2TRMA

The three-dimensional structure of asn102 mutant of trypsin. role of asp102 in serine protease catalysis
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
223
structure length
223
Chain Sequence
b'IVGGYTCQENSVPYQVSLNSGYHFCGGSLINDQWVVSAAHCYKSRIQVRLGEHNINVLEGNEQFVNAAKIIKHPNFDRKTLNNNIMLIKLSSPVKLNARVATVALPSSCAPAGTQCLISGWGNTLSSGVNEPDLLQCLDAPLLPQADCEASYPGKITDNMVCVGFLEGGKDSCQGDSGGPVVCNGELQGIVSWGYGCALPDNPGVYTKVCNYVDWIQDTIAAN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRYPSIN
publication title The three-dimensional structure of Asn102 mutant of trypsin: role of Asp102 in serine protease catalysis.
pubmed rcsb
source organism Rattus norvegicus
molecule tags Hydrolase (serine proteinase)
total genus 42
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1988-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2trmA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2trmA02
3SJ9A 1BZXE 1TGCA 1F7ZA 2FESH 1BRCE 1WSSH 3ELAH 3RXBA 4MG3A 5JPMH 3CP7A 1ZMNA 3A7ZA 3FP7E 1C9PA 1AVGH 1HIAB 3SV6A 3GY4A 4UDWH 1P9SA 1GG6C 1C4V2 2R0KA 1RTLA 3SUGA 1NM6A 3RLWH 2GMTB 1N8OB 1Y5BT 3EA7A 2AGIX 2ZI2H 3STIA 1RS0A 3TK6A 5EW2H 1ESBA 1TNJA 1H8DH 1BBRK 1THRH 2QAAA 5DJ7A 4CR5A 3OYPA 2H5CA 4DURA 5EQRA 2GP9B 1C1RA 1GMDG 1MTUA 1O3IA 3BIVH 1TFXA 1BBRH 1YC0A 1MU8B 4MTBA 2ZQ2A 1NFYA 2Y5GA 2BVSH 1EP5A 1NN6A 3QN7A 3F6UH 4JZIA 5EPNA 4JMYA 4D7GA 1F2SE 2FODA 1O2PA 1NY22 2ZDMA 3T29A 9LPRA 4ABEA 4XE4A 2DUCA 3RXJA 1GHBG 1GG6B 1TB6H 2NU1E 2TGTA 2PWXA 3MNXA 1JXPA 2OINA 1Z8RA 4ZXXH 1GL1A 3GDSA 4ZHMU 2DE8A 2ZDLA 2RDLA 3LJOA 2HGTH 3S9AA 1O35A 1Q3XA 5HYOA 2HWLB 1MBMA 2BVRH 1DWEH 4RKJB 3ZZ9A 1MH0A 1H1BA 3VGCC 5F6MA 4INKA 1EATA 2A0QB 1UO6A 2XWBI 2A4OA 3MMGA 4XOJA 1DITH 4ISIH 1AB9C 3M7TA 1HUTH 1MUEB 3GICB 1INCA 2VINA 4AGKA 2BD4A 3ZYEA 1TALA 3Q3YA 1C5UA 2VIOA 4PROA 5C1XA 2ZDNA 3H7OA 2NU3E 1QJ1B 2ZP0H 4Y6DA 3ZV8A 2VWMA 4BXSA 2XXLA 2HVXA 2OC1A 1F0TA 1QRZA 1V3XA 7GCHG 3NWUA 1NRRH 3ATWA 3P8NA 1L0ZA 1BTXA 3I77A 4Y76A 1OWDA 3QGNB 4WMDA 4Y71A 1J9CH 2ODYB 2AEIH 2BDCA 3RXFA 4X8SH 3QZRA 3RDZA 4D7FA 3VGCB 3QX5H 1LKBA 2P93A 2R3YA 3ZZCA 1G2MA 1BMLA 1CVWH 1CGHA 3MWIU 1GI5A 1EKBB 1AB9B 1GI4A 1E34B 5BRRE 3VXFH 4WH6A 4K1SA 3F9EA 2FOBA 1K1LA 3GCOA 4NFEA 3JZ1B 1J17T 2FOHA 3KIDU 4BXWA 4CR9A 3ZZ5A 5DP8A 1Z1JA 5LGOA 5EXLA 4FUCA 1VCWA 4E7NA 1ELGA 1MBQA 1P04A 1UVSH 1TRYA 3F9FA 4ESTE 3T28A 1Y5AT 1J14A 1V6DA 1TOCB 2ZIQH 3ZZBA 1DXPA 3PMBB 3RUOA 1W14U 1C1SA 1EOLA 3ENSB 1PPFE 2OC0A 4NA9H 2ZPSA 1S82A 1N6YA 1XUFA 1MMJN 1GVZA 3PV4A 1DE7H 1MZAA 4YM9A 4GHTA 2O9QA 2F83A 1IQLA 1EAWA 3CENA 4UONA 1B5GH 3BTHE 3LGYA 4AFQA 1PFXC 3TNSA 1P2MA 2FZZA 2ANWA 2ZKSA 4NIVA 4WH8A 2G55A 1P2OA 3PMHB 1NC6A 1SPJA 1EB1H 1K1NA 4BTUB 3RLYH 4U32A 3ATMA 1YPLH 1ZLRA 2XNIA 4OS4A 2AIPA 1P2QA 1P9UA 2IPHA 2FS8A 1ZJKA 1MD8A 2VWLA 2ZCLP 1ZYOA 4CH8B 1H9IE 1VJAU 1C5LH 1AZZA 3TJVA 2QXHA 4ABDA 5JB9S 3BEFB 5EGMA 1TA2A 1SGQE 2PUXB 4I8LA 1KLIH 4K2YA 1KXDA 3ODDA 1C1UH 5DGJA 1TX8A 2VGCC 1HAVA 3SI3H 4K5ZA 4X0WU 2CXVA 2VB0A 1A2CH 2Q6FA 2PTNA 1EJMA 1K1IA 3W94A 2QCYA 1BTPA 2F9VA 1EAXA 1GHXH 4AYVB 2D1JA 3D65E 2ZECA 2FX6A 3IITA 2BB4A 1PQ5A 1DS2E 1BTWA 1GVLA 2AMDA 2R3UA 1Z71A 4YLQH 2F9UA 1K22H 1C1PA 3PO1C 2GDEH 2HNTE 1BTZA 2W7UA 2ZU4A 1MZDA 1ELCA 3A7XA 1NS3A 1UHBB 1HAIH 1AHTH 2Y7ZA 4BOHA 1C2EA 2Z9IA 3ITIA 1O3NA 5C2ZA 1DY9A 1BBRE 1WU1A 2ZFQH 2VWOA 1DPOA 4Y0YE 3LOXA 2CF9H 3K65B 2AGEX 1XUHA 1IQGA 2VGCB 2G52A 2Z7FE 4RSPA 1P2KA 3HGNA 2ILNA 1XKAC 2WPLS 3A8AA 1S84A 1CQQA 1JIMA 5EG4A 3SNAA 2XCNA 4Y10E 5I46H 3HKIB 2B0FA 1V2LT 2J38A 1C5MD 1TIOA 1TLDA 3PO1B 4NSVA 1YPHE 3KN2A 1A5HA 4LOYH 1CGJE 1QJ7B 3BEIB 2CV3A 4YT6H 4LZ1H 4TWYA 2J34A 1TNGA 1IQHA 2ZPRA 1FPCH 1OXGA 3QUMP 2HLCA 3HK3B 1GBKA 2RA0A 3E16B 4X2XA 2W7SA 1F5LA 2QXJA 3EDXB 1FPHH 2PHBA 3AAUA 1UVTH 1GJCB 1AD8H 1UTKA 1Z8JB 3M36A 4O9VA 1ABIH 3UQVA 1MCTA 1TAWA 1TGBA 3UQOA 2GZ9A 5DG6A 2H6MA 1IQKA 1A0LA 2ZGXH 1VCQA 5HXFA 1JMOH 1BTUA 5FPTA 5ETXA 1O39A 4X8TH 1KTTB 3E6PH 4KTSA 5EQQA 1QL7A 1QHRB 4I8JA 1OP2A 1QNJA 2ZFRH 1GI3A 1BT7A 2BXTH 3RXKA 1AFQC 1SLVB 2STAE 1NRPH 1RD3B 1LO6A 3QLPH 1DM4B 2FXRA 1L1GA 2FYRA 1GDNA 1KDQA 1HBTH 1TRMA 1V2NT 1FLEE 2AERH 4ZH8A 4B73A 3S9BA 1AE5A 2GZ7A 4BANB 3MNSA 2BY8X 1ZTKA 3A82A 2AMPA 3DUXH 2P3FH 1C1NA 3UIRA 2PTCE 1O30A 2J94A 1NT1A 4Q2KA 1TMUH 1YPJH 3MU8A 4CRDA 1SQOA 5JBBS 1H4WA 2ZPQA 1O5FH 2H9HA 3PMJA 1RJXB 2OXSA 1PYTC 4JZFH 2ZTXA 1ETRH 1TPOA 1UTPA 1AFQB 1SGEE 5K7RA 2CMYA 1VITF 1P12E 1O2LA 2VU8E 2F3CE 5FX6A 5FXLA 2Y80A 4XSKU 3SGBE 3LDXH 1P02A 2OC7A 4WXVA 3RMNH 3TITA 5JBTA 1YP9A 3UR9A 1ELEE 1O3EA 1KXCA 2XRCA 3OY5U 3M5LA 1A7SA 1DICA 1A0JA 1H9HE 3LC3A 2HPQH 2FTLE 1DLEA 2AMQA 1AFEH 1GMHF 1XMNB 3KHVA 1FN6A 3RXDA 2O8WA 4E7RG 2BD9A 1GI2A 1NTPA 2ZHQH 3BTEE 2HRVA 2WPIS 3ZZ6A 1XUJA 3LPRA 2C4FH 2BTCE 5F8TA 4ABAA 2QXIA 3ZVEA 2A7JA 4DJZB 2SNWA 1GBLA 1SR5C 1CGIE 3A7TA 1AWFH 1CA8B 2OCVB 2BDGA 2GDDA 3ZZAA 1UCYK 1Q2WA 1S0RA 3DD2H 1UCYH 1F0UA 2BY5X 1ZZZA 5E0HA 2ZFFH 4AOQA 5FPYA 3FZDA 1YLDA 1CSOE 1EZUC 1MD7A 1C1QA 1GMCF 3M5MA 1OYTH 1O3KA 4ZKNU 2VWNA 2W3KA 1BITA 1RIWC 1O34A 1W7GH 2QC2A 3MNBA 3UTUH 4ZUHA 2FIRH 2A31A 3U8RH 2JH0D 1LTOA 3H5CB 1O2QA 3P8FA 1EPTA 1PPHE 1KLTA 4OS5A 5FBEA 2SGFE 3TLOA 1MQ5A 2EC9H 5BPEA 1DSTA 3M61U 1A3EH 4A1XA 5GPIB 3R3GB 5EOKA 1SGYE 3NZIA 3RMLH 3A87A 2W5EA 1PPZA 2UWOA 3KQDA 1ZJDA 5FPSA 1D3PB 3E0NB 2ZCKP 1S83A 3SJ8A 5L30H 3ATLA 1YCPK 1C5RA 1G36A 1Z1IA 1A61H 5E0JA 1LHCH 2H5DA 3BTKE 1AVXA 4ISOA 1QB6A 4Y7AA 1RIWB 3GDUA 1UTNA 3SGQE 1YCPH 1D4PB 1ZOMA 3EGKH 4CRGA 2TBSA 4FUFA 4MPXA 1ELFA 3EA8A 1CT2E 1C5ZB 3FFGA 5HM9A 2P3UB 1BJVA 1NFUA 2UUJB 2C8YB 1YGCH 4A5TS 1GJ5H 3STJA 1KLJH 2FP7B 3ZV9A 1XXFA 1S5SA 4IC5A 2CF8H 3VB3A 1PYTD 1QY6A 4HGCA 1NU7B 3S7KB 5JBAS 3BG8A 1SLWB 3PWCA 4DOQA 1D6RA 1EJNA 4DIIH 1SQTA 4IGDA 3VB6A 1IQNA 1YBWA 4JCNA 1HJ8A 2FDAA 2BZ6H 3SGAE 4Q80A 1QB9A 3H7TA 1QB1A 5FCKA 4AG2A 3A7WA 2Z9KA 3BTFE 1O2UA 2P95A 2OD3B 1GI9B 3UNSA 1S6FA 1WBGB 1AMHA 1VITG 1ANDA 2W3IA 3FP6E 3E0PB 1EUFA 1DT2A 4MPUA 5TCAA 1ORFA 1BCUH 4MNVA 3SV2H 2FEQH 3AAVA 3VB7A 1G30B 3ZVAA 1UTJA 2OQ5A 2WPMS 4YOGA 1ARBA 1W3CA 2GD4B 4DCDA 3P92A 1YPKH 2ZHDA 2FOMB 1EP6A 1EZSC 2HNTC 4TPIZ 2FX4A 3ZZ4A 1GBMA 1GMHG 1O3CA 1TMTH 4GHQA 4JYUH 4KTUA 1WUNH 4H42U 3AVZA 3PB1E 6ESTA 1IAUA 4CRBA 1QRWA 1UVPA 3SBKA 3ESTA 2TGDA 1QJ6B 3E91A 2CJIA 2BY9X 1V2PT 4AB8A 2SGPE 1TGNA 3HGPA 1AIXH 3ZVFA 1FNIA 1L1JA 4U2WA 3A86A 5EU8A 3UPEA 2XCFA 1A46H 3SO3A 3PLKA 5C1YA 4MQAA 3CS7A 4NWLA 1W0ZU 4F4OC 4JK6A 1DXWA 1DFPA 1QRXA 4FUHA 1AWHB 1YPHC 1KXFA 4YO9A 2JH6D 1P2IA 1MCVA 1V2VT 2P3TB 1SGDE 1ZTJA 2ZG0H 1EB2A 2PUQH 1O2XA 1LVBA 1BDAA 1OOKB 2HOBA 4OGYA 1O5AB 3QTVH 3T62A 4NSYA 1GMCG 3C27B 1GDQA 1QIXB 1YPEH 1PPGE 2QA9E 4H6TA 9ESTA 1MQ6A 2Y5HA 3GY5A 6GCHG 4BTIB 2ODPA 3KQCA 3Q3XA 5FAHA 2FOAA 1V2WT 1J16A 2R0LA 2BQ6B 3AASA 4YT7H 1UCYE 2GV7A 5C67A 3VEQB 1GBIA 4NGAH 3MOCA 1O31A 4GUXA 4IW4E 3RXCA 1SFIA 1MTVA 3MH7A 4CRCA 3A8CA 3RU4T 1ABJH 2C8ZB 4LK4A 2Z94A 3SV7A 3GCHC 1P05A 3OTJE 2I6SA 1LVMA 1O3LA 5DP7A 2K1QA 1E37B 1BOQA 2FOEA 1NESE 4UE7H 3SU5A 4X2YA 1P8VC 2XC5A 5T6DA 3KGPA 1D6WA 3IG6B 1EXFA 3MTYA 4X6NA 5E2PA 4H6SB 1C1OA 2PSYA 2FS9A 3QGJA 1HAOH 2F91A 2Z9LA 1LHEH 1C5NH 1TNIA 4X1RU 3A7VA 3SJOA 2THFB 2A7HA 1NROH 2O8MA 2WYJA 2R2MB 4ABJA 1CA0C 2GV6A 1PJPA 1F0RA 1W11U 3GCHB 5DP6A 1A5IA 1O33A 3FP8E 1G3EA 1SSXA 1ZMLA 2J4IA 1WTGH 2A2XH 1SLXB 5GXPA 1AGJA 4YTAA 1O3GA 3SNEA 2QN5T 1W10U 1AN1E 1FY1A 2BLWA 3ZVGA 4U30A 1KY9A 1GHAF 1TNKA 4R8TB 4I32A 1V2UT 2B5TB 3DFLA 1GGDC 5E0GA 2KAIA 5PTPA 5I25A 2WUCA 1CA0B 1EPTC 1FAKH 5SGAE 2H2ZA 2G5VA 4MPWA 2D26C 1Y3YA 1E0FD 1HAYB 2AGGX 1SHYA 1BTYA 1GJ6A 4UFDH 1G3CA 1ANCA 2AYWA 3RXEA 2BDBA 1A1RA 2R9PA 3LGUA 3R0FA 1GHYH 1TPAE 3E90B 1QBOA 1XXDA 2ZHEH 1TPSA 2RG3A 1Z6JH 1X7AC 3K2UA 4E06H 1O37A 1KXEA 4FXGH 3SU4A 5A8ZA 2FMJA 1IQMA 1K1PA 1GGDB 2BOHB 1C9TA 4SGBE 3BEUA 4TYDA 1D3QB 3O8DA 4O97A 2PKAB 1TBQH 2ZF0H 1SGIB 2G51A 3RMOH 4D8NA 1FIZA 1MU6B 3TNTA 2ALPA 3MFJA 3HK6B 2XBYA 5EPYA 5C1UA 1A3BH 2BY7X 4Z0KA 1O3OA 5J4QA 1SGFA 1GJAB 1SFQB 3E8LA 4KELA 4YOIA 1IQEA 1LHGH 3T26A 2VIDA 4WXIA 1ARCA 1AKSA 1LQDB 3TGKE 1O2SA 7KMEH 4CH2B 5C20A 4INLA 2SGAA 1G3DA 2B7DH 2OTVA 4ASHA 1CT0E 3SOSA 2Q6GA 3ZVCA 4HZHA 5DPAA 3TGJE 2OBOA 1W8BH 3HKJB 2G81E 3Q77A 1GL0E 4WMFA 3TJUA 1C5SA 2Z9JA 1ZSLA 2OP9A 4AGJA 3MU5A 5TCCA 1O3MA 3UREA 2XTTB 4MNYA 1ZPCA 2BDYA 1GCTC 3M5OA 3LGIA 1THSH 1HIAA 1LQEA 1Y3VA 2G4UA 1BB0B 3M3SA 3F9GA 2P16A 2Z6BD 1ZHPA 3FAOA 3UFAA 1K2I1 2JKHA 1K1JA 1O2OA 1B0FA 4TPYA 3A8DA 1THPB 1FI8A 2GGVB 3SNDA 1F5KU 2Y6TA 3RXTA 2A2QH 1IQFA 2ZDVH 1G9IE 1TMBH 2G00A 5JDUB 3TK9A 5B6OA 1OYQA 4LZ4B 3TJOA 4XBCA 2XBXA 1SGCA 3MO9A 3PMAB 1GDUA 4ABFA 1T8OA 2NU2E 4BNRA 1Y3WA 2XW9A 2ZHWH 2ZDAH 1U6QA 1ZGVA 1UMAH 1ZGIA 2RA3A 2ZNKH 3MNCA 4K1TA 1C5YB 1CBWC 1O2NA 1SGRE 4J2YB 4A1VA 3F1SB 1O3PB 1GCTB 1ETTH 3N7OA 3K9XB 1TE0A 3M35A 1O5DH 1GBBA 4O3TA 1OWJA 4NA8A 1LPGB 4K69A 5ABWA 1TGTA 5CHAC 3P17H 4R0IA 1K9OE 4UFEH 4Y7BA 1KYNA 3L6PA 2V3HH 3T27A 4AFZA 4JZDH 4DY7B 1L4DA 2EI6A 3MU4A 1GHVH 3SQHE 2Q1JA 4RN6A 1Z8GA 1GBJA 5AVDA 4JYTA 4AX9H 4XDEA 2FI4E 3GISB 4NFFA 1ELVA 3RM2H 1GHAG 1G32B 1DX5M 1ZSKA 4NZQA 1TWXB 3RXUA 2Z3DA 1CBWB 1QR3E 3ATKA 1C4U2 5DK1A 1T32A 2RCEA 3UWIA 3QTOH 1N1LA 3SNBA 1P10A 1QTFA 1AU8A 5HM2A 2QV1A 5JB8S 1O2ZA 2BQWB 5DP5A 3BTGE 4GLYA 4Q7XA 3RXMA 3V13A 3SN8A 2P94A 3PM3A 4X6OA 1O2IA 3BIUH 4WJG2 5CHAB 2H9EH 5CE1A 1NPMA 3EAJA 3DHKH 3DT0H 2AFQB 1Z7KA 2BDIA 4B2CA 1Y8TA 1C5XB 2ZQ1A 1FY5A 2JETC 4H4FA 4ZAEA 2SGEE 1D9IA 3A7YA 1GJ9B 4I33A 3LT3A 1YPMH 5E2OA 1T4VH 1ELDE 1BQYA 5TJXA 1F92A 3GY8A 1HLTH 3V7TA 5GCHF 3RU4E 1T8NA 1ZR0A 2HNTF 3GY3A 5C5OA 3GY2A 3LIWA 5IYTA 5LH8A 1QURH 3LC5A 2PW8H 4ZROA 2GT8A 4FUGA 1O2GH 1BA8B 1GVKB 4GCHF 2ZGCA 1OWIA 2SNVA 1NFWA 3TVJB 2JETB 1ZMJA 2ZTYA 1P03A 1PQAA 3BTME 2G4TA 1UJ1A 2QYIA 4D76A 2GT7A 1A4WH 4YZUA 4M7GA 3SUEA 4FVBA 1NRSH 4K8BA 2CN0H 2HALA 1VGCC 1Z8IB 1O3DA 2FM2A 2V6NA 1FV9A 1O3HA 2BOKA 2BYAX 2ZCHP 1HDTH 1HGTH 4YOJA 2A1DB 5GJ4B 1TRNA 1V2KT 2A4GA 3RC4A 1L2EA 1TNLA 3SQEE 2CGAA 1NZQH 2P8OC 2ZGJA 3G01A 1DVAH 2BLOA 3TH4H 3W95A 6GCHF 2BD8A 4DG4A 3MO6A 3O8RA 2PSXA 1OSSA 5E8EH 1C5WB 3TIUA 2ZGBH 1FDPA 1BTHH 4GAWA 3B8JA 1AZ8A 2Y82A 4FUIA 2BQ7B 1JRSA 1MTSA 3A81A 2YOLA 8GCHF 4U01A 1H8IH 1VGCB 1ELTA 3U8OH 1HXFH 3DA9B 3ODFA 2ANKH 4ZHAA 1ZHMA 4Y79A 3TJNA 1TBRH 2NU0E 3F9HA 1PPBH 3U8TH 1C5VA 4CHAC 4F49A 2BD2A 1NFXA 3VXEH 4AN7A 2B9LA 2QXGA 4CREA 3OSYA 1QQ4A 1DSUA 3QK1A 4IS5A 2P8OB 1DOJA 4A92A 3DFJA 1ELBA 2FOGA 4NZLA 1O2YA 2ODQA 2WPHS 2AIQA 1S6HA 2F9OA 4NG9H 3HATH 3MH6A 2OBQA 1ELAA 1P2NA 4VGCC 2FLBH 4GVUA 1UHBA 1GJ7B 2XC4A 1O32A 4Q7ZA 3TH3H 1WQVH 2EI7A 4X1PU 4IMQA 1E38B 3MU1A 4XBBA 2WPJS 4KGAA 2ZU1A 1SI5H 2J95A 2JH5D 2IJOB 5G4BA 4CHAB 7LPRA 3UR6A 1LMWB 4AYYB 4WY3A 1HAVB 2VH0A 1G37A 1O2WA 1QL9A 3P70B 4YESB 2WV4A 1DWDH 2IN2A 4K60A 1BRAA 2EEKA 3EA9A 2BVXH 3URCA 3L33A 2ZTZA 1WOFA 3M3VA 3GCNA 1HAXB 1PPEE 4DGJA 1TX6A 1MKWK 1SGTA 1K28D 3PYHA 5FX5A 4X8VH 2VVUA 1A5GH 4MPVA 4VGCB 4ZKOU 4DIHH 5LPEA 3UWJH 5F8ZA 1TQ7B 1QBNA 2BLVA 2PKSC 1Y59T 1G3BA 1O5BB 2BX3A 1O2VA 2TGPZ 1MKWH 4YLUA 1HAZB 2ZDKA 1MTNC 2OQUA 4UD9H 3SHAH 3O8BA 1SOTA 4DT7B 3KQBA 1AO5A 3K6ZA 3D49H 4NCYA 4OS1A 2SGDE 3SU1A 3S7HB 2Z3EA 4WF8A 2A32A 3MH4A 4IN2A 2GCHF 2YNBA 4ISHH 1T31A 2SGQE 1B0EA 4X1QU 3TGIE 5GCHG 1P11E 4OS2A 3RXRA 4BAQB 2STBE 5AFYH 4NA7A 2V3OH 2ZU5A 1J15A 1WCZA 1VITH 1DWCH 1CO7E 3KQEA 1EX3A 3PLBA 1FZZA 2VVCA 2PKSB 4B76A 1YF4A 1DUEA 2FWWA 2VIVA 1QGFA 1N6XA 1O2KA 5FBIA 4MNWA 1MTNB 1P2JA 3GYLB 1AVWA 4GCHG 3A84A 1UVOA 3UNRA 1GJ4H 3CS0A 2A4QA 3SW2B 5AFZH 1GBAA 1OWKA 1JWTA 1AUJA 4X8UH 1DUAA 4NIXA 1W13U 1O2TA 1BMMH 1L4ZA 2FLRH 1Z6EA 4I8HA 1F0SA 1CHOF 3UUZA 1O2MA 4FUBA 5LPFA 2TIOA 1GJBB 4BAHB 3BF6H 1BRBE 1UTOA 3SNCA 1D3TB 1FY8E 3A80A 1PQ8A 2CHAC 2VIPA 5EQSA 1BUIA 1JRTA 4IMZA 3GDVA 1CHGA 1SGPE 1BHXB 1LHDH 1P57B 3MH5A 1CT4E 2BX4A 4ABIA 1C1VH 1LVOA 3PWBA 1NU9A 2ZA5A 3U1JB 1C2FA 1O36A 3SV8A 1T7CA 4B2BA 3PROA 3BTWE 4ZHLU 4RKOB 1IOEA 1H9LB 4A1TA 1EJAA 3E3TA 2WPKS 1C2LA 1XUIA 1B7XB 1KDQB 1SG8B 1DWBH 1YCPM 8GCHG 4I7YH 5L6NH 1V2QT 2ZO3H 3LGVA 3M37A 3SJIA 4UFGH 1SMFE 1LHFH 2CHAB 2ZFSA 4X2WA 3U9AH 5C3NA 1OWEA 4BAMB 4OS7A 1JOUB 1SLUB 2BZAA 3GCTG 1E35B 4DW2U 1HB0B 3Q76A 1GBDA 1OKXA 2BD3A 2WV5A 1ESTA 1HJ9A 1WTHD 4D9RA 3ZVBA 3D62A 4I8GA 5A0CA 5L2YH 3BG4C 1WAYB 2PFEA 1VZQH 3A85A 1AY6H 1AUTC 1FQ3A 2OC8A 5ESTE 1HCGA 2C93B 3ZZ8A 1RRKA 2J2UA 2FTMA 1UK4A 1GI1A 2ZFTA 3BSQA 4WWYA 4MVNA 5F8XA 2YNAA 1C2MA 3B23B 5GIBA 1GWAA 3Q00A 5EXMA 5EXNA 2BMGB 3FANA 4B2AA 3RXLA 1O0DH 1OPHB 4TY6A 1EASA 2GX4A 1T4UH 3BV9B 1P0SH 4ISLA 3RC5A 2G8TA 2XBVA 2WUBA 1HV7A 2BDAA 2UWPA 2Y7XA 4GPGA 1NRQH 2ULLA 1GJDB 2LNCA 3A88A 4UEHH 3ATIA 5J4SA 1T8MA 1UK3A 5C5NA 1K1MA 4E05H 3A89A 2TRMA 1T8LA 3BG4B 3ZZ7A 1V2ST 5A8YA 1QQUA 1JBUH 4I8KA 1OS8A 2OUAA 2PR3A 1XVMA 3C1KA 4ABGA 1MKXK 3UOPA 3GY7A 5FCRA 4B1TA 1FIWA 3SJKA 3A83A 2BXUH 5DP3A 1TOMH 2XBWA 2O8UA 2H9TH 2J92A 1MKXH 4GSOA 3L3TA 1GBFA 4ZXYH 4AFSA 2QF0A 2F9NA 1O3AA 2ZGHA 2UWLA 3JZ2B 1ZTLA 3SU3A 4DVAU 2GCHG 1VCPA 1IQJA 3F68H 1MTWA 1NRNH 4JZ1A 2FI5E 3VPKA 1D3DB 1GBHA 3RXAA 1QCPA 4JK5A 3VB5A 7ESTE 1O3FA 3T5FH 1W7XH 3GY6A 4BTTB 1YKTA 1ZRBA 2NU4E 2IOTA 1ID5H 2Z3CA 3KEEA 3LGWA 1Y3XA 1QFKH 2M5TA 2ZFPH 1C2DA 3SUDA 5L2ZH 1E36B 2VIWA 1TX7A 3LU9B 1O2JA 1ZHRA 3NUMA 3EYDA 5JBCS 1EPTB 1TNHA 3I78A 3FZZA 5GDSH 4THNH 1V2MT 4XBDA 1KSNA 4CBNA 1TQ0B 3GOVB 4B71A 3NCLA 2ZU3A 2BM2A 1BIOA 1SL3A 1SQAA 4JZEH 4KP0A 3TPIZ 4O03A 1Y5UT 1YLCA 5T3HA 1SBWA 1CHOG 5T6GA 1GJ8B 1ANBA 1P3CA 1KXBA 2Y5FA 4FU7A 4FUEA 5ESBA 1UTLM 1P09A 1LDTT 4ZMAH 4FVDA 3AW0A 1RTFB 1BMAA 4FUJA 1C2GA 3P6ZB 4NIWA 1SHHB 4KKDA 3RXVA 1TPPA 1V2RT 5AF9H 4O3UA 3U69H 2TGAA 3SUFA 5DO4H 2B8OH 5A09A 2ALVA 2W26A 3MHWU 2Q6DA 1EZQA 1UK2A 3MO3A 1O5EH 4MDSA 3SHCH 4X6PA 3T2NA 1C2JA 4X2VA 2OLGA 4JYVH 3V3MA 4Y11E 1UTMA 2PLXA 2TPIZ 2V0BA 2FOCA 4J1YA 2GCTC 1DLKB 3O8CA 1ZPZA 4IBLH 2AH4X 1KTSB 1RXPA 3TU7H 3NXPA 3RXSA 2ESTE 3RMMH 4X1SU 5GWZA 2C8WB 2AS9A 4X1NU 8ESTE 4QT8C 3U98H 1SOZA 2EI8A 1NO9H 3ZVDA 4IC6A 1HAGE 1XM1A 3LH1A 2BLQA 3VFEA 1HRTH 1QBVH 4MLFB 2FI3E 3SU2A 3P95A 3A8BA 3AW1A 6LPRA 1SC8U 1O38A 2ZC9H 2GCTB 3KNXA 2A5KA 4ZKSU 2I6QA 1UVUH 1BJUA 1YYY1 2BY6X 1P06A 4INHA 1EQ9A 4K3JA 4K8YA 1XUKA 3RM0H 3VB4A 2GKVE 5A8XA 1GHZA 3M3TA 3QO6A 1L1NA 4TY7A 3BTQE 1J8AA 1W0YH 3GYMA 3RU4D 3RXOA 1XKBC 1KIGH 3B9FH 2UUFB 4CBOA 2PGQB 2A5IA 3EE0B 3EQ0H 1HYLA 1M9UA 2WYGA 4CRFA 1V2OT 3V0XA 5HGGA 5A2MH 1TONA 1IHTH 4TWWA 2O8TA 1V2JT 3Q3KA 2Z9GA 1GI7B 1P01A 2O8LA 1OWHA 4AZ2B 1KXAA 5IDKA 2V35A 4OS6A 5AHGH 3M5NA 3SU6A 1UTQA 1GCDA 1EOJA 4A7IB 1K21H 3NKKA 2FPZA 3S9CA 1WQSA 2SFAA 1DANH 3TH2H 3BTTE 2UUYA 3RXIA 3MU0A 2ZZUH 5T6FA 5H4IB 2ZU2A 4XFQA 4OGXA 1K1OA 3LGTA 1WV7H 1O3JA 2F9BH 5DKMA 2BD5A 2H1UA 2BD7A 2VIQA 2D8WA 2QY0B 1ZPBA 5DP4A 1GBEA 2QGRA 4A6LA 4BAOB 1C4Y2 1HJAC 1DY8A 4AFUA 1C5QA 2VNTA 4Q7YA 1C1MA 1QA7A 1LPZB 1QA0A 1C1TA 2XWAA 3D23A 3WY8A 1HNEE 2NWNA 1AE8H 3K6YA 3RXPA 4ZKRU 4I31A 2PGBB 3UY9A 4AG1A 2D2DA 2Y81A 4B74A 3S0NA 8KME2 3SORA 5JYIA 1GHWH 5K0HA 1FY3A 2GTBA 2ZWLH 5A0AE 1HPGA 2A5AA 1MAYA 2BHGA 2GZ8A 1BHXF 5LPRA 1ZSJA 3LH3A 5HMAA 3UNQA 4Z6AH 2C3SA 1S0QA 1TA6A 3RXQA 2VH6A 1HJAB 4ABHA 4MNXA 1W12U 2WINI 1CU1A 3LONA 3RXHA 3MYWA 1QL8A 3P8GA 1FONA 3S69A 3PTBA 1HAHH 1VR1H 2ZHFH 1GPZA 4CRAA 3TK5A 3FVFB 1GMDF 1LCYA 2XC0A 1XVOA 1LKAA 4Y0ZE 3BTDE 4Y8YA 1MAXA 3OU0A 3SZNA 1O5GH 6CHAC 3ZZ3A 1ESAA 2R2WU 2ANMH 1GHBF 2J9NA 1PQ7A 2GVFA 3ZZDA 2A4RA 5A0BA 1FY4A 4HTCH 3M7QA 3IWMA 4HFPB 1GI8B 2UUKB 1HAPH 1BMNH 1GBCA 1IQIA 1S81A 1YPGH 1EAIA 1AQ7A 1C2KA 3KCGH 1C5OH 1Y3UA 1FAXA 1FJSA 4X6MA 4FUDA 3RC6A 5EODA 2C8XB 1FN8A 4HI3A 2VVVA 1SB1H 2KAIB 4WMEA 1TABE 4AB9A 3OX7U 1HXEH 1IHSH 3PLPA 4NWKA 1C2IA 2PKAA 3QDZB 2PV9B 3GCTF 5DP9A 5EW1H 3P8OA 1C2HA 6CHAB 1ZRKA 3RXGA 1RTKA 3T25A 1ACBE 3SU0A 2HPPH 3SI4H 1SGNE 4IN1A 3U1IB 7GCHF 1Q31A 2C90B 4ISNA 1FMGA 3KF2A 1C5TA 1O5CB 1GBTA 1TBZH 4Y8ZA 4Y8XA 3SV9A 2VJ1A 2QF3A 3URDA 1S85A 1OP8A 4WVPE 2FO9A 2LPRA 2G5NA 3I29A 1W2KH 1LPKB 1FUJA 1SGFG 1EAUA 1G2LA 1OP0A 2FYQA 3RP2A 3LJJA 2DE9A 4SGAE 1O2RA 1C1WH 5F03A 1WYKA 1HFDA 4LXBH 3HPTB 3BN9A 3E1XB 4ABBA 1JIRA 1RFNA 3UOUA 4AORA 1DDJA 1RGQA 3KL6A 3LKWA 5FHTA 3V12A 1F5RA 4FU9A 1EZXC 1TGSZ 2EA3A 1VJ9U 3MI4A 4B75A 1OX1A 2QIQA 5CMXH 1FXYA 2P59A 3OY6U 3QWCH 2ZEBA 1XX9A 3NK8A 3M7UA 4KTCA 2BDHA 1AI8H 3QZQA 1V2TT 1YM0A 4K1EA 1ETSH 1ANEA 2FOFA 2XYAA 4FU8A 1LVYA 1TYNA 1AKSB 4UFFH 2A7CA 1XUGA 1GI0A 2GMTC 1N8OC 1CE5A 1A0HB 4D9QA 1C5PA 1P3EA 2ANYA 3NPSA 3ZYDA 2F9PA 3PTNA 4NIYA 1BRUP 1SVPA 8LPRA 1PPCE 2A45B 2ASUB 4BAKB 1GI6A 1O2HA 1O3BA
chains in the Genus database with same CATH superfamily
3SJ9A 1BZXE 1VKYA 1TGCA 1F7ZA 2FESH 1BRCE 1WSSH 3ELAH 4Q4LA 3RXBA 4MG3A 5JPMH 3CP7A 1ZMNA 2M2AA 3A7ZA 3FP7E 1C9PA 1AVGH 1HIAB 3SV6A 3GY4A 4UDWH 1P9SA 1GG6C 1C4V2 2R0KA 1RTLA 3SUGA 1NM6A 3RLWH 2GMTB 1N8OB 4ASUD 1Y5BT 3EA7A 2AGIX 2ZI2H 3STIA 1RS0A 3TK6A 5EW2H 1ESBA 1TNJA 1H8DH 1BBRK 1THRH 2QAAA 5DJ7A 4CR5A 3OYPA 2H5CA 4DURA 5EQRA 2GP9B 1C1RA 1GMDG 1MTUA 1O3IA 3BIVH 1TFXA 1BBRH 1YC0A 1MU8B 4MTBA 2ZQ2A 1NFYA 2Y5GA 2BVSH 1EP5A 1NN6A 3QN7A 4ACAA 3F6UH 4JZIA 5EPNA 4JMYA 4D7GA 1F2SE 2FODA 1O2PA 1NY22 2ZDMA 3T29A 9LPRA 4ABEA 4XE4A 2DUCA 3RXJA 1GHBG 1GG6B 1TB6H 2NU1E 2TGTA 2PWXA 3MNXA 1JXPA 2OINA 1Z8RA 4ZXXH 1GL1A 3GDSA 4ZHMU 2DE8A 2ZDLA 2RDLA 2KCYA 5C94A 3LJOA 2HGTH 3S9AA 3W1EA 1O35A 1Q3XA 5HYOA 2HWLB 1MBMA 2BVRH 1DWEH 4RKJB 3ZZ9A 1MH0A 1H1BA 3VGCC 5F6MA 4INKA 1EATA 2A0QB 1UO6A 2XWBI 2A4OA 3MMGA 4XOJA 1DITH 4ISIH 1OHHD 1AB9C 3M7TA 1HUTH 1MUEB 3GICB 1INCA 2VINA 4AGKA 2BD4A 3ZYEA 1TALA 3Q3YA 1C5UA 2VIOA 4PROA 4TT3D 5C1XA 2ZDNA 3H7OA 2NU3E 1QJ1B 2ZP0H 4Y6DA 3ZV8A 2VWMA 4BXSA 2XXLA 3F2GA 2HVXA 2OC1A 1F0TA 1QRZA 4B6FA 1V3XA 7GCHG 3NWUA 1NRRH 3ATWA 3P8NA 1L0ZA 1BTXA 2JJ1D 3I77A 4Y76A 1OWDA 3QGNB 4WMDA 4Y71A 1J9CH 2ODYB 2AEIH 2BDCA 2J97A 2YMSC 3RXFA 4X8SH 3QZRA 3RDZA 4D7FA 3VGCB 3QX5H 1LKBA 2P93A 2R3YA 3ZZCA 1G2MA 1BMLA 1CVWH 1CGHA 3MWIU 5EJ1A 1GI5A 1EKBB 1AB9B 2WHXA 1GI4A 2RFKC 1E34B 5BRRE 3VXFH 4WH6A 4K1SA 3F9EA 2FOBA 1K1LA 3GCOA 4NFEA 3JZ1B 1J17T 2FOHA 3KIDU 4BXWA 4CR9A 3ZZ5A 5DP8A 1Z1JA 5LGOA 5EXLA 4FUCA 1VCWA 4E7NA 1ELGA 1MBQA 1P04A 1UVSH 1TRYA 3F9FA 4ESTE 3T28A 1Y5AT 1J14A 1V6DA 1TOCB 2ZIQH 3ZZBA 1DXPA 3PMBB 3RUOA 1W14U 1C1SA 1EOLA 3ENSB 1PPFE 2OC0A 4NA9H 2ZPSA 1S82A 1N6YA 1XUFA 1MMJN 1GVZA 3PV4A 1DE7H 1MZAA 4YM9A 4GHTA 2HLDD 2O9QA 2F83A 1IQLA 1EAWA 1H8ED 3CENA 4UONA 1B5GH 3BTHE 3LGYA 4AFQA 1PFXC 3TNSA 1P2MA 2FZZA 2ANWA 2ZKSA 4NIVA 4WH8A 2G55A 1P2OA 3PMHB 1NC6A 1SPJA 1EB1H 1K1NA 4BTUB 3RLYH 4U32A 3ATMA 1YPLH 1ZLRA 2XNIA 4OS4A 2AIPA 1P2QA 1P9UA 2IPHA 2FS8A 2WV9A 1ZJKA 1MD8A 2VWLA 2ZCLP 1ZYOA 4CH8B 1H9IE 1VJAU 1C5LH 1AZZA 3TJVA 2QXHA 4ABDA 5JB9S 3BEFB 5EGMA 1TA2A 1SGQE 2PUXB 4I8LA 1KLIH 2LP6A 4K2YA 1KXDA 1WXRA 3ODDA 1C1UH 5DGJA 1TX8A 2VGCC 1HAVA 3SI3H 4K5ZA 4X0WU 2CXVA 2VB0A 1A2CH 2Q6FA 2PTNA 1EJMA 1K1IA 3W94A 2QCYA 1BTPA 2F9VA 1EAXA 1GHXH 4AYVB 2D1JA 3D65E 2ZECA 2FX6A 3IITA 3FOAA 1YY3A 1PQ5A 1DS2E 2BB4A 1BTWA 1GVLA 2AMDA 2R3UA 1Z71A 2LELA 4YLQH 2F9UA 2KX4A 1K22H 1C1PA 3PO1C 2GDEH 2HNTE 1BTZA 2W7UA 2ZU4A 1MZDA 1ELCA 3A7XA 1NS3A 1UHBB 1HAIH 1AHTH 2Y7ZA 4BOHA 1C2EA 2Z9IA 3ITIA 1O3NA 5C2ZA 1DY9A 1BBRE 1WU1A 2ZFQH 1E1RD 2VWOA 1DPOA 4Y0YE 3LOXA 2CF9H 3K65B 2AGEX 1XUHA 1IQGA 2VGCB 2G52A 2Z7FE 4RSPA 1P2KA 3DSOA 3HGNA 2ILNA 1XKAC 2WPLS 3A8AA 1S84A 1CQQA 2YMSD 1JIMA 5EG4A 3SNAA 2XCNA 4Y10E 5I46H 3HKIB 2B0FA 1V2LT 2J38A 1C5MD 1TIOA 1TLDA 3PO1B 4NSVA 1YPHE 3KN2A 1A5HA 4LOYH 1CGJE 1QJ7B 3BEIB 2CV3A 4YT6H 4LZ1H 4TWYA 2J34A 1TNGA 1IQHA 2ZPRA 1FPCH 1OXGA 3QUMP 2HLCA 3HK3B 1GBKA 2RA0A 3E16B 4X2XA 2W7SA 1F5LA 2QXJA 3EDXB 1FPHH 2PHBA 3AAUA 1UVTH 1GJCB 1AD8H 1UTKA 1Z8JB 3M36A 4O9VA 1ABIH 3UQVA 1MCTA 1TAWA 1TGBA 3UQOA 2GZ9A 5DG6A 2H6MA 1IQKA 1A0LA 2ZGXH 1VCQA 5HXFA 1JMOH 3EE7A 1BTUA 5FPTA 5ETXA 1O39A 4X8TH 2KCPA 1KTTB 3E6PH 4KTSA 2XOKD 5EQQA 1QL7A 1QHRB 2JIZD 4I8JA 1OP2A 1QNJA 2ZFRH 1GI3A 1BT7A 2BXTH 3RXKA 1AFQC 1SLVB 2STAE 1NRPH 1RD3B 1LO6A 3QLPH 2F4LA 1DM4B 2FXRA 1L1GA 5GNDA 2FYRA 5KGOA 1GDNA 4Q63A 1KDQA 1HBTH 1TRMA 1V2NT 1FLEE 2AERH 4ZH8A 4B73A 3S9BA 1AE5A 2GZ7A 4BANB 5HIZA 3MNSA 2BY8X 1ZTKA 3A82A 2AMPA 3DUXH 2P3FH 1C1NA 3UIRA 1EFRD 2PTCE 1O30A 2J94A 1NT1A 4Q2KA 1TMUH 1YPJH 3MU8A 4CRDA 5B6LA 1SQOA 5JBBS 1H4WA 2ZPQA 1O5FH 2H9HA 3PMJA 1RJXB 2OXSA 1PYTC 4JZFH 2ZTXA 1ETRH 1TPOA 1UTPA 1AFQB 1SGEE 3PRDA 3AK5A 5K7RA 2CMYA 1VITF 4TSFD 3ZIAD 1P12E 1O2LA 2VU8E 2F3CE 5FX6A 5FXLA 3WWFA 2Y80A 4XSKU 3SGBE 3LDXH 1P02A 2OC7A 4WXVA 3RMNH 3TITA 5JBTA 1YP9A 3UR9A 1ELEE 1O3EA 1KXCA 2XRCA 3OY5U 3M5LA 4AC9A 1A7SA 1DICA 1A0JA 1H9HE 3LC3A 2HPQH 2FTLE 1DLEA 2AMQA 1AFEH 1GMHF 1XMNB 3KHVA 1FN6A 3RXDA 3F2HA 2O8WA 1S6LA 4E7RG 2BD9A 1GI2A 1NTPA 2ZHQH 3BTEE 2HRVA 2WPIS 3ZZ6A 1XUJA 3LPRA 2C4FH 2BTCE 5F8TA 4ABAA 2QXIA 3ZVEA 2A7JA 4DJZB 2SNWA 1GBLA 1SR5C 1CGIE 3A7TA 1AWFH 1CA8B 2OCVB 2BDGA 2GDDA 3ZZAA 1UCYK 1Q2WA 1S0RA 3DD2H 1E79D 1UCYH 1F0UA 2BY5X 1ZZZA 5E0HA 2ZFFH 4AOQA 5FPYA 3FZDA 1YLDA 1CSOE 1EZUC 1MD7A 1C1QA 1GMCF 3M5MA 1OYTH 1O3KA 4ZKNU 2VWNA 2W3KA 1BITA 1RIWC 1O34A 1W7GH 2QC2A 3MNBA 3UTUH 4ZUHA 2FIRH 2A31A 3U8RH 2JH0D 1LTOA 3H5CB 1O2QA 3P8FA 1EPTA 1PPHE 1KLTA 4OS5A 5FBEA 2SGFE 3TLOA 1MQ5A 2EC9H 5BPEA 1DSTA 3M61U 1A3EH 4A1XA 5GPIB 3R3GB 5EOKA 1SGYE 3NZIA 3RMLH 3A87A 2W5EA 1PPZA 2UWOA 3KQDA 1ZJDA 5FPSA 1D3PB 3E0NB 2ZCKP 1S83A 3SJ8A 5L30H 3ATLA 1YCPK 2CK3D 1C5RA 1G36A 1Z1IA 1A61H 5E0JA 1NBME 1LHCH 2H5DA 3BTKE 1AVXA 4ISOA 1QB6A 4Y7AA 1RIWB 3GDUA 1UTNA 3SGQE 1YCPH 1D4PB 1ZOMA 3GS9A 3EGKH 4CRGA 2TBSA 4FUFA 4MPXA 1ELFA 3EA8A 1CT2E 1YLNA 1C5ZB 3FFGA 5HM9A 2P3UB 1BJVA 1NFUA 2UUJB 2C8YB 1YGCH 4A5TS 1GJ5H 3STJA 1KLJH 2FP7B 4FOUC 3ZV9A 1XXFA 1S5SA 3N7DA 4IC5A 2CF8H 3VB3A 1PYTD 1QY6A 4HGCA 1NU7B 3S7KB 5JBAS 3BG8A 1SLWB 3PWCA 2J5UA 4DOQA 1D6RA 1EJNA 4DIIH 1SQTA 4IGDA 3VB6A 1IQNA 1YBWA 4JCNA 1HJ8A 2FDAA 2BZ6H 3SGAE 2K0QA 1QB9A 4Q80A 3H7TA 1QB1A 5FCKA 4AG2A 3A7WA 4HG6A 2Z9KA 3BTFE 1O2UA 2P95A 2OD3B 1GI9B 3UNSA 1S6FA 1WBGB 3UB0A 1AMHA 1VITG 3PV2A 1ANDA 2W3IA 3FP6E 3E0PB 1EUFA 3NRLA 1DT2A 4MPUA 5TCAA 1ORFA 1BCUH 4MNVA 3SV2H 2FEQH 3AAVA 3VB7A 1G30B 3ZVAA 1UTJA 2OQ5A 2WPMS 4YOGA 1ARBA 1W3CA 2GD4B 4DCDA 3P92A 1YPKH 2ZHDA 2FOMB 1EP6A 1EZSC 2HNTC 4TPIZ 2FX4A 3ZZ4A 1GBMA 1GMHG 3UAIC 1O3CA 1TMTH 4GHQA 4JYUH 4KTUA 1WUNH 4H42U 3AVZA 3PB1E 6ESTA 1IAUA 4CRBA 1QRWA 1UVPA 3SBKA 3ESTA 2TGDA 1QJ6B 3E91A 2CJIA 2BY9X 1V2PT 4AB8A 2SGPE 1TGNA 3HGPA 1AIXH 3ZVFA 1FNIA 1L1JA 1UW7A 4U2WA 3A86A 5EU8A 3UPEA 2XCFA 1A46H 3SO3A 3PLKA 5C1YA 4MQAA 3CS7A 4NWLA 1W0ZU 4F4OC 4JK6A 1DXWA 1DFPA 1QRXA 4FUHA 1AWHB 1YPHC 1KXFA 4YO9A 2JH6D 1P2IA 1MCVA 1V2VT 2P3TB 1SGDE 1ZTJA 2ZG0H 1EB2A 2PUQH 1O2XA 1LVBA 1BDAA 1OOKB 2HOBA 4OGYA 2J98B 1O5AB 3QTVH 3T62A 4DT4A 4NSYA 1GMCG 2L6OA 3C27B 1GDQA 1QIXB 1YPEH 1PPGE 2QA9E 3FO8D 4H6TA 1MQ6A 9ESTA 5KECA 2Y5HA 3GY5A 4RI0A 6GCHG 4BTIB 2ODPA 3KQCA 3Q3XA 5FAHA 2FOAA 1V2WT 1J16A 2R0LA 2BQ6B 3AASA 4YT7H 1UCYE 2GV7A 5C67A 3VEQB 1GBIA 4NGAH 3MOCA 1O31A 4GUXA 4IW4E 3RXCA 1SFIA 1MTVA 3MH7A 4CRCA 3A8CA 3KYGA 3RU4T 1ABJH 2C8ZB 4LK4A 2Z94A 3SV7A 3GCHC 1P05A 3OTJE 2I6SA 1LVMA 1O3LA 5DP7A 2K1QA 1E37B 1BOQA 2FOEA 1NESE 4UE7H 3SU5A 4X2YA 1P8VC 2XC5A 5T6DA 3KGPA 1D6WA 3IG6B 1EXFA 5IK2D 3MTYA 4X6NA 5E2PA 4H6SB 1C1OA 2PSYA 2FS9A 1COWD 3QGJA 1HAOH 2F91A 2Z9LA 1LHEH 1C5NH 1TNIA 4X1RU 3A7VA 3SJOA 2THFB 2A7HA 5CHBA 1NROH 2O8MA 2WYJA 2R2MB 4ABJA 1CA0C 2GV6A 1PJPA 1F0RA 4P02A 1W11U 3GCHB 5DP6A 1A5IA 1O33A 3FP8E 1G3EA 1ZMLA 1SSXA 2YMSB 2J4IA 1WTGH 5DSFA 2A2XH 1SLXB 5GXPA 1AGJA 4Z1MD 4YTAA 1O3GA 3SNEA 2V3MA 2QN5T 3F2FA 1W10U 1AN1E 1FY1A 2BLWA 3ZVGA 4U30A 1KY9A 3VG8A 1GHAF 1TNKA 4R8TB 4I32A 1V2UT 2PP6A 2B5TB 3DFLA 1GGDC 5E0GA 2KAIA 5PTPA 5I25A 2WUCA 1CA0B 1EPTC 1FAKH 5HIYA 5SGAE 2H2ZA 2G5VA 4MPWA 2D26C 1Y3YA 1E0FD 1WDIA 1HAYB 2AGGX 1SHYA 1BTYA 1GJ6A 4UFDH 1G3CA 1ANCA 2AYWA 3RXEA 2BDBA 1A1RA 2R9PA 3LGUA 2KM0A 3R0FA 4XD7D 1GHYH 1TPAE 3E90B 1QBOA 1XXDA 2ZHEH 1TPSA 2RG3A 1Z6JH 1X7AC 3K2UA 4E06H 1O37A 1KXEA 4FXGH 3SU4A 5A8ZA 2FMJA 1IQMA 1K1PA 1GGDB 2BOHB 1C9TA 4SGBE 3BEUA 4TYDA 1D3QB 3O8DA 4O97A 2PKAB 1TBQH 2ZF0H 1SGIB 2G51A 3RMOH 4D8NA 1FIZA 3KQ5A 1MU6B 3FKSD 3TNTA 2ALPA 3MFJA 3HK6B 2XBYA 3F0PA 5EPYA 5C1UA 1A3BH 2BY7X 4Z0KA 1O3OA 5J4QA 1SGFA 1GJAB 1SFQB 3E8LA 4KELA 4YOIA 1IQEA 1LHGH 3T26A 2VIDA 4WXIA 1ARCA 1AKSA 1LQDB 3TGKE 1O2SA 7KMEH 4CH2B 5C20A 4INLA 2SGAA 1G3DA 2B7DH 2OTVA 4ASHA 1CT0E 3SOSA 2Q6GA 3ZVCA 4HZHA 5DPAA 2WSSD 3TGJE 2OBOA 1W8BH 3HKJB 3SYJA 2G81E 3Q77A 1GL0E 4WMFA 3TJUA 1C5SA 2Z9JA 1ZSLA 2OP9A 4AGJA 3MU5A 5TCCA 1O3MA 3UREA 2XTTB 4MNYA 1ZPCA 2BDYA 1GCTC 3M5OA 3LGIA 1THSH 1HIAA 1LQEA 1Y3VA 2G4UA 1BB0B 2EY4C 3M3SA 2QE7D 3F9GA 2P16A 2Z6BD 1ZHPA 3FAOA 3UFAA 1K2I1 2JKHA 1K1JA 1O2OA 1B0FA 4TPYA 3A8DA 1THPB 1FI8A 1SQRA 2GGVB 3SNDA 1F5KU 2Y6TA 3RXTA 2A2QH 1IQFA 2ZDVH 1G9IE 1TMBH 2G00A 5JDUB 2KZ4A 3TK9A 5B6OA 1OYQA 4LZ4B 3TJOA 4XBCA 2XBXA 1SGCA 3MO9A 3PMAB 1GDUA 4ABFA 1T8OA 2NU2E 4BNRA 1Y3WA 2XW9A 2ZHWH 5DN6D 2ZDAH 1U6QA 1ZGVA 1UMAH 1ZGIA 2RA3A 2ZNKH 3MNCA 4K1TA 1C5YB 1CBWC 1O2NA 1SGRE 4J2YB 4A1VA 3F1SB 1O3PB 1GCTB 1ETTH 3N7OA 3K9XB 1TE0A 3M35A 1O5DH 1GBBA 4O3TA 1OWJA 4NA8A 2K8IA 1LPGB 4K69A 5ABWA 1TGTA 5CHAC 3P17H 4R0IA 1K9OE 2W6JD 4UFEH 4Y7BA 3WW7A 1KYNA 3L6PA 2V3HH 3T27A 4AFZA 4JZDH 4DY7B 1L4DA 2EI6A 3MU4A 1GHVH 3SQHE 2Q1JA 4RN6A 1Z8GA 1GBJA 5AVDA 4JYTA 4AX9H 4XDEA 2FI4E 3GISB 4NFFA 1ELVA 3RM2H 1GHAG 1G32B 1DX5M 1ZSKA 4NZQA 1TWXB 3RXUA 2Z3DA 1CBWB 1QR3E 3ATKA 1C4U2 5DK1A 3OEHD 1T32A 2RCEA 3UWIA 3QTOH 1N1LA 3SNBA 1MABB 1P10A 1QTFA 1AU8A 5HM2A 2QV1A 5JB8S 5EJLA 1O2ZA 2BQWB 5DP5A 3BTGE 4GLYA 4Q7XA 3RXMA 3V13A 3SN8A 2P94A 3PM3A 4X6OA 1O2IA 3BIUH 4WJG2 5CHAB 2H9EH 5CE1A 1NPMA 3EAJA 3DHKH 3DT0H 3H09A 2AFQB 1Z7KA 2BDIA 4B2CA 1Y8TA 5T1VA 1C5XB 2ZQ1A 1FY5A 2JETC 4H4FA 4ZAEA 1SKYE 2SGEE 1D9IA 3A7YA 1GJ9B 4I33A 3LT3A 1QZ8A 1YPMH 5E2OA 1T4VH 1ELDE 1BQYA 5TJXA 1F92A 3GY8A 1HLTH 3V7TA 5GCHF 3RU4E 2XNDD 4ZCNA 1T8NA 1ZR0A 2HNTF 3GY3A 5C5OA 3GY2A 3LIWA 5IYTA 5LH8A 1QURH 3LC5A 2PW8H 4ZROA 2GT8A 4FUGA 2V7QD 1O2GH 1BA8B 1GVKB 4GCHF 2ZGCA 1OWIA 2SNVA 1NFWA 3TVJB 2JETB 1ZMJA 2ZTYA 1P03A 1NBMD 1PQAA 3BTME 2G4TA 1UJ1A 2QYIA 4D76A 2GT7A 1A4WH 4YZUA 4M7GA 3SUEA 4FVBA 1NRSH 4K8BA 2CN0H 2HALA 1VGCC 1Z8IB 1O3DA 5EJZA 2FM2A 2V6NA 1FV9A 1O3HA 2BOKA 2BYAX 2ZCHP 1HDTH 1HGTH 4YOJA 2A1DB 5GJ4B 1TRNA 1V2KT 2A4GA 3RC4A 1L2EA 1TNLA 3SQEE 2CGAA 1NZQH 2P8OC 2ZGJA 3G01A 1DVAH 2BLOA 3TH4H 3W95A 6GCHF 2BD8A 3CNRA 4DG4A 3MO6A 3O8RA 2PSXA 1OSSA 5E8EH 1C5WB 3TIUA 2ZGBH 1FDPA 1BTHH 4GAWA 3B8JA 1AZ8A 2Y82A 4FUIA 2BQ7B 1JRSA 1MTSA 3A81A 2YOLA 8GCHF 4U01A 1H8IH 4YXWD 1VGCB 1ELTA 3U8OH 1HXFH 3DA9B 3ODFA 4F48B 2ANKH 4ZHAA 1ZHMA 4Y79A 3TJNA 1TBRH 2NU0E 3F9HA 1PPBH 3U8TH 1C5VA 4CHAC 4F49A 1BMFD 2BD2A 2QF4A 1NFXA 3VXEH 4AN7A 2B9LA 2QXGA 4CREA 3OSYA 1QQ4A 1DSUA 3QK1A 4IS5A 2P8OB 1DOJA 4A92A 3DFJA 1ELBA 2FOGA 2JJ2D 1O2YA 2ODQA 4NZLA 2WPHS 2AIQA 1S6HA 2F9OA 4NG9H 3HATH 3MH6A 2OBQA 1ELAA 1P2NA 4VGCC 2FLBH 4GVUA 1UHBA 1GJ7B 2XC4A 1O32A 4Q7ZA 3TH3H 1WQVH 4M9FA 1H8HD 2L74A 2EI7A 4X1PU 5KEDA 4IMQA 1E38B 3MU1A 4XBBA 2WPJS 4KGAA 2ZU1A 1SI5H 2J95A 2JH5D 2IJOB 5G4BA 4CHAB 7LPRA 3UR6A 1LMWB 4AYYB 4WY3A 1HAVB 2VH0A 1G37A 1O2WA 1QL9A 3P70B 4YESB 2WV4A 1DWDH 2IN2A 4K60A 1BRAA 2EEKA 3EA9A 2BVXH 3URCA 3L33A 2ZTZA 1WOFA 3M3VA 3GCNA 1HAXB 1PPEE 4DGJA 1TX6A 1MKWK 1SGTA 1K28D 3PYHA 5FX5A 4X8VH 2VVUA 1A5GH 4MPVA 4VGCB 4ZKOU 4DIHH 5LPEA 3UWJH 5F8ZA 1TQ7B 1QBNA 2BLVA 2PKSC 1Y59T 1G3BA 1O5BB 2BX3A 1O2VA 2TGPZ 1MKWH 4YLUA 1HAZB 2ZDKA 1MTNC 2OQUA 4UD9H 3SHAH 3O8BA 1SOTA 4DT7B 3KQBA 1AO5A 3K6ZA 3D49H 4NCYA 4OS1A 2SGDE 3SU1A 3S7HB 2Z3EA 4WF8A 2A32A 3MH4A 4IN2A 2GCHF 2YNBA 2GJGA 3DSPA 4ISHH 1T31A 2SGQE 1B0EA 4X1QU 3TGIE 5GCHG 1P11E 4OS2A 3RXRA 4BAQB 2STBE 5AFYH 4NA7A 2V3OH 2ZU5A 1J15A 1WCZA 1VITH 1DWCH 1CO7E 3KQEA 1EX3A 3PLBA 1FZZA 2VVCA 2PKSB 4B76A 1YF4A 1DUEA 2FWWA 2VIVA 1QGFA 1N6XA 1O2KA 5FBIA 4MNWA 1MTNB 1P2JA 3GYLB 3OE7D 1AVWA 4GCHG 3A84A 1UVOA 3UNRA 1GJ4H 3CS0A 2A4QA 2WPDD 3SW2B 4P00A 2HVYB 2AHME 5AFZH 1GBAA 1OWKA 1JWTA 1AUJA 4X8UH 1DUAA 4NIXA 1W13U 1O2TA 1BMMH 1L4ZA 2FLRH 1Z6EA 4I8HA 1F0SA 1CHOF 3UUZA 1O2MA 4FUBA 5LPFA 2TIOA 1GJBB 4BAHB 3BF6H 1BRBE 1UTOA 3SNCA 1D3TB 1FY8E 3A80A 1PQ8A 2CHAC 2VIPA 5EQSA 1BUIA 1JRTA 4IMZA 3GDVA 1CHGA 1SGPE 1BHXB 1LHDH 1P57B 3MH5A 1CT4E 2BX4A 4ABIA 3DCLA 1C1VH 1LVOA 3PWBA 1NU9A 2ZA5A 3U1JB 1C2FA 1O36A 3SV8A 1T7CA 4B2BA 3PROA 3BTWE 4ZHLU 3SZEA 4RKOB 1IOEA 1FX0B 1H9LB 4A1TA 1EJAA 2KR7A 3E3TA 2IPQX 2WPKS 1C2LA 1XUIA 1B7XB 1KDQB 1SG8B 1DWBH 1YCPM 8GCHG 4I7YH 5L6NH 1V2QT 2ZO3H 3LGVA 3M37A 3SJIA 4UFGH 1SMFE 1LHFH 2CHAB 3FN8A 3N99A 2ZFSA 4X2WA 3U9AH 5C3NA 1OWEA 4BAMB 4OS7A 1JOUB 4B6EA 1SLUB 2BZAA 3GCTG 1E35B 5CDFE 4DW2U 1HB0B 3Q76A 1GBDA 1OKXA 2BD3A 2WV5A 1ESTA 1HJ9A 1WTHD 4D9RA 3ZVBA 3D62A 4I8GA 5A0CA 5L2YH 3BG4C 1WAYB 2PFEA 1VZQH 3A85A 1AY6H 1AUTC 1FQ3A 2OC8A 5ESTE 1HCGA 2C93B 2IJD1 3ZZ8A 1RRKA 2J2UA 2FTMA 1UK4A 1GI1A 2ZFTA 3BSQA 4WWYA 4MVNA 5F8XA 2YNAA 1C2MA 3B23B 5GIBA 1GWAA 3Q00A 5EXMA 5EXNA 2BMGB 3FANA 4B2AA 3RXLA 1O0DH 1OPHB 4TY6A 1EASA 2GX4A 1T4UH 3WWBA 3OTPA 3BV9B 1P0SH 1K0HA 4ISLA 3RC5A 2G8TA 2XBVA 2WUBA 1HV7A 2BDAA 2UWPA 2Y7XA 4GPGA 1NRQH 2ULLA 1GJDB 2LNCA 3A88A 4UEHH 3ATIA 5J4SA 1T8MA 1UK3A 5C5NA 1K1MA 4E05H 3A89A 2TRMA 1YWUA 1T8LA 3BG4B 3ZZ7A 1V2ST 5A8YA 1QQUA 1JBUH 4I8KA 1OS8A 2OUAA 2PR3A 1XVMA 3C1KA 4ABGA 1MKXK 3UOPA 3GY7A 5FCRA 4B1TA 1FIWA 3SJKA 3A83A 2BXUH 5DP3A 1TOMH 2XBWA 2O8UA 1E1QD 2H9TH 1MKXH 2J92A 4GSOA 3L3TA 1GBFA 3OAAD 4ZXYH 4AFSA 2QF0A 2F9NA 1O3AA 2ZGHA 2UWLA 3JZ2B 1ZTLA 3SU3A 4DVAU 2RDEA 2GCHG 1VCPA 1IQJA 3F68H 3PRBA 1MTWA 1NRNH 4JZ1A 2FI5E 3VPKA 1D3DB 1GBHA 3RXAA 2OK5A 1QCPA 4JK5A 3VB5A 7ESTE 1O3FA 3T5FH 1W7XH 3GY6A 4BTTB 1YKTA 1ZRBA 2NU4E 2IOTA 1ID5H 2Z3CA 3KEEA 3LGWA 1Y3XA 1QFKH 2M5TA 2ZFPH 1C2DA 3SUDA 5L2ZH 1E36B 2VIWA 1TX7A 3LU9B 1O2JA 1ZHRA 3NUMA 3EYDA 5JBCS 1EPTB 1TNHA 3I78A 3FZZA 5GDSH 4THNH 1V2MT 4XBDA 1KSNA 5C0UA 4CBNA 1TQ0B 3GOVB 4B71A 3NCLA 2ZU3A 2BM2A 1BIOA 1SL3A 1SQAA 4JZEH 4KP0A 3TPIZ 4O03A 1Y5UT 1YLCA 5T3HA 1SBWA 1CHOG 5T6GA 1GJ8B 3PV5A 1ANBA 1P3CA 1KXBA 2Y5FA 4FU7A 4I86A 4FUEA 5ESBA 1UTLM 1P09A 1LDTT 4ZMAH 4FVDA 3AW0A 1RTFB 1BMAA 4FUJA 1C2GA 3P6ZB 4NIWA 1SHHB 4KKDA 3RXVA 1TPPA 1V2RT 5AF9H 4O3UA 5EIYA 3U69H 2TGAA 3SUFA 5DO4H 2B8OH 5A09A 2ALVA 2W26A 3MHWU 2Q6DA 1EZQA 1UK2A 3MO3A 1O5EH 4MDSA 3SHCH 4X6PA 3T2NA 1C2JA 3MQKC 4X2VA 2OLGA 4JYVH 3V3MA 4Y11E 1UTMA 2PLXA 2TPIZ 2V0BA 2FOCA 5C17A 4J1YA 2GCTC 1DLKB 3O8CA 3OFND 1ZPZA 4IBLH 2AH4X 1KTSB 1RXPA 3TU7H 3F0OA 3NXPA 3RXSA 3U28C 2ESTE 3RMMH 4X1SU 5GWZA 4RT1A 2C8WB 2AS9A 4X1NU 8ESTE 4QT8C 4F55A 3U98H 1SOZA 2VBCA 2EI8A 1NO9H 3ZVDA 4IC6A 1HAGE 1XM1A 3LH1A 2BLQA 3VFEA 1HRTH 1QBVH 4MLFB 2FI3E 3SU2A 3P95A 3A8BA 3AW1A 6LPRA 1SC8U 1O38A 2ZC9H 2GCTB 3KNXA 2A5KA 4ZKSU 2I6QA 1UVUH 1BJUA 1YYY1 2BY6X 1P06A 4INHA 1EQ9A 4K3JA 4K8YA 1XUKA 3RM0H 3VB4A 2GKVE 5A8XA 1GHZA 3M3TA 3QO6A 1L1NA 4TY7A 3BTQE 1J8AA 1W0YH 3GYMA 3RU4D 3RXOA 1XKBC 1KIGH 3B9FH 2UUFB 4CBOA 2PGQB 2A5IA 3EE0B 3EQ0H 1HYLA 1M9UA 2J98A 2WYGA 4CRFA 5HKKD 1V2OT 3V0XA 5HGGA 5A2MH 1TONA 1IHTH 4TWWA 2O8TA 1V2JT 3Q3KA 2Z9GA 1GI7B 1P01A 2O8LA 1OWHA 4AZ2B 1KXAA 2W6ID 5IDKA 2V35A 4OS6A 5AHGH 3M5NA 3SU6A 1UTQA 1GCDA 1EOJA 4A7IB 1K21H 3NKKA 2FPZA 3S9CA 1WQSA 2SFAA 1DANH 3TH2H 3BTTE 2UUYA 3RXIA 3MU0A 2ZZUH 5T6FA 5H4IB 2ZU2A 4XFQA 4OGXA 1K1OA 3LGTA 1WV7H 2F43B 3F3BA 1O3JA 2F9BH 5DKMA 2BD5A 2H1UA 2BD7A 2VIQA 2D8WA 2QY0B 1ZPBA 5DP4A 4RT0A 1GBEA 2QGRA 4A6LA 4BAOB 1C4Y2 2WZQA 1HJAC 1DY8A 4AFUA 3OEED 1C5QA 2VNTA 4Q7YA 1C1MA 1QA7A 1LPZB 1QA0A 1C1TA 2XWAA 3D23A 3WY8A 1HNEE 2NWNA 1AE8H 3K6YA 3RXPA 4OM9A 4ZKRU 4I31A 2PGBB 3UY9A 4AG1A 2D2DA 2Y81A 4B74A 3S0NA 8KME2 3SORA 5JYIA 2QF5A 1GHWH 5K0HA 1FY3A 2GTBA 2ZWLH 5A0AE 2EQNA 1HPGA 2A5AA 1MAYA 2BHGA 2GZ8A 1BHXF 5LPRA 1ZSJA 3LH3A 5HMAA 3UNQA 4Z6AH 2C3SA 1S0QA 1TA6A 3RXQA 3DSGA 2VH6A 1HJAB 4ABHA 4MNXA 1W12U 2WINI 1CU1A 3LONA 3RXHA 3MYWA 1QL8A 3P8GA 1FONA 3KYFA 3S69A 3PTBA 1HAHH 1VR1H 2ZHFH 1GPZA 4CRAA 3TK5A 1W0JD 3FVFB 1GMDF 1LCYA 2XC0A 1XVOA 1LKAA 4XRNA 4Y0ZE 3BTDE 1KMHB 4Y8YA 1MAXA 3OU0A 3SZNA 1W0KD 1O5GH 6CHAC 3ZZ3A 1ESAA 2R2WU 2ANMH 1GHBF 2J9NA 1PQ7A 2GVFA 3ZZDA 2A4RA 5A0BA 1FY4A 4HTCH 3M7QA 3IWMA 4HFPB 1GI8B 2UUKB 1HAPH 1BMNH 1GBCA 1IQIA 1S81A 1YPGH 1EAIA 1AQ7A 1C2KA 3KCGH 1C5OH 5C0TA 1Y3UA 1FAXA 1FJSA 4X6MA 4FUDA 3RC6A 5EODA 2C8XB 1FN8A 4HI3A 2KCOA 2VVVA 1SB1H 2KAIB 4WMEA 1TABE 4AB9A 3OX7U 1HXEH 1IHSH 3PLPA 4NWKA 1C2IA 2PKAA 3QDZB 2PV9B 3GCTF 5DP9A 5EW1H 3P8OA 1C2HA 6CHAB 1ZRKA 3RXGA 1RTKA 3T25A 1ACBE 3SU0A 2HPPH 3SI4H 3N7EA 1SGNE 4IN1A 3U1IB 7GCHF 1Q31A 2C90B 4ISNA 1FMGA 3KF2A 1C5TA 1O5CB 2KCAA 1GBTA 1TBZH 4Y8ZA 4Y8XA 3SV9A 2VJ1A 2QF3A 3URDA 1S85A 1OP8A 4WVPE 2FO9A 2LPRA 2G5NA 3I29A 1W2KH 1LPKB 1FUJA 1SGFG 1EAUA 1G2LA 1OP0A 2FYQA 3RP2A 3LJJA 2DE9A 4SGAE 2KFWA 1O2RA 1C1WH 5F03A 1WYKA 1HFDA 4LXBH 3HPTB 3BN9A 3E1XB 4ABBA 1JIRA 1RFNA 3UOUA 4AORA 1DDJA 1RGQA 3KL6A 3LKWA 5FHTA 5FL7D 3V12A 1F5RA 4FU9A 1EZXC 1TGSZ 2EA3A 1VJ9U 3MI4A 4B75A 1OX1A 2QIQA 5CMXH 1FXYA 2P59A 3OY6U 4FETA 3QWCH 2ZEBA 1XX9A 3NK8A 3M7UA 4KTCA 2BDHA 1AI8H 3QZQA 1V2TT 1YM0A 4K1EA 1ETSH 1ANEA 2FOFA 2XYAA 4FU8A 5F53A 1LVYA 1TYNA 1AKSB 4UFFH 2A7CA 1XUGA 1GI0A 2GMTC 1N8OC 1CE5A 1A0HB 4ACBA 4D9QA 1C5PA 1P3EA 2ANYA 3NPSA 3ZYDA 2F9PA 3PTNA 4NIYA 1BRUP 1SVPA 8LPRA 1PPCE 2A45B 2ASUB 2JDID 4BAKB 1GI6A 1O2HA 1O3BA
chains in the Genus database with same CATH topology
3SJ9A 1BZXE 1TGCA 1F7ZA 2FESH 1BRCE 1WSSH 3ELAH 3RXBA 4MG3A 5JPMH 3CP7A 1ZMNA 3A7ZA 3FP7E 1C9PA 1AVGH 1HIAB 3SV6A 3GY4A 4UDWH 1P9SA 1GG6C 1C4V2 2R0KA 1RTLA 3SUGA 1NM6A 3RLWH 2GMTB 1N8OB 1Y5BT 3EA7A 2AGIX 2ZI2H 3STIA 1RS0A 3TK6A 5EW2H 1ESBA 1TNJA 1H8DH 1BBRK 1THRH 2QAAA 5DJ7A 4CR5A 3OYPA 2H5CA 4DURA 5EQRA 2GP9B 1C1RA 1GMDG 1MTUA 1O3IA 3BIVH 1TFXA 1BBRH 1YC0A 1MU8B 4MTBA 2ZQ2A 1NFYA 2Y5GA 2BVSH 1EP5A 1NN6A 3QN7A 3F6UH 4JZIA 5EPNA 4JMYA 4D7GA 1F2SE 2FODA 1O2PA 1NY22 2ZDMA 3T29A 9LPRA 4ABEA 4XE4A 2DUCA 3RXJA 1GHBG 1GG6B 1TB6H 2NU1E 2TGTA 2PWXA 3MNXA 1JXPA 2OINA 1Z8RA 4ZXXH 1GL1A 3GDSA 4ZHMU 2DE8A 2ZDLA 2RDLA 3LJOA 2HGTH 3S9AA 1O35A 1Q3XA 5HYOA 2HWLB 1MBMA 2BVRH 1DWEH 4RKJB 3ZZ9A 1MH0A 1H1BA 3VGCC 5F6MA 4INKA 1EATA 2A0QB 1UO6A 2XWBI 2A4OA 3MMGA 4XOJA 1DITH 4ISIH 1AB9C 3M7TA 1HUTH 1MUEB 3GICB 1INCA 2VINA 4AGKA 2BD4A 3ZYEA 1TALA 3Q3YA 1C5UA 2VIOA 4PROA 5C1XA 2ZDNA 3H7OA 2NU3E 1QJ1B 2ZP0H 4Y6DA 3ZV8A 2VWMA 4BXSA 2XXLA 2HVXA 2OC1A 1F0TA 1QRZA 1V3XA 7GCHG 3NWUA 1NRRH 3ATWA 3P8NA 1L0ZA 1BTXA 3I77A 4Y76A 1OWDA 3QGNB 4WMDA 4Y71A 1J9CH 2ODYB 2AEIH 2BDCA 3RXFA 4X8SH 3QZRA 3RDZA 4D7FA 3VGCB 3QX5H 1LKBA 2P93A 2R3YA 3ZZCA 1G2MA 1BMLA 1CVWH 1CGHA 3MWIU 1GI5A 1EKBB 1AB9B 1GI4A 1E34B 5BRRE 3VXFH 4WH6A 4K1SA 3F9EA 2FOBA 1K1LA 3GCOA 4NFEA 3JZ1B 1J17T 2FOHA 3KIDU 4BXWA 4CR9A 3ZZ5A 5DP8A 1Z1JA 5LGOA 5EXLA 4FUCA 1VCWA 4E7NA 1ELGA 1MBQA 1P04A 1UVSH 1TRYA 3F9FA 4ESTE 3T28A 1Y5AT 1J14A 1V6DA 1TOCB 2ZIQH 3ZZBA 1DXPA 3PMBB 3RUOA 1W14U 1C1SA 1EOLA 3ENSB 1PPFE 2OC0A 4NA9H 2ZPSA 1S82A 1N6YA 1XUFA 1MMJN 1GVZA 3PV4A 1DE7H 1MZAA 4YM9A 4GHTA 2O9QA 2F83A 1IQLA 1EAWA 3CENA 4UONA 1B5GH 3BTHE 3LGYA 4AFQA 1PFXC 3TNSA 1P2MA 2FZZA 2ANWA 2ZKSA 4NIVA 4WH8A 2G55A 1P2OA 3PMHB 1NC6A 1SPJA 1EB1H 1K1NA 4BTUB 3RLYH 4U32A 3ATMA 1YPLH 1ZLRA 2XNIA 4OS4A 2AIPA 1P2QA 1P9UA 2IPHA 2FS8A 1ZJKA 1MD8A 2VWLA 2ZCLP 1ZYOA 4CH8B 1H9IE 1VJAU 1C5LH 1AZZA 3TJVA 2QXHA 4ABDA 5JB9S 3BEFB 5EGMA 1TA2A 1SGQE 2PUXB 4I8LA 1KLIH 4K2YA 1KXDA 3ODDA 1C1UH 5DGJA 1TX8A 2VGCC 1HAVA 3SI3H 4K5ZA 4X0WU 2CXVA 2VB0A 1A2CH 2Q6FA 2PTNA 1EJMA 1K1IA 3W94A 2QCYA 1BTPA 2F9VA 1EAXA 1GHXH 4AYVB 2D1JA 3D65E 2ZECA 2FX6A 3IITA 2BB4A 1PQ5A 1DS2E 1BTWA 1GVLA 2AMDA 2R3UA 1Z71A 4YLQH 2F9UA 1K22H 1C1PA 3PO1C 2GDEH 2HNTE 1BTZA 2W7UA 2ZU4A 1MZDA 1ELCA 3A7XA 1NS3A 1UHBB 1HAIH 1AHTH 2Y7ZA 4BOHA 1C2EA 2Z9IA 3ITIA 1O3NA 5C2ZA 1DY9A 1BBRE 1WU1A 2ZFQH 2VWOA 1DPOA 4Y0YE 3LOXA 2CF9H 3K65B 2AGEX 1XUHA 1IQGA 2VGCB 2G52A 2Z7FE 4RSPA 1P2KA 3HGNA 2ILNA 1XKAC 2WPLS 3A8AA 1S84A 1CQQA 1JIMA 5EG4A 3SNAA 2XCNA 4Y10E 5I46H 3HKIB 2B0FA 1V2LT 2J38A 1C5MD 1TIOA 1TLDA 3PO1B 4NSVA 1YPHE 3KN2A 1A5HA 4LOYH 1CGJE 1QJ7B 3BEIB 2CV3A 4YT6H 4LZ1H 4TWYA 2J34A 1TNGA 1IQHA 2ZPRA 1FPCH 1OXGA 3QUMP 2HLCA 3HK3B 1GBKA 2RA0A 3E16B 4X2XA 2W7SA 1F5LA 2QXJA 3EDXB 1FPHH 2PHBA 3AAUA 1UVTH 1GJCB 1AD8H 1UTKA 1Z8JB 3M36A 4O9VA 1ABIH 3UQVA 1MCTA 1TAWA 1TGBA 3UQOA 2GZ9A 5DG6A 2H6MA 1IQKA 1A0LA 2ZGXH 1VCQA 5HXFA 1JMOH 1BTUA 5FPTA 5ETXA 1O39A 4X8TH 1KTTB 3E6PH 4KTSA 5EQQA 1QL7A 1QHRB 4I8JA 1OP2A 1QNJA 2ZFRH 1GI3A 1BT7A 2BXTH 3RXKA 1AFQC 1SLVB 2STAE 1NRPH 1RD3B 1LO6A 3QLPH 1DM4B 2FXRA 1L1GA 2FYRA 1GDNA 1KDQA 1HBTH 1TRMA 1V2NT 1FLEE 2AERH 4ZH8A 4B73A 3S9BA 1AE5A 2GZ7A 4BANB 3MNSA 2BY8X 1ZTKA 3A82A 2AMPA 3DUXH 2P3FH 1C1NA 3UIRA 2PTCE 1O30A 2J94A 1NT1A 4Q2KA 1TMUH 1YPJH 3MU8A 4CRDA 1SQOA 5JBBS 1H4WA 2ZPQA 1O5FH 2H9HA 3PMJA 1RJXB 2OXSA 1PYTC 4JZFH 2ZTXA 1ETRH 1TPOA 1UTPA 1AFQB 1SGEE 5K7RA 2CMYA 1VITF 1P12E 1O2LA 2VU8E 2F3CE 5FX6A 5FXLA 2Y80A 4XSKU 3SGBE 3LDXH 1P02A 2OC7A 4WXVA 3RMNH 3TITA 5JBTA 1YP9A 3UR9A 1ELEE 1O3EA 1KXCA 2XRCA 3OY5U 3M5LA 1A7SA 1DICA 1A0JA 1H9HE 3LC3A 2HPQH 2FTLE 1DLEA 2AMQA 1AFEH 1GMHF 1XMNB 3KHVA 1FN6A 3RXDA 2O8WA 4E7RG 2BD9A 1GI2A 1NTPA 2ZHQH 3BTEE 2HRVA 2WPIS 3ZZ6A 1XUJA 3LPRA 2C4FH 2BTCE 5F8TA 4ABAA 2QXIA 3ZVEA 2A7JA 4DJZB 2SNWA 1GBLA 1SR5C 1CGIE 3A7TA 1AWFH 1CA8B 2OCVB 2BDGA 2GDDA 3ZZAA 1UCYK 1Q2WA 1S0RA 3DD2H 1UCYH 1F0UA 2BY5X 1ZZZA 5E0HA 2ZFFH 4AOQA 5FPYA 3FZDA 1YLDA 1CSOE 1EZUC 1MD7A 1C1QA 1GMCF 3M5MA 1OYTH 1O3KA 4ZKNU 2VWNA 2W3KA 1BITA 1RIWC 1O34A 1W7GH 2QC2A 3MNBA 3UTUH 4ZUHA 2FIRH 2A31A 3U8RH 2JH0D 1LTOA 3H5CB 1O2QA 3P8FA 1EPTA 1PPHE 1KLTA 4OS5A 5FBEA 2SGFE 3TLOA 1MQ5A 2EC9H 5BPEA 1DSTA 3M61U 1A3EH 4A1XA 5GPIB 3R3GB 5EOKA 1SGYE 3NZIA 3RMLH 3A87A 2W5EA 1PPZA 2UWOA 3KQDA 1ZJDA 5FPSA 1D3PB 3E0NB 2ZCKP 1S83A 3SJ8A 5L30H 3ATLA 1YCPK 1C5RA 1G36A 1Z1IA 1A61H 5E0JA 1LHCH 2H5DA 3BTKE 1AVXA 4ISOA 1QB6A 4Y7AA 1RIWB 3GDUA 1UTNA 3SGQE 1YCPH 1D4PB 1ZOMA 3EGKH 4CRGA 2TBSA 4FUFA 4MPXA 1ELFA 3EA8A 1CT2E 1C5ZB 3FFGA 5HM9A 2P3UB 1BJVA 1NFUA 2UUJB 2C8YB 1YGCH 4A5TS 1GJ5H 3STJA 1KLJH 2FP7B 3ZV9A 1XXFA 1S5SA 4IC5A 2CF8H 3VB3A 1PYTD 1QY6A 4HGCA 1NU7B 3S7KB 5JBAS 3BG8A 1SLWB 3PWCA 4DOQA 1D6RA 1EJNA 4DIIH 1SQTA 4IGDA 3VB6A 1IQNA 1YBWA 4JCNA 1HJ8A 2FDAA 2BZ6H 3SGAE 4Q80A 1QB9A 3H7TA 1QB1A 5FCKA 4AG2A 3A7WA 2Z9KA 3BTFE 1O2UA 2P95A 2OD3B 1GI9B 3UNSA 1S6FA 1WBGB 1AMHA 1VITG 1ANDA 2W3IA 3FP6E 3E0PB 1EUFA 1DT2A 4MPUA 5TCAA 1ORFA 1BCUH 4MNVA 3SV2H 2FEQH 3AAVA 3VB7A 1G30B 3ZVAA 1UTJA 2OQ5A 2WPMS 4YOGA 1ARBA 1W3CA 2GD4B 4DCDA 3P92A 1YPKH 2ZHDA 2FOMB 1EP6A 1EZSC 2HNTC 4TPIZ 2FX4A 3ZZ4A 1GBMA 1GMHG 1O3CA 1TMTH 4GHQA 4JYUH 4KTUA 1WUNH 4H42U 3AVZA 3PB1E 6ESTA 1IAUA 4CRBA 1QRWA 1UVPA 3SBKA 3ESTA 2TGDA 1QJ6B 3E91A 2CJIA 2BY9X 1V2PT 4AB8A 2SGPE 1TGNA 3HGPA 1AIXH 3ZVFA 1FNIA 1L1JA 4U2WA 3A86A 5EU8A 3UPEA 2XCFA 1A46H 3SO3A 3PLKA 5C1YA 4MQAA 3CS7A 4NWLA 1W0ZU 4F4OC 4JK6A 1DXWA 1DFPA 1QRXA 4FUHA 1AWHB 1YPHC 1KXFA 4YO9A 2JH6D 1P2IA 1MCVA 1V2VT 2P3TB 1SGDE 1ZTJA 2ZG0H 1EB2A 2PUQH 1O2XA 1LVBA 1BDAA 1OOKB 2HOBA 4OGYA 1O5AB 3QTVH 3T62A 4NSYA 1GMCG 3C27B 1GDQA 1QIXB 1YPEH 1PPGE 2QA9E 4H6TA 9ESTA 1MQ6A 2Y5HA 3GY5A 6GCHG 4BTIB 2ODPA 3KQCA 3Q3XA 5FAHA 2FOAA 1V2WT 1J16A 2R0LA 2BQ6B 3AASA 4YT7H 1UCYE 2GV7A 5C67A 3VEQB 1GBIA 4NGAH 3MOCA 1O31A 4GUXA 4IW4E 3RXCA 1SFIA 1MTVA 3MH7A 4CRCA 3A8CA 3RU4T 1ABJH 2C8ZB 4LK4A 2Z94A 3SV7A 3GCHC 1P05A 3OTJE 2I6SA 1LVMA 1O3LA 5DP7A 2K1QA 1E37B 1BOQA 2FOEA 1NESE 4UE7H 3SU5A 4X2YA 1P8VC 2XC5A 5T6DA 3KGPA 1D6WA 3IG6B 1EXFA 3MTYA 4X6NA 5E2PA 4H6SB 1C1OA 2PSYA 2FS9A 3QGJA 1HAOH 2F91A 2Z9LA 1LHEH 1C5NH 1TNIA 4X1RU 3A7VA 3SJOA 2THFB 2A7HA 1NROH 2O8MA 2WYJA 2R2MB 4ABJA 1CA0C 2GV6A 1PJPA 1F0RA 1W11U 3GCHB 5DP6A 1A5IA 1O33A 3FP8E 1G3EA 1SSXA 1ZMLA 2J4IA 1WTGH 2A2XH 1SLXB 5GXPA 1AGJA 4YTAA 1O3GA 3SNEA 2QN5T 1W10U 1AN1E 1FY1A 2BLWA 3ZVGA 4U30A 1KY9A 1GHAF 1TNKA 4R8TB 4I32A 1V2UT 2B5TB 3DFLA 1GGDC 5E0GA 2KAIA 5PTPA 5I25A 2WUCA 1CA0B 1EPTC 1FAKH 5SGAE 2H2ZA 2G5VA 4MPWA 2D26C 1Y3YA 1E0FD 1HAYB 2AGGX 1SHYA 1BTYA 1GJ6A 4UFDH 1G3CA 1ANCA 2AYWA 3RXEA 2BDBA 1A1RA 2R9PA 3LGUA 3R0FA 1GHYH 1TPAE 3E90B 1QBOA 1XXDA 2ZHEH 1TPSA 2RG3A 1Z6JH 1X7AC 3K2UA 4E06H 1O37A 1KXEA 4FXGH 3SU4A 5A8ZA 2FMJA 1IQMA 1K1PA 1GGDB 2BOHB 1C9TA 4SGBE 3BEUA 4TYDA 1D3QB 3O8DA 4O97A 2PKAB 1TBQH 2ZF0H 1SGIB 2G51A 3RMOH 4D8NA 1FIZA 1MU6B 3TNTA 2ALPA 3MFJA 3HK6B 2XBYA 5EPYA 5C1UA 1A3BH 2BY7X 4Z0KA 1O3OA 5J4QA 1SGFA 1GJAB 1SFQB 3E8LA 4KELA 4YOIA 1IQEA 1LHGH 3T26A 2VIDA 4WXIA 1ARCA 1AKSA 1LQDB 3TGKE 1O2SA 7KMEH 4CH2B 5C20A 4INLA 2SGAA 1G3DA 2B7DH 2OTVA 4ASHA 1CT0E 3SOSA 2Q6GA 3ZVCA 4HZHA 5DPAA 3TGJE 2OBOA 1W8BH 3HKJB 2G81E 3Q77A 1GL0E 4WMFA 3TJUA 1C5SA 2Z9JA 1ZSLA 2OP9A 4AGJA 3MU5A 5TCCA 1O3MA 3UREA 2XTTB 4MNYA 1ZPCA 2BDYA 1GCTC 3M5OA 3LGIA 1THSH 1HIAA 1LQEA 1Y3VA 2G4UA 1BB0B 3M3SA 3F9GA 2P16A 2Z6BD 1ZHPA 3FAOA 3UFAA 1K2I1 2JKHA 1K1JA 1O2OA 1B0FA 4TPYA 3A8DA 1THPB 1FI8A 2GGVB 3SNDA 1F5KU 2Y6TA 3RXTA 2A2QH 1IQFA 2ZDVH 1G9IE 1TMBH 2G00A 5JDUB 3TK9A 5B6OA 1OYQA 4LZ4B 3TJOA 4XBCA 2XBXA 1SGCA 3MO9A 3PMAB 1GDUA 4ABFA 1T8OA 2NU2E 4BNRA 1Y3WA 2XW9A 2ZHWH 2ZDAH 1U6QA 1ZGVA 1UMAH 1ZGIA 2RA3A 2ZNKH 3MNCA 4K1TA 1C5YB 1CBWC 1O2NA 1SGRE 4J2YB 4A1VA 3F1SB 1O3PB 1GCTB 1ETTH 3N7OA 3K9XB 1TE0A 3M35A 1O5DH 1GBBA 4O3TA 1OWJA 4NA8A 1LPGB 4K69A 5ABWA 1TGTA 5CHAC 3P17H 4R0IA 1K9OE