2TRMA

The three-dimensional structure of asn102 mutant of trypsin. role of asp102 in serine protease catalysis
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
223
structure length
223
Chain Sequence
IVGGYTCQENSVPYQVSLNSGYHFCGGSLINDQWVVSAAHCYKSRIQVRLGEHNINVLEGNEQFVNAAKIIKHPNFDRKTLNNNIMLIKLSSPVKLNARVATVALPSSCAPAGTQCLISGWGNTLSSGVNEPDLLQCLDAPLLPQADCEASYPGKITDNMVCVGFLEGGKDSCQGDSGGPVVCNGELQGIVSWGYGCALPDNPGVYTKVCNYVDWIQDTIAAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRYPSIN
publication title The three-dimensional structure of Asn102 mutant of trypsin: role of Asp102 in serine protease catalysis.
pubmed rcsb
source organism Rattus norvegicus
molecule tags Hydrolase (serine proteinase)
total genus 42
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1988-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2trmA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2trmA02
3VB5A 3MH7A 1HAVA 5H4IB 1CA8B 2GV6A 2LNCA 1Z8GA 4YZUA 3URDA 3GCNA 2AS9A 1LVOA 2OC8A 1OP2A 2JH0D 3LJOA 3BF6H 3A86A 1PYTC 5T6DA 1G36A 2F9BH 3HPTB 3VB7A 7GCHF 3SBKA 2W26A 1KIGH 5K7RA 2SGDE 4NG9H 5EQQA 1T7CA 1TWXB 2A4RA 4THNH 4RKJB 3ZYDA 1TPPA 4INLA 1Z8IB 2VIPA 2H1UA 4OGXA 2XNIA 5C1XA 1SGPE 2QYIA 1FAXA 4O3UA 2Q6FA 3E0NB 5GPIB 6CHAB 1LHCH 2AIPA 3RXSA 3BTHE 3SGAE 2BD4A 1CHOG 2OQ5A 1JXPA 1NS3A 1L1JA 1DY9A 1AY6H 1GJAB 4D7FA 2PSYA 3SJKA 2Z9LA 3RP2A 4XE4A 1O5AB 2QXGA 4DIIH 4U32A 2QGRA 5L2YH 3VEQB 1EPTA 4LK4A 4RSPA 1F5LA 3U69H 1C5ZB 1SPJA 1OXGA 1NFUA 4HZHA 1VJAU 2D1JA 3GY4A 3KQBA 5GXPA 3TK5A 1L2EA 1CT0E 1GJ6A 1HAXB 2CJIA 1GBFA 2C93B 4H6TA 1DLKB 4Y8YA 3PTNA 2FEQH 2W7UA 1C5PA 3I78A 3TNSA 1NT1A 3A8BA 1XUJA 4Q7ZA 2A2XH 2D8WA 1W3CA 1BUIA 1MUEB 1VCQA 3M61U 5EXNA 1GWAA 4NIVA 4BXWA 1GCTB 2OC0A 2OINA 3GDUA 1O2NA 4AFZA 2J92A 1E0FD 2F9OA 2FI3E 1AFQB 2J4IA 1D9IA 5FBIA 2HOBA 4NZLA 1MD7A 5JBCS 3M5LA 3BIVH 3M5OA 4MVNA 3PB1E 4O9VA 1HAZB 1C5LH 3RXLA 3R0FA 5A8YA 1L1GA 2WYJA 2ZGJA 3V12A 5ABWA 1DM4B 1Y3VA 1UTOA 4UE7H 4ZUHA 1HAPH 2A4GA 2PFEA 1ELAA 2QXIA 2OBQA 1VITG 5C1UA 1LTOA 1D3TB 1BB0B 2CHAC 1T4UH 1TYNA 2GGVB 5F8XA 8GCHG 1A3EH 3SU6A 2F9VA 1F92A 2XBVA 1W8BH 1O5CB 1AUTC 4DJZB 1O5FH 4B75A 4B2BA 2A1DB 2V0BA 1Y8TA 4IS5A 5TJXA 3TU7H 4ESTE 1QBVH 3E0PB 1GJDB 2FTLE 3W94A 4D9RA 1ZRBA 5HM2A 1LHEH 2PKAA 3K2UA 3C1KA 4MNXA 1GJ5H 1OYTH 4XBCA 4XOJA 1AVWA 5HMAA 2GKVE 1TPAE 2WPMS 1TGCA 3SUDA 3SNAA 3EGKH 1NROH 3RXBA 1P2OA 2O8MA 1TA2A 2ANKH 4X6MA 1P2IA 2OP9A 2WPHS 1DS2E 1FN8A 1VZQH 2PLXA 1SI5H 3RMMH 1NRRH 1MTSA 2P8OB 5DP9A 2Z7FE 3FP8E 1MD8A 4UEHH 4E05H 2A0QB 4JYUH 1NN6A 3SW2B 2XBYA 3VPKA 1GI1A 2ZGBH 2R2WU 2QF0A 3UWIA 1AI8H 1FXYA 1SLWB 4WXVA 2PW8H 5PTPA 1SOZA 2AMDA 2P59A 4FU8A 3Q76A 1MU6B 3PMHB 2ZCKP 1ZR0A 1ELTA 1SR5C 4ZH8A 1O2GH 1LMWB 1O3PB 4MNWA 3UIRA 3KQEA 1ZTLA 4ABHA 1ZHRA 3ZZAA 4X1NU 1YCPK 3HK6B 1ZHPA 2AIQA 1Z71A 1RTLA 3GDVA 1Y3WA 3SHCH 4JZDH 2BD7A 2GVFA 2ZHDA 2ZU1A 1SLXB 2Q1JA 3A82A 1QL9A 1KDQB 1EZSC 3M35A 2F91A 1O30A 3TNTA 4BTTB 3A85A 1G3DA 2BYAX 5AFYH 3LU9B 1BRUP 3EDXB 1C1WH 3L6PA 3PLKA 3E3TA 1D6RA 4LXBH 2BY7X 1ELCA 2Y6TA 4BTUB 1P2QA 1EPTC 1DXWA 2ZU5A 1BMNH 2C8XB 4Z6AH 1MZAA 1NFWA 2AYWA 2ZIQH 5LPFA 4Y10E 2GX4A 3RU4D 5BPEA 1YPKH 1Y5BT 1J16A 3TGKE 1W2KH 4CRGA 4K1SA 2G55A 3GYLB 4AGJA 1WOFA 2ALPA 1DITH 1LHDH 3D62A 1E34B 3S69A 1BTXA 3P8GA 1B0EA 1EOJA 2NU0E 1NRQH 1IQJA 2FP7B 2VWOA 3SU3A 1UK4A 4K3JA 2P3UB 1BRBE 3O8RA 3AW1A 1BA8B 3R3GB 4Y7AA 4ZXXH 3SNEA 2ALVA 3ZVGA 3WY8A 4ABDA 3QLPH 6ESTA 2QY0B 1V2RT 1EJAA 5EQRA 2BD2A 2ZHEH 3RXMA 3T27A 4YT6H 4BNRA 2CF8H 4AB9A 1FI8A 3F6UH 2ZTYA 5L30H 1E36B 4LZ4B 2V6NA 1O5BB 3MFJA 3RXUA 1SFIA 2SNWA 3TH3H 1YPMH 1CA0C 1TRYA 1C1OA 1MQ6A 3OSYA 2GD4B 4CRAA 4JZ1A 5TCCA 1C4U2 1GVZA 2GZ8A 2ZZUH 1TX8A 2JH5D 1FIWA 1QQ4A 1D6WA 1UHBB 3A7XA 1TNHA 3P95A 2R3UA 2Z9KA 1FMGA 2O9QA 5DP4A 3SU0A 4KTUA 1G2LA 2WPKS 3VB3A 1ZSJA 4IC6A 3RU4E 2IN2A 1W7GH 3ODFA 4ZKSU 1O2TA 1SQAA 3T29A 1GCDA 4F49A 2QA9E 3QK1A 4WMEA 7GCHG 1C5NH 3K6YA 5LPEA 1YGCH 1KXAA 1Z6EA 1KY9A 4TPYA 1M9UA 3RM0H 1WUNH 4Y76A 1GMCG 1ZGIA 1AVXA 3LH3A 1SB1H 2SNVA 1RTFB 3QTVH 4ISIH 4YOIA 1FNIA 1SGIB 3IITA 1O35A 3DUXH 1IQKA 1UCYH 1C2MA 3O8DA 3OU0A 1IQFA 3U98H 2VH6A 1CBWB 5DP3A 1EP6A 1O2ZA 3RC4A 3SU5A 1BRCE 1PQ8A 1Y3UA 5DG6A 5F03A 3K6ZA 1FN6A 3EA7A 4B73A 2GCTB 4DGJA 3VB6A 1V2KT 1F0TA 2BD3A 4BXSA 2VGCB 2HNTE 1EAIA 2Y5FA 1A0JA 2A4QA 5AVDA 4I8GA 3ZV8A 1PQAA 3MYWA 1DSUA 1EZXC 1QJ1B 1Z8JB 4PROA 3CP7A 4GHQA 2HNTF 4NIWA 5FPYA 4AYVB 1C5WB 2BD9A 2H5DA 2SFAA 3PO1C 1VITF 3BTQE 6GCHF 3GY8A 1ANBA 4OS1A 1VGCC 8GCHF 2F83A 1GHWH 3VFEA 1AD8H 3FFGA 1HJ8A 3LDXH 2ULLA 3A7VA 4I8KA 1GGDB 2ILNA 3A7ZA 1EKBB 3Q3KA 2OLGA 2NU3E 2ZDNA 3P70B 2STBE 2SGFE 4YESB 1RXPA 4BAOB 3GY2A 1BBRH 1ZSKA 3RXJA 2Z9IA 4K8YA 3SGBE 1TMTH 2AFQB 3H7OA 1O3KA 1ZMNA 2BDCA 1PPHE 1O3OA 4ZHAA 1MU8B 1O3NA 2RDLA 2I6SA 2Y82A 1AIXH 5C5OA 4CH2B 3ZVBA 1KTTB 4B71A 1BHXF 4Y0YE 3A7WA 3F68H 1O3DA 1C1QA 1S81A 3M3TA 3I29A 3BG8A 2H9HA 4ABEA 1THRH 1O2HA 3BV9B 1L4ZA 1HJAB 1HRTH 4WH8A 4B2AA 2TPIZ 2WPLS 3BTKE 2HGTH 4O3TA 4CREA 2FLRH 1EX3A 1C5OH 4MNVA 1O2PA 4FXGH 3G01A 3D23A 3PMAB 3VB4A 4TWYA 1RFNA 2A4OA 1DSTA 1C2LA 4VGCC 1LO6A 3PMBB 3LKWA 5I46H 1ZGVA 1XUFA 3H5CB 4DCDA 1AKSA 3HGPA 4ZROA 1XUIA 1VCWA 1BZXE 3SV2H 2K1QA 3KN2A 1DICA 3DD2H 1RIWC 3STJA 1IQEA 4K69A 1C2GA 2EI6A 3SZNA 2P3TB 2J94A 4X6PA 1AE5A 4D8NA 4FUFA 1VITH 1E38B 1EOLA 3RXRA 3M5NA 1HAGE 4AOQA 1DE7H 1HCGA 1GDQA 1O3GA 4I7YH 3PWBA 2BHGA 3SN8A 1QRZA 1T32A 5JYIA 3ZZ4A 1BTWA 4BAQB 5C2ZA 4YO9A 2HNTC 1MBQA 1C5QA 3UWJH 3FP6E 1Z7KA 1UVUH 4Y8ZA 1UTLM 1FY1A 4INHA 1C2IA 1Y59T 1C4V2 2ZTXA 1QJ7B 3D49H 1NRSH 3PLBA 1CE5A 1A1RA 3UFAA 1YF4A 3BEUA 1JRSA 3S9BA 1O38A 1O5GH 1MKWH 1GHZA 1ETTH 1DXPA 5CHAC 3BTTE 1P03A 1KYNA 4JMYA 3PROA 1V2VT 2G5VA 3GYMA 3LC3A 1RJXB 3ZVCA 1NM6A 2FXRA 2BD5A 3UQOA 1S6HA 2Q6GA 1S84A 1PPZA 3MH5A 3FZDA 1A0LA 1YPEH 2XXLA 4H42U 4MTBA 3UOUA 2RG3A 2RA0A 5T3HA 4LOYH 1O3FA 1BOQA 1UJ1A 4D76A 3PTBA 4Y7BA 2W5EA 5T6GA 1EAUA 1F5KU 1GHVH 2WV5A 1TBRH 3LPRA 4X1PU 3SUEA 4WXIA 5E2OA 1HYLA 4HGCA 3TGJE 2VWNA 5F8ZA 1FPCH 1OSSA 3RMLH 2ZO3H 1PPCE 4R8TB 1W7XH 1S0RA 3SU4A 2JH6D 1LHGH 1P05A 1F5RA 2GZ7A 1YP9A 1GJBB 1T8LA 4WF8A 4WVPE 4AX9H 1C2FA 1GMCF 2WPJS 1BJVA 3KCGH 2ZFRH 1C9PA 2Z6BD 1C5MD 5G4BA 5LPRA 1O2UA 4H4FA 1SOTA 1DWEH 2KAIA 2EEKA 1GJ7B 4SGAE 1IHSH 4UFEH 1IOEA 1UK2A 1EAWA 2EA3A 1QRWA 1CT2E 5JB9S 1MKXH 1JIMA 1NFYA 1RRKA 3ZZ3A 1BCUH 1GBCA 5EXLA 1TGNA 5BRRE 2BOHB 3SUGA 2FI5E 3SNDA 2OCVB 2Y5GA 3N7OA 2ZQ2A 1GJCB 5A2MH 3EQ0H 4NSYA 1AQ7A 1DX5M 1UO6A 3RXIA 2RCEA 1AHTH 1O2VA 4JYTA 2ZKSA 2PGBB 2B9LA 5HXFA 4ZHLU 2OBOA 2R0KA 5CMXH 3A8CA 1ZHMA 1LKAA 2VIDA 2G51A 1HJ9A 1LPKB 1U6QA 4TWWA 1VR1H 1AFEH 1ABIH 1C2KA 3BTDE 1MTNC 4CHAC 1OKXA 2GP9B 4OS6A 1BDAA 2ODPA 1HXEH 1Q2WA 1DANH 1TQ0B 1XKBC 2EC9H 3DT0H 3RXHA 1KLTA 3ZZ5A 4AFUA 4XBDA 2VIWA 3LGTA 3UQVA 1K1IA 2ZPRA 4IN1A 2QC2A 1O3AA 1O3MA 2R9PA 3GY7A 3LGYA 4ABJA 4ABBA 3V7TA 4I8JA 1F7ZA 1UTQA 4WJG2 2DUCA 3TPIZ 4FVBA 2TGTA 1YBWA 3U9AH 4MNYA 4X8VH 1O2YA 4Z0KA 3BEFB 3T25A 5F8TA 1TQ7B 4GLYA 4JYVH 1A61H 1YPJH 1C5VA 6GCHG 4CBOA 4D9QA 3BN9A 3S0NA 2Y80A 4U01A 2VIOA 5GJ4B 1G3EA 2QN5T 2ZDKA 2ZQ1A 3UTUH 4XSKU 1S0QA 4UDWH 1TRMA 1ORFA 2BTCE 4NSVA 2ZFFH 1V2MT 1TALA 2O8WA 2PUQH 3A83A 1A5IA 1O36A 1GBTA 1O31A 4NIYA 3CS7A 2EI8A 2PTNA 2PSXA 1FLEE 1BMLA 3SV8A 5EPNA 1ZRKA 4YLQH 1NRPH 4J2YB 2PGQB 2BXTH 1WBGB 2AERH 3QGJA 2AH4X 5JDUB 2PKSC 1OWJA 2THFB 2H9TH 1Q31A 2FOGA 2CHAB 4JZEH 1K1MA 3BTGE 4H6SB 3SI3H 3RMNH 1ELGA 3MHWU 2GV7A 8KME2 3RXCA 1O3HA 2FYRA 4I33A 3NK8A 3O8BA 4K8BA 5FX5A 3TJVA 1ZPZA 4GHTA 2F3CE 5EG4A 1Z1JA 3H7TA 4U30A 5DP8A 3D65E 3PLPA 1GHBF 1GDNA 1S85A 2DE9A 2W3KA 3ATMA 4NA7A 1TBZH 1GI7B 3TK6A 4MPWA 1INCA 2BY6X 4KTCA 1V2TT 2ZFPH 1LKBA 1AWFH 3BEIB 2QIQA 1QTFA 4YOJA 4IN2A 1OWKA 1HIAA 1ANCA 2TGPZ 5GCHG 4NFEA 3M37A 2FZZA 1C1PA 1WAYB 2ZDVH 5ETXA 1P8VC 3QUMP 3NKKA 3QWCH 1YLCA 2FYQA 2JETC 5T6FA 1QJ6B 3UNQA 4CBNA 3RXKA 4Y0ZE 3GCTG 1H1BA 1HAVB 3SQEE 4AN7A 5HGGA 4NFFA 3UNSA 1D3QB 1PPFE 4X6OA 3RUOA 5GIBA 5DK1A 4B74A 1IQLA 1O2MA 4YTAA 5A8ZA 1HPGA 1A4WH 1SL3A 2YNBA 2XTTB 5A09A 2G8TA 3UR9A 2XWAA 3UREA 4LZ1H 3KL6A 3SV9A 5FX6A 3A88A 2W7SA 1GMHG 1HUTH 3BTEE 3TGIE 1LVMA 3LJJA 1QHRB 1YKTA 4F4OC 5E0HA 3ATLA 1IQIA 2ANWA 2P3FH 1O2WA 1LQDB 1HAIH 4FUGA 3F9HA 1C1RA 4GVUA 4A7IB 1O3EA 1P09A 3MO6A 4IW4E 3KHVA 4A5TS 3MU5A 2QXJA 1CQQA 3LIWA 3NUMA 3DHKH 5K0HA 1KXFA 1L0ZA 3TJNA 1YPLH 4KELA 3E1XB 4ZXYH 3RXVA 1O2XA 1J15A 1Y3XA 3RMOH 1J8AA 2GTBA 4OS7A 4UFGH 1QFKH 1SVPA 1TGTA 4ISHH 4YLUA 1QB1A 1EZUC 1EPTB 1TPOA 5EW1H 1ANEA 1TABE 4E7RG 2ZTZA 1BTYA 3RLWH 1TGBA 1QL8A 5C20A 4X2YA 4HFPB 2QF3A 4CRDA 3A89A 4A1TA 2ESTE 1F0RA 4NWLA 1SSXA 3E91A 2ASUB 3ZVEA 4OS5A 1HAHH 2ZDAH 2A5KA 4NGAH 2Y7XA 1UCYK 2O8LA 2V35A 1O2KA 2C8WB 3SU1A 8LPRA 1C2HA 1K28D 3SNBA 1KSNA 1YPHE 1YYY1 2FX4A 3MMGA 1FUJA 1V6DA 4INKA 4CR5A 1K2I1 2ANYA 1FY4A 2ZA5A 4BANB 2F9NA 1P2MA 4NZQA 5DP6A 1ESTA 2EI7A 1BMMH 1FY8E 1QIXB 4KKDA 4A92A 5F6MA 1FJSA 3M3VA 1PFXC 3QN7A 1MTWA 1B0FA 4GUXA 2G4TA 2TGAA 1NTPA 4J1YA 2Z3EA 1V2UT 4MPUA 1AVGH 3HKJB 2CGAA 4I31A 4X8SH 1FONA 2XC4A 3L3TA 1F0UA 1ESBA 4Q7YA 4ZAEA 1GBEA 4K1TA 1YLDA 2NU4E 1P11E 2BLWA 2Z3DA 1P9UA 1HDTH 3V13A 2GT8A 2GZ9A 1HB0B 2B8OH 1W10U 4M7GA 1BBRK 1JIRA 4DG4A 3LOXA 1AUJA 3OY6U 1IQMA 2FM2A 1O5DH 1PPGE 5SGAE 1CSOE 2A5AA 3MNSA 3KGPA 4CH8B 2FS8A 4AFSA 2C4FH 1GI9B 1SQTA 4Y8XA 5DP5A 4O97A 3VGCC 1G3BA 4Y6DA 2PKAB 1DY8A 1L1NA 1OS8A 1MTUA 1HXFH 2GDEH 3M7TA 2PTCE 3P8OA 2VB0A 1GBKA 2TIOA 1B7XB 1HAYB 2TRMA 1GBBA 5AFZH 2QV1A 3MNBA 2CF9H 2AGGX 3GDSA 2VNTA 2BLQA 4KP0A 1AB9C 5L2ZH 2ZHFH 1CGJE 3GCOA 1RTKA 2OTVA 1GJ9B 4X2XA 1W13U 5FPSA 1SGTA 3A81A 1P10A 3PYHA 3QZRA 2VJ1A 2FODA 2ZHWH 5EOKA 1L4DA 1C5UA 1PYTD 1OP0A 3JZ1B 3VXFH 1OWIA 1NFXA 3BG4C 1XKAC 3PV4A 3QX5H 3KF2A 4A1VA 1WQSA 2ZU4A 2V3HH 7ESTE 1NZQH 1ZSLA 3GCHC 5C1YA 2WUCA 4K1EA 1KLIH 1J9CH 1WSSH 2P94A 2ZFSA 3PO1B 4WMFA 2XYAA 4X1SU 4AB8A 1QA0A 1PJPA 2WUBA 3AVZA 1SMFE 1VGCB 4I8HA 4E7NA 3RXGA 1G3CA 4RN6A 5JB8S 2STAE 3GISB 1LPGB 4MLFB 3SJ9A 1YPHC 3U1IB 2BLOA 3ZZ6A 2XBXA 5HM9A 3FANA 1FDPA 3A80A 1H8DH 5A0BA 1D4PB 1V3XA 2ZF0H 2WINI 1XXDA 1DVAH 3MU0A 2BDBA 1BTUA 2HPQH 3TK9A 5C3NA 3TH2H 3MO9A 4FUHA 2FOEA 1YM0A 2ZPQA 2HLCA 3IG6B 1GHAF 1P9SA 3EA9A 5J4SA 2OUAA 1AO5A 1P02A 3MU1A 3UOPA 4NA9H 1SG8B 2W3IA 5ESBA 2FOHA 1RGQA 1GI0A 5GCHF 1TBQH 1FAKH 4ISOA 2BQ7B 1C5XB 3BIUH 5JBBS 1XMNB 4I8LA 3NCLA 3SV6A 1ZLRA 2ZPSA 3NPSA 1C1UH 2M5TA 4X1QU 1YCPM 2GMTC 3L33A 3MU8A 1XVMA 2QXHA 3GCTF 1A7SA 2OXSA 1JRTA 1F0SA 3A7YA 2V3OH 1EUFA 3ODDA 2ZGHA 2Y81A 3FP7E 2A7HA 5FCRA 1SGQE 2CN0H 3ITIA 5L6NH 1N6YA 1GHBG 1X7AC 3RLYH 3B9FH 4VGCB 1P12E 1SHHB 1Y3YA 5DGJA 1PPBH 4AZ2B 1EB1H 1TOMH 1G2MA 3ATWA 1O2JA 3FZZA 1K1PA 1PQ5A 4GCHG 1K1LA 3K9XB 4ZKRU 3UY9A 1O33A 1NESE 3CS0A 1GMHF 1KXDA 1O3LA 5LH8A 1S82A 3ENSB 1AZZA 2UWPA 1EQ9A 1A3BH 1RIWB 4DW2U 3M7UA 3RC6A 2SGAA 1TIOA 2J9NA 3RM2H 1C1VH 2P95A 1W0ZU 1E35B 1N8OC 2BDAA 1T4VH 2GCHG 3QZQA 1O34A 3RXOA 4D7GA 1TONA 2BY8X 1G9IE 2BDYA 2TBSA 1TPSA 1GG6C 9ESTA 4HI3A 3M3SA 3UR6A 4X6NA 1V2OT 2C8ZB 1ZMJA 1FZZA 1K1NA 3Q3XA 1ELVA 1NO9H 2ZGCA 3SORA 1EB2A 1UTJA 4IBLH 3ZYEA 3NZIA 3SO3A 3U8RH 1KXCA 1P2JA 2IPHA 1ELEE 1C4Y2 1XUHA 2BOKA 4Y11E 1KTSB 5DO4H 1NY22 1O3CA 1H8IH 3SJOA 4U2WA 2ZFQH 5DKMA 2SGQE 1BTHH 4KTSA 1MKXK 3TJUA 3TH4H 2FDAA 3A84A 4ABFA 2B0FA 1Y5AT 2XW9A 1C2JA 2FOAA 3JZ2B 4X2WA 2R2MB 1QCPA 2F9UA 1TE0A 4BAHB 5EXMA 1NC6A 3AASA 1GI3A 6CHAC 1KDQA 2Y5HA 4OGYA 4YM9A 3E6PH 1A5HA 1ARBA 1HAOH 1SFQB 1MCVA 1C5RA 3OX7U 1ZJDA 3Q00A 5A0CA 2A45B 4AYYB 1QRXA 1ZTKA 1BMAA 3TLOA 1GBIA 2BVSH 1PPEE 1EP5A 1MQ5A 2HPPH 3ATKA 1QNJA 3TVJB 3B8JA 3Q77A 2ZWLH 1IAUA 4BTIB 1ETRH 4Y79A 4K5ZA 1KXBA 2IOTA 1KXEA 2G52A 4ABIA 4DIHH 2OC1A 4Q80A 4X8TH 1C2EA 2IJOB 4FVDA 2XCFA 3M36A 1P01A 3S7KB 1QBNA 1A5GH 2A2QH 1MBMA 1ACBE 1XX9A 4FUBA 5FHTA 3CENA 3OTJE 3V0XA 2J34A 1DWCH 2XRCA 3GY3A 1GCTC 5E0JA 2J38A 1KLJH 3ZV9A 3E16B 5A8XA 1AFQC 1C1TA 1HV7A 4Q7XA 1P3EA 4DY7B 1TMUH 1ELBA 1GHYH 1V2PT 5ESTE 4WWYA 1QQUA 4UFFH 2ZU3A 4DT7B 3EA8A 1WYKA 1WV7H 1QB9A 2BMGB 1V2WT 4SGBE 1W12U 1AMHA 4AG2A 2HRVA 1SLVB 3SU2A 4ZMAH 4GAWA 1O5EH 2LPRA 1H9HE 4UONA 3MNXA 3SQHE 1OWEA 1O32A 1GBJA 2Z94A 5EU8A 1OX1A 1O2LA 3NWUA 3GICB 4BOHA 3LGIA 1UHBA 1THPB 2O8UA 3V3MA 1C1NA 3BTWE 3C27B 3HK3B 3T62A 3MH6A 1UVPA 1AKSB 1D3PB 4FUCA 1GVLA 2UUFB 4WMDA 1W0YH 3F9EA 5E8EH 1QURH 1DOJA 2ZI2H 4TPIZ 1UVTH 1O2QA 3B23B 1Z1IA 1SC8U 1LDTT 2DE8A 1H9IE 3NXPA 2B7DH 4NCYA 1FY5A 1VJ9U 2FESH 3U1JB 1UK3A 1BRAA 1H4WA 2NU1E 1SGFG 2ZHQH 1HBTH 1MTNB 4CHAB 2ZP0H 3O8CA 3PMJA 1P2KA 4JZIA 4AFQA 1OP8A 1ZPBA 2A5IA 9LPRA 1FIZA 3HGNA 5HYOA 3TIUA 4B76A 2I6QA 1EXFA 1V2QT 2ZECA 1TA6A 1V2LT 2BVXH 1LPZB 4E06H 1UTNA 5LGOA 2CMYA 3SGQE 4JZFH 3ZZBA 3HATH 1TNIA 4B1TA 2P8OC 1E37B 2Q6DA 1S83A 2SGPE 2ZNKH 4FUJA 1BITA 1A0HB 3F9FA 3RXPA 1O3BA 2A32A 1ESAA 2BD8A 1ARCA 4ISLA 3GY6A 4WY3A 3UNRA 3DFJA 4DVAU 4MDSA 2G00A 3ZZ9A 1K1JA 1P04A 4JCNA 1TX7A 2BLVA 1C5SA 1HNEE 1GJ4H 1K21H 1GI5A 2F9PA 1MMJN 1MZDA 1SHYA 2BY9X 1GHXH 6LPRA 2ZCLP 1BTZA 3MWIU 4YT7H 1J14A 1UTMA 1IHTH 5DP7A 2AEIH 2WPIS 1C2DA 1JMOH 3S9AA 2ODQA 3K65B 4WH6A 1CT4E 2AMPA 2Z9GA 1GI4A 4GCHF 4GPGA 1GHAG 1GI6A 2BY5X 3KQDA 3LH1A 3UUZA 1WCZA 3TJOA 2FTMA 4ABGA 5IDKA 2PKSB 1O2IA 1S6FA 4BAKB 4KGAA 1GBAA 3M7QA 3URCA 2PR3A 3RXDA 5JPMH 5IYTA 1C1MA 4UFDH 1J17T 3AAUA 4YOGA 2C3SA 1O39A 2B5TB 1DWDH 2BVRH 2CV3A 3BSQA 2GCHF 1DWBH 1LQEA 2ZGXH 3IWMA 1P3CA 1V2JT 2C90B 5C67A 2ODYB 3DA9B 2WV4A 3GY5A 3U8OH 4ISNA 1MTVA 2JKHA 1LVYA 1O2SA 4OS4A 3RXQA 4AG1A 2VVCA 5DPAA 1FQ3A 1P0SH 3GOVB 1LVBA 3LGUA 1SGEE 1QBOA 1B5GH 1ID5H 5FAHA 4AGKA 2BX3A 2BM2A 2ZU2A 1JBUH 2WYGA 8ESTE 1ELDE 1C5YB 2TGDA 1K9OE 1FPHH 2VVUA 1TNKA 2ZDLA 4CRBA 3QGNB 1DUAA 3ELAH 3QO6A 4MG3A 1EJNA 1UCYE 1XXFA 3DFLA 1G37A 4OS2A 1UTKA 2JETB 2KAIB 3ZZDA 3T26A 1XUGA 2A31A 2AMQA 5J4QA 4FU7A 5EW2H 4AORA 1AE8H 2H9EH 2R3YA 2SGEE 1MAYA 2FOBA 5EQSA 1BIOA 4HTCH 3ZVAA 2P16A 4DOQA 1EATA 3SJIA 1SBWA 1YCPH 1O0DH 1K22H 2FX6A 1ELFA 1XVOA 1SGCA 4NWKA 3RXTA 3LGWA 1UVOA 3SOSA 1GMDG 1QL7A 2PV9B 1AU8A 3HKIB 3S7HB 1IQHA 4X2VA 2VWLA 3P6ZB 3ZVDA 2UUYA 1LHFH 3MU4A 1GBDA 2J95A 1GL0E 3SJ8A 3T2NA 3SUFA 3KNXA 3SHAH 1IQNA 3MI4A 3RXEA 1SGYE 1WTGH 2G81E 1SGDE 2BZAA 3A8DA 2UUKB 2BB4A 3KQCA 3QDZB 1Z8RA 1GBHA 1ANDA 3RXAA 3A8AA 2NU2E 1NPMA 1ZPCA 1TNJA 3LONA 1DT2A 4ABAA 1PQ7A 2FO9A 1BBRE 3TITA 1UMAH 1SGNE 2QCYA 3Q3YA 1LCYA 1UVSH 1Q3XA 1GI8B 1C9TA 1BQYA 4CRFA 3RDZA 4I32A 4MPXA 4ZKOU 1CBWC 1CHOF 1CGHA 4CRCA 1W11U 1MAXA 1YC0A 1Z6JH 1JWTA 5FCKA 1T8NA 1A2CH 1EASA 1SGFA 1CA0B 2BXUH 1CHGA 2FOCA 1TFXA 2UUJB 1ZOMA 2GCTC 1AZ8A 3M5MA 1EAXA 2VGCC 1DLEA 4MPVA 1HGTH 3ESTA 1BTPA 4BAMB 2FLBH 3STIA 1SGRE 4IC5A 2ANMH 2R0LA 2XBWA 2QAAA 1ETSH 1TLDA 1BT7A 3I77A 4ZKNU 2PHBA 2OQUA 2BDIA 1MCTA 3MH4A 3E8LA 2XCNA 4IMQA 1V2NT 1V2ST 1GGDC 4FUEA 3KEEA 3EAJA 2Z3CA 2HALA 3P17H 2PUXB 2BZ6H 1O2OA 4A6LA 1HLTH 3S9CA 1ZTJA 1N1LA 1XM1A 2ZDMA 4R0IA 2HWLB 1GBLA 5FBEA 2AGEX 3MTYA 1T8OA 1NRNH 4TY7A 5FPTA 2VVVA 1C1SA 1TGSZ 1ZYOA 2YNAA 1TMBH 5A0AE 1QGFA 2BDGA 1O3IA 5EPYA 4K2YA 2BQ6B 5GDSH 2BQWB 3QTOH 1OWDA 2ZCHP 2C8YB 3MOCA 3BTME 2XWBI 3VGCB 1FV9A 1G30B 2HVXA 3E90B 4NA8A 4XDEA 1HJAC 5CE1A 2BDHA 2A7JA 3RU4T 4NIXA 2OC7A 4Y71A 7LPRA 2RA3A 3KIDU 1P2NA 1THSH 3RXFA 1XUKA 4TY6A 1P06A 4X0WU 2PWXA 1HIAB 2ZFTA 3PM3A 3F1SB 1AB9B 3LGVA 5JBAS 1DDJA 3MNCA 1T31A 7KMEH 1SQOA 2VIQA 1O37A 1AWHB 4IMZA 5FXLA 3ATIA 1AN1E 1EZQA 2H5CA 3ZZ7A 4JK6A 3T5FH 4A1XA 2Z9JA 3F9GA 3FAOA 1TOCB 5EODA 2D2DA 4O03A 3MO3A 5E0GA 3BG4B 1GL1A 1DUEA 5JBTA 1ZJKA 2FPZA 1ZZZA 3GCHB 3A87A 1AGJA 2VH0A 5E2PA 4ASHA 1CO7E 1F2SE 1TNGA 1WQVH 2ZEBA 3P8NA 1VCPA 2A7CA 1DFPA 1TRNA 1IQGA 1CGIE 2UWOA 1OWHA 2FI4E 1NU9A 3RC5A 1S5SA 2YOLA 3SV7A 4X1RU 1MKWK 4JK5A 1GJ8B 1EJMA 1CU1A 1Y5UT 1RD3B 2XC0A 1WTHD 1O3JA 1FY3A 1JOUB 3A7TA 2FS9A 2FMJA 3AW0A 4FU9A 1BJUA 3P8FA 1D3DB 2FIRH 1CVWH 3FVFB 1QR3E 3P92A 3AAVA 4FUDA 1RS0A 2P93A 2G4UA 3PWCA 3SNCA 2VWMA 2OD3B 4GSOA 1GVKB 1TNLA 4IGDA 3T28A 2ZG0H 2FOMB 4K60A 5I25A 2FOFA 1TB6H 2FWWA 5AF9H 1OYQA 1G32B 1ZMLA 4UD9H 2GMTB 4ZHMU 1GBMA 3VXEH 4MQAA 1W14U 5C5NA 4DURA 1MH0A 5DJ7A 2D26C 2NWNA 1SLUB 5AHGH 2ZC9H 1A46H 2VIVA 1ABJH 3SI4H 1C5TA 1NU7B 1H9LB 1YPGH 3OY5U 1N6XA 4TYDA 1GMDF 2AGIX 2H2ZA 2GT7A 2VU8E 3EE0B 4B2CA 1QA7A 4FUIA 5TCAA 1OPHB 1QB6A 1K1OA 1UTPA 3U8TH 5B6OA 2VINA 4XFQA 1WU1A 2XC5A 2J2UA 1OOKB 3ZZ8A 2BX4A 1QY6A 3EYDA 2O8TA 3ZZCA 3UPEA 4Q2KA 1GDUA 1TX6A 4CR9A 1N8OB 2GDDA 5EGMA 1GI2A 3LT3A 2H6MA 1HFDA 1GPZA 3ZVFA 5CHAB 4XBBA 4QT8C 2Y7ZA 4RKOB 1P57B 1TAWA 3OYPA 1GG6B 3BTFE 3LC5A 3W95A 5GWZA 1BHXB 1DPOA 1T8MA 2G5NA 2UWLA 4X8UH 2CXVA 1O2RA
chains in the Genus database with same CATH superfamily
3VB5A 3MH7A 1HAVA 5H4IB 1CA8B 2GV6A 2JDID 1Z8GA 2LNCA 4YZUA 3URDA 5B6LA 3GCNA 2AS9A 1LVOA 2OC8A 1OP2A 2JH0D 3N99A 3LJOA 3BF6H 3A86A 1PYTC 5T6DA 1G36A 2F9BH 3HPTB 3VB7A 7GCHF 4ZCNA 3SBKA 2W26A 1KIGH 5K7RA 2SGDE 4NG9H 5EQQA 1T7CA 1TWXB 2A4RA 4THNH 4RKJB 3ZYDA 1TPPA 4INLA 1Z8IB 2VIPA 2H1UA 4OGXA 2XNIA 5EJLA 5C1XA 1SGPE 2QYIA 1FAXA 4O3UA 2Q6FA 3E0NB 5GPIB 6CHAB 1LHCH 2AIPA 3RXSA 3BTHE 3SGAE 2BD4A 5EJZA 1CHOG 2OQ5A 1JXPA 1NS3A 1L1JA 1DY9A 1AY6H 1GJAB 4D7FA 2AHME 2PSYA 3SJKA 2Z9LA 3RP2A 4XE4A 1O5AB 2QXGA 4DIIH 4U32A 2QGRA 5L2YH 3VEQB 1EPTA 4LK4A 4RSPA 1F5LA 3U69H 1C5ZB 1SPJA 1OXGA 1NFUA 4HZHA 1VJAU 2D1JA 3GY4A 3KQBA 5GXPA 3TK5A 1L2EA 1CT0E 1GJ6A 1HAXB 2CJIA 1GBFA 2C93B 4H6TA 1DLKB 4Y8YA 3PTNA 2FEQH 2W7UA 1C5PA 3I78A 3TNSA 1NT1A 3A8BA 1XUJA 4Q7ZA 3SZEA 2A2XH 2D8WA 1W3CA 1BUIA 1MUEB 1VCQA 3M61U 5EXNA 1GWAA 4NIVA 2J5UA 1YWUA 4BXWA 1GCTB 2OC0A 2OINA 3GDUA 1O2NA 4AFZA 2J92A 1E0FD 2F9OA 2FI3E 1AFQB 2J4IA 1D9IA 5FBIA 5F53A 2HOBA 4NZLA 1MD7A 5JBCS 3M5LA 3BIVH 3M5OA 4ACBA 4MVNA 3PB1E 4O9VA 1HAZB 1C5LH 3RXLA 3R0FA 5A8YA 1L1GA 2WYJA 2ZGJA 3V12A 5ABWA 1DM4B 1Y3VA 1UTOA 4UE7H 4ZUHA 3ZIAD 1HAPH 2A4GA 2PFEA 1ELAA 2QXIA 2OBQA 1VITG 5C1UA 1LTOA 1D3TB 1BB0B 2CHAC 1T4UH 1TYNA 2GGVB 5F8XA 8GCHG 1A3EH 3SU6A 2F9VA 1F92A 2XBVA 1W8BH 1O5CB 1AUTC 4DJZB 1O5FH 4B75A 4B2BA 2A1DB 2V0BA 1Y8TA 2WHXA 2RDEA 4IS5A 5TJXA 3TU7H 4ESTE 1QBVH 3E0PB 1GJDB 2FTLE 3W94A 1MABB 4D9RA 1ZRBA 5HM2A 1LHEH 2PKAA 3K2UA 3C1KA 4MNXA 1GJ5H 1OYTH 4XBCA 4XOJA 1AVWA 5HMAA 2GKVE 1TPAE 3OE7D 2WPMS 1TGCA 3SUDA 3SNAA 3EGKH 1NROH 3RXBA 1P2OA 2O8MA 1TA2A 2ANKH 4X6MA 1P2IA 2OP9A 2WPHS 1DS2E 1FN8A 1VZQH 2PLXA 1SI5H 3RMMH 1NRRH 1MTSA 2P8OB 5DP9A 2Z7FE 3FP8E 1MD8A 4UEHH 4E05H 2A0QB 4JYUH 1NN6A 3SW2B 2XBYA 3VPKA 1GI1A 2ZGBH 2R2WU 2QF0A 3UWIA 1AI8H 1FXYA 1SLWB 4P00A 4WXVA 5EJ1A 2PW8H 5PTPA 1SOZA 2AMDA 2P59A 4FU8A 3Q76A 1MU6B 3PMHB 2ZCKP 1ZR0A 1ELTA 1SR5C 4ZH8A 1O2GH 1LMWB 1O3PB 4MNWA 3UIRA 3KQEA 1ZTLA 4ABHA 1ZHRA 3ZZAA 4X1NU 1YCPK 3HK6B 1ZHPA 2AIQA 1Z71A 1RTLA 3GDVA 1Y3WA 3SHCH 4JZDH 2BD7A 2GVFA 2ZHDA 2ZU1A 1SLXB 2LELA 3PV2A 2Q1JA 3A82A 1QL9A 1KDQB 1EZSC 3M35A 2F91A 1O30A 3TNTA 4BTTB 3A85A 1G3DA 2BYAX 5AFYH 3LU9B 1BRUP 3EDXB 1C1WH 3L6PA 3PLKA 3E3TA 1D6RA 4LXBH 2BY7X 1ELCA 2Y6TA 4BTUB 1P2QA 1EPTC 1DXWA 2ZU5A 1BMNH 2C8XB 3DCLA 4Z6AH 1MZAA 1NFWA 2AYWA 2ZIQH 5LPFA 2CK3D 4Y10E 2GX4A 3RU4D 5BPEA 1YPKH 3PV5A 1Y5BT 1J16A 3TGKE 1W2KH 4CRGA 4K1SA 2G55A 4TT3D 3GYLB 4AGJA 1WOFA 2ALPA 1DITH 1LHDH 3D62A 1E34B 3S69A 1BTXA 3P8GA 4AC9A 1B0EA 1EOJA 2NU0E 1NRQH 1IQJA 2FP7B 2VWOA 3SU3A 1UK4A 2RFKC 4K3JA 2P3UB 1BRBE 3O8RA 3AW1A 1BA8B 3R3GB 4Y7AA 4ZXXH 3SNEA 2ALVA 3ZVGA 3WY8A 4ABDA 3N7EA 3QLPH 6ESTA 2QY0B 1V2RT 1EJAA 5EQRA 2BD2A 2ZHEH 3RXMA 3T27A 4YT6H 4BNRA 2CF8H 4AB9A 1FI8A 3F6UH 2ZTYA 5L30H 2HLDD 1E36B 4LZ4B 2V6NA 1O5BB 3MFJA 3RXUA 4B6EA 1SFIA 2SNWA 3TH3H 1YPMH 1CA0C 1TRYA 1C1OA 1MQ6A 3OSYA 2GD4B 4CRAA 4JZ1A 5TCCA 1C4U2 1GVZA 2GZ8A 2ZZUH 1TX8A 2JH5D 1FIWA 1QQ4A 1D6WA 1UHBB 3A7XA 1TNHA 3P95A 2R3UA 2Z9KA 1FMGA 2O9QA 5DP4A 3SU0A 4KTUA 1G2LA 2WPKS 3VB3A 1ZSJA 4IC6A 3RU4E 2IN2A 1W7GH 3ODFA 4ZKSU 1O2TA 1SQAA 3T29A 1GCDA 4F49A 2QA9E 3QK1A 4WMEA 7GCHG 1C5NH 3K6YA 5LPEA 1YGCH 1KXAA 1Z6EA 1KY9A 4TPYA 1M9UA 3RM0H 1WUNH 4Y76A 1GMCG 1ZGIA 1AVXA 3LH3A 1SB1H 2SNVA 1RTFB 3QTVH 4ISIH 4YOIA 1FNIA 1SGIB 3IITA 1O35A 3DUXH 1IQKA 1UCYH 1C2MA 3O8DA 3OU0A 1IQFA 3U98H 2VH6A 1CBWB 3MQKC 5DP3A 1EP6A 1O2ZA 3RC4A 3SU5A 1BRCE 1PQ8A 1Y3UA 5DG6A 3WW7A 5F03A 3K6ZA 1FN6A 3EA7A 3F0OA 4B73A 2GCTB 4DGJA 3VB6A 1V2KT 1F0TA 2BD3A 4BXSA 2VGCB 2HNTE 1EAIA 2Y5FA 1A0JA 2A4QA 5AVDA 4I8GA 2K0QA 3ZV8A 1PQAA 3MYWA 1DSUA 1EZXC 1QJ1B 1Z8JB 4PROA 3CP7A 4GHQA 2HNTF 4NIWA 5FPYA 4AYVB 1C5WB 2BD9A 2H5DA 2SFAA 3PO1C 1VITF 3BTQE 6GCHF 3GY8A 1ANBA 4OS1A 1VGCC 8GCHF 2F83A 1GHWH 3VFEA 1AD8H 3FFGA 1HJ8A 3LDXH 2ULLA 3A7VA 4I8KA 1GGDB 2ILNA 4OM9A 3A7ZA 1EKBB 3Q3KA 2OLGA 5C0UA 2NU3E 2ZDNA 3P70B 2STBE 2SGFE 4YESB 1RXPA 4BAOB 3GY2A 1BBRH 1ZSKA 3RXJA 2Z9IA 4K8YA 3SGBE 1TMTH 2AFQB 3H7OA 1O3KA 1ZMNA 2BDCA 1PPHE 1O3OA 4ZHAA 1MU8B 1O3NA 2RDLA 2I6SA 2Y82A 1AIXH 5C5OA 4CH2B 3ZVBA 3FOAA 1KTTB 4B71A 2WPDD 1BHXF 4Y0YE 3A7WA 3F68H 1O3DA 1C1QA 1S81A 3M3TA 3I29A 3BG8A 2H9HA 4ABEA 1THRH 1O2HA 3BV9B 1WXRA 1L4ZA 1HJAB 1HRTH 4WH8A 4B2AA 2TPIZ 2WPLS 3BTKE 2HGTH 4O3TA 4CREA 2FLRH 1EX3A 1C5OH 4MNVA 1O2PA 4FXGH 3G01A 3D23A 3PMAB 3VB4A 4TWYA 1RFNA 2A4OA 1DSTA 1C2LA 4VGCC 1LO6A 3PMBB 3LKWA 5I46H 1ZGVA 1XUFA 3H5CB 4DCDA 1AKSA 3HGPA 4ZROA 1XUIA 1VCWA 1BZXE 3SV2H 2K1QA 3KQ5A 3KN2A 3FO8D 1DICA 3DD2H 1RIWC 3STJA 1IQEA 4K69A 3NRLA 1C2GA 2EI6A 3DSPA 3SZNA 2P3TB 2J94A 4X6PA 1AE5A 4D8NA 4FUFA 1VITH 1E38B 1EOLA 3RXRA 3M5NA 1HAGE 4AOQA 1DE7H 1HCGA 1GDQA 1O3GA 4I7YH 3PWBA 2BHGA 3SN8A 1QRZA 1T32A 5JYIA 3ZZ4A 1BTWA 4BAQB 5C2ZA 4YO9A 2HNTC 1MBQA 1C5QA 3UWJH 2YMSB 3FP6E 1Z7KA 1UVUH 4Y8ZA 1UTLM 1FY1A 4INHA 1C2IA 1Y59T 1C4V2 2ZTXA 1QJ7B 2EQNA 3D49H 1NRSH 3PLBA 1CE5A 1A1RA 3UFAA 1YF4A 2KCOA 3BEUA 1JRSA 3S9BA 1O38A 1O5GH 1MKWH 1GHZA 1ETTH 1DXPA 5CHAC 3BTTE 1P03A 1KYNA 4JMYA 3PROA 1V2VT 5T1VA 2G5VA 3GYMA 3LC3A 1RJXB 3ZVCA 1NM6A 2FXRA 2BD5A 3UQOA 1S6HA 2Q6GA 1K0HA 1S84A 1PPZA 3MH5A 3FZDA 1A0LA 1YPEH 2XXLA 4H42U 4MTBA 3UOUA 2RG3A 2RA0A 5T3HA 5KGOA 4LOYH 2L6OA 1O3FA 1BOQA 1UJ1A 2K8IA 4D76A 3PTBA 4Y7BA 2W5EA 5T6GA 1EAUA 1F5KU 1GHVH 2WV5A 1TBRH 3DSOA 3LPRA 4X1PU 3SUEA 4WXIA 5E2OA 4FOUC 1HYLA 4HGCA 3TGJE 2VWNA 5F8ZA 1FPCH 1OSSA 3RMLH 2ZO3H 3UB0A 1PPCE 4R8TB 1W7XH 1S0RA 2XOKD 3SU4A 2JH6D 1LHGH 1P05A 1F5RA 2GZ7A 1YP9A 1GJBB 1T8LA 4WF8A 4WVPE 4DT4A 4AX9H 1C2FA 1GMCF 2WPJS 1BJVA 3KCGH 3W1EA 2ZFRH 1C9PA 2Z6BD 1C5MD 5G4BA 5LPRA 1O2UA 4H4FA 1SOTA 1DWEH 2KAIA 2EEKA 1GJ7B 4SGAE 1IHSH 4UFEH 1IOEA 1UK2A 1EAWA 2EA3A 1QRWA 1CT2E 5JB9S 1MKXH 1JIMA 2J98A 1NFYA 1RRKA 3ZZ3A 1BCUH 1GBCA 5EXLA 1TGNA 5BRRE 3AK5A 2BOHB 3SUGA 2FI5E 3SNDA 2OCVB 2Y5GA 3N7OA 2ZQ2A 1GJCB 5A2MH 3EQ0H 4NSYA 4Q4LA 1AQ7A 2OK5A 1DX5M 1UO6A 5KEDA 3RXIA 2RCEA 1AHTH 1O2VA 2V7QD 2ZKSA 4JYTA 2PGBB 2B9LA 5HXFA 4ZHLU 2OBOA 2R0KA 5CMXH 3A8CA 1ZHMA 1LKAA 2VIDA 2G51A 1HJ9A 1LPKB 1U6QA 4TWWA 1VKYA 1VR1H 1AFEH 1ABIH 1C2KA 3BTDE 1MTNC 4CHAC 1OKXA 2GP9B 4OS6A 1BDAA 2ODPA 1HXEH 1Q2WA 2IJD1 1DANH 1TQ0B 1XKBC 2EC9H 3DT0H 3RXHA 1KLTA 3ZZ5A 5IK2D 4AFUA 4XBDA 2VIWA 3LGTA 3UQVA 1K1IA 2ZPRA 4IN1A 2QC2A 1O3AA 1O3MA 2R9PA 3GY7A 3LGYA 4ABJA 4ABBA 3V7TA 4I8JA 1F7ZA 1UTQA 4WJG2 2DUCA 3TPIZ 4FVBA 2TGTA 1YBWA 3U9AH 5HIZA 4MNYA 4X8VH 1O2YA 4Z0KA 3BEFB 3T25A 5F8TA 1TQ7B 4GLYA 4JYVH 1A61H 1YPJH 1C5VA 6GCHG 4CBOA 4D9QA 4F55A 3BN9A 3S0NA 2Y80A 4U01A 4HG6A 2VIOA 5GJ4B 1G3EA 2QN5T 2ZDKA 2ZQ1A 3UTUH 4XSKU 1S0QA 4UDWH 1TRMA 1ORFA 2BTCE 4NSVA 2ZFFH 1V2MT 1TALA 2O8WA 2PUQH 3A83A 1A5IA 1O36A 1GBTA 1O31A 4NIYA 5HKKD 3CS7A 2EI8A 3UAIC 2PTNA 2PSXA 1FLEE 1BMLA 3SV8A 5EPNA 1ZRKA 4YLQH 5DSFA 1NRPH 2JJ2D 4J2YB 2PGQB 2BXTH 1WBGB 2AERH 3QGJA 2AH4X 5JDUB 2PKSC 3WWBA 1OWJA 2THFB 2H9TH 1Q31A 2FOGA 2CHAB 4JZEH 1K1MA 3BTGE 4H6SB 3SI3H 3RMNH 1ELGA 3MHWU 2GV7A 3DSGA 8KME2 3RXCA 1O3HA 2FYRA 4I33A 3NK8A 3O8BA 4K8BA 5FX5A 3TJVA 1ZPZA 4GHTA 2F3CE 5EG4A 1Z1JA 3H7TA 4U30A 5DP8A 3D65E 3PLPA 1GHBF 4ASUD 1GDNA 1S85A 2DE9A 2W3KA 3ATMA 4NA7A 1TBZH 1GI7B 3TK6A 4MPWA 1INCA 2BY6X 4KTCA 1V2TT 2ZFPH 1LKBA 1AWFH 3BEIB 2QIQA 1QTFA 4YOJA 4IN2A 1OWKA 1HIAA 1ANCA 2TGPZ 5GCHG 4NFEA 3CNRA 3M37A 2FZZA 1C1PA 1WAYB 2ZDVH 5ETXA 2V3MA 1P8VC 3QUMP 3NKKA 3QWCH 1YLCA 2FYQA 2JETC 5T6FA 1QJ6B 3UNQA 4CBNA 3RXKA 4Y0ZE 3GCTG 3PRDA 1H1BA 1HAVB 3SQEE 4AN7A 5HGGA 4NFFA 3UNSA 1D3QB 1PPFE 3F3BA 4X6OA 3RUOA 5GIBA 5DK1A 4B74A 1IQLA 1O2MA 2QF5A 4YTAA 5A8ZA 3KYGA 1HPGA 1A4WH 1SL3A 2YNBA 2XTTB 5A09A 2G8TA 3UR9A 2XWAA 3UREA 2KFWA 4LZ1H 3KL6A 3SV9A 5FX6A 5CHBA 3A88A 2W7SA 1GMHG 1HUTH 3BTEE 3TGIE 2KX4A 1LVMA 3LJJA 1QHRB 1YKTA 4F4OC 5E0HA 3ATLA 1IQIA 2ANWA 2P3FH 1O2WA 1LQDB 1HAIH 4FUGA 3F9HA 1C1RA 5C17A 4GVUA 4A7IB 1O3EA 1P09A 3MO6A 4IW4E 3KHVA 4A5TS 3MU5A 2QXJA 1CQQA 3LIWA 3NUMA 3DHKH 5K0HA 1KXFA 1L0ZA 3TJNA 1YPLH 4KELA 3E1XB 4ZXYH 3RXVA 1O2XA 1J15A 1Y3XA 3RMOH 1J8AA 2GTBA 4OS7A 4UFGH 1QFKH 1SVPA 1TGTA 4ISHH 4YLUA 1QB1A 1EZUC 1EPTB 1TPOA 5EW1H 1ANEA 1TABE 4E7RG 2ZTZA 1BTYA 3RLWH 1TGBA 1QL8A 2YMSD 4X2YA 5C20A 4HFPB 2QF3A 4CRDA 3A89A 4A1TA 2ESTE 1F0RA 4NWLA 1SSXA 3E91A 2ASUB 3ZVEA 4OS5A 1HAHH 2KZ4A 2ZDAH 2A5KA 4NGAH 2Y7XA 1UCYK 2O8LA 1NBMD 1O2KA 2C8WB 2V35A 3SU1A 8LPRA 1C2HA 1K28D 3SNBA 1KSNA 1YPHE 1YYY1 2FX4A 3MMGA 1FUJA 1V6DA 4INKA 4CR5A 1K2I1 2ANYA 1FY4A 2ZA5A 4BANB 2F9NA 1P2MA 4NZQA 5DP6A 1ESTA 1H8HD 2EI7A 1BMMH 1FY8E 1QIXB 4KKDA 4A92A 5F6MA 1FJSA 3M3VA 1PFXC 3QN7A 1MTWA 1B0FA 4GUXA 2G4TA 2TGAA 1NTPA 1YY3A 4J1YA 2Z3EA 1V2UT 4MPUA 1AVGH 3HKJB 2CGAA 4I31A 4X8SH 1FONA 2XC4A 3L3TA 1F0UA 1ESBA 4Q7YA 4ZAEA 1GBEA 4K1TA 1YLDA 2NU4E 1P11E 2BLWA 2EY4C 2Z3DA 1P9UA 1HDTH 3V13A 2GT8A 2GZ9A 1HB0B 2B8OH 1W10U 4M7GA 1BBRK 1JIRA 4DG4A 3LOXA 1AUJA 3OY6U 1IQMA 2FM2A 1O5DH 1PPGE 5SGAE 1CSOE 2A5AA 3MNSA 3KGPA 4CH8B 2FS8A 4AFSA 2C4FH 1GI9B 1SQTA 4Y8XA 5DP5A 2JJ1D 4O97A 3VGCC 3OEED 1G3BA 4Y6DA 2PKAB 1DY8A 1L1NA 1OS8A 1MTUA 1HXFH 2GDEH 3M7TA 2PTCE 3P8OA 2VB0A 1GBKA 2TIOA 1B7XB 1HAYB 2TRMA 1GBBA 5AFZH 2QV1A 4XRNA 3MNBA 2CF9H 2AGGX 3GDSA 2VNTA 2BLQA 4KP0A 1AB9C 5L2ZH 2ZHFH 1CGJE 3GCOA 1RTKA 2OTVA 1GJ9B 4X2XA 1W13U 5FPSA 1SGTA 3A81A 1P10A 3PYHA 3OAAD 3QZRA 2VJ1A 2FODA 2ZHWH 5EOKA 1L4DA 4XD7D 1C5UA 1PYTD 1OP0A 3JZ1B 3VXFH 1OWIA 1NFXA 3BG4C 1XKAC 3PV4A 3QX5H 3KF2A 4A1VA 1WQSA 2ZU4A 2V3HH 7ESTE 1NZQH 1ZSLA 3GCHC 2W6JD 5C1YA 2GJGA 2WUCA 4K1EA 1KLIH 5GNDA 1J9CH 1WSSH 2P94A 2ZFSA 3PO1B 4WMFA 2XYAA 4X1SU 4AB8A 1QA0A 1PJPA 2WUBA 3AVZA 1SMFE 1VGCB 4I8HA 4E7NA 3RXGA 1G3CA 4RN6A 5JB8S 2STAE 3GISB 1LPGB 4MLFB 3SJ9A 1YPHC 3U1IB 2BLOA 3ZZ6A 2XBXA 5HM9A 3FANA 1FDPA 3A80A 1H8DH 5A0BA 1D4PB 1V3XA 2ZF0H 2WINI 1XXDA 1DVAH 3MU0A 2BDBA 1BTUA 2HPQH 3TK9A 5C3NA 3TH2H 3MO9A 4FUHA 5DN6D 2FOEA 1YM0A 2ZPQA 2HLCA 3IG6B 2QF4A 1E1QD 1GHAF 1P9SA 3EA9A 2OUAA 1AO5A 1P02A 3MU1A 3UOPA 5J4SA 4NA9H 1SG8B 2W3IA 5ESBA 1E1RD 2FOHA 1RGQA 1GI0A 5GCHF 1TBQH 1FAKH 4ISOA 2BQ7B 1C5XB 3BIUH 5JBBS 1XMNB 4I8LA 3NCLA 3SV6A 1ZLRA 2ZPSA 3NPSA 1C1UH 1UW7A 2M5TA 4X1QU 1YCPM 2GMTC 3L33A 3MU8A 1XVMA 2QXHA 2YMSC 1A7SA 3GCTF 2OXSA 1JRTA 1F0SA 3A7YA 2V3OH 1EUFA 2JIZD 3ODDA 2ZGHA 2Y81A 3FP7E 2A7HA 5FCRA 1SGQE 4RT0A 2CN0H 2F4LA 3ITIA 5L6NH 1N6YA 1GHBG 1X7AC 3RLYH 3B9FH 4VGCB 1P12E 1SHHB 1Y3YA 5DGJA 1PPBH 4AZ2B 1EB1H 1TOMH 1G2MA 3ATWA 1O2JA 3FZZA 1K1PA 1PQ5A 4GCHG 1K1LA 3K9XB 4ZKRU 3UY9A 1O33A 1NESE 3CS0A 1GMHF 1KXDA 2LP6A 1O3LA 3OEHD 5LH8A 1S82A 3ENSB 1AZZA 2UWPA 5FL7D 1EQ9A 1A3BH 1RIWB 4DW2U 3M7UA 3RC6A 2SGAA 1TIOA 2J9NA 3RM2H 1C1VH 2P95A 1W0ZU 1E35B 1N8OC 4RT1A 2BDAA 1T4VH 2GCHG 3QZQA 1O34A 3RXOA 4D7GA 1TONA 2BY8X 1G9IE 1W0KD 2BDYA 2TBSA 1TPSA 1GG6C 9ESTA 4HI3A 3M3SA 3UR6A 4X6NA 1V2OT 2C8ZB 1ZMJA 1FZZA 1K1NA 3Q3XA 1ELVA 1NO9H 2ZGCA 3SORA 1EB2A 2L74A 1UTJA 4IBLH 3ZYEA 3NZIA 3SO3A 3U8RH 1KXCA 1P2JA 2IPHA 1ELEE 1C4Y2 1XUHA 2BOKA 4Y11E 1KTSB 5DO4H 1NY22 1O3CA 1H8IH 3SJOA 4U2WA 5KECA 2ZFQH 5DKMA 2SGQE 1BTHH 4KTSA 1MKXK 3TJUA 3TH4H 2FDAA 3A84A 2M2AA 4ABFA 2B0FA 1Y5AT 2XW9A 1C2JA 4I86A 2FOAA 3JZ2B 4X2WA 2R2MB 1QCPA 2F9UA 1TE0A 4BAHB 5EXMA 2KR7A 1NC6A 3AASA 1GI3A 6CHAC 1KDQA 2Y5HA 4OGYA 4YM9A 3E6PH 1A5HA 1ARBA 1HAOH 1SFQB 1MCVA 1C5RA 3OX7U 1ZJDA 3Q00A 5A0CA 2A45B 4AYYB 1QRXA 1ZTKA 1BMAA 3TLOA 1GBIA 2BVSH 1PPEE 1EP5A 1MQ5A 2HPPH 3ATKA 3F2GA 1QNJA 3TVJB 3B8JA 3Q77A 2ZWLH 1IAUA 4BTIB 1ETRH 4Y79A 4K5ZA 1KXBA 2IOTA 2J97A 1KXEA 2WV9A 2G52A 4ABIA 4DIHH 2OC1A 4Q80A 4X8TH 1C2EA 2IJOB 4FVDA 2XCFA 3M36A 1P01A 3S7KB 1QBNA 1A5GH 2A2QH 1MBMA 1ACBE 1XX9A 1SKYE 4FETA 4FUBA 5FHTA 3CENA 3OTJE 3V0XA 2J34A 1DWCH 2XRCA 3GY3A 4Z1MD 1GCTC 5E0JA 2J38A 1KLJH 3ZV9A 3E16B 5A8XA 1AFQC 1C1TA 1HV7A 4Q7XA 1P3EA 1H8ED 4DY7B 1TMUH 1ELBA 1GHYH 1V2PT 5ESTE 4WWYA 1QQUA 4UFFH 2ZU3A 4DT7B 3EA8A 1WYKA 1WV7H 1QB9A 2BMGB 1V2WT 4SGBE 1W12U 1AMHA 4AG2A 2HRVA 3FKSD 1SLVB 3SU2A 4ZMAH 4GAWA 1O5EH 2LPRA 1H9HE 4UONA 3MNXA 3SQHE 1OWEA 1O32A 1GBJA 2Z94A 5EU8A 1OHHD 1OX1A 1O2LA 3NWUA 3GICB 4BOHA 3LGIA 1UHBA 1THPB 2O8UA 3V3MA 1C1NA 3BTWE 3C27B 3HK3B 3T62A 3MH6A 1UVPA 1AKSB 1D3PB 4FUCA 1E79D 1GVLA 2UUFB 4WMDA 1W0YH 3F9EA 5E8EH 1QURH 1DOJA 2ZI2H 4TPIZ 1UVTH 1O2QA 3B23B 1Z1IA 1SC8U 1LDTT 2DE8A 1H9IE 3NXPA 2B7DH 4NCYA 1FY5A 1VJ9U 2FESH 3U1JB 1UK3A 1BRAA 1H4WA 2KM0A 1SGFG 2NU1E 2ZHQH 1HBTH 1MTNB 4CHAB 2ZP0H 3O8CA 3PMJA 1P2KA 4JZIA 4AFQA 1OP8A 1ZPBA 2A5IA 9LPRA 5C94A 1FIZA 3HGNA 5HYOA 3TIUA 4B76A 2I6QA 1EXFA 3SYJA 1V2QT 2ZECA 1TA6A 1V2LT 2BVXH 1LPZB 4E06H 1UTNA 5LGOA 2CMYA 3SGQE 4JZFH 3ZZBA 3HATH 1TNIA 4YXWD 4B1TA 2P8OC 1E37B 2Q6DA 2KCYA 1S83A 2SGPE 2ZNKH 4FUJA 1BITA 4M9FA 1A0HB 3F9FA 3RXPA 1O3BA 2A32A 1ESAA 2BD8A 3OTPA 1ARCA 4ISLA 3GY6A 4WY3A 3UNRA 1EFRD 3DFJA 4DVAU 4MDSA 2G00A 3ZZ9A 5CDFE 1K1JA 1P04A 5C0TA 4JCNA 1TX7A 3F0PA 2BLVA 1C5SA 3FN8A 1HNEE 1GJ4H 1K21H 1GI5A 2F9PA 1MMJN 1MZDA 1SHYA 2BY9X 1GHXH 6LPRA 2ZCLP 1BTZA 3MWIU 4YT7H 1J14A 1UTMA 1IHTH 5DP7A 2AEIH 2WPIS 1C2DA 1JMOH 3S9AA 2ODQA 2QE7D 3K65B 4WH6A 1CT4E 2AMPA 2Z9GA 1GI4A 4GCHF 4GPGA 1GHAG 1GI6A 2BY5X 3KQDA 3LH1A 3UUZA 1WCZA 3TJOA 2FTMA 4ABGA 5IDKA 2PKSB 1O2IA 1S6FA 4B6FA 4BAKB 4KGAA 1GBAA 3M7QA 3URCA 2PR3A 3RXDA 5JPMH 5IYTA 1C1MA 4UFDH 1J17T 3AAUA 4YOGA 3N7DA 2C3SA 1O39A 2B5TB 1DWDH 2BVRH 2CV3A 3BSQA 2GCHF 1DWBH 1LQEA 2ZGXH 3IWMA 1P3CA 1V2JT 2C90B 5C67A 2ODYB 3DA9B 2WV4A 3GY5A 3U8OH 4ISNA 2WZQA 1MTVA 2JKHA 1LVYA 1O2SA 4OS4A 3RXQA 4AG1A 2VVCA 5DPAA 1FQ3A 1P0SH 3GOVB 1LVBA 3LGUA 1SGEE 1QBOA 1B5GH 1ID5H 1S6LA 4AGKA 5FAHA 2BX3A 2BM2A 2ZU2A 1JBUH 2WYGA 8ESTE 1ELDE 2W6ID 1C5YB 2TGDA 1K9OE 1FPHH 2VVUA 1TNKA 2ZDLA 4CRBA 3QGNB 1DUAA 3ELAH 3QO6A 4MG3A 1EJNA 1UCYE 1XXFA 3DFLA 1G37A 4OS2A 1UTKA 2JETB 2KAIB 3ZZDA 3T26A 1XUGA 2A31A 2AMQA 5J4QA 4FU7A 5EW2H 4AORA 1AE8H 2H9EH 2R3YA 2SGEE 1MAYA 2FOBA 5EQSA 1BIOA 2J98B 4HTCH 3ZVAA 2P16A 4DOQA 1EATA 3SJIA 1SBWA 1YCPH 1O0DH 1K22H 2FX6A 1ELFA 4TSFD 1XVOA 3F2HA 1SGCA 4NWKA 3RXTA 3LGWA 1UVOA 3SOSA 1GMDG 1QL7A 2PV9B 1AU8A 3HKIB 3S7HB 1IQHA 4X2VA 2VWLA 3P6ZB 3ZVDA 2UUYA 1LHFH 3MU4A 1GBDA 2J95A 1GL0E 3SJ8A 3T2NA 3SUFA 3KNXA 3SHAH 1IQNA 3MI4A 3RXEA 1SGYE 1WTGH 2G81E 1SGDE 2BZAA 3A8DA 2UUKB 2BB4A 3KQCA 3QDZB 1Z8RA 1GBHA 1ANDA 3RXAA 3A8AA 5HIYA 2NU2E 1NPMA 1ZPCA 1TNJA 3LONA 1DT2A 4RI0A 4ABAA 1PQ7A 2FO9A 1BBRE 3TITA 1UMAH 1SGNE 2QCYA 3Q3YA 1LCYA 1UVSH 1Q3XA 1GI8B 1C9TA 1BQYA 2VBCA 4CRFA 3RDZA 4I32A 4MPXA 4ZKOU 1CBWC 1CHOF 1CGHA 4CRCA 1W11U 1MAXA 1YC0A 1Z6JH 1JWTA 5FCKA 1T8NA 1A2CH 1EASA 1SGFA 1CA0B 2BXUH 1CHGA 2HVYB 2FOCA 1TFXA 2UUJB 1ZOMA 2GCTC 1AZ8A 3M5MA 1EAXA 2VGCC 1DLEA 4MPVA 1HGTH 3ESTA 1BTPA 4BAMB 2FLBH 3STIA 1SGRE 4F48B 4IC5A 1NBME 2ANMH 2R0LA 2XBWA 4ACAA 2QAAA 1ETSH 1TLDA 1BT7A 3I77A 4ZKNU 2PHBA 2OQUA 2BDIA 1MCTA 3MH4A 3H09A 3E8LA 2XCNA 4IMQA 1V2NT 1V2ST 1GGDC 4FUEA 1KMHB 3KEEA 3EAJA 2Z3CA 2HALA 3P17H 2PUXB 2BZ6H 1O2OA 4A6LA 1HLTH 1QZ8A 1SQRA 3S9CA 1ZTJA 1N1LA 1XM1A 2ZDMA 4R0IA 2HWLB 1GBLA 5FBEA 2AGEX 3MTYA 1T8OA 1NRNH 2KCPA 4TY7A 2VVVA 1C1SA 1TGSZ 1ZYOA 5FPTA 2YNAA 1TMBH 5A0AE 1QGFA 2BDGA 1O3IA 5EPYA 4K2YA 2BQ6B 5GDSH 2BQWB 3QTOH 1OWDA 2ZCHP 2C8YB 3MOCA 3BTME 1BMFD 2XWBI 3VGCB 1FV9A 1G30B 2HVXA 3E90B 4NA8A 4XDEA 1HJAC 5CE1A 2BDHA 2A7JA 3RU4T 5EIYA 4NIXA 2OC7A 4Y71A 7LPRA 2RA3A 3KIDU 1P2NA 1THSH 2KCAA 3RXFA 1XUKA 1YLNA 3PRBA 4TY6A 1P06A 4X0WU 2PWXA 1HIAB 2ZFTA 3PM3A 3F1SB 1AB9B 3LGVA 5JBAS 1DDJA 3MNCA 1T31A 7KMEH 1SQOA 2VIQA 1O37A 1AWHB 4IMZA 5FXLA 3ATIA 1AN1E 1EZQA 2H5CA 3WWFA 3ZZ7A 4P02A 4JK6A 3T5FH 4A1XA 2Z9JA 3F9GA 3FAOA 1TOCB 5EODA 2D2DA 4O03A 3MO3A 5E0GA 3BG4B 1GL1A 1DUEA 5JBTA 1ZJKA 2FPZA 1ZZZA 3GCHB 3VG8A 3A87A 1AGJA 2VH0A 5E2PA 4ASHA 2IPQX 1CO7E 1F2SE 1TNGA 1WQVH 2ZEBA 3P8NA 1VCPA 2A7CA 1DFPA 3KYFA 1TRNA 1IQGA 1CGIE 2UWOA 1OWHA 2FI4E 1NU9A 3RC5A 2XNDD 1S5SA 2YOLA 3SV7A 4X1RU 1MKWK 4JK5A 1GJ8B 1EJMA 1CU1A 1Y5UT 3GS9A 1RD3B 2XC0A 1WTHD 1O3JA 2PP6A 1FY3A 2WSSD 1JOUB 3A7TA 2FS9A 2FMJA 3AW0A 4FU9A 1BJUA 3P8FA 1D3DB 2FIRH 1CVWH 3FVFB 1QR3E 3P92A 3AAVA 4FUDA 1RS0A 2P93A 2G4UA 3PWCA 3SNCA 2VWMA 2OD3B 4GSOA 1GVKB 1TNLA 4IGDA 3T28A 2ZG0H 2FOMB 4K60A 5I25A 2FOFA 1TB6H 2FWWA 5AF9H 1OYQA 1G32B 1ZMLA 4UD9H 2GMTB 4ZHMU 1GBMA 3VXEH 4MQAA 1W14U 5C5NA 4DURA 1MH0A 5DJ7A 3F2FA 2D26C 2NWNA 1SLUB 5AHGH 3U28C 2ZC9H 1A46H 2VIVA 1ABJH 3SI4H 1C5TA 1NU7B 1H9LB 1YPGH 3OY5U 1N6XA 4TYDA 1GMDF 2AGIX 2H2ZA 2F43B 2GT7A 2VU8E 3EE0B 4B2CA 1QA7A 4FUIA 5TCAA 1OPHB 1COWD 1QB6A 1K1OA 1UTPA 3U8TH 5B6OA 2VINA 4XFQA 1WU1A 2XC5A 2J2UA 1OOKB 3ZZ8A 2BX4A 1QY6A 1W0JD 3EYDA 2O8TA 3ZZCA 3UPEA 4Q2KA 3EE7A 1GDUA 1TX6A 4CR9A 1N8OB 2GDDA 5EGMA 1GI2A 3LT3A 2H6MA 1HFDA 1GPZA 3ZVFA 5CHAB 4XBBA 1WDIA 4QT8C 3OFND 2Y7ZA 4RKOB 1P57B 1TAWA 3OYPA 1GG6B 3BTFE 3LC5A 3W95A 5GWZA 1FX0B 1BHXB 1DPOA 1T8MA 2G5NA 2UWLA 4X8UH 2CXVA 1O2RA 4Q63A
chains in the Genus database with same CATH topology
3VB5A 3MH7A 1HAVA 5H4IB 1CA8B 2GV6A 2LNCA 1Z8GA 4YZUA 3URDA 3GCNA 2AS9A 1LVOA 2OC8A 1OP2A 2JH0D 3LJOA 3BF6H 3A86A 1PYTC 5T6DA 1G36A 2F9BH 3HPTB 3VB7A 7GCHF 3SBKA 2W26A 1KIGH 5K7RA 2SGDE 4NG9H 5EQQA 1T7CA 1TWXB 2A4RA 4THNH 4RKJB 3ZYDA 1TPPA 4INLA 1Z8IB 2VIPA 2H1UA 4OGXA 2XNIA 5C1XA 1SGPE 2QYIA 1FAXA 4O3UA 2Q6FA 3E0NB 5GPIB 6CHAB 1LHCH 2AIPA 3RXSA 3BTHE 3SGAE 2BD4A 1CHOG 2OQ5A 1JXPA 1NS3A 1L1JA 1DY9A 1AY6H 1GJAB 4D7FA 2PSYA 3SJKA 2Z9LA 3RP2A 4XE4A 1O5AB 2QXGA 4DIIH 4U32A 2QGRA 5L2YH 3VEQB 1EPTA 4LK4A 4RSPA 1F5LA 3U69H 1C5ZB 1SPJA 1OXGA 1NFUA 4HZHA 1VJAU 2D1JA 3GY4A 3KQBA 5GXPA 3TK5A 1L2EA 1CT0E 1GJ6A 1HAXB 2CJIA 1GBFA 2C93B 4H6TA 1DLKB 4Y8YA 3PTNA 2FEQH 2W7UA 1C5PA 3I78A 3TNSA 1NT1A 3A8BA 1XUJA 4Q7ZA 2A2XH 2D8WA 1W3CA 1BUIA 1MUEB 1VCQA 3M61U 5EXNA 1GWAA 4NIVA 4BXWA 1GCTB 2OC0A 2OINA 3GDUA 1O2NA 4AFZA 2J92A 1E0FD 2F9OA 2FI3E 1AFQB 2J4IA 1D9IA 5FBIA 2HOBA 4NZLA 1MD7A 5JBCS 3M5LA 3BIVH 3M5OA 4MVNA 3PB1E 4O9VA 1HAZB 1C5LH 3RXLA 3R0FA 5A8YA 1L1GA 2WYJA 2ZGJA 3V12A 5ABWA 1DM4B 1Y3VA 1UTOA 4UE7H 4ZUHA 1HAPH 2A4GA 2PFEA 1ELAA 2QXIA 2OBQA 1VITG 5C1UA 1LTOA 1D3TB 1BB0B 2CHAC 1T4UH 1TYNA 2GGVB 5F8XA 8GCHG 1A3EH 3SU6A 2F9VA 1F92A 2XBVA 1W8BH 1O5CB 1AUTC 4DJZB 1O5FH 4B75A 4B2BA 2A1DB 2V0BA 1Y8TA 4IS5A 5TJXA 3TU7H 4ESTE 1QBVH 3E0PB 1GJDB 2FTLE 3W94A 4D9RA 1ZRBA 5HM2A 1LHEH 2PKAA 3K2UA 3C1KA 4MNXA 1GJ5H 1OYTH 4XBCA 4XOJA 1AVWA 5HMAA 2GKVE 1TPAE 2WPMS 1TGCA 3SUDA 3SNAA 3EGKH 1NROH 3RXBA 1P2OA 2O8MA 1TA2A 2ANKH 4X6MA 1P2IA 2OP9A 2WPHS 1DS2E 1FN8A 1VZQH 2PLXA 1SI5H 3RMMH 1NRRH 1MTSA 2P8OB 5DP9A 2Z7FE 3FP8E 1MD8A 4UEHH 4E05H 2A0QB 4JYUH 1NN6A 3SW2B 2XBYA 3VPKA 1GI1A 2ZGBH 2R2WU 2QF0A 3UWIA 1AI8H 1FXYA 1SLWB 4WXVA 2PW8H 5PTPA 1SOZA 2AMDA 2P59A 4FU8A 3Q76A 1MU6B 3PMHB 2ZCKP 1ZR0A 1ELTA 1SR5C 4ZH8A 1O2GH 1LMWB 1O3PB 4MNWA 3UIRA 3KQEA 1ZTLA 4ABHA 1ZHRA 3ZZAA 4X1NU 1YCPK 3HK6B 1ZHPA 2AIQA 1Z71A 1RTLA 3GDVA 1Y3WA 3SHCH 4JZDH 2BD7A 2GVFA 2ZHDA 2ZU1A 1SLXB 2Q1JA 3A82A 1QL9A 1KDQB 1EZSC 3M35A 2F91A 1O30A 3TNTA 4BTTB 3A85A 1G3DA 2BYAX 5AFYH 3LU9B 1BRUP 3EDXB 1C1WH 3L6PA 3PLKA 3E3TA 1D6RA 4LXBH 2BY7X 1ELCA 2Y6TA 4BTUB 1P2QA 1EPTC 1DXWA 2ZU5A 1BMNH 2C8XB 4Z6AH 1MZAA 1NFWA 2AYWA 2ZIQH 5LPFA 4Y10E 2GX4A 3RU4D 5BPEA 1YPKH 1Y5BT 1J16A 3TGKE 1W2KH 4CRGA 4K1SA 2G55A 3GYLB 4AGJA 1WOFA 2ALPA 1DITH 1LHDH 3D62A 1E34B 3S69A 1BTXA 3P8GA 1B0EA 1EOJA 2NU0E 1NRQH 1IQJA 2FP7B 2VWOA 3SU3A 1UK4A 4K3JA 2P3UB 1BRBE 3O8RA 3AW1A 1BA8B 3R3GB 4Y7AA 4ZXXH 3SNEA 2ALVA 3ZVGA 3WY8A 4ABDA 3QLPH 6ESTA 2QY0B 1V2RT 1EJAA 5EQRA 2BD2A 2ZHEH 3RXMA 3T27A 4YT6H 4BNRA 2CF8H 4AB9A 1FI8A 3F6UH 2ZTYA 5L30H 1E36B 4LZ4B 2V6NA 1O5BB 3MFJA 3RXUA 1SFIA 2SNWA 3TH3H 1YPMH 1CA0C 1TRYA 1C1OA 1MQ6A 3OSYA 2GD4B 4CRAA 4JZ1A 5TCCA 1C4U2 1GVZA 2GZ8A 2ZZUH 1TX8A 2JH5D 1FIWA 1QQ4A 1D6WA 1UHBB 3A7XA 1TNHA 3P95A 2R3UA 2Z9KA 1FMGA 2O9QA 5DP4A 3SU0A 4KTUA 1G2LA 2WPKS 3VB3A 1ZSJA 4IC6A 3RU4E 2IN2A 1W7GH 3ODFA 4ZKSU 1O2TA 1SQAA 3T29A 1GCDA 4F49A 2QA9E 3QK1A 4WMEA 7GCHG 1C5NH 3K6YA 5LPEA 1YGCH 1KXAA 1Z6EA 1KY9A 4TPYA 1M9UA 3RM0H 1WUNH 4Y76A 1GMCG 1ZGIA 1AVXA 3LH3A 1SB1H 2SNVA 1RTFB 3QTVH 4ISIH 4YOIA 1FNIA 1SGIB 3IITA 1O35A 3DUXH 1IQKA 1UCYH 1C2MA 3O8DA 3OU0A 1IQFA 3U98H 2VH6A 1CBWB 5DP3A 1EP6A 1O2ZA 3RC4A 3SU5A 1BRCE 1PQ8A 1Y3UA 5DG6A 5F03A 3K6ZA 1FN6A 3EA7A 4B73A 2GCTB 4DGJA 3VB6A 1V2KT 1F0TA 2BD3A 4BXSA 2VGCB 2HNTE 1EAIA 2Y5FA 1A0JA 2A4QA 5AVDA 4I8GA 3ZV8A 1PQAA 3MYWA 1DSUA 1EZXC 1QJ1B 1Z8JB 4PROA 3CP7A 4GHQA 2HNTF 4NIWA 5FPYA 4AYVB 1C5WB 2BD9A 2H5DA 2SFAA 3PO1C 1VITF 3BTQE 6GCHF 3GY8A 1ANBA 4OS1A 1VGCC 8GCHF 2F83A 1GHWH 3VFEA 1AD8H 3FFGA 1HJ8A 3LDXH 2ULLA 3A7VA 4I8KA 1GGDB 2ILNA 3A7ZA 1EKBB 3Q3KA 2OLGA 2NU3E 2ZDNA 3P70B 2STBE 2SGFE 4YESB 1RXPA 4BAOB 3GY2A 1BBRH 1ZSKA 3RXJA 2Z9IA 4K8YA 3SGBE 1TMTH 2AFQB 3H7OA 1O3KA 1ZMNA 2BDCA 1PPHE 1O3OA 4ZHAA 1MU8B 1O3NA 2RDLA 2I6SA 2Y82A 1AIXH 5C5OA 4CH2B 3ZVBA 1KTTB 4B71A 1BHXF 4Y0YE 3A7WA 3F68H 1O3DA 1C1QA 1S81A 3M3TA 3I29A 3BG8A 2H9HA 4ABEA 1THRH 1O2HA 3BV9B 1L4ZA 1HJAB 1HRTH 4WH8A 4B2AA 2TPIZ 2WPLS 3BTKE 2HGTH 4O3TA 4CREA 2FLRH 1EX3A 1C5OH 4MNVA 1O2PA 4FXGH 3G01A 3D23A 3PMAB 3VB4A 4TWYA 1RFNA 2A4OA 1DSTA 1C2LA 4VGCC 1LO6A 3PMBB 3LKWA 5I46H 1ZGVA 1XUFA 3H5CB 4DCDA 1AKSA 3HGPA 4ZROA 1XUIA 1VCWA 1BZXE 3SV2H 2K1QA 3KN2A 1DICA 3DD2H 1RIWC 3STJA 1IQEA 4K69A 1C2GA 2EI6A 3SZNA 2P3TB 2J94A 4X6PA 1AE5A 4D8NA 4FUFA 1VITH 1E38B 1EOLA 3RXRA 3M5NA 1HAGE 4AOQA 1DE7H 1HCGA 1GDQA 1O3GA 4I7YH 3PWBA 2BHGA 3SN8A 1QRZA 1T32A 5JYIA 3ZZ4A 1BTWA 4BAQB 5C2ZA 4YO9A 2HNTC 1MBQA 1C5QA 3UWJH 3FP6E 1Z7KA 1UVUH 4Y8ZA 1UTLM 1FY1A 4INHA 1C2IA 1Y59T 1C4V2 2ZTXA 1QJ7B 3D49H 1NRSH 3PLBA 1CE5A 1A1RA 3UFAA 1YF4A 3BEUA 1JRSA 3S9BA 1O38A 1O5GH 1MKWH 1GHZA 1ETTH 1DXPA 5CHAC 3BTTE 1P03A 1KYNA 4JMYA 3PROA 1V2VT 2G5VA 3GYMA 3LC3A 1RJXB 3ZVCA 1NM6A 2FXRA 2BD5A 3UQOA 1S6HA 2Q6GA 1S84A 1PPZA 3MH5A 3FZDA 1A0LA 1YPEH 2XXLA 4H42U 4MTBA 3UOUA 2RG3A 2RA0A 5T3HA 4LOYH 1O3FA 1BOQA 1UJ1A 4D76A 3PTBA 4Y7BA 2W5EA 5T6GA 1EAUA 1F5KU 1GHVH 2WV5A 1TBRH 3LPRA 4X1PU 3SUEA 4WXIA 5E2OA 1HYLA 4HGCA 3TGJE 2VWNA 5F8ZA 1FPCH 1OSSA 3RMLH 2ZO3H 1PPCE 4R8TB 1W7XH 1S0RA 3SU4A 2JH6D 1LHGH 1P05A 1F5RA 2GZ7A 1YP9A 1GJBB 1T8LA 4WF8A 4WVPE 4AX9H 1C2FA 1GMCF 2WPJS 1BJVA 3KCGH 2ZFRH 1C9PA 2Z6BD 1C5MD 5G4BA 5LPRA 1O2UA 4H4FA 1SOTA 1DWEH 2KAIA 2EEKA 1GJ7B 4SGAE 1IHSH 4UFEH 1IOEA 1UK2A 1EAWA 2EA3A 1QRWA 1CT2E 5JB9S 1MKXH 1JIMA 1NFYA 1RRKA 3ZZ3A 1BCUH 1GBCA 5EXLA 1TGNA 5BRRE 2BOHB 3SUGA 2FI5E 3SNDA 2OCVB 2Y5GA 3N7OA 2ZQ2A 1GJCB 5A2MH 3EQ0H 4NSYA 1AQ7A 1DX5M 1UO6A 3RXIA 2RCEA 1AHTH 1O2VA 4JYTA 2ZKSA 2PGBB 2B9LA 5HXFA 4ZHLU 2OBOA 2R0KA 5CMXH 3A8CA 1ZHMA 1LKAA 2VIDA 2G51A 1HJ9A 1LPKB 1U6QA 4TWWA 1VR1H 1AFEH 1ABIH 1C2KA 3BTDE 1MTNC 4CHAC 1OKXA 2GP9B 4OS6A 1BDAA 2ODPA 1HXEH 1Q2WA 1DANH 1TQ0B 1XKBC 2EC9H 3DT0H 3RXHA 1KLTA 3ZZ5A 4AFUA 4XBDA 2VIWA 3LGTA 3UQVA 1K1IA 2ZPRA 4IN1A 2QC2A 1O3AA 1O3MA 2R9PA 3GY7A 3LGYA 4ABJA 4ABBA 3V7TA 4I8JA 1F7ZA 1UTQA 4WJG2 2DUCA 3TPIZ 4FVBA 2TGTA 1YBWA 3U9AH 4MNYA 4X8VH 1O2YA 4Z0KA 3BEFB 3T25A 5F8TA 1TQ7B 4GLYA 4JYVH 1A61H 1YPJH 1C5VA 6GCHG 4CBOA 4D9QA 3BN9A 3S0NA 2Y80A 4U01A 2VIOA 5GJ4B 1G3EA 2QN5T 2ZDKA 2ZQ1A 3UTUH 4XSKU 1S0QA 4UDWH 1TRMA 1ORFA 2BTCE 4NSVA 2ZFFH 1V2MT 1TALA 2O8WA 2PUQH 3A83A 1A5IA 1O36A 1GBTA 1O31A 4NIYA 3CS7A 2EI8A 2PTNA 2PSXA 1FLEE 1BMLA 3SV8A 5EPNA 1ZRKA 4YLQH 1NRPH 4J2YB 2PGQB 2BXTH 1WBGB 2AERH 3QGJA 2AH4X 5JDUB 2PKSC 1OWJA 2THFB 2H9TH 1Q31A 2FOGA 2CHAB 4JZEH 1K1MA 3BTGE 4H6SB 3SI3H 3RMNH 1ELGA 3MHWU 2GV7A 8KME2 3RXCA 1O3HA 2FYRA 4I33A 3NK8A 3O8BA 4K8BA 5FX5A 3TJVA 1ZPZA 4GHTA 2F3CE 5EG4A 1Z1JA 3H7TA 4U30A 5DP8A 3D65E 3PLPA 1GHBF 1GDNA 1S85A 2DE9A 2W3KA 3ATMA 4NA7A 1TBZH 1GI7B 3TK6A 4MPWA 1INCA 2BY6X 4KTCA 1V2TT 2ZFPH 1LKBA 1AWFH 3BEIB 2QIQA 1QTFA 4YOJA 4IN2A 1OWKA 1HIAA 1ANCA 2TGPZ 5GCHG 4NFEA 3M37A 2FZZA 1C1PA 1WAYB 2ZDVH 5ETXA 1P8VC 3QUMP 3NKKA 3QWCH 1YLCA 2FYQA 2JETC 5T6FA 1QJ6B 3UNQA 4CBNA 3RXKA 4Y0ZE 3GCTG 1H1BA 1HAVB 3SQEE 4AN7A 5HGGA 4NFFA 3UNSA 1D3QB 1PPFE 4X6OA 3RUOA 5GIBA 5DK1A 4B74A 1IQLA 1O2MA 4YTAA 5A8ZA 1HPGA 1A4WH 1SL3A 2YNBA 2XTTB 5A09A 2G8TA 3UR9A 2XWAA 3UREA 4LZ1H 3KL6A 3SV9A 5FX6A 3A88A 2W7SA 1GMHG 1HUTH 3BTEE 3TGIE 1LVMA 3LJJA 1QHRB 1YKTA 4F4OC 5E0HA 3ATLA 1IQIA 2ANWA 2P3FH 1O2WA 1LQDB 1HAIH 4FUGA 3F9HA 1C1RA 4GVUA 4A7IB 1O3EA 1P09A 3MO6A 4IW4E 3KHVA 4A5TS 3MU5A 2QXJA 1CQQA 3LIWA 3NUMA 3DHKH 5K0HA 1KXFA 1L0ZA 3TJNA 1YPLH 4KELA 3E1XB 4ZXYH 3RXVA 1O2XA 1J15A 1Y3XA 3RMOH 1J8AA 2GTBA 4OS7A 4UFGH 1QFKH 1SVPA 1TGTA 4ISHH 4YLUA 1QB1A 1EZUC 1EPTB 1TPOA 5EW1H 1ANEA 1TABE 4E7RG 2ZTZA 1BTYA 3RLWH 1TGBA 1QL8A 5C20A 4X2YA 4HFPB 2QF3A 4CRDA 3A89A 4A1TA 2ESTE 1F0RA 4NWLA 1SSXA 3E91A 2ASUB 3ZVEA 4OS5A 1HAHH 2ZDAH 2A5KA 4NGAH 2Y7XA 1UCYK 2O8LA 2V35A 1O2KA 2C8WB 3SU1A 8LPRA 1C2HA 1K28D 3SNBA 1KSNA 1YPHE 1YYY1 2FX4A 3MMGA 1FUJA 1V6DA 4INKA 4CR5A 1K2I1 2ANYA 1FY4A 2ZA5A 4BANB 2F9NA 1P2MA 4NZQA 5DP6A 1ESTA 2EI7A 1BMMH 1FY8E 1QIXB 4KKDA 4A92A 5F6M