2TRMA

The three-dimensional structure of asn102 mutant of trypsin. role of asp102 in serine protease catalysis
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
223
structure length
223
Chain Sequence
IVGGYTCQENSVPYQVSLNSGYHFCGGSLINDQWVVSAAHCYKSRIQVRLGEHNINVLEGNEQFVNAAKIIKHPNFDRKTLNNNIMLIKLSSPVKLNARVATVALPSSCAPAGTQCLISGWGNTLSSGVNEPDLLQCLDAPLLPQADCEASYPGKITDNMVCVGFLEGGKDSCQGDSGGPVVCNGELQGIVSWGYGCALPDNPGVYTKVCNYVDWIQDTIAAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRYPSIN
publication title The three-dimensional structure of Asn102 mutant of trypsin: role of Asp102 in serine protease catalysis.
pubmed rcsb
source organism Rattus norvegicus
molecule tags Hydrolase (serine proteinase)
total genus 42
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1988-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2trmA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2trmA02
4ISIH 3A7YA 5EQQA 1N1LA 3F1SB 4AFZA 3MHWU 2NU0E 3A85A 3KCGH 1GI1A 2ULLA 3AW1A 1BTYA 2RCEA 5A09A 4FUGA 1CGIE 1LPKB 1FIZA 3FP8E 4R0IA 1HAVA 1GBMA 2G00A 2VIOA 2HPPH 2VVVA 4ABJA 4ISHH 2W3IA 1OS8A 4B1TA 1DWBH 5FCKA 2BXUH 1KXEA 1PYTD 3GY5A 3LT3A 4CREA 3M35A 1O3EA 1TOMH 3I78A 1V2TT 4RSPA 4IMQA 1A61H 3A86A 2H2ZA 2O8MA 1PJPA 4ZMAH 4OGXA 5LPRA 1F2SE 1OYTH 1EPTC 1XKBC 1P3EA 2OC1A 3MOCA 1P3CA 3L6PA 2CMYA 4OS2A 4NSVA 1KXFA 3SU1A 1FY8E 4YOJA 4MDSA 2OP9A 2W26A 1GBKA 1DVAH 2HNTC 1GHBG 1DT2A 1GL0E 1AZZA 4FUDA 1FV9A 1TABE 4JK6A 3FAOA 2ODPA 3A8CA 3SJ9A 1LVBA 2BX4A 1QL7A 3E8LA 4Y6DA 5E0GA 1W3CA 1EOJA 5IYTA 1ZGIA 4NGAH 1SQAA 2J34A 5T6FA 1TYNA 1O5AB 3SU3A 4A6LA 4AYYB 2WPLS 1SOZA 3RU4E 3UTUH 1W12U 2UWPA 2ZHEH 1SLWB 2GV6A 4FU8A 1A3EH 3GDUA 6GCHF 5PTPA 1S6HA 2BLQA 1ZTJA 1U6QA 1J15A 4Y10E 3TK5A 1VGCB 2NU4E 1CT4E 1H8DH 3E3TA 4HTCH 3ZZ8A 1Z8IB 1OPHB 1QBOA 4MQAA 1VITG 4TWYA 1MU8B 2C93B 5CHAC 4UFDH 3TH2H 3KF2A 3PO1C 3SNAA 5DP5A 1UVUH 1E38B 2BTCE 1AVWA 2Y5HA 4B2CA 2WV5A 1ZMNA 1TMBH 1MBMA 5ETXA 4GUXA 5DGJA 1DXWA 2BZAA 1T7CA 1MKWH 2V6NA 5C1XA 1PPFE 3URDA 1TA6A 2FM2A 4Q7YA 4TY7A 1FXYA 1Y3XA 3LH3A 9LPRA 3T5FH 3ZZAA 2C4FH 1EUFA 1O35A 1C4V2 1LO6A 1P04A 1G2MA 5ESTE 5C1YA 3RXGA 4K2YA 1AI8H 3EDXB 2ZKSA 1AKSB 3MTYA 2SNVA 2B8OH 2OD3B 2ZQ2A 1GG6C 5A8XA 1GGDC 3SU5A 1DWDH 1KTSB 1O2LA 1PFXC 2FESH 2SGAA 3HK6B 1UCYH 4X2WA 3E0PB 4FUCA 2SGQE 1T32A 1GHAG 4K5ZA 1P2QA 4X0WU 5FXLA 4Y8ZA 5FBEA 4A1VA 2JKHA 4Y76A 4ZAEA 2ZDKA 2GCHF 2GT7A 2AH4X 2BY6X 4MNWA 1SLVB 1MQ6A 3A88A 1QRXA 4MPVA 1TPAE 4YT7H 1O5DH 2HGTH 2Q6DA 2BDHA 3SQHE 1SGFA 4AFSA 4RKOB 9ESTA 1GJDB 1CBWC 2ZU5A 1S0RA 4CR9A 3MU0A 5TJXA 1V2MT 2SNWA 4IW4E 4FUIA 3R0FA 3SNEA 3TU7H 4NA7A 1BMNH 2GDEH 4A1XA 1C5MD 1BBRH 2KAIA 3U8TH 4MTBA 1TRYA 2Z9LA 2A4QA 5H4IB 1CVWH 2QF0A 1P9UA 1HBTH 3T62A 3TJUA 8GCHG 4OS7A 1BHXF 3O8CA 4X2XA 3D62A 2ZFPH 1F5KU 1HAIH 4DW2U 2BD9A 2BB4A 2HPQH 1SLUB 1ZLRA 1K1OA 1T8NA 1ZHMA 5EXNA 4H6SB 3MU4A 4O03A 2FP7B 4R8TB 3GY3A 1AUTC 5EGMA 1UTOA 4XOJA 3OX7U 3PTNA 1K1LA 1Y59T 2VWOA 6ESTA 1AY6H 1C2HA 3SUFA 1XUIA 3SN8A 1BRAA 1GI4A 1EPTB 1BA8B 1DY9A 1AVXA 2OBQA 2WYJA 3VEQB 2Z9KA 2AFQB 2K1QA 4BTTB 1G3CA 1KLTA 1GBEA 1ANBA 1SHYA 4QT8C 1YPHC 4ZXXH 1EZXC 5F6MA 3V12A 4MG3A 1HCGA 2M5TA 2NWNA 1HJ9A 4J1YA 1NM6A 2XC5A 5DG6A 5A0BA 3TIUA 2EI8A 1DPOA 1THSH 3NKKA 3MH7A 3UY9A 3ZYDA 1J14A 1HLTH 5EXMA 1GMDF 3EE0B 1TQ7B 3URCA 1AO5A 1XMNB 1TPSA 2W7SA 1O3JA 3GYLB 4NA9H 2VWMA 4X1QU 1PPBH 1HRTH 1L2EA 1TE0A 1C1WH 5DJ7A 3MNBA 4FUEA 1GVLA 1TALA 3SV6A 2EC9H 1UHBA 4CBOA 4UFFH 3G01A 2P8OC 3ATWA 3TK6A 4D9QA 3KL6A 1SFQB 1C1RA 2QC2A 1O3GA 1KYNA 3UNRA 2V3HH 3ATKA 4AB9A 1C5WB 1Y5BT 2BDBA 4WH8A 1P9SA 1C2LA 2YOLA 2ZTYA 2BM2A 1P2JA 4B73A 1WOFA 3KQEA 5CHAB 3SUDA 1NRQH 1NS3A 1NRPH 1ZSLA 4XDEA 3BF6H 3RXSA 2ODQA 2PKAB 2XBWA 1LPZB 1C1QA 1EQ9A 3A87A 1SMFE 5GIBA 5GWZA 3M5NA 1ELBA 1TBZH 4D9RA 7KMEH 1O34A 4GLYA 2A2QH 4WXVA 3BG4C 1P2OA 1GI8B 1ZPCA 3GISB 1GHZA 1ZRBA 3MH4A 3N7OA 3RP2A 1SVPA 4JZFH 1NY22 1C1PA 1MTUA 4H6TA 1HAGE 1GG6B 3SO3A 3TLOA 1ESBA 3M3SA 4JMYA 5DKMA 3PYHA 5LPEA 3RXLA 3ATMA 2AMPA 1HDTH 1VCQA 1GGDB 1NFXA 2HOBA 1DY8A 4Q80A 5EQSA 1G3DA 5IDKA 5GCHF 3BTHE 2ZHFH 3STJA 4Y11E 3RXFA 1FY5A 4WVPE 6CHAC 3M37A 1JIMA 2A5KA 4NG9H 5C67A 2ZQ1A 1ELDE 1S0QA 2W7UA 3SQEE 1W2KH 1BTUA 2TBSA 3ZZ5A 4TWWA 3RXKA 1Q2WA 2JETC 1GHXH 1Y3UA 1RGQA 1KXCA 2WPHS 2PSXA 4AG1A 1WQSA 4ABIA 4CHAB 1GHYH 1GI9B 1O2KA 2G8TA 1ZMLA 3ZVDA 1K2I1 1YGCH 2CGAA 1KY9A 1WCZA 3T28A 3D23A 3JZ1B 3V3MA 5F8XA 2QV1A 1F5LA 3RMMH 8ESTE 3Q76A 2IN2A 3LPRA 5ABWA 1QA0A 2Q6GA 1NZQH 1ZR0A 3RXQA 3SGQE 3M7TA 1IQEA 2Y81A 3DT0H 2BHGA 1A46H 1O2SA 3UR6A 4H4FA 3L3TA 2ZO3H 1TRNA 1OP2A 2GZ7A 4U2WA 2B9LA 2F9NA 2ZHDA 1QHRB 4AX9H 1AUJA 1K21H 3UOUA 4MPWA 3T2NA 1P05A 2BYAX 2VWLA 1O2UA 2FOFA 3PMBB 2TGTA 3LONA 2NU1E 3RXEA 2WPIS 1C9TA 1TNGA 7GCHF 2H5DA 2I6QA 4AB8A 2QA9E 3GCTG 1LPGB 1OP0A 4D7GA 3BIVH 3BIUH 3EAJA 2STAE 5GDSH 2A4RA 2ZC9H 1EOLA 3M7UA 1ZRKA 2VIWA 1ESAA 3EYDA 2FEQH 3SNDA 1O31A 1YBWA 4NIVA 3U1JB 2BQ7B 3SOSA 3RLWH 1TGCA 1O2YA 1S83A 2OQ5A 2TGPZ 2V3OH 1AU8A 4HGCA 4I31A 3LGYA 7LPRA 2WUBA 1O5FH 1V2NT 1UTMA 1SGEE 1D6WA 1O3NA 2OQUA 2ZDLA 1AVGH 1E36B 4CRBA 2GD4B 3LC5A 4X2VA 2FX4A 1YPMH 4BAHB 1FN6A 3FP6E 3R3GB 1TX6A 1WAYB 1F0TA 3UQOA 3A7VA 1O36A 1GDQA 2J38A 3DFJA 1P8VC 1ABJH 1AWHB 3ZZ9A 2RDLA 1TWXB 1QURH 1FPHH 2ZU1A 2A31A 4DT7B 1BTWA 1O33A 2BVRH 4M7GA 4NIXA 5EW2H 2ZGJA 3VXEH 4ZHAA 3LIWA 1QCPA 4Y7BA 1FONA 1RFNA 1OWEA 2HLCA 2GT8A 3A83A 3V7TA 2VINA 4KGAA 5I25A 2ZF0H 1AHTH 1TGSZ 5HMAA 1O2HA 4RN6A 1NRSH 2BX3A 4IS5A 1MU6B 1EP5A 4O9VA 1EX3A 3EGKH 2RG3A 1IQNA 3EA7A 1SHHB 1GI0A 3I77A 1O2MA 1HIAA 2GZ9A 1V2VT 1S6FA 3RMOH 1GMHG 1O30A 4HZHA 4RKJB 4X8TH 2VGCB 1K22H 3A7TA 2V0BA 2ZHQH 2XXLA 4GCHG 4IGDA 4U30A 4O3TA 1TNHA 2OINA 4WWYA 3ZYEA 5FX6A 3S9AA 3DD2H 1TNKA 2FI5E 1THRH 3K6YA 5E8EH 3LOXA 3DUXH 3V0XA 2HWLB 1ESTA 1TQ0B 4YESB 4BOHA 1IQLA 1KSNA 2WV4A 4X1SU 2FDAA 1CA0B 4INKA 1SPJA 2QYIA 3GDSA 3ESTA 4YT6H 4Y71A 1C5RA 4JZDH 3W94A 3BG4B 2VIVA 1HPGA 1O3DA 3Q3XA 4K60A 2Z3DA 2Y82A 2IJOB 2CHAC 1K9OE 1Y3WA 2ALVA 1NFYA 1OXGA 3MO3A 1MTWA 1HXFH 2ZWLH 1BHXB 3RMNH 2BVSH 4MNXA 1O3MA 6CHAB 1V2RT 1VCWA 2GDDA 4K69A 4DGJA 1L4ZA 3T25A 1C1UH 2J9NA 4NWLA 2ZDMA 1N6XA 2TGAA 1Z6JH 1GJ4H 1MTVA 4ASHA 1GHBF 1BT7A 1A0JA 4I8JA 3NPSA 2ZPQA 1BUIA 1BQYA 2OC8A 2JETB 2F83A 3QTVH 1QIXB 3LKWA 5FBIA 2VU8E 3BEIB 1F0SA 1L1NA 2EI7A 4B2BA 4CRAA 5DPAA 1DM4B 5JB9S 3ZZBA 1YCPK 3UREA 3PB1E 3GCHC 1J17T 2PR3A 1BMLA 1D6RA 2Y5FA 1VITH 3UOPA 2FMJA 2HVXA 3BTFE 2QXIA 1HFDA 1TRMA 2HNTE 4JYTA 2BDIA 1Z7KA 2JH0D 4AG2A 1NU7B 2AERH 1ANCA 1PPGE 4FUBA 4AYVB 4DIHH 1AB9B 1PPHE 2BDAA 3FANA 4JZIA 1PYTC 1VITF 1OYQA 1EB2A 1C2KA 1WBGB 1IQFA 3O8RA 1TOCB 3U8OH 3U8RH 1VJ9U 2AMQA 3TH3H 3SV9A 1GVZA 1T4VH 1PQ8A 1VJAU 4ZKOU 1O3HA 3E91A 3KQBA 3GY6A 1NTPA 3KHVA 2WPMS 2ZNKH 5JBAS 2AMDA 1GJ5H 3BEFB 1AE8H 3GCOA 5K7RA 4IN2A 1LTOA 3NZIA 1AD8H 4AGKA 1K1PA 4ZH8A 1ZSKA 2XTTB 1C1SA 1MBQA 3NWUA 1O2QA 3ENSB 3F9GA 3RU4D 2ZFTA 4ABAA 5DP3A 4ZXYH 4CRGA 4X8UH 2ZDVH 2SGFE 4LOYH 3SGAE 1BMAA 3BV9B 3FZDA 1O2RA 1SGRE 1LVMA 2TRMA 3QGNB 1SFIA 1GHAF 3P8FA 1ZTKA 2QCYA 4YTAA 1SQOA 3PTBA 4WMDA 2ZDAH 1AFQC 3SV2H 1ZOMA 2XBVA 1G3BA 1L1GA 4F49A 1DLEA 1EP6A 3SHCH 2Z9JA 3JZ2B 3ZZ4A 4K3JA 2AYWA 2J94A 1SOTA 4ABHA 1C4Y2 1A3BH 4NFEA 1ZMJA 1NC6A 3ZZ3A 3ODDA 4O97A 1O2JA 1TNIA 4ZHLU 4MNVA 5E2OA 2HRVA 4B74A 3ZVFA 3RU4T 2FOMB 4I8HA 3SJOA 2H6MA 1KDQB 4DURA 1GBHA 1NO9H 3LGWA 1YYY1 2H9TH 2A0QB 1F5RA 4Z0KA 2Z7FE 1BRUP 1O3CA 5L30H 1MCVA 1LKAA 3ZVBA 1LHDH 2AEIH 1GDUA 2A5AA 2XC4A 3RM2H 1Y5UT 5HM9A 1Z71A 1QL9A 3IITA 1L1JA 2ESTE 4JZ1A 3A7XA 6GCHG 1SSXA 3B9FH 5JBBS 4DIIH 5EQRA 1W0ZU 1GJ9B 1RRKA 1UMAH 3BTWE 1UTPA 3NCLA 5FAHA 3S7KB 5BRRE 4F4OC 1BZXE 2G51A 2XWBI 2ZU2A 2GCTC 1DITH 3RXMA 1FJSA 1FPCH 1WV7H 1TA2A 2AGIX 4IN1A 2C8ZB 2FOCA 2G5VA 1EKBB 4UONA 1YPLH 3ZVCA 3VPKA 3UNSA 4UDWH 4ABDA 3RXRA 4Y8YA 4ZHMU 4WJG2 3BTQE 1CHGA 1FAKH 3OSYA 4OS4A 3ZZ7A 3F9HA 3KQCA 3PMHB 5K0HA 1J16A 1QRWA 1K1IA 4GHTA 3K65B 1XX9A 1S82A 4E05H 1ELEE 1SGNE 1QJ1B 3HGNA 1W7GH 1C5TA 2F9PA 3EA9A 2Y6TA 3RXCA 1GPZA 3AAUA 4ISLA 3OY5U 3A89A 3RXIA 1DUEA 4XBDA 2J95A 5E2PA 2A1DB 2Y80A 5FCRA 4ZROA 1BRCE 1P10A 1ZJDA 2TPIZ 4I8LA 5G4BA 4LZ4B 3ZVGA 3OU0A 2ZG0H 2ZECA 1GL1A 3SU4A 2D8WA 3A82A 2VVCA 1IQMA 1H9IE 2F3CE 1DOJA 2A7HA 3CENA 3GCHB 3CP7A 2BLVA 1EJAA 2BOKA 1NROH 2UUKB 2SFAA 1IQHA 1TGTA 1YPHE 4AFUA 3TPIZ 4AORA 5HYOA 1MKWK 5L2ZH 2BXTH 4KTUA 3OY6U 2XWAA 3TITA 1EAXA 3K9XB 1G3EA 3TNTA 1SGDE 2ZU3A 3KGPA 3A7ZA 1HAZB 1BOQA 3DFLA 4NSYA 1HXEH 1UTJA 1ETTH 2BD4A 2PLXA 4A7IB 1G36A 5AFZH 1MKXK 5CMXH 2Q1JA 3BSQA 1ETRH 4WY3A 1H8IH 5A8ZA 1W7XH 4BAMB 2OC7A 1G2LA 1T31A 1SGYE 2Z9GA 1GMCG 4VGCC 1LKBA 1QB1A 4INLA 3D49H 3E0NB 1OKXA 4Z6AH 4O3UA 1CSOE 3E90B 1ZZZA 3ZVAA 1P12E 1O3KA 1MD7A 2D2DA 3MU1A 4XE4A 1TX8A 2OLGA 3TNSA 4B75A 4FU9A 2RA0A 1O2PA 1H9LB 2ZTZA 1HNEE 4WMFA 1FDPA 4JCNA 2O8TA 3MNSA 3M5LA 1EAUA 2A7CA 3PWBA 1EZQA 1CHOG 2PTCE 2H5CA 1KXBA 2R0KA 2G4TA 2GVFA 1ARCA 1ELVA 2Y7ZA 4ZUHA 4B76A 3A8AA 4BTIB 3PO1B 3P8GA 1OWJA 2G4UA 1C9PA 5C5NA 4DVAU 3RMLH 1GJCB 4A92A 4JK5A 1O2VA 4ESTE 3P6ZB 1HIAB 2BLOA 3BEUA 2FODA 3VB6A 4NZQA 1AQ7A 1P2NA 1ELFA 2VIDA 1HUTH 3NK8A 4ISNA 2BY9X 1BBRE 1Y3VA 3LJJA 3BTKE 4X8VH 4JYVH 1ANEA 1MZAA 4XBCA 1A7SA 3VGCC 1BJVA 4AFQA 3AASA 1AKSA 1O2OA 1H9HE 1GDNA 5C5OA 4NZLA 2P16A 4KP0A 1HGTH 1A0LA 3QDZB 1P02A 4K1EA 2B0FA 3GOVB 3PWCA 1QA7A 3SU6A 1P09A 1C5YB 1O3AA 1ZPBA 2A4GA 1GHVH 3M5OA 2QXGA 1DSTA 4X6OA 2EI6A 6LPRA 1A0HB 2QN5T 2GCTB 3ZZDA 1AN1E 3GYMA 1SQTA 1OP8A 1LDTT 5DK1A 3ZV9A 1HAVB 4ZKRU 3U1IB 3GCTF 1CBWB 1V2LT 1QJ7B 3GY2A 3I29A 4AN7A 1O2ZA 1ABIH 2BLWA 1X7AC 2CF8H 4FUHA 1GHWH 1F7ZA 4YOGA 3BTEE 3MU8A 3V13A 1W10U 2PUQH 1NN6A 1S81A 1ZTLA 3A84A 1FLEE 5EU8A 3PLBA 1YPJH 5DO4H 2FOAA 4KTSA 1T8LA 4LK4A 2ASUB 5ESBA 5FPYA 1YLCA 3CS7A 1ANDA 3F68H 1Q3XA 2FIRH 5DP6A 1V2WT 3LGTA 4ABFA 1GJAB 1CO7E 3LDXH 3RXUA 4YOIA 2BQ6B 2BVXH 3TH4H 4DJZB 1E34B 2FOHA 2P3UB 3ZVEA 5AVDA 2PGBB 2BQWB 3SUEA 2IOTA 1HV7A 4YZUA 3MMGA 1BDAA 1O3LA 3F9FA 3Q77A 1PPCE 2AS9A 4X1RU 1C5NH 1FN8A 4I8KA 2GP9B 1QR3E 5T6GA 1SGTA 1TB6H 1KIGH 1E35B 1A5IA 2R0LA 3UPEA 1AFEH 2AIQA 5JBCS 3VB5A 1GI7B 1A4WH 4KKDA 3MWIU 3SGBE 3SUGA 3OTJE 4ZKSU 1EPTA 2O9QA 3EQ0H 2ZHWH 2PFEA 1KXDA 2ANWA 2NU2E 1O38A 1LVOA 2P93A 3VFEA 2FI3E 1JOUB 1UK3A 4OS1A 3O8DA 3F6UH 1MTSA 4NFFA 3A80A 2BDYA 1W8BH 4GCHF 1K1NA 2QAAA 1P2IA 1VGCC 4HI3A 2FYQA 3UQVA 2ZCKP 1AE5A 1BIOA 3VB7A 4NA8A 4VGCB 1CE5A 3QWCH 3SV7A 1G32B 1YCPH 1FQ3A 1RJXB 1LVYA 2ANYA 1D3TB 2B7DH 2SGDE 4SGAE 2C8XB 1PPZA 3LGUA 5E0JA 3GY7A 4U32A 4CH2B 1EXFA 2P8OB 1EB1H 4E06H 1DFPA 4AOQA 1MZDA 1V2ST 4CH8B 5FPSA 2VIQA 4INHA 2FZZA 2R3UA 2C3SA 4PROA 1UVOA 2OBOA 4FUFA 1LMWB 2ANMH 1PQ7A 1ACBE 4GAWA 1N8OC 4D76A 2ILNA 1E37B 3RC4A 5DP7A 3QTOH 4FUJA 3RLYH 3MFJA 1NPMA 1O3IA 1LHFH 5I46H 3E1XB 3MNCA 2A4OA 2ZZUH 1JRTA 2RA3A 5A0AE 2F9VA 2SGPE 4IBLH 1C5OH 1GI3A 2PKAA 4ABGA 4XBBA 3U9AH 2FTMA 1TLDA 1D9IA 3K6ZA 2P3FH 1QY6A 4BXWA 4MPUA 1CGJE 1G30B 3RC6A 5A8YA 5HXFA 4FXGH 1O32A 2UUYA 1B7XB 1GBTA 3M61U 1MTNC 2XW9A 1T8MA 1K28D 1SI5H 3HPTB 5AHGH 1GCTC 1P06A 1GI6A 3MH6A 3AW0A 4XFQA 3PMAB 1MMJN 4MLFB 1SGCA 4BAQB 1SBWA 1AGJA 2EEKA 2G55A 3SV8A 3RXPA 2KAIB 1UTQA 1W14U 1K1MA 3VB3A 1ELAA 4E7NA 2VH6A 3KEEA 3TVJB 2ZEBA 4B2AA 3PMJA 1O5EH 3M3TA 2ZIQH 3GY4A 1FUJA 1PQ5A 3SORA 2XNIA 4JYUH 5GXPA 3M5MA 2BOHB 3UWJH 2BY5X 4DCDA 2BD8A 2ZFSA 3HKJB 1FAXA 1FY4A 5F8ZA 1TX7A 3RXTA 4DG4A 3SBKA 2D26C 1ZSJA 3QN7A 5CE1A 5DP4A 4LXBH 2ZFRH 1OWIA 3PM3A 2BDCA 1MH0A 1RIWC 2A45B 2CXVA 2LNCA 4ABEA 1SGPE 3T29A 3A8BA 3D65E 5SGAE 1UK4A 4GHQA 5EPYA 2FWWA 2XC0A 1BJUA 3TK9A 4THNH 3Q3YA 1KXAA 4CR5A 1BTHH 1GBJA 2UWLA 1J8AA 1SGQE 2GX4A 1W13U 1C5QA 3RXBA 1GBCA 2YNBA 4JZEH 1ZJKA 3VXFH 1DXPA 1E0FD 1A2CH 2QIQA 4X1NU 1CA8B 2AGEX 1DWEH 1RD3B 3BTDE 3Q3KA 2BZ6H 3GY8A 4K8YA 2EA3A 5DP9A 4LZ1H 1ID5H 2HALA 2IPHA 2PKSC 2ZPRA 3BTTE 5BPEA 1UO6A 1DS2E 2H9HA 4Y7AA 2GTBA 3UFAA 1D3QB 2FOGA 3L33A 4X6NA 2B5TB 1HAOH 1TNLA 1O2TA 3P92A 1Z1IA 2ZGXH 4Y8XA 4Q7XA 3SJ8A 3SHAH 2GGVB 1WYKA 1QJ6B 5F03A 5HM2A 1C2GA 1C2FA 1O3BA 1UVPA 1YC0A 3W95A 1RXPA 1V2KT 1FI8A 1XVMA 1G37A 5T3HA 1UHBB 1C5LH 2P95A 4UFGH 2PUXB 2ALPA 1DE7H 1O5BB 1RS0A 4A5TS 1TMTH 1O5CB 2F91A 1D3PB 1UJ1A 1DLKB 3U69H 4BTUB 2P59A 1V2UT 1AIXH 1DICA 1P03A 2P94A 2QXHA 1KLJH 2G5NA 2TGDA 2ZDNA 1UTKA 1TFXA 1YLDA 2NU3E 1OWDA 1S84A 1XXFA 4IC6A 4DOQA 4WXIA 4YLQH 5JPMH 2ZCHP 1Y8TA 2BD7A 2Y5GA 3TGJE 2OUAA 2PHBA 2GKVE 3PLKA 1VR1H 1A5HA 1NFWA 2OCVB 2GZ8A 3P8NA 1TBRH 3ZZCA 3KIDU 3LGIA 1YM0A 1DX5M 2J2UA 1DSUA 1Z8RA 2FYRA 1ZYOA 1YP9A 3GCNA 4U01A 1YF4A 1W11U 1TGNA 2PW8H 1C5SA 3B23B 1EASA 2DUCA 3QZQA 4NWKA 8GCHF 1HJ8A 1O37A 1EJNA 1N8OB 1LQDB 1MKXH 3ZZ6A 1QGFA 2BD5A 2JH5D 1C5XB 1T4UH 1P2KA 2PV9B 2FOEA 3A8DA 1UTNA 2CN0H 1TBQH 3H7OA 3QX5H 2Z3EA 1QBVH 1C2DA 1SC8U 1C2IA 1O3FA 4DY7B 3M3VA 3MO9A 5AFYH 4XSKU 1YPEH 3FVFB 2CHAB 1MTNB 2P3TB 5FPTA 1GCTB 4CHAC 4YM9A 2AGGX 1YCPM 2ZA5A 4TY6A 1P0SH 3ATLA 1QNJA 1IOEA 1WTGH 5EG4A 1H4WA 4HFPB 3SI4H 1CQQA 1IQKA 1QTFA 4CRDA 5LH8A 1THPB 1QFKH 1WUNH 4OGYA 5JB8S 1ORFA 5J4SA 2Z94A 3M7QA 2BD3A 1ELTA 3GICB 2CJIA 1VCPA 1GMCF 4TPIZ 2A32A 2JH6D 2ZP0H 3B8JA 1TGBA 1QL8A 3CS0A 3PROA 3U98H 1AZ8A 1LHEH 2R3YA 8LPRA 1C5VA 2CF9H 1NFUA 1DUAA 1ELCA 2GCHG 3M36A 1NESE 1SGIB 4Y0ZE 2WUCA 4GPGA 3PLPA 1P01A 2FX6A 3TJVA 1XUJA 4K1SA 1HJAC 1RIWB 2A2XH 4IC5A 1CT0E 1XUKA 1LHGH 5B6OA 1FY1A 1MCTA 1EAIA 2WPKS 4J2YB 3S7HB 1D3DB 1TPPA 3E6PH 4UEHH 1CHOF 1C1VH 1GJ7B 1FZZA 2Y7XA 3IWMA 1O2NA 1H1BA 1C1OA 1XM1A 2Q6FA 1CT2E 3SU2A 2ANKH 4BXSA 2R2MB 1VZQH 4KELA 3SJIA 1SGFG 1JXPA 5EW1H 1UCYK 4BNRA 1ZPZA 3A7WA 1MQ5A 2XBYA 1RTFB 4D7FA 3HGPA 3LH1A 1GBAA 4H42U 2BDGA 2G81E 2PKSB 3C1KA 3ZV8A 5C1UA 1GBIA 3H7TA 4SGBE 5JDUB 1C2MA 1TMUH 3UNQA 3MH5A 2ZI2H 1UCYE 2FO9A 4FU7A 1HAPH 2THFB 2SGEE 2ZCLP 2FS9A 3BTGE 1XVOA 1BITA 3P8OA 5EPNA 1AMHA 3VB4A 2AIPA 5TCAA 8KME2 2LPRA 3QGJA 1GI5A 2WINI 4X1PU 3A81A 2C8YB 2ZU4A 1GCDA 1QQUA 2Z6BD 1L4DA 2UUJB 1YPKH 1V6DA 2J92A 3AAVA 3ATIA 3SNBA 2QF3A 3NUMA 3H5CB 1AFQB 3EA8A 1WSSH 1SB1H 1O5GH 4WMEA 5TCCA 1C1MA 1BBRK 3T26A 1GBFA 1BRBE 2A7JA 2VNTA 1V2OT 3QZRA 3LC3A 1F0RA 1MAXA 7ESTE 4BANB 3QLPH 2VIPA 2PTNA 2GV7A 1SR5C 2FLRH 2VVUA 1W0YH 4TYDA 1K1JA 5J4QA 2VGCC 2WYGA 1IAUA 2BY8X 1UK2A 3SZNA 4K1TA 2F9UA 2XYAA 1PQAA 1BTZA 3GDVA 1MUEB 2FPZA 3DHKH 2Z9IA 1S5SA 4WH6A 4A1TA 3SJKA 2XCNA 1QB6A 4MPXA 2UUFB 1GMDG 1XUFA 1KDQA 4CRCA 4I8GA 5LPFA 1P57B 1CA0C 3BG8A 1SG8B 1DDJA 4I32A 1C2EA 3UUZA 1QQ4A 3RXOA 3S0NA 2UWOA 1IHTH 2GMTC 1BCUH 1IQIA 1LHCH 3UR9A 1WTHD 5JBTA 2TIOA 5JYIA 5C2ZA 2XCFA 2ZFQH 1CGHA 3ITIA 3P17H 3RXHA 3RXAA 3MU5A 2WPJS 1B0FA 1HYLA 3RXJA 3Q00A 2O8LA 1BTPA 4Q2KA 4D8NA 1INCA 1M9UA 2C8WB 1JBUH 1MAYA 1OX1A 1EJMA 4E7RG 1JWTA 1C1NA 1O3OA 1C2JA 1O2IA 1C4U2 2FS8A 3RC5A 1F0UA 4KTCA 4FVDA 5DP8A 2DE8A 4MVNA 1Z8GA 2VJ1A 2FTLE 5A2MH 1GI2A 3QK1A 4IMZA 1V2PT 5T6DA 2QY0B 2PGQB 3MNXA 3F9EA 3C27B 1MD8A 1LQEA 1Z8JB 1DWCH 3P95A 5LGOA 3UIRA 1EATA 1GBBA 5EXLA 1OWKA 2FI4E 2W5EA 1HAHH 3WY8A 2CV3A 1TNJA 2Z3CA 3DA9B 1HAXB 1PPEE 5GCHG 2PSYA 2J4IA 2FXRA 1AB9C 1OWHA 1EZSC 1OOKB 1NRNH 3PV4A 2ODYB 2VB0A 4TPYA 2FLBH 5FX5A 1Z6EA 1HB0B 4NCYA 1V2JT 1GJ6A 1HAYB 1BMMH 2D1JA 1ELGA 2ZGHA 3LGVA 5HGGA 2OXSA 2ZFFH 2C90B 3RM0H 4UE7H 4Y79A 2ZTXA 1FNIA 1O2WA 1F92A 3KNXA 3K2UA 4UFEH 4FVBA 1HJAB 1IHSH 1QRZA 3RXVA 4UD9H 5C3NA 2FOBA 4BAKB 3TGKE 1A5GH 1WQVH 5L6NH 2PWXA 3STIA 1JRSA 1SL3A 1L0ZA 1J9CH 3OYPA 3QO6A 3QUMP 1GMHF 2BY7X 4X6MA 4YO9A 5A0CA 1YPGH 2F9OA 1Y3YA 1QB9A 3P70B 3TJOA 4ZKNU 1BB0B 5GJ4B 1TONA 4AGJA 3SNCA 5L2YH 4YLUA 1A1RA 4OS6A 1UVSH 2BMGB 3MI4A 2O8UA 3SI3H 1O2GH 1GVKB 2ZPSA 1TAWA 3AVZA 3ELAH 2XBXA 1WU1A 2I6SA 4X2YA 4AZ2B 3SW2B 3S9BA 1BTXA 2W3KA 2XRCA 2OTVA 1N6YA 1ARBA 2ZGCA 5GPIB 1B5GH 1C5UA 3T27A 3NXPA 5EOKA 5E0HA 3HK3B 1ZGVA 1AWFH 2HNTF 1IQGA 1JMOH 1NT1A 4K8BA 1GJBB 1V2QT 3MYWA 3BN9A 2R2WU 1FMGA 3RDZA 4NIWA 4I7YH 2QXJA 7GCHG 1NU9A 1XXDA 1NRRH 3BTME 1XUGA 2G52A 3KQDA 5F8TA 4WF8A 2YNAA 3RUOA 4OS5A 1RTKA 3FP7E 1D4PB 1OSSA 1YKTA 1UTLM 1V3XA 3S69A 1GWAA 1O2XA 2BD2A 4Y0YE 1QBNA 1P11E 1Y5AT 1IQJA 1XUHA 2QGRA 1LCYA 4GVUA 2STBE 3TJNA 2O8WA 5C20A 1TPOA 3ODFA 4ABBA 1UVTH 2V35A 1S85A 4NIYA 1GBDA 2A5IA 3KN2A 4I33A 1KLIH 2OC0A 3TGIE 2VH0A 1C1TA 3LJOA 3LU9B 1DANH 1G9IE 1XKAC 1C5ZB 2H9EH 1KTTB 1T8OA 1ZHRA 3HKIB 4B71A 1Q31A 1Z1JA 1RTLA 1C5PA 3FZZA 1B0EA 1GBLA 4BAOB 3VGCB 5EODA 4Q7ZA 1FY3A 5AF9H 4X6PA 2R9PA 4CRFA 1SLXB 2DE9A 1EAWA 2H1UA 1CU1A 1JIRA 3FFGA 1O3PB 4MNYA 5FHTA 1ETSH 3S9CA 3RXDA 4ISOA 1O39A 3E16B 3SU0A 1ZHPA 2F9BH 1FIWA 2GMTB 1O0DH 1GJ8B 4GSOA 1TIOA 1P2MA 2VWNA 2ZGBH 3MO6A 3O8BA 4X8SH 3UWIA 3IG6B 4CBNA 3HATH 1EZUC
chains in the Genus database with same CATH superfamily
4ISIH 3A7YA 5EQQA 1N1LA 3F1SB 4AFZA 3MHWU 2NU0E 3A85A 3KCGH 1GI1A 2ULLA 3AW1A 1BTYA 2RCEA 5A09A 4FUGA 1CGIE 1LPKB 1FIZA 3FP8E 4R0IA 2KCPA 1HAVA 1GBMA 2G00A 2VIOA 2HPPH 2VVVA 3DCLA 4ABJA 4ISHH 2W3IA 1OS8A 4B1TA 1DWBH 5FCKA 2BXUH 1KXEA 1PYTD 3GY5A 3LT3A 4CREA 3M35A 1O3EA 1TOMH 3I78A 1V2TT 4RSPA 4IMQA 1A61H 3A86A 2H2ZA 2O8MA 1PJPA 4ZMAH 4OGXA 2JIZD 5HIZA 5LPRA 5FL7D 1F2SE 1OYTH 1EPTC 1XKBC 1P3EA 2OC1A 3MOCA 1P3CA 3L6PA 3OFND 2CMYA 4OS2A 4F48B 4NSVA 1KXFA 3SU1A 1E1RD 1FY8E 4YOJA 4MDSA 2OP9A 2W26A 1GBKA 1DVAH 2HNTC 1GHBG 1DT2A 1GL0E 4XRNA 1AZZA 4FUDA 1FV9A 1TABE 4JK6A 3FAOA 2ODPA 3A8CA 3SJ9A 2HLDD 1LVBA 2BX4A 1QL7A 3E8LA 4Y6DA 5E0GA 1W3CA 1EOJA 5IYTA 1ZGIA 4NGAH 1SQAA 2J34A 5T6FA 1EFRD 1TYNA 1O5AB 3SU3A 4A6LA 4AYYB 2WPLS 1SOZA 3RU4E 3UTUH 1W12U 4Z1MD 2UWPA 2ZHEH 1SLWB 2GV6A 4FU8A 1A3EH 3GDUA 6GCHF 5PTPA 1S6HA 2BLQA 1ZTJA 1U6QA 1J15A 4Y10E 3TK5A 1VGCB 2NU4E 1CT4E 1H8DH 3E3TA 4HTCH 3ZZ8A 1Z8IB 1OPHB 1QBOA 4MQAA 1VITG 4TWYA 1MU8B 2C93B 5CHAC 4UFDH 3TH2H 3KF2A 3PO1C 3SNAA 5DP5A 1UVUH 1E38B 2BTCE 3F0PA 1AVWA 2Y5HA 4B2CA 2WV5A 1ZMNA 1TMBH 1MBMA 5ETXA 4GUXA 5DGJA 2V3MA 2BZAA 1T7CA 1MKWH 2V6NA 1DXWA 5C1XA 1PPFE 3URDA 1TA6A 2FM2A 2XOKD 4Q7YA 4TY7A 1FXYA 1Y3XA 3LH3A 9LPRA 3T5FH 3ZZAA 2C4FH 1EUFA 1O35A 1C4V2 2IPQX 1LO6A 3AK5A 1P04A 1G2MA 5ESTE 5C1YA 3RXGA 4K2YA 1AI8H 3EDXB 2ZKSA 1AKSB 3MTYA 2SNVA 2B8OH 5IK2D 2OD3B 2ZQ2A 1GG6C 3OAAD 5A8XA 3F2GA 1GGDC 3SU5A 1DWDH 1KTSB 1O2LA 1PFXC 2FESH 2SGAA 3HK6B 1UCYH 4X2WA 3E0PB 4FUCA 2SGQE 1T32A 1GHAG 2M2AA 4K5ZA 1P2QA 4X0WU 5FXLA 4Y8ZA 5FBEA 4A1VA 2JKHA 4Y76A 4ZAEA 2ZDKA 2GCHF 2GT7A 2AH4X 2BY6X 4MNWA 1SLVB 1MQ6A 3A88A 1QRXA 4MPVA 1TPAE 4YT7H 1O5DH 2HGTH 2Q6DA 2BDHA 3SQHE 1SGFA 4AFSA 4RKOB 9ESTA 1GJDB 1CBWC 2ZU5A 1S0RA 4CR9A 3MU0A 5TJXA 3N99A 1V2MT 2SNWA 4IW4E 4FUIA 3R0FA 3SNEA 3TU7H 4NA7A 1BMNH 5CDFE 2GDEH 4A1XA 1C5MD 1BBRH 2KAIA 3U8TH 4MTBA 1TRYA 2Z9LA 2A4QA 5H4IB 1CVWH 2QF0A 1P9UA 1HBTH 3T62A 3TJUA 5B6LA 8GCHG 1UW7A 4OS7A 1BHXF 3O8CA 4X2XA 3D62A 2ZFPH 1F5KU 1HAIH 4DW2U 2BD9A 2BB4A 2HPQH 1SLUB 1ZLRA 1K1OA 1T8NA 1ZHMA 5EXNA 4H6SB 3MU4A 4O03A 3ZIAD 2FP7B 4R8TB 3GY3A 1AUTC 5EGMA 1UTOA 4XOJA 4M9FA 3OX7U 1S6LA 3PTNA 1K1LA 1Y59T 2VWOA 6ESTA 1AY6H 3GS9A 1C2HA 3SUFA 1XUIA 3SN8A 1BRAA 1GI4A 1EPTB 1BA8B 1DY9A 1AVXA 2J97A 2OBQA 2WYJA 3VEQB 2Z9KA 2AFQB 2K1QA 4BTTB 1G3CA 1KLTA 1GBEA 1ANBA 1SHYA 4QT8C 1YPHC 4ZXXH 1EZXC 5F6MA 3V12A 4MG3A 1HCGA 2M5TA 2NWNA 1HJ9A 4J1YA 1NM6A 2XC5A 5DG6A 5A0BA 3UB0A 3TIUA 2EI8A 1DPOA 1THSH 3NKKA 3MH7A 3UY9A 3ZYDA 1J14A 1HLTH 5EXMA 3FKSD 1GMDF 3EE0B 1TQ7B 3URCA 1AO5A 1XMNB 1TPSA 2W7SA 1O3JA 3GYLB 4NA9H 2VWMA 4X1QU 1PPBH 1HRTH 1L2EA 1TE0A 1C1WH 5DJ7A 3MNBA 4FUEA 1GVLA 1TALA 3SV6A 2EC9H 1UHBA 4CBOA 1YY3A 4UFFH 3G01A 2P8OC 3ATWA 3TK6A 4D9QA 3KL6A 2KM0A 1SFQB 1C1RA 2QC2A 1O3GA 1KYNA 3UNRA 2V3HH 1NBMD 3ATKA 4AB9A 1C5WB 1Y5BT 2BDBA 4WH8A 1QZ8A 1P9SA 1C2LA 2YOLA 2ZTYA 2BM2A 1P2JA 4B73A 1WOFA 3KQEA 5CHAB 3SUDA 1NRQH 1NS3A 1NRPH 1ZSLA 4XDEA 3BF6H 3RXSA 2ODQA 2PKAB 2XBWA 1LPZB 1C1QA 1EQ9A 3A87A 1SMFE 5GIBA 5GWZA 3M5NA 1ELBA 1TBZH 4D9RA 7KMEH 1O34A 5C0TA 4GLYA 2A2QH 3KYFA 4WXVA 2LP6A 3BG4C 1P2OA 1GI8B 1ZPCA 3GISB 1GHZA 1ZRBA 3MH4A 3N7OA 3RP2A 1SVPA 4JZFH 1NY22 1C1PA 1MTUA 4H6TA 1HAGE 1GG6B 3SO3A 3TLOA 1ESBA 3M3SA 4JMYA 5DKMA 3PYHA 5LPEA 3RXLA 3ATMA 2AMPA 1HDTH 1VCQA 1GGDB 1NFXA 2HOBA 1DY8A 4Q80A 5EQSA 1G3DA 5IDKA 5GCHF 3BTHE 2ZHFH 3STJA 4Y11E 3RXFA 1FY5A 4WVPE 6CHAC 3M37A 1JIMA 3N7DA 2A5KA 4NG9H 5C67A 2KCOA 1ELDE 1S0QA 2W7UA 2ZQ1A 4XD7D 3SQEE 1W2KH 1BTUA 2TBSA 3ZZ5A 4TWWA 3RXKA 1Q2WA 2JETC 1GHXH 1Y3UA 1RGQA 3DSPA 1KXCA 2WPHS 2PSXA 4AG1A 1WQSA 4ABIA 4CHAB 2KFWA 1GHYH 1GI9B 1O2KA 2G8TA 1ZMLA 3ZVDA 1K2I1 1YGCH 2CGAA 1KY9A 1WCZA 3T28A 3D23A 3JZ1B 3V3MA 4DT4A 2AHME 5F8XA 2QV1A 1F5LA 3RMMH 8ESTE 3Q76A 2IN2A 3LPRA 5ABWA 1QA0A 2Q6GA 1NZQH 1ZR0A 3RXQA 3SGQE 3M7TA 1IQEA 2Y81A 3DT0H 2BHGA 1A46H 1O2SA 3UR6A 4H4FA 3L3TA 2ZO3H 1TRNA 1OP2A 2GZ7A 4U2WA 2HVYB 2B9LA 2F9NA 2ZHDA 1QHRB 3SYJA 4AX9H 1AUJA 1K21H 3UOUA 4MPWA 3T2NA 1P05A 2BYAX 2VWLA 1O2UA 2FOFA 3PMBB 2TGTA 3LONA 3NRLA 2NU1E 3RXEA 2WPIS 1C9TA 1TNGA 7GCHF 2H5DA 2I6QA 4AB8A 2QA9E 3GCTG 1LPGB 1OP0A 4D7GA 3BIVH 3BIUH 3EAJA 2STAE 5GDSH 2A4RA 2ZC9H 1EOLA 3M7UA 1ZRKA 2VIWA 2J98B 1ESAA 3EYDA 2FEQH 3SNDA 1O31A 1YBWA 4NIVA 3U1JB 2BQ7B 3SOSA 3RLWH 1TGCA 1O2YA 1S83A 2OQ5A 2TGPZ 2V3OH 1AU8A 4HGCA 4I31A 3LGYA 7LPRA 2WUBA 1O5FH 1V2NT 5EJZA 1UTMA 1SGEE 1D6WA 1O3NA 2OQUA 2ZDLA 1AVGH 1E36B 4CRBA 2GJGA 2GD4B 3LC5A 4X2VA 2FX4A 1YPMH 4BAHB 1FN6A 3FP6E 3R3GB 1TX6A 1WAYB 1F0TA 3UQOA 3A7VA 1O36A 1GDQA 2J38A 3DFJA 1P8VC 5CHBA 1ABJH 1AWHB 4YXWD 3ZZ9A 2RDLA 1TWXB 1QURH 1FPHH 2ZU1A 2A31A 4DT7B 1BTWA 3WWBA 1O33A 2BVRH 4M7GA 4NIXA 5EW2H 2ZGJA 3VXEH 4ZHAA 3LIWA 1QCPA 1SQRA 3OEED 4Y7BA 1FONA 1RFNA 1OWEA 2HLCA 2GT8A 3A83A 3V7TA 2VINA 4KGAA 5I25A 2ZF0H 1AHTH 1TGSZ 5HMAA 1O2HA 4RN6A 1NRSH 2BX3A 4IS5A 5C0UA 1MU6B 1EP5A 4O9VA 3WW7A 1EX3A 3EGKH 2RG3A 1IQNA 3EA7A 1SHHB 1GI0A 3I77A 1O2MA 1HIAA 2GZ9A 1V2VT 1S6FA 3RMOH 1GMHG 1O30A 4HZHA 4RKJB 4X8TH 2VGCB 2EY4C 1K22H 2JJ2D 3A7TA 2V0BA 2ZHQH 2XXLA 4GCHG 4IGDA 5F53A 4U30A 4O3TA 1TNHA 2OINA 4WWYA 3ZYEA 5FX6A 3S9AA 3DD2H 1TNKA 2FI5E 1THRH 3K6YA 5E8EH 3LOXA 3DUXH 3V0XA 2HWLB 3F2FA 1ESTA 1TQ0B 1COWD 4YESB 4BOHA 1IQLA 1KSNA 2WV4A 4X1SU 2FDAA 1CA0B 4INKA 1SPJA 2QYIA 3GDSA 1E79D 3ESTA 4YT6H 4Y71A 1C5RA 4JZDH 3W94A 4B6EA 3BG4B 2VIVA 1HPGA 1O3DA 3Q3XA 4K60A 2Z3DA 2Y82A 2IJOB 2CHAC 1K9OE 1Y3WA 2ALVA 1NFYA 1OXGA 3MO3A 1MTWA 5C17A 1HXFH 2ZWLH 1BHXB 3RMNH 2BVSH 4MNXA 1O3MA 6CHAB 1V2RT 3OE7D 1VCWA 2GDDA 4K69A 4DGJA 1L4ZA 3T25A 1C1UH 2J9NA 4NWLA 2ZDMA 1N6XA 2TGAA 1Z6JH 1GJ4H 1MTVA 4ASHA 1GHBF 1BT7A 1A0JA 4I8JA 3NPSA 2ZPQA 4B6FA 1BUIA 1BQYA 2OC8A 3W1EA 2JETB 2F83A 3QTVH 1QIXB 3LKWA 5FBIA 2VU8E 3BEIB 1F0SA 1L1NA 2EI7A 4B2BA 4CRAA 5DPAA 3OTPA 1DM4B 5JB9S 3ZZBA 1YCPK 3UREA 3PB1E 3FO8D 1J17T 2PR3A 3GCHC 2W6ID 1BMLA 1D6RA 2Y5FA 1VITH 3UOPA 2FMJA 2HVXA 3BTFE 2QXIA 1HFDA 1TRMA 2HNTE 4JYTA 2BDIA 1Z7KA 2JH0D 4AG2A 4Q63A 1NU7B 2AERH 1ANCA 1PPGE 4FUBA 4TSFD 4AYVB 4DIHH 1AB9B 1PPHE 1W0KD 2BDAA 3FANA 4JZIA 1PYTC 1VITF 1OYQA 1EB2A 1C2KA 1WBGB 1IQFA 3O8RA 1TOCB 3U8OH 3U8RH 1H8HD 1VJ9U 2AMQA 3TH3H 3SV9A 1GVZA 1T4VH 1PQ8A 1VJAU 4ZKOU 1O3HA 3E91A 3KQBA 3GY6A 1NTPA 2KX4A 3KHVA 2WPMS 2KZ4A 2ZNKH 5JBAS 2AMDA 1GJ5H 3BEFB 1AE8H 3GCOA 5K7RA 4IN2A 1LTOA 3NZIA 1AD8H 4AGKA 1K1PA 4ZH8A 1ZSKA 2XTTB 1C1SA 1MBQA 3NWUA 1O2QA 3ENSB 3F9GA 3RU4D 2ZFTA 4ABAA 5DP3A 4ZXYH 4CRGA 4X8UH 2ZDVH 2SGFE 4LOYH 3SGAE 1BMAA 3BV9B 3FZDA 1O2RA 1SGRE 1LVMA 2TRMA 3QGNB 1SFIA 1GHAF 3P8FA 1ZTKA 2QCYA 1OHHD 4YTAA 1SQOA 3PTBA 4WMDA 2ZDAH 1AFQC 3SV2H 1ZOMA 2XBVA 1G3BA 1L1GA 2YMSB 3F0OA 4F49A 1DLEA 1EP6A 3SHCH 2Z9JA 3JZ2B 3ZZ4A 1SKYE 4K3JA 2AYWA 2J94A 1SOTA 4ABHA 1C4Y2 1A3BH 4NFEA 1ZMJA 1NC6A 3ZZ3A 3ODDA 5KEDA 4O97A 1O2JA 1TNIA 4ZHLU 4MNVA 5E2OA 2HRVA 4B74A 3ZVFA 3RU4T 2FOMB 4I8HA 3SJOA 2H6MA 1KDQB 4DURA 1GBHA 1NO9H 3LGWA 1YYY1 2H9TH 2A0QB 1F5RA 4Z0KA 2Z7FE 1BRUP 1O3CA 5L30H 1MCVA 1LKAA 3ZVBA 1LHDH 2AEIH 1GDUA 2A5AA 2XC4A 4FETA 3RM2H 1Y5UT 5HM9A 1Z71A 1QL9A 3PRBA 3IITA 1L1JA 2ESTE 4JZ1A 3A7XA 6GCHG 1SSXA 3B9FH 5JBBS 4DIIH 5EQRA 1W0ZU 1GJ9B 1RRKA 1UMAH 3BTWE 1UTPA 3NCLA 5GNDA 5FAHA 3S7KB 5BRRE 4F4OC 1BZXE 2G51A 2XWBI 2ZU2A 2GCTC 1DITH 3RXMA 1FJSA 1FPCH 1WV7H 1TA2A 2AGIX 4IN1A 2C8ZB 2FOCA 2G5VA 1EKBB 4UONA 1YPLH 3UAIC 3ZVCA 3VPKA 3UNSA 4UDWH 4ABDA 3RXRA 4Y8YA 4ZHMU 4WJG2 3BTQE 1CHGA 1FAKH 3OSYA 4OS4A 3ZZ7A 3F9HA 3KQCA 3PMHB 5K0HA 1J16A 4TT3D 1QRWA 1K1IA 4GHTA 3K65B 1XX9A 1S82A 4E05H 1ELEE 1SGNE 1QJ1B 3HGNA 1W7GH 1C5TA 2F9PA 3EA9A 2Y6TA 3RXCA 1GPZA 3AAUA 4ISLA 3OY5U 3A89A 3RXIA 1DUEA 4XBDA 2J95A 5E2PA 2A1DB 2Y80A 5FCRA 4ZROA 1BRCE 1P10A 1ZJDA 2TPIZ 4I8LA 5G4BA 4LZ4B 3ZVGA 3OU0A 2ZG0H 2ZECA 1GL1A 3SU4A 2D8WA 3A82A 2VVCA 1IQMA 2F3CE 1H9IE 1DOJA 2A7HA 2V7QD 3CENA 3GCHB 3CP7A 2BLVA 1EJAA 2BOKA 2XNDD 1NROH 2UUKB 2SFAA 1IQHA 1TGTA 1YPHE 4AFUA 3TPIZ 4AORA 5HYOA 1MKWK 5L2ZH 2BXTH 4KTUA 2K8IA 3OY6U 2XWAA 3TITA 1EAXA 3K9XB 1G3EA 3TNTA 1SGDE 2ZU3A 3KGPA 3A7ZA 1HAZB 1BOQA 3DFLA 4NSYA 5EJ1A 1HXEH 1UTJA 1ETTH 2BD4A 2PLXA 4A7IB 1G36A 5AFZH 1MKXK 5CMXH 2Q1JA 3BSQA 1ETRH 3DSGA 4WY3A 1H8IH 5A8ZA 1W7XH 4BAMB 2QE7D 2OC7A 1G2LA 1T31A 1SGYE 2Z9GA 1GMCG 4VGCC 1LKBA 1QB1A 4INLA 3D49H 3E0NB 1OKXA 4Z6AH 4O3UA 1CSOE 3E90B 3KQ5A 1ZZZA 3ZVAA 1P12E 1O3KA 1MD7A 2D2DA 3MU1A 4XE4A 1TX8A 2OLGA 3TNSA 4B75A 4FU9A 3PV2A 2RA0A 1O2PA 1H9LB 2ZTZA 1HNEE 4WMFA 1FDPA 4JCNA 2O8TA 5C94A 3MNSA 3M5LA 1EAUA 2A7CA 3PWBA 3F2HA 1EZQA 1CHOG 2PTCE 2H5CA 1KXBA 2R0KA 2G4TA 2GVFA 1ARCA 1ELVA 2Y7ZA 4ZUHA 4B76A 3A8AA 4BTIB 3PO1B 3P8GA 4I86A 1OWJA 2G4UA 1C9PA 3VG8A 5C5NA 4DVAU 3RMLH 1GJCB 4A92A 4JK5A 1O2VA 4ESTE 2OK5A 3P6ZB 1HIAB 2BLOA 3BEUA 4RT1A 2FODA 3VB6A 4NZQA 1AQ7A 1P2NA 1ELFA 2VIDA 1HUTH 3NK8A 4ISNA 2BY9X 1BBRE 1Y3VA 3LJJA 3BTKE 4X8VH 4JYVH 1WDIA 1ANEA 1MZAA 2IJD1 4XBCA 1A7SA 3VGCC 1BJVA 4AFQA 3AASA 1AKSA 1O2OA 1H9HE 1GDNA 5C5OA 4NZLA 2P16A 4KP0A 1HGTH 4ASUD 1A0LA 3QDZB 1P02A 4K1EA 2B0FA 3GOVB 3PWCA 1QA7A 3SU6A 1P09A 2WV9A 1C5YB 1O3AA 1ZPBA 2A4GA 5KECA 1GHVH 3M5OA 2QXGA 1DSTA 4HG6A 4X6OA 2EI6A 6LPRA 1A0HB 2QN5T 2GCTB 3ZZDA 1AN1E 3GYMA 1SQTA 1OP8A 1LDTT 5DK1A 3ZV9A 1HAVB 4ZKRU 3U1IB 3GCTF 1CBWB 1V2LT 1QJ7B 3GY2A 3I29A 4AN7A 1O2ZA 1ABIH 2BLWA 1X7AC 2CF8H 3PV5A 4FUHA 1GHWH 1F7ZA 4YOGA 3BTEE 3MU8A 3V13A 1W10U 2PUQH 1NN6A 1S81A 1ZTLA 3A84A 1FLEE 5EU8A 4F55A 3PLBA 1YPJH 5DO4H 2FOAA 4KTSA 1T8LA 4LK4A 2ASUB 5ESBA 5FPYA 1YLCA 3CS7A 1ANDA 3F68H 1Q3XA 2FIRH 5DP6A 1V2WT 3LGTA 4ABFA 2QF5A 1GJAB 1CO7E 3LDXH 3RXUA 4YOIA 2BQ6B 2BVXH 3TH4H 4DJZB 1E34B 2FOHA 2P3UB 3ZVEA 5AVDA 1WXRA 2PGBB 2BQWB 3SUEA 4P02A 2IOTA 1HV7A 4YZUA 3MMGA 1BDAA 1O3LA 3F9FA 3Q77A 1PPCE 2AS9A 4X1RU 1C5NH 1FN8A 4I8KA 2GP9B 1QR3E 5T6GA 1SGTA 1TB6H 1KIGH 1E35B 1A5IA 2R0LA 3UPEA 1AFEH 2AIQA 5JBCS 3CNRA 3VB5A 1GI7B 1A4WH 4KKDA 3MWIU 3SGBE 3SUGA 3OTJE 4ZKSU 1EPTA 2O9QA 3EQ0H 2ZHWH 2PFEA 1KXDA 2ANWA 2EQNA 1O38A 1LVOA 2NU2E 2P93A 3VFEA 2FI3E 1JOUB 1UK3A 4OS1A 3O8DA 3F6UH 1MTSA 4NFFA 3A80A 2BDYA 1W8BH 4GCHF 1K1NA 2QAAA 1P2IA 1VGCC 4HI3A 2FYQA 3UQVA 2ZCKP 1AE5A 1BIOA 3VB7A 4NA8A 4VGCB 1CE5A 3QWCH 3SV7A 1G32B 1YCPH 1FQ3A 1RJXB 1LVYA 2ANYA 1D3TB 2B7DH 2SGDE 4SGAE 2C8XB 1PPZA 3LGUA 5E0JA 3GY7A 4U32A 4CH2B 1EXFA 2P8OB 1EB1H 4E06H 1DFPA 4AOQA 1MZDA 1V2ST 4CH8B 5FPSA 2VIQA 4INHA 2FZZA 2R3UA 2C3SA 4PROA 1UVOA 2OBOA 2WSSD 4FUFA 1LMWB 2ANMH 1PQ7A 1ACBE 4GAWA 1N8OC 4D76A 2ILNA 1E37B 3RC4A 5DP7A 3QTOH 4FUJA 3RLYH 5DSFA 3MFJA 1NPMA 1O3IA 1LHFH 5I46H 3E1XB 3MNCA 2A4OA 2ZZUH 1JRTA 2RA3A 5A0AE 2F9VA 2SGPE 4IBLH 1C5OH 1GI3A 2PKAA 4ABGA 4XBBA 3U9AH 2FTMA 1TLDA 1D9IA 3K6ZA 2P3FH 1QY6A 4BXWA 4MPUA 1CGJE 1G30B 2QF4A 3RC6A 5A8YA 5HXFA 4FXGH 3EE7A 1O32A 2UUYA 1B7XB 1GBTA 3M61U 1MTNC 2XW9A 1T8MA 1K28D 1SI5H 3HPTB 5AHGH 1GCTC 1P06A 1GI6A 3MH6A 3AW0A 4XFQA 3PMAB 1MMJN 4MLFB 1SGCA 4BAQB 1SBWA 1AGJA 2EEKA 2G55A 3SV8A 3RXPA 2KAIB 1UTQA 1W14U 1K1MA 3VB3A 1ELAA 1W0JD 4E7NA 2VH6A 3KEEA 3TVJB 2ZEBA 4B2AA 3PMJA 1O5EH 3M3TA 2ZIQH 3GY4A 1FUJA 1PQ5A 3SORA 2XNIA 4JYUH 5GXPA 1MABB 3M5MA 2BOHB 3UWJH 2BY5X 4DCDA 2BD8A 2K0QA 2ZFSA 2W6JD 1FAXA 3HKJB 1FY4A 5F8ZA 1TX7A 3RXTA 4DG4A 3SBKA 2D26C 1ZSJA 3QN7A 5CE1A 5DP4A 4LXBH 2ZFRH 1OWIA 3PM3A 2BDCA 1MH0A 1RIWC 2A45B 2CXVA 2LNCA 2LELA 4ABEA 1SGPE 3T29A 3A8BA 3D65E 5SGAE 1UK4A 4GHQA 5EPYA 2FWWA 2XC0A 1BJUA 5EIYA 3TK9A 4ACAA 4THNH 3Q3YA 1KXAA 4CR5A 1BTHH 1GBJA 2UWLA 1J8AA 1SGQE 2GX4A 1W13U 1C5QA 3RXBA 1GBCA 2YNBA 4JZEH 1ZJKA 3VXFH 1DXPA 2J5UA 1E0FD 1A2CH 2QIQA 4X1NU 1CA8B 2AGEX 1DWEH 1RD3B 3BTDE 3Q3KA 2BZ6H 3GY8A 4K8YA 2EA3A 2RFKC 5DP9A 4LZ1H 1ID5H 2HALA 2IPHA 2PKSC 2ZPRA 3BTTE 5BPEA 1UO6A 1DS2E 2H9HA 4Y7AA 2GTBA 3UFAA 1D3QB 2FOGA 3L33A 4X6NA 2B5TB 1HAOH 1TNLA 1O2TA 3P92A 1Z1IA 2ZGXH 4Y8XA 4Q7XA 3SJ8A 3SHAH 2GGVB 1WYKA 1QJ6B 5F03A 5HM2A 1C2GA 1C2FA 1O3BA 4AC9A 1UVPA 1YC0A 3W95A 1RXPA 1V2KT 1FI8A 1XVMA 2J98A 1G37A 5T3HA 1UHBB 1KMHB 1C5LH 2P95A 4UFGH 5KGOA 2PUXB 2ALPA 1DE7H 1O5BB 1RS0A 4A5TS 1TMTH 1O5CB 2F91A 1D3PB 1UJ1A 1DLKB 3U69H 4BTUB 2P59A 1V2UT 1AIXH 1DICA 1P03A 2P94A 2QXHA 1KLJH 2G5NA 2TGDA 2ZDNA 3FOAA 1UTKA 1TFXA 1YLDA 2NU3E 1OWDA 1S84A 1XXFA 4IC6A 4DOQA 4WXIA 4YLQH 5JPMH 2ZCHP 1Y8TA 2BD7A 5HIYA 2Y5GA 3TGJE 2OUAA 2PHBA 2GKVE 3PLKA 4ACBA 1VKYA 1VR1H 1A5HA 1NFWA 2OCVB 2F4LA 2GZ8A 3P8NA 1TBRH 3ZZCA 3KIDU 3LGIA 1YM0A 1DX5M 2J2UA 1DSUA 1Z8RA 2FYRA 1ZYOA 1YP9A 3GCNA 4U01A 1YF4A 1W11U 1TGNA 2PW8H 1C5SA 3B23B 1EASA 2DUCA 3QZQA 4NWKA 8GCHF 1HJ8A 1O37A 3FN8A 1EJNA 1N8OB 1LQDB 1MKXH 2PP6A 3ZZ6A 1QGFA 2BD5A 2JH5D 1C5XB 1T4UH 1P2KA 2PV9B 2FOEA 3A8DA 1UTNA 2CN0H 1TBQH 3H7OA 3WWFA 3QX5H 2Z3EA 1QBVH 1C2DA 1SC8U 1C2IA 1O3FA 3F3BA 4DY7B 4P00A 3M3VA 3MO9A 5AFYH 4XSKU 1YPEH 3FVFB 2CHAB 1MTNB 2P3TB 5FPTA 1GCTB 4CHAC 4YM9A 2AGGX 1YCPM 5DN6D 2ZA5A 4TY6A 1E1QD 1P0SH 3ATLA 1QNJA 1IOEA 1WTGH 5EG4A 1H4WA 4HFPB 3SI4H 1CQQA 1IQKA 1QTFA 2F43B 4CRDA 5LH8A 1THPB 3OEHD 1QFKH 2KR7A 1WUNH 4OGYA 5JB8S 1ORFA 1YLNA 5J4SA 2Z94A 3M7QA 2BD3A 1ELTA 3GICB 2CJIA 1VCPA 1GMCF 4TPIZ 2A32A 2JH6D 2ZP0H 3B8JA 1TGBA 1QL8A 3CS0A 3PROA 3U98H 1AZ8A 1LHEH 2R3YA 8LPRA 1C5VA 2CF9H 1NFUA 1DUAA 1ELCA 2GCHG 3M36A 1NESE 1SGIB 4Y0ZE 2WUCA 4GPGA 3PLPA 1P01A 2FX6A 4Q4LA 3TJVA 1XUJA 4K1SA 1HJAC 1RIWB 2A2XH 4IC5A 1CT0E 1XUKA 1LHGH 5B6OA 1FY1A 1MCTA 1EAIA 2WPKS 4J2YB 3S7HB 1D3DB 1TPPA 3E6PH 4UEHH 1CHOF 1C1VH 1GJ7B 1FZZA 2Y7XA 3IWMA 1O2NA 1H1BA 1C1OA 1XM1A 2Q6FA 1CT2E 3SU2A 2ANKH 4BXSA 2R2MB 1VZQH 4KELA 3SJIA 1SGFG 1JXPA 5EW1H 1UCYK 4BNRA 1ZPZA 3U28C 3A7WA 1MQ5A 2XBYA 1RTFB 4D7FA 3HGPA 3LH1A 1GBAA 4H42U 2BDGA 2G81E 2PKSB 3C1KA 3ZV8A 5C1UA 1GBIA 3KYGA 3H7TA 3SZEA 4SGBE 5JDUB 1C2MA 1TMUH 3UNQA 3MH5A 2ZI2H 1UCYE 2FO9A 4FU7A 1HAPH 2THFB 2SGEE 2ZCLP 2FS9A 3BTGE 1XVOA 3H09A 1BITA 3P8OA 5EPNA 1AMHA 3VB4A 2AIPA 5TCAA 8KME2 2LPRA 3QGJA 1GI5A 2WINI 4X1PU 3A81A 2C8YB 2ZU4A 1GCDA 1QQUA 1BMFD 2Z6BD 1L4DA 2UUJB 1YPKH 1V6DA 2J92A 3AAVA 3ATIA 3SNBA 2QF3A 1NBME 3NUMA 3H5CB 1AFQB 3EA8A 1WSSH 1SB1H 1O5GH 4WMEA 3N7EA 5TCCA 1C1MA 1BBRK 3T26A 1GBFA 1BRBE 2A7JA 2VNTA 1V2OT 3QZRA 3LC3A 1F0RA 1MAXA 7ESTE 4BANB 2L74A 2VIPA 2PTNA 2GV7A 3QLPH 1SR5C 2FLRH 2VVUA 5EJLA 1W0YH 4TYDA 1K1JA 5J4QA 2VGCC 2WYGA 1IAUA 2BY8X 1UK2A 3SZNA 4K1TA 2F9UA 2XYAA 1PQAA 1BTZA 3GDVA 1MUEB 2FPZA 3DHKH 2Z9IA 1S5SA 4WH6A 4A1TA 3SJKA 2XCNA 1QB6A 4MPXA 2UUFB 1GMDG 1XUFA 1KDQA 4CRCA 4I8GA 5LPFA 1P57B 1CA0C 3BG8A 1SG8B 1DDJA 4I32A 1C2EA 3UUZA 1QQ4A 3RXOA 3S0NA 2UWOA 1IHTH 2GMTC 1BCUH 1IQIA 1LHCH 3UR9A 1WTHD 5JBTA 2TIOA 5JYIA 5C2ZA 2XCFA 2ZFQH 2KCYA 1CGHA 3ITIA 3P17H 3RXHA 3RXAA 3MU5A 2WPJS 1B0FA 1HYLA 3RXJA 3Q00A 2O8LA 1BTPA 4Q2KA 4D8NA 1INCA 1M9UA 2C8WB 2WZQA 1JBUH 1MAYA 1OX1A 1EJMA 4E7RG 1JWTA 1C1NA 1O3OA 1C2JA 1O2IA 1C4U2 2FS8A 3RC5A 1F0UA 4RT0A 4KTCA 4FVDA 2JJ1D 5DP8A 2DE8A 4MVNA 1Z8GA 2VJ1A 2FTLE 5A2MH 1GI2A 3QK1A 4IMZA 1V2PT 5T6DA 2QY0B 2PGQB 3MNXA 3F9EA 3C27B 1MD8A 1LQEA 1Z8JB 1DWCH 3P95A 5LGOA 3UIRA 1EATA 1GBBA 2JDID 5EXLA 1OWKA 2FI4E 4OM9A 2W5EA 3DSOA 1HAHH 3WY8A 2CV3A 1TNJA 2Z3CA 3DA9B 1HAXB 1PPEE 5GCHG 2PSYA 2J4IA 2FXRA 1AB9C 1OWHA 1EZSC 1OOKB 1NRNH 1FX0B 3PV4A 2ODYB 2VB0A 4TPYA 2FLBH 5FX5A 1Z6EA 1HB0B 4NCYA 1V2JT 1GJ6A 1HAYB 1BMMH 5HKKD 2D1JA 1ELGA 2ZGHA 3LGVA 5HGGA 2OXSA 4FOUC 2ZFFH 2C90B 5T1VA 3RM0H 4UE7H 4Y79A 2ZTXA 1FNIA 1O2WA 1F92A 2WPDD 3KNXA 3K2UA 4UFEH 4FVBA 1HJAB 1IHSH 1QRZA 3RXVA 4UD9H 5C3NA 2FOBA 4BAKB 3TGKE 1A5GH 1WQVH 5L6NH 2PWXA 3STIA 1JRSA 1SL3A 1L0ZA 1J9CH 2YMSD 3OYPA 3QO6A 3QUMP 2CK3D 1GMHF 2BY7X 4X6MA 4YO9A 5A0CA 1YPGH 2F9OA 1Y3YA 1QB9A 3P70B 3TJOA 4ZKNU 1BB0B 5GJ4B 1TONA 4AGJA 3SNCA 5L2YH 4YLUA 1A1RA 4OS6A 1UVSH 2BMGB 3MI4A 2O8UA 3SI3H 1O2GH 1GVKB 2ZPSA 1TAWA 3AVZA 3ELAH 2XBXA 1WU1A 2I6SA 4X2YA 4AZ2B 3SW2B 3S9BA 2YMSC 1BTXA 2W3KA 2XRCA 3MQKC 2OTVA 1N6YA 1ARBA 2ZGCA 5GPIB 1B5GH 1C5UA 3T27A 3NXPA 5EOKA 5E0HA 3HK3B 1ZGVA 1AWFH 2HNTF 1IQGA 1JMOH 1NT1A 4K8BA 1GJBB 1V2QT 3MYWA 3BN9A 2R2WU 1FMGA 3RDZA 4NIWA 4I7YH 2QXJA 7GCHG 1NU9A 1XXDA 1NRRH 3BTME 1XUGA 2G52A 3KQDA 5F8TA 4WF8A 2YNAA 3RUOA 4OS5A 1RTKA 3FP7E 1D4PB 1OSSA 1YKTA 3PRDA 1UTLM 1V3XA 3S69A 1GWAA 1O2XA 2BD2A 4Y0YE 1QBNA 1P11E 1Y5AT 1IQJA 2RDEA 1XUHA 2QGRA 1LCYA 4GVUA 2STBE 3TJNA 2O8WA 5C20A 1TPOA 3ODFA 4ABBA 1H8ED 1UVTH 2V35A 1S85A 4NIYA 1GBDA 2A5IA 3KN2A 4I33A 1KLIH 2OC0A 3TGIE 2VH0A 1C1TA 3LJOA 3LU9B 1G9IE 1DANH 1XKAC 1C5ZB 2H9EH 1KTTB 1T8OA 1ZHRA 3HKIB 4B71A 1Q31A 1Z1JA 1RTLA 1C5PA 3FZZA 1B0EA 1GBLA 4BAOB 3VGCB 5EODA 2WHXA 4Q7ZA 1FY3A 5AF9H 4X6PA 2R9PA 4CRFA 1SLXB 2DE9A 1EAWA 2L6OA 4ZCNA 2H1UA 1CU1A 1JIRA 3FFGA 1O3PB 4MNYA 5FHTA 1ETSH 3S9CA 3RXDA 4ISOA 1O39A 3E16B 3SU0A 1YWUA 1K0HA 1ZHPA 2F9BH 1FIWA 2GMTB 1O0DH 1GJ8B 2KCAA 4GSOA 1TIOA 1P2MA 2VWNA 2ZGBH 2VBCA 3MO6A 3O8BA 4X8SH 4RI0A 3UWIA 3IG6B 4CBNA 3HATH 1EZUC
chains in the Genus database with same CATH topology
4ISIH 3A7YA 5EQQA 1N1LA 3F1SB 4AFZA 3MHWU 2NU0E 3A85A 3KCGH 1GI1A 2ULLA 3AW1A 1BTYA 2RCEA 5A09A 4FUGA 1CGIE 1LPKB 1FIZA 3FP8E 4R0IA 1HAVA 1GBMA 2G00A 2VIOA 2HPPH 2VVVA 4ABJA 4ISHH 2W3IA 1OS8A 4B1TA 1DWBH 5FCKA 2BXUH 1KXEA 1PYTD 3GY5A 3LT3A 4CREA 3M35A 1O3EA 1TOMH 3I78A 1V2TT 4RSPA 4IMQA 1A61H 3A86A 2H2ZA 2O8MA 1PJPA 4ZMAH 4OGXA 5LPRA 1F2SE 1OYTH 1EPTC 1XKBC 1P3EA 2OC1A 3MOCA 1P3CA 3L6PA 2CMYA 4OS2A 4NSVA 1KXFA 3SU1A 1FY8E 4YOJA 4MDSA 2OP9A 2W26A 1GBKA 1DVAH 2HNTC 1GHBG 1DT2A 1GL0E 1AZZA 4FUDA 1FV9A 1TABE 4JK6A 3FAOA 2ODPA 3A8CA 3SJ9A 1LVBA 2BX4A 1QL7A 3E8LA 4Y6DA 5E0GA 1W3CA 1EOJA 5IYTA 1ZGIA 4NGAH 1SQAA 2J34A 5T6FA 1TYNA 1O5AB 3SU3A 4A6LA 4AYYB 2WPLS 1SOZA 3RU4E 3UTUH 1W12U 2UWPA 2ZHEH 1SLWB 2GV6A 4FU8A 1A3EH 3GDUA 6GCHF 5PTPA 1S6HA 2BLQA 1ZTJA 1U6QA 1J15A 4Y10E 3TK5A 1VGCB 2NU4E 1CT4E 1H8DH 3E3TA 4HTCH 3ZZ8A 1Z8IB 1OPHB 1QBOA 4MQAA 1VITG 4TWYA 1MU8B 2C93B 5CHAC 4UFDH 3TH2H 3KF2A 3PO1C 3SNAA 5DP5A 1UVUH 1E38B 2BTCE 1AVWA 2Y5HA 4B2CA 2WV5A 1ZMNA 1TMBH 1MBMA 5ETXA 4GUXA 5DGJA 1DXWA 2BZAA 1T7CA 1MKWH 2V6NA 5C1XA 1PPFE 3URDA 1TA6A 2FM2A 4Q7YA 4TY7A 1FXYA 1Y3XA 3LH3A 9LPRA 3T5FH 3ZZAA 2C4FH 1EUFA 1O35A 1C4V2 1LO6A 1P04A 1G2MA 5ESTE 5C1YA 3RXGA 4K2YA 1AI8H 3EDXB 2ZKSA 1AKSB 3MTYA 2SNVA 2B8OH 2OD3B 2ZQ2A 1GG6C 5A8XA 1GGDC 3SU5A 1DWDH 1KTSB 1O2LA 1PFXC 2FESH 2SGAA 3HK6B 1UCYH 4X2WA 3E0PB 4FUCA 2SGQE 1T32A 1GHAG 4K5ZA 1P2QA 4X0WU 5FXLA 4Y8ZA 5FBEA 4A1VA 2JKHA 4Y76A 4ZAEA 2ZDKA 2GCHF 2GT7A 2AH4X 2BY6X 4MNWA 1SLVB 1MQ6A 3A88A 1QRXA 4MPVA 1TPAE 4YT7H 1O5DH 2HGTH 2Q6DA 2BDHA 3SQHE 1SGFA 4AFSA 4RKOB 9ESTA 1GJDB 1CBWC 2ZU5A 1S0RA 4CR9A 3MU0A 5TJXA 1V2MT 2SNWA 4IW4E 4FUIA 3R0FA 3SNEA 3TU7H 4NA7A 1BMNH 2GDEH 4A1XA 1C5MD 1BBRH 2KAIA 3U8TH 4MTBA 1TRYA 2Z9LA 2A4QA 5H4IB 1CVWH 2QF0A 1P9UA 1HBTH 3T62A 3TJUA 8GCHG 4OS7A 1BHXF 3O8CA 4X2XA 3D62A 2ZFPH 1F5KU 1HAIH 4DW2U 2BD9A 2BB4A 2HPQH 1SLUB 1ZLRA 1K1OA 1T8NA 1ZHMA 5EXNA 4H6SB 3MU4A 4O03A 2FP7B 4R8TB 3GY3A 1AUTC 5EGMA 1UTOA 4XOJA 3OX7U 3PTNA 1K1LA 1Y59T 2VWOA 6ESTA 1AY6H 1C2HA 3SUFA 1XUIA 3SN8A 1BRAA 1GI4A 1EPTB 1BA8B 1DY9A 1AVXA 2OBQA 2WYJA 3VEQB 2Z9KA 2AFQB 2K1QA 4BTTB 1G3CA 1KLTA 1GBEA 1ANBA 1SHYA 4QT8C 1YPHC 4ZXXH 1EZXC 5F6MA 3V12A 4MG3A 1HCGA 2M5TA 2NWNA 1HJ9A 4J1YA 1NM6A 2XC5A 5DG6A 5A0BA 3TIUA 2EI8A 1DPOA 1THSH 3NKKA 3MH7A 3UY9A 3ZYDA 1J14A 1HLTH 5EXMA 1GMDF 3EE0B 1TQ7B 3URCA 1AO5A 1XMNB 1TPSA 2W7SA 1O3JA 3GYLB 4NA9H 2VWMA 4X1QU 1PPBH 1HRTH 1L2EA 1TE0A 1C1WH 5DJ7A 3MNBA 4FUEA 1GVLA 1TALA 3SV6A 2EC9H 1UHBA 4CBOA 4UFFH 3G01A 2P8OC 3ATWA 3TK6A 4D9QA 3KL6A 1SFQB 1C1RA 2QC2A 1O3GA 1KYNA 3UNRA 2V3HH 3ATKA 4AB9A 1C5WB 1Y5BT 2BDBA 4WH8A 1P9SA 1C2LA 2YOLA 2ZTYA 2BM2A 1P2JA 4B73A 1WOFA 3KQEA 5CHAB 3SUDA 1NRQH 1NS3A 1NRPH 1ZSLA 4XDEA 3BF6H 3RXSA 2ODQA 2PKAB 2XBWA 1LPZB 1C1QA 1EQ9A 3A87A 1SMFE 5GIBA 5GWZA 3M5NA 1ELBA 1TBZH 4D9RA 7KMEH 1O34A 4GLYA 2A2QH 4WXVA 3BG4C 1P2OA 1GI8B 1ZPCA 3GISB 1GHZA 1ZRBA 3MH4A 3N7OA 3RP2A 1SVPA 4JZFH 1NY22 1C1PA 1MTUA 4H6TA 1HAGE 1GG6B 3SO3A 3TLOA 1ESBA 3M3SA 4JMYA 5DKMA 3PYHA 5LPEA 3RXLA 3ATMA 2AMPA 1HDTH 1VCQA 1GGDB 1NFXA 2HOBA 1DY8A 4Q80A 5EQSA 1G3DA 5IDKA 5GCHF 3BTHE 2ZHFH 3STJA 4Y11E 3RXFA 1FY5A 4WVPE 6CHAC 3M37A 1JIMA 2A5KA 4NG9H 5C67A 2ZQ1A 1ELDE 1S0QA 2W7UA 3SQEE 1W2KH 1BTUA 2TBSA 3ZZ5A 4TWWA 3RXKA 1Q2WA 2JETC 1GHXH 1Y3UA 1RGQA 1KXCA 2WPHS 2PSXA 4AG1A 1WQSA 4ABIA 4CHAB 1GHYH 1GI9B 1O2KA 2G8TA 1ZMLA 3ZVDA 1K2I1 1YGCH 2CGAA 1KY9A 1WCZA 3T28A 3D23A 3JZ1B 3V3MA 5F8XA 2QV1A 1F5LA 3RMMH 8ESTE 3Q76A 2IN2A 3LPRA 5ABWA 1QA0A 2Q6GA 1NZQH 1ZR0A 3RXQA 3SGQE 3M7TA 1IQEA 2Y81A 3DT0H 2BHGA 1A46H 1O2SA 3UR6A 4H4FA 3L3TA 2ZO3H 1TRNA 1OP2A 2GZ7A 4U2WA 2B9LA 2F9NA 2ZHDA 1QHRB 4AX9H 1AUJA 1K21H 3UOUA 4MPWA 3T2NA 1P05A 2BYAX 2VWLA 1O2UA 2FOFA 3PMBB 2TGTA 3LONA 2NU1E 3RXEA 2WPIS 1C9TA 1TNGA 7GCHF 2H5DA 2I6QA 4AB8A 2QA9E 3GCTG 1LPGB 1OP0A 4D7GA 3BIVH 3BIUH 3EAJA 2STAE 5GDSH 2A4RA 2ZC9H 1EOLA 3M7UA 1ZRKA 2VIWA 1ESAA 3EYDA 2FEQH 3SNDA 1O31A 1YBWA 4NIVA 3U1JB 2BQ7B 3SOSA 3RLWH 1TGCA 1O2YA 1S83A 2OQ5A 2TGPZ 2V3OH 1AU8A 4HGCA 4I31A 3LGYA 7LPRA 2WUBA 1O5FH 1V2NT 1UTMA 1SGEE 1D6WA 1O3NA 2OQUA 2ZDLA 1AVGH 1E36B 4CRBA 2GD4B 3LC5A 4X2VA 2FX4A 1YPMH 4BAHB 1FN6A 3FP6E 3R3GB 1TX6A 1WAYB 1F0TA 3UQOA 3A7VA 1O36A 1GDQA 2J38A 3DFJA 1P8VC 1ABJH 1AWHB 3ZZ9A 2RDLA 1TWXB 1QURH 1FPHH 2ZU1A 2A31A 4DT7B 1BTWA 1O33A 2BVRH 4M7GA 4NIXA 5EW2H 2ZGJA 3VXEH 4ZHAA 3LIWA 1QCPA 4Y7BA 1FONA 1RFNA 1OWEA 2HLCA 2GT8A 3A83A 3V7TA 2VINA 4KGAA 5I25A 2ZF0H 1AHTH 1TGSZ 5HMAA 1O2HA 4RN6A 1NRSH 2BX3A 4IS5A 1MU6B 1EP5A 4O9VA 1EX3A 3EGKH 2RG3A 1IQNA 3EA7A 1SHHB 1GI0A 3I77A 1O2MA 1HIAA 2GZ9A 1V2VT 1S6FA 3RMOH 1GMHG 1O30A 4HZHA 4RKJB 4X8TH 2VGCB 1K22H 3A7TA 2V0BA 2ZHQH 2XXLA 4GCHG 4IGDA 4U30A 4O3TA 1TNHA 2OINA 4WWYA 3ZYEA 5FX6A 3S9AA 3DD2H 1TNKA 2FI5E 1THRH 3K6YA 5E8EH 3LOXA 3DUXH 3V0XA 2HWLB 1ESTA 1TQ0B 4YESB 4BOHA 1IQLA 1KSNA 2WV4A 4X1SU 2FDAA 1CA0B 4INKA 1SPJA 2QYIA 3GDSA 3ESTA 4YT6H 4Y71A 1C5RA 4JZDH 3W94A 3BG4B 2VIVA 1HPGA 1O3DA 3Q3XA 4K60A 2Z3DA 2Y82A 2IJOB 2CHAC 1K9OE 1Y3WA 2ALVA 1NFYA 1OXGA 3MO3A 1MTWA 1HXFH 2ZWLH 1BHXB 3RMNH 2BVSH 4MNXA 1O3MA 6CHAB 1V2RT 1VCWA 2GDDA 4K69A 4DGJA 1L4ZA 3T25A 1C1UH 2J9NA 4NWLA 2ZDMA 1N6XA 2TGAA 1Z6JH 1GJ4H 1MTVA 4ASHA 1GHBF 1BT7A 1A0JA 4I8JA 3NPSA 2ZPQA 1BUIA 1BQYA 2OC8A 2JETB 2F83A 3QTVH 1QIXB 3LKWA 5FBIA 2VU8E 3BEIB 1F0SA 1L1NA 2EI7A 4B2BA 4CRAA 5DPAA 1DM4B 5JB9S 3ZZBA 1YCPK 3UREA 3PB1E 3GCHC 1J17T 2PR3A 1BMLA 1D6RA 2Y5FA 1VITH 3UOPA 2FMJA 2HVXA 3BTFE 2QXIA 1HFDA 1TRMA 2HNTE 4JYTA 2BDIA 1Z7KA 2JH0D 4AG2A 1NU7B 2AERH 1ANCA 1PPGE 4FUBA 4AYVB 4DIHH 1AB9B 1PPHE 2BDAA 3FANA 4JZIA 1PYTC 1VITF 1OYQA 1EB2A 1C2KA 1WBGB 1IQFA 3O8RA 1TOCB 3U8OH 3U8RH 1VJ9U 2AMQA 3TH3H 3SV9A 1GVZA 1T4VH 1PQ8A 1VJAU 4ZKOU 1O3HA 3E91A 3KQBA 3GY6A 1NTPA 3KHVA 2WPMS 2ZNKH 5JBAS 2AMDA 1GJ5H 3BEFB 1AE8H 3GCOA 5K7RA 4IN2A 1LTOA 3NZIA 1AD8H 4AGKA 1K1PA 4ZH8A 1ZSKA 2XTTB 1C1SA 1MBQA 3NWUA 1O2QA 3ENSB 3F9GA 3RU4D 2ZFTA 4ABAA 5DP3A 4ZXYH 4CRGA 4X8UH 2ZDVH 2SGFE 4LOYH 3SGAE 1BMAA 3BV9B 3FZDA 1O2RA 1SGRE 1LVMA 2TRMA 3QGNB 1SFIA 1GHAF 3P8FA 1ZTKA 2QCYA 4YTAA 1SQOA 3PTBA 4WMDA 2ZDAH 1AFQC 3SV2H 1ZOMA 2XBVA 1G3BA 1L1GA 4F49A 1DLEA 1EP6A 3SHCH 2Z9JA 3JZ2B 3ZZ4A 4K3JA 2AYWA 2J94A 1SOTA 4ABHA 1C4Y2 1A3BH 4NFEA 1ZMJA 1NC6A 3ZZ3A 3ODDA 4O97A 1O2JA 1TNIA 4ZHLU 4MNVA 5E2OA 2HRVA 4B74A 3ZVFA 3RU4T 2FOMB 4I8HA 3SJOA 2H6MA 1KDQB 4DURA 1GBHA 1NO9H 3LGWA 1YYY1 2H9TH 2A0QB 1F5RA 4Z0KA 2Z7FE 1BRUP 1O3CA 5L30H 1MCVA 1LKAA 3ZVBA 1LHDH 2AEIH 1GDUA 2A5AA 2XC4A 3RM2H 1Y5UT 5HM9A 1Z71A 1QL9A 3IITA 1L1JA 2ESTE 4JZ1A 3A7XA 6GCHG 1SSXA 3B9FH 5JBBS 4DIIH 5EQRA 1W0ZU 1GJ9B 1RRKA 1UMAH 3BTWE 1UTPA 3NCLA 5FAHA 3S7KB 5BRRE 4F4OC 1BZXE 2G51A 2XWBI 2ZU2A 2GCTC 1DITH 3RXMA 1FJSA 1FPCH 1WV7H 1TA2A 2AGIX 4IN1A 2C8ZB 2FOCA 2G5VA 1EKBB 4UONA 1YPLH 3ZVCA 3VPKA 3UNSA 4UDWH 4ABDA 3RXRA 4Y8YA 4ZHMU 4WJG2 3BTQE 1CHGA 1FAKH 3OSYA 4OS4A 3ZZ7A 3F9HA 3KQCA 3PMHB 5K0HA 1J16A 1QRWA 1K1IA 4GHTA 3K65B 1XX9A 1S82A 4E05H 1ELEE 1SGNE 1QJ1B 3HGNA 1W7GH 1C5TA 2F9PA 3EA9A 2Y6TA 3RXCA 1GPZA 3AAUA 4ISLA 3OY5U 3A89A 3RXIA 1DUEA 4XBDA 2J95A 5E2PA 2A1DB 2Y80A 5FCRA 4ZROA 1BRCE 1P10A 1ZJDA 2TPIZ 4I8LA 5G4BA 4LZ4B 3ZVGA 3OU0A 2ZG0H 2ZECA 1GL1A 3SU4A 2D8WA 3A82A 2VVCA 1IQMA 1H9IE 2F3CE 1DOJA 2A7HA 3CENA 3GCHB 3CP7A 2BLVA 1EJAA 2BOKA 1NROH 2UUKB 2SFAA 1IQHA 1TGTA 1YPHE 4AFUA 3TPIZ 4AORA 5HYOA 1MKWK 5L2ZH 2BXTH 4KTUA 3OY6U 2XWAA 3TITA 1EAXA 3K9XB 1G3EA 3TNTA 1SGDE 2ZU3A 3KGPA 3A7ZA 1HAZB 1BOQA 3DFLA 4NSYA 1HXEH 1UTJA 1ETTH 2BD4A 2PLXA 4A7IB 1G36A 5AFZH 1MKXK 5CMXH 2Q1JA 3BSQA 1ETRH 4WY3A 1H8IH 5A8ZA 1W7XH 4BAMB 2OC7A 1G2LA 1T31A 1SGYE 2Z9GA 1GMCG 4VGCC 1LKBA 1QB1A 4INLA 3D49H 3E0NB 1OKXA 4Z6AH 4O3UA 1CSOE 3E90B 1ZZZA 3ZVAA 1P12E 1O3KA 1MD7A 2D2DA 3MU1A 4XE4A 1TX8A 2OLGA 3TNSA 4B75A 4FU9A 2RA0A 1O2PA 1H9LB 2ZTZA 1HNEE 4WMFA 1FDPA 4JCNA 2O8TA 3MNSA 3M5LA 1EAUA 2A7CA 3PWBA 1EZQA 1CHOG 2PTCE 2H5CA 1KXBA 2R0KA 2G4TA 2GVFA 1ARCA 1ELVA 2Y7Z