3I77A

35/99/170-loops of fxa in sgt
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
230
structure length
230
Chain Sequence
VVGGTRAAQGEFPFMVRLINEENEGFCGGALYAQDIVLTAAHCVSGSGNNTSITATGGVVDLQSSSAVKVRSTKVLQAPGFTKETYGKDWALIKLAQPINQPTLKIATTTAYNQGTFTVAGWGANREGGSQQRYLLKANVPFVSDAACRSSSSFILVANEMICAGYPDTGGVDTCQGDSGGPMFRKDNADEWIQVGIVSWGYGCARPGYPGVYTEVSTFASAIASAARTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Trypsin
publication title Combinatorial Enzyme Design Probes Allostery and Cooperativity in the Trypsin Fold.
pubmed doi rcsb
source organism Streptomyces griseus
total genus 56
structure length 230
sequence length 230
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2009-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3i77A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3i77A02
3RU4T 4CREA 1WQVH 2PR3A 5A2MH 2A7JA 5C20A 1GMCF 2QXHA 1BTPA 4ABIA 2BDBA 1AZ8A 3V3MA 3GY8A 2V3OH 4ZHLU 4X0WU 4BTTB 1MQ5A 1C1PA 1MZAA 4ZKSU 2M5TA 1BJUA 1ESBA 3V13A 2HNTF 4IMQA 4X2YA 4K8YA 2HNTC 1C2EA 5BPEA 1O2PA 1Q31A 2G8TA 2FZZA 4CRAA 2PGBB 1AN1E 1DPOA 4NSVA 4AZ2B 2VGCB 4PROA 2V3HH 2QXIA 3BG4B 2W26A 1MKXK 2JH6D 1C5OH 1DWEH 1H4WA 1TONA 3ZZ4A 2FMJA 1K1PA 3ZV9A 3Q3YA 2GX4A 2PKSC 1TMUH 1LHFH 1D3TB 1FQ3A 5FPSA 2H9HA 1C9TA 5C1UA 3RUOA 4B2BA 4ISLA 2O8MA 3ZZ9A 4Y8YA 3JZ1B 3SHCH 2CJIA 3QTOH 1G2MA 3WY8A 1E0FD 4AOQA 2ZGCA 1F7ZA 1SGPE 5L2YH 1UVSH 1MU6B 3NKKA 3TK5A 1EZQA 1BRAA 1VITH 3E16B 4NIWA 5IYTA 4AG1A 1O3JA 1ACBE 1GI7B 3FFGA 4I8GA 1QQ4A 2VWLA 4DOQA 3GISB 4YLUA 1GHBF 2SGDE 3GOVB 3FAOA 1AHTH 5DKMA 1GVLA 1L1NA 1G3DA 1SLVB 4B71A 2C93B 3RC6A 1O5GH 3ZZ3A 2XBVA 2VIQA 2AGEX 2EI7A 1TPPA 5DP7A 4XBDA 1PQ7A 3RXHA 1C2HA 1E38B 1C5UA 4GAWA 4DVAU 1GHAG 4H6TA 4OGYA 3UPEA 1RFNA 3ATIA 3VB3A 3ZZ8A 6CHAB 2R3UA 1BHXB 1VCWA 4IN1A 1ZTLA 1C5XB 4B1TA 5DJ7A 3CS0A 1JOUB 1A3EH 4UDWH 5DGJA 5DP6A 1FIWA 2GZ8A 3A8BA 2FP7B 1FZZA 1T8LA 5A0BA 1FPHH 4K2YA 1CA8B 2THFB 2GZ9A 1DANH 4BAKB 1HRTH 4LOYH 1OOKB 2GDEH 2R0KA 1SGRE 1ZSJA 5FCRA 1SGQE 1ESAA 1UHBA 4DIHH 8GCHF 1B0EA 2Z9KA 3QK1A 2UUKB 4KGAA 1ZPCA 4Q7XA 5G4BA 5EW1H 1RIWC 1T4UH 3BG8A 3MH4A 2SGAA 1BB0B 7GCHF 1TWXB 2XCFA 1F5RA 4Y7BA 4Q80A 2H9EH 4WJG2 2F9OA 1O31A 2EEKA 2WPIS 1FXYA 3AAVA 2OUAA 3ZZ5A 1P8VC 1RGQA 3RM0H 2WYGA 1SHYA 1QHRB 3GY4A 3M7TA 5PTPA 4WF8A 4CH8B 1AB9B 2NU4E 1BBRK 5JBBS 2FESH 5DK1A 3F6UH 4ABHA 4FUFA 1KDQB 2VIPA 3SJOA 1KLJH 1F0TA 1GGDC 3BN9A 5LPEA 1HBTH 1GHWH 1YKTA 1ELGA 1MBMA 1A46H 1L0ZA 1JBUH 4ZXXH 1MU8B 2CN0H 1MTVA 1UVOA 4TWYA 4ABBA 4A1XA 5A0AE 1EZUC 3UQOA 4JYUH 1T8OA 4MPXA 3UQVA 4ZXYH 2A1DB 1Y3XA 3R0FA 1KXDA 2TIOA 2VIOA 3SORA 1C1TA 2ZHDA 1EASA 4MVNA 4K69A 2BY9X 3NWUA 2FX4A 1P2NA 1YCPH 1DUEA 4BXWA 4ZROA 1SSXA 3KHVA 4Q2KA 2FLBH 1AE5A 1MBQA 1OXGA 3ZZBA 3PB1E 2PKSB 4UEHH 3DA9B 4X6PA 1ESTA 1EKBB 2G55A 1QR3E 4OS7A 2BX3A 1W3CA 3TJNA 1CVWH 3BSQA 3MNBA 1ZYOA 2W7SA 4TPIZ 4D8NA 2PHBA 4Y0ZE 2AS9A 2ZQ2A 3A8AA 2H6MA 1THRH 3P8OA 2IN2A 1OSSA 2IJOB 2OBQA 1WOFA 1ZOMA 2FOBA 2OD3B 1CT0E 1O2YA 3E1XB 3U98H 1FONA 3RLYH 3LKWA 1VJ9U 3I78A 2ASUB 3AW1A 4YOIA 4A1TA 1TB6H 2ODYB 3T5FH 5FX6A 1XKAC 1GBJA 1QY6A 2OINA 1T8NA 3LIWA 1EOLA 4YTAA 2VWOA 1HAZB 1P2IA 1GMDG 1SQTA 4GUXA 1EAIA 4JZDH 4NZQA 3SNCA 5C3NA 1O38A 4R8TB 1LCYA 1XUJA 1O34A 1CGIE 1V2OT 1ZSLA 5EG4A 5EW2H 1ELCA 1P3CA 2SGEE 1SGCA 1SFIA 1L2EA 1UMAH 1QL8A 3SUGA 2JH0D 1O2KA 3PLBA 3KQDA 1C9PA 1CHOF 4KKDA 4NWKA 3SU1A 5C67A 1JIMA 2EA3A 2FTMA 4KTCA 1FY3A 4NA8A 1GVZA 2AERH 1Y59T 1GHYH 3UFAA 3KN2A 3NUMA 5FBEA 1YPEH 1YPHC 2WV4A 1H1BA 1CGJE 3MYWA 1EZXC 2OC7A 3N7OA 4D7FA 1O2OA 1NRRH 4AFSA 3A82A 1J9CH 3U8RH 1C5LH 4ABEA 3O8CA 3RXVA 1EB2A 3A85A 1GHXH 2BQ7B 3FP8E 3AAUA 1SB1H 5EPNA 1J14A 2K1QA 1ID5H 1AVGH 1QRZA 1RIWB 1GI1A 1O3EA 2ZDNA 4NCYA 2CMYA 3GDSA 4FUGA 3SJIA 4FVDA 2ZA5A 2Y81A 3RXJA 1TA2A 3QTVH 3H7TA 5J4QA 3ENSB 3SV9A 5I46H 2P93A 1BTHH 2WYJA 3QGNB 8ESTE 1UO6A 1DLKB 1PQAA 1TYNA 1OYTH 1WQSA 4TYDA 3GCTG 3U69H 4ABFA 4M7GA 1EQ9A 5F03A 4UE7H 2WUCA 2ANWA 3LOXA 4XOJA 4E06H 1OX1A 1GVKB 3OY5U 3ATMA 3KQEA 1ZGVA 3M61U 4WY3A 1KLTA 3A86A 4ZKNU 4XBBA 4FUHA 1BTYA 1TNHA 3HGPA 4NA7A 3RXBA 2AIQA 1HXEH 3M3VA 1O3CA 1YPLH 2O8WA 4IC5A 5SGAE 1C4U2 3MH7A 1AZZA 1K1IA 2PKAA 1O5BB 1AVXA 2PTCE 2Q6DA 1JRTA 1KXCA 3QGJA 1BMNH 1C2KA 1OWDA 4ZHAA 1XX9A 1ELTA 1O2XA 2D2DA 2F9PA 1MH0A 3F1SB 1QCPA 1UCYH 3ZZDA 1EJMA 1LVBA 1THSH 1D6WA 1UTLM 3RXRA 1K22H 5F8XA 3C1KA 3GCHC 2A4OA 1OP8A 4FU8A 4YT7H 2C8WB 3MOCA 1S81A 2KAIA 2ZFRH 3UIRA 3LT3A 4Y7AA 3E0PB 1QA7A 2UUJB 4H4FA 6ESTA 1CBWC 1ZRKA 2BD3A 1EAWA 4U01A 3VPKA 3DFLA 1D4PB 1EPTC 1JWTA 1UJ1A 1K1MA 2Q1JA 4WXVA 4OS6A 2BHGA 2ZHFH 1BTUA 4J2YB 1MQ6A 2RA3A 4MPVA 1ZJKA 1K21H 3URCA 1DM4B 4GVUA 1V2MT 5LPFA 4K3JA 1D3PB 1GJ4H 1BTXA 1O5EH 3HKJB 3K6YA 2BXTH 1ELDE 1LQEA 1P0SH 4HGCA 1TGNA 2H2ZA 1G36A 2C3SA 4FU7A 1P2JA 4IBLH 2P3UB 1SLUB 2VU8E 4A92A 4LZ4B 1OWIA 3U9AH 1LKAA 1QB6A 2C8XB 4B2CA 1NRSH 3ZVAA 1N8OC 2W3KA 3GY3A 1ZMJA 3QO6A 1H9HE 1RTLA 1PPGE 2YNAA 1OKXA 3IITA 1C5TA 2GCTC 1OS8A 1RRKA 4MLFB 3F68H 1O2QA 4I8LA 5I25A 4DJZB 2OC8A 2Z3DA 1INCA 1MCTA 2VIVA 3EAJA 3SV2H 2Y7XA 2RDLA 3RXCA 3SI4H 2GDDA 4Y79A 1XXDA 1CQQA 3URDA 1PPBH 1EP6A 1J15A 1GJ9B 1ZHRA 2BD5A 3QWCH 3SV7A 1O0DH 5ETXA 4JZ1A 1RD3B 3GICB 4I31A 4AG2A 1HXFH 1C2MA 5B6OA 1ETRH 3UWIA 3BTKE 5T3HA 1VZQH 1C5VA 1MKWK 1QJ1B 1NM6A 4JCNA 1C5ZB 3S7KB 1S0QA 1DXWA 3SNDA 3RXUA 4NIYA 5JB8S 2GT7A 2FDAA 3QDZB 4XSKU 1UTQA 1Z1IA 1ZR0A 4OS4A 2QGRA 1UK3A 4AB8A 3RXDA 2W5EA 4E7NA 4LXBH 1SGFA 1AFQC 2FI4E 3ZZ6A 2OC1A 2XTTB 3EA7A 1J8AA 1HAVA 5K7RA 1S85A 1W12U 4VGCC 2H9TH 1NRNH 2BD8A 2G4TA 2LPRA 1O32A 5A09A 2FOEA 3KGPA 4THNH 1BTWA 3IG6B 3KF2A 3PTBA 4KTUA 4KELA 3H7OA 3ZVFA 4F49A 1AQ7A 5TJXA 4CBOA 3QLPH 2GD4B 1G37A 3E0NB 1WSSH 2GCHG 3SV6A 2FODA 4BANB 4AB9A 1Y3YA 4ZUHA 4X6NA 2XWAA 2AMDA 1S84A 3ZV8A 5E0JA 5EQSA 2RA0A 1CHGA 1C2DA 4KTSA 4UFGH 2VJ1A 6GCHF 1LVOA 2PWXA 5AVDA 1C5RA 1KXAA 1HJAC 3A84A 2A45B 1T32A 2OLGA 3ZYDA 2BDIA 2P3FH 1HAOH 1C1QA 1GBBA 1O2SA 2HRVA 2UUFB 1SC8U 1DWBH 2Y5GA 1NFYA 1SFQB 1A0LA 3M5OA 1PQ5A 3GCHB 1C4V2 1J17T 2O8LA 5GDSH 1C5MD 1B5GH 1Y3UA 2BZ6H 4YOGA 1C2IA 3BTDE 2ZZUH 4ZH8A 1XUFA 2FOGA 4CRFA 4D9RA 2ZDKA 1CBWB 3VB7A 1HNEE 1P57B 3QUMP 2A31A 1EPTB 1GBDA 2V35A 1IQFA 2WPLS 3V12A 4YLQH 2HVXA 3PMHB 1LQDB 5A8XA 2BLVA 3GYLB 2VB0A 1WCZA 1GI3A 2GV6A 4GHTA 3B9FH 2AGIX 3GYMA 2OTVA 3NXPA 2WPHS 1THPB 5DP5A 5HM2A 1QBVH 1S83A 2BOHB 1IAUA 1Y3VA 1Z7KA 3F9GA 1NY22 2FLRH 2QYIA 2JETC 3SU4A 3V0XA 1O3KA 1LPGB 1PPCE 2Z6BD 2SGFE 2QIQA 1N8OB 3SHAH 1NRQH 1W14U 1AWFH 3BTHE 4FXGH 5FBIA 5GJ4B 1TPAE 2GCTB 3TNSA 1V2KT 2Z3CA 4D76A 1GI2A 3BTME 2FOCA 1S82A 4MDSA 4Z6AH 4UFEH 1G2LA 1H9LB 2QXGA 1MD7A 5AHGH 3RC5A 4KP0A 1GI4A 3MFJA 1G3CA 1Z71A 1O2LA 4K1TA 4QT8C 3VEQB 1B7XB 2PSYA 2ZGBH 4YM9A 1LMWB 3RXTA 4YZUA 4A1VA 3L33A 3RXKA 2NU2E 2AYWA 2CHAC 2UWPA 2BVSH 1BQYA 2J4IA 2ZTYA 4JK6A 2W3IA 3GY5A 4ISHH 5TCAA 3MO6A 4MNYA 5IDKA 4IN2A 1TGSZ 3UNRA 1GBEA 1YBWA 4CR5A 1O3GA 2BD4A 1Q2WA 4I8KA 3RDZA 5HYOA 1GHAF 1L4DA 1BOQA 1GBKA 2ZU4A 3SU6A 1C1OA 1KTTB 1DICA 1ZMNA 1NESE 2PW8H 2OBOA 4MPUA 2Z9GA 1NS3A 3MO3A 2Q6FA 3PMBB 4DURA 4R0IA 5L2ZH 1UTOA 1AFQB 1TRMA 3MU5A 1ZHPA 4ASHA 3PV4A 1GBHA 3NCLA 1O2IA 1O3PB 2ZDMA 1HAPH 4VGCB 5E0HA 1F0SA 3TGIE 4HTCH 1YLCA 3SU5A 3MU4A 5HXFA 3ESTA 3LGUA 3D62A 3PM3A 4IMZA 2I6QA 1MCVA 5L6NH 2SGQE 1B0FA 2NU3E 4X8SH 1TPOA 1GJBB 1BA8B 3GY2A 5T6DA 3RXAA 8KME2 3E8LA 1FV9A 2FOFA 3PWBA 1WU1A 5TCCA 3S9BA 4FUDA 3ODFA 3LC3A 2J94A 3UOPA 1BDAA 3ZVBA 4ZKOU 1VR1H 1TRNA 1TOMH 3S9AA 4BXSA 1NZQH 4BNRA 2ZDAH 2A5IA 1TMBH 1TBQH 1OP0A 1AUTC 3ATKA 1MTUA 1RS0A 5GXPA 1GJ6A 1HJAB 2WINI 2GKVE 1YF4A 1A0JA 3A83A 5GPIB 1O3BA 2B5TB 3LPRA 1SGNE 1IOEA 1O3MA 4DGJA 1O2NA 3RMMH 1GI9B 1ZTJA 1GCTC 1HIAB 1UCYE 2GV7A 2CV3A 2GZ7A 2J92A 4AYVB 1FY8E 7GCHG 2Y80A 2A2QH 2ODQA 3RMOH 1M9UA 1P2QA 1AU8A 1TNIA 1FIZA 4GSOA 5DP8A 1A5HA 2XBXA 4ZAEA 4XE4A 1HAGE 4AFZA 3TJUA 2ZCHP 2ZFQH 3A89A 3ELAH 4I33A 1SGIB 3S0NA 2BD2A 2G00A 1KDQA 1W7GH 1K1OA 1OWHA 3Q3KA 2CGAA 3M7QA 4OS2A 2EI8A 3IWMA 1N6XA 3SJ8A 3TPIZ 5A8YA 2ZTXA 1TQ7B 5FPYA 3VXFH 2Y5FA 2AFQB 3SI3H 2Y5HA 1WUNH 3GCNA 2H5CA 4A6LA 4U2WA 1AKSB 3ZYEA 1O5AB 2TGTA 1H9IE 3RU4D 1F0RA 2JETB 1O2RA 3RXEA 3MTYA 2ZFPH 3A7ZA 2ANMH 1CA0C 1TX7A 1LPZB 1O2VA 2VWMA 1P12E 1V2WT 3F9HA 3ZVEA 3NK8A 1GBCA 1SLXB 2ZFSA 1FUJA 1TIOA 2ZEBA 3LGYA 2FOHA 1HB0B 1O36A 4UD9H 3VXEH 1O5FH 3BTWE 4JMYA 3A87A 5E0GA 1OWKA 2A5KA 5A8ZA 3TGJE 5JBTA 2DE8A 1A4WH 1O2WA 2VH6A 2Y6TA 3MU0A 1TABE 1F92A 1Y3WA 1DS2E 1O39A 1YM0A 4ESTE 1IQHA 1ELEE 1KY9A 1GMDF 3SU3A 2CHAB 1E37B 1XUKA 1GPZA 3RM2H 1HUTH 1PPEE 3LH1A 4JZFH 4NFFA 3MH6A 3EE0B 3ZVCA 1D3DB 3M35A 2XCNA 1D6RA 1O3AA 1TALA 2GT8A 2ZQ1A 5JYIA 2DE9A 1C4Y2 1YPGH 4BAOB 1A5GH 4H42U 4ISOA 2A7HA 4YESB 1EAXA 3PWCA 1AMHA 3CENA 5EPYA 2HALA 1HFDA 3AVZA 1DWDH 1K1JA 1Q3XA 4WH8A 1IQNA 1GDNA 2PTNA 1FN6A 3BTTE 3EGKH 4YO9A 5JDUB 3AW0A 3BF6H 4X1RU 4CRDA 2ZI2H 2BDCA 1RJXB 2SNVA 1GMHF 1CHOG 4A5TS 2BY8X 1FN8A 1FJSA 5HMAA 2WUBA 2PSXA 3T29A 3TIUA 2UUYA 1TGCA 1VITF 1SGTA 2ZNKH 2ZO3H 2A2XH 2B9LA 1Z6EA 1MAYA 1SQAA 5T6GA 1X7AC 1GI8B 2ZCLP 2F83A 1K2I1 3SGQE 2YOLA 5GCHF 2VVVA 9LPRA 2A5AA 1GL1A 1LVYA 1E35B 2ULLA 1O3FA 4INKA 4HI3A 3HATH 4Y8ZA 1SOTA 3SJKA 5DO4H 1HPGA 1NROH 2XYAA 5HM9A 3M5LA 2ZHQH 1GCTB 3Q77A 3BIUH 1IQKA 4JK5A 2FX6A 2C4FH 3TNTA 1AIXH 1IQIA 4NIVA 1O2UA 1W2KH 3DHKH 3G01A 2BY6X 4JZEH 3M37A 4BAMB 1QNJA 3U1JB 2QF0A 2R0LA 3D65E 1TRYA 2VVCA 3SUEA 3PROA 3STJA 1P06A 2GMTC 2HWLB 5C5OA 1DX5M 1CT4E 4INHA 4X1SU 2QAAA 1O2GH 1F0UA 1W10U 4DCDA 1EATA 1TBRH 4CRCA 1LHCH 5F6MA 2BD7A 3SU0A 1NN6A 1GBAA 1IQGA 1YYY1 4BAHB 4D7GA 2D26C 1TQ0B 1Y5UT 4NFEA 3LGTA 3M5NA 1GL0E 1HAXB 2XC0A 2ALVA 3BV9B 1VCPA 1NU9A 2ZWLH 1MTNC 3DD2H 1AD8H 3KQBA 1QL7A 1V2UT 3BTFE 4B73A 5DP9A 3RP2A 1C5QA 3RXQA 3FP7E 1UK2A 2VVUA 1ANDA 1U6QA 2ZGJA 1HCGA 4X1NU 1VGCC 3L3TA 4XFQA 2FXRA 1CT2E 1CA0B 4K8BA 2P59A 1JRSA 1EOJA 3UWJH 2ZFFH 4X1QU 1AFEH 1P02A 1GI6A 1P10A 4K1EA 1QL9A 2QA9E 2OQ5A 2BX4A 3OSYA 3S9CA 2A4QA 1YPHE 3DUXH 3Q00A 1LVMA 3MH5A 3LU9B 2TGPZ 4GCHG 2JH5D 1GBIA 1HJ8A 2C90B 4AFQA 5C5NA 2TGAA 1V6DA 1KSNA 1P3EA 2P8OC 3O8BA 3JZ2B 5DG6A 4WVPE 4X8VH 1Z8RA 1C1SA 1LO6A 1V2PT 2ZPQA 4K60A 4O03A 2NWNA 1ZSKA 3GY7A 1P2KA 1SQOA 4ISIH 1GJ8B 1TLDA 1T7CA 1ANEA 2NU1E 3BTGE 3M3TA 4ABJA 5CHAC 1FMGA 1W0YH 2A32A 2AMQA 5FCKA 4GHQA 3GDUA 5AFYH 1G9IE 1IQLA 3UREA 3P92A 2BDAA 3HPTB 1GCDA 3DFJA 3SNAA 3HGNA 4ABDA 1GDQA 1Z6JH 1HYLA 4B2AA 4RKOB 4MNWA 3UR6A 5C2ZA 4O3UA 2IOTA 4B75A 1HJ9A 3QZRA 1Z8IB 3S69A 4XDEA 1JXPA 1O3NA 1OYQA 2GGVB 2ZKSA 7KMEH 2Q6GA 1BCUH 1IQMA 1ARBA 1CSOE 2BXUH 5HGGA 4DG4A 2FWWA 1FY1A 1SMFE 2H5DA 3FANA 1DY8A 5CMXH 3RXGA 3OTJE 3A8DA 3T25A 1O2ZA 2QY0B 4O9VA 3BIVH 1S6FA 1WAYB 1SR5C 1WTHD 2QN5T 1RTFB 1UTKA 4MG3A 5DP4A 4AGJA 2ZU5A 2A7CA 1LKBA 2D1JA 1VCQA 4OS1A 4TY6A 4Z0KA 3ODDA 3TH4H 2Z9JA 5LGOA 1TX6A 1MD8A 1YLDA 1QGFA 1NT1A 1NFUA 2EC9H 4NGAH 4NG9H 4Y8XA 3SNEA 7LPRA 2F9BH 2P3TB 1PPHE 2FEQH 1PFXC 1BHXF 3W94A 1JIRA 5CE1A 3T28A 2BY7X 1FY5A 3BTEE 2F91A 3OY6U 2ZPSA 2BMGB 3EA9A 1XUGA 4Y0YE 4MQAA 4E7RG 2V6NA 3VFEA 1G32B 5JPMH 1AGJA 3SUDA 2O8TA 2GCHF 3OU0A 1SGEE 1T4VH 1TMTH 2GMTB 3OX7U 1TA6A 1Z8GA 3ZVGA 1GJDB 1QRXA 4NZLA 3PYHA 3QZQA 2HGTH 3MMGA 4XBCA 1HV7A 1SL3A 2BDHA 1TOCB 2LNCA 2PUQH 3PMAB 5F8ZA 3E3TA 2ZGXH 4WXIA 4AX9H 5ESTE 1HAYB 3D49H 1IQJA 1GWAA 1NTPA 1T8MA 1UVTH 2PFEA 1P03A 3K6ZA 3SW2B 3I29A 2WPJS 1OWJA 1MTNB 2BDYA 4B74A 6GCHG 1BJVA 1P9SA 3ZZAA 1VGCB 1GJCB 2GVFA 2QV1A 1ELVA 5FXLA 3FVFB 1Y8TA 2FS9A 9ESTA 2CXVA 2J9NA 4DT7B 3VB5A 1TNLA 1XKBC 3P8NA 2SGPE 2B0FA 2XC4A 3KNXA 4WH6A 4AFUA 2BVXH 1FAKH 1ELFA 2IPHA 2ZHEH 7ESTE 4I32A 1GMCG 4MPWA 3RXFA 4JZIA 1NRPH 1E36B 1EX3A 2P8OB 3SGBE 1EPTA 3MNXA 5ESBA 2J95A 3U8OH 3PO1C 1ELAA 1C2LA 4NWLA 4TY7A 2AGGX 5LH8A 3UR9A 4WWYA 4AYYB 1ZTKA 3C27B 1NFWA 2H1UA 2ZU1A 3GY6A 4O3TA 5DPAA 1BITA 1AUJA 2R2WU 4ABAA 5CHAB 3A7VA 2GP9B 3OYPA 2RCEA 1TNGA 4FUJA 1P11E 1ARCA 2TRMA 1EB1H 2AMPA 3CS7A 4CRGA 1C5NH 2R2MB 1DITH 1O3OA 2PV9B 2TGDA 5EOKA 1C1RA 2WPKS 1QIXB 3S7HB 1DUAA 3TGKE 1KYNA 4JYTA 2UWLA 1DY9A 2BQ6B 1GI5A 2ZG0H 1SPJA 5C1XA 1UVUH 3GCOA 1S0RA 4K5ZA 1O3HA 1W8BH 3B8JA 1SG8B 3LH3A 3M3SA 4WMFA 1CGHA 4Y6DA 5EXMA 3T62A 2A4RA 3MI4A 1SGDE 1GHBG 4FVBA 1MKXH 3E91A 1PYTD 1TAWA 3RLWH 3R3GB 2O9QA 2STAE 4ZHMU 1E34B 4TPYA 3RXMA 1KLIH 4MNXA 1NU7B 1JMOH 1F5KU 1KTSB 3LC5A 3RXPA 2FS8A 2ZFTA 4Y10E 3SBKA 1EZSC 3SU2A 1P9UA 3A81A 3LJOA 1C1WH 3FP6E 1P04A 3RMLH 3T26A 3UUZA 1C2GA 1UHBB 3B23B 1L4ZA 4YOJA 2HOBA 3HK6B 2BTCE 3LGVA 1A61H 2W7UA 4BAQB 2HNTE 2D8WA 1ZRBA 3D23A 4CH2B 1DSTA 2JKHA 3MNCA 2XWBI 2BZAA 4X6OA 1GJ5H 4AGKA 4J1YA 3SZNA 1DT2A 3ITIA 1G3BA 2Z9LA 3F9FA 2EI6A 1YCPK 1F5LA 3SO3A 5F8TA 2FOAA 1C1UH 1GI0A 1KXFA 3K2UA 4FUBA 3RXSA 4X8UH 4ABGA 8GCHG 1EUFA 1YPKH 4HZHA 1YC0A 5T6FA 1LHGH 3ZZCA 1SHHB 1YGCH 1ZHMA 1KXBA 4FUEA 5J4SA 3H5CB 2C8YB 1GBTA 2VNTA 3F9EA 3PTNA 1EP5A 1XUIA 1A1RA 1O2HA 2VWNA 1FDPA 2XW9A 1XM1A 4O97A 3A8CA 4U32A 4NSYA 2G81E 2BQWB 2ZC9H 1HIAA 3O8RA 3QN7A 2FYQA 1BRUP 1CO7E 1AE8H 1YPJH 3L6PA 3RXIA 2DUCA 2QC2A 3EA8A 3UNSA 2SNWA 1GJ7B 1CU1A 2ILNA 1AO5A 2SFAA 1NFXA 2B8OH 1FI8A 1L1GA 1BMMH 4UONA 1TE0A 1W11U 2G52A 3QX5H 5DP3A 2ZCKP 1UTJA 5FHTA 4CHAC 1Z8JB 1AVWA 1HGTH 4CBNA 1ANBA 1SVPA 1A3BH 2G4UA 3PO1B 4FU9A 4IC6A 1O2MA 3E90B 2WPMS 1LDTT 1XVOA 4AN7A 3UNQA 5EQQA 3TVJB 4NIXA 3SQHE 1ELBA 2GTBA 2AH4X 2ZPRA 1AKSA 3TH2H 1BBRH 4IW4E 1FY4A 5EODA 1TBZH 3UY9A 1GG6C 1P01A 4RSPA 4BTUB 2Y82A 4FUCA 2FI3E 3CP7A 3MHWU 1BTZA 2R3YA 2BM2A 2A0QB 5EXLA 4A7IB 1SOZA 3TJVA 3TH3H 3SN8A 4X6MA 3ZZ7A 3M5MA 2J34A 1D3QB 2ALPA 1LHEH 3SUFA 2F9VA 2I6SA 3SV8A 1A7SA 1PJPA 3PLPA 4D9QA 1BT7A 1DWCH 6LPRA 3KL6A 2OC0A 1V2JT 1RXPA 3P8FA 4Y71A 4BTIB 1O3IA 4Y11E 3RXLA 1N6YA 4SGAE 5E2OA 1AI8H 1GBMA 1TGBA 2YNBA 2ZDVH 3U8TH 1C5PA 1PYTC 1EAUA 2Z3EA 1MAXA 3T27A 1GBLA 5AFZH 3T2NA 1G30B 2G5VA 1A5IA 1ZPBA 2P95A 3MWIU 5C1YA 1FNIA 4SGBE 1XVMA 2BYAX 1QBOA 2RG3A 4I8HA 3UTUH 3LDXH 2NU0E 1K1LA 4UFFH 3TK6A 4I8JA 1S5SA 1BMAA 1L1JA 1W7XH 2AIPA 2OP9A 3LGWA 4WMDA 2Z9IA 1DE7H 4MTBA 2ZF0H 3BEUA 3DT0H 1SLWB 3KQCA 2VINA 4X2VA 4INLA 1ZMLA 4TWWA 1NPMA 2ZIQH 1GMHG 1G3EA 4OS5A 1OWEA 3K65B 2OCVB 1S6HA 3VGCC 4ZMAH 1C1MA 1HDTH 3TLOA 1VITG 1UCYK 2J2UA 3ZVDA 2XRCA 3GCTF 5JBAS 2ZU2A 1K1NA 1ZJDA 5GIBA 1YCPM 3I77A 1QRWA 4IS5A 4DIIH 3A88A 3M7UA 2V0BA 5E8EH 2BLOA 3NPSA 2ZECA 1UTMA 1ZGIA 1C1VH 2HPQH 1SGFG 5GCHG 3M36A 1BIOA 1P05A 3A7YA 1K28D 2O8UA 4MNVA 3P8GA 1O5CB 2STBE 4H6SB 1WBGB 1GGDB 1O5DH 3SQEE 4LK4A 4Q7YA 1QJ6B 3LONA 2PKAB 3GDVA 5H4IB 1MTSA 1BRBE 1N1LA 3MO9A 2VIDA 1DSUA 1ORFA 5FX5A 2VH0A 3MNSA 5E2PA 2A4GA 1NC6A 3BEIB 1C5YB 4ZKRU 4CHAB 1TPSA 2B7DH 1C5WB 5JB9S 1BRCE 1YPMH 1PPFE 2FIRH 5FPTA 4B76A 3TITA 4DY7B 1ZLRA 2FO9A 2F9NA 1H8DH 1SI5H 1V2NT 3K9XB 4CRBA 1TX8A 4X8TH 4F4OC 5AF9H 4U30A 1KXEA 3V7TA 2F9UA 1WTGH 2KAIB 2Z7FE 4X1PU 5LPRA 3E6PH 2R9PA 1QURH 1AY6H 3KCGH 1AWHB 1FAXA 2FI5E 3TK9A 3VB6A 2FYRA 2HPPH 4FUIA 5EQRA 1HAIH 2ZGHA 1GG6B 4GCHF 3EQ0H 1DOJA 1GBFA 3MU8A 4YT6H 3Q3XA 3SNBA 4Q7ZA 1NO9H 1V3XA 3P70B 4IGDA 4JYVH 4LZ1H 5JBCS 3A7WA 3SJ9A 1ABIH 4NA9H 1ZPZA 1UVPA 3EDXB 1V2LT 1TNJA 2ZHWH 1OP2A 2ZP0H 1Y5AT 1PQ8A 1QBNA 4GLYA 1ETSH 3RC4A 4BOHA 1YP9A 4X2WA 3O8DA 1V2TT 4AORA 1LPKB 1A2CH 1F2SE 1HAHH 1K9OE 2VGCC 3BG4C 1C2JA 2FTLE 3SGAE 3U1IB 1BMLA 1MUEB 4UFDH 5FAHA 2J38A 5EXNA 1TGTA 1A0HB 2PUXB 2BLQA 1SBWA 3ATLA 2ZTZA 1GDUA 2CF8H 4ISNA 2TBSA 3P17H 1UK4A 4WMEA 1ANCA 1PPZA 3A7XA 3NZIA 1O2TA 1O33A 3ATWA 1QA0A 3FZZA 3TJOA 2ZDLA 1TFXA 4E05H 3EYDA 1DDJA 3KIDU 4RKJB 4CR9A 5BRRE 1WV7H 1EJAA 2XXLA 1DLEA 2BD9A 1P2OA 1W0ZU 1ZZZA 3P95A 2QCYA 3AASA 2UWOA 2C8ZB 1XUHA 1KIGH 5L30H 1SGYE 1BZXE 5GWZA 1DFPA 3PLKA 4I7YH 1TNKA 1V2ST 1QQUA 1C1NA 3MU1A 1QFKH 1D9IA 2FM2A 4DW2U 1O3LA 1WYKA 2ESTE 1EJNA 1VJAU 2BB4A 3TU7H 2ANYA 1LHDH 2AEIH 2G5NA 1T31A 1MMJN 1Z1JA 3HK3B 3VB4A 3P6ZB 3VGCB 3LGIA 1BUIA 3KEEA 1HAVB 1IHSH 3STIA 2XC5A 4GPGA 3LJJA 1P09A 6CHAC 1V2VT 3RMNH 5ABWA 1ETTH 1QB9A 1IHTH 1DVAH 3W95A 3BTQE 2OXSA 1MZDA 3HKIB 1RTKA 4HFPB 3RU4E 1GHZA 1GJAB 2VIWA 1H8IH 2BOKA 3Q76A 1QB1A 2P94A 2CF9H 1GHVH 4OGXA 1O3DA 1CE5A 1UTPA 3PMJA 1FLEE 1W13U 2WV5A 2Y7ZA 4X2XA 1O30A 2G51A 1O35A 2BLWA 4K1SA 1XXFA 2ZU3A 1V2QT 1QJ7B 2QF3A 5K0HA 1O37A 2HLCA 2XNIA 2F3CE 2QXJA 2BVRH 5A0CA 2FOMB 3A80A 2OQUA 1V2RT 2XBYA 1XMNB 1MKWH 5EGMA 3UOUA 1C5SA 2BDGA 3FZDA 1MTWA 5EU8A 2ODPA 1J16A 4Y76A 1OPHB 1ABJH 2ANKH 1C2FA 2PLXA 1P2MA 1FPCH 2XBWA 1HLTH 2TPIZ 1DXPA 3RXOA 2PGQB 1AB9C 4RN6A 1QTFA 3BEFB 1EXFA 1BBRE 1IQEA 2BY5X 1LTOA 1Y5BT 1UTNA 1O2JA 2FPZA 2Z94A 8LPRA 2P16A 3SOSA 3A7TA
chains in the Genus database with same CATH superfamily
4ACBA 3RU4T 4CREA 1WQVH 2PR3A 5A2MH 2A7JA 5C20A 1GMCF 2QXHA 1BTPA 4ABIA 2BDBA 1AZ8A 3V3MA 3GY8A 2V3OH 5GNDA 4ZHLU 4X0WU 4BTTB 1MQ5A 1C1PA 1MZAA 4ZKSU 2M5TA 1BJUA 1ESBA 3V13A 2HNTF 4IMQA 4X2YA 4K8YA 2HNTC 1C2EA 5BPEA 1O2PA 1Q31A 2G8TA 2FZZA 4CRAA 2PGBB 1AN1E 1DPOA 4NSVA 4AZ2B 2VGCB 4PROA 2V3HH 2QXIA 3BG4B 2W26A 4TSFD 1MKXK 2JH6D 1C5OH 1DWEH 1H4WA 1TONA 3PRBA 3ZZ4A 2FMJA 1K1PA 3ZV9A 3Q3YA 2RFKC 2GX4A 2PKSC 1TMUH 1LHFH 1D3TB 1FQ3A 5FPSA 2H9HA 1C9TA 5C1UA 3RUOA 4B2BA 4ISLA 2O8MA 3ZZ9A 4Y8YA 3JZ1B 3SHCH 3OEED 2CJIA 3QTOH 1G2MA 3WY8A 1E0FD 2WHXA 4AOQA 2ZGCA 1F7ZA 1SGPE 5L2YH 1UVSH 1MU6B 3NKKA 3TK5A 1EZQA 1BRAA 1VITH 3E16B 4NIWA 5IYTA 4AG1A 1O3JA 1ACBE 1GI7B 3FFGA 4I8GA 1QQ4A 2VWLA 4DOQA 3GISB 2KR7A 4YLUA 1GHBF 2SGDE 3GOVB 3FAOA 1AHTH 5DKMA 1GVLA 1L1NA 3KYGA 1G3DA 1SLVB 4B71A 3EE7A 2C93B 3RC6A 1O5GH 3ZZ3A 2XBVA 2VIQA 2AGEX 2EI7A 1TPPA 2JJ2D 5DP7A 4XBDA 1PQ7A 3RXHA 1C2HA 1E38B 1C5UA 4GAWA 4DVAU 1GHAG 4H6TA 4OGYA 4I86A 3UPEA 1RFNA 3ATIA 3VB3A 3ZZ8A 6CHAB 2R3UA 1BHXB 1VCWA 4IN1A 3OEHD 1ZTLA 1C5XB 4B1TA 5DJ7A 3CS0A 1JOUB 1A3EH 4UDWH 5DGJA 5DP6A 1FIWA 2GZ8A 3A8BA 2FP7B 1FZZA 1T8LA 5A0BA 1FPHH 4K2YA 1CA8B 2THFB 3FN8A 2GZ9A 1DANH 4BAKB 1HRTH 4LOYH 1OOKB 1YY3A 2GDEH 2R0KA 1SGRE 1ZSJA 5HKKD 5FCRA 1SGQE 1ESAA 1UHBA 4DIHH 8GCHF 1B0EA 2Z9KA 3QK1A 2UUKB 4KGAA 1ZPCA 4Q7XA 5G4BA 5EW1H 1RIWC 1T4UH 3BG8A 3MH4A 2SGAA 1BB0B 7GCHF 1TWXB 2IJD1 1F5RA 2XCFA 4Q80A 2H9EH 4Y7BA 4WJG2 2F9OA 1O31A 2EEKA 2WPIS 1FXYA 3KYFA 3AAVA 2OUAA 3ZZ5A 1P8VC 1RGQA 3RM0H 2WYGA 1SHYA 1QHRB 3GY4A 3M7TA 2WPDD 5PTPA 1H8ED 4WF8A 4CH8B 1AB9B 2NU4E 1BBRK 5JBBS 2FESH 5DK1A 3F6UH 4ABHA 4FUFA 1KDQB 2VIPA 3SJOA 1KLJH 1F0TA 1GGDC 3BN9A 5LPEA 1HBTH 1GHWH 1YKTA 3U28C 1ELGA 3KQ5A 1MBMA 1A46H 1L0ZA 1JBUH 4ZXXH 1MU8B 2CN0H 2LP6A 1MTVA 1UVOA 4TWYA 4ABBA 4A1XA 5A0AE 1EZUC 3UQOA 4JYUH 1T8OA 4MPXA 3UQVA 4ZXYH 2A1DB 1Y3XA 3R0FA 2RDEA 1KXDA 2TIOA 2VIOA 3SORA 1C1TA 2ZHDA 1EASA 4MVNA 4TT3D 4K69A 2BY9X 3NWUA 2FX4A 1P2NA 1YCPH 1DUEA 4BXWA 4ZROA 1SSXA 3KHVA 4Q2KA 2FLBH 1AE5A 1MBQA 1OXGA 3ZZBA 3PB1E 2PKSB 4UEHH 3DA9B 4X6PA 1ESTA 1EKBB 3OAAD 2G55A 4RT0A 1QR3E 4OS7A 2BX3A 1W3CA 3TJNA 1CVWH 3BSQA 3MNBA 2VBCA 1ZYOA 2W7SA 4TPIZ 4D8NA 2PHBA 4Y0ZE 2AS9A 2ZQ2A 3A8AA 2H6MA 1THRH 3P8OA 2IN2A 1OSSA 2IJOB 2OBQA 1WOFA 1ZOMA 2FOBA 2OD3B 1CT0E 1O2YA 3E1XB 3U98H 1FONA 3RLYH 4F55A 3LKWA 1VJ9U 3I78A 2ASUB 2EQNA 3AW1A 4YOIA 4A1TA 1TB6H 2ODYB 3T5FH 5FX6A 1XKAC 1GBJA 1QY6A 2OINA 1T8NA 3LIWA 1EOLA 4YTAA 2VWOA 1HAZB 1P2IA 1GMDG 1SQTA 4GUXA 1EAIA 4JZDH 4NZQA 3SNCA 5C3NA 1O38A 4R8TB 1LCYA 1XUJA 1O34A 1ZSLA 1CGIE 1V2OT 5EG4A 5EW2H 1ELCA 1KMHB 1P3CA 1SGCA 2SGEE 1SFIA 1L2EA 1UMAH 1QL8A 3MQKC 3SUGA 2JH0D 1O2KA 3PLBA 3KQDA 1C9PA 1CHOF 4KKDA 4NWKA 3SU1A 5C67A 1JIMA 2EA3A 2FTMA 4KTCA 1FY3A 4NA8A 1GVZA 2AERH 1Y59T 1GHYH 3UFAA 3KN2A 3NUMA 5FBEA 1YPEH 1YPHC 2WV4A 1H1BA 1CGJE 3MYWA 1EZXC 2OC7A 3N7OA 2J98B 4D7FA 1O2OA 1NRRH 4AFSA 3A82A 1J9CH 3U8RH 1C5LH 4ABEA 3O8CA 3RXVA 1EB2A 3A85A 1GHXH 2BQ7B 3FP8E 3AAUA 1SB1H 5EPNA 1J14A 2K1QA 1ID5H 2QF4A 5EJ1A 4Z1MD 1AVGH 1QRZA 1RIWB 1GI1A 1O3EA 3ZIAD 2ZDNA 4NCYA 4OM9A 2CMYA 3GDSA 4FUGA 3SJIA 4FVDA 2ZA5A 2Y81A 3RXJA 1TA2A 1WDIA 3QTVH 3H7TA 5J4QA 3ENSB 3SV9A 5I46H 2P93A 1BTHH 2WYJA 3QGNB 8ESTE 1UO6A 1DLKB 1PQAA 1TYNA 1OYTH 1WQSA 2K8IA 4TYDA 3GCTG 3U69H 4ABFA 4M7GA 1EQ9A 5F03A 4UE7H 2WUCA 2ANWA 3LOXA 4XOJA 4E06H 1OX1A 1GVKB 3OY5U 3ATMA 3KQEA 1ZGVA 3M61U 3CNRA 4WY3A 1KLTA 3A86A 4ZKNU 4XBBA 4FUHA 1BTYA 1TNHA 3HGPA 4NA7A 3RXBA 2AIQA 1HXEH 3M3VA 1O3CA 1YPLH 2O8WA 4IC5A 5SGAE 1C4U2 3MH7A 1AZZA 1K1IA 2PKAA 1O5BB 1AVXA 2PTCE 2Q6DA 1JRTA 1KXCA 3QGJA 1BMNH 1C2KA 1OWDA 4ZHAA 1XX9A 1ELTA 1O2XA 2D2DA 2F9PA 1MH0A 3F1SB 2HVYB 1QCPA 1UCYH 3ZZDA 1EJMA 1LVBA 1THSH 1D6WA 2AHME 1UTLM 3RXRA 1K22H 5F8XA 3C1KA 3GCHC 2A4OA 1OP8A 4FU8A 2V7QD 4YT7H 2C8WB 3MOCA 1S81A 2KAIA 2ZFRH 3UIRA 3LT3A 4Y7AA 3E0PB 1QA7A 2UUJB 4H4FA 6ESTA 1CBWC 1ZRKA 2BD3A 1EAWA 4U01A 3VPKA 3DFLA 1D4PB 1EPTC 1JWTA 1UJ1A 1K1MA 2Q1JA 2M2AA 4WXVA 4OS6A 2BHGA 2ZHFH 1BTUA 4J2YB 1MQ6A 2RA3A 4MPVA 1ZJKA 1K21H 3URCA 1DM4B 4GVUA 1V2MT 5LPFA 4K3JA 1D3PB 1GJ4H 4ZCNA 1BTXA 1O5EH 3HKJB 3K6YA 5EJZA 2BXTH 1ELDE 1LQEA 5C0TA 1P0SH 4HGCA 1TGNA 2H2ZA 1G36A 2C3SA 4FU7A 1P2JA 4IBLH 2P3UB 1SLUB 2VU8E 4A92A 4LZ4B 1OWIA 3U9AH 1LKAA 1QB6A 2C8XB 4B2CA 1NRSH 3ZVAA 1N8OC 2W3KA 3GY3A 1ZMJA 3QO6A 1H9HE 1RTLA 1PPGE 2YNAA 1OKXA 3IITA 1C5TA 2GCTC 1OS8A 1RRKA 4MLFB 3F68H 1O2QA 4I8LA 5I25A 4DJZB 2OC8A 2Z3DA 1INCA 1MCTA 2VIVA 3EAJA 3SV2H 2Y7XA 2RDLA 3RXCA 3SI4H 2GDDA 3F2HA 4Y79A 3VG8A 1XXDA 1CQQA 3URDA 1PPBH 1EP6A 1J15A 1GJ9B 1ZHRA 2BD5A 3QWCH 3SV7A 1O0DH 5ETXA 4JZ1A 1RD3B 2XOKD 3GICB 4I31A 4AG2A 2K0QA 1HXFH 1C2MA 5B6OA 1ETRH 3UWIA 3BTKE 5T3HA 1VZQH 1C5VA 1MKWK 1QJ1B 1NM6A 4JCNA 1C5ZB 3S7KB 1S0QA 1DXWA 3SNDA 3RXUA 4NIYA 5JB8S 2GT7A 2FDAA 3QDZB 4XD7D 4XSKU 1UTQA 1Z1IA 1ZR0A 4OS4A 2QGRA 3WWFA 1UK3A 4AB8A 3RXDA 2W5EA 4P00A 4E7NA 4LXBH 1SGFA 1AFQC 2FI4E 3ZZ6A 2OC1A 2XTTB 3EA7A 1J8AA 1HAVA 5K7RA 1S85A 1W12U 4VGCC 2H9TH 1NRNH 2BD8A 2G4TA 2LPRA 4XRNA 3F2GA 1O32A 5A09A 2FOEA 3KGPA 4THNH 1BTWA 3IG6B 3KF2A 3PTBA 4KTUA 4KELA 3H7OA 3ZVFA 4F49A 1AQ7A 5TJXA 4CBOA 3QLPH 2GD4B 1G37A 3E0NB 1WSSH 2GCHG 3SV6A 2FODA 4BANB 4AB9A 1Y3YA 4ZUHA 4X6NA 2XWAA 2AMDA 1S84A 3ZV8A 5E0JA 5EQSA 2RA0A 1CHGA 1C2DA 4KTSA 4UFGH 2VJ1A 6GCHF 1LVOA 2PWXA 5AVDA 1C5RA 5C0UA 1KXAA 3N7EA 1HJAC 3A84A 2A45B 1T32A 2OLGA 3ZYDA 2BDIA 2P3FH 1HAOH 1C1QA 1GBBA 1O2SA 2HRVA 2UUFB 1SC8U 1DWBH 2Y5GA 1NFYA 1SFQB 2JDID 1A0LA 3M5OA 1PQ5A 3GCHB 1C4V2 1J17T 2O8LA 5GDSH 1C5MD 1B5GH 1Y3UA 2BZ6H 2KCPA 4YOGA 1C2IA 3BTDE 2ZZUH 4ZH8A 1XUFA 2FOGA 4CRFA 4D9RA 2ZDKA 1CBWB 3VB7A 1HNEE 1P57B 3QUMP 2A31A 1EPTB 1GBDA 2V35A 1IQFA 2WPLS 3V12A 4YLQH 2HVXA 3PMHB 1LQDB 5A8XA 2BLVA 3GYLB 1E1QD 2VB0A 1WCZA 1GI3A 2GV6A 4GHTA 3B9FH 2AGIX 5IK2D 3GYMA 2OTVA 3NXPA 2WPHS 1THPB 5DP5A 5HM2A 1QBVH 1S83A 2BOHB 1IAUA 1Y3VA 1Z7KA 3F9GA 1NY22 2FLRH 2QYIA 2JETC 3SU4A 3V0XA 1O3KA 1LPGB 1PPCE 2Z6BD 2SGFE 2QIQA 1N8OB 3SHAH 1NRQH 1W14U 1AWFH 3BTHE 4FXGH 5FBIA 5GJ4B 4Q4LA 5EJLA 1TPAE 2GCTB 5DSFA 1V2KT 3TNSA 2Z3CA 4D76A 1GI2A 3BTME 2FOCA 1S82A 4MDSA 4Z6AH 4UFEH 1G2LA 1H9LB 2QXGA 1MD7A 5AHGH 3RC5A 4KP0A 1GI4A 3MFJA 1NBMD 1G3CA 1Z71A 1O2LA 4K1TA 4QT8C 3VEQB 1B7XB 2PSYA 2ZGBH 4YM9A 1LMWB 3RXTA 4YZUA 2JJ1D 4A1VA 1S6LA 3L33A 2NU2E 3RXKA 2AYWA 2CHAC 2UWPA 2BVSH 1BQYA 2J4IA 2ZTYA 4JK6A 2W3IA 3GY5A 4ISHH 5TCAA 3MO6A 4MNYA 5IDKA 4IN2A 1TGSZ 3UNRA 1GBEA 1YBWA 4CR5A 1O3GA 2BD4A 1Q2WA 4I8KA 3RDZA 5HYOA 1GHAF 1L4DA 1BOQA 1GBKA 2ZU4A 3SU6A 4ASUD 1C1OA 1KTTB 1DICA 1ZMNA 1NESE 2PW8H 2OBOA 2J5UA 4MPUA 2Z9GA 1NS3A 3MO3A 2Q6FA 3PMBB 4DURA 1K0HA 4R0IA 5L2ZH 1UTOA 1AFQB 1TRMA 3MU5A 1ZHPA 4ASHA 3PV4A 1GBHA 3OTPA 3NCLA 1O2IA 1O3PB 2ZDMA 1HAPH 4VGCB 5E0HA 1F0SA 5C17A 3TGIE 4HTCH 1YLCA 3SU5A 3MU4A 5HXFA 3ESTA 3LGUA 3D62A 3PM3A 4IMZA 2I6QA 1MCVA 5L6NH 2SGQE 1B0FA 2NU3E 4X8SH 1TPOA 1GJBB 1BA8B 3GY2A 5T6DA 3RXAA 8KME2 3E8LA 1FV9A 2FOFA 2L74A 3PWBA 1WU1A 5TCCA 3S9BA 4FUDA 3ODFA 3LC3A 2J94A 3UOPA 1BDAA 3ZVBA 4ZKOU 1VR1H 1TRNA 1TOMH 3S9AA 4BXSA 1NZQH 4BNRA 2ZDAH 2A5IA 1TMBH 1TBQH 1OP0A 1AUTC 3ATKA 1MTUA 1RS0A 5GXPA 1GJ6A 1HJAB 2WINI 2GKVE 1YF4A 1A0JA 3A83A 5GPIB 1O3BA 2B5TB 3LPRA 1SGNE 1IOEA 1O3MA 4DGJA 1O2NA 3RMMH 1GI9B 1ZTJA 1GCTC 1HIAB 1UCYE 2GV7A 2CV3A 2GZ7A 2J92A 4AYVB 1FY8E 7GCHG 2Y80A 2A2QH 2ODQA 3RMOH 1M9UA 1P2QA 1AU8A 1TNIA 1FIZA 4GSOA 5DP8A 1A5HA 2XBXA 4ZAEA 4XE4A 1HAGE 4AFZA 3TJUA 1WXRA 2ZCHP 2ZFQH 3A89A 3ELAH 4I33A 1SGIB 3S0NA 2BD2A 2G00A 1KDQA 1W7GH 1K1OA 1OWHA 3Q3KA 2CGAA 3M7QA 3WW7A 4OS2A 2EI8A 3IWMA 1N6XA 3SJ8A 3TPIZ 5A8YA 2ZTXA 1TQ7B 5FPYA 3VXFH 2Y5FA 2AFQB 5KECA 3SI3H 2Y5HA 1WUNH 3GCNA 2H5CA 4A6LA 4U2WA 1AKSB 3ZYEA 1OHHD 1O5AB 2TGTA 1H9IE 3RU4D 1F0RA 2JETB 1O2RA 3RXEA 3MTYA 2ZFPH 3A7ZA 2ANMH 1CA0C 1TX7A 1LPZB 1O2VA 3SYJA 2VWMA 1P12E 1V2WT 3F9HA 3FKSD 3ZVEA 3NK8A 1GBCA 1SLXB 2ZFSA 1FUJA 1TIOA 2ZEBA 3LGYA 2FOHA 1HB0B 1O36A 4UD9H 3VXEH 1O5FH 3BTWE 4JMYA 3A87A 4FETA 5E0GA 1OWKA 2A5KA 5A8ZA 3TGJE 5JBTA 2DE8A 1A4WH 1O2WA 2VH6A 2Y6TA 3MU0A 1TABE 1F92A 1Y3WA 1DS2E 1O39A 1YM0A 4ESTE 1IQHA 1ELEE 1KY9A 1GMDF 1W0KD 3SU3A 2CHAB 1E37B 1XUKA 1GPZA 3RM2H 1HUTH 1PPEE 3LH1A 4JZFH 4NFFA 3MH6A 3EE0B 3ZVCA 1D3DB 1FX0B 3M35A 2XCNA 1D6RA 1O3AA 1TALA 2GT8A 2ZQ1A 5JYIA 2DE9A 1C4Y2 1YPGH 4BAOB 1A5GH 4H42U 4ISOA 2A7HA 4YESB 1EAXA 2W6ID 3PWCA 3PRDA 1AMHA 3CENA 5EPYA 3F0PA 2HALA 1HFDA 3AVZA 1DWDH 1K1JA 1Q3XA 4WH8A 3NRLA 1IQNA 1GDNA 2PTNA 1FN6A 3BTTE 3EGKH 4YO9A 5JDUB 3AW0A 3BF6H 4X1RU 4CRDA 2ZI2H 2BDCA 1RJXB 2SNVA 1GMHF 1CHOG 4A5TS 2BY8X 1FN8A 1FJSA 5HMAA 2WUBA 2PSXA 3T29A 5KGOA 3TIUA 2UUYA 1TGCA 1VITF 1SGTA 2ZNKH 2ZO3H 2A2XH 2B9LA 1Z6EA 1MAYA 2J98A 1SQAA 5T6GA 1X7AC 1GI8B 2ZCLP 2F83A 1K2I1 3SGQE 2YOLA 5GCHF 2VVVA 9LPRA 2A5AA 1GL1A 1LVYA 1E35B 2ULLA 1O3FA 4INKA 4HI3A 3HATH 4Y8ZA 1SOTA 3SJKA 5DO4H 1HPGA 1NROH 2XYAA 4ACAA 4RT1A 5HM9A 3M5LA 2ZHQH 1GCTB 3Q77A 3BIUH 1IQKA 4JK5A 2FX6A 2C4FH 3TNTA 1AIXH 1IQIA 4NIVA 1O2UA 1W2KH 3DHKH 2F4LA 2BY6X 3G01A 4JZEH 3M37A 4BAMB 1QNJA 3U1JB 2QF0A 2R0LA 3D65E 1TRYA 2VVCA 3SUEA 3PROA 3STJA 1P06A 2GMTC 2HWLB 5C5OA 1DX5M 2KCAA 1CT4E 4INHA 4X1SU 2QAAA 1O2GH 1F0UA 1W10U 4DCDA 1EATA 1TBRH 4CRCA 1LHCH 5F6MA 2BD7A 3SU0A 1NN6A 1GBAA 1IQGA 1YYY1 4BAHB 4D7GA 2D26C 1TQ0B 1Y5UT 4NFEA 3LGTA 3M5NA 1GL0E 1HAXB 2XC0A 2ALVA 3BV9B 1VCPA 1NU9A 2ZWLH 1MTNC 3DD2H 1AD8H 3KQBA 1QL7A 1V2UT 3BTFE 4B73A 5DP9A 3RP2A 1C5QA 3RXQA 2GJGA 3FP7E 1UK2A 2VVUA 1ANDA 1U6QA 2ZGJA 1HCGA 4X1NU 1VGCC 3L3TA 4XFQA 2FXRA 1CT2E 1CA0B 1YWUA 4K8BA 2P59A 1JRSA 1EOJA 3UWJH 3FOAA 2ZFFH 4X1QU 1AFEH 5EIYA 1P02A 1GI6A 1P10A 4K1EA 1QL9A 2QA9E 2OQ5A 2BX4A 3OSYA 5HIYA 3S9CA 2A4QA 1YPHE 3DUXH 3Q00A 2WZQA 1LVMA 3MH5A 3LU9B 2TGPZ 4GCHG 2JH5D 1GBIA 1HJ8A 2C90B 4AFQA 5C5NA 2TGAA 1V6DA 1KSNA 1P3EA 2P8OC 3O8BA 3JZ2B 5DG6A 4WVPE 4X8VH 1Z8RA 1C1SA 1LO6A 1V2PT 2ZPQA 4K60A 4O03A 2NWNA 1ZSKA 3GY7A 1P2KA 1SQOA 4ISIH 1GJ8B 1TLDA 1T7CA 1ANEA 2NU1E 3BTGE 3M3TA 4ABJA 5CHAC 1FMGA 1W0YH 2A32A 2AMQA 5FCKA 4GHQA 3GDUA 5AFYH 1G9IE 1IQLA 3UREA 3P92A 2BDAA 3HPTB 1GCDA 3DFJA 3SNAA 4AC9A 3HGNA 4ABDA 1GDQA 1Z6JH 1HYLA 4B2AA 4RKOB 4MNWA 2J97A 3UR6A 5C2ZA 4O3UA 2IOTA 4B75A 1HJ9A 3QZRA 1Z8IB 3S69A 4XDEA 1JXPA 1O3NA 1OYQA 2GGVB 2ZKSA 7KMEH 2Q6GA 1BCUH 1IQMA 1ARBA 1CSOE 2BXUH 5HGGA 4DG4A 2FWWA 1FY1A 3SZEA 1SMFE 2H5DA 3FANA 1DY8A 5CMXH 3RXGA 3OTJE 3A8DA 3T25A 1O2ZA 2QY0B 4O9VA 3BIVH 1S6FA 1WAYB 1SR5C 1WTHD 2QN5T 1RTFB 1UTKA 4MG3A 5DP4A 4AGJA 2ZU5A 2A7CA 1LKBA 2D1JA 1MABB 1VCQA 4OS1A 4TY6A 4Z0KA 3ODDA 3TH4H 2Z9JA 5LGOA 1TX6A 1MD8A 1YLDA 1QGFA 1NT1A 1NFUA 2EC9H 4NGAH 4NG9H 4Y8XA 3SNEA 7LPRA 2F9BH 1E79D 1UW7A 2P3TB 1PPHE 2FEQH 2YMSC 1PFXC 1BHXF 3W94A 1JIRA 1H8HD 5CE1A 3T28A 2BY7X 1FY5A 3BTEE 2F91A 3OY6U 2ZPSA 2BMGB 3EA9A 1XUGA 4Y0YE 4MQAA 4E7RG 2V6NA 3VFEA 1G32B 5JPMH 1AGJA 3SUDA 2O8TA 2GCHF 3OU0A 2CK3D 1SGEE 1T4VH 1TMTH 2GMTB 3OX7U 1TA6A 1Z8GA 3ZVGA 3AK5A 3DSPA 1GJDB 1QRXA 4NZLA 3PYHA 3QZQA 2HGTH 3MMGA 4XBCA 1HV7A 1SL3A 2BDHA 1TOCB 2LNCA 2PUQH 3PMAB 5F8ZA 3E3TA 2ZGXH 4WXIA 4AX9H 5ESTE 3DCLA 1HAYB 3D49H 1IQJA 1GWAA 1NTPA 1T8MA 3OE7D 1UVTH 2PFEA 1P03A 3K6ZA 3SW2B 3I29A 2WPJS 1OWJA 1BMFD 1MTNB 2BDYA 3DSGA 4DT4A 4B74A 6GCHG 1BJVA 1P9SA 3ZZAA 1VGCB 1GJCB 2GVFA 2QV1A 1EFRD 1ELVA 5FXLA 2W6JD 3FVFB 1Y8TA 2FS9A 9ESTA 2CXVA 2J9NA 4DT7B 3VB5A 1TNLA 2HLDD 1XKBC 3P8NA 2SGPE 2B0FA 2XC4A 3KNXA 4WH6A 4AFUA 2BVXH 1FAKH 3F2FA 1ELFA 2IPHA 2ZHEH 7ESTE 4I32A 1GMCG 4MPWA 3RXFA 4JZIA 1NRPH 1E36B 1EX3A 2P8OB 1QZ8A 4F48B 3SGBE 1EPTA 3MNXA 5ESBA 2J95A 3U8OH 3PO1C 1ELAA 1C2LA 4NWLA 4TY7A 2AGGX 5LH8A 3UR9A 4WWYA 4AYYB 3N99A 1ZTKA 3C27B 1NFWA 2H1UA 2ZU1A 2V3MA 3GY6A 4O3TA 5DPAA 1BITA 1AUJA 2R2WU 4ABAA 2KFWA 5CHAB 3A7VA 2GP9B 3OYPA 2RCEA 1TNGA 5CDFE 4FUJA 2WSSD 1P11E 5B6LA 3UAIC 1ARCA 2TRMA 1EB1H 2AMPA 3CS7A 4CRGA 1C5NH 2R2MB 1DITH 1O3OA 2PV9B 5KEDA 2TGDA 5EOKA 1C1RA 1W0JD 1QIXB 2WPKS 1DUAA 3S7HB 3TGKE 1KYNA 4JYTA 2UWLA 5DN6D 1DY9A 2BQ6B 1GI5A 2ZG0H 1SPJA 1YLNA 5FL7D 5C1XA 1UVUH 3GCOA 1S0RA 4K5ZA 1O3HA 1W8BH 3B8JA 1SG8B 3LH3A 3M3SA 4WMFA 1CGHA 4Y6DA 5EXMA 3T62A 2A4RA 3MI4A 1SGDE 2KCYA 1GHBG 4FVBA 1MKXH 3E91A 1PYTD 1TAWA 3RLWH 3R3GB 2O9QA 2STAE 4ZHMU 1E34B 4TPYA 3RXMA 1KLIH 4MNXA 1NU7B 1JMOH 1F5KU 1KTSB 3LC5A 2YMSB 3RXPA 2FS8A 2ZFTA 4Y10E 3SBKA 1EZSC 3SU2A 1P9UA 3A81A 3LJOA 2L6OA 1C1WH 3FP6E 1P04A 3RMLH 3T26A 2KX4A 3UUZA 1C2GA 1UHBB 3B23B 1L4ZA 4YOJA 2HOBA 3HK6B 2BTCE 3LGVA 1A61H 2W7UA 4BAQB 2HNTE 2D8WA 3N7DA 1ZRBA 3D23A 4CH2B 1DSTA 2JKHA 3MNCA 2XWBI 2BZAA 4X6OA 1GJ5H 4AGKA 4J1YA 3SZNA 1DT2A 3ITIA 1G3BA 2Z9LA 3F9FA 2EI6A 1YCPK 1F5LA 3SO3A 5F8TA 2FOAA 1C1UH 1GI0A 1KXFA 3K2UA 4FUBA 3RXSA 4X8UH 4ABGA 8GCHG 1EUFA 1YPKH 4HZHA 1YC0A 4RI0A 5T6FA 1LHGH 3ZZCA 1SHHB 1YGCH 1ZHMA 1KXBA 4FUEA 5J4SA 2QE7D 3H5CB 2C8YB 1GBTA 2VNTA 3F9EA 3PTNA 1COWD 1EP5A 1XUIA 1A1RA 1O2HA 2VWNA 1FDPA 2XW9A 1XM1A 4O97A 3A8CA 4U32A 4NSYA 2G81E 2BQWB 2ZC9H 1HIAA 3O8RA 3QN7A 2FYQA 1BRUP 1CO7E 1AE8H 1YPJH 3L6PA 3RXIA 2DUCA 2QC2A 3EA8A 3UNSA 2SNWA 1GJ7B 1CU1A 2ILNA 1AO5A 2SFAA 1NFXA 2B8OH 3PV5A 1FI8A 1L1GA 1BMMH 2OK5A 4UONA 1TE0A 1W11U 2G52A 2KCOA 3QX5H 5DP3A 2ZCKP 1UTJA 5FHTA 4CHAC 1Z8JB 1AVWA 1HGTH 4CBNA 1ANBA 1SVPA 1A3BH 2G4UA 3PO1B 4FU9A 4IC6A 1O2MA 3E90B 2WPMS 1LDTT 1XVOA 4AN7A 2QF5A 3UNQA 5EQQA 3TVJB 4NIXA 3SQHE 1ELBA 2GTBA 2WV9A 2AH4X 2ZPRA 1AKSA 3TH2H 1BBRH 4IW4E 1FY4A 5EODA 1TBZH 3UY9A 1GG6C 1P01A 4RSPA 4BTUB 2Y82A 4FUCA 2FI3E 3CP7A 3MHWU 1BTZA 1SQRA 2R3YA 2BM2A 2A0QB 5EXLA 4A7IB 1SOZA 3TJVA 3TH3H 3SN8A 4X6MA 3ZZ7A 3M5MA 2LELA 2J34A 1D3QB 2ALPA 1LHEH 3SUFA 2F9VA 2I6SA 3SV8A 1A7SA 1PJPA 3PLPA 4D9QA 1BT7A 1DWCH 6LPRA 3KL6A 2OC0A 3GS9A 1V2JT 1RXPA 3P8FA 4Y71A 5HIZA 4BTIB 1O3IA 4Y11E 3RXLA 1N6YA 4HG6A 4SGAE 5E2OA 1AI8H 1GBMA 1TGBA 2YNBA 2ZDVH 3U8TH 1C5PA 1PYTC 1EAUA 2Z3EA 1MAXA 3T27A 1GBLA 5AFZH 3T2NA 1G30B 2G5VA 1A5IA 1ZPBA 2P95A 3MWIU 5C1YA 1FNIA 4SGBE 1XVMA 2BYAX 1QBOA 2RG3A 4I8HA 3UTUH 3LDXH 2NU0E 1K1LA 3DSOA 4UFFH 3TK6A 4I8JA 1S5SA 1BMAA 1L1JA 1W7XH 2AIPA 2OP9A 3LGWA 3WWBA 4WMDA 2Z9IA 1DE7H 4MTBA 2ZF0H 3BEUA 3DT0H 1SLWB 3KQCA 2VINA 4X2VA 4INLA 1ZMLA 4TWWA 1NPMA 2ZIQH 1GMHG 1G3EA 4M9FA 4OS5A 1OWEA 2YMSD 3K65B 2OCVB 1S6HA 3VGCC 4ZMAH 1C1MA 1HDTH 3TLOA 1VITG 1UCYK 2J2UA 3ZVDA 2XRCA 3GCTF 2F43B 5JBAS 2ZU2A 1K1NA 1ZJDA 5GIBA 1YCPM 3I77A 1QRWA 4IS5A 4DIIH 3A88A 3M7UA 2V0BA 5E8EH 2BLOA 3NPSA 2ZECA 1UTMA 1ZGIA 1C1VH 2HPQH 1SGFG 5GCHG 3M36A 1BIOA 1P05A 3H09A 3A7YA 1K28D 2O8UA 4MNVA 3P8GA 1O5CB 2STBE 4H6SB 1WBGB 1GGDB 1O5DH 3SQEE 2PP6A 4LK4A 4Q7YA 1QJ6B 3LONA 2PKAB 3GDVA 5H4IB 1MTSA 1BRBE 1N1LA 3MO9A 2VIDA 1DSUA 1ORFA 5FX5A 2VH0A 5CHBA 3MNSA 5E2PA 2A4GA 1NBME 1NC6A 3BEIB 1C5YB 4ZKRU 4CHAB 1TPSA 2B7DH 3OFND 1C5WB 5JB9S 1BRCE 1YPMH 1PPFE 2FIRH 5FPTA 4B76A 3TITA 4DY7B 1ZLRA 2FO9A 5T1VA 2F9NA 1H8DH 1SI5H 1V2NT 3K9XB 4CRBA 1TX8A 4X8TH 4F4OC 5AF9H 4U30A 1KXEA 3V7TA 2F9UA 4YXWD 1WTGH 2KAIB 2Z7FE 4X1PU 5LPRA 3E6PH 2R9PA 2IPQX 1QURH 1AY6H 3KCGH 1AWHB 1FAXA 2FI5E 3TK9A 3VB6A 2FYRA 2HPPH 4FUIA 5EQRA 1HAIH 2KM0A 2ZGHA 1GG6B 3FO8D 4GCHF 3EQ0H 1DOJA 1GBFA 3MU8A 4YT6H 3Q3XA 3SNBA 4Q7ZA 1NO9H 1SKYE 3W1EA 1V3XA 3P70B 4IGDA 4Q63A 4JYVH 4LZ1H 5JBCS 3A7WA 3SJ9A 1ABIH 4NA9H 1ZPZA 1UVPA 3EDXB 1V2LT 1TNJA 2ZHWH 1OP2A 2EY4C 2ZP0H 1Y5AT 1PQ8A 1QBNA 4GLYA 1ETSH 3RC4A 4BOHA 1YP9A 4X2WA 3O8DA 1V2TT 4AORA 1LPKB 4P02A 1A2CH 1F2SE 1HAHH 1K9OE 2VGCC 4B6FA 2KZ4A 3BG4C 1C2JA 2FTLE 3SGAE 3U1IB 1BMLA 1MUEB 4UFDH 5FAHA 2J38A 2XNDD 5EXNA 1TGTA 1A0HB 2PUXB 4FOUC 2BLQA 1SBWA 3ATLA 2ZTZA 3F0OA 1GDUA 2CF8H 5F53A 4ISNA 2TBSA 3P17H 1UK4A 4WMEA 1ANCA 1PPZA 3A7XA 3NZIA 1O2TA 1O33A 3PV2A 3ATWA 1QA0A 3FZZA 3TJOA 2ZDLA 1TFXA 4E05H 3EYDA 1DDJA 4B6EA 3KIDU 4RKJB 4CR9A 5BRRE 1WV7H 1EJAA 2XXLA 1DLEA 2BD9A 1P2OA 1W0ZU 1ZZZA 3P95A 2QCYA 3AASA 2UWOA 2C8ZB 1XUHA 1KIGH 5L30H 1SGYE 1BZXE 5GWZA 1DFPA 3PLKA 4I7YH 1TNKA 1V2ST 1QQUA 1C1NA 3MU1A 1QFKH 1D9IA 2FM2A 4DW2U 1O3LA 1WYKA 2ESTE 1EJNA 1VJAU 2BB4A 3TU7H 2ANYA 1LHDH 2AEIH 2G5NA 1T31A 1MMJN 1Z1JA 3HK3B 3VB4A 3P6ZB 3VGCB 3LGIA 1BUIA 3KEEA 1HAVB 1IHSH 3UB0A 3STIA 2XC5A 4GPGA 3LJJA 1P09A 6CHAC 1V2VT 3RMNH 5ABWA 1ETTH 2JIZD 1QB9A 1IHTH 1DVAH 3F3BA 3W95A 3BTQE 2OXSA 1MZDA 3HKIB 1RTKA 4HFPB 3RU4E 1E1RD 1GHZA 1GJAB 2VIWA 5C94A 1H8IH 2BOKA 3Q76A 1QB1A 2P94A 2CF9H 1GHVH 4OGXA 1O3DA 1CE5A 1UTPA 3PMJA 1FLEE 1W13U 2WV5A 2Y7ZA 4X2XA 1O30A 2G51A 1O35A 2BLWA 4K1SA 1XXFA 2ZU3A 1VKYA 1V2QT 1QJ7B 2QF3A 5K0HA 1O37A 2HLCA 2XNIA 2F3CE 2QXJA 2BVRH 5A0CA 2FOMB 3A80A 2OQUA 1V2RT 2XBYA 1XMNB 1MKWH 5EGMA 3UOUA 1C5SA 2BDGA 3FZDA 1MTWA 5EU8A 2ODPA 1J16A 4Y76A 1OPHB 1ABJH 2ANKH 1C2FA 2PLXA 1P2MA 1FPCH 2XBWA 1HLTH 2TPIZ 1DXPA 3RXOA 2PGQB 1AB9C 4RN6A 1QTFA 3BEFB 1EXFA 1BBRE 1IQEA 2BY5X 1LTOA 1Y5BT 1UTNA 1O2JA 2FPZA 2Z94A 8LPRA 2P16A 3SOSA 3A7TA
chains in the Genus database with same CATH topology
3RU4T 4CREA 1WQVH 2PR3A 5A2MH 2A7JA 5C20A 1GMCF 2QXHA 1BTPA 4ABIA 2BDBA 1AZ8A 3V3MA 3GY8A 2V3OH 4ZHLU 4X0WU 4BTTB 1MQ5A 1C1PA 1MZAA 4ZKSU 2M5TA 1BJUA 1ESBA 3V13A 2HNTF 4IMQA 4X2YA 4K8YA 2HNTC 1C2EA 5BPEA 1O2PA 1Q31A 2G8TA 2FZZA 4CRAA 2PGBB 1AN1E 1DPOA 4NSVA 4AZ2B 2VGCB 4PROA 2V3HH 2QXIA 3BG4B 2W26A 1MKXK 2JH6D 1C5OH 1DWEH 1H4WA 1TONA 3ZZ4A 2FMJA 1K1PA 3ZV9A 3Q3YA 2GX4A 2PKSC 1TMUH 1LHFH 1D3TB 1FQ3A 5FPSA 2H9HA 1C9TA 5C1UA 3RUOA 4B2BA 4ISLA 2O8MA 3ZZ9A 4Y8YA 3JZ1B 3SHCH 2CJIA 3QTOH 1G2MA 3WY8A 1E0FD 4AOQA 2ZGCA 1F7ZA 1SGPE 5L2YH 1UVSH 1MU6B 3NKKA 3TK5A 1EZQA 1BRAA 1VITH 3E16B 4NIWA 5IYTA 4AG1A 1O3JA 1ACBE 1GI7B 3FFGA 4I8GA 1QQ4A 2VWLA 4DOQA 3GISB 4YLUA 1GHBF 2SGDE 3GOVB 3FAOA 1AHTH 5DKMA 1GVLA 1L1NA 1G3DA 1SLVB 4B71A 2C93B 3RC6A 1O5GH 3ZZ3A 2XBVA 2VIQA 2AGEX 2EI7A 1TPPA 5DP7A 4XBDA 1PQ7A 3RXHA 1C2HA 1E38B 1C5UA 4GAWA 4DVAU 1GHAG 4H6TA 4OGYA 3UPEA 1RFNA 3ATIA 3VB3A 3ZZ8A 6CHAB 2R3UA 1BHXB 1VCWA 4IN1A 1ZTLA 1C5XB 4B1TA 5DJ7A 3CS0A 1JOUB 1A3EH 4UDWH 5DGJA 5DP6A 1FIWA 2GZ8A 3A8BA 2FP7B 1FZZA 1T8LA 5A0BA 1FPHH 4K2YA 1CA8B 2THFB 2GZ9A 1DANH 4BAKB 1HRTH 4LOYH 1OOKB 2GDEH 2R0KA 1SGRE 1ZSJA 5FCRA 1SGQE 1ESAA 1UHBA 4DIHH 8GCHF 1B0EA 2Z9KA 3QK1A 2UUKB 4KGAA 1ZPCA 4Q7XA 5G4BA 5EW1H 1RIWC 1T4UH 3BG8A 3MH4A 2SGAA 1BB0B 7GCHF 1TWXB 2XCFA 1F5RA 4Y7BA 4Q80A 2H9EH 4WJG2 2F9OA 1O31A 2EEKA 2WPIS 1FXYA 3AAVA 2OUAA 3ZZ5A 1P8VC 1RGQA 3RM0H 2WYGA 1SHYA 1QHRB 3GY4A 3M7TA 5PTPA 4WF8A 4CH8B 1AB9B 2NU4E 1BBRK 5JBBS 2FESH 5DK1A 3F6UH 4ABHA 4FUFA 1KDQB 2VIPA 3SJOA 1KLJH 1F0TA 1GGDC 3BN9A 5LPEA 1HBTH 1GHWH 1YKTA 1ELGA 1MBMA 1A46H 1L0ZA 1JBUH 4ZXXH 1MU8B 2CN0H 1MTVA 1UVOA 4TWYA 4ABBA 4A1XA 5A0AE 1EZUC 3UQOA 4JYUH 1T8OA 4MPXA 3UQVA 4ZXYH 2A1DB 1Y3XA 3R0FA 1KXDA 2TIOA 2VIOA 3SORA 1C1TA 2ZHDA 1EASA 4MVNA 4K69A 2BY9X 3NWUA 2FX4A 1P2NA 1YCPH 1DUEA 4BXWA 4ZROA 1SSXA 3KHVA 4Q2KA 2FLBH 1AE5A 1MBQA 1OXGA 3ZZBA 3PB1E 2PKSB 4UEHH 3DA9B 4X6PA 1ESTA 1EKBB 2G55A 1QR3E 4OS7A 2BX3A 1W3CA 3TJNA 1CVWH 3BSQA 3MNBA 1ZYOA 2W7SA 4TPIZ 4D8NA 2PHBA 4Y0ZE 2AS9A 2ZQ2A 3A8AA 2H6MA 1THRH 3P8OA 2IN2A 1OSSA 2IJOB 2OBQA 1WOFA 1ZOMA 2FOBA 2OD3B 1CT0E 1O2YA 3E1XB 3U98H 1FONA 3RLYH 3LKWA 1VJ9U 3I78A 2ASUB 3AW1A 4YOIA 4A1TA 1TB6H 2ODYB 3T5FH 5FX6A 1XKAC 1GBJA 1QY6A 2OINA 1T8NA 3LIWA 1EOLA 4YTAA 2VWOA 1HAZB 1P2IA 1GMDG 1SQTA 4GUXA 1EAIA 4JZDH 4NZQA 3SNCA 5C3NA 1O38A 4R8TB 1LCYA 1XUJA 1O34A 1CGIE 1V2OT 1ZSLA 5EG4A 5EW2H 1ELCA 1P3CA 2SGEE 1SGCA 1SFIA 1L2EA 1UMAH 1QL8A 3SUGA 2JH0D 1O2KA 3PLBA 3KQDA 1C9PA 1CHOF 4KKDA 4NWKA 3SU1A 5C67A 1JIMA 2EA3A 2FTMA 4KTCA 1FY3A 4NA8A 1GVZA 2AERH 1Y59T 1GHYH 3UFAA 3KN2A 3NUMA 5FBEA 1YPEH 1YPHC 2WV4A 1H1BA 1CGJE 3MYWA 1EZXC 2OC7A 3N7OA 4D7FA 1O2OA 1NRRH 4AFSA 3A82A 1J9CH 3U8RH 1C5LH 4ABEA 3O8CA 3RXVA 1EB2A 3A85A 1GHXH 2BQ7B 3FP8E 3AAUA 1SB1H 5EPNA 1J14A 2K1QA 1ID5H 1AVGH 1QRZA 1RIWB 1GI1A 1O3EA 2ZDNA 4NCYA 2CMYA 3GDSA 4FUGA 3SJIA 4FVDA 2ZA5A 2Y81A 3RXJA 1TA2A 3QTVH 3H7TA 5J4QA 3ENSB 3SV9A 5I46H 2P93A 1BTHH 2WYJA 3QGNB 8ESTE 1UO6A 1DLKB 1PQAA 1TYNA 1OYTH 1WQSA 4TYDA 3GCTG 3U69H 4ABFA 4M7GA 1EQ9A 5F03A 4UE7H 2WUCA 2ANWA 3LOXA 4XOJA 4E06H 1OX1A 1GVKB 3OY5U 3ATMA 3KQEA 1ZGVA 3M61U 4WY3A 1KLTA 3A86A 4ZKNU 4XBBA 4FUHA 1BTYA 1TNHA 3HGPA 4NA7A 3RXBA 2AIQA 1HXEH 3M3VA 1O3CA 1YPLH 2O8WA 4IC5A 5SGAE 1C4U2 3MH7A 1AZZA 1K1IA 2PKAA 1O5BB 1AVXA 2PTCE 2Q6DA 1JRTA 1KXCA 3QGJA 1BMNH 1C2KA 1OWDA 4ZHAA 1XX9A 1ELTA 1O2XA 2D2DA 2F9PA 1MH0A 3F1SB 1QCPA 1UCYH 3ZZDA 1EJMA 1LVBA 1THSH 1D6WA 1UTLM 3RXRA 1K22H 5F8XA 3C1KA 3GCHC 2A4OA 1OP8A 4FU8A 4YT7H 2C8WB 3MOCA 1S81A 2KAIA 2ZFRH 3UIRA 3LT3A 4Y7AA 3E0PB 1QA7A 2UUJB 4H4FA 6ESTA 1CBWC 1ZRKA 2BD3A 1EAWA 4U01A 3VPKA 3DFLA 1D4PB 1EPTC 1JWTA 1UJ1A 1K1MA 2Q1JA 4WXVA 4OS6A 2BHGA 2ZHFH 1BTUA 4J2YB 1MQ6A 2RA3A 4MPVA 1ZJKA 1K21H 3URCA 1DM4B 4GVUA 1V2MT 5LPFA 4K3JA 1D3PB 1GJ4H 1BTXA 1O5EH 3HKJB 3K6YA 2BXTH 1ELDE 1LQEA 1P0SH 4HGCA 1TGNA 2H2ZA 1G36A 2C3SA 4FU7A 1P2JA 4IBLH 2P3UB 1SLUB 2VU8E 4A92A 4LZ4B 1OWIA 3U9AH 1LKAA 1QB6A 2C8XB 4B2CA 1NRSH 3ZVAA 1N8OC 2W3KA 3GY3A 1ZMJA 3QO6A 1H9HE 1RTLA 1PPGE 2YNAA 1OKXA 3IITA 1C5TA 2GCTC 1OS8A 1RRKA 4MLFB 3F68H 1O2QA 4I8LA 5I25A 4DJZB 2OC8A 2Z3DA 1INCA 1MCTA 2VIVA 3EAJA 3SV2H 2Y7XA 2RDLA 3RXCA 3SI4H 2GDDA 4Y79A 1XXDA 1CQQA 3URDA 1PPBH 1EP6A 1J15A 1GJ9B 1ZHRA 2BD5A 3QWCH 3SV7A 1O0DH 5ETXA 4JZ1A 1RD3B 3GICB 4I31A 4AG2A 1HXFH 1C2MA 5B6OA 1ETRH 3UWIA 3BTKE 5T3HA 1VZQH 1C5VA 1MKWK 1QJ1B 1NM6A 4JCNA 1C5ZB 3S7KB 1S0QA 1DXWA 3SNDA 3RXUA 4NIYA 5JB8S 2GT7A 2FDAA 3QDZB 4XSKU 1UTQA 1Z1IA 1ZR0A 4OS4A 2QGRA 1UK3A 4AB8A 3RXDA 2W5EA 4E7NA 4LXBH 1SGFA 1AFQC 2FI4E 3ZZ6A 2OC1A 2XTTB 3EA7A 1J8AA 1HAVA 5K7RA 1S85A 1W12U 4VGCC 2H9TH 1NRNH 2BD8A 2G4TA 2LPRA 1O32A 5A09A 2FOEA 3KGPA 4THNH 1BTWA 3IG6B 3KF2A 3PTBA 4KTUA 4KELA 3H7OA 3ZVFA 4F49A 1AQ7A 5TJXA 4CBOA 3QLPH 2GD4B 1G37A 3E0NB 1WSSH 2GCHG 3SV6A 2FODA 4BANB 4AB9A 1Y3YA 4ZUHA 4X6NA 2XWAA 2AMDA 1S84A 3ZV8A 5E0JA 5EQSA 2RA0A 1CHGA 1C2DA 4KTSA 4UFGH 2VJ1A 6GCHF 1LVOA 2PWXA 5AVDA 1C5RA 1KXAA 1HJAC 3A84A 2A45B 1T32A 2OLGA 3ZYDA 2BDIA 2P3FH 1HAOH 1C1QA 1GBBA 1O2SA 2HRVA 2UUFB 1SC8U 1DWBH 2Y5GA 1NFYA 1SFQB 1A0LA 3M5OA 1PQ5A 3GCHB 1C4V2 1J17T 2O8LA 5GDSH 1C5MD 1B5GH 1Y3UA 2BZ6H 4YOGA 1C2IA 3BTDE 2ZZUH 4ZH8A 1XUFA 2FOGA 4CRFA 4D9RA 2ZDKA 1CBWB 3VB7A 1HNEE 1P57B 3QUMP 2A31A 1EPTB 1GBDA 2V35A 1IQFA 2WPLS 3V12A 4YLQH 2HVXA 3PMHB 1LQDB 5A8XA 2BLVA 3GYLB 2VB0A 1WCZA 1GI3A 2GV6A 4GHTA 3B9FH 2AGIX 3GYMA 2OTVA 3NXPA 2WPHS 1THPB 5DP5A 5HM2A 1QBVH 1S83A 2BOHB 1IAUA 1Y3VA 1Z7KA 3F9GA 1NY22 2FLRH 2QYIA 2JETC 3SU4A 3V0XA 1O3KA 1LPGB 1PPCE 2Z6BD 2SGFE 2QIQA 1N8OB 3SHAH 1NRQH 1W14U 1AWFH 3BTHE 4FXGH 5FBIA 5GJ4B 1TPAE 2GCTB 3TNSA 1V2KT 2Z3CA 4D76A 1GI2A 3BTME 2FOCA 1S82A 4MDSA 4Z6AH 4UFEH 1G2LA 1H9LB 2QXGA 1MD7A 5AHGH 3RC5A 4KP0A 1GI4A 3MFJA 1G3CA 1Z71A 1O2LA 4K1TA 4QT8C 3VEQB 1B7XB 2PSYA 2ZGBH 4YM9A 1LMWB 3RXTA 4YZUA 4A1VA 3L33A 3RXKA 2NU2E 2AYWA 2CHAC 2UWPA 2BVSH 1BQYA 2J4IA 2ZTYA 4JK6A 2W3IA 3GY5A 4ISHH 5TCAA 3MO6A 4MNYA 5IDKA 4IN2A 1TGSZ 3UNRA 1GBEA 1YBWA 4CR5A 1O3GA 2BD4A 1Q2WA 4I8KA 3RDZA 5HYOA 1GHAF 1L4DA 1BOQA 1GBKA 2ZU4A 3SU6A 1C1OA 1KTTB 1DICA 1ZMNA 1NESE 2PW8H 2OBOA 4MPUA 2Z9GA 1NS3A 3MO3A 2Q6FA 3PMBB 4DURA 4R0IA 5L2ZH 1UTOA 1AFQB 1TRMA 3MU5A 1ZHPA 4ASHA 3PV4A 1GBHA 3NCLA 1O2IA 1O3PB 2ZDMA 1HAPH 4VGCB 5E0HA 1F0SA 3TGIE 4HTCH 1YLCA 3SU5A 3MU4A 5HXFA 3ESTA 3LGUA 3D62A 3PM3A 4IMZA 2I6QA 1MCVA 5L6NH 2SGQE 1B0FA 2NU3E 4X8SH 1TPOA 1GJBB 1BA8B 3GY2A 5T6DA 3RXAA 8KME2 3E8LA 1FV9A 2FOFA 3PWBA 1WU1A 5TCCA 3S9BA 4FUDA 3ODFA 3LC3A 2J94A 3UOPA 1BDAA 3ZVBA 4ZKOU 1VR1H 1TRNA 1TOMH 3S9AA 4BXSA 1NZQH 4BNRA 2ZDAH 2A5IA 1TMBH 1TBQH 1OP0A 1AUTC 3ATKA 1MTUA 1RS0A 5GXPA 1GJ6A 1HJAB 2WINI 2GKVE 1YF4A 1A0JA 3A83A 5GPIB 1O3BA 2B5TB 3LPRA 1SGNE 1IOEA 1O3MA 4DGJA 1O2NA 3RMMH 1GI9B 1ZTJA 1GCTC 1HIAB 1UCYE 2GV7A 2CV3A 2GZ7A 2J92A 4AYVB 1FY8E 7GCHG 2Y80A 2A2QH 2ODQA 3RMOH 1M9UA 1P2QA 1AU8A 1TNIA 1FIZA 4GSOA 5DP8A 1A5HA 2XBXA 4ZAEA 4XE4A 1HAGE 4AFZA 3TJUA 2ZCHP 2ZFQH 3A89A 3ELAH 4I33A 1SGIB 3S0NA 2BD2A 2G00A 1KDQA 1W7GH 1K1OA 1OWHA 3Q3KA 2CGAA 3M7QA 4OS2A 2EI8A 3IWMA 1N6XA 3SJ8A 3TPIZ 5A8YA 2ZTXA 1TQ7B 5FPYA 3VXFH 2Y5FA 2AFQB 3SI3H 2Y5HA 1WUNH 3GCNA 2H5CA 4A6LA 4U2WA 1AKSB 3ZYEA 1O5AB 2TGTA 1H9IE 3RU4D 1F0RA 2JETB 1O2RA 3RXEA 3MTYA 2ZFPH 3A7ZA 2ANMH 1CA0C 1TX7A 1LPZB 1O2VA 2VWMA 1P12E 1V2WT 3F9HA 3ZVEA 3NK8A 1GBCA 1SLXB 2ZFSA 1FUJA 1TIOA 2ZEBA 3LGYA 2FOHA 1HB0B 1O36A 4UD9H 3VXEH 1O5FH 3BTWE 4JMYA 3A87A 5E0GA 1OWKA 2A5KA 5A8ZA 3TGJE 5JBTA 2DE8A 1A4WH 1O2WA 2VH6A 2Y6TA 3MU0A 1TABE 1F92A 1Y3WA 1DS2E 1O39A 1YM0A 4ESTE 1IQHA 1ELEE 1KY9A 1GMDF 3SU3A 2CHAB 1E37B 1XUKA 1GPZA 3RM2H 1HUTH 1PPEE 3LH1A 4JZFH 4NFFA 3MH6A 3EE0B 3ZVCA 1D3DB 3M35A 2XCNA 1D6RA 1O3AA 1TALA 2GT8A 2ZQ1A 5JYIA 2DE9A 1C4Y2 1YPGH 4BAOB 1A5GH 4H42U 4ISOA 2A7HA 4YESB 1EAXA 3PWCA 1AMHA 3CENA 5EPYA 2HALA 1HFDA 3AVZA 1DWDH 1K1JA 1Q3XA 4WH8A 1IQNA 1GDNA 2PTNA 1FN6A 3BTTE 3EGKH 4YO9A 5JDUB 3AW0A 3BF6H