA 1FY5A 1TPPA 2OBOA 4LK4A 2PUXB 2DE9A 5GPIB 2Z9LA 1P10A 2BOKA 2BQ6B 1BTXA 1O3BA 3LJOA 1GHAF 2ODPA 1EUFA 1SGCA 2LPRA 4Y0YE 1ZSKA 2WV5A 2WUBA 3AW0A 3L6PA 3A8DA 1V2VT 4NCYA 1P2OA 3PO1B 4YT6H 1UVTH 2XRCA 4JK5A 3K6ZA 3DD2H 2XC5A 6CHAB 4QT8C 1O3EA 2BLVA 3ZZCA 1DWBH 4BAKB 3SU6A 1O2SA 1TGBA 1UTQA 3TGKE 1P05A 5EPNA 1QY6A 1C5ZB 1TONA 1WOFA 1GCDA 2Y81A 3M7QA 3SNDA 1UVPA 2F9UA 2TGTA 1GJ4H 1Y3YA 2W3KA 1O31A 3KQCA 4OM9A 5AFYH 2GT8A 1NM6A 1P2JA 1C1TA 4AORA 4ABJA 1DY9A 5K7RA 3CENA 4FVDA 1FPCH 1UCYK 3QK1A 1GHBF 1AO5A 1ELVA 3PO1C 2BTCE 3TNTA 3PLPA 4WXVA 1GBFA 2J4IA 3RU4T 1HPGA 2C93B 1C5PA 3E1XB 3DFLA 6CHAC 1VITG 1S0RA 3ATWA 2C90B 5EXLA 4UEHH 5IYTA 1GVZA 3KNXA 1BRBE 5FPTA 2KAIB 1O3HA 3SZNA 3PV5A 5K0HA 4MDSA 1UK4A 4R8TB 4AGJA 4H6TA 1NT1A 1O2QA 1MTUA 2NU3E 4X8VH 1MBQA 2VH0A 2ILNA 1DFPA 1GJDB 1KLTA 2OQ5A 3P17H 2VIDA 5C67A 3I29A 1HAVB 2SGQE 2XWBI 3CS7A 3S0NA 4AYYB 3NPSA 1MCVA 4D7FA 5L2YH 1UTLM 2K1QA 3F6UH 3NUMA 1AN1E 4K5ZA 1W7XH 1ZSJA 1UVSH 3SGBE 4OS7A 2PHBA 1FXYA 2FOGA 1GI3A 3ATKA 1EPTA 3FP7E 3U8RH 3ZZ7A 1QIXB 4ZH8A 1RIWB 2GZ8A 1C1NA 4Y76A 3IG6B 1Z6JH 1EJMA 2NU0E 1BRAA 2WPHS 1O2GH 5DP3A 1GBLA 1W12U 1WTHD 3ZZ6A 1P04A 3TITA 1Y5UT 3LGVA 2G81E 2PKAB 1Q31A 1MZAA 2V6NA 2O8UA 5EGMA 2IJOB 2F91A 1J8AA 3TNSA 3GDUA 4WF8A 4TWWA 1RIWC 3ZYDA 1GGDB 3PLBA 1G36A 1CO7E 1JWTA 1IQFA 1AFEH 1IQHA 1BTWA 1C5XB 4LZ1H 3U8OH 1BRCE 3H7TA 1TBZH 1DITH 2F9OA 3N7OA 4O03A 5EQRA 3RXLA 7GCHG 4A1TA 5A2MH 4Y8YA 1V2KT 4XDEA 1BUIA 5ABWA 2GTBA 5HXFA 3KL6A 1A5IA 1J17T 3EQ0H 1JRSA 4WH6A 1RTFB 5C20A 3H09A 1Q2WA 2BD3A 3TGIE 1S84A 1C4V2 1D3QB 1GGDC 3GCTF 4D9RA 2ZO3H 4JZEH 3TH4H 1HAOH 2AGIX 4NIYA 2CN0H 1F7ZA 1T8LA 1YPMH 2BY7X 2BZAA 5GDSH 4FUJA 3MMGA 3LOXA 5JBBS 2SGAA 3OYPA 1A1RA 1YPHC 4MQAA 2F83A 1SGYE 1TNKA 1P3EA 1BCUH 3A87A 1UK2A 1ARBA 1GBMA 1FPHH 2R2WU 3RMNH 1HFDA 1NFUA 2AMQA 3FVFB 1GDQA 3MU8A 3FP8E 4GVUA 5C2ZA 5T1VA 4SGBE 3QWCH 1BZXE 3BEFB 1CQQA 1BMAA 3SZEA 3BTGE 3TH2H 2C4FH 1ZRKA 4GPGA 1CHOF 1L1NA 1TQ7B 3BG4B 3ZVCA 1H9LB 1Y3XA 5LGOA 2ZU3A 1BTHH 2UUFB 5CE1A 3M37A 3KEEA 5L2ZH 1DVAH 1TOCB 1C9TA 3QX5H 1A0HB 1PQ8A 1PPCE 2BDAA 1RTLA 1MKXH 1OOKB 1S82A 4JYUH 2G5VA 3MNSA 4NIXA 1V2TT 3ZV9A 4AN7A 2F9NA 4A92A 1EB2A 1PYTC 1O2LA 1VCQA 3PMBB 1SR5C 3MFJA 4NZQA 5GXPA 4GUXA 3ZV8A 2VIPA 2NU2E 1C5LH 1BRUP 2H2ZA 3FFGA 5JDUB 2R3UA 4OS2A 4XBDA 2P59A 3EAJA 4O3TA 3GCOA 1VJAU 1S5SA 3SV8A 1HYLA 3ATIA 4XBCA 1O39A 1MQ6A 9ESTA 3P95A 4E06H 1TAWA 3MNXA 2KAIA 6GCHF 1BQYA 4ISOA 1GI6A 2GV7A 1S0QA 1KXBA 4JZIA 3PM3A 2ZDAH 2EI7A 1BT7A 4X2VA 3A7TA 1J16A 4YLUA 3ZZ9A 3E0NB 2F9VA 3MYWA 1S81A 1NO9H 2JKHA 7KMEH 1SFQB 1AY6H 1HAVA 3M3TA 1T4VH 1SGTA 4JYTA 4DGJA 5DJ7A 1T4UH 1Z8RA 2ZDLA 3UNRA 1D9IA 2J94A 3RXFA 3ZYEA 4WJG2 1K1OA 2Q6FA 2ZU2A 5E0HA 3LU9B 2A7CA 2XCNA 5BPEA 1MTSA 1XX9A 3GCNA 1HXFH 2BLQA 3HGPA 1WQSA 3KN2A 2G4TA 1NROH 3P6ZB 1L1GA 5A8ZA 2BX4A 2FI3E 4IBLH 1E35B 2NU1E 2AMDA 3A82A 1O2OA 1PPFE 2C8WB 1SSXA 4X1PU 1BB0B 3QUMP 1Y5AT 1WTGH 1O34A 2WYGA 3ZVAA 1YPEH 1E0FD 1AMHA 3MI4A 1MAXA 1AB9B 2PKAA 2ZCKP 1GVKB 3LGWA 1FMGA 3RM2H 1FONA 2FLRH 2FX6A 5JB9S 1GI2A 2BDIA 2FIRH 1D3TB 2GZ7A 1P01A 2VWLA 3SYJA 1VITF 2HPPH 1SLVB 1NS3A 2FM2A 1B5GH 1NRSH 1RFNA 2F3CE 4YTAA 4AG2A 2DE8A 1N6XA 3P70B 1JMOH 4Y8XA 1XUGA 2QXGA 4TYDA 2OP9A 3U1JB 3D65E 1O2ZA 4AFSA 4R0IA 5F03A 3UIRA 1CE5A 1O3CA 1BBRE 5EOKA 1EOLA 1RXPA 1AB9C 1EB1H 4ZKSU 4KTCA 4D7GA 4RKJB 1THPB 4UD9H 4DIHH 1MUEB 1ETTH 1O30A 1P06A 2FO9A 2PGQB 1TIOA 2H9TH 3RXUA 3OY6U 1SGEE 2FXRA 3PV4A 3EA9A 1HBTH 1CHGA 1BIOA 1VZQH 1OWJA 1Y5BT 3E8LA 1ZTJA 1OWDA 2HNTC 2VWMA 3DUXH 3GCHB 1KTTB 3PMHB 2ANMH 2THFB 1F2SE 1EQ9A 1EAWA 1EAXA 3VGCB 1ORFA 3UR6A 3RXOA 1F0UA 1P9UA 2XBYA 5ESTE 1T31A 2Z6BD 3BTKE 4X6MA 1GI0A 1A3EH 1AZZA 2OTVA 1O2UA 4H6SB 2ZFPH 4K3JA 2WPKS 1CT2E 1X7AC 2PW8H
chains in the Genus database with same CATH superfamily
4Q63A 1FY4A 1UO6A 1GHWH 2ZHDA 3Q77A 2H5DA 1TE0A 1XUJA 1A7SA 2GV6A 2WZQA 1VITH 3QO6A 3U69H 1QBOA 2P16A 4Z0KA 1A46H 1HXEH 2FWWA 1NRRH 1F5RA 5KGOA 4X1SU 2J34A 2O8WA 3GCHC 1L1JA 1C9PA 1DOJA 1NFWA 4X1NU 1ELTA 1A0JA 1S83A 2BQ7B 2ZDKA 3VGCC 4DJZB 5HM9A 2ZIQH 1CGJE 1KSNA 2HNTF 1CSOE 4OS5A 1DXPA 1QL8A 2XBXA 1DUAA 4FUGA 4E7NA 1B0FA 3LH3A 3KCGH 1TRNA 3PMJA 4AOQA 1KYNA 1QB1A 1Y59T 1AWHB 3GISB 2XNDD 4X6PA 3ZVEA 3AK5A 2A31A 1MKWH 3OSYA 1O38A 4MG3A 2ZGHA 3AW1A 1O5DH 2O8LA 1UJ1A 1V2PT 2FYQA 3PTNA 5C1XA 4U2WA 2V3MA 1GI9B 1FNIA 1HAIH 2ZQ2A 2ZU5A 2BLOA 1V2WT 1HJ8A 1TFXA 2ZGXH 4KP0A 1C2GA 3QN7A 4NG9H 5TCAA 3BTQE 3SU3A 5EW2H 2B7DH 2ANYA 2CF9H 2EA3A 2PTNA 1D6RA 1IQNA 1HJAB 1NFXA 2ODYB 4B2BA 2UUJB 3M5OA 3R0FA 1H9HE 2HWLB 3TIUA 1E37B 2HALA 3VXEH 3GDVA 5C5OA 3HKJB 1C1QA 5IK2D 1KMHB 3NCLA 1C1RA 5J4SA 2B0FA 1JRTA 1VR1H 1QFKH 3A8CA 3OY5U 3H7OA 1ANCA 5DP7A 2JIZD 1BMFD 4Y8ZA 1VKYA 3BSQA 4DY7B 2Q6GA 1IQKA 1QRWA 2SNWA 2ZGCA 3LC3A 1SQOA 2WPMS 4X2YA 2PFEA 1TX7A 1ZHMA 5I25A 1YPHE 5G4BA 2SGFE 2Z3DA 1P2NA 3P8NA 1SBWA 2C3SA 1DWEH 4MLFB 2WHXA 4X8UH 2FOAA 1GBIA 1RGQA 1QRXA 2RG3A 2EI8A 2W26A 4TT3D 4YT7H 4Q7YA 3BTDE 1BTYA 2FI5E 2H1UA 3H5CB 3T28A 5ETXA 2FOBA 2QY0B 3TVJB 1O36A 1YPJH 4NSVA 4U01A 1OP0A 3V7TA 1OWKA 1TBRH 2JETB 2A32A 1YM0A 3FZDA 3KHVA 3RLYH 4O97A 3KQBA 1TRYA 3ODFA 5DKMA 1MBMA 3BTHE 1MABB 1V2UT 2ZI2H 1ID5H 1ZYOA 3R3GB 1BJUA 5B6OA 5E2PA 4YZUA 5TCCA 1W3CA 5GNDA 4JYVH 4ZROA 1PPZA 2NU4E 3SJ9A 3FANA 3ZVFA 1JBUH 3K2UA 1Z8GA 2H5CA 3KGPA 3VB4A 1TOMH 1CU1A 3RMOH 3RM0H 4I8HA 1GDUA 1HUTH 1WUNH 2JETC 3E16B 2Q6DA 4K2YA 1FY3A 1AUTC 1GMCF 5LPRA 1NRNH 5EXNA 3A84A 2GT7A 1G37A 3U9AH 5CDFE 5A0BA 1O2YA 4BAHB 2Z9KA 1KXCA 3ZZDA 4J1YA 1INCA 2G52A 1S6HA 1O2TA 4RKOB 1MTVA 4ASHA 1C2KA 3SGQE 2C8ZB 5EPYA 3SJOA 2RDEA 1BITA 1ELAA 2QXIA 2OK5A 2OUAA 1UTKA 2P93A 1C1UH 1DY8A 2HVXA 1TABE 3SU4A 1COWD 3OEED 5HGGA 1WCZA 3NK8A 4I33A 2PTCE 2ESTE 4PROA 4P02A 5ESBA 1G9IE 1LHEH 5C17A 4Q2KA 1XXDA 2FX4A 1KXDA 2JJ2D 1UMAH 1GI1A 3V3MA 3ZVDA 1AVXA 1GBAA 1O3AA 1BMMH 3GY2A 4F49A 3RXTA 2AMPA 1F0SA 1UVUH 3A86A 3VB7A 2Y6TA 2L6OA 4NA8A 1K2I1 1V2JT 4CRFA 4MVNA 3O8RA 5F8TA 3EGKH 1EOJA 2I6QA 1YPLH 3LH1A 5DGJA 1O3OA 4FOUC 3SHAH 7ESTE 4B74A 3MH5A 1O3JA 1OYTH 1QNJA 3GY8A 3LGIA 4ABIA 4CHAB 5F6MA 2VNTA 5A0CA 5CHBA 2G5NA 1VCPA 4HFPB 5AFZH 1O5CB 4DT4A 1AI8H 4OS4A 3WWBA 2ZNKH 4ZKRU 3A7ZA 3RC5A 1O5AB 3UY9A 3UOPA 2YMSB 1V6DA 2Y5GA 2VVVA 4CH2B 1W14U 2QA9E 4KGAA 3BIVH 1ESTA 3VB3A 2ZPRA 1PJPA 1TMTH 1RTKA 2DUCA 3A8AA 3JZ1B 4I8LA 1O2JA 4MPXA 4CHAC 4D76A 1DLKB 1OXGA 3A83A 2WPLS 3BTTE 3PLKA 1JXPA 3URDA 1GL0E 1FIWA 2ZWLH 2WPJS 1EZSC 1MH0A 2A5KA 5DSFA 2Z9JA 2YMSC 1HIAB 1QB6A 1WSSH 3L33A 1QBNA 4TSFD 2HNTE 3SU2A 3T62A 2XC4A 1OPHB 3M3VA 4TWYA 1EP5A 3ZZ4A 2JH0D 2Z3CA 5FHTA 3URCA 1AVGH 1SKYE 4NIVA 1OP2A 5FXLA 1D4PB 2D2DA 3VPKA 5JYIA 3UQVA 1G30B 2FOHA 3PYHA 2Y5HA 2XTTB 5C94A 1BOQA 1DXWA 1LKBA 1UVOA 1FV9A 4SGAE 2G51A 4AZ2B 2W5EA 3ITIA 4Q7XA 1OYQA 3E90B 3RP2A 2F9PA 3MO3A 1SFIA 4BTUB 3A89A 2FOFA 2BD2A 1ZGIA 3BG8A 1JIMA 1C2MA 3QLPH 2PR3A 3F1SB 4F4OC 1KXAA 3TH3H 1KDQB 2AIQA 1QJ6B 1BDAA 3UAIC 1V2NT 3BN9A 1VCWA 3TPIZ 3QDZB 1MCTA 4CRDA 2ALVA 2BM2A 4X6NA 4ABGA 2BDGA 4XOJA 2FYRA 5L6NH 2XOKD 2OXSA 2PV9B 2EQNA 1HAXB 1NPMA 1C5WB 1C5UA 1ABJH 3NKKA 3SNBA 1OWEA 1GDNA 1TGNA 2Q1JA 1WU1A 1K1MA 2H6MA 3NZIA 1LO6A 2XXLA 5T6GA 1FY1A 2FTMA 4ZUHA 1QURH 3MH7A 4LZ4B 1YCPM 1C1SA 1GJAB 1AD8H 1P03A 1IHSH 4TPIZ 1DICA 3BEIB 3Q00A 3WY8A 1BHXB 3DA9B 3RXJA 3PWCA 4K8YA 4DT7B 1A61H 1GI8B 1GHVH 4Y79A 3KF2A 4KKDA 4B6EA 2VIVA 1ACBE 1ELCA 1J14A 4DIIH 2PGBB 1E38B 3MU1A 2AIPA 3DSGA 3HPTB 6ESTA 2ZECA 4ABHA 1AGJA 3FOAA 2ZTZA 1QQ4A 1WXRA 1LPZB 5GCHG 1SLWB 4FUDA 3K6YA 1CBWB 1JOUB 3P92A 3GY4A 2ZU4A 3ATLA 1THRH 4Y7BA 2ZFSA 2J98B 1PQAA 1QBVH 2HOBA 3LJJA 3RXHA 1C2IA 2BX3A 1XMNB 2QAAA 4B73A 4B75A 3VFEA 3RU4E 2KCYA 4TY7A 2YNAA 1C5RA 3UR9A 1E1RD 3GICB 4ABEA 1KXEA 2XCFA 1T8NA 1C1OA 2A5AA 2QF5A 1MQ5A 1DSTA 1EJAA 3Q3YA 2SNVA 4FU8A 3A7WA 3EDXB 3LT3A 4Y0ZE 2VU8E 1S6LA 3S9BA 1CBWC 3RDZA 3O8BA 5AHGH 2D26C 1KIGH 1H4WA 3Q3XA 2UUKB 3SI3H 1HAGE 4ABFA 2CGAA 2BY9X 1GJ7B 4B2CA 2F4LA 1D3DB 3M5MA 4DURA 2Z9GA 1QTFA 1EXFA 4YOGA 2BY5X 1HV7A 2GP9B 3LPRA 4ABBA 4I8KA 3UTUH 4XBBA 1V2QT 2D1JA 1G32B 1BHXF 1NN6A 3KYFA 1YP9A 2Y82A 2ZFFH 4JK6A 1EASA 2GMTB 2FS8A 4BAOB 2ZF0H 4UE7H 2GD4B 4B1TA 3M36A 1LHFH 4WMDA 2J9NA 2ZPQA 1NESE 1O5FH 2Z9IA 2ZFRH 4I32A 1BMLA 4AFUA 4K69A 1YPGH 2ZGJA 2GKVE 1C1WH 3VEQB 1GBCA 1BTZA 3E0PB 1HIAA 3UNQA 2J5UA 1LMWB 1K1NA 4I8GA 2W6ID 4XE4A 1FLEE 1CA8B 4O9VA 4CRCA 2FOCA 2ZU1A 1ZMJA 5EU8A 2LELA 4ZAEA 1Y3UA 2FODA 4CRGA 1NZQH 4ZKNU 3AASA 1N1LA 2GMTC 1XUKA 4IMQA 3B23B 2V35A 1K9OE 1P11E 1RD3B 1OKXA 1P12E 1IAUA 1YKTA 5A8XA 3BV9B 2XBWA 3VXFH 3TU7H 3SO3A 4O3UA 5FX6A 1E34B 2QXHA 3STJA 4WMFA 2BHGA 1KY9A 1T32A 2AEIH 1NC6A 3FAOA 1DS2E 1KDQA 1H8HD 4UONA 5B6LA 1EKBB 2VIQA 3GYLB 1TWXB 2VGCB 3PB1E 1SL3A 1HJ9A 1ZMLA 3BTME 2FI4E 2ZHEH 2VBCA 2ZP0H 3C27B 4ISNA 3F9FA 2FDAA 1Z7KA 5FBEA 3GY7A 4FXGH 1GI4A 2BDYA 3WWFA 1HAHH 1O2MA 1ZHPA 3E3TA 3NRLA 3MO6A 1OS8A 5J4QA 2AS9A 4YESB 4DG4A 1SGDE 4WMEA 4GHTA 2VIOA 2W6JD 5AF9H 5DP4A 4MNXA 2Y7XA 1C2LA 1V2ST 2FTLE 3RMLH 3M3SA 2VGCC 2XWAA 2P3TB 1GHBG 1AFQB 2CK3D 8KME2 1A5HA 3RXSA 4JZDH 1O5EH 4U32A 4BXWA 1C5QA 1DWCH 1TNHA 1BBRK 1SVPA 5T3HA 3SGAE 1YCPK 2FPZA 3MHWU 1EAUA 1F92A 4INHA 2EEKA 1FUJA 2PUQH 4MPUA 3U1IB 5DO4H 5BRRE 4GLYA 1UK3A 3SJKA 3T26A 5T6FA 3LGTA 2ZCHP 1F0RA 3S9AA 4F48B 1HCGA 5FPSA 3TJNA 4ZMAH 1F0TA 2PLXA 2ZCLP 1AFQC 2J98A 1YBWA 2Z3EA 8GCHG 1EJNA 3AVZA 5DG6A 2QGRA 3K65B 4ISLA 3UB0A 1GBEA 1T8OA 4A7IB 5C1YA 1O2XA 2QXJA 2OC0A 5DP5A 1G3CA 4H42U 3OFND 5LPEA 1GHYH 1UCYH 3MH4A 2AH4X 2BVXH 1NY22 2CMYA 2HLDD 1XVOA 3N99A 7GCHF 1C2HA 1CA0B 4B2AA 1F5KU 1RS0A 1G3BA 4K1TA 2XC0A 3ZZ3A 2VIWA 1T8MA 4I31A 4IN1A 4M9FA 1LCYA 1OHHD 1PPGE 1ZHRA 3JZ2B 1P2IA 1W0YH 4FU7A 4Y6DA 3EYDA 1IQGA 1YC0A 4H4FA 3FZZA 1YGCH 5A09A 4VGCB 2W3IA 2ZQ1A 1MKXK 1PQ7A 3E6PH 2BXUH 5I46H 3U8TH 1ZJKA 1GVLA 3UNSA 1QA7A 1SLXB 1Z8IB 3OTPA 1CA0C 2BYAX 1XKAC 3SHCH 1W10U 2P94A 4OGXA 3MU0A 3BIUH 1P57B 1L4ZA 1PPHE 4ZXXH 4JZFH 3D49H 3GDSA 3U98H 2WINI 3SQEE 3SUFA 1P09A 2G00A 4TPYA 2TIOA 2F9BH 1HAYB 1C2JA 1ZTKA 1TMUH 2OINA 4Q7ZA 4ZXYH 1AU8A 1NU9A 1O5GH 5GCHF 1EP6A 4K1EA 1O5BB 4VGCC 1U6QA 2Y7ZA 2GGVB 1O3PB 1O0DH 3BTEE 1FN6A 4RI0A 1O3KA 2WV4A 1O2RA 4X2WA 3I78A 4A6LA 1C4U2 1HDTH 1Y3WA 2GCTC 2SFAA 3BEUA 4BTIB 5E0GA 1GMHG 2A5IA 3MU4A 1JIRA 3STIA 5FPYA 1TX6A 1UHBB 1K28D 4DCDA 4HG6A 1EAIA 5H4IB 4Q80A 2IOTA 1XUHA 5C1UA 3GS9A 1Q3XA 4LOYH 4WY3A 1EZQA 1HLTH 3OX7U 1S6FA 1HAZB 2Y80A 1ESBA 1DPOA 1K21H 3T29A 1HAPH 4NWLA 2C8XB 1V2MT 1BA8B 1IOEA 4K60A 1Y8TA 1YLDA 1OP8A 2P8OB 1YF4A 4MNYA 3RXBA 1QCPA 1GG6B 1SI5H 1O3MA 2ZEBA 4BNRA 3F2GA 3NXPA 4AB8A 3SV9A 4XSKU 1ETSH 2RCEA 1J9CH 1TPSA 4Z6AH 3CS0A 1FAXA 3C1KA 1MU6B 1CHOG 2OLGA 4MPWA 1O3FA 1EPTC 3IWMA 1UTJA 3TLOA 2KX4A 3TK6A 2A4QA 5GWZA 4DW2U 2V7QD 3RUOA 5JBCS 4BAQB 1AWFH 1C1MA 3AAUA 9LPRA 3RXEA 4Y11E 3T2NA 3GY5A 4Y71A 1P02A 2P95A 3ENSB 2P8OC 4MNVA 1GG6C 3SUDA 2VJ1A 1P8VC 1XUFA 1O2IA 1P3CA 2GCHG 3BTWE 2ZPSA 4UDWH 1TALA 5HIYA 1O3NA 1IQJA 1ELDE 1AE8H 3KIDU 3S7HB 1GWAA 4TY6A 1ZPCA 1PPBH 1CT0E 2I6SA 1DDJA 3SI4H 1OX1A 4Y10E 1SGRE 1K0HA 4CRAA 1ZMNA 4K1SA 2GDEH 2V3OH 3E91A 5AVDA 1P2KA 1SMFE 4NA9H 2GDDA 1ELFA 1DM4B 3IITA 4E05H 1LHDH 3TK9A 2UWLA 3PROA 2G55A 3ZZAA 3T25A 1DSUA 3SU5A 3A7VA 1QA0A 3SNAA 4FUHA 2A2QH 1UCYE 3O8DA 1C2DA 1YLCA 1IQMA 5JBTA 4UFFH 1E79D 3F0OA 4AB9A 5TJXA 2KM0A 1IQLA 2XBVA 3Q76A 5DK1A 1N6YA 2FOMB 3LGUA 3QZRA 2A4RA 1GL1A 3UWIA 3KQEA 1O35A 2OC1A 2FESH 4CRBA 4WH8A 5IDKA 2FEQH 3NWUA 1TRMA 2JJ1D 1NRQH 2A1DB 3F68H 1LQEA 1SOTA 3FO8D 4A1VA 1GMDG 2ZHFH 4ACAA 4NFEA 3SN8A 5DP8A 4CBOA 4GSOA 1AHTH 4B71A 3ZZ8A 1SLUB 3RXRA 2Z7FE 1K1LA 4NIWA 3SW2B 1TPAE 3VG8A 1Z8JB 3GY6A 4Q4LA 4J2YB 5CHAB 2AYWA 3S69A 2V0BA 3MH6A 2ZTYA 1O3DA 1QZ8A 1ZZZA 3B8JA 3M61U 3RXIA 2HPQH 2BOHB 4OS1A 1MKWK 4RSPA 3SUGA 4F55A 4Z1MD 1SGIB 1NBME 3LC5A 1YY3A 3MTYA 1W13U 2BQWB 2B5TB 2BVRH 1P9SA 4KELA 4I7YH 1A0LA 1MU8B 4UFEH 1QHRB 4ZHAA 5LPFA 2ALPA 3M35A 3TJUA 3UPEA 1FAKH 3A8BA 4K8BA 2KCOA 1UTNA 1BTPA 4BANB 1QQUA 1FY8E 1ZOMA 1ARCA 3U28C 3DFJA 2OCVB 4MNWA 1V3XA 4WVPE 1WV7H 2VINA 2CHAB 3I77A 1O33A 1TPOA 5CHAC 8GCHF 1O2PA 3RC4A 4HI3A 2GVFA 1XUIA 4THNH 3SJ8A 1B0EA 4CR5A 1P2QA 1BJVA 1ANBA 1RRKA 2YMSD 4X8SH 3V0XA 4YO9A 2K0QA 1WYKA 1PFXC 2ZTXA 2ZHWH 1C5OH 3RC6A 1UHBA 2XNIA 5DP9A 2BD7A 1KLIH 5KEDA 2TGPZ 1DWDH 2VH6A 2VB0A 2FMJA 3EE0B 2TGAA 1LQDB 3ZZ5A 8ESTE 1K1PA 3SV7A 1LPKB 2Z94A 4IC6A 1TNJA 3LGYA 4AYVB 4AX9H 8LPRA 3QTOH 3EA7A 1NFYA 1AKSB 1OWIA 5FX5A 5F8XA 2CHAC 1XKBC 4WXIA 1HB0B 5JPMH 1QJ7B 2KCAA 3SV2H 1ELEE 2ZDMA 3T5FH 4BAMB 4NSYA 2FLBH 1SQAA 1SGFG 1TYNA 1MZDA 1LTOA 1TNGA 3M5LA 3MQKC 4KTUA 4NA7A 2QCYA 1A3BH 2J92A 3N7DA 3SU0A 4OGYA 4JCNA 3N7EA 3MWIU 2ZKSA 1O2WA 2TBSA 2UWOA 4CR9A 2GX4A 4INKA 1YPKH 2TPIZ 1GCTB 2J95A 1WDIA 1AUJA 2PSYA 1WBGB 2J38A 1DE7H 3BF6H 1XVMA 2BDHA 4JZ1A 3TGJE 2W7SA 3A85A 3CP7A 2KFWA 4ZKOU 1M9UA 5L30H 3FP6E 2BDBA 2ANWA 1G2LA 3PV2A 2BY6X 3EA8A 1BBRH 1ZJDA 3DHKH 3PRDA 1YCPH 2TGDA 3D23A 2AHME 2ZFQH 2GZ9A 2BMGB 3QZQA 2PWXA 1IHTH 2BXTH 2RDLA 3QGJA 1ESAA 1GCTC 1MAYA 2PP6A 1GJ6A 1GMHF 2A7JA 1RJXB 1LHGH 2ZDVH 2CV3A 1TNIA 1G2MA 3OAAD 2D8WA 2WYJA 3UREA 1MTWA 2P3FH 2WPIS 2VWOA 3OU0A 1SOZA 1TGCA 3PTBA 3RXMA 3VB5A 3AAVA 1LVBA 1EFRD 1LDTT 2PKSB 3D62A 4RN6A 1SGNE 2BD8A 5EQQA 2FP7B 4FUCA 2VVUA 1MMJN 1KXFA 2M5TA 4GCHG 3VB6A 3LONA 1GI7B 1UTPA 1IQEA 4WWYA 1GBDA 2QIQA 2EC9H 3SBKA 1GHZA 3UQOA 2CJIA 3MU5A 1ELGA 2FOEA 1H8IH 1C1VH 1SPJA 3OE7D 3V12A 4FUEA 2R0KA 1C2EA 1O2HA 1W7GH 4XFQA 4ABDA 4UFDH 4AFQA 3SORA 4AGKA 5EODA 1NRPH 4FETA 1V2LT 2ZGBH 3DT0H 2WV9A 2PKSC 4AFZA 3SU1A 2Y5FA 3ODDA 1PYTD 4IGDA 3ELAH 3LKWA 4FUIA 2G8TA 2BD5A 1AE5A 1FZZA 4XD7D 1EATA 3ZIAD 1GBBA 5HKKD 1P0SH 2GCHF 4INLA 4OS6A 2AGEX 2ZZUH 3ZVBA 1H1BA 1W8BH 4YLQH 3SV6A 3MNBA 3M5NA 1C5VA 1C5NH 5FL7D 1A2CH 3BG4C 4ZHMU 2ZC9H 3K9XB 4ISIH 4D9QA 1ZPZA 2ANKH 3DCLA 1O32A 5JBAS 1MD7A 1O3GA 5C3NA 1EX3A 4ASUD 1CGIE 3F9EA 3SOSA 5DP6A 2BD9A 2BZ6H 2OD3B 1VGCB 4KTSA 1K1JA 3SJIA 3MO9A 5JB8S 2A7HA 2A0QB 1O3LA 2BY8X 3RLWH 1J15A 1ANEA 1NU7B 1TLDA 1THSH 2QF3A 1LVYA 1SGQE 4M7GA 1ZR0A 1T7CA 1SC8U 3HGNA 3QGNB 1DANH 4D8NA 1Z6EA 4BTTB 1GMCG 2QF0A 4YOJA 5SGAE 1ZTLA 3UFAA 1S85A 4NZLA 2BB4A 4FVBA 1C5SA 1P2MA 1XXFA 3W94A 5DPAA 1IQIA 1KLJH 2B9LA 1O2VA 1FN8A 5FCKA 1VGCC 1WAYB 1K22H 1TGSZ 1D6WA 2O8TA 3TK5A 3S9CA 4IS5A 1AKSA 1E36B 2BD4A 1DX5M 1GHAG 2EI6A 3M7TA 1QL9A 2SGPE 3WW7A 1GMDF 2STAE 1O3IA 2OC7A 1C5MD 1GJ5H 4DVAU 1DT2A 1TNLA 3ZVGA 3B9FH 1TA6A 4X2XA 1H8DH 3HKIB 2J2UA 1DLEA 1C4Y2 4NGAH 4ACBA 2OC8A 3ATMA 3RXVA 4CREA 1C5YB 1GJBB 5C0UA 3KQ5A 2A45B 3TJOA 3SNEA 2XW9A 4X6OA 4IW4E 4RT1A 4ISHH 4CH8B 3RXKA 2LNCA 4MTBA 1TX8A 1ZSLA 2QC2A 1B7XB 3P8OA 3MNCA 4X1RU 1PPEE 3V13A 2ZHQH 1ZLRA 5EXMA 2HVYB 1LVOA 4E7RG 1HGTH 2RFKC 2A4GA 1W0KD 4A5TS 2SGDE 1XM1A 1ETRH 4X1QU 1AQ7A 3RXDA 1GBJA 2BVSH 1W11U 4ZCNA 1A5GH 4YM9A 1VJ9U 1ELBA 1Z1JA 5F8ZA 1CT4E 1OWHA 1GBHA 1QJ1B 4CBNA 3UWJH 1ABIH 1TGTA 1W2KH 4FUFA 1C2FA 2KR7A 4YOIA 2AERH 1V2RT 1QR3E 4NFFA 1YYY1 5C5NA 1DUEA 3BTFE 2JH5D 3O8CA 1V2OT 4X0WU 2QYIA 4BXSA 5LH8A 2UUYA 2HRVA 1LKAA 2OQUA 2VWNA 4HTCH 1C5TA 1G3EA 1HNEE 2O9QA 3SQHE 3S7KB 1FJSA 1SHHB 2A4OA 4B6FA 4GHQA 3TJVA 3RXCA 2ODQA 5EQSA 2KZ4A 4FU9A 2YNBA 3SUEA 1LPGB 4HZHA 1LHCH 2FZZA 2F43B 1Z71A 3HK6B 1CVWH 1W0ZU 1HRTH 3HK3B 1SG8B 4NWKA 1O2NA 2JH6D 1CGHA 1SGPE 3P8FA 6LPRA 1WQVH 1ANDA 2STBE 2ZFTA 3A7YA 3F0PA 3UOUA 2BDCA 2IN2A 3W95A 4X8TH 1L0ZA 2BLWA 3A81A 2LP6A 3A80A 3LIWA 5PTPA 1ZRBA 1BTUA 5HM2A 3ZZBA 2YOLA 5FAHA 4UFGH 3ESTA 1FQ3A 2TRMA 1TA2A 4FUBA 1FI8A 2XYAA 2GCTB 3M7UA 1MD8A 3GOVB 3RXQA 2ASUB 3MOCA 1OSSA 1GJ9B 2R2MB 4ABAA 1TB6H 3A88A 1GJCB 3KQDA 1GI5A 2RA3A 3LDXH 2CF8H 1FIZA 2H9HA 2B8OH 1UTOA 2QV1A 4MPVA 1BMNH 5GIBA 2HGTH 1UTMA 5HYOA 1GHXH 1GBTA 2IPHA 5HMAA 4IMZA 1ZPBA 1QB9A 1K1IA 4GCHF 1ZGVA 2ZA5A 3GCTG 4AG1A 1Z1IA 1QGFA 1O2KA 2P3UB 3RXAA 4GAWA 2ULLA 3Q3KA 1GJ8B 1QL7A 1AVWA 1N8OB 2R0LA 5A8YA 1SB1H 1EPTB 3EE7A 1EZXC 1AIXH 1KTSB 4Y7AA 4HGCA 1SQTA 5E2OA 5EJLA 2V3HH 4A1XA 3RU4D 4ZHLU 1O37A 5T6DA 1HJAC 2ZDNA 2CXVA 5EW1H 3GYMA 1PQ5A 3QTVH 2PSXA 3HATH 1H9IE 2QE7D 1FDPA 1LVMA 3F2HA 5FCRA 5FBIA 1EZUC 4JMYA 3A7XA 2H9EH 3OTJE 2G4UA 5EG4A 4IC5A 3PMAB 1GPZA 3PWBA 1SGFA 1F5LA 4LXBH 2VVCA 1TBQH 3L3TA 1QRZA 1L2EA 2ZG0H 2SGEE 2A2XH 2KCPA 4B76A 1N8OC 4P00A 2NWNA 4I8JA 5E8EH 2IJD1 1MTNB 3F3BA 3T27A 5CMXH 2WUCA 5GJ4B 4U30A 5A0AE 3P8GA 3F9GA 2FS9A 4DOQA 1AZ8A 2C8YB 4BOHA 2O8MA 3RXGA 3F9HA 3SNCA 1SHYA 3RMMH 1G3DA 2UWPA 5EJZA 2RA0A 1D3PB 7LPRA 2R3YA 3CNRA 5C0TA 2AGGX 2WPDD 1NTPA 1C1PA 1GBKA 1MTNC 3G01A 1TMBH 3OEHD 2QN5T 2W7UA 1SQRA 3GY3A 2OBQA 3UUZA 2HLCA 4IN2A 3RXPA 6GCHG 3FKSD 2AFQB 1L4DA 5E0JA 1TQ0B 4ESTE 1A4WH 1Y3VA 2R9PA 1FY5A 1TPPA 2OBOA 4LK4A 4XRNA 2PUXB 2DE9A 3F2FA 5GPIB 2Z9LA 1P10A 2BOKA 2BQ6B 1BTXA 1O3BA 3KYGA 3LJOA 1GHAF 2ODPA 1EUFA 1SGCA 2LPRA 4Y0YE 1ZSKA 2WV5A 2WUBA 5EIYA 3AW0A 3L6PA 3A8DA 1V2VT 4NCYA 1P2OA 3PO1B 4YT6H 1UVTH 2XRCA 4JK5A 3K6ZA 3DD2H 2XC5A 6CHAB 4QT8C 1O3EA 2BLVA 3ZZCA 1DWBH 4AC9A 4BAKB 3SU6A 1O2SA 1TGBA 1UTQA 3TGKE 1P05A 5EPNA 1QY6A 1C5ZB 1TONA 1WOFA 1GCDA 2Y81A 3M7QA 3SNDA 1UVPA 2F9UA 2TGTA 1GJ4H 1UW7A 1Y3YA 2W3KA 1O31A 2M2AA 3KQCA 4OM9A 5AFYH 2GT8A 1NM6A 1P2JA 1C1TA 4AORA 4ABJA 1DY9A 5K7RA 3CENA 4FVDA 1FPCH 1UCYK 3QK1A 1GHBF 1AO5A 1ELVA 3PO1C 2BTCE 3TNTA 1H8ED 3PLPA 4WXVA 1GBFA 2J4IA 5KECA 3RU4T 1HPGA 2C93B 1C5PA 3E1XB 3DFLA 6CHAC 1VITG 1S0RA 3ATWA 2C90B 5EXLA 4UEHH 5IYTA 1GVZA 3KNXA 1BRBE 5FPTA 3DSPA 2KAIB 1O3HA 3PV5A 3SZNA 5K0HA 2J97A 1UK4A 4MDSA 4R8TB 4AGJA 3W1EA 4H6TA 1NT1A 1O2QA 1MTUA 2NU3E 2L74A 4X8VH 1MBQA 2VH0A 2ILNA 1DFPA 1GJDB 1KLTA 2OQ5A 3P17H 2VIDA 5C67A 3I29A 1HAVB 2SGQE 2XWBI 3CS7A 3S0NA 4AYYB 3NPSA 1MCVA 4D7FA 5L2YH 1UTLM 2K1QA 3F6UH 3NUMA 1AN1E 4K5ZA 1W7XH 1ZSJA 1UVSH 3SGBE 4OS7A 2PHBA 1FXYA 2FOGA 1GI3A 3ATKA 1EPTA 3FP7E 3U8RH 3ZZ7A 1QIXB 4ZH8A 1RIWB 2GZ8A 1C1NA 2IPQX 4Y76A 3IG6B 1Z6JH 1EJMA 2NU0E 1BRAA 2WPHS 1O2GH 5DP3A 1GBLA 1W12U 1WTHD 3ZZ6A 1P04A 3TITA 1Y5UT 3LGVA 2G81E 2PKAB 1Q31A 5HIZA 1MZAA 2V6NA 2O8UA 5EGMA 2IJOB 2F91A 1J8AA 3TNSA 3GDUA 4WF8A 4TWWA 1RIWC 3ZYDA 1GGDB 3PLBA 1G36A 1CO7E 1JWTA 1IQFA 1AFEH 1IQHA 1BTWA 1C5XB 4LZ1H 3U8OH 1BRCE 3H7TA 1TBZH 1DITH 2F9OA 3N7OA 4O03A 5EQRA 3RXLA 7GCHG 4A1TA 5A2MH 4Y8YA 1V2KT 4XDEA 1BUIA 5ABWA 2GTBA 5HXFA 3KL6A 2EY4C 1A5IA 1J17T 3EQ0H 1JRSA 4WH6A 1RTFB 5C20A 3H09A 1Q2WA 2BD3A 3TGIE 1S84A 1C4V2 2JDID 1D3QB 1GGDC 3GCTF 4D9RA 2ZO3H 4JZEH 3TH4H 1HAOH 2AGIX 4NIYA 2CN0H 1F7ZA 1T8LA 1YPMH 2BY7X 2BZAA 5GDSH 4FUJA 1YWUA 3MMGA 3LOXA 5JBBS 2SGAA 3OYPA 1A1RA 1YPHC 4MQAA 2F83A 1SGYE 1TNKA 1P3EA 1BCUH 3A87A 1UK2A 1ARBA 1GBMA 1FPHH 2R2WU 3RMNH 1HFDA 1NFUA 2AMQA 3FVFB 1GDQA 3MU8A 3FP8E 4GVUA 5C2ZA 5T1VA 4SGBE 3QWCH 1BZXE 3BEFB 1CQQA 1BMAA 3SZEA 3BTGE 3TH2H 2C4FH 1ZRKA 4GPGA 1CHOF 1L1NA 1TQ7B 3BG4B 3ZVCA 1H9LB 1Y3XA 5LGOA 1W0JD 2QF4A 2ZU3A 1BTHH 2UUFB 5CE1A 3M37A 5F53A 3KEEA 5L2ZH 1DVAH 1TOCB 1C9TA 3QX5H 1A0HB 4YXWD 1PQ8A 1PPCE 2BDAA 1RTLA 1MKXH 1OOKB 1S82A 4JYUH 2G5VA 3MNSA 4NIXA 1V2TT 4RT0A 3ZV9A 4AN7A 2F9NA 4A92A 1EB2A 1PYTC 1FX0B 1O2LA 1VCQA 3PMBB 1SR5C 3MFJA 4NZQA 5GXPA 4GUXA 3ZV8A 2VIPA 2NU2E 1C5LH 1BRUP 2H2ZA 3FFGA 5JDUB 2R3UA 4OS2A 1E1QD 4XBDA 2P59A 3EAJA 4O3TA 3GCOA 1VJAU 1S5SA 3SV8A 1HYLA 3ATIA 2GJGA 4XBCA 1O39A 1MQ6A 9ESTA 3P95A 4E06H 1TAWA 3MNXA 2KAIA 6GCHF 1BQYA 4ISOA 1GI6A 2GV7A 1S0QA 2WSSD 1KXBA 4JZIA 3PM3A 2ZDAH 2EI7A 1BT7A 3FN8A 4X2VA 3A7TA 1J16A 4YLUA 3ZZ9A 3E0NB 2F9VA 3MYWA 1S81A 1NO9H 2JKHA 7KMEH 1SFQB 1AY6H 1HAVA 3M3TA 1T4VH 1SGTA 4JYTA 4DGJA 5DJ7A 1T4UH 1Z8RA 2ZDLA 3UNRA 1D9IA 2J94A 3RXFA 3ZYEA 4WJG2 1K1OA 2Q6FA 2ZU2A 5E0HA 3LU9B 2A7CA 2XCNA 5BPEA 1MTSA 1XX9A 3GCNA 1HXFH 2BLQA 3HGPA 1WQSA 3KN2A 2G4TA 1NROH 3P6ZB 1L1GA 5A8ZA 2BX4A 2FI3E 4IBLH 1E35B 2NU1E 2AMDA 3A82A 1O2OA 1PPFE 2C8WB 1SSXA 4X1PU 1BB0B 3QUMP 1Y5AT 1WTGH 1O34A 3DSOA 2WYGA 3ZVAA 1YPEH 1E0FD 1AMHA 3MI4A 1MAXA 1AB9B 2PKAA 2ZCKP 1YLNA 1GVKB 3LGWA 1FMGA 3RM2H 1FONA 2FLRH 2FX6A 5JB9S 1GI2A 2BDIA 2FIRH 2K8IA 1D3TB 2GZ7A 1P01A 2VWLA 3SYJA 1VITF 2HPPH 1SLVB 1NS3A 2FM2A 1B5GH 1NRSH 1RFNA 2F3CE 4YTAA 4AG2A 2DE8A 1N6XA 3P70B 1JMOH 4Y8XA 1XUGA 2QXGA 4TYDA 2OP9A 3U1JB 3D65E 1O2ZA 4AFSA 4R0IA 5F03A 3UIRA 1CE5A 1O3CA 1BBRE 5EOKA 1EOLA 1RXPA 1AB9C 1EB1H 4ZKSU 4KTCA 4D7GA 4RKJB 1THPB 4UD9H 1NBMD 4DIHH 1MUEB 1ETTH 5DN6D 1O30A 1P06A 2FO9A 2PGQB 1TIOA 2H9TH 3RXUA 3OY6U 1SGEE 2FXRA 3PV4A 3EA9A 1HBTH 1CHGA 1BIOA 1VZQH 1OWJA 1Y5BT 3E8LA 1ZTJA 1OWDA 2HNTC 2VWMA 3DUXH 3GCHB 1KTTB 3PMHB 2ANMH 5EJ1A 2THFB 1F2SE 1EQ9A 3PRBA 1EAWA 1EAXA 3VGCB 1ORFA 3UR6A 3RXOA 1F0UA 1P9UA 2XBYA 4I86A 5ESTE 1T31A 2Z6BD 3BTKE 4X6MA 1GI0A 1A3EH 1AZZA 2OTVA 1O2UA 4H6SB 2ZFPH 4K3JA 2WPKS 1CT2E 1X7AC 2PW8H
chains in the Genus database with same CATH topology
4Q63A 1FY4A 1UO6A 1GHWH 2ZHDA 3Q77A 2H5DA 1TE0A 1XUJA 1A7SA 2GV6A 3QO6A 1VITH 2WZQA 3U69H 1QBOA 2P16A 4Z0KA 1A46H 1HXEH 2FWWA 1NRRH 1F5RA 4X1SU 2J34A 2O8WA 3GCHC 1L1JA 1C9PA 1DOJA 1NFWA 4X1NU 1ELTA 1A0JA 1S83A 2BQ7B 2ZDKA 3VGCC 4DJZB 5HM9A 2ZIQH 1CGJE 1KSNA 2HNTF 1CSOE 4OS5A 1DXPA 1QL8A 2XBXA 1DUAA 4FUGA 4E7NA 1B0FA 3LH3A 3KCGH 1TRNA 3PMJA 4AOQA 1KYNA 1QB1A 1Y59T 1AWHB 3GISB 4X6PA 3ZVEA 2XNDD 3AK5A 2A31A 1MKWH 3OSYA 1O38A 4MG3A 2ZGHA 3AW1A 1O5DH 2O8LA 1UJ1A 1V2PT 2FYQA 3PTNA 5C1XA 4U2WA 1GI9B 1FNIA 1HAIH 2ZQ2A 2ZU5A 2BLOA 1V2WT 1HJ8A 1TFXA 2ZGXH 4KP0A 1C2GA 3QN7A 4NG9H 5TCAA 3BTQE 3SU3A 5EW2H 2B7DH 2ANYA 2CF9H 2EA3A 2PTNA 1D6RA 1IQNA 1HJAB 1NFXA 2ODYB 4B2BA 2UUJB 3M5OA 3R0FA 1H9HE 2HWLB 3TIUA 1E37B 2HALA 3VXEH 3GDVA 5C5OA 3HKJB 1C1QA 5IK2D 3NCLA 1KMHB 1C1RA 5J4SA 2B0FA 1JRTA 1VR1H 1QFKH 3A8CA 3OY5U 3H7OA 1ANCA 5DP7A 2JIZD 1BMFD 4Y8ZA 3BSQA 4DY7B 2Q6GA 1IQKA 1QRWA 2SNWA 2ZGCA 3LC3A 1SQOA 2WPMS 4X2YA 2PFEA 1TX7A 1ZHMA 5I25A 1YPHE 5G4BA 2SGFE 2Z3DA 1P2NA 3P8NA 1SBWA 2C3SA 1DWEH 4MLFB 2WHXA 4X8UH 2FOAA 1GBIA 1RGQA 1QRXA 2RG3A 2EI8A 2W26A 4TT3D 4YT7H 4Q7YA 3BTDE 1BTYA 2FI5E 2H1UA 3H5CB 3T28A 5ETXA 2FOBA 2QY0B 3TVJB 1O36A 1YPJH 4NSVA 4U01A 1OP0A 3V7TA 1OWKA 1TBRH 2JETB 2A32A 1YM0A 3FZDA 3KHVA 3RLYH 4O97A 3KQBA 1TRYA 3ODFA 5DKMA 1MBMA 3BTHE 1MABB 1V2UT 2ZI2H 1ID5H 1ZYOA 3R3GB 1BJUA 5B6OA 5E2PA 4YZUA 5TCCA 1W3CA 5GNDA 4JYVH 4ZROA 1PPZA 2NU4E 3SJ9A 3FANA 3ZVFA 1JBUH 3K2UA 1Z8GA 2H5CA 3KGPA 3VB4A 1TOMH 1CU1A 3RMOH 3RM0H 4I8HA 1GDUA 1HUTH 1WUNH 2JETC 3E16B 2Q6DA 4K2YA 1FY3A 1AUTC 1GMCF 5LPRA 1NRNH 5EXNA 3A84A 2GT7A 1G37A 3U9AH 5CDFE 5A0BA 1O2YA 4BAHB 2Z9KA 1KXCA 3ZZDA 4J1YA 1INCA 2G52A 1S6HA 1O2TA 4RKOB 1MTVA 4ASHA 1C2KA 3SGQE 2C8ZB 5EPYA 3SJOA 1BITA 1ELAA 2QXIA 2OK5A 2OUAA 1UTKA 2P93A 1C1UH 1DY8A 2HVXA 1TABE 3SU4A 1COWD 5HGGA 3OEED 1WCZA 3NK8A 4I33A 2PTCE 2ESTE 4PROA 5ESBA 1G9IE 1LHEH 5C17A 4Q2KA 1XXDA 2FX4A 1KXDA 2JJ2D 1UMAH 1GI1A 3V3MA 3ZVDA 1AVXA 1GBAA 1O3AA 1BMMH 3GY2A 4F49A 3RXTA 2AMPA 1F0SA 1UVUH 3A86A 3VB7A 2Y6TA 2L6OA 4NA8A 1K2I1 1V2JT 4CRFA 4MVNA 3O8RA 5F8TA 3EGKH 1EOJA 2I6QA 1YPLH 3LH1A 5DGJA 1O3OA 3SHAH 7ESTE 4B74A 3MH5A 1O3JA 1OYTH 1QNJA 3GY8A 3LGIA 4ABIA 4CHAB 5F6MA 2VNTA 5A0CA 5CHBA 2G5NA 1VCPA 4HFPB 5AFZH 1O5CB 4DT4A 1AI8H 4OS4A 3WWBA 2ZNKH 4ZKRU 3A7ZA 3RC5A 1O5AB 3UY9A 3UOPA 2YMSB 1V6DA 2Y5GA 2VVVA 4CH2B 1W14U 2QA9E 4KGAA 3BIVH 1ESTA 3VB3A 2ZPRA 1PJPA 1TMTH 1RTKA 2DUCA 3A8AA 3JZ1B 4I8LA 1O2JA 4MPXA 4CHAC 4D76A 1DLKB 1OXGA 3A83A 2WPLS 3BTTE 3PLKA 1JXPA 3URDA 1GL0E 1FIWA 2ZWLH 2WPJS 1EZSC 1MH0A 2A5KA 5DSFA 2Z9JA 2YMSC 1HIAB 1QB6A 1WSSH 3L33A 1QBNA 4TSFD 2HNTE 3SU2A 3T62A 2XC4A 1OPHB 3M3VA 4TWYA 1EP5A 3ZZ4A 2JH0D 2Z3CA 5FHTA 3URCA 1AVGH 1SKYE 4NIVA 1OP2A 5FXLA 1D4PB 2D2DA 3VPKA 5JYIA 3UQVA 1G30B 2FOHA 3PYHA 2Y5HA 2XTTB 1BOQA 1DXWA 1LKBA 1UVOA 1FV9A 4SGAE 2G51A 4AZ2B 2W5EA 3ITIA 4Q7XA 1OYQA 3E90B 3RP2A 2F9PA 3MO3A 1SFIA 4BTUB 3A89A 2FOFA 2BD2A 1ZGIA 3BG8A 1JIMA 1C2MA 3QLPH 2PR3A 3F1SB 4F4OC 1KXAA 3TH3H 1KDQB 2AIQA 1QJ6B 1BDAA 1V2NT 3BN9A 1VCWA 3TPIZ 3QDZB 1MCTA 4CRDA 2ALVA 2BM2A 4X6NA 4ABGA 2BDGA 4XOJA 2FYRA 5L6NH 2XOKD 2OXSA 2PV9B 1HAXB 1NPMA 1C5WB 1C5UA 1ABJH 3NKKA 3SNBA 1OWEA 1GDNA 1TGNA 2Q1JA 1WU1A 1K1MA 2H6MA 3NZIA 1LO6A 2XXLA 5T6GA 1FY1A 2FTMA 4ZUHA 1QURH 3MH7A 4LZ4B 1YCPM 1C1SA 1GJAB 1AD8H 1P03A 1IHSH 4TPIZ 1DICA 3BEIB 3Q00A 3WY8A 1BHXB 3DA9B 3RXJA 3PWCA 4K8YA 4DT7B 1A61H 1GI8B 1GHVH 4Y79A 3KF2A 4KKDA 4B6EA 2VIVA 1ACBE 1ELCA 1J14A 4DIIH 2PGBB 1E38B 3MU1A 2AIPA 3HPTB 6ESTA 2ZECA 4ABHA 1AGJA 3FOAA 2ZTZA 1QQ4A 1WXRA 1LPZB 5GCHG 1SLWB 4FUDA 3K6YA 1CBWB 1JOUB 3P92A 3GY4A 2ZU4A 3ATLA 1THRH 4Y7BA 2ZFSA 1PQAA 1QBVH 2HOBA 3LJJA 3RXHA 1C2IA 2BX3A 1XMNB 2QAAA 4B73A 4B75A 3VFEA 3RU4E 4TY7A 2KCYA 2YNAA 1C5RA 3UR9A 1E1RD 3GICB 4ABEA 1KXEA 2XCFA 1T8NA 1C1OA 2A5AA 2QF5A 1MQ5A 1DSTA 1EJAA 3Q3YA 2SNVA 4FU8A 3A7WA 3EDXB 3LT3A 4Y0ZE 2VU8E 1S6LA 3S9BA 1CBWC 3RDZA 3O8BA 5AHGH 2D26C 1KIGH 1H4WA 3Q3XA 2UUKB 3SI3H 1HAGE 4ABFA 2CGAA 2BY9X 1GJ7B 4B2CA 3M5MA 1D3DB 4DURA 2F4LA 2Z9GA 1QTFA 1EXFA 4YOGA 2BY5X 1HV7A 2GP9B 3LPRA 4ABBA 4I8KA 3UTUH 4XBBA 1V2QT 2D1JA 1G32B 1BHXF 1NN6A 1YP9A 2Y82A 2ZFFH 4JK6A 1EASA 2GMTB 2FS8A 4BAOB 2ZF0H 4UE7H 2GD4B 4B1TA 3M36A 1LHFH 4WMDA 2J9NA 2ZPQA 1NESE 1O5FH 2Z9IA 2ZFRH 4I32A 1BMLA 4AFUA 4K69A 1YPGH 2ZGJA 2GKVE 1C1WH 3VEQB 1GBCA 1BTZA 3E0PB 1HIAA 3UNQA 2J5UA 1LMWB 1K1NA 4I8GA 4XE4A 2W6ID 1FLEE 1CA8B 4O9VA 4CRCA 2FOCA 2ZU1A 1ZMJA 5EU8A 2LELA 4ZAEA 1Y3UA 2FODA 4CRGA 1NZQH 4ZKNU 3AASA 1N1LA 2GMTC 1XUKA 4IMQA 3B23B 2V35A 1K9OE 1P11E 1RD3B 1OKXA 1P12E 1IAUA 1YKTA 5A8XA 3BV9B 2XBWA 3VXFH 3TU7H 3SO3A 4O3UA 5FX6A 1E34B 2QXHA 3STJA 4WMFA 2BHGA 1KY9A 1T32A 2AEIH 1NC6A 3FAOA 1DS2E 1KDQA 4UONA 1H8HD 5B6LA 1EKBB 2VIQA 3GYLB 1TWXB 2VGCB 3PB1E 1SL3A 1HJ9A 1ZMLA 3BTME 2FI4E 2ZHEH 2VBCA 2ZP0H 3C27B 4ISNA 3F9FA 2FDAA 1Z7KA 5FBEA 3GY7A 4FXGH 1GI4A 2BDYA 3WWFA 1HAHH 1O2MA 1ZHPA 3E3TA 3NRLA 3MO6A 1OS8A 5J4QA 2AS9A 4YESB 4DG4A 1SGDE 4WMEA 4GHTA 2VIOA 2W6JD 5AF9H 5DP4A 4MNXA 2Y7XA 1C2LA 1V2ST 2FTLE 3RMLH 3M3SA 2VGCC 2XWAA 2P3TB 1GHBG 1AFQB 8KME2 2CK3D 1A5HA 3RXSA 4JZDH 1O5EH 4U32A 4BXWA 1C5QA 1DWCH 1TNHA 1BBRK 1SVPA 5T3HA 3SGAE 1YCPK 2FPZA 3MHWU 1EAUA 1F92A 4INHA 2EEKA 1FUJA 2PUQH 4MPUA 3U1IB 5DO4H 5BRRE 4GLYA 1UK3A 3SJKA 3T26A 5T6FA 3LGTA 2ZCHP 1F0RA 3S9AA 1HCGA 5FPSA 3TJNA 4ZMAH 1F0TA 2PLXA 2ZCLP 1AFQC 1YBWA 2Z3EA 8GCHG 1EJNA 3AVZA 5DG6A 2QGRA 3K65B 4ISLA 3UB0A 1GBEA 1T8OA 4A7IB 5C1YA 1O2XA 2QXJA 2OC0A 5DP5A 1G3CA 4H42U 5LPEA 3OFND 1GHYH 1UCYH 3MH4A 2AH4X 2BVXH 1NY22 2CMYA 2HLDD 1XVOA 3N99A 7GCHF 1C2HA 1CA0B 4B2AA 1F5KU 1RS0A 1G3BA 4K1TA 2XC0A 3ZZ3A 2VIWA 1T8MA 4I31A 4IN1A 4M9FA 1LCYA 1OHHD 1PPGE 1ZHRA 3JZ2B 1P2IA 1W0YH 4FU7A 4Y6DA 3EYDA 1IQGA 1YC0A 4H4FA 3FZZA 1YGCH 5A09A 4VGCB 2W3IA 2ZQ1A 1MKXK 1PQ7A 3E6PH 2BXUH 5I46H 3U8TH 1ZJKA 1GVLA 3UNSA 1QA7A 1SLXB 1Z8IB 3OTPA 1CA0C 2BYAX 1XKAC 3SHCH 1W10U 2P94A 4OGXA 3MU0A 3BIUH 1P57B 1L4ZA 1PPHE 4ZXXH 4JZFH 3D49H 3GDSA 3U98H 2WINI 3SQEE 3SUFA 1P09A 2G00A 4TPYA 2TIOA 2F9BH 1HAYB 1C2JA 1ZTKA 1TMUH 2OINA 4Q7ZA 4ZXYH 1AU8A 1NU9A 1O5GH 5GCHF 1EP6A 4K1EA 1O5BB 4VGCC 1U6QA 2Y7ZA 2GGVB 1O3PB 1O0DH 3BTEE 1FN6A 4RI0A 1O3KA 2WV4A 1O2RA 4X2WA 3I78A 4A6LA 1C4U2 1HDTH 1Y3WA 2GCTC 2SFAA 3BEUA 4BTIB 5E0GA 1GMHG 2A5IA 3MU4A 1JIRA 3STIA 5FPYA 1TX6A 1UHBB 1K28D 4DCDA 5H4IB 1EAIA 4Q80A 2IOTA 1XUHA 5C1UA 4LOYH 1Q3XA 3GS9A 4WY3A 1EZQA 1HLTH 3OX7U 1S6FA 1HAZB 2Y80A 1ESBA 1DPOA 1K21H 3T29A 1HAPH 4NWLA 2C8XB 1V2MT 1BA8B 1IOEA 4K60A 1Y8TA 1YLDA 1OP8A 2P8OB 1YF4A 4MNYA 3RXBA 1QCPA 1GG6B 1SI5H 1O3MA 2ZEBA 4BNRA 3F2GA 3NXPA 4AB8A 3SV9A 4XSKU 1ETSH 2RCEA 1J9CH 1TPSA 4Z6AH 3CS0A 1FAXA 3C1KA 1MU6B 1CHOG 2OLGA 4MPWA 1O3FA 1EPTC 3IWMA 1UTJA 3TLOA 3TK6A 2A4QA 5GWZA 4DW2U 2V7QD 3RUOA 5JBCS 4BAQB 1AWFH 1C1MA 3AAUA 9LPRA 3RXEA 4Y11E 3T2NA 3GY5A 4Y71A 1P02A 2P95A 3ENSB 2P8OC 4MNVA 1GG6C 3SUDA 2VJ1A 1P8VC 1XUFA 1O2IA 1P3CA 2GCHG 3BTWE 2ZPSA 4UDWH 1TALA 1O3NA 1IQJA 1ELDE 1AE8H 3KIDU 3S7HB 1GWAA 4TY6A 1ZPCA 1PPBH 1CT0E 2I6SA 1DDJA 3SI4H 1OX1A 4Y10E 1SGRE 4CRAA 1ZMNA 4K1SA 2GDEH 2V3OH 3E91A 5AVDA 1P2KA 1SMFE 4NA9H 2GDDA 1ELFA 1DM4B 3IITA 4E05H 1LHDH 3TK9A 2UWLA 3PROA 2G55A 3ZZAA 3T25A 1DSUA 3SU5A 3A7VA 1QA0A 3SNAA 4FUHA 2A2QH 1UCYE 3O8DA 1C2DA 1YLCA 1IQMA 5JBTA 4UFFH 1E79D 4AB9A 3F0OA 5TJXA 2KM0A 1IQLA 2XBVA 3Q76A 5DK1A 1N6YA 2FOMB 3LGUA 3QZRA 2A4RA 1GL1A 3UWIA 3KQEA 1O35A 2OC1A 2FESH 4CRBA 4WH8A 5IDKA 2FEQH 3NWUA 1TRMA 2JJ1D 1NRQH 2A1DB 3F68H 1LQEA 1SOTA 3FO8D 4A1VA 1GMDG 2ZHFH 4NFEA 3SN8A 5DP8A 4CBOA 4GSOA 1AHTH 4B71A 3ZZ8A 1SLUB 3RXRA 2Z7FE 1K1LA 4NIWA 3SW2B 1TPAE 3VG8A 1Z8JB 3GY6A 4Q4LA 4J2YB 5CHAB 2AYWA 3S69A 2V0BA 3MH6A 2ZTYA 1O3DA 1ZZZA 3B8JA 3M61U 3RXIA 2HPQH 2BOHB 4OS1A 1MKWK 4RSPA 3SUGA 4F55A 4Z1MD<