3I77A

35/99/170-loops of fxa in sgt
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
230
structure length
230
Chain Sequence
VVGGTRAAQGEFPFMVRLINEENEGFCGGALYAQDIVLTAAHCVSGSGNNTSITATGGVVDLQSSSAVKVRSTKVLQAPGFTKETYGKDWALIKLAQPINQPTLKIATTTAYNQGTFTVAGWGANREGGSQQRYLLKANVPFVSDAACRSSSSFILVANEMICAGYPDTGGVDTCQGDSGGPMFRKDNADEWIQVGIVSWGYGCARPGYPGVYTEVSTFASAIASAARTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Trypsin
publication title Combinatorial Enzyme Design Probes Allostery and Cooperativity in the Trypsin Fold.
pubmed doi rcsb
source organism Streptomyces griseus
molecule tags Hydrolase
total genus 56
structure length 230
sequence length 230
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2009-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3i77A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3i77A02
6ESTA 2ZGXH 1ANEA 2AS9A 1A0JA 1EPTA 3OX7U 1O36A 2FI3E 1GI3A 1RIWB 3QTOH 8LPRA 5F6MA 2Z6BD 1CA8B 2AMDA 3ELAH 1K21H 2R9PA 3GY5A 2CHAC 4YT7H 4RKJB 4CREA 1DT2A 2ZHQH 1N1LA 1W14U 4R0IA 5EGMA 1NRPH 3EGKH 1NFYA 2PFEA 1P8VC 1SQOA 3SI3H 3SNDA 4JYVH 1HLTH 5CHAC 4FUGA 4FU9A 4TY6A 4FUBA 1QBVH 2BVXH 2PTCE 1OWJA 1MAYA 2Z94A 4ZHMU 1BTWA 1UVSH 1L0ZA 5G4BA 1IQJA 1FY8E 1ZMLA 4K2YA 1QBOA 2ZFSA 1BZXE 4FVDA 2GMTB 1C5UA 5FHTA 2EI8A 5AFYH 2F9NA 1C2MA 1G2LA 1SPJA 2P16A 1KXFA 5T6DA 3S9CA 7GCHF 2F9OA 1QL9A 4I32A 3ZVFA 2V3HH 2IJOB 3PMJA 3RXPA 3GCTG 3VGCC 1WUNH 2PLXA 1BMNH 1UTMA 2P8OC 2Q6DA 1DWBH 2WYJA 1TMTH 6LPRA 1G30B 1OP8A 3QGNB 3U1JB 3Q3YA 1O2QA 2FOGA 2Y6TA 3PO1B 1AO5A 1TBZH 3LGVA 1RGQA 2VH0A 1VITF 4JK5A 4VGCC 1IAUA 1OSSA 1FONA 3U8OH 4KP0A 3STJA 3TK6A 7ESTE 3SHAH 1PPHE 1O2OA 2A0QB 3FAOA 1GBHA 3Q77A 2HWLB 2B9LA 4NA8A 1YYY1 3A7ZA 2HOBA 3BTQE 1TOMH 3NXPA 1ZOMA 2PKAB 1C9TA 2PWXA 1W0YH 3ATIA 7KMEH 3PYHA 2R0LA 2BY5X 1CHOF 1TNLA 2ZF0H 1K9OE 5C20A 1SGTA 1H9LB 4YESB 1BBRE 2H5CA 1GHWH 4I8KA 1YCPM 2BHGA 3OYPA 5I46H 4Z6AH 2QGRA 4AB8A 4AB9A 3P70B 1C4V2 2F9PA 2GD4B 3A8DA 2P94A 1L4DA 1TGNA 2A5AA 5DPAA 2GCTC 1TGCA 3BTFE 1RS0A 5TCAA 2GDDA 3RXFA 1QGFA 1KXDA 1HIAB 4K8BA 1W10U 1GDUA 3MNXA 2TRMA 3MWIU 2FDAA 6CHAC 1O2RA 2J38A 4FUJA 1TFXA 9ESTA 1GGDB 1QHRB 1M9UA 2AH4X 2HPPH 2NU3E 1QNJA 4UFGH 1C5RA 4AFSA 5JYIA 2JH6D 3MHWU 1BBRH 5AFZH 1UHBB 1O2KA 1EJMA 2AGGX 4A6LA 1SVPA 5F03A 2XWBI 2XNIA 4OS4A 1GHBF 3M37A 1TA2A 2DE8A 4LXBH 4Y71A 4Q2KA 4A1VA 3L6PA 1H9HE 1WU1A 4SGBE 3E6PH 1YCPK 2VVVA 2O8TA 5EOKA 4IS5A 1AVGH 1B0FA 3ZZ8A 4I33A 3PM3A 1GHAF 1GBBA 1XUKA 2QN5T 1RFNA 2A2XH 2ZU1A 3QDZB 4UFEH 3SGBE 3A82A 1NFXA 1SGIB 3GY3A 3UFAA 1SHYA 3NCLA 1CGHA 5HM9A 1QRWA 3SW2B 2QY0B 3IG6B 1KXAA 2ZC9H 1QFKH 4ISNA 3ZVAA 1ABJH 2FS9A 3ZVEA 2FOMB 1C5WB 1ZTLA 5GPIB 1J14A 1O3PB 3LKWA 4X8SH 1AFQC 3BN9A 2ZI2H 4MPWA 4X1NU 2UUKB 1P03A 3V7TA 1KTTB 1TPAE 1KLJH 4U30A 2FOFA 1FN6A 4GHQA 5A8YA 1MD7A 2XYAA 4U2WA 1C5LH 2A4GA 2BD5A 4MPXA 1QY6A 1RTKA 2PKSC 2OP9A 5GIBA 1SR5C 1XM1A 1GJ4H 2P93A 1PYTC 5EXNA 3SUGA 1QIXB 4H42U 1ZJDA 1TLDA 3QZQA 1GI1A 1HJ8A 2RA3A 4AZ2B 2OQ5A 4F4OC 5I25A 1GMDF 1HAGE 2ZQ2A 1BTHH 3O8RA 1GI5A 1IQNA 1O2HA 2EC9H 1GG6C 4BAHB 4WMEA 3RP2A 3NWUA 2ZDNA 1C4U2 1G3EA 1H8IH 2GGVB 3OY5U 1IHTH 2STAE 3DD2H 2VH6A 3RXOA 3ZZ5A 3HKJB 4AG1A 1MH0A 3M7UA 1YLDA 1TGSZ 3R0FA 3T62A 2ZP0H 1C5YB 1Q3XA 1K1MA 2ZCKP 4YOIA 1AKSA 1YBWA 4A5TS 1V2WT 4XBBA 3SO3A 1V2UT 4YLQH 1ACBE 5FAHA 4YT6H 1V2RT 3PV4A 1WYKA 2BMGB 4M7GA 4WXVA 1DY9A 4CH2B 1DPOA 4GUXA 4J2YB 1NFWA 3FFGA 4X2VA 4OS5A 2PSYA 2XBXA 1O31A 1LCYA 1SB1H 9LPRA 4JMYA 2W3KA 3UUZA 3P17H 3GCHC 5TCCA 5C1XA 1SGFG 4K1SA 3RM0H 1FV9A 3M3TA 1W0ZU 3RU4E 1AUJA 4HI3A 2FX4A 3LONA 4GPGA 2AIQA 1HBTH 1NROH 2GP9B 2ZHEH 3TJNA 2OINA 4ZUHA 1GJDB 3L33A 4YOGA 1C1QA 1FUJA 1TX6A 2NU2E 3Q3XA 8GCHG 1LVMA 1PPEE 1SGFA 2OLGA 2BVSH 3BEFB 1K1PA 1X7AC 4DY7B 5A2MH 4B2AA 2HPQH 1WAYB 2H6MA 1NRQH 2HVXA 1KLTA 1MUEB 2PSXA 5K7RA 1D3PB 1TALA 1O2LA 3MO3A 1TGTA 4B2BA 1L4ZA 1UTKA 2VU8E 1JXPA 4DGJA 3SBKA 3BEUA 2PKSB 1GDQA 3KQCA 1QA0A 5DP6A 1MZDA 1O5EH 1GBDA 1AZZA 4X2YA 1O38A 1FI8A 3W95A 4Y76A 5JBBS 1ZPZA 1C5MD 1FAXA 3GISB 3P8FA 3PTNA 3E16B 2GCHG 1DWCH 3TJVA 4K5ZA 1S82A 1O2JA 5DP4A 1HAXB 2SGQE 2BZAA 1C2IA 4DJZB 2ZGHA 1O32A 1O3EA 4FUHA 1IQLA 2J95A 3MYWA 3U9AH 1GHZA 2BB4A 1BCUH 1BMAA 1JIMA 4THNH 2VGCC 4IMQA 1DWDH 1IQEA 2O8UA 3SGQE 4IN2A 1AY6H 1MTNB 4JYUH 2BQ7B 2SGPE 4D7GA 4ABDA 3CS7A 2PR3A 1BTYA 1MU6B 2XTTB 2Y7ZA 1LO6A 3ATLA 3GDVA 4DURA 4Q7XA 1MZAA 2F3CE 2RCEA 1ZTJA 3M5LA 2R2MB 4JZ1A 3ODFA 1BHXB 4MLFB 2XC0A 2BDCA 1XUGA 4ZKRU 1FLEE 3GCHB 4I8GA 1RJXB 3VB7A 4JK6A 4LOYH 1GMCF 2ZDMA 2GZ9A 5F8TA 1P57B 1ZSKA 1RTFB 3SU0A 1GJCB 1PPCE 1BT7A 3I78A 3MNCA 1C4Y2 1PJPA 1F0SA 2CV3A 3U98H 4I8JA 2FWWA 1HGTH 2BLOA 1MKXH 1PPZA 5A0BA 2C8ZB 2XC4A 5HYOA 1SL3A 3S0NA 2CXVA 1O2VA 3A7WA 4J1YA 2P3FH 3KEEA 3T2NA 5FX6A 3A86A 1C1UH 1G3DA 3SI4H 2B0FA 4OS7A 2Y82A 1C1OA 1YPKH 1ZHMA 2ODQA 2H9HA 1GJAB 4CHAB 1YPMH 1FPCH 1SBWA 1KY9A 3ZVGA 3MO9A 5EW1H 1F5KU 5C67A 5TJXA 1UHBA 5L2YH 2ZDVH 1KLIH 1ZTKA 1ESAA 4X1RU 1MQ6A 2J4IA 4I8HA 1DITH 1YPEH 4XSKU 2WUBA 3FP8E 4ISHH 1AFEH 1SFQB 4NIXA 1GHVH 3OTJE 4WVPE 3A89A 1TX8A 3FZDA 4IGDA 4ABIA 4X0WU 5JBCS 2W7UA 1ZHRA 3ZZCA 3M35A 1QB9A 3SU5A 1V2VT 4Y0ZE 3DA9B 2JH5D 1LHGH 1H4WA 1Z1JA 5JBAS 3RC4A 1BOQA 1V2LT 2ZNKH 2FTMA 1WBGB 4GAWA 2FESH 3PB1E 4HTCH 1W12U 1GBIA 1HAVB 1WQSA 1GBEA 2ZQ1A 3MU8A 2OBQA 3PLKA 5T6GA 3SJ9A 2J34A 1VCPA 1D6WA 3BF6H 3PWBA 4AN7A 2WYGA 1W8BH 4NIWA 3ATMA 4DCDA 2OXSA 1NU7B 5DO4H 4AGJA 1K1JA 4XBCA 4AFUA 3ODDA 2UUYA 3A8AA 1Z6EA 1ZYOA 1UK2A 4NZLA 2O8LA 1LMWB 3HK3B 3K2UA 1C1VH 3GYMA 4CRGA 2P3TB 2XC5A 1A3BH 2AGIX 2F91A 1HDTH 1BIOA 2FXRA 4NWLA 1BTUA 1LKBA 2NU4E 4K1TA 3SJKA 3EAJA 1P01A 1SHHB 5HXFA 2FP7B 3AAUA 3F9GA 1N8OB 1YGCH 3ESTA 4RKOB 4WWYA 2WV5A 1EB1H 1DS2E 1GJ7B 1VJAU 3CP7A 1HYLA 1HXFH 4BNRA 3ATWA 3VEQB 3KF2A 1C5PA 1EAWA 1F5RA 2ZHDA 3UQOA 4CBNA 3PMAB 2LNCA 1AUTC 1O2GH 2A7JA 2ZG0H 1F92A 2ZDLA 2BDIA 3BG4C 3LOXA 4FVBA 4Y0YE 5SGAE 4IW4E 1ELTA 4BTTB 1MKWK 4TY7A 1JRSA 1D9IA 1KYNA 2A31A 3F68H 3P8NA 1F5LA 1UVOA 2ANWA 1FDPA 4WY3A 2WUCA 3TVJB 1UJ1A 1SGNE 3S7KB 4CBOA 1XUFA 1Z8RA 4D76A 1TYNA 4ZMAH 4WH6A 1DX5M 3S9AA 1UK4A 2TIOA 1L2EA 4D9QA 3N7OA 1NPMA 1JBUH 1QJ7B 4FUDA 4ZAEA 4Q7YA 1VZQH 3W94A 1BB0B 3PROA 1V6DA 1TAWA 1Y8TA 4BANB 1LKAA 2VWOA 1LPGB 2ZEBA 3ZZAA 1CT0E 3D62A 1D3DB 4NWKA 3V13A 3M36A 7GCHG 3RUOA 4MNVA 3LC3A 1K1LA 4X8TH 2F9VA 1ELEE 4UONA 1J17T 1GL0E 1O3IA 1ZHPA 5AF9H 3TK9A 1AWFH 3F9HA 3RXVA 1CE5A 1U6QA 1RD3B 1D3TB 3RXJA 5DP8A 3LJJA 1ETSH 1VITG 1D3QB 2ZFRH 2W7SA 1V2QT 2ZTXA 3Q76A 2FOEA 6GCHF 1SQAA 1ELBA 5E2OA 3TIUA 4NSVA 2A1DB 1S0RA 4TPIZ 1OP2A 2BOHB 5IYTA 4ABAA 1VJ9U 2FI4E 1QURH 1NTPA 2FMJA 1S84A 2FOBA 2JH0D 4FUIA 3SQHE 4E7RG 3SJIA 5DGJA 3VXEH 1AB9C 2ZGBH 1THPB 5JDUB 4B2CA 1GI9B 1V3XA 1KXBA 1CHOG 4TPYA 4MTBA 3RU4T 1F0RA 3M61U 4JZDH 1WOFA 1BTZA 3UY9A 1MTUA 5AHGH 1GVKB 1O3OA 3ZZ9A 1C5OH 1ZSJA 2GZ8A 2B5TB 1KIGH 1OS8A 2PTNA 3QGJA 4A92A 2STBE 1GPZA 1ANDA 1GHXH 2OC1A 1OWEA 3ZZ7A 1GBMA 1C1MA 1BJUA 2GVFA 1AU8A 3SU2A 1IQKA 1TMUH 1UTPA 1TRYA 2GX4A 4MPVA 5LPFA 1O5GH 3D23A 1SLWB 2JETB 5C1YA 1HXEH 1FY5A 1GJ6A 1C5ZB 4GLYA 3GY4A 1NRNH 1BMLA 2G8TA 2P3UB 1PPBH 1G32B 4BTIB 1EJNA 3GY6A 1OYTH 3K65B 4FUFA 3HGNA 4K3JA 1GHBG 1IQGA 2EI7A 2UWLA 3GDSA 4B76A 3GCNA 1OWKA 2ZA5A 2CHAB 4CRCA 2WPJS 3RLYH 1D6RA 2R2WU 4X8UH 1K1IA 1BRCE 4IC6A 1B7XB 1KDQB 1C1RA 4HZHA 1Q31A 5CHAB 2VB0A 2PUQH 4MQAA 1C2HA 2C8WB 2ZPQA 1GDNA 2ZU2A 1GHAG 1SMFE 2OUAA 3RXBA 3TJOA 4I31A 5ABWA 1CA0C 1HUTH 1EAXA 5EQSA 2ANYA 2PW8H 1HAYB 2CF9H 1P10A 3RXCA 1BHXF 4X2WA 5DJ7A 1CGJE 2QIQA 1OKXA 3TNSA 4GSOA 3UREA 2OC8A 5DG6A 1O3FA 5F8XA 1A7SA 3H7TA 2ULLA 2BDBA 5FCRA 1ELVA 1TRNA 3RC5A 4K60A 2TGTA 1YCPH 1N6XA 3DFLA 3S69A 5EPYA 1EPTC 2Y5FA 1VGCC 3ZVCA 4NA7A 1BRAA 4UEHH 4AORA 1YF4A 1UVUH 4WF8A 1XVOA 2SGEE 1Y59T 5EODA 3VGCB 2W3IA 1EX3A 1AB9B 1BMMH 3EQ0H 1BQYA 4X1QU 1FY4A 2P8OB 3BTME 3RXKA 1SOTA 5BPEA 3VB4A 3TH3H 1C2FA 3OY6U 3FP6E 1FZZA 2ZZUH 3M3VA 3SU1A 1S0QA 4F49A 4VGCB 1W7GH 3RXSA 1TNIA 5L2ZH 1GMDG 1GBLA 3QWCH 1TNHA 1TABE 2VNTA 1LVOA 1UVTH 3LGUA 3EA7A 3OSYA 3LDXH 3TU7H 4B73A 4X1PU 2V3OH 2GT7A 2ZTZA 3MH6A 4JYTA 4MVNA 2D26C 1Q2WA 1LTOA 3HATH 4CR5A 1E0FD 3P8OA 5GDSH 2A4OA 4Q7ZA 1G37A 4JCNA 3SV2H 1O3HA 1C1NA 1O2MA 3SNAA 1O0DH 2XXLA 2HLCA 1NM6A 3BG8A 4OGXA 1Y5UT 4D9RA 1KTSB 4NA9H 3A81A 2ZKSA 1AE5A 3RMNH 3AW0A 1EQ9A 3GY7A 2I6QA 4X2XA 3HK6B 1O3MA 4HGCA 1RXPA 2WV4A 2NU1E 2C90B 2W5EA 4GVUA 2GCTB 1C2KA 5GWZA 2ZFQH 1ZMJA 3UNRA 1RRKA 1QL7A 4GCHF 2QV1A 1O2XA 4RSPA 4NZQA 3RXQA 6CHAB 5JB8S 3RXRA 1UTJA 4BAKB 2XW9A 3F9FA 1AD8H 2A4QA 1O3NA 1DOJA 1PQ5A 1CA0B 1DVAH 5FPYA 2A7CA 1ABIH 3T27A 1PFXC 3UOUA 1ELCA 1MMJN 1FY3A 4H6TA 1ZMNA 2PV9B 1EAUA 1F0UA 3EA8A 3A8CA 1G3BA 2CJIA 5LPRA 1UK3A 1FMGA 3SNEA 3SUEA 2SGDE 1T4UH 3SJ8A 1SGEE 3RXAA 3JZ2B 2GT8A 2Z9LA 3M7QA 1TBQH 3WY8A 3GCOA 1ELGA 1EPTB 3BTHE 1GBJA 4FU8A 8ESTE 1KSNA 2VIDA 1C1WH 3A7VA 4U32A 4BTUB 4X8VH 1ZGIA 1IOEA 1MD8A 2BD8A 3PMHB 5HM2A 1S83A 2D2DA 4KELA 4AYYB 2QXIA 1Y3UA 2BY6X 4NIVA 1GWAA 4DVAU 2B8OH 1HPGA 3RXIA 4BAMB 5C3NA 3BTGE 3E91A 3E0NB 3MTYA 2KAIB 1AFQB 2GDEH 3UWJH 3SV7A 1NY22 3D49H 3QTVH 5LH8A 4WMFA 3MH4A 3KQEA 3EE0B 2J92A 2UUJB 2C8YB 1TWXB 4XE4A 4AFQA 1E36B 5EPNA 4INLA 3RXHA 1WCZA 4ABFA 5FPSA 3GYLB 1C5NH 2BVRH 2HALA 1EOJA 2O8WA 3R3GB 2CGAA 1EP5A 2Z7FE 3MMGA 2BD2A 2FS8A 1ANCA 4B71A 2ODPA 1LQEA 3P6ZB 1DDJA 4A1XA 1EP6A 2RA0A 1UO6A 3C1KA 2FX6A 4BAOB 2V35A 1CT2E 3M5MA 1GG6B 1O3AA 4CH8B 1MAXA 3Q00A 4ISLA 4LZ4B 2OD3B 5EU8A 4D7FA 4YOJA 3I29A 3B23B 1DSTA 1H9IE 4K69A 3LH1A 1V2TT 1HJ9A 3MU5A 5CE1A 3S7HB 4O97A 1G2MA 2AERH 4PROA 1ANBA 2QAAA 1QB1A 1A61H 2QCYA 2AEIH 2BZ6H 4ABBA 2WPKS 3TNTA 2FYRA 1TQ7B 1GMCG 1C1SA 1QR3E 1IQIA 1GBCA 3DUXH 2W26A 3PWCA 3SU6A 3A85A 4NG9H 2DUCA 2BX3A 3QZRA 1F0TA 4U01A 1FQ3A 1FN8A 2ZECA 4AYVB 4OGYA 1TRMA 1FIZA 3H5CB 3EA9A 2Q1JA 3GICB 1GVLA 3KCGH 2SFAA 1HB0B 5JPMH 1AI8H 4HFPB 2QF3A 3K9XB 3M3SA 5CMXH 3FP7E 2Z9JA 2FOCA 2G00A 2CF8H 1HAHH 5DKMA 2PKAA 4ZKNU 2ZU5A 5GCHG 2NU0E 3RDZA 4SGAE 3RMLH 4KTUA 1GI2A 1GVZA 1E35B 2HNTC 1C2GA 3UQVA 3LGIA 2FOAA 4DT7B 2WPLS 1P06A 5A0CA 1ETRH 1K28D 4E06H 1TGBA 2QXGA 1O5CB 3GOVB 1FAKH 1AWHB 5T6FA 1BJVA 3NKKA 5K0HA 1FY1A 1P04A 1TOCB 3U8TH 1QRZA 1BUIA 2ALVA 2ZCLP 1KDQA 1HIAA 2H1UA 3DFJA 1O33A 2G4TA 2RG3A 2Z3CA 3VB3A 3TPIZ 1ELAA 4LK4A 3F6UH 2Z9KA 3V12A 4NFFA 3TLOA 2K1QA 2BOKA 2XBVA 3IITA 3I77A 4AFZA 4K8YA 2VWLA 2P95A 3U8RH 1CBWC 3UOPA 3STIA 1SGQE 1NFUA 3FVFB 1AVWA 1P2JA 1Z8IB 2B7DH 2G81E 3LPRA 1OP0A 1EB2A 1WTGH 1E37B 1AVXA 1RIWC 1GCDA 2IOTA 1VR1H 2Z3DA 3SN8A 2VGCB 4NFEA 2EEKA 2A2QH 4YO9A 1QBNA 1IHSH 2R3UA 5EW2H 1GJ8B 1V2OT 2XWAA 2VIWA 4BXWA 1C9PA 5F8ZA 2GKVE 1B5GH 3A8BA 2C3SA 1EZSC 3A80A 1SGCA 3GDUA 2OTVA 1Y3YA 4Y8YA 5EXLA 1DXWA 2AMQA 1SGDE 2C93B 3O8DA 1UTNA 1BRUP 1L1NA 2BTCE 2WPIS 4TWWA 1OWHA 1YM0A 5IDKA 2CN0H 1O30A 1K22H 4INKA 3HPTB 3QUMP 1DE7H 3KGPA 2ZTYA 1P2NA 1HV7A 1XUIA 1ORFA 3U1IB 2GMTC 1UCYK 1AE8H 1XXFA 2R0KA 3HGPA 4YM9A 1PQAA 1ETTH 1NT1A 2O9QA 1CO7E 3M7TA 3VB5A 5FBEA 3ZZ4A 3KNXA 1G9IE 1LVYA 1GI4A 3UWIA 1LPZB 3NZIA 2ZIQH 2OBOA 1EZUC 2BDYA 1O2WA 3BTWE 4WH8A 1A5GH 2GZ7A 4ISOA 4Z0KA 1XKBC 1AKSB 1SG8B 4MDSA 1OXGA 1AN1E 2OC7A 3RLWH 1MKWH 2FO9A 3JZ1B 5C1UA 4ZXYH 3SNCA 1OPHB 1TONA 4ESTE 2Z9IA 2AIPA 4ABEA 1EJAA 2UWOA 1J8AA 1NU9A 4OS2A 2V0BA 1SI5H 1V2ST 5EQQA 3A88A 2TBSA 1BTPA 1Y3XA 3AAVA 2Q6GA 5EXMA 4FUCA 2Y5HA 5C5NA 5GJ4B 3CS0A 4X6OA 1P09A 2R3YA 1IQFA 2FPZA 5ETXA 1XKAC 1FIWA 3TGKE 4AOQA 4Y8ZA 6GCHG 4WJG2 2O8MA 3BEIB 1H8DH 1GMHF 1QQ4A 5T3HA 1XUJA 1A1RA 1Y5AT 3ATKA 3BTEE 1H1BA 1A0LA 5B6OA 1L1JA 1J9CH 4DIHH 2HNTE 1Z71A 1NRSH 3E8LA 1P9SA 3UNSA 2PUXB 2ZO3H 1KXEA 1T4VH 2VVCA 1MBMA 4ZH8A 1P9UA 4KKDA 3LT3A 1UTOA 4XBDA 1GI7B 2ZPSA 2KAIA 1GGDC 1GCTC 1N6YA 3GY2A 2FODA 3MNSA 4DG4A 1MCTA 3M5NA 1O3DA 4MNXA 2H9EH 3RXMA 3KHVA 2CMYA 3BV9B 1WSSH 1XXDA 3UPEA 1XMNB 4JZIA 5E0HA 1PPGE 1Z8JB 1SFIA 1S5SA 1V2PT 1EXFA 1Y5BT 1Z6JH 2ZDKA 5J4SA 1TNGA 2TGAA 3TITA 1O5BB 2QF0A 1O2SA 3RMOH 5H4IB 1TPPA 1O3JA 5A0AE 1GHYH 4KTSA 1VCWA 4DW2U 2BLQA 4I8LA 4O9VA 3RXGA 2BLWA 5C5OA 2ANMH 5DK1A 1IQHA 3VPKA 1HAOH 2Y80A 3C27B 1A5IA 1FXYA 2ALPA 2ZHWH 1L1GA 5JB9S 1MCVA 2M5TA 3IWMA 2ZWLH 1TMBH 3BG4B 1BRBE 4E05H 2V6NA 1DY8A 3ZVBA 1P3CA 1V2MT 1TB6H 3SUFA 3BTDE 1HAIH 3MI4A 3UNQA 4TWYA 1CGIE 1HRTH 1P3EA 1YPJH 3T28A 1FJSA 5DP7A 3GCTF 1J16A 1C1TA 3LJOA 2I6SA 2SGAA 4UE7H 4LZ1H 3RXDA 1NRRH 3F1SB 4ZKSU 3QO6A 5J4QA 1XVMA 2XBWA 1GL1A 2VWNA 2YOLA 1C5SA 4CRBA 4O3TA 2ZGJA 2ZPRA 3CENA 1P11E 3UTUH 1VCQA 3RXTA 2QC2A 3TK5A 4ABGA 3A87A 3SGAE 1DLKB 2VVUA 1GI8B 1C5QA 2BDAA 3ZVDA 3RU4D 1OWIA 2JKHA 3T25A 1UVPA 1SLUB 2J2UA 4X6MA 1NZQH 1XX9A 1P0SH 1SQTA 3Q3KA 3LC5A 2BXTH 1EKBB 1A2CH 2FI5E 4NIYA 3T5FH 1O5AB 2G55A 1AQ7A 1BITA 1GBKA 3AASA 3MO6A 1O5FH 3MU0A 4H4FA 4B75A 1GCTB 1JMOH 4I7YH 3SV6A 1A5HA 4Y7AA 1C2DA 1O35A 1BA8B 5ESTE 2UWPA 1BBRK 1LVBA 1DFPA 2J94A 2WINI 1O34A 2FM2A 3LH3A 2BD3A 3K6YA 1O3LA 3E0PB 1W13U 3QN7A 3S9BA 3TH4H 4CR9A 4DOQA 3BSQA 4NSYA 3PTBA 4IMZA 1SGYE 3KQBA 4Q80A 1SC8U 1TA6A 2D8WA 5L6NH 3G01A 1LHCH 1BTXA 4JZFH 2BD4A 2ZGCA 1CU1A 3L3TA 1Z8GA 1T8LA 3ZZ6A 1T8OA 1O37A 5HMAA 1NS3A 5ESBA 1QJ1B 4UD9H 3NPSA 2IPHA 3E1XB 2C4FH 4Y11E 4GCHG 3PLBA 1K1OA 1O2UA 2VINA 3V3MA 3MU1A 2LPRA 2QXHA 2WPHS 1A3EH 3SV8A 1YKTA 3A83A 1C2EA 1HAVA 1P2KA 1T32A 4X6NA 2TPIZ 1AGJA 2OCVB 4UFFH 1OYQA 5DP5A 4ZHAA 3LIWA 1C5VA 4XDEA 1O2IA 1RTLA 1Y3VA 1YPLH 2H5DA 2VIQA 4X6PA 3UR9A 1ID5H 2ESTE 2Z9GA 3H7OA 3AW1A 2XCNA 1G3CA 4WMDA 3SNBA 4CRAA 2GTBA 1NO9H 4Y10E 4ABJA 3TGIE 2QXJA 4ZXXH 4FU7A 1PYTD 1ELFA 1TQ0B 2BD9A 5E0JA 4YZUA 4MG3A 1G36A 1QB6A 5FPTA 2TGPZ 3FANA 2BDGA 2PGQB 1GBAA 3SV9A 4E7NA 2OQUA 1T7CA 2EA3A 4A1TA 1TX7A 1DUAA 1TIOA 1V2NT 2FTLE 1DANH 1UTLM 2YNBA 1JIRA 4AG2A 1P05A 3LGTA 3QX5H 1JOUB 2GV6A 2HNTF 3VFEA 3B8JA 3ZV9A 4A7IB 5A09A 1VGCB 2J9NA 2G5VA 2QA9E 1OOKB 5E2PA 1MTNC 2Y7XA 5BRRE 2ZDAH 1P2IA 2RDLA 1V2KT 4RN6A 3T26A 1DLEA 3UR6A 1O3CA 1PQ7A 1ZGVA 5FCKA 4JZEH 5DP3A 3U69H 2A7HA 1QJ6B 3A7YA 5LGOA 2UUFB 2F83A 4TYDA 1O2NA 1O5DH 1QA7A 3TH2H 4CRFA 4FUEA 3URCA 1GI6A 4O03A 1C2LA 1XUHA 1YPHC 4WXIA 4D8NA 1IQMA 1TNJA 1JRTA 2NWNA 3AVZA 1C5TA 3ITIA 2TGDA 3VB6A 1DM4B 1CVWH 2FLBH 1SOZA 1DWEH 4BAQB 1INCA 1B0EA 1K2I1 1LPKB 1EZQA 2C8XB 3SHCH 2A4RA 1QQUA 3UIRA 3QLPH 3VXFH 3MU4A 4CRDA 2WPMS 5GXPA 1O2PA 3SORA 1GJBB 4CHAC 8KME2 1W3CA 2A32A 3B9FH 2FIRH 1EATA 2AMPA 1AZ8A 3V0XA 1CSOE 1V2JT 3BTKE 1ZJKA 3URDA 3ZZBA 4OS6A 2G52A 3SUDA 8GCHF 3EYDA 5E8EH 2VIPA 3DHKH 1CHGA 4ZKOU 2BDHA 1GBTA 2Y5GA 1Z7KA 3P95A 2BY8X 1TPOA 3E3TA 5FX5A 3D65E 2THFB 1GJ5H 1MTSA 4ABHA 4DIIH 1DSUA 2OC0A 4MNWA 5FBIA 2HRVA 1FNIA 1K1NA 2FLRH 4ZHLU 2G5NA 1C2JA 2A5IA 1O2ZA 3TJUA 2F9BH 3KIDU 3SJOA 2BY9X 1DUEA 2ZU4A 2BD7A 2YNAA 1Z1IA 2EI6A 2A5KA 1ZZZA 1NC6A 3RC6A 1ZRKA 5PTPA 3KN2A 2GCHF 2SNVA 1SLXB 3SZNA 1W7XH 1A46H 1YPGH 5AVDA 4ASHA 1FPHH 4GHTA 1PQ8A 3KL6A 4UDWH 2G51A 1ZRBA 2ANKH 1W11U 3EDXB 4NCYA 1MU8B 1NESE 4MPUA 3SQEE 1HNEE 3SOSA 3MOCA 1JWTA 4IC5A 2H2ZA 2ZFTA 1EOLA 1S6FA 3F9EA 3E90B 1HCGA 1LHDH 2ZFFH 4BXSA 5A8XA 3MH5A 5EG4A 1TE0A 1DXPA 1TNKA 2FOHA 2Z3EA 2PHBA 1UMAH 3O8BA 1MTVA 4Y7BA 1N8OC 1WQVH 4Y6DA 1O3KA 1CQQA 3PMBB 1AMHA 3DT0H 3P92A 3MH7A 4QT8C 1P12E 3MFJA 1DICA 4XOJA 1MKXK 1S6HA 3BIVH 1VITH 2BX4A 1THRH 2ZFPH 1WV7H 2AGEX 2QYIA 5EQRA 3RM2H 1ZPCA 1ESBA 1P2OA 1Y3WA 2AYWA 5HGGA 1ESTA 2F9UA 2HGTH 3FZZA 4INHA 5C2ZA 1S85A 2PGBB 2SNWA 3A84A 1HJAC 5GCHF 1ELDE 1EZXC 3TGJE 2DE9A 1ZSLA 2SGFE 4YTAA 1EUFA 2VJ1A 4ISIH 1YC0A 2Q6FA 1TPSA 1C5XB 1YLCA 4B1TA 5DP9A 5FXLA 2AFQB 3LGWA 2BQ6B 1A4WH 1LHFH 3GY8A 1GBFA 1LHEH 4IN1A 2Y81A 1WTHD 3MNBA 1UCYE 1OX1A 4BOHA 5E0GA 1PPFE 3RXLA 1MQ5A 1KXCA 2BQWB 3ZYDA 3BIUH 1YPHE 4Y79A 3RXEA 4OS1A 1THSH 1O39A 1AIXH 1OWDA 1SGRE 2BXUH 3O8CA 1T31A 2VWMA 1ARCA 5JBTA 4KGAA 1TBRH 1ZLRA 3A7XA 7LPRA 2GV7A 2VIVA 4YLUA 1O2YA 1ZPBA 1SSXA 1BDAA 2XRCA 4KTCA 2ODYB 4FXGH 1GI0A 1T8MA 4IBLH 3LGYA 4AGKA 2ZCHP 3T29A 1UCYH 4NGAH 1HFDA 2FZZA 2IN2A 2VIOA 1EAIA 2BM2A 1YP9A 2ZHFH 1E34B 2XCFA 3HKIB 3PLPA 4X1SU 5LPEA 2BY7X 4UFDH 3P8GA 2BLVA 3NUMA 1EASA 2ILNA 3K6ZA 1HAZB 3RXUA 4MNYA 1QRXA 1QCPA 1E38B 1SLVB 1MTWA 1O3BA 3M5OA 1F2SE 3ENSB 3RMMH 1C1PA 2FYQA 3OU0A 4B74A 5A8ZA 1NN6A 1P2QA 1QTFA 4AX9H 3PO1C 1F7ZA 3BTTE 2ZU3A 4XFQA 1D4PB 4ZROA 1GMHG 1W2KH 1LDTT 2H9TH 3A7TA 1A0HB 4H6SB 1T8NA 1MBQA 1GJ9B 5L30H 1AHTH 1P2MA 2ASUB 1ZR0A 2A45B 4R8TB 1QL8A 4O3UA 1LQDB 2G4UA 3ZYEA 2D1JA 3ZV8A 3ZZ3A 1O2TA 3KQDA 3QK1A 3ZZDA 1HAPH 1ARBA 1S81A 2FEQH 2XBYA 1J15A 3NK8A 1SGPE 2BYAX 1CBWB 1O3GA 4Y8XA 3SU3A 1CT4E 1HJAB 1P02A 2P59A 2JETC 3LU9B 3SU4A 1UTQA 4K1EA
chains in the Genus database with same CATH superfamily
6ESTA 2ZGXH 1ANEA 2AS9A 1A0JA 1EPTA 3OX7U 1O36A 2FI3E 1GI3A 1RIWB 3QTOH 1BMFD 8LPRA 5F6MA 2Z6BD 1CA8B 2LELA 2AMDA 3ELAH 1K21H 2R9PA 3GY5A 2CHAC 4YT7H 4RKJB 4CREA 1DT2A 2ZHQH 1N1LA 1W14U 4R0IA 5EGMA 1NRPH 2J97A 2QF4A 3EGKH 1NFYA 2PFEA 1E1QD 1P8VC 1SQOA 3SI3H 3SNDA 4JYVH 1HLTH 5CHAC 4FUGA 4FU9A 4TY6A 4FUBA 1QBVH 2BVXH 2JJ2D 2PTCE 1OWJA 1MAYA 2Z94A 4ZHMU 3EE7A 5B6LA 1BTWA 1UVSH 1L0ZA 5G4BA 1IQJA 1FY8E 1ZMLA 4K2YA 1QBOA 2ZFSA 1BZXE 4FVDA 2GMTB 1C5UA 5FHTA 2EI8A 5AFYH 2F9NA 1C2MA 1G2LA 1SPJA 2P16A 1KXFA 5T6DA 3S9CA 7GCHF 2F9OA 1QL9A 4I32A 2QF5A 3ZVFA 2V3HH 2IJOB 3PMJA 3RXPA 3GCTG 3VGCC 1WUNH 2PLXA 1BMNH 4AC9A 1UTMA 2P8OC 2Q6DA 1DWBH 2WYJA 1TMTH 6LPRA 1G30B 1OP8A 3QGNB 3U1JB 3Q3YA 1O2QA 2FOGA 2Y6TA 3PO1B 1AO5A 1TBZH 3LGVA 1RGQA 2VH0A 1VITF 4JK5A 4VGCC 1IAUA 1OSSA 1FONA 3U8OH 4KP0A 3STJA 3TK6A 3FOAA 7ESTE 3SHAH 1PPHE 1O2OA 2A0QB 3FAOA 1GBHA 3Q77A 2HWLB 2B9LA 4NA8A 1YYY1 3A7ZA 2HOBA 3BTQE 1TOMH 3NXPA 1ZOMA 2PKAB 1C9TA 2PWXA 1W0YH 3ATIA 7KMEH 3PYHA 2R0LA 2BY5X 1CHOF 1TNLA 2ZF0H 3KYGA 1K9OE 5C20A 1SGTA 1H9LB 4YESB 1BBRE 2H5CA 1GHWH 4I8KA 1YCPM 2BHGA 3OYPA 5I46H 4Z6AH 2QGRA 4AB8A 4AB9A 3P70B 1C4V2 2F9PA 2GD4B 3A8DA 2P94A 1L4DA 1TGNA 2A5AA 5DPAA 2GCTC 1TGCA 3BTFE 1RS0A 5TCAA 2GDDA 3RXFA 1QGFA 1KXDA 1HIAB 4K8BA 1W10U 1GDUA 3MNXA 2TRMA 3MWIU 2FDAA 6CHAC 1O2RA 2J38A 4FUJA 1TFXA 9ESTA 1GGDB 1QHRB 1M9UA 2AH4X 2HPPH 2NU3E 1QNJA 4UFGH 1C5RA 4AFSA 5JYIA 2JH6D 3MHWU 2YMSB 1BBRH 5AFZH 1UHBB 1O2KA 1EJMA 2JIZD 2AGGX 4A6LA 1SVPA 5F03A 3W1EA 2XWBI 2XNIA 4OS4A 1GHBF 3M37A 1TA2A 2DE8A 4LXBH 4Y71A 4Q2KA 4A1VA 5KGOA 3L6PA 1H9HE 1WU1A 4SGBE 3E6PH 1YCPK 2VVVA 2O8TA 5EOKA 4P00A 4IS5A 1AVGH 1B0FA 3ZZ8A 4I33A 3PM3A 1GHAF 4XRNA 1GBBA 1XUKA 2QN5T 1RFNA 2A2XH 2ZU1A 3QDZB 4UFEH 3SGBE 3A82A 1NFXA 1SGIB 3GY3A 3UFAA 1SHYA 3NCLA 1CGHA 5HM9A 1QRWA 3SW2B 2QY0B 3IG6B 1KXAA 2ZC9H 1QFKH 4ISNA 3ZVAA 1ABJH 2FS9A 3ZVEA 2FOMB 2HVYB 1C5WB 1ZTLA 5GPIB 1J14A 1O3PB 3LKWA 4X8SH 1AFQC 3BN9A 2ZI2H 4MPWA 4X1NU 2UUKB 1P03A 1W0JD 3V7TA 1KTTB 1TPAE 1KLJH 4U30A 2LP6A 2FOFA 1FN6A 4GHQA 5A8YA 1MD7A 2XYAA 4U2WA 1C5LH 2A4GA 2BD5A 4MPXA 1QY6A 1RTKA 2PKSC 2OP9A 5GIBA 1SR5C 1XM1A 1GJ4H 2P93A 1PYTC 5EXNA 3SUGA 1QIXB 4H42U 1ZJDA 1TLDA 3QZQA 1GI1A 1HJ8A 2RA3A 4AZ2B 2OQ5A 4F4OC 5I25A 1GMDF 1HAGE 2ZQ2A 1BTHH 3O8RA 1GI5A 1IQNA 1O2HA 2EC9H 1GG6C 4BAHB 4WMEA 3RP2A 3NWUA 2ZDNA 1C4U2 1G3EA 1H8IH 1UW7A 2GGVB 3OY5U 1IHTH 2STAE 3DD2H 2VH6A 3RXOA 3ZZ5A 3HKJB 5EJZA 4AG1A 1MH0A 3M7UA 1YLDA 1TGSZ 3R0FA 3T62A 2ZP0H 1C5YB 1Q3XA 1K1MA 2ZCKP 4YOIA 1AKSA 1YBWA 4A5TS 1V2WT 4XBBA 3SO3A 1V2UT 4YLQH 1ACBE 5FAHA 4YT6H 1V2RT 3PV4A 1WYKA 2BMGB 4M7GA 4WXVA 1DY9A 4CH2B 1DPOA 4GUXA 4J2YB 1NFWA 3FFGA 4X2VA 4OS5A 2PSYA 2XBXA 3SZEA 1O31A 1LCYA 1SB1H 9LPRA 4JMYA 2W3KA 3UUZA 3P17H 3GCHC 5TCCA 5C1XA 1SGFG 4K1SA 3RM0H 1FV9A 3M3TA 1W0ZU 3RU4E 1AUJA 4HI3A 2FX4A 3LONA 4GPGA 2AIQA 1HBTH 1NROH 2GP9B 2ZHEH 2RDEA 3TJNA 2OINA 4ZUHA 1GJDB 3L33A 4YOGA 1C1QA 1FUJA 1TX6A 2NU2E 3Q3XA 8GCHG 1LVMA 1PPEE 1SGFA 2OLGA 2BVSH 3BEFB 1K1PA 1X7AC 4DY7B 5A2MH 4B2AA 2HPQH 1WAYB 2H6MA 3F0PA 1NRQH 2HVXA 1KLTA 1MUEB 2PSXA 5K7RA 1D3PB 1TALA 1O2LA 1NBME 1TGTA 3MO3A 4B2BA 1L4ZA 1YWUA 1UTKA 2VU8E 1JXPA 4DGJA 3SBKA 3BEUA 1GDQA 2PKSB 3KQCA 1QA0A 5DP6A 1MZDA 1O5EH 1GBDA 1AZZA 4X2YA 1O38A 1FI8A 3W95A 4Y76A 5JBBS 1ZPZA 1C5MD 1FAXA 3GISB 3P8FA 3PTNA 3E16B 2GCHG 1DWCH 3TJVA 4K5ZA 1S82A 1O2JA 5DP4A 1HAXB 2SGQE 2BZAA 1C2IA 4DJZB 2ZGHA 1O32A 1O3EA 4FUHA 1IQLA 2J95A 3MYWA 3U9AH 1GHZA 2BB4A 2W6JD 1BCUH 1OHHD 1BMAA 1JIMA 3SYJA 4THNH 2VGCC 4IMQA 1DWDH 1IQEA 2O8UA 3SGQE 4IN2A 4Q63A 1AY6H 1MTNB 4JYUH 2BQ7B 5DSFA 2SGPE 4D7GA 4ABDA 3CS7A 2PR3A 1BTYA 1MU6B 2XTTB 2Y7ZA 1LO6A 3ATLA 3GDVA 4DURA 4Q7XA 1MZAA 2F3CE 2RCEA 1ZTJA 3M5LA 2R2MB 4JZ1A 3ODFA 1BHXB 4MLFB 2KCYA 2XC0A 2BDCA 1XUGA 4ZKRU 1FLEE 3GCHB 4I8GA 1RJXB 3VB7A 4JK6A 4LOYH 1GMCF 2ZDMA 2GZ9A 5F8TA 1P57B 1ZSKA 1RTFB 4RT0A 3SU0A 1GJCB 1PPCE 1BT7A 3I78A 3MNCA 1C4Y2 1PJPA 1F0SA 2CV3A 3U98H 4I8JA 2FWWA 1HGTH 2BLOA 1MKXH 1PPZA 4YXWD 5A0BA 2C8ZB 2XC4A 5HYOA 1SL3A 3S0NA 2CXVA 1O2VA 3A7WA 4J1YA 2P3FH 3KEEA 3T2NA 5FX6A 3A86A 1C1UH 1G3DA 1E79D 3SI4H 2B0FA 4OS7A 2Y82A 1C1OA 1YPKH 1ZHMA 2H9HA 2ODQA 1GJAB 4CHAB 1YPMH 1FPCH 1SBWA 1KY9A 3ZVGA 3MO9A 5EW1H 1F5KU 5C67A 5TJXA 1UHBA 5L2YH 2ZDVH 2M2AA 1KLIH 1ZTKA 1ESAA 4X1RU 1MQ6A 2J4IA 4I8HA 1DITH 1YPEH 4XSKU 2WUBA 3FP8E 4ISHH 1AFEH 1SFQB 4NIXA 1GHVH 3OTJE 4WVPE 3A89A 1TX8A 3FZDA 4IGDA 4ABIA 4X0WU 5JBCS 2W7UA 1ZHRA 3ZZCA 3M35A 1QB9A 3SU5A 1V2VT 4Y0ZE 3DA9B 2JH5D 1LHGH 1H4WA 1Z1JA 5JBAS 3RC4A 1BOQA 1V2LT 2ZNKH 2FTMA 1WBGB 4GAWA 2FESH 3PB1E 4HTCH 1W12U 1GBIA 1HAVB 1WQSA 1GBEA 2ZQ1A 3MU8A 2OBQA 3PLKA 5T6GA 3SJ9A 2J34A 1VCPA 1D6WA 3BF6H 3PWBA 4AN7A 2WYGA 5C0UA 1W8BH 4NIWA 3ATMA 4DCDA 2OXSA 1NU7B 5DO4H 4AGJA 1K1JA 4XBCA 4AFUA 3ODDA 2UUYA 3A8AA 1Z6EA 1ZYOA 1UK2A 4NZLA 2O8LA 1LMWB 3HK3B 3K2UA 1C1VH 3GYMA 4CRGA 2P3TB 2XC5A 1A3BH 2AGIX 2F91A 1K0HA 1HDTH 1BIOA 2FXRA 4NWLA 1BTUA 1LKBA 2NU4E 2V7QD 4K1TA 3SJKA 3EAJA 1P01A 1SHHB 3F0OA 2FP7B 5HXFA 3NRLA 5EIYA 3AAUA 3F9GA 1N8OB 1YGCH 3ESTA 4RKOB 4WWYA 2WV5A 1EB1H 1DS2E 1GJ7B 1VJAU 3CP7A 1HYLA 1HXFH 4BNRA 3ATWA 3MQKC 3VEQB 3KF2A 1C5PA 1EAWA 1F5RA 2ZHDA 3UQOA 4CBNA 3PMAB 2LNCA 1AUTC 1O2GH 2A7JA 2ZG0H 1F92A 2ZDLA 2BDIA 3BG4C 3LOXA 4FVBA 4Y0YE 5SGAE 4IW4E 1ELTA 4I86A 4BTTB 1MKWK 4TY7A 1JRSA 1D9IA 1KYNA 2A31A 3F68H 3P8NA 1F5LA 1UVOA 2ANWA 3DCLA 1FDPA 4WY3A 2WUCA 3TVJB 1UJ1A 1SGNE 3S7KB 4CBOA 1XUFA 1Z8RA 4D76A 1TYNA 4ZMAH 4WH6A 1DX5M 3S9AA 1UK4A 2TIOA 1L2EA 4D9QA 3N7OA 1NPMA 1JBUH 1QJ7B 4FUDA 4ZAEA 4Q7YA 1VZQH 3W94A 1BB0B 3PROA 1V6DA 1TAWA 1Y8TA 4BANB 1KMHB 1LKAA 2VWOA 1LPGB 2ZEBA 3ZZAA 1CT0E 3D62A 1D3DB 4NWKA 3V13A 3M36A 7GCHG 3RUOA 4MNVA 3LC3A 1K1LA 4X8TH 2F9VA 1ELEE 4UONA 1J17T 1GL0E 1O3IA 1ZHPA 5AF9H 3TK9A 1AWFH 3F9HA 3RXVA 3WWBA 1CE5A 1U6QA 1RD3B 1D3TB 3RXJA 5DP8A 3LJJA 3FO8D 1ETSH 1VITG 1D3QB 2ZFRH 2W7SA 5C17A 1V2QT 2KZ4A 2ZTXA 3Q76A 2FOEA 6GCHF 1SQAA 1ELBA 1YY3A 5E2OA 3TIUA 2WSSD 4NSVA 2A1DB 2V3MA 1S0RA 4TPIZ 1OP2A 2BOHB 5IYTA 4ABAA 5HKKD 1VJ9U 2FI4E 1QURH 1NTPA 2FMJA 1S84A 2FOBA 2JH0D 4FUIA 3SQHE 4E7RG 4DT4A 3SJIA 5DGJA 3VXEH 2VBCA 1AB9C 2ZGBH 1THPB 3AK5A 5JDUB 2YMSD 4B2CA 1GI9B 1V3XA 1KXBA 1CHOG 4TPYA 4MTBA 3RU4T 1F0RA 3M61U 4JZDH 1WOFA 1BTZA 3UY9A 1MTUA 5AHGH 1GVKB 1O3OA 3OTPA 3ZZ9A 1C5OH 1ZSJA 2GZ8A 4B6FA 4P02A 2B5TB 1KIGH 1OS8A 2PTNA 3QGJA 4A92A 2STBE 1GPZA 1ANDA 1GHXH 2OC1A 1OWEA 3ZZ7A 1GBMA 1C1MA 1BJUA 2GVFA 1AU8A 3SU2A 1IQKA 1TMUH 1UTPA 1TRYA 3PV5A 2GX4A 4MPVA 5LPFA 1O5GH 3D23A 1SLWB 2JETB 5C1YA 1HXEH 1FY5A 1GJ6A 1C5ZB 4GLYA 3GY4A 1NRNH 1BMLA 2G8TA 2P3UB 1PPBH 1G32B 4BTIB 1EJNA 3GY6A 1OYTH 3K65B 4FUFA 3GS9A 3HGNA 4K3JA 1GHBG 1IQGA 2EI7A 2UWLA 3GDSA 4B76A 3GCNA 3WWFA 1OWKA 2ZA5A 2CHAB 4CRCA 2WPJS 3RLYH 1D6RA 2R2WU 4X8UH 1K1IA 1BRCE 4IC6A 1B7XB 1KDQB 1C1RA 4HZHA 1Q31A 5CHAB 2VB0A 2PUQH 4MQAA 1C2HA 2C8WB 2ZPQA 2HLDD 1GDNA 2ZU2A 1GHAG 1SMFE 2OUAA 3RXBA 3TJOA 3UB0A 4I31A 5FL7D 5ABWA 1CA0C 1HUTH 1EAXA 5EQSA 2ANYA 2PW8H 1HAYB 2CF9H 1P10A 3RXCA 2KR7A 1BHXF 4X2WA 5DJ7A 1CGJE 2QIQA 3UAIC 1OKXA 3TNSA 4GSOA 3UREA 2OC8A 5DG6A 1O3FA 5F8XA 1A7SA 3H7TA 2ULLA 2BDBA 5FCRA 1ELVA 1TRNA 3RC5A 4K60A 2TGTA 1YCPH 1N6XA 3DFLA 3S69A 5EPYA 1EPTC 2Y5FA 1VGCC 3ZVCA 4NA7A 1BRAA 4UEHH 4AORA 1YF4A 1UVUH 4WF8A 1XVOA 2SGEE 1Y59T 5EODA 3VGCB 2W3IA 5HIYA 1EX3A 1AB9B 1BMMH 3EQ0H 1BQYA 4X1QU 1FY4A 2P8OB 3BTME 3RXKA 1SOTA 5BPEA 3VB4A 3TH3H 1C2FA 3OY6U 3FP6E 1FZZA 2ZZUH 3M3VA 3SU1A 1S0QA 4F49A 4VGCB 1W7GH 1SQRA 3RXSA 1TNIA 5L2ZH 1GMDG 1GBLA 3QWCH 1TNHA 1TABE 2VNTA 1LVOA 1UVTH 2EQNA 2L6OA 3EA7A 3LDXH 3LGUA 3OSYA 3TU7H 4B73A 4X1PU 2V3OH 2GT7A 2ZTZA 3MH6A 4JYTA 4MVNA 2D26C 2KCPA 1Q2WA 1LTOA 3HATH 4CR5A 1E0FD 3P8OA 5GDSH 2A4OA 4Q7ZA 1G37A 4JCNA 3SV2H 1O3HA 1C1NA 1O2MA 3SNAA 1O0DH 2XXLA 2HLCA 1NM6A 3BG8A 4OGXA 1Y5UT 4D9RA 1KTSB 4NA9H 3A81A 2ZKSA 3OEHD 1AE5A 3RMNH 3AW0A 4B6EA 1EQ9A 3GY7A 2I6QA 4X2XA 3HK6B 1O3MA 4HGCA 1RXPA 2WV4A 2NU1E 2C90B 2W5EA 4GVUA 2GCTB 1C2KA 5GWZA 2WHXA 2ZFQH 1ZMJA 3UNRA 1RRKA 1QL7A 4GCHF 2QV1A 1O2XA 4RSPA 4NZQA 3RXQA 6CHAB 5JB8S 3RXRA 1UTJA 4BAKB 2XW9A 3F9FA 1AD8H 2A4QA 1O3NA 1DOJA 1PQ5A 3PRBA 1CA0B 1DVAH 5FPYA 2A7CA 1ABIH 3T27A 1PFXC 3UOUA 1ELCA 1MMJN 1FY3A 4H6TA 1ZMNA 2PV9B 1EAUA 1F0UA 3EA8A 3A8CA 1G3BA 2CJIA 1YLNA 1UK3A 5LPRA 1FMGA 3SNEA 3SUEA 2SGDE 1T4UH 3SJ8A 1SGEE 3RXAA 3JZ2B 2GT8A 2Z9LA 3M7QA 1TBQH 3WY8A 3GCOA 5IK2D 1ELGA 1EPTB 3BTHE 1GBJA 4FU8A 8ESTE 1KSNA 2VIDA 1C1WH 3A7VA 4U32A 4BTUB 5KEDA 4X8VH 1ZGIA 1IOEA 1MD8A 2BD8A 3PMHB 5HM2A 1S83A 2D2DA 4KELA 4AYYB 2QXIA 1Y3UA 3VG8A 2BY6X 4NIVA 1GWAA 4DVAU 2B8OH 1HPGA 3RXIA 4BAMB 5C3NA 3BTGE 3E91A 3E0NB 3MTYA 2KAIB 1AFQB 2GDEH 3UWJH 3SV7A 1NY22 4F55A 3D49H 3QTVH 5LH8A 4WMFA 3MH4A 4ZCNA 3KQEA 3EE0B 2J92A 2UUJB 2C8YB 3CNRA 1TWXB 4XE4A 4AFQA 1E36B 5EPNA 4INLA 3RXHA 1WCZA 4ABFA 5FPSA 3GYLB 1C5NH 2BVRH 2HALA 1EOJA 2O8WA 3R3GB 5GNDA 2CGAA 1EP5A 2Z7FE 3MMGA 2OK5A 2BD2A 2FS8A 2WZQA 1ANCA 4B71A 2ODPA 1LQEA 3P6ZB 1DDJA 4A1XA 1EP6A 2RA0A 1UO6A 3C1KA 2FX6A 2K0QA 4BAOB 2V35A 1CT2E 3M5MA 1GG6B 1O3AA 4CH8B 1MAXA 3Q00A 4ISLA 4LZ4B 2OD3B 5EU8A 4D7FA 4YOJA 3I29A 3B23B 1DSTA 1H9IE 4HG6A 4K69A 1QZ8A 3LH1A 1V2TT 1HJ9A 4XD7D 3MU5A 5CE1A 3S7HB 4O97A 1G2MA 2AERH 4PROA 1ANBA 2QAAA 1QB1A 1A61H 2QCYA 2AEIH 5EJLA 2BZ6H 4ABBA 2WPKS 3TNTA 2FYRA 1TQ7B 1GMCG 1C1SA 1QR3E 1IQIA 1GBCA 3DUXH 2W26A 3N99A 3PWCA 3SU6A 3A85A 4NG9H 2DUCA 2BX3A 3QZRA 1F0TA 4U01A 1FQ3A 1FN8A 2ZECA 4AYVB 4OGYA 1TRMA 1FIZA 3H5CB 3EA9A 2Q1JA 3GICB 1GVLA 3KCGH 2SFAA 1HB0B 5JPMH 1AI8H 2J98B 4HFPB 2QF3A 3K9XB 5CDFE 2WV9A 3M3SA 5CMXH 3FP7E 2Z9JA 2FOCA 2G00A 2CF8H 1HAHH 5DKMA 2PKAA 4ZKNU 2ZU5A 5GCHG 2NU0E 3RDZA 4SGAE 3RMLH 4KTUA 1GI2A 1GVZA 1W0KD 1E35B 2HNTC 1C2GA 3UQVA 3LGIA 2FOAA 4DT7B 2WPLS 1P06A 5A0CA 1ETRH 1K28D 4E06H 1TGBA 2QXGA 1O5CB 3GOVB 4ASUD 1FAKH 2QE7D 1AWHB 5T6FA 1BJVA 3NKKA 5K0HA 1FY1A 1P04A 1TOCB 3U8TH 1QRZA 1BUIA 2ALVA 2ZCLP 1KDQA 1HIAA 2H1UA 3DFJA 1O33A 2G4TA 2RG3A 2Z3CA 3VB3A 3TPIZ 1ELAA 4LK4A 3F6UH 2Z9KA 3V12A 4NFFA 3TLOA 2K1QA 2BOKA 2XBVA 3IITA 3I77A 4AFZA 4K8YA 2VWLA 2P95A 3U8RH 1CBWC 3UOPA 3STIA 1SGQE 5HIZA 1NFUA 3FVFB 1AVWA 1P2JA 1Z8IB 2B7DH 2G81E 3LPRA 1OP0A 1EB2A 1WTGH 2RFKC 1E37B 1AVXA 1EFRD 3F2HA 1RIWC 1GCDA 2IOTA 1VR1H 2XNDD 2AHME 4ACAA 2Z3DA 3PV2A 3SN8A 2IPQX 2VGCB 4NFEA 2EEKA 2A2QH 4YO9A 1QBNA 1IHSH 2R3UA 4FOUC 5EW2H 1GJ8B 1V2OT 2XWAA 2VIWA 4BXWA 1C9PA 5F8ZA 2GKVE 1B5GH 3A8BA 2C3SA 1EZSC 3A80A 1SGCA 3GDUA 2OTVA 1Y3YA 4Y8YA 3DSOA 5EXLA 1DXWA 2AMQA 1SGDE 3OAAD 2C93B 3O8DA 1UTNA 1BRUP 1L1NA 2BTCE 2WPIS 4TWWA 1OWHA 1YM0A 5IDKA 2CN0H 1O30A 1K22H 4INKA 3HPTB 3QUMP 1DE7H 3KGPA 2ZTYA 1P2NA 1HV7A 1XUIA 1ORFA 3U1IB 2GMTC 1UCYK 1AE8H 1XXFA 2R0KA 3HGPA 3KQ5A 4YM9A 1PQAA 5KECA 1ETTH 1NT1A 2O9QA 1CO7E 3M7TA 3VB5A 5FBEA 2F4LA 3ZZ4A 3KNXA 1G9IE 3DSPA 1LVYA 1GI4A 3UWIA 1LPZB 3NZIA 1E1RD 2ZIQH 2OBOA 1EZUC 2BDYA 5C94A 1O2WA 3BTWE 4WH8A 1A5GH 5EJ1A 2GZ7A 4ISOA 4Z0KA 1XKBC 5DN6D 1AKSB 1SG8B 4MDSA 1OXGA 1AN1E 2OC7A 3RLWH 1MKWH 2FO9A 3JZ1B 5C1UA 4ZXYH 3SNCA 1OPHB 1TONA 3N7EA 4ESTE 2Z9IA 2AIPA 4ABEA 1EJAA 2UWOA 1J8AA 1NU9A 2KX4A 4OS2A 2V0BA 1SI5H 1V2ST 5EQQA 3A88A 2TBSA 1BTPA 1Y3XA 3AAVA 2Q6GA 5EXMA 4FUCA 2Y5HA 5C5NA 5GJ4B 3CS0A 4X6OA 1H8ED 1P09A 2R3YA 1IQFA 2FPZA 5ETXA 1XKAC 1FIWA 3TGKE 4AOQA 4Y8ZA 6GCHG 4WJG2 2O8MA 3BEIB 1H8DH 1GMHF 1QQ4A 5T3HA 1XUJA 1A1RA 1Y5AT 3ATKA 3BTEE 1H1BA 1A0LA 5B6OA 1L1JA 1J9CH 4DIHH 2HNTE 1Z71A 2JDID 1NRSH 2KCAA 1P9SA 3E8LA 3UNSA 2PUXB 2ZO3H 1KXEA 4TT3D 1T4VH 3OEED 2VVCA 1MBMA 4ZH8A 1P9UA 1SKYE 4KKDA 3LT3A 1UTOA 4XBDA 1GI7B 2ZPSA 2KAIA 1GGDC 1GCTC 1N6YA 3GY2A 2FODA 3MNSA 4DG4A 1MCTA 3M5NA 1O3DA 4MNXA 2H9EH 2YMSC 3RXMA 3KHVA 2CMYA 3BV9B 1WSSH 1XXDA 3UPEA 1XMNB 4JZIA 5E0HA 1PPGE 1Z8JB 4F48B 1SFIA 1S5SA 1V2PT 1EXFA 2PP6A 1Y5BT 1Z6JH 2ZDKA 5J4SA 1TNGA 2TGAA 3TITA 1O5BB 2QF0A 1O2SA 3RMOH 5H4IB 1TPPA 1O3JA 5A0AE 1GHYH 4KTSA 1VCWA 4DW2U 2BLQA 4I8LA 4O9VA 3RXGA 2BLWA 5C5OA 2ANMH 5DK1A 1IQHA 3VPKA 1HAOH 2Y80A 3C27B 1A5IA 1FXYA 2ALPA 2ZHWH 2KCOA 1L1GA 5JB9S 1MCVA 2M5TA 4TSFD 3IWMA 2ZWLH 1TMBH 3BG4B 1BRBE 4E05H 2V6NA 1DY8A 3ZVBA 1P3CA 1V2MT 1TB6H 2EY4C 3SUFA 3BTDE 1HAIH 3H09A 3MI4A 4ACBA 2F43B 3UNQA 2WPDD 4TWYA 1CGIE 3U28C 1HRTH 1P3EA 1YPJH 3T28A 1FJSA 5T1VA 5DP7A 3GCTF 1J16A 1C1TA 3LJOA 2I6SA 2SGAA 4UE7H 4LZ1H 3RXDA 1NRRH 3F1SB 4ZKSU 3QO6A 5J4QA 1XVMA 2XBWA 1GL1A 2J98A 2VWNA 2YOLA 1C5SA 2L74A 4O3TA 4CRBA 2ZGJA 2ZPRA 3CENA 2W6ID 1P11E 3UTUH 1VCQA 3RXTA 2QC2A 3TK5A 4ABGA 3A87A 3SGAE 1DLKB 2VVUA 1GI8B 1C5QA 2BDAA 3ZVDA 3RU4D 1OWIA 2JKHA 3T25A 1UVPA 1SLUB 1VKYA 2J2UA 4X6MA 1NZQH 1XX9A 1P0SH 1SQTA 3Q3KA 3LC5A 2BXTH 1EKBB 1A2CH 2FI5E 4NIYA 3T5FH 1O5AB 2G55A 1AQ7A 1BITA 1GBKA 3AASA 3MO6A 1O5FH 3MU0A 4H4FA 4B75A 4Z1MD 1GCTB 3FN8A 1JMOH 4I7YH 3SV6A 1A5HA 4Y7AA 1C2DA 1O35A 1BA8B 5ESTE 2UWPA 1BBRK 1LVBA 1DFPA 2J94A 2WINI 1O34A 2FM2A 3LH3A 2BD3A 3K6YA 1O3LA 3E0PB 1W13U 3QN7A 3S9BA 3TH4H 2KM0A 1NBMD 4CR9A 2KFWA 4DOQA 3BSQA 4NSYA 3PTBA 3DSGA 4IMZA 1SGYE 3KQBA 4RI0A 4Q80A 1SC8U 1TA6A 2D8WA 5L6NH 3G01A 1LHCH 1BTXA 4JZFH 2BD4A 2ZGCA 1CU1A 3L3TA 1Z8GA 1T8LA 3ZZ6A 1T8OA 1O37A 5HMAA 1NS3A 5ESBA 1QJ1B 4UD9H 3NPSA 4Q4LA 2IPHA 3E1XB 2C4FH 4Y11E 5C0TA 4GCHG 3PLBA 1K1OA 1O2UA 2VINA 3V3MA 3MU1A 2LPRA 2QXHA 2WPHS 1A3EH 3SV8A 3ZIAD 1YKTA 3A83A 1C2EA 1HAVA 1P2KA 1T32A 4X6NA 2TPIZ 1AGJA 1FX0B 2OCVB 4UFFH 1OYQA 5DP5A 4ZHAA 3LIWA 1C5VA 4XDEA 1O2IA 1RTLA 2J5UA 1Y3VA 1YPLH 2H5DA 2VIQA 4OM9A 4X6PA 3KYFA 3UR9A 1ID5H 2ESTE 2Z9GA 3H7OA 3AW1A 2XCNA 1G3CA 4WMDA 3SNBA 4CRAA 2GTBA 1NO9H 4Y10E 4ABJA 3TGIE 2QXJA 4ZXXH 4FU7A 1PYTD 1ELFA 1TQ0B 2BD9A 2K8IA 5E0JA 4YZUA 4MG3A 1G36A 1QB6A 5FPTA 2TGPZ 3FANA 2BDGA 2PGQB 1GBAA 3SV9A 4E7NA 2OQUA 1T7CA 2EA3A 3F2GA 4A1TA 1TX7A 1DUAA 1TIOA 1V2NT 2FTLE 1DANH 1UTLM 2YNBA 1JIRA 4AG2A 1P05A 3LGTA 3QX5H 1JOUB 2GV6A 2HNTF 3VFEA 3B8JA 3ZV9A 4A7IB 5A09A 1VGCB 2J9NA 2G5VA 2QA9E 1OOKB 5E2PA 1MTNC 2Y7XA 5BRRE 2ZDAH 1P2IA 2RDLA 1V2KT 4RN6A 3T26A 1DLEA 3UR6A 1O3CA 1PQ7A 1ZGVA 5F53A 5FCKA 4JZEH 5DP3A 3U69H 2A7HA 1QJ6B 3A7YA 5LGOA 2UUFB 2F83A 4TYDA 1O2NA 1O5DH 1QA7A 3TH2H 4CRFA 4FUEA 3URCA 1GI6A 4O03A 1C2LA 1XUHA 1YPHC 4WXIA 4D8NA 1IQMA 1TNJA 1JRTA 2NWNA 3AVZA 1C5TA 3ITIA 2TGDA 3VB6A 1DM4B 1CVWH 2FLBH 3OE7D 1SOZA 1DWEH 4BAQB 1INCA 1B0EA 1K2I1 1LPKB 1EZQA 1S6LA 2C8XB 3SHCH 2A4RA 1QQUA 3N7DA 3UIRA 3QLPH 3VXFH 3MU4A 4CRDA 2WPMS 5GXPA 1O2PA 3SORA 1GJBB 4CHAC 8KME2 1W3CA 2A32A 1H8HD 3B9FH 2FIRH 1EATA 2AMPA 1AZ8A 3V0XA 1CSOE 1V2JT 3BTKE 1ZJKA 3URDA 3ZZBA 4OS6A 2G52A 3SUDA 8GCHF 3EYDA 5E8EH 2VIPA 3DHKH 1CHGA 4ZKOU 2BDHA 1GBTA 2Y5GA 1Z7KA 3P95A 2BY8X 1TPOA 3E3TA 5FX5A 3D65E 2THFB 1GJ5H 3PRDA 5CHBA 1MTSA 4ABHA 2JJ1D 2XOKD 4DIIH 1DSUA 2OC0A 4MNWA 5FBIA 2HRVA 1FNIA 1K1NA 2FLRH 4ZHLU 3FKSD 2G5NA 1C2JA 2A5IA 1O2ZA 3TJUA 2F9BH 3KIDU 3SJOA 2BY9X 1DUEA 2ZU4A 2BD7A 2YNAA 1Z1IA 2EI6A 2A5KA 1ZZZA 1NC6A 3RC6A 1ZRKA 5PTPA 3KN2A 2GCHF 2SNVA 1SLXB 3SZNA 1W7XH 1A46H 1YPGH 5AVDA 4ASHA 1FPHH 4GHTA 1PQ8A 3KL6A 4UDWH 2G51A 1ZRBA 2ANKH 3F2FA 1W11U 3EDXB 4NCYA 1MU8B 1NESE 4MPUA 3SQEE 1HNEE 3SOSA 3MOCA 1JWTA 4IC5A 2H2ZA 2ZFTA 1EOLA 1S6FA 3F9EA 3E90B 1HCGA 1LHDH 2ZFFH 4BXSA 5A8XA 3MH5A 5EG4A 1TE0A 1DXPA 1TNKA 4M9FA 2FOHA 2Z3EA 2PHBA 1UMAH 3O8BA 1MTVA 4Y7BA 1N8OC 1WQVH 4Y6DA 1O3KA 1CQQA 3PMBB 1MABB 1AMHA 3DT0H 3P92A 3MH7A 4QT8C 1P12E 3MFJA 1DICA 4XOJA 1MKXK 1S6HA 3BIVH 1VITH 2BX4A 1THRH 2ZFPH 1WV7H 1WXRA 2AGEX 2QYIA 5EQRA 3RM2H 1ZPCA 1ESBA 1P2OA 1Y3WA 2AYWA 5HGGA 1ESTA 2F9UA 2HGTH 3FZZA 4INHA 5C2ZA 1S85A 1WDIA 2PGBB 2SNWA 3A84A 3OFND 1HJAC 5GCHF 1ELDE 1EZXC 3TGJE 2DE9A 1ZSLA 2SGFE 4YTAA 1EUFA 2VJ1A 4ISIH 1YC0A 2Q6FA 1TPSA 1C5XB 1YLCA 4B1TA 5DP9A 5FXLA 2AFQB 3LGWA 2BQ6B 1A4WH 1LHFH 3GY8A 1GBFA 1LHEH 4IN1A 2IJD1 2Y81A 1WTHD 3MNBA 1UCYE 1OX1A 4BOHA 5E0GA 1PPFE 3RXLA 1MQ5A 1KXCA 2BQWB 3ZYDA 3BIUH 1YPHE 4Y79A 3RXEA 4OS1A 1THSH 2CK3D 1O39A 1AIXH 1OWDA 1SGRE 2BXUH 3O8CA 1T31A 2VWMA 1ARCA 5JBTA 4KGAA 1TBRH 1ZLRA 3A7XA 7LPRA 2GV7A 2VIVA 4YLUA 1O2YA 1ZPBA 1SSXA 1BDAA 2GJGA 2XRCA 4KTCA 2ODYB 4RT1A 4FXGH 1GI0A 3F3BA 1T8MA 4IBLH 3LGYA 4AGKA 2ZCHP 3T29A 1UCYH 4NGAH 1HFDA 2FZZA 2IN2A 1COWD 2VIOA 1EAIA 2BM2A 1YP9A 2ZHFH 1E34B 2XCFA 3HKIB 3PLPA 4X1SU 5LPEA 2BY7X 4UFDH 3P8GA 2BLVA 3NUMA 1EASA 2ILNA 3K6ZA 4FETA 1HAZB 3RXUA 4MNYA 1QRXA 1QCPA 1E38B 1SLVB 1MTWA 1O3BA 3M5OA 3WW7A 1F2SE 3ENSB 3RMMH 1C1PA 2FYQA 3OU0A 4B74A 5A8ZA 1NN6A 1P2QA 1QTFA 4AX9H 3PO1C 1F7ZA 3BTTE 2ZU3A 4XFQA 1D4PB 4ZROA 1GMHG 1W2KH 1LDTT 2H9TH 3A7TA 1A0HB 4H6SB 1T8NA 1MBQA 1GJ9B 5L30H 1AHTH 1P2MA 2ASUB 1ZR0A 2A45B 4R8TB 1QL8A 4O3UA 1LQDB 2G4UA 3ZYEA 2D1JA 3ZV8A 3ZZ3A 1O2TA 3KQDA 3QK1A 3ZZDA 1HAPH 1ARBA 1S81A 2FEQH 2XBYA 1J15A 3NK8A 1SGPE 2BYAX 1CBWB 1O3GA 4Y8XA 3SU3A 1CT4E 1HJAB 1P02A 2P59A 2JETC 3LU9B 3SU4A 1UTQA 4K1EA
chains in the Genus database with same CATH topology
6ESTA 2ZGXH 1ANEA 2AS9A 1A0JA 1EPTA 3OX7U 1O36A 2FI3E 1GI3A 1RIWB 3QTOH 8LPRA 5F6MA 2Z6BD 1CA8B 2AMDA 3ELAH 1K21H 2R9PA 3GY5A 2CHAC 4YT7H 4RKJB 4CREA 1DT2A 2ZHQH 1N1LA 1W14U 4R0IA 5EGMA 1NRPH 3EGKH 1NFYA 2PFEA 1P8VC 1SQOA 3SI3H 3SNDA 4JYVH 1HLTH 5CHAC 4FUGA 4FU9A 4TY6A 4FUBA 1QBVH 2BVXH 2PTCE 1OWJA 1MAYA 2Z94A 4ZHMU 1BTWA 1UVSH 1L0ZA 5G4BA 1IQJA 1FY8E 1ZMLA 4K2YA 1QBOA 2ZFSA 1BZXE 4FVDA 2GMTB 1C5UA 5FHTA 2EI8A 5AFYH 2F9NA 1C2MA 1G2LA 1SPJA 2P16A 1KXFA 5T6DA 3S9CA 7GCHF 2F9OA 1QL9A 4I32A 3ZVFA 2V3HH 2IJOB 3PMJA 3RXPA 3GCTG 3VGCC 1WUNH 2PLXA 1BMNH 1UTMA 2P8OC 2Q6DA 1DWBH 2WYJA 1TMTH 6LPRA 1G30B 1OP8A 3QGNB 3U1JB 3Q3YA 1O2QA 2FOGA 2Y6TA 3PO1B 1AO5A 1TBZH 3LGVA 1RGQA 2VH0A 1VITF 4JK5A 4VGCC 1IAUA 1OSSA 1FONA 3U8OH 4KP0A 3STJA 3TK6A 7ESTE 3SHAH 1PPHE 1O2OA 2A0QB 3FAOA 1GBHA 3Q77A 2HWLB 2B9LA 4NA8A 1YYY1 3A7ZA 2HOBA 3BTQE 1TOMH 3NXPA 1ZOMA 2PKAB 1C9TA 2PWXA 1W0YH 3ATIA 7KMEH 3PYHA 2R0LA 2BY5X 1CHOF 1TNLA 2ZF0H 1K9OE 5C20A 1SGTA 1H9LB 4YESB 1BBRE 2H5CA 1GHWH 4I8KA 1YCPM 2BHGA 3OYPA 5I46H 4Z6AH 2QGRA 4AB8A 4AB9A 3P70B 1C4V2 2F9PA 2GD4B 3A8DA 2P94A 1L4DA 1TGNA 2A5AA 5DPAA 2GCTC 1TGCA 3BTFE 1RS0A 5TCAA 2GDDA 3RXFA 1QGFA 1KXDA 1HIAB 4K8BA 1W10U 1GDUA 3MNXA 2TRMA 3MWIU 2FDAA 6CHAC 1O2RA 2J38A 4FUJA 1TFXA 9ESTA 1GGDB 1QHRB 1M9UA 2AH4X 2HPPH 2NU3E 1QNJA 4UFGH 1C5RA 4AFSA 5JYIA 2JH6D 3MHWU 1BBRH 5AFZH 1UHBB 1O2KA 1EJMA 2AGGX 4A6LA 1SVPA 5F03A 2XWBI 2XNIA 4OS4A 1GHBF 3M37A 1TA2A 2DE8A 4LXBH 4Y71A 4Q2KA 4A1VA 3L6PA 1H9HE 1WU1A 4SGBE 3E6PH 1YCPK 2VVVA 2O8TA 5EOKA 4IS5A 1AVGH 1B0FA 3ZZ8A 4I33A 3PM3A 1GHAF 1GBBA 1XUKA 2QN5T 1RFNA 2A2XH 2ZU1A 3QDZB 4UFEH 3SGBE 3A82A 1NFXA 1SGIB 3GY3A 3UFAA 1SHYA 3NCLA 1CGHA 5HM9A 1QRWA 3SW2B 2QY0B 3IG6B 1KXAA 2ZC9H 1QFKH 4ISNA 3ZVAA 1ABJH 2FS9A 3ZVEA 2FOMB 1C5WB 1ZTLA 5GPIB 1J14A 1O3PB 3LKWA 4X8SH 1AFQC 3BN9A 2ZI2H 4MPWA 4X1NU 2UUKB 1P03A 3V7TA 1KTTB 1TPAE 1KLJH 4U30A 2FOFA 1FN6A 4GHQA 5A8YA 1MD7A 2XYAA 4U2WA 1C5LH 2A4GA 2BD5A 4MPXA 1QY6A 1RTKA 2PKSC 2OP9A 5GIBA 1SR5C 1XM1A 1GJ4H 2P93A 1PYTC 5EXNA 3SUGA 1QIXB 4H42U 1ZJDA 1TLDA 3QZQA 1GI1A 1HJ8A 2RA3A 4AZ2B 2OQ5A 4F4OC 5I25A 1GMDF 1HAGE 2ZQ2A 1BTHH 3O8RA 1GI5A 1IQNA 1O2HA 2EC9H 1GG6C 4BAHB 4WMEA 3RP2A 3NWUA 2ZDNA 1C4U2 1G3EA 1H8IH 2GGVB 3OY5U 1IHTH 2STAE 3DD2H 2VH6A 3RXOA 3ZZ5A 3HKJB 4AG1A 1MH0A 3M7UA 1YLDA 1TGSZ 3R0FA 3T62A 2ZP0H 1C5YB 1Q3XA 1K1MA 2ZCKP 4YOIA 1AKSA 1YBWA 4A5TS 1V2WT 4XBBA 3SO3A 1V2UT 4YLQH 1ACBE 5FAHA 4YT6H 1V2RT 3PV4A 1WYKA 2BMGB 4M7GA 4WXVA 1DY9A 4CH2B 1DPOA 4GUXA 4J2YB 1NFWA 3FFGA 4X2VA 4OS5A 2PSYA 2XBXA 1O31A 1LCYA 1SB1H 9LPRA 4JMYA 2W3KA 3UUZA 3P17H 3GCHC 5TCCA 5C1XA 1SGFG 4K1SA 3RM0H 1FV9A 3M3TA 1W0ZU 3RU4E 1AUJA 4HI3A 2FX4A 3LONA 4GPGA 2AIQA 1HBTH 1NROH 2GP9B 2ZHEH 3TJNA 2OINA 4ZUHA 1GJDB 3L33A 4YOGA 1C1QA 1FUJA 1TX6A 2NU2E 3Q3XA 8GCHG 1LVMA 1PPEE 1SGFA 2OLGA 2BVSH 3BEFB 1K1PA 1X7AC 4DY7B 5A2MH 4B2AA 2HPQH 1WAYB 2H6MA 1NRQH 2HVXA 1KLTA 1MUEB 2PSXA 5K7RA 1D3PB 1TALA 1O2LA 3MO3A 1TGTA 4B2BA 1L4ZA 1UTKA 2VU8E 1JXPA 4DGJA 3SBKA 3BEUA 2PKSB 1GDQA 3KQCA 1QA0A 5DP6A 1MZDA 1O5EH 1GBDA 1AZZA 4X2YA 1O38A 1FI8A 3W95A 4Y76A 5JBBS 1ZPZA 1C5MD 1FAXA 3GISB 3P8FA 3PTNA 3E16B 2GCHG 1DWCH 3TJVA 4K5ZA 1S82A 1O2JA 5DP4A 1HAXB 2SGQE 2BZAA 1C2IA 4DJZB 2ZGHA 1O32A 1O3EA 4FUHA 1IQLA 2J95A 3MYWA 3U9AH 1GHZA 2BB4A 1BCUH 1BMAA 1JIMA 4THNH 2VGCC 4IMQA 1DWDH 1IQEA 2O8UA 3SGQE 4IN2A 1AY6H 1MTNB 4JYUH 2BQ7B 2SGPE 4D7GA 4ABDA 3CS7A 2PR3A 1BTYA 1MU6B 2XTTB 2Y7ZA 1LO6A 3ATLA 3GDVA 4DURA 4Q7XA 1MZAA 2F3CE 2RCEA 1ZTJA 3M5LA 2R2MB 4JZ1A 3ODFA 1BHXB 4MLFB 2XC0A 2BDCA 1XUGA 4ZKRU 1FLEE 3GCHB 4I8GA 1RJXB 3VB7A 4JK6A 4LOYH 1GMCF 2ZDMA 2GZ9A 5F8TA 1P57B 1ZSKA 1RTFB 3SU0A 1GJCB 1PPCE 1BT7A 3I78A 3MNCA 1C4Y2 1PJPA 1F0SA 2CV3A 3U98H 4I8JA 2FWWA 1HGTH 2BLOA 1MKXH 1PPZA 5A0BA 2C8ZB 2XC4A 5HYOA 1SL3A 3S0NA 2CXVA 1O2VA 3A7WA 4J1YA 2P3FH 3KEEA 3T2NA 5FX6A 3A86A 1C1UH 1G3DA 3SI4H 2B0FA 4OS7A 2Y82A 1C1OA 1YPKH 1ZHMA 2ODQA 2H9HA 1GJAB 4CHAB 1YPMH 1FPCH 1SBWA 1KY9A 3ZVGA 3MO9A 5EW1H 1F5KU 5C67A 5TJXA 1UHBA 5L2YH 2ZDVH 1KLIH 1ZTKA 1ESAA 4X1RU 1MQ6A 2J4IA 4I8HA 1DITH 1YPEH 4XSKU 2WUBA 3FP8E 4ISHH 1AFEH 1SFQB 4NIXA 1GHVH 3OTJE 4WVPE 3A89A 1TX8A 3FZDA 4IGDA 4ABIA 4X0WU 5JBCS 2W7UA 1ZHRA 3ZZCA 3M35A 1QB9A 3SU5A 1V2VT 4Y0ZE 3DA9B 2JH5D 1LHGH 1H4WA 1Z1JA 5JBAS 3RC4A 1BOQA 1V2LT 2ZNKH 2FTMA 1WBGB 4GAWA 2FESH 3PB1E 4HTCH 1W12U 1GBIA 1HAVB 1WQSA 1GBEA 2ZQ1A 3MU8A 2OBQA 3PLKA 5T6GA 3SJ9A 2J34A 1VCPA 1D6WA 3BF6H 3PWBA 4AN7A 2WYGA 1W8BH 4NIWA 3ATMA 4DCDA 2OXSA 1NU7B 5DO4H 4AGJA 1K1JA 4XBCA 4AFUA 3ODDA 2UUYA 3A8AA 1Z6EA 1ZYOA 1UK2A 4NZLA 2O8LA 1LMWB 3HK3B 3K2UA 1C1VH 3GYMA 4CRGA 2P3TB 2XC5A 1A3BH 2AGIX 2F91A 1HDTH 1BIOA 2FXRA 4NWLA 1BTUA 1LKBA 2NU4E 4K1TA 3SJKA 3EAJA 1P01A 1SHHB 5HXFA 2FP7B 3AAUA 3F9GA 1N8OB 1YGCH 3ESTA 4RKOB 4WWYA 2WV5A 1EB1H 1DS2E 1GJ7B 1VJAU 3CP7A 1HYLA 1HXFH 4BNRA 3ATWA 3VEQB 3KF2A 1C5PA 1EAWA 1F5RA 2ZHDA 3UQOA 4CBNA 3PMAB 2LNCA 1AUTC 1O2GH 2A7JA 2ZG0H 1F92A 2ZDLA 2BDIA 3BG4C 3LOXA 4FVBA 4Y0YE 5SGAE 4IW4E 1ELTA 4BTTB 1MKWK 4TY7A 1JRSA 1D9IA 1KYNA 2A31A 3F68H 3P8NA 1F5LA 1UVOA 2ANWA 1FDPA 4WY3A 2WUCA 3TVJB 1UJ1A 1SGNE 3S7KB 4CBOA 1XUFA 1Z8RA 4D76A 1TYNA 4ZMAH 4WH6A 1DX5M 3S9AA 1UK4A 2TIOA 1L2EA 4D9QA 3N7OA 1NPMA 1JBUH 1QJ7B 4FUDA 4ZAEA 4Q7YA 1VZQH 3W94A 1BB0B 3PROA 1V6DA 1TAWA 1Y8TA 4BANB 1LKAA 2VWOA 1LPGB 2ZEBA 3ZZAA 1CT0E 3D62A 1D3DB 4NWKA 3V13A 3M36A 7GCHG 3RUOA 4MNVA 3LC3A 1K1LA 4X8TH 2F9VA 1ELEE 4UONA 1J17T 1GL0E 1O3IA 1ZHPA 5AF9H 3TK9A 1AWFH 3F9HA 3RXVA 1CE5A 1U6QA 1RD3B 1D3TB 3RXJA 5DP8A 3LJJA 1ETSH 1VITG 1D3QB 2ZFRH 2W7SA 1V2QT 2ZTXA 3Q76A 2FOEA 6GCHF 1SQAA 1ELBA 5E2OA 3TIUA 4NSVA 2A1DB 1S0RA 4TPIZ 1OP2A 2BOHB 5IYTA 4ABAA 1VJ9U 2FI4E 1QURH 1NTPA 2FMJA 1S84A 2FOBA 2JH0D 4FUIA 3SQHE 4E7RG 3SJIA 5DGJA 3VXEH 1AB9C 2ZGBH 1THPB 5JDUB 4B2CA 1GI9B 1V3XA 1KXBA 1CHOG 4TPYA 4MTBA 3RU4T 1F0RA 3M61U 4JZDH 1WOFA 1BTZA 3UY9A 1MTUA 5AHGH 1GVKB 1O3OA 3ZZ9A 1C5OH 1ZSJA 2GZ8A 2B5TB 1KIGH 1OS8A 2PTNA 3QGJA 4A92A 2STBE 1GPZA 1ANDA 1GHXH 2OC1A 1OWEA 3ZZ7A 1GBMA 1C1MA 1BJUA 2GVFA 1AU8A 3SU2A 1IQKA 1TMUH 1UTPA 1TRYA 2GX4A 4MPVA 5LPFA 1O5GH 3D23A 1SLWB 2JETB 5C1YA 1HXEH 1FY5A 1GJ6A 1C5ZB 4GLYA 3GY4A 1NRNH 1BMLA 2G8TA 2P3UB 1PPBH 1G32B 4BTIB 1EJNA 3GY6A 1OYTH 3K65B 4FUFA 3HGNA 4K3JA 1GHBG 1IQGA 2EI7A 2UWLA 3GDSA 4B76A 3GCNA 1OWKA 2ZA5A 2CHAB 4CRCA 2WPJS 3RLYH 1D6RA 2R2WU 4X8UH 1K1IA 1BRCE 4IC6A 1B7XB 1KDQB 1C1RA 4HZHA 1Q31A 5CHAB 2VB0A 2PUQH 4MQAA 1C2HA 2C8WB 2ZPQA 1GDNA 2ZU2A 1GHAG 1SMFE 2OUAA 3RXBA 3TJOA 4I31A 5ABWA 1CA0C 1HUTH 1EAXA 5EQSA 2ANYA 2PW8H 1HAYB 2CF9H 1P10A 3RXCA 1BHXF 4X2WA 5DJ7A 1CGJE 2QIQA 1OKXA 3TNSA 4GSOA 3UREA 2OC8A 5DG6A 1O3FA 5F8XA 1A7SA 3H7TA 2ULLA 2BDBA 5FCRA 1ELVA 1TRNA 3RC5A 4K60A 2TGTA 1YCPH 1N6XA 3DFLA 3S69A 5EPYA 1EPTC 2Y5FA 1VGCC 3ZVCA 4NA7A 1BRAA 4UEHH 4AORA 1YF4A 1UVUH 4WF8A 1XVOA 2SGEE 1Y59T 5EODA 3VGCB 2W3IA 1EX3A 1AB9B 1BMMH 3EQ0H 1BQYA 4X1QU 1FY4A 2P8OB 3BTME 3RXKA 1SOTA 5BPEA 3VB4A 3TH3H 1C2FA 3OY6U 3FP6E 1FZZA 2ZZUH 3M3VA 3SU1A 1S0QA 4F49A 4VGCB 1W7GH 3RXSA 1TNIA 5L2ZH 1GMDG 1GBLA 3QWCH 1TNHA 1TABE 2VNTA 1LVOA 1UVTH 3LGUA 3EA7A 3OSYA 3LDXH 3TU7H 4B73A 4X1PU 2V3OH 2GT7A 2ZTZA 3MH6A 4JYTA 4MVNA 2D26C 1Q2WA 1LTOA 3HATH 4CR5A 1E0FD 3P8OA 5GDSH 2A4OA 4Q7ZA 1G37A 4JCNA 3SV2H 1O3HA 1C1NA 1O2MA 3SNAA 1O0DH 2XXLA 2HLCA 1NM6A 3BG8A 4OGXA 1Y5UT 4D9RA 1KTSB 4NA9H 3A81A 2ZKSA 1AE5A 3RMNH 3AW0A 1EQ9A 3GY7A 2I6QA 4X2XA 3HK6B 1O3MA 4HGCA 1RXPA 2WV4A 2NU1E 2C90B 2W5EA 4GVUA 2GCTB 1C2KA 5GWZA 2ZFQH 1ZMJA 3UNRA 1RRKA 1QL7A 4GCHF 2QV1A 1O2XA 4RSPA 4NZQA 3RXQA 6CHAB 5JB8S 3RXRA 1UTJA 4BAKB 2XW9A 3F9FA 1AD8H 2A4QA 1O3NA 1DOJA 1PQ5A 1CA0B 1DVAH 5FPYA 2A7CA 1ABIH 3T27A 1PFXC 3UOUA 1ELCA 1MMJN 1FY3A 4H6TA 1ZMNA 2PV9B 1EAUA 1F0UA 3EA8A 3A8CA 1G3BA 2CJIA 5LPRA 1UK3A 1FMGA 3SNEA 3SUEA 2SGDE 1T4UH 3SJ8A 1SGEE 3RXAA 3JZ2B 2GT8A 2Z9LA 3M7QA 1TBQH 3WY8A 3GCOA 1ELGA 1EPTB 3BTHE 1GBJA 4FU8A 8ESTE 1KSNA 2VIDA 1C1WH 3A7VA 4U32A