2TRMA

The three-dimensional structure of asn102 mutant of trypsin. role of asp102 in serine protease catalysis
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
223
structure length
223
Chain Sequence
IVGGYTCQENSVPYQVSLNSGYHFCGGSLINDQWVVSAAHCYKSRIQVRLGEHNINVLEGNEQFVNAAKIIKHPNFDRKTLNNNIMLIKLSSPVKLNARVATVALPSSCAPAGTQCLISGWGNTLSSGVNEPDLLQCLDAPLLPQADCEASYPGKITDNMVCVGFLEGGKDSCQGDSGGPVVCNGELQGIVSWGYGCALPDNPGVYTKVCNYVDWIQDTIAAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase (serine proteinase)
molecule keywords TRYPSIN
publication title The three-dimensional structure of Asn102 mutant of trypsin: role of Asp102 in serine protease catalysis.
pubmed rcsb
source organism Rattus norvegicus
total genus 42
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1988-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2trmA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2trmA02
2RG3A 1HV7A 1C1WH 1F5RA 2RCEA 1P12E 4DVAU 2ZU5A 2FO9A 1OYTH 2QC2A 1UVPA 1K1OA 2HWLB 3HGPA 3BTME 4KP0A 1SG8B 3AAVA 1JOUB 1HNEE 2J4IA 3KF2A 1B5GH 5C5NA 1C5PA 3GCOA 1C5RA 1N6XA 1NFYA 2VIQA 4NSVA 2F9VA 1AE5A 4MNVA 1QRZA 2BXTH 2OQUA 3RC4A 4X1PU 3M7QA 5DP4A 1TB6H 3DA9B 1O3DA 4Y76A 3SV8A 3F6UH 1HRTH 3LGUA 5EPNA 3RXHA 1A7SA 2ZNKH 4KGAA 4Y79A 4B2AA 1GL0E 1XUJA 1CHOF 1AZ8A 1DOJA 1SHYA 4U32A 4GLYA 4K3JA 1FN6A 3UTUH 1WOFA 2YNAA 6GCHF 2VH0A 2ZDVH 2B8OH 3RU4D 1FAXA 2JH5D 1BIOA 3FP7E 1C1PA 1O2PA 1P2IA 1C1VH 4BXSA 1GBAA 1O2MA 4I8JA 1CBWC 4XSKU 3RMLH 5T6GA 1NU9A 1C2LA 1WQVH 2Z9JA 2BMGB 4X6MA 1AQ7A 1ZMNA 1O39A 4H6TA 2KAIA 4VGCB 4GCHF 4WVPE 3U8OH 1V2KT 3A7TA 4U2WA 1SGIB 1SMFE 2XRCA 5CHAB 5C2ZA 2QN5T 1CGIE 1BTUA 1W12U 3GY6A 5TCAA 4GCHG 1NFXA 2VJ1A 3M3TA 1GPZA 4INLA 2JKHA 3T25A 1JRSA 2VIPA 1TNIA 1GBMA 3ZVEA 4ZUHA 2R0LA 3NK8A 1L4DA 3K65B 6CHAC 4Y0YE 2DE9A 3PTNA 1J17T 1ZOMA 1LPKB 1KXEA 1UVSH 2PGQB 2UUKB 4J1YA 4O3TA 3W94A 3ZZDA 1TALA 1QA0A 1SLUB 8GCHF 1UO6A 2WV4A 5GDSH 4E7RG 1TPAE 1YBWA 4I31A 2ZPSA 1ZSKA 1G3DA 2SGAA 1HDTH 2BVRH 2Y5FA 5HMAA 3STIA 2HLCA 5C3NA 8GCHG 3WY8A 1BMLA 1TPOA 1MZAA 3PMJA 1IQKA 3BSQA 3P95A 1UK4A 1BITA 1C5SA 2ZDNA 1JIRA 4NGAH 1O3PB 3MO3A 1BTYA 1L4ZA 1HAZB 3RC6A 3TH3H 1ARCA 1DITH 2AERH 1VCWA 4BAQB 1NRSH 1GHVH 5CMXH 4Q7ZA 2FOCA 3U8RH 1RIWC 1CSOE 3GDUA 1HJ9A 3SJKA 3DUXH 1HFDA 2QYIA 4X2WA 1HB0B 4LZ4B 3PWBA 2ZZUH 1DM4B 3ZZ4A 1TX6A 3P17H 3KHVA 1ZRKA 2P8OC 3ZVFA 1FLEE 1EUFA 2ZC9H 4UFGH 3LT3A 1MH0A 5FHTA 1BTXA 2FS9A 4DURA 2VIDA 1ELAA 1E0FD 2SGEE 3FP8E 5A0AE 4F4OC 2GT7A 2FTLE 4NA8A 1IHTH 2TRMA 1V2TT 1DSUA 3A8CA 1LMWB 3A86A 1MD7A 3QTOH 1K1JA 2TIOA 1O3LA 3SUGA 2V6NA 4MDSA 1IQFA 1DWBH 3BEUA 1MCTA 1C1TA 1AIXH 1P3EA 1K2I1 1Y3XA 4CH8B 5TJXA 3RMOH 3SU1A 4K60A 4ABDA 2ODPA 3BTTE 3EA8A 1ZJDA 1DWCH 4AYYB 2ZTYA 2OLGA 4BOHA 3M7TA 1P3CA 2AYWA 1OWJA 4OS6A 3UR6A 3L33A 1S81A 2AH4X 1KLTA 1VJAU 1EP5A 5DJ7A 2GZ9A 3GCHB 4Y7AA 1O2QA 4TWWA 2ZWLH 4JZ1A 1LHCH 4HGCA 2RA0A 3D65E 1O34A 3RXDA 2ZU1A 1OKXA 2J94A 3SZNA 1GHBG 4X6PA 1O35A 1ELGA 2WUCA 5DPAA 3C1KA 3K9XB 3RXMA 1P2JA 2R9PA 3GY2A 1AMHA 3VGCB 3SJOA 2ZIQH 3Q3YA 2EC9H 4CR5A 1OPHB 1OYQA 1PQ8A 1THPB 2OCVB 1C2JA 1DLEA 2XC4A 1ZHPA 3D62A 3F9GA 4ZKRU 3AAUA 3PV4A 1BRAA 1C4Y2 2GMTB 2WPMS 1YF4A 3O8RA 2QCYA 5LPFA 2ANWA 1UHBB 2SFAA 2Y80A 4NA9H 3BN9A 2CHAC 1P8VC 4AB8A 2Z6BD 3H5CB 4H6SB 1XX9A 1ZPZA 1B7XB 3SOSA 2QF0A 1CO7E 1EJAA 1SGYE 1ABIH 1CQQA 1BOQA 1ESBA 3R3GB 3QK1A 1C5XB 3VB4A 1TIOA 5A8YA 1UTMA 1LHDH 2GT8A 2D1JA 4NIXA 1TGNA 1E34B 3NUMA 4O03A 1GBIA 1QA7A 2CF8H 2V3HH 1L1JA 2OC8A 1GBKA 1QIXB 1O33A 1C5ZB 2GCHF 2G4UA 1EJNA 5J4SA 4K1EA 4UDWH 1EAUA 3F68H 3SUEA 2JH6D 3DD2H 4X8UH 2ZP0H 3MU0A 1N6YA 1LPZB 1GBDA 1MU6B 3MU5A 1L2EA 1YPGH 3S9AA 2GCHG 1ZMLA 2VVCA 4JZIA 1BHXB 1BBRK 3LH1A 3FAOA 2VWOA 3M5NA 1JWTA 1HJAB 2ODYB 1FY8E 1H9IE 3HK6B 3A8BA 1F0UA 2XYAA 3L3TA 1X7AC 2XBXA 3UPEA 1NRQH 3KN2A 1UVOA 1F7ZA 2Q6GA 5H4IB 1LVMA 4X1NU 3ZYEA 1SLWB 3ZZ6A 1DY9A 1ID5H 5J4QA 3LC5A 4UEHH 4X6NA 2A2QH 4KKDA 3AASA 3B9FH 2Z9IA 4X0WU 1GBTA 1D6RA 2GDDA 3TK9A 2FEQH 5FPSA 3A84A 1DUAA 1Z8JB 1BCUH 1UVTH 3P8GA 5JBAS 2PR3A 4AFZA 1SOTA 3U1IB 3SV6A 1DE7H 1THRH 3O8BA 1UTQA 2ANKH 1O38A 3E3TA 3BTQE 3ZVAA 3GY8A 5C1UA 2IN2A 2R2MB 1FY4A 5G4BA 2A31A 3SNAA 3SJ8A 1O2XA 4WWYA 4CRCA 1EPTB 2ZQ1A 3ZZ8A 4YOJA 1S6HA 3MMGA 4FUCA 3L6PA 3I78A 1SVPA 2XWBI 2A4GA 4IN2A 1KLJH 1TQ7B 3V3MA 4UFFH 4ISOA 2ALVA 3RLWH 3G01A 3FZDA 1HIAB 1EQ9A 1XMNB 2EI8A 3UQOA 1GHZA 2BD2A 1TOMH 1EZQA 2ZHEH 3PLPA 2Y7XA 4JZDH 1O2LA 1RXPA 2Z3EA 2ZFPH 1O3KA 1QL9A 1ZSLA 2BHGA 1C1NA 2VIWA 4U01A 1GMCF 4Q7YA 1GHXH 1CE5A 2I6SA 3EA9A 5EOKA 4ABJA 2GCTC 1C2KA 3M7UA 4ABEA 1GI5A 2WV5A 1TGSZ 2OBOA 1GMCG 4ISLA 2FI5E 1Q2WA 3MYWA 1P2OA 1NS3A 3KQBA 5I46H 1P9UA 1G9IE 2G4TA 1OX1A 3M36A 3ZV8A 1SGFA 2CXVA 3SNDA 4INHA 1V2NT 2H5DA 4IW4E 2H5CA 2HNTE 2QIQA 2A5AA 5JB9S 2OUAA 3ITIA 1E36B 8LPRA 1A5IA 1WCZA 3QGNB 4O3UA 4XBCA 4CRDA 5FCKA 3RP2A 3RXAA 1GMDF 2B5TB 4ZHAA 4ABAA 1OWHA 3MNCA 2ZHDA 1SLVB 2JETC 2BTCE 1TNGA 4IS5A 5E8EH 3LH3A 1F5KU 7KMEH 4MG3A 1GMDG 1P2NA 3NXPA 3KQDA 1O5AB 4Y6DA 1O3OA 2HGTH 1DUEA 4X1RU 1C1SA 1M9UA 4B74A 1B0EA 1O32A 1WQSA 2BX4A 3A8DA 4K69A 3UNSA 3VB3A 4X2VA 2FDAA 1V2LT 2ZI2H 5C67A 4X8VH 3S9CA 3UNRA 1UK3A 3BTWE 1TGTA 1TQ0B 2QXHA 2BD9A 1C2EA 1NT1A 2ZDLA 3LGWA 3T29A 2DUCA 1QL7A 1SFIA 1TYNA 3H7OA 5GCHF 1T31A 4FUJA 2R3UA 3PMAB 5JB8S 4O9VA 1AUJA 4UFDH 2WUBA 1AVWA 5JBBS 3UNQA 3PTBA 3EGKH 1BT7A 3A7WA 1G30B 5L30H 3MH7A 1XUKA 5GCHG 3LGVA 3OU0A 3P70B 3SJ9A 4NFFA 3ZV9A 1QB6A 2ZG0H 2TGDA 4IC5A 3LU9B 3RXPA 2WINI 2WPLS 2FYQA 2PGBB 3FVFB 4Q7XA 1UTPA 3SV9A 2BOHB 3IITA 5A8ZA 2FXRA 3BV9B 1AFQC 4OS1A 3PB1E 1FPCH 1GI6A 3DFLA 3S69A 2PV9B 4J2YB 1ELEE 1Y59T 1QB1A 3GY5A 3LC3A 3OSYA 5E2OA 1T4VH 1XUGA 3BEIB 1RTKA 1GI7B 4RN6A 3QTVH 4AG2A 1K28D 2BQWB 5DKMA 1N8OC 4MPWA 1C5QA 3NCLA 2ZF0H 5FPTA 1CBWB 1TMUH 1NRRH 3RC5A 2NWNA 5CE1A 3BEFB 1UCYE 2FS8A 4LXBH 1ESAA 2HPPH 1Z8RA 3E8LA 1LVYA 3LONA 1GVKB 1ABJH 1RD3B 1NPMA 4DGJA 3F9HA 4H42U 1DANH 4MVNA 1D6WA 2H9TH 3UIRA 2TGAA 3OYPA 1C2MA 4FUFA 3T2NA 4AFUA 4SGAE 2Q6FA 1HLTH 2J9NA 3CENA 1ELCA 3BF6H 4OS4A 1P2QA 5E0JA 5LPRA 2BLWA 1GVZA 3ODFA 1PQAA 4DG4A 1WU1A 1RTLA 5GXPA 3BG4B 1T8LA 1UTNA 1K1NA 1XM1A 1ANCA 1TRYA 1C5MD 3E1XB 4GUXA 1GDUA 2A4RA 2BD4A 1EZXC 4ABBA 5HM9A 1O3MA 2O8MA 3SV2H 3MH4A 1O3GA 1AKSB 1K21H 1VZQH 5I25A 2VGCB 2K1QA 1GI0A 3HPTB 3EA7A 1ZTLA 2XW9A 1C1RA 1AB9C 1SLXB 1EAXA 4JMYA 1O5EH 2ZCKP 3SU4A 1T8NA 4NWLA 4GSOA 4FUDA 1D3QB 5EQSA 4UONA 4HFPB 1FIZA 4CREA 1TNLA 4ZXXH 4ZAEA 1MKXH 1NROH 1YLCA 4WH6A 2VWLA 3P8NA 2GTBA 2BY8X 4FVBA 2BVSH 4YT7H 4Y10E 4IMZA 1T32A 3A8AA 2PTNA 1CHOG 2XC5A 1O3NA 1GI4A 3B23B 3TVJB 3GISB 5GPIB 1QURH 1O3JA 1PFXC 1V2MT 1F2SE 6GCHG 1PPFE 3HKIB 2XXLA 3GY4A 1XUFA 1C5WB 1GBLA 1OOKB 4NCYA 4WY3A 1KIGH 1CA0B 4K2YA 1A4WH 4FVDA 5HGGA 1HAHH 2EI7A 1ZRBA 1GI1A 4O97A 2NU1E 1Y3YA 1FIWA 3Q3KA 1YCPH 2J95A 2R0KA 1GWAA 3PLBA 1XVMA 1FI8A 2H9HA 1DPOA 1DXPA 2VVVA 3OX7U 3PMBB 1C2DA 1FONA 1SGPE 2HOBA 1LQDB 1P57B 3W95A 3GYLB 4A5TS 1BTHH 1QL8A 2AFQB 4TY7A 3VB6A 1AY6H 4ZXYH 3M5MA 2IPHA 2A0QB 1V2QT 2CV3A 4BXWA 2Y7ZA 4CBNA 3PO1C 3LGTA 1YM0A 1MKWH 2C3SA 3E0NB 3TH4H 1IQLA 4IBLH 3SN8A 1WBGB 3E91A 2BVXH 4D8NA 3ZZCA 3LPRA 1J9CH 4FU7A 1MMJN 5EXNA 1BRUP 4WMFA 2B7DH 2D26C 2HNTC 1DFPA 4MPXA 1PQ5A 2B9LA 1IQMA 4K5ZA 1EZSC 1F0RA 1OS8A 4AG1A 1MAXA 2BDIA 2Y5GA 3UWIA 3UOUA 3IG6B 4JK5A 3RXOA 3LJJA 2WPHS 1DS2E 3ODDA 5DO4H 3LDXH 4MPVA 2WPJS 1O5FH 3ESTA 2H1UA 1G32B 1NO9H 2W3IA 3LOXA 4IN1A 1LHEH 1YPHE 1Z7KA 3A81A 5DG6A 3RLYH 1EAWA 4YOIA 4CHAB 4DOQA 1QR3E 1NTPA 1BTZA 5HXFA 1S84A 3O8CA 3FP6E 1DDJA 1SSXA 1UCYK 1F5LA 3N7OA 2GX4A 3SJIA 4JK6A 5A0CA 1DY8A 2P93A 1HPGA 1GGDB 1SGQE 3T26A 2CHAB 2FZZA 3A83A 1TMTH 2Z9LA 2GZ8A 2ODQA 2XCNA 2OD3B 4D76A 3HATH 1GHWH 1QRWA 1Z71A 4FUBA 5LGOA 1C5LH 5F8ZA 2STBE 2D2DA 1H4WA 4UD9H 1XVOA 1BQYA 1O2ZA 1IQEA 5CHAC 2A7HA 1GI8B 2BY5X 1ETSH 3KEEA 3QGJA 1SB1H 2Z3CA 3ATWA 1P09A 3KIDU 1CT0E 3T5FH 1V3XA 4YZUA 1JBUH 2OP9A 3A87A 1KTTB 3OTJE 1Q3XA 2OQ5A 3P8OA 4PROA 1TA6A 4R0IA 1NRNH 3A89A 1CT2E 2CMYA 1KXFA 1O5BB 1LVBA 1UTOA 3CS0A 4NIWA 1GJ9B 4B73A 5B6OA 4XDEA 5FPYA 1TRMA 1XKAC 1GJBB 1P02A 2ZA5A 3K6YA 4HI3A 1KDQA 1SPJA 5A2MH 1YGCH 1QJ7B 2ZDMA 1V2OT 1UMAH 3Q3XA 3UY9A 4UE7H 4CR9A 2VB0A 1XUIA 2SGFE 2C8XB 1KY9A 3M3VA 4RKJB 1RRKA 5AFZH 2O9QA 4ABFA 1SFQB 2WPIS 4BANB 1OSSA 1B0FA 3F1SB 1J8AA 3PWCA 5ETXA 3SI4H 1VJ9U 3A80A 1XUHA 1G3BA 3PMHB 4K1TA 1GHYH 1C2GA 1QQUA 1GCTB 5BRRE 1UTLM 2O8LA 1JMOH 1YPEH 1S82A 2YOLA 2EI6A 2ZCHP 4AGKA 3QN7A 2UUFB 1E38B 1WTGH 2BD3A 1QY6A 2J2UA 4D7FA 4CRGA 1TBZH 2BY7X 2AEIH 1BZXE 1GJ4H 1EOJA 5F03A 2VH6A 2ZGXH 2KAIB 1ETTH 1JRTA 3CS7A 1P9SA 1ELVA 1SGDE 3NZIA 2A5KA 3K2UA 1CVWH 2F9PA 4WF8A 2PKAA 1T8OA 1P10A 4E05H 1WAYB 2P94A 2FYRA 1EX3A 3Q77A 3KNXA 5JDUB 1DLKB 4ISNA 2DE8A 3P92A 4D9RA 1BRCE 2Q1JA 1SQAA 1PYTC 2V35A 2BZ6H 1W0ZU 3TJNA 2YNBA 2AMDA 2ZHWH 4ABIA 3RXSA 3TK6A 1JIMA 1DVAH 3BTGE 1HAVA 3UFAA 3GCHC 3BTHE 3SU2A 1TE0A 2P59A 1GMHF 1O5GH 4K8YA 1HBTH 1GI9B 3ZYDA 1FPHH 3RXVA 1EKBB 2XTTB 4JYUH 2BDBA 2D8WA 3ZVGA 1IQNA 1Z8IB 2SNVA 1O37A 5T6DA 3V0XA 1ANEA 3ZZ5A 5ABWA 2PKSB 1GMHG 1A5GH 3KL6A 3VGCC 3SUDA 4JYVH 4D9QA 1LPGB 1BA8B 2C4FH 1AU8A 4GHQA 3ENSB 1GBCA 3A82A 1MZDA 5E0HA 1GBEA 2P3TB 2XBYA 1Z6EA 3JZ1B 2GMTC 2ZEBA 4DIIH 1ZPBA 1IHSH 1VITF 4BTUB 2ZFQH 4DCDA 5EODA 3KQEA 3PROA 1ZGIA 3UREA 1O2KA 3MU1A 1QFKH 1CU1A 1Y5BT 2GP9B 2P3FH 5GIBA 1VITG 1AHTH 3RXRA 1Y3WA 2TPIZ 2A7JA 3M61U 3SU6A 2F91A 1EXFA 1GG6B 5FAHA 2QXGA 4XOJA 1O2NA 5FX6A 1BMMH 2ALPA 3MOCA 1VR1H 2SNWA 2H9EH 5LH8A 1P06A 2VWMA 2F83A 3LGIA 2NU4E 2OINA 1FMGA 2C90B 2FWWA 4X8SH 2ILNA 2XBWA 1BTWA 2ZFRH 1EJMA 1NFUA 2GDEH 1T4UH 3ELAH 1K1LA 1S83A 1F0TA 2OC0A 1NN6A 1YPKH 2QY0B 4ZKNU 3STJA 1O5DH 1YPHC 4FU8A 4Y7BA 2W5EA 3FFGA 3RXGA 2P3UB 2C93B 2GD4B 1S85A 3GY7A 1KSNA 2Y5HA 1FY5A 4HZHA 3RXKA 1OWEA 2UWPA 1O3AA 1PYTD 1XXFA 1P05A 3S7KB 1A46H 4ZKOU 2ASUB 1EOLA 3UWJH 5DP5A 4I8LA 3KGPA 3QO6A 1AFQB 8ESTE 1ARBA 4AOQA 1C1MA 5AVDA 2ZFSA 2PLXA 3TK5A 5JBCS 1OP0A 2TBSA 1W2KH 1TNHA 5C1XA 1WUNH 3MTYA 1AN1E 1CGHA 5C5OA 3MO6A 4H4FA 1YP9A 1U6QA 3M5OA 3S0NA 1HAYB 3RMNH 2ZFFH 3SU3A 2UWLA 3MU4A 1MTNB 4KTUA 4RSPA 3I77A 3OY5U 2WYJA 4MPUA 1AWFH 3TGKE 1MCVA 1LKBA 4TYDA 2FOFA 7ESTE 1QJ6B 1CGJE 1DWDH 4LZ1H 4X8TH 1BTPA 1MU8B 3RXJA 3C27B 3VEQB 1LO6A 1CA8B 2A4QA 4F49A 3ZVCA 2NU3E 1ANBA 2ZU2A 2PUXB 1IQHA 1Y5UT 1FN8A 3BTEE 2FI4E 4AX9H 2BY9X 4NA7A 4TWYA 1C1QA 1O2WA 2ZU3A 3URDA 1QHRB 1TWXB 2R2WU 4AFQA 5GJ4B 4IGDA 4NZLA 4ZHMU 4HTCH 9LPRA 4XFQA 2A2XH 4YLQH 3TJVA 2W26A 5F8XA 3M3SA 2M5TA 4NFEA 3MFJA 1SOZA 4JZEH 1CHGA 2G5VA 3HGNA 8KME2 2QGRA 3QZRA 1C4U2 4I7YH 1GJ7B 1GJDB 5FCRA 2FTMA 4ABHA 1A1RA 1G3CA 3QLPH 5IYTA 4JZFH 4FXGH 1G2MA 2Y81A 5PTPA 4KELA 1H8IH 1ANDA 2PKAB 3RXTA 1HGTH 1AFEH 1W13U 2HRVA 2ZDAH 2ZDKA 3GCTF 1E35B 4FUHA 1RGQA 5L2YH 4JCNA 7GCHF 4GPGA 1GBHA 1O3HA 4M7GA 1MQ6A 3URCA 3ZZ3A 1O36A 1ZGVA 3T27A 3GCTG 1DICA 7GCHG 1QBVH 1ELDE 4OS5A 1SGCA 1WV7H 4TY6A 4AGJA 5T6FA 1SI5H 3MH5A 4YTAA 1DT2A 4U30A 5EXLA 1HAOH 9ESTA 1O30A 2Y6TA 1TLDA 1VITH 1O3FA 3MNBA 4LK4A 4Y71A 2PW8H 1BDAA 3MH6A 3RXQA 3P6ZB 1OWDA 4XBBA 1TRNA 2FI3E 1F92A 1Y8TA 5JPMH 5K7RA 3SV7A 1ZTKA 1ORFA 1EAIA 1MAYA 2BDCA 1EB2A 1UJ1A 5AFYH 4AZ2B 3U1JB 1G36A 1HCGA 2ZHFH 3E6PH 4NIYA 1ZPCA 3SNBA 6CHAB 1VCPA 3BIVH 3PO1B 4X1QU 4ZMAH 5A09A 1C5VA 2WYGA 5EGMA 5FBEA 1VGCC 4FUIA 5L6NH 4MLFB 1G3EA 1O2UA 1W11U 5AF9H 4ZKSU 1KLIH 4Y8YA 4FUEA 2FOAA 4X2YA 5HYOA 3TITA 2ZECA 3GOVB 1J15A 1LKAA 3RMMH 3U69H 4Y8ZA 3TGIE 4CRFA 3BTFE 1UK2A 3A88A 3MNXA 2BD5A 5ESBA 1MTWA 3SHAH 1V2PT 1P0SH 2FLRH 3SO3A 1MQ5A 3ATIA 1W14U 1TNJA 1V2RT 2FOBA 2O8WA 3MI4A 4GHTA 2VIOA 4ISIH 3MHWU 1UHBA 2BXUH 3FZZA 5DGJA 1KXBA 1RIWB 1SGEE 1HYLA 4WXVA 3UUZA 1SC8U 2XWAA 1QQ4A 4MNWA 1YCPM 2ZGJA 4Y0ZE 1C9TA 2ESTE 1BBRH 3MO9A 3SGQE 4GAWA 1ZR0A 2PUQH 1G37A 2RDLA 2AMPA 5DK1A 4OGXA 5LPEA 1HJ8A 1RTFB 5EPYA 1WYKA 2BD8A 2AGEX 3SGBE 1INCA 1QJ1B 2F9NA 2P8OB 2F9OA 4LOYH 1SL3A 3VXEH 1LHGH 1O2GH 2A32A 4YM9A 3RXFA 1O3CA 4WMEA 2FOMB 4ISHH 1O2JA 1O3EA 1GBFA 4ZHLU 2PSXA 1RJXB 3SORA 1D3PB 3PM3A 3BIUH 1BMNH 3BG8A 4BNRA 2BLOA 2FIRH 1O2VA 1TOCB 4YLUA 2ZGHA 2GVFA 2LNCA 3P8FA 2AS9A 2QAAA 3M35A 1FXYA 3LIWA 1H8DH 1TPSA 1GHAF 5F8TA 4BAKB 2ZHQH 1BJUA 4QT8C 1TBRH 4B2CA 4E06H 5AHGH 1W10U 1GHAG 5DP7A 4TPIZ 1Y5AT 4YESB 3ATMA 2EEKA 2FOHA 1S0RA 3BG4C 2GV6A 4R8TB 3UR9A 2G00A 3GCNA 4B1TA 1TGBA 1SHHB 1WTHD 2I6QA 1AD8H 1K1MA 2BM2A 1AVXA 5C1YA 2BOKA 2UWOA 2VGCC 4X2XA 3E16B 4NG9H 4ZROA 4Z0KA 3NPSA 1GJCB 4Q2KA 3A7ZA 2W3KA 1HAPH 4BTTB 1C1UH 1UTJA 2H2ZA 3TIUA 1XKBC 1MTUA 2PWXA 1K9OE 1WSSH 3ZVDA 1BBRE 1Y3VA 2GGVB 2J38A 2GZ7A 2ZTXA 1YPLH 2FX4A 5DP6A 4K1SA 4YOGA 3U9AH 3ZZ9A 2BB4A 1AWHB 3ZZ7A 4UFEH 3EQ0H 4ESTE 2FOGA 1O31A 1EPTA 4THNH 2BD7A 7LPRA 2ZQ2A 1AE8H 2BLVA 3H7TA 1NESE 4DW2U 1N1LA 1OP2A 1P03A 4B75A 2HNTF 1OWIA 3DFJA 2FODA 1DSTA 2PFEA 1NU7B 4ZH8A 1HIAA 2UUJB 3FANA 1CA0C 4VGCC 1MBQA 3PLKA 1A3EH 3SBKA 2QXJA 2FOEA 5DP9A 1YYY1 1C2IA 1ZSJA 1W8BH 3S9BA 2VINA 1GI3A 3O8DA 1TABE 1BB0B 3SNCA 3JZ2B 2VWNA 1FUJA 3RM0H 4DY7B 3V7TA 4IMQA 2ZU4A 1LCYA 3E90B 1KTSB 5EQRA 5EU8A 1EASA 2RA3A 1PPGE 1LHFH 2AIPA 3GDSA 3SU5A 5EW1H 1HUTH 1KXAA 2VNTA 1NFWA 3R0FA 5K0HA 4MQAA 4B2BA 4BAMB 2XC0A 2Y82A 3KCGH 4BTIB 1FZZA 1SGFG 1ZTJA 3VPKA 1V2WT 1ZHRA 4A1VA 1O2HA 1OWKA 1Z1IA 3MU8A 4NZQA 3HK3B 1SQOA 3LJOA 1OP8A 5EXMA 2IJOB 1PPCE 2BDHA 3SUFA 1GHBF 1YKTA 1VCQA 2G81E 2ZPQA 1GJ6A 1W7XH 2CGAA 1GBJA 1PPEE 4A1TA 3M37A 1GBBA 5IDKA 4SGBE 4IC6A 1K1PA 2FESH 4CHAC 6ESTA 3SU0A 2STAE 3Q76A 1ESTA 3TJOA 1FQ3A 1O2TA 1S0QA 1Q31A 1A3BH 2OC1A 2QV1A 1C9PA 3SHCH 4I8HA 3D23A 4XE4A 4RKOB 3MNSA 4YT6H 4X6OA 4DIHH 1GGDC 4NIVA 1ELFA 1A61H 2BZAA 1DWEH 3RU4E 3V12A 3IWMA 2ZTZA 5FBIA 1QB9A 3VFEA 1MTVA 1NY22 1E37B 1RS0A 1C5OH 1SR5C 3UQVA 1QRXA 3T62A 1IQJA 2VU8E 1A5HA 3TNTA 1C5YB 4B71A 3RXUA 4KTCA 2AGIX 4Q80A 3A7YA 4JYTA 2A5IA 2BDAA 4Y11E 1D3DB 4AORA 1YPMH 1HXEH 2GCTB 3TGJE 2G8TA 1MKXK 1KYNA 5C20A 2GV7A 1SQTA 1FY3A 3RXLA 3U98H 1V6DA 2XCFA 3DHKH 1S6FA 1J16A 5FXLA 3NWUA 4AYVB 2W7UA 4GVUA 3Q00A 1D3TB 1T8MA 3EYDA 2F9BH 2V3OH 1O2RA 1KXDA 3A85A 3SNEA 1C5NH 2OXSA 2Z3DA 3SW2B 3CP7A 4OS2A 4AB9A 3AW1A 1TGCA 3MWIU 1ZZZA 2J92A 4K8BA 1O3IA 3BTKE 1Y3UA 1G2LA 1YCPK 2G55A 1FDPA 2ULLA 3B8JA 4NWKA 3SI3H 4CRBA 3RXIA 1O2OA 2HPQH 5T3HA 3NKKA 1CT4E 1YLDA 3GICB 1PPBH 2SGQE 4INKA 2BY6X 3SQEE 2H6MA 3VB5A 2SGPE 3QUMP 2C8YB 3T28A 6LPRA 2A7CA 2QF3A 4MNYA 1D9IA 5A0BA 2JETB 3QZQA 1SGNE 2EA3A 1TPPA 4WH8A 1MKWK 2C8ZB 4ASHA 3PYHA 2C8WB 3GYMA 2HVXA 1TAWA 4DJZB 1C1OA 2OBQA 1QBOA 3A7VA 1QTFA 4I33A 2FMJA 1AZZA 5A8XA 1ETRH 4B76A 2PTCE 2V0BA 1GL1A 1C2HA 1O5CB 3TU7H 3ZVBA 1GCTC 2Z94A 1SGRE 2CN0H 4KTSA 1GJ8B 2IOTA 1C2FA 1GJ5H 3ZZBA 4X1SU 1AKSA 4CBOA 4A92A 2BYAX 1A2CH 5F6MA 1HAXB 1UVUH 2BQ6B 5SGAE 1Z6JH 1O0DH 1THSH 3RDZA 1C5TA 1NZQH 3RM2H 2BDYA 3D49H 1AO5A 4AN7A 5ESTE 1AGJA 3TNSA 1XXDA 2NU0E 1TFXA 3ATKA 2OC7A 1LTOA 2O8TA 1HJAC 2AIQA 1UTKA 1BRBE 1ELTA 5EW2H 1Z1JA 4XBDA 1NC6A 3LKWA 1V2UT 5JBTA 3TJUA 1TBQH 1MBMA 4WXIA 4CRAA 1IAUA 1LQEA 2FX6A 2Z9KA 1H1BA 1NM6A 2O8UA 2AMQA 1A0LA 1S5SA 3BTDE 4MNXA 2Z7FE 2A4OA 1W7GH 3QDZB 3LGYA 1PPHE 2BQ7B 1L0ZA 1O2IA 1QBNA 1SGTA 3EDXB 1AI8H 3RXEA 2F9UA 2PKSC 2F3CE 4I8KA 1N8OB 4BAHB 4BAOB 1F0SA 3A7XA 1TONA 1O2SA 1GI2A 1QNJA 5HM2A 1ZLRA 2A1DB 1KDQB 1ZMJA 2ZGBH 1DX5M 1QGFA 3HKJB 1IQIA 1ACBE 2FLBH 2XNIA 1BHXF 2FPZA 4YO9A 1L1GA 2R3YA 1V2VT 1FNIA 5BPEA 1ELBA 1EPTC 1P2MA 3E0PB 1BJVA 1J14A 1C5UA 1FV9A 1P01A 3KQCA 1EZUC 1GDNA 1T7CA 2LPRA 5DP3A 2AGGX 2J34A 1GVLA 2P16A 1V2ST 2THFB 1P11E 2G5NA 3EE0B 5L2ZH 1OXGA 2JH0D 3F9FA 1Z8GA 4WMDA 1GG6C 4E7NA 5EG4A 1O3BA 3VXFH 1UCYH 1TX8A 2OTVA 3ZZAA 1GDQA 5FX5A 2QA9E 1AUTC 1QCPA 3S7HB 4NSYA 3OY6U 3GY3A 3RXCA 2VIVA 1VGCB 3I29A 1HAGE 2PHBA 1DXWA 1GJAB 5E0GA 1P04A 3QX5H 3EAJA 2B0FA 2BLQA 4A7IB 1EB1H 2Q6DA 3AW0A 3VB7A 1AB9B 2ZPRA 3GDVA 4MTBA 3SQHE 2G52A 3SGAE 2HALA 2BX3A 1YPJH 1PQ7A 1SBWA 4WJG2 1C4V2 5E2PA 1HAIH 1TA2A 4OGYA 1MD8A 1EP6A 3RUOA 2CF9H 2G51A 1FY1A 2W7SA 4Y8XA 1PPZA 3UOPA 3M5LA 2TGPZ 2ZCLP 2A45B 1BMAA 1P2KA 4FU9A 1IQGA 1K22H 2VVUA 2Z9GA 3TPIZ 2PSYA 4DT7B 2XBVA 2SGDE 1H9HE 4A1XA 1AVGH 2WPKS 2NU2E 2FP7B 1HAVB 4OS7A 1ZJKA 3TH2H 2ANYA 2BDGA 1PJPA 5JYIA 5TCCA 2ZGCA 1D4PB 1YC0A 2UUYA 1TX7A 1GCDA 1A0JA 3AVZA 1FAKH 1L1NA 3DT0H 5DP8A 2P95A 4CH2B 1EATA 1NRPH 1KXCA 1FJSA 1H9LB 1MTNC 3TLOA 2ZKSA 1JXPA 3V13A 4I32A 1ZYOA 3F9EA 3QWCH 3RU4T 1W3CA 2ANMH 4FUGA 3U8TH 1MTSA 4I8GA 1TMBH 1A0HB 3K6ZA 1IOEA 1LVOA 1V2JT 4Z6AH 1HXFH 2ZO3H 4D7GA 2CJIA 2GKVE 4ABGA 1BUIA 4A6LA 1TNKA 3RXBA 2QXIA 4AFSA 1K1IA 2FM2A 5EQQA 1O2YA 3ATLA 4TPYA 5GWZA 2ZFTA 1W0YH 1ZHMA 2TGTA 1LDTT 1RFNA 1MUEB
chains in the Genus database with same CATH superfamily
2RG3A 1HV7A 1C1WH 5HIYA 1F5RA 2RCEA 1P12E 4DVAU 2ZU5A 1H8ED 1OYTH 2FO9A 1UVPA 1K1OA 2QC2A 2HWLB 3HGPA 3BTME 4KP0A 1SG8B 3AAVA 1JOUB 1HNEE 2J4IA 3KF2A 1B5GH 5C5NA 1C5PA 3GCOA 1C5RA 1N6XA 1NFYA 2VIQA 4NSVA 2F9VA 1AE5A 4MNVA 1QRZA 2BXTH 2OQUA 3RC4A 4X1PU 3M7QA 5DP4A 1TB6H 3DA9B 1O3DA 4Y76A 3SV8A 3F6UH 1HRTH 3LGUA 5EPNA 3RXHA 1A7SA 2ZNKH 4KGAA 4Y79A 4B2AA 1GL0E 1XUJA 1CHOF 2KX4A 1AZ8A 1DOJA 1SHYA 4U32A 4GLYA 4K3JA 1FN6A 3UTUH 1WOFA 2YNAA 2RFKC 6GCHF 2VH0A 2ZDVH 2B8OH 3RU4D 1FAXA 2JH5D 1BIOA 3FP7E 1C1PA 1O2PA 1P2IA 1C1VH 4BXSA 1GBAA 1O2MA 4I8JA 1CBWC 4XSKU 3RMLH 5T6GA 1NU9A 1W0KD 1C2LA 1WQVH 2Z9JA 2BMGB 4X6MA 1AQ7A 1ZMNA 1O39A 4H6TA 2KAIA 4VGCB 4GCHF 4WVPE 3U8OH 1BMFD 1V2KT 3A7TA 4U2WA 1SGIB 1SMFE 2XRCA 5CHAB 5C2ZA 2QN5T 1CGIE 1BTUA 1W12U 3GY6A 5TCAA 4GCHG 1NFXA 2VJ1A 3M3TA 1GPZA 4HG6A 4INLA 2JKHA 3T25A 1JRSA 2VIPA 1TNIA 1GBMA 3ZVEA 4ZUHA 1MABB 2R0LA 3NK8A 1L4DA 2KM0A 3K65B 6CHAC 2HVYB 4Y0YE 2DE9A 3PTNA 1J17T 1ZOMA 1LPKB 1KXEA 1UVSH 2PGQB 2UUKB 4J1YA 4O3TA 3W94A 5T1VA 3ZZDA 1TALA 1QA0A 1SLUB 2EQNA 4P00A 8GCHF 1UO6A 2WV4A 5GDSH 4E7RG 1TPAE 1YBWA 4I31A 2ZPSA 1ZSKA 1G3DA 2SGAA 1HDTH 2BVRH 2Y5FA 5HMAA 3STIA 2HLCA 5C3NA 8GCHG 3WY8A 1BMLA 1TPOA 1MZAA 2XOKD 3PMJA 1IQKA 3BSQA 3P95A 1UK4A 1BITA 1C5SA 2ZDNA 1JIRA 4NGAH 1O3PB 3MO3A 1BTYA 1L4ZA 1HAZB 3RC6A 3TH3H 1ARCA 1DITH 2AERH 1VCWA 4BAQB 1NRSH 1GHVH 5CMXH 4Q7ZA 2FOCA 3U8RH 1RIWC 1CSOE 4F55A 3GDUA 1HJ9A 3SJKA 3DUXH 1HFDA 2QYIA 4X2WA 1HB0B 4LZ4B 2K0QA 3PWBA 2ZZUH 1DM4B 3ZZ4A 1TX6A 3P17H 3KHVA 1ZRKA 2P8OC 3ZVFA 1FLEE 1EUFA 2ZC9H 4UFGH 3LT3A 1MH0A 5FHTA 1BTXA 2FS9A 4DURA 2VIDA 1ELAA 3WWBA 2JDID 1E0FD 2SGEE 3FP8E 5A0AE 4F4OC 2GT7A 1EFRD 2FTLE 4NA8A 1IHTH 2TRMA 1V2TT 4OM9A 1DSUA 3A8CA 1LMWB 3A86A 1MD7A 3QTOH 1K1JA 2TIOA 1O3LA 3SUGA 2V6NA 4MDSA 1IQFA 1DWBH 3BEUA 1MCTA 1C1TA 1AIXH 1P3EA 1K2I1 1Y3XA 4CH8B 5TJXA 3RMOH 3SU1A 4K60A 4ABDA 2ODPA 3BTTE 3EA8A 1ZJDA 1DWCH 4AYYB 2ZTYA 2OLGA 4BOHA 3M7TA 1P3CA 2AYWA 1OWJA 4OS6A 3UR6A 3L33A 1S81A 2AH4X 1KLTA 1VJAU 1EP5A 5DJ7A 2GZ9A 3GCHB 4Y7AA 1O2QA 4TWWA 5F53A 2ZWLH 4JZ1A 1LHCH 4HGCA 2RA0A 3D65E 1O34A 3RXDA 2ZU1A 1OKXA 4DT4A 2J94A 3SZNA 1GHBG 4X6PA 1O35A 1ELGA 2WUCA 5DPAA 4Q4LA 3C1KA 3K9XB 3RXMA 1P2JA 1E1RD 2R9PA 3GY2A 1AMHA 3VGCB 3SJOA 2ZIQH 3Q3YA 2EC9H 4CR5A 1OPHB 1OYQA 1PQ8A 1THPB 2OCVB 1C2JA 1DLEA 2XC4A 1ZHPA 3D62A 3F9GA 4ZKRU 3AAUA 3PV4A 4RI0A 1BRAA 1C4Y2 2GMTB 2WPMS 1YF4A 3O8RA 2QCYA 5LPFA 2ANWA 1UHBB 2SFAA 2Y80A 4NA9H 3BN9A 2CHAC 1P8VC 4AB8A 2Z6BD 3H5CB 4H6SB 1XX9A 1ZPZA 3FO8D 1B7XB 3SOSA 1WDIA 2QF0A 1CO7E 1EJAA 1SGYE 1ABIH 1CQQA 1BOQA 1ESBA 3N7DA 3R3GB 3QK1A 4F48B 1C5XB 3VB4A 1TIOA 5A8YA 1UTMA 1LHDH 2GT8A 2D1JA 4NIXA 1TGNA 1E34B 3NUMA 4O03A 1GBIA 1QA7A 2CF8H 2V3HH 1L1JA 2OC8A 2J97A 1GBKA 1QIXB 1O33A 1C5ZB 2GCHF 2G4UA 1EJNA 5J4SA 4K1EA 4UDWH 1EAUA 3F68H 3SUEA 2JH6D 3DD2H 4X8UH 2ZP0H 3MU0A 1N6YA 1LPZB 1GBDA 1MU6B 3MU5A 1L2EA 1YPGH 3S9AA 2GCHG 1ZMLA 2VVCA 4JZIA 1BHXB 1BBRK 3LH1A 3FAOA 2VWOA 3M5NA 5C17A 1JWTA 1HJAB 2ODYB 1FY8E 1H9IE 3HK6B 3A8BA 1F0UA 2XYAA 3L3TA 4B6EA 1X7AC 1SQRA 2XBXA 2W6ID 3UPEA 1NRQH 3KN2A 1UVOA 1F7ZA 2Q6GA 5H4IB 1LVMA 4X1NU 3ZYEA 1SLWB 3ZZ6A 1DY9A 1ID5H 4RT1A 5J4QA 3LC5A 4UEHH 4X6NA 2A2QH 4KKDA 3AASA 3B9FH 2Z9IA 4X0WU 1GBTA 1D6RA 2GDDA 3TK9A 2FEQH 5FPSA 3A84A 1DUAA 1Z8JB 1BCUH 1UVTH 3P8GA 5JBAS 2PR3A 4AFZA 1SOTA 3U1IB 3SV6A 1DE7H 1THRH 5IK2D 3O8BA 1UTQA 2ANKH 1O38A 3E3TA 3FKSD 3BTQE 3ZVAA 3GY8A 5DSFA 5C1UA 2IN2A 2R2MB 1FY4A 5G4BA 2A31A 3SNAA 3SJ8A 1O2XA 4WWYA 4CRCA 1EPTB 2ZQ1A 3ZZ8A 4YOJA 1S6HA 3MMGA 4FUCA 3L6PA 3I78A 1SVPA 2XWBI 2A4GA 4IN2A 1KLJH 1TQ7B 3V3MA 4UFFH 4ISOA 2ALVA 3RLWH 3G01A 3FZDA 1HIAB 1EQ9A 1XMNB 2EI8A 3UQOA 1GHZA 2BD2A 1TOMH 1EZQA 2ZHEH 3PLPA 2Y7XA 4JZDH 1O2LA 1RXPA 2Z3EA 2ZFPH 1O3KA 1QL9A 1ZSLA 2BHGA 1C1NA 2VIWA 4U01A 1GMCF 4Q7YA 1GHXH 1CE5A 2I6SA 3EA9A 5EOKA 4ABJA 2GCTC 1C2KA 3M7UA 4ABEA 1GI5A 2WV5A 1TGSZ 1GMCG 2OBOA 4ISLA 2FI5E 2WSSD 1Q2WA 3MYWA 2WV9A 1P2OA 1NS3A 3KQBA 5I46H 1P9UA 1G9IE 2G4TA 1OX1A 3M36A 3ZV8A 1SGFA 2CXVA 3SNDA 4INHA 1V2NT 2H5DA 4IW4E 2H5CA 2HNTE 2QIQA 2A5AA 5JB9S 2OUAA 3ITIA 3SZEA 1E36B 5HIZA 8LPRA 1A5IA 1WCZA 3QGNB 4O3UA 4XBCA 4CRDA 5FCKA 3RP2A 3RXAA 1GMDF 2B5TB 4ZHAA 4ABAA 1OWHA 3MNCA 2ZHDA 1SLVB 2JETC 2BTCE 1TNGA 4IS5A 5E8EH 3LH3A 1F5KU 7KMEH 4MG3A 1GMDG 1P2NA 5C0TA 3NXPA 3KQDA 1O5AB 4Y6DA 1O3OA 2HGTH 1DUEA 4X1RU 1C1SA 1M9UA 4B74A 1B0EA 1O32A 1WQSA 2BX4A 3A8DA 4K69A 3UNSA 3VB3A 4X2VA 2FDAA 1V2LT 2ZI2H 3EE7A 5C67A 4X8VH 3S9CA 3UNRA 1UK3A 3BTWE 1TGTA 1TQ0B 2QXHA 2BD9A 1C2EA 1NT1A 2ZDLA 3LGWA 3T29A 2DUCA 1QL7A 1SFIA 1TYNA 3H7OA 5GCHF 1T31A 4FUJA 2R3UA 3PMAB 4XRNA 5JB8S 4O9VA 1AUJA 4UFDH 2WUBA 1AVWA 5JBBS 3UNQA 3PTBA 3EGKH 1BT7A 3A7WA 1G30B 5L30H 3MH7A 1XUKA 5GCHG 3LGVA 3OU0A 3P70B 3SJ9A 4NFFA 3ZV9A 1QB6A 2ZG0H 2TGDA 4IC5A 3LU9B 3RXPA 2WINI 2WPLS 2FYQA 2PGBB 3FVFB 4Q7XA 1UTPA 3SV9A 2BOHB 3IITA 3KQ5A 5A8ZA 3UB0A 2FXRA 3BV9B 1AFQC 4OS1A 3PB1E 1FPCH 1GI6A 3DFLA 5EJZA 3S69A 2PV9B 4ASUD 4J2YB 1ELEE 1Y59T 1QB1A 3GY5A 3LC3A 3OSYA 5E2OA 1T4VH 1XUGA 3BEIB 1RTKA 1GI7B 4RN6A 3QTVH 4AG2A 1K28D 2BQWB 5DKMA 1N8OC 1H8HD 1C5QA 3NCLA 4MPWA 2ZF0H 5FPTA 5KECA 1CBWB 1TMUH 1NRRH 3RC5A 2NWNA 5CE1A 3BEFB 1UCYE 2FS8A 4LXBH 1ESAA 2HPPH 1Z8RA 3E8LA 1LVYA 3LONA 1GVKB 1ABJH 1RD3B 1NPMA 4DGJA 3F9HA 4H42U 1DANH 4MVNA 1D6WA 2H9TH 3UIRA 2TGAA 2HLDD 3OYPA 1C2MA 4FUFA 3T2NA 4AFUA 4SGAE 2Q6FA 4TT3D 1HLTH 2J9NA 3CENA 1ELCA 3BF6H 4OS4A 1P2QA 5E0JA 5LPRA 2BLWA 3FN8A 1GVZA 3ODFA 1PQAA 4DG4A 2KCPA 1WU1A 1RTLA 5GXPA 3BG4B 1T8LA 1UTNA 1K1NA 1XM1A 1ANCA 1TRYA 1C5MD 3E1XB 4GUXA 1GDUA 2A4RA 2BD4A 1EZXC 2YMSB 4ABBA 5HM9A 1O3MA 2O8MA 3SV2H 3MH4A 1O3GA 1AKSB 1K21H 1VZQH 5I25A 2VGCB 2K1QA 1KMHB 1GI0A 3HPTB 3EA7A 1ZTLA 2XW9A 1C1RA 1AB9C 1SLXB 3N99A 1EAXA 4JMYA 1O5EH 2ZCKP 3SU4A 5DN6D 1T8NA 4NWLA 3DSGA 4GSOA 4FUDA 1D3QB 5EQSA 4UONA 1SKYE 4HFPB 1FIZA 4CREA 1TNLA 4ZXXH 4ZAEA 1MKXH 1NROH 1YLCA 4WH6A 2VWLA 3P8NA 2GTBA 2BY8X 4FVBA 2BVSH 4YT7H 4Y10E 4IMZA 1T32A 3A8AA 2PTNA 1CHOG 2XC5A 1O3NA 1GI4A 3B23B 3TVJB 3GISB 5GPIB 1QURH 1O3JA 1PFXC 1V2MT 2CK3D 1F2SE 6GCHG 1PPFE 3HKIB 2XXLA 2V7QD 3GY4A 1XUFA 1C5WB 1GBLA 1OOKB 4NCYA 4WY3A 4B6FA 1KIGH 1CA0B 4K2YA 1A4WH 4FVDA 5HGGA 1HAHH 2EI7A 1ZRBA 1GI1A 4O97A 2NU1E 1Y3YA 1FIWA 3Q3KA 1YCPH 2J95A 2R0KA 1GWAA 3PLBA 1XVMA 1FI8A 2H9HA 1DPOA 1DXPA 2VVVA 3OX7U 3PMBB 1C2DA 1FONA 1SGPE 2HOBA 1LQDB 1P57B 3W95A 3GYLB 4A5TS 1BTHH 1QL8A 3MQKC 2AFQB 4TY7A 3VB6A 2W6JD 1AY6H 4ZXYH 3AK5A 3M5MA 2IPHA 2A0QB 1V2QT 2CV3A 4BXWA 2Y7ZA 4CBNA 3PO1C 3LGTA 1YM0A 1MKWH 2C3SA 3E0NB 3TH4H 1IQLA 4IBLH 3SN8A 1WBGB 3E91A 2BVXH 4D8NA 3ZZCA 3LPRA 1J9CH 4FU7A 1MMJN 5EXNA 1BRUP 4WMFA 2B7DH 2D26C 2HNTC 1DFPA 4MPXA 1PQ5A 2B9LA 1IQMA 4K5ZA 1K0HA 1EZSC 1F0RA 1OS8A 5HKKD 4AG1A 2V3MA 1MAXA 2WZQA 2BDIA 2Y5GA 3UWIA 3UOUA 3IG6B 4JK5A 3RXOA 3LJJA 2WPHS 1DS2E 3ODDA 5DO4H 3LDXH 4MPVA 2WPJS 1O5FH 3ESTA 2H1UA 1G32B 1NO9H 2W3IA 2PP6A 3LOXA 4IN1A 1LHEH 3OE7D 1YPHE 1Z7KA 3A81A 5DG6A 3RLYH 1EAWA 2GJGA 4YOIA 4CHAB 4DOQA 1QR3E 1NTPA 1BTZA 5HXFA 1S84A 3O8CA 3FP6E 1DDJA 2IPQX 1SSXA 1OHHD 1F5LA 1UCYK 3N7OA 2GX4A 3SJIA 4JK6A 5A0CA 1DY8A 2P93A 1HPGA 1GGDB 1SGQE 3T26A 2CHAB 2FZZA 3DSPA 3A83A 1TMTH 2Z9LA 2GZ8A 2ODQA 3OEED 2XCNA 2OD3B 4D76A 3CNRA 3HATH 1GHWH 1QRWA 1Z71A 4FUBA 5LGOA 1C5LH 5F8ZA 2STBE 2D2DA 1H4WA 4UD9H 1XVOA 1BQYA 1O2ZA 1IQEA 5CHAC 2A7HA 1GI8B 2BY5X 1ETSH 3KEEA 2WHXA 2M2AA 3QGJA 1SB1H 2Z3CA 3ATWA 1P09A 3KIDU 1CT0E 2J98A 3T5FH 1V3XA 4YZUA 1JBUH 2OP9A 3A87A 1KTTB 3OTJE 1Q3XA 2OQ5A 3P8OA 4PROA 1TA6A 4R0IA 1NRNH 3A89A 1CT2E 2CMYA 1KXFA 2KCOA 1O5BB 1LVBA 1UTOA 3CS0A 4NIWA 1GJ9B 4B73A 5B6OA 4FOUC 4XDEA 5FPYA 1TRMA 1XKAC 1GJBB 1P02A 2ZA5A 3K6YA 4HI3A 1KDQA 4ACBA 1SPJA 5A2MH 1YGCH 1QJ7B 2ZDMA 1V2OT 1UMAH 3Q3XA 3UY9A 4UE7H 4CR9A 2VB0A 1XUIA 2SGFE 2C8XB 1KY9A 3M3VA 4RKJB 1RRKA 5AFZH 2O9QA 4ABFA 1SFQB 2WPIS 4BANB 1OSSA 1B0FA 3F1SB 1J8AA 3OEHD 3PWCA 5ETXA 3SI4H 1VJ9U 3A80A 1XUHA 1G3BA 3PMHB 4K1TA 1GHYH 1C2GA 2L6OA 1QQUA 1GCTB 5BRRE 1UTLM 2O8LA 1JMOH 1YPEH 1S82A 1FX0B 2YOLA 2EI6A 2ZCHP 4AGKA 3QN7A 2UUFB 1E38B 1WTGH 2BD3A 1QY6A 2J2UA 4D7FA 4CRGA 1TBZH 2BY7X 2AEIH 1BZXE 1GJ4H 1EOJA 5F03A 2VH6A 2ZGXH 2KAIB 1ETTH 1JRTA 3CS7A 1P9SA 1ELVA 1SGDE 3NZIA 2A5KA 3K2UA 1CVWH 4I86A 2F9PA 4WF8A 2PKAA 1T8OA 1P10A 3PV2A 4E05H 1WAYB 2P94A 2FYRA 1EX3A 3Q77A 3KNXA 2KCYA 5JDUB 1DLKB 4ISNA 2DE8A 3P92A 4D9RA 1S6LA 1BRCE 2Q1JA 1SQAA 1PYTC 2V35A 2BZ6H 1W0ZU 3TJNA 2YNBA 1COWD 2AMDA 2ZHWH 4ABIA 3RXSA 3TK6A 1JIMA 1DVAH 3BTGE 1HAVA 3UFAA 4FETA 3GCHC 3BTHE 3SU2A 1TE0A 2P59A 1GMHF 1O5GH 4K8YA 1HBTH 1GI9B 3ZYDA 1FPHH 3RXVA 1EKBB 2XTTB 4JYUH 2BDBA 2D8WA 3ZVGA 1IQNA 1Z8IB 2SNVA 1O37A 5T6DA 3V0XA 1ANEA 3ZZ5A 5ABWA 2PKSB 1GMHG 1A5GH 2AHME 3KL6A 3SUDA 3VGCC 4JYVH 4D9QA 1LPGB 1BA8B 2C4FH 1AU8A 4GHQA 3ENSB 1GBCA 3A82A 1MZDA 5E0HA 1GBEA 2P3TB 2XBYA 3W1EA 1Z6EA 3JZ1B 2GMTC 2ZEBA 4DIIH 1ZPBA 1IHSH 1VITF 4BTUB 2ZFQH 4DCDA 5EODA 3KQEA 3PROA 1ZGIA 3UREA 1UW7A 1O2KA 4RT0A 3MU1A 1QFKH 1CU1A 1Y5BT 2GP9B 2P3FH 5GIBA 1VITG 1AHTH 3RXRA 1Y3WA 2TPIZ 2A7JA 3GS9A 3M61U 3SU6A 2F91A 1EXFA 1GG6B 5FAHA 2QXGA 4XOJA 1O2NA 5FX6A 1BMMH 2ALPA 3MOCA 1VR1H 2SNWA 2H9EH 2JJ2D 5LH8A 1P06A 2VWMA 2F83A 3LGIA 2NU4E 2OINA 1FMGA 2C90B 2FWWA 4X8SH 2ILNA 2XBWA 1BTWA 2ZFRH 1EJMA 1NFUA 2GDEH 1T4UH 3ELAH 1K1LA 1S83A 1F0TA 2OC0A 1NN6A 5EIYA 1YPKH 2QY0B 3PRBA 4ZKNU 3STJA 1O5DH 1YPHC 4FU8A 4Y7BA 4ZCNA 2W5EA 3FFGA 3RXGA 2P3UB 2C93B 2GD4B 1S85A 3GY7A 1KSNA 2Y5HA 1FY5A 4HZHA 3RXKA 1OWEA 2UWPA 1O3AA 1PYTD 1XXFA 1P05A 3S7KB 1A46H 4ZKOU 2ASUB 1EOLA 3UWJH 5DP5A 4I8LA 3KGPA 3QO6A 1AFQB 8ESTE 1ARBA 4AOQA 1C1MA 5AVDA 2ZFSA 2PLXA 3TK5A 5JBCS 1OP0A 2TBSA 1W2KH 1TNHA 5C1XA 1WUNH 3MTYA 1AN1E 1CGHA 5C5OA 3MO6A 4H4FA 1YP9A 1U6QA 3M5OA 3S0NA 1HAYB 3RMNH 2ZFFH 3SU3A 2UWLA 3MU4A 1MTNB 4KTUA 4RSPA 3I77A 3OY5U 2WYJA 4MPUA 1AWFH 5EJ1A 3TGKE 1MCVA 1LKBA 4TYDA 2FOFA 7ESTE 1QJ6B 1CGJE 2KZ4A 1DWDH 4LZ1H 4X8TH 2LELA 1BTPA 1MU8B 3RXJA 3C27B 3VEQB 1LO6A 1CA8B 2A4QA 4F49A 3ZVCA 2NU3E 1ANBA 2ZU2A 2PUXB 1IQHA 1YY3A 1Y5UT 1FN8A 3BTEE 2FI4E 4AX9H 2BY9X 4NA7A 4TWYA 1C1QA 1O2WA 2ZU3A 3URDA 1QHRB 1TWXB 2R2WU 4AFQA 5GJ4B 4IGDA 4NZLA 4ZHMU 4HTCH 9LPRA 4XFQA 2A2XH 4YLQH 3TJVA 2W26A 4AC9A 5F8XA 3M3SA 2M5TA 4NFEA 3MFJA 1SOZA 4JZEH 1CHGA 2G5VA 3HGNA 8KME2 2QGRA 3QZRA 1C4U2 4I7YH 1GJ7B 1GJDB 5FCRA 2FTMA 4ABHA 1A1RA 1G3CA 1QZ8A 3QLPH 4P02A 5IYTA 4JZFH 4FXGH 1G2MA 2Y81A 3WW7A 5PTPA 4KELA 1H8IH 1ANDA 5CDFE 2PKAB 3RXTA 1HGTH 1AFEH 1W13U 2HRVA 2ZDAH 2ZDKA 3GCTF 1E35B 4FUHA 1RGQA 5L2YH 4JCNA 7GCHF 4GPGA 1GBHA 1O3HA 4M7GA 1MQ6A 1NBME 3URCA 3ZZ3A 1O36A 1ZGVA 3T27A 3GCTG 1DICA 5KEDA 7GCHG 1QBVH 1ELDE 4OS5A 1SGCA 1WV7H 4TY6A 4AGJA 5T6FA 1SI5H 3MH5A 4YTAA 1DT2A 4U30A 5EXLA 1HAOH 9ESTA 1O30A 2Y6TA 1TLDA 1VITH 1O3FA 3MNBA 4LK4A 4Y71A 2PW8H 1BDAA 3MH6A 3RXQA 3P6ZB 1OWDA 4XBBA 1TRNA 2FI3E 2QE7D 1F92A 1Y8TA 5JPMH 5K7RA 3SV7A 1ZTKA 1ORFA 1EAIA 1MAYA 2BDCA 1EB2A 1UJ1A 5AFYH 4AZ2B 3U1JB 1G36A 1HCGA 2ZHFH 3E6PH 4NIYA 1ZPCA 3SNBA 6CHAB 1VCPA 3BIVH 3PO1B 4X1QU 4ZMAH 5A09A 5CHBA 1C5VA 2WYGA 5EGMA 5FBEA 1VGCC 3H09A 4FUIA 5L6NH 4MLFB 1G3EA 1O2UA 1W11U 3WWFA 4ZKSU 1KLIH 4Y8YA 5AF9H 1WXRA 4FUEA 2FOAA 4X2YA 5HYOA 3TITA 2ZECA 3GOVB 1J15A 1LKAA 3RMMH 3U69H 4Y8ZA 3TGIE 4CRFA 3BTFE 1UK2A 3A88A 3MNXA 2BD5A 5ESBA 1MTWA 3SHAH 1V2PT 1P0SH 2FLRH 3SO3A 1MQ5A 2JIZD 3ATIA 1W14U 1TNJA 1V2RT 2FOBA 2J5UA 2O8WA 3MI4A 4GHTA 2VIOA 4ISIH 3MHWU 1UHBA 2BXUH 3FZZA 5DGJA 1KXBA 1RIWB 1SGEE 1HYLA 4WXVA 3UUZA 1SC8U 1E1QD 2XWAA 1QQ4A 4MNWA 1YCPM 2ZGJA 4Y0ZE 1C9TA 2ESTE 1BBRH 3MO9A 3SGQE 4GAWA 1ZR0A 2PUQH 1G37A 2RDLA 2AMPA 5DK1A 4OGXA 5LPEA 1HJ8A 1RTFB 5EPYA 1WYKA 2BD8A 2AGEX 3SGBE 1INCA 1QJ1B 2F9NA 2P8OB 2F9OA 4LOYH 1SL3A 3VXEH 1LHGH 1O2GH 2A32A 4YM9A 3RXFA 1O3CA 4WMEA 2FOMB 4ISHH 1O2JA 4XD7D 1O3EA 1GBFA 4ZHLU 2PSXA 1RJXB 3SORA 1D3PB 3PM3A 3BIUH 1BMNH 3BG8A 4BNRA 2QF5A 2BLOA 2FIRH 1O2VA 1TOCB 4YLUA 2ZGHA 2GVFA 2LNCA 3P8FA 2AS9A 2QAAA 3M35A 1FXYA 1VKYA 3LIWA 1H8DH 1TPSA 2L74A 1GHAF 5F8TA 5EJLA 4BAKB 2ZHQH 1BJUA 4QT8C 1TBRH 4B2CA 4E06H 1W0JD 5AHGH 1W10U 1GHAG 5DP7A 4TPIZ 1Y5AT 4YESB 2VBCA 2WPDD 3ATMA 2EEKA 2FOHA 1S0RA 3BG4C 3F2HA 2GV6A 4R8TB 3UR9A 2G00A 3GCNA 4B1TA 2YMSC 1TGBA 1SHHB 1WTHD 2I6QA 1AD8H 1K1MA 2BM2A 1AVXA 5C1YA 2BOKA 2UWOA 2VGCC 4X2XA 3E16B 4NG9H 4ZROA 4Z0KA 3NPSA 1GJCB 4Q2KA 3A7ZA 2W3KA 1HAPH 4BTTB 1C1UH 2QF4A 1UTJA 2H2ZA 2IJD1 3DCLA 3TIUA 1XKBC 1MTUA 2PWXA 1K9OE 1WSSH 3ZVDA 1BBRE 1Y3VA 2GGVB 2J38A 2GZ7A 3KYGA 2ZTXA 1YPLH 2FX4A 5DP6A 4K1SA 4YOGA 3U9AH 3ZZ9A 2BB4A 1AWHB 3ZZ7A 4UFEH 3EQ0H 4ESTE 2FOGA 1O31A 1EPTA 4THNH 2BD7A 7LPRA 2ZQ2A 1AE8H 2BLVA 3H7TA 1NESE 4DW2U 1N1LA 1OP2A 1P03A 4B75A 2HNTF 1OWIA 5B6LA 3DFJA 2FODA 3OTPA 1DSTA 2PFEA 1NU7B 4ZH8A 1HIAA 2UUJB 3FANA 1CA0C 4VGCC 3F0OA 1MBQA 3PLKA 1A3EH 2K8IA 3SBKA 2QXJA 2FOEA 5DP9A 1YYY1 1C2IA 1ZSJA 1W8BH 3S9BA 2VINA 1GI3A 3O8DA 1TABE 1BB0B 3SNCA 3JZ2B 2VWNA 1FUJA 2KCAA 3RM0H 4DY7B 3V7TA 4IMQA 2ZU4A 1LCYA 4ACAA 3E90B 1KTSB 5EQRA 5EU8A 4YXWD 1EASA 2RA3A 1PPGE 1LHFH 1YWUA 2AIPA 3GDSA 3SU5A 5EW1H 1HUTH 1KXAA 2VNTA 3F0PA 1NFWA 3R0FA 5K0HA 4MQAA 4B2BA 4BAMB 2XC0A 2Y82A 3KCGH 4BTIB 1FZZA 1SGFG 1ZTJA 3VPKA 5KGOA 1V2WT 3F2GA 1ZHRA 4A1VA 1O2HA 1OWKA 1Z1IA 3MU8A 2YMSD 4NZQA 3HK3B 1SQOA 3LJOA 1OP8A 5EXMA 2IJOB 1PPCE 2F43B 2BDHA 3SUFA 1GHBF 1YKTA 1VCQA 2G81E 5C0UA 2OK5A 2ZPQA 1GJ6A 3OAAD 1W7XH 2CGAA 1GBJA 1PPEE 4A1TA 3M37A 1GBBA 5IDKA 4SGBE 4IC6A 1K1PA 2FESH 4CHAC 6ESTA 3SU0A 2STAE 3Q76A 1ESTA 3TJOA 1FQ3A 1O2TA 1S0QA 1Q31A 1A3BH 2OC1A 2QV1A 1C9PA 3SHCH 4I8HA 3UAIC 3D23A 4XE4A 4RKOB 3MNSA 4YT6H 4X6OA 4DIHH 1GGDC 4NIVA 3PRDA 1ELFA 1A61H 2BZAA 1DWEH 3RU4E 3V12A 4Z1MD 3IWMA 2ZTZA 5FBIA 3KYFA 1QB9A 3VFEA 1MTVA 1NY22 1E37B 1RS0A 1C5OH 1SR5C 3UQVA 1QRXA 3T62A 1IQJA 2VU8E 1A5HA 3TNTA 1C5YB 4B71A 3RXUA 4KTCA 1E79D 2AGIX 4Q80A 3A7YA 4JYTA 2A5IA 2BDAA 4Y11E 1D3DB 4AORA 1YPMH 1HXEH 2GCTB 5C94A 3TGJE 2G8TA 1MKXK 1KYNA 4M9FA 5C20A 2GV7A 1SQTA 1FY3A 3RXLA 3U98H 1V6DA 2XCFA 3DHKH 1S6FA 1J16A 3F3BA 5FXLA 3NWUA 4AYVB 2W7UA 4GVUA 3Q00A 1D3TB 1T8MA 3EYDA 2F9BH 2V3OH 4Q63A 1O2RA 1KXDA 3A85A 3SNEA 1C5NH 2OXSA 2Z3DA 1NBMD 3SW2B 3CP7A 4OS2A 4AB9A 3AW1A 1TGCA 3MWIU 1ZZZA 2J92A 4K8BA 1O3IA 3BTKE 1Y3UA 1G2LA 1YCPK 2G55A 3N7EA 1FDPA 2ULLA 3B8JA 4NWKA 3SI3H 4CRBA 3RXIA 1O2OA 2HPQH 5T3HA 3NKKA 1CT4E 1YLDA 3GICB 1PPBH 3OFND 2SGQE 4INKA 2BY6X 3SQEE 2H6MA 3VB5A 2SGPE 3QUMP 2C8YB 3T28A 6LPRA 2A7CA 2QF3A 4MNYA 4TSFD 1D9IA 5A0BA 2JETB 3QZQA 1SGNE 3VG8A 2EA3A 1TPPA 4WH8A 1MKWK 2C8ZB 4ASHA 3PYHA 2C8WB 3GYMA 2HVXA 1TAWA 4DJZB 1C1OA 2OBQA 1QBOA 3A7VA 1QTFA 4I33A 2FMJA 1AZZA 5A8XA 1ETRH 4B76A 2PTCE 2V0BA 1GL1A 1C2HA 1O5CB 3TU7H 3ZVBA 1GCTC 2Z94A 1SGRE 2CN0H 4KTSA 1GJ8B 2IOTA 1C2FA 1GJ5H 3ZZBA 4X1SU 1AKSA 4CBOA 4A92A 2BYAX 1A2CH 5F6MA 1HAXB 1UVUH 2BQ6B 5SGAE 1Z6JH 1O0DH 1THSH 3RDZA 1C5TA 1NZQH 3RM2H 2BDYA 3D49H 1AO5A 3NRLA 4AN7A 5ESTE 1AGJA 3TNSA 1XXDA 2NU0E 1TFXA 3ATKA 2OC7A 1LTOA 2O8TA 1HJAC 2AIQA 1UTKA 1BRBE 1ELTA 5EW2H 1Z1JA 4XBDA 1NC6A 3LKWA 1V2UT 5JBTA 3TJUA 1TBQH 1MBMA 4WXIA 4CRAA 1IAUA 1LQEA 2F4LA 2FX6A 3FOAA 2Z9KA 2J98B 1H1BA 1NM6A 2O8UA 2AMQA 1A0LA 1S5SA 3BTDE 4MNXA 2Z7FE 2A4OA 2JJ1D 1W7GH 1YLNA 3PV5A 3QDZB 5FL7D 3LGYA 1PPHE 2BQ7B 3DSOA 1L0ZA 1O2IA 1QBNA 1SGTA 3EDXB 1AI8H 3RXEA 2F9UA 2PKSC 2F3CE 4I8KA 1N8OB 4BAHB 4BAOB 1F0SA 3A7XA 1TONA 1O2SA 1GI2A 1QNJA 5HM2A 1ZLRA 2A1DB 1KDQB 1ZMJA 2ZGBH 1DX5M 1QGFA 3HKJB 1IQIA 1ACBE 2FLBH 2XNIA 1BHXF 2FPZA 4YO9A 1L1GA 2R3YA 1V2VT 1FNIA 5BPEA 1ELBA 1EPTC 1P2MA 3E0PB 1BJVA 1J14A 1C5UA 1FV9A 1P01A 3KQCA 1EZUC 1GDNA 1T7CA 3SYJA 2LPRA 3U28C 5DP3A 2AGGX 2J34A 2XNDD 1GVLA 2P16A 1V2ST 2THFB 1P11E 2G5NA 3EE0B 5L2ZH 1OXGA 2JH0D 3F9FA 1Z8GA 4WMDA 1GG6C 4E7NA 5EG4A 1O3BA 3VXFH 1UCYH 1TX8A 2OTVA 3ZZAA 1GDQA 5FX5A 2QA9E 1AUTC 1QCPA 3S7HB 4NSYA 3OY6U 3GY3A 3RXCA 2VIVA 1VGCB 3I29A 1HAGE 2PHBA 1DXWA 1GJAB 5E0GA 1P04A 3QX5H 3EAJA 2B0FA 2BLQA 4A7IB 1EB1H 2Q6DA 3AW0A 3VB7A 1AB9B 3ZIAD 2ZPRA 3GDVA 4MTBA 3F2FA 3SQHE 2G52A 3SGAE 2HALA 2BX3A 1YPJH 1PQ7A 1SBWA 2KR7A 1C4V2 4WJG2 5E2PA 1HAIH 1TA2A 4OGYA 1MD8A 1EP6A 2LP6A 3RUOA 5GNDA 2CF9H 2G51A 1FY1A 2W7SA 4Y8XA 1PPZA 3UOPA 3M5LA 2TGPZ 2ZCLP 2RDEA 2A45B 1BMAA 1P2KA 4FU9A 1IQGA 1K22H 2VVUA 2Z9GA 3TPIZ 2PSYA 4DT7B 2XBVA 2SGDE 1H9HE 4A1XA 1AVGH 2WPKS 2NU2E 2FP7B 1HAVB 4OS7A 1ZJKA 2EY4C 3TH2H 2ANYA 2BDGA 1PJPA 5JYIA 5TCCA 2ZGCA 1D4PB 1YC0A 2UUYA 1TX7A 1GCDA 1A0JA 3AVZA 1FAKH 1L1NA 3DT0H 5DP8A 2P95A 4CH2B 1EATA 1NRPH 1KXCA 1FJSA 1H9LB 1MTNC 3TLOA 2KFWA 2ZKSA 1JXPA 3V13A 4I32A 1ZYOA 3F9EA 3QWCH 3RU4T 1W3CA 2ANMH 4FUGA 3U8TH 1MTSA 4I8GA 1TMBH 1A0HB 3K6ZA 1IOEA 1LVOA 1V2JT 4Z6AH 1HXFH 2ZO3H 4D7GA 2CJIA 2GKVE 4ABGA 1BUIA 4A6LA 1TNKA 3RXBA 2QXIA 4AFSA 1K1IA 2FM2A 5EQQA 1O2YA 3ATLA 4TPYA 5GWZA 2ZFTA 1W0YH 1ZHMA 2TGTA 1LDTT 1RFNA 1MUEB
chains in the Genus database with same CATH topology
2RG3A 1HV7A 1C1WH 1F5RA 2RCEA 1P12E 4DVAU 2ZU5A 2FO9A 1OYTH 2QC2A 1UVPA 1K1OA 2HWLB 3HGPA 3BTME 4KP0A 1SG8B 3AAVA 1JOUB 1HNEE 2J4IA 3KF2A 1B5GH 5C5NA 1C5PA 3GCOA 1C5RA 1N6XA 1NFYA 2VIQA 4NSVA 2F9VA 1AE5A 4MNVA 1QRZA 2BXTH 2OQUA 3RC4A 4X1PU 3M7QA 5DP4A 1TB6H 3DA9B 1O3DA 4Y76A 3SV8A 3F6UH 1HRTH 3LGUA 5EPNA 3RXHA 1A7SA 2ZNKH 4KGAA 4Y79A 4B2AA 1GL0E 1XUJA 1CHOF 1AZ8A 1DOJA 1SHYA 4U32A 4GLYA 4K3JA 1FN6A 3UTUH 1WOFA 2YNAA 6GCHF 2VH0A 2ZDVH 2B8OH 3RU4D 1FAXA 2JH5D 1BIOA 3FP7E 1C1PA 1O2PA 1P2IA 1C1VH 4BXSA 1GBAA 1O2MA 4I8JA 1CBWC 4XSKU 3RMLH 5T6GA 1NU9A 1C2LA 1WQVH 2Z9JA 2BMGB 4X6MA 1AQ7A 1ZMNA 1O39A 4H6TA 2KAIA 4VGCB 4GCHF 4WVPE 3U8OH 1V2KT 3A7TA 4U2WA 1SGIB 1SMFE 2XRCA 5CHAB 5C2ZA 2QN5T 1CGIE 1BTUA 1W12U 3GY6A 5TCAA 4GCHG 1NFXA 2VJ1A 3M3TA 1GPZA 4INLA 2JKHA 3T25A 1JRSA 2VIPA 1TNIA 1GBMA 3ZVEA 4ZUHA 2R0LA 3NK8A 1L4DA 3K65B 6CHAC 4Y0YE 2DE9A 3PTNA 1J17T 1ZOMA 1LPKB 1KXEA 1UVSH 2PGQB 2UUKB 4J1YA 4O3TA 3W94A 3ZZDA 1TALA 1QA0A 1SLUB 8GCHF 1UO6A 2WV4A 5GDSH 4E7RG 1TPAE 1YBWA 4I31A 2ZPSA 1ZSKA 1G3DA 2SGAA 1HDTH 2BVRH 2Y5FA 5HMAA 3STIA 2HLCA 5C3NA 8GCHG 3WY8A 1BMLA 1TPOA 1MZAA 3PMJA 1IQKA 3BSQA 3P95A 1UK4A 1BITA 1C5SA 2ZDNA 1JIRA 4NGAH 1O3PB 3MO3A 1BTYA 1L4ZA 1HAZB 3RC6A 3TH3H 1ARCA 1DITH 2AERH 1VCWA 4BAQB 1NRSH 1GHVH 5CMXH 4Q7ZA 2FOCA 3U8RH 1RIWC 1CSOE 3GDUA 1HJ9A 3SJKA 3DUXH 1HFDA 2QYIA 4X2WA 1HB0B 4LZ4B 3PWBA 2ZZUH 1DM4B 3ZZ4A 1TX6A 3P17H 3KHVA 1ZRKA 2P8OC 3ZVFA 1FLEE 1EUFA 2ZC9H 4UFGH 3LT3A 1MH0A 5FHTA 1BTXA 2FS9A 4DURA 2VIDA 1ELAA 1E0FD 2SGEE 3FP8E 5A0AE 4F4OC 2GT7A 2FTLE 4NA8A 1IHTH 2TRMA 1V2TT 1DSUA 3A8CA 1LMWB 3A86A 1MD7A 3QTOH 1K1JA 2TIOA 1O3LA 3SUGA 2V6NA 4MDSA 1IQFA 1DWBH 3BEUA 1MCTA 1C1TA 1AIXH 1P3EA 1K2I1 1Y3XA 4CH8B 5TJXA 3RMOH 3SU1A 4K60A 4ABDA 2ODPA 3BTTE 3EA8A 1ZJDA 1DWCH 4AYYB 2ZTYA 2OLGA 4BOHA 3M7TA 1P3CA 2AYWA 1OWJA 4OS6A 3UR6A 3L33A 1S81A 2AH4X 1KLTA 1VJAU 1EP5A 5DJ7A 2GZ9A 3GCHB 4Y7AA 1O2QA 4TWWA 2ZWLH 4JZ1A 1LHCH 4HGCA 2RA0A 3D65E 1O34A 3RXDA 2ZU1A 1OKXA 2J94A 3SZNA 1GHBG 4X6PA 1O35A 1ELGA 2WUCA 5DPAA 3C1KA 3K9XB 3RXMA 1P2JA 2R9PA 3GY2A 1AMHA 3VGCB 3SJOA 2ZIQH 3Q3YA 2EC9H 4CR5A 1OPHB 1OYQA 1PQ8A 1THPB 2OCVB 1C2JA 1DLEA 2XC4A 1ZHPA 3D62A 3F9GA 4ZKRU 3AAUA 3PV4A 1BRAA 1C4Y2 2GMTB 2WPMS 1YF4A 3O8RA 2QCYA 5LPFA 2ANWA 1UHBB 2SFAA 2Y80A 4NA9H 3BN9A 2CHAC 1P8VC 4AB8A 2Z6BD 3H5CB 4H6SB 1XX9A 1ZPZA 1B7XB 3SOSA 2QF0A 1CO7E 1EJAA 1SGYE 1ABIH 1CQQA 1BOQA 1ESBA 3R3GB 3QK1A 1C5XB 3VB4A 1TIOA 5A8YA 1UTMA 1LHDH 2GT8A 2D1JA 4NIXA 1TGNA 1E34B 3NUMA 4O03A 1GBIA 1QA7A 2CF8H 2V3HH 1L1JA 2OC8A 1GBKA 1QIXB 1O33A 1C5ZB 2GCHF 2G4UA 1EJNA 5J4SA 4K1EA 4UDWH 1EAUA 3F68H 3SUEA 2JH6D 3DD2H 4X8UH 2ZP0H 3MU0A 1N6YA 1LPZB 1GBDA 1MU6B 3MU5A 1L2EA 1YPGH 3S9AA 2GCHG 1ZMLA 2VVCA 4JZIA 1BHXB 1BBRK 3LH1A 3FAOA 2VWOA 3M5NA 1JWTA 1HJAB 2ODYB 1FY8E 1H9IE 3HK6B 3A8BA 1F0UA 2XYAA 3L3TA 1X7AC 2XBXA 3UPEA 1NRQH 3KN2A 1UVOA 1F7ZA 2Q6GA 5H4IB 1LVMA 4X1NU 3ZYEA 1SLWB 3ZZ6A 1DY9A 1ID5H 5J4QA 3LC5A 4UEHH 4X6NA 2A2QH 4KKDA 3AASA 3B9FH 2Z9IA 4X0WU 1GBTA 1D6RA 2GDDA 3TK9A 2FEQH 5FPSA 3A84A 1DUAA 1Z8JB 1BCUH 1UVTH 3P8GA 5JBAS 2PR3A 4AFZA 1SOTA 3U1IB 3SV6A 1DE7H 1THRH 3O8BA 1UTQA 2ANKH 1O38A 3E3TA 3BTQE 3ZVAA 3GY8A 5C1UA 2IN2A 2R2MB 1FY4A 5G4BA 2A31A 3SNAA 3SJ8A 1O2XA 4WWYA 4CRCA 1EPTB 2ZQ1A 3ZZ8A 4YOJA 1S6HA 3MMGA 4FUCA 3L6PA 3I78A 1SVPA 2XWBI 2A4GA 4IN2A 1KLJH 1TQ7B 3V3MA 4UFFH 4ISOA 2ALVA 3RLWH 3G01A 3FZDA 1HIAB 1EQ9A 1XMNB 2EI8A 3UQOA 1GHZA 2BD2A 1TOMH 1EZQA 2ZHEH 3PLPA 2Y7XA 4JZDH 1O2LA 1RXPA 2Z3EA 2ZFPH 1O3KA 1QL9A 1ZSLA 2BHGA 1C1NA 2VIWA 4U01A 1GMCF 4Q7YA 1GHXH 1CE5A 2I6SA 3EA9A 5EOKA 4ABJA 2GCTC 1C2KA 3M7UA 4ABEA 1GI5A 2WV5A 1TGSZ 2OBOA 1GMCG 4ISLA 2FI5E 1Q2WA 3MYWA 1P2OA 1NS3A 3KQBA 5I46H 1P9UA 1G9IE 2G4TA 1OX1A 3M36A 3ZV8A 1SGFA 2CXVA 3SNDA 4INHA 1V2NT 2H5DA 4IW4E 2H5CA 2HNTE 2QIQA 2A5AA 5JB9S 2OUAA 3ITIA 1E36B 8LPRA 1A5IA 1WCZA 3QGNB 4O3UA 4XBCA 4CRDA 5FCKA 3RP2A 3RXAA 1GMDF 2B5TB 4ZHAA 4ABAA 1OWHA 3MNCA 2ZHDA 1SLVB 2JETC 2BTCE 1TNGA 4IS5A 5E8EH 3LH3A 1F5KU 7KMEH 4MG3A 1GMDG 1P2NA 3NXPA 3KQDA 1O5AB 4Y6DA 1O3OA 2HGTH 1DUEA 4X1RU 1C1SA 1M9UA 4B74A 1B0EA 1O32A 1WQSA 2BX4A 3A8DA 4K69A 3UNSA 3VB3A 4X2VA 2FDAA 1V2LT 2ZI2H 5C67A 4X8VH 3S9CA 3UNRA 1UK3A 3BTWE 1TGTA 1TQ0B 2QXHA 2BD9A 1C2EA 1NT1A 2ZDLA 3LGWA 3T29A 2DUCA 1QL7A 1SFIA 1TYNA 3H7OA 5GCHF 1T31A 4FUJA 2R3UA 3PMAB 5JB8S 4O9VA 1AUJA 4UFDH 2WUBA 1AVWA 5JBBS 3UNQA 3PTBA 3EGKH 1BT7A 3A7WA 1G30B 5L30H 3MH7A 1XUKA 5GCHG 3LGVA 3OU0A 3P70B 3SJ9A 4NFFA 3ZV9A 1QB6A 2ZG0H 2TGDA 4IC5A 3LU9B 3RXPA 2WINI 2WPLS 2FYQA 2PGBB 3FVFB 4Q7XA 1UTPA 3SV9A 2BOHB 3IITA 5A8ZA 2FXRA 3BV9B 1AFQC 4OS1A 3PB1E 1FPCH 1GI6A 3DFLA 3S69A 2PV9B 4J2YB 1ELEE 1Y59T 1QB1A 3GY5A 3LC3A 3OSYA 5E2OA 1T4VH 1XUGA 3BEIB 1RTKA 1GI7B 4RN6A 3QTVH 4AG2A 1K28D 2BQWB 5DKMA 1N8OC 4MPWA 1C5QA 3NCLA 2ZF0H 5FPTA 1CBWB 1TMUH 1NRRH 3RC5A 2NWNA 5CE1A 3BEFB 1UCYE 2FS8A 4LXBH 1ESAA 2HPPH 1Z8RA 3E8LA 1LVYA 3LONA 1GVKB 1ABJH 1RD3B 1NPMA 4DGJA 3F9HA 4H42U 1DANH 4MVNA 1D6WA 2H9TH 3UIRA 2TGAA 3OYPA 1C2MA 4FUFA 3T2NA 4AFUA 4SGAE 2Q6FA 1HLTH 2J9NA 3CENA 1ELCA 3BF6H 4OS4A 1P2QA 5E0JA 5LPRA 2BLWA 1GVZA 3ODFA 1PQAA 4DG4A 1WU1A 1RTLA 5GXPA 3BG4B 1T8LA 1UTNA 1K1NA 1XM1A 1ANCA 1TRYA 1C5MD 3E1XB 4GUXA 1GDUA 2A4RA 2BD4A 1EZXC 4ABBA 5HM9A 1O3MA 2O8MA 3SV2H 3MH4A 1O3GA 1AKSB 1K21H 1VZQH 5I25A 2VGCB 2K1QA 1GI0A 3HPTB 3EA7A 1ZTLA 2XW9A 1C1RA 1AB9C 1SLXB 1EAXA 4JMYA 1O5EH 2ZCKP 3SU4A 1T8NA 4NWLA 4GSOA 4FUDA 1D3QB 5EQSA 4UONA 4HFPB 1FIZA 4CREA 1TNLA 4ZXXH 4ZAEA 1MKXH 1NROH 1YLCA 4WH6A 2VWLA 3P8NA 2GTBA 2BY8X 4FVBA 2BVSH 4YT7H 4Y10E 4IMZA 1T32A 3A8AA 2PTNA 1CHOG 2XC5A 1O3NA 1GI4A 3B23B 3TVJB 3GISB 5GPIB 1QURH 1O3JA 1PFXC 1V2MT 1F2SE 6GCHG 1PPFE 3HKIB 2XXLA 3GY4A 1XUFA 1C5WB 1GBLA 1OOKB 4NCYA 4WY3A 1KIGH 1CA0B 4K2YA 1A4WH 4FVDA 5HGGA 1HAHH 2EI7A 1ZRBA 1GI1A 4O97A 2NU1E 1Y3YA 1FIWA 3Q3KA 1YCPH 2J95A 2R0KA 1GWAA 3PLBA 1XVMA 1FI8A 2H9HA 1DPOA 1DXPA 2VVVA 3OX7U 3PMBB 1C2DA 1FONA 1SGPE 2HOBA 1LQDB 1P57B 3W95A 3GYLB 4A5TS 1BTHH 1QL8A 2AFQB 4TY7A 3VB6A 1AY6H 4ZXYH 3M5MA 2IPHA 2A0QB 1V2QT 2CV3A 4BXWA 2Y7ZA 4CBNA 3PO1C 3LGTA 1YM0A 1MKWH 2C3SA 3E0NB 3TH4H 1IQLA 4IBLH 3SN8A 1WBGB 3E91A 2BVXH 4D8NA 3ZZCA 3LPRA 1J9CH 4FU7A 1MMJN 5EXNA 1BRUP 4WMFA 2B7DH 2D26C 2HNTC 1DFPA 4MPXA 1PQ5A 2B9LA 1IQMA 4K5ZA 1EZSC 1F0RA 1OS8A 4AG1A 1MAXA 2BDIA 2Y5GA 3UWIA 3UOUA 3IG6B 4JK5A 3RXOA 3LJJA 2WPHS 1DS2E 3ODDA 5DO4H 3LDXH 4MPVA 2WPJS 1O5FH 3ESTA 2H1UA 1G32B 1NO9H 2W3IA 3LOXA 4IN1A 1LHEH 1YPHE 1Z7KA 3A81A 5DG6A 3RLYH 1EAWA 4YOIA 4CHAB 4DOQA 1QR3E 1NTPA 1BTZA 5HXFA 1S84A 3O8CA 3FP6E 1DDJA 1SSXA 1UCYK 1F5LA 3N7OA 2GX4A 3SJIA 4JK6A 5A0CA 1DY8A 2P93A 1HPGA 1GGDB 1SGQE 3T26A 2CHAB 2FZZA 3A83A 1TMTH 2Z9LA 2GZ8A 2ODQA 2XCNA 2OD3B 4D76A 3HATH 1GHWH 1QRWA 1Z71A 4FUBA 5LGOA 1C5LH 5F8ZA 2STBE 2D2DA 1H4WA 4UD9H 1XVOA 1BQYA 1O2ZA 1IQEA 5CHAC 2A7HA 1GI8B 2BY5X 1ETSH 3KEEA 3QGJA 1SB1H 2Z3CA 3ATWA 1P09A 3KIDU 1CT0E 3T5FH 1V3XA 4YZUA 1JBUH 2OP9A 3A87A 1KTTB 3OTJE 1Q3XA 2OQ5A 3P8OA 4PROA 1TA6A 4R0IA 1NRNH 3A89A 1CT2E 2CMYA 1KXFA 1O5BB 1LVBA 1UTOA 3CS0A 4NIWA 1GJ9B 4B73A 5B6OA 4XDEA 5FPYA 1TRMA 1XKAC 1GJBB 1P02A 2ZA5A 3K6YA 4HI3A 1KDQA 1SPJA 5A2MH 1YGCH 1QJ7B 2ZDMA 1V2OT 1UMAH 3Q3XA 3UY9A 4UE7H 4CR9A 2VB0A 1XUIA 2SGFE 2C8XB 1KY9A 3M3VA 4RKJB 1RRKA 5AFZH 2O9QA 4ABFA 1SFQB 2WPIS 4BANB 1OSSA 1B0FA 3F1SB 1J8AA 3PWCA 5ETXA 3SI4H 1VJ9U 3A80A 1XUHA 1G3BA 3PMHB 4K1TA 1GHYH 1C2GA 1QQUA 1GCTB 5BRRE 1UTLM 2O8LA 1JMOH 1YPEH 1S82A 2YOLA 2EI6A 2ZCHP 4AGKA 3QN7A 2UUFB 1E38B 1WTGH 2BD3A 1QY6A 2J2UA 4D7FA 4CRGA 1TBZH 2BY7X 2AEIH 1BZXE 1GJ4H 1EOJA 5F03A 2VH6A 2ZGXH 2KAIB 1ETTH 1JRTA 3CS7A 1P9SA 1ELVA 1SGDE 3NZIA 2A5KA 3K2UA 1CVWH 2F9PA 4WF8A 2PKAA 1T8OA 1P10A 4E05H 1WAYB 2P94A 2FYRA 1EX3A 3Q77A 3KNXA 5JDUB 1DLKB 4ISNA 2DE8A 3P92A 4D9RA 1BRCE 2Q1JA 1SQAA 1PYTC 2V35A 2BZ6H 1W0ZU 3TJNA 2YNBA 2AMDA 2ZHWH 4ABIA 3RXSA 3TK6A 1JIMA 1DVAH 3BTGE 1HAVA 3UFAA 3GCHC 3BTHE 3SU2A 1TE0A 2P59A 1GMHF 1O5GH