4GAWA

Crystal structure of active human granzyme h
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
226
structure length
224
Chain Sequence
IIGGHEAKPHSRPYMAFVQFLQERKRCGGILVRKDFVLTAAHCQGSSINVTLGAHNIKEQERTQQFIPVKRPIPHPAYNPKNFSNDIMLLQLERKAKWTTAVRPLRLPSSKAQVKPGQLCSVAGWGYVSMSTLATTLQEVLLTVQKDCQCERLFHGNYSRATEICVGDPKKTQTGFKGDSGGPLVCKDVAQGILSYGNKKGTPPGVYIKVSHFLPWIKRTMKRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Granzyme H
publication title Identification of SERPINB1 as a physiological inhibitor of human granzyme H
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 36
structure length 224
sequence length 226
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature ec 3.4.21.-:
pdb deposition date 2012-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4gawA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4gawA02
1MTNC 3MO6A 5DP6A 1LHFH 2G5NA 4CRDA 2TPIZ 2FX4A 1FY3A 4JZDH 2XWAA 2H9HA 4IMQA 2GV7A 1BMMH 1WTGH 4PROA 1DSTA 1GG6C 1NRPH 2ZGJA 1D9IA 4D8NA 1EQ9A 1MMJN 2O8WA 2VIOA 1K1OA 1XMNB 2XWBI 5E0GA 1TMBH 2GD4B 2PKSC 2J38A 1V2VT 1HBTH 4XFQA 2CHAB 1ELTA 4D7GA 4D9RA 1NPMA 1TIOA 3ZVDA 2ZPSA 2XTTB 3SU1A 1OWJA 2V6NA 2VJ1A 1A5IA 3OSYA 1AE8H 5PTPA 1TB6H 2BHGA 1YCPK 1W8BH 3QGNB 2J94A 5EGMA 1FQ3A 3FFGA 3Q77A 4MPUA 4CHAC 1OYQA 3BEUA 2ZEBA 4UONA 3VB7A 3URCA 3U8OH 3SV6A 2GDEH 3RC6A 1SFIA 2EC9H 2A31A 1U6QA 1TBQH 4X6OA 1ZSKA 2JKHA 4X1PU 3OY6U 2XC4A 1AFQB 1FIZA 2P3FH 1GBBA 1C4Y2 1C5PA 4MNVA 1K22H 4FUEA 1G9IE 3BTGE 4AFSA 4Q7XA 5HM9A 1NO9H 1MQ5A 1P04A 3NK8A 1S6FA 1KLJH 3CS0A 1AVXA 4JYVH 3RU4E 2H5DA 1DPOA 3T62A 2EEKA 1HGTH 2B5TB 2JETC 2ZU5A 4Q2KA 4YT7H 3LKWA 3STIA 1O2XA 1DANH 4ZKSU 1M9UA 3SOSA 2ZGHA 1EJMA 2AIQA 3T29A 2ZF0H 1C2JA 1HAIH 1YBWA 1Z8GA 2PTCE 1QRWA 4A5TS 2VWNA 1V2LT 5EG4A 2BQWB 1UVUH 4NSYA 1UTKA 1E34B 1LPGB 5JYIA 4AGJA 2C3SA 2IJOB 4FU9A 3NCLA 1RRKA 3LPRA 1OP2A 2FS9A 3E1XB 3IITA 3VFEA 2QGRA 2FX6A 3QK1A 3PM3A 4K5ZA 3DT0H 1LVYA 1KTSB 2H1UA 3ZYEA 5AF9H 3QTOH 2BXUH 5DKMA 3PMJA 5L30H 3R0FA 5FHTA 1MH0A 2GCHG 2ZHFH 4YT6H 4YTAA 4K3JA 1VJ9U 4E06H 1B0EA 1ZGVA 3HK3B 5E0HA 3PMHB 3EE0B 1P03A 2YNAA 4U32A 1GL1A 4B2AA 1FUJA 3A8AA 3HATH 1HIAB 4AFUA 2FOMB 2PGQB 1YCPH 2QY0B 3DA9B 2BYAX 3DUXH 1NRNH 1VGCB 1DLKB 1XUGA 2TGDA 4IC5A 2ODPA 4SGAE 2RA0A 1QRXA 5GJ4B 4AZ2B 8LPRA 1A0JA 3M3SA 4KKDA 1UJ1A 1SHHB 2ESTE 1XUIA 3TLOA 5K7RA 1BTHH 3LT3A 1UVSH 2PUQH 1P2OA 1BBRK 3SGBE 2GTBA 4ISLA 1K1MA 2GX4A 3RXGA 4MQAA 1NRSH 2BD3A 1PFXC 2AMPA 2ZFQH 2Y81A 2A45B 1NM6A 4WMFA 3RMNH 3ESTA 1O32A 1TALA 1PPFE 1P05A 4LK4A 1J8AA 2G4TA 2V3OH 2A7JA 2Z7FE 3M5OA 2Y82A 1PQ8A 2F9VA 3EYDA 2I6SA 4I8KA 2J92A 1E35B 4Y76A 4A7IB 2TGAA 1YP9A 1GBCA 2GMTB 1XVOA 1HAVB 1GI7B 2ODYB 5GCHG 3TH2H 2F9BH 4XDEA 2Z9GA 4ZKOU 2TBSA 1ZJKA 2FXRA 4O97A 4CBOA 3RXQA 4X1RU 1Y8TA 3MH7A 1AWHB 2FOAA 4NA8A 5LH8A 3S7HB 4Y6DA 3O8CA 4AB9A 3A86A 4R0IA 3M3VA 1O2UA 3MOCA 1NESE 1K1IA 4ZHMU 1UCYE 5HGGA 3SV2H 1AFEH 4IW4E 2C8YB 2ZDAH 3B8JA 1TX7A 3RXAA 1KXDA 4MPVA 4DG4A 2Z94A 1G36A 4FUGA 3RP2A 1MUEB 4IC6A 3GCOA 3ZVAA 2STAE 1FIWA 2ZZUH 1ZTLA 1HJ8A 2A5IA 3RXIA 3UY9A 1QBVH 1O3HA 3VB3A 3ZYDA 3W94A 1O2IA 5A8YA 1YPLH 5LGOA 4Y7AA 1OKXA 1K1NA 6LPRA 3RXKA 5FX6A 1CHOF 2C90B 1IQFA 1T4VH 3RXJA 1DUAA 2OD3B 3IWMA 3E0PB 1GCTB 1GPZA 4GAWA 3MH5A 1MKWK 1ZZZA 2AEIH 1AU8A 5EW1H 1BBRH 2HRVA 2WPKS 2G5VA 2G51A 4ZUHA 3F9EA 3MU0A 3FANA 3EA7A 5HM2A 4UEHH 1WUNH 2QIQA 2SGDE 4ZHLU 2DE9A 4K1SA 3HK6B 2AYWA 3VB6A 3RU4T 1K21H 5EQSA 3KIDU 2ULLA 4RKJB 2J4IA 1O5CB 3HGPA 2Z6BD 1GJ4H 1Y3XA 4CRGA 1VITH 2GCTC 3VB4A 1AUTC 2B8OH 2VIPA 5L6NH 1XXFA 4MNWA 1CQQA 1SC8U 5TJXA 8ESTE 1A0LA 4MLFB 3SUEA 2VIVA 1C1UH 1ELCA 2Z9IA 1LHCH 4NCYA 4TY6A 5J4QA 1T32A 1WU1A 5CMXH 4FUBA 1EOLA 4U01A 2CF9H 2BD4A 2FI4E 1QL7A 3RXBA 1J14A 4OS1A 2F83A 3U69H 3DFLA 2FLBH 2VH0A 3RC5A 4B76A 1AQ7A 1H9IE 1SGDE 1GBHA 2BXTH 3QZQA 1TLDA 5DP3A 2OQUA 3NPSA 1V2ST 4GPGA 3AAVA 1EZSC 3LU9B 1C5WB 1GDUA 3V13A 2XXLA 1V2UT 1AVWA 3MH4A 1O2GH 1UK2A 2ZHEH 1LVBA 2OC1A 1F0RA 4E7RG 3L33A 1OP0A 1G2LA 2RDLA 1CE5A 4MG3A 2AGIX 2WPLS 3SV9A 1GJ7B 2HPPH 3S9AA 1UVTH 4X6MA 2P94A 1BTYA 3QUMP 4OGXA 1FI8A 3RXPA 1HNEE 1OP8A 1QB6A 1AB9B 2FOHA 2BMGB 1UTMA 3U1IB 4ZXYH 2EI6A 1J15A 2OC7A 1HLTH 1DXPA 1SGRE 1MCTA 4FUHA 1YPEH 2BD7A 3BG4B 1MKWH 1ZGIA 1PPGE 2GDDA 1K28D 2A4OA 3VEQB 2ODQA 1EAIA 2A7HA 2AMQA 1EJAA 1A3EH 3V3MA 2C8XB 1NS3A 1CT0E 1O2OA 1SGEE 2OC8A 1C5RA 1KXEA 1LCYA 1F2SE 4KELA 1OSSA 2YOLA 4RSPA 2LPRA 4O3UA 1LMWB 1FY8E 3LGVA 2H9TH 1LQDB 1QIXB 3RXUA 2B9LA 5F8ZA 1QURH 2ZDLA 2NWNA 1QBOA 4CR9A 2R2MB 1ZTJA 2WPHS 1CGHA 3SU2A 1B0FA 1BIOA 3FZZA 4B71A 1FV9A 2ZGXH 3MYWA 4FVBA 3EA8A 3SV7A 2IPHA 3F9GA 5C3NA 1Q31A 1UTJA 2XYAA 5AFYH 3KNXA 3TPIZ 2FO9A 1SGFG 1ZOMA 1SMFE 3PO1C 1UCYH 3DHKH 1C2KA 1ELEE 2VWLA 1ARCA 3PWBA 1EPTC 4NGAH 1TQ7B 1N8OC 1E38B 2FODA 2AS9A 2FYQA 1BTXA 4GCHF 3T27A 2ZQ2A 3PTBA 4O3TA 1SB1H 4OS6A 1S83A 1HJAB 1QJ1B 1EKBB 4D76A 2H6MA 2ZU4A 4FVDA 3F9HA 4GHTA 2TRMA 2F91A 1O3FA 4X2YA 2LNCA 3RMMH 4YO9A 5GPIB 1Z8JB 2XC0A 3HGNA 2GCHF 4AFZA 4AN7A 3T25A 1K9OE 1HAPH 1AIXH 1XX9A 1GJDB 1ZRKA 3OYPA 1TX6A 4IN1A 1PQ5A 3A8BA 1EATA 4YLUA 1SGIB 2R9PA 1BDAA 1GMHG 2C8ZB 1ORFA 1AHTH 1EJNA 3F6UH 1Z6EA 1A2CH 1Z1JA 9LPRA 1HAGE 1GGDB 2CF8H 2CJIA 1DWEH 2I6QA 3K9XB 2Z3EA 3KCGH 1XUHA 1C1OA 1DWBH 1OWEA 3ZV8A 1F0UA 4Z0KA 7LPRA 2B0FA 1QA7A 4X8UH 1D3QB 3ODFA 1TRYA 2ZP0H 1WBGB 1ELBA 3A81A 3M5MA 5BRRE 1TMUH 2BLQA 4F4OC 4MNXA 4Q7ZA 2BX4A 4B2CA 3P8FA 1P02A 4E7NA 1SL3A 1EPTA 2OP9A 3JZ1B 1IQEA 4X2VA 3SUFA 3QN7A 2EI7A 1Y3WA 2HVXA 2BDHA 2FOCA 5JBAS 1YPHC 1OPHB 4LXBH 1H9HE 1XKBC 6CHAC 1HAZB 1C5LH 1GMDG 3PTNA 2M5TA 4NZQA 1CHOG 2V35A 3RU4D 3L6PA 3PMAB 1G32B 1O2JA 1O3IA 3ZVCA 3ATWA 3TK6A 2FPZA 4ZAEA 2OLGA 1O35A 3M7TA 3G01A 2G81E 1TE0A 3SNAA 5EXLA 1VITF 2A0QB 1OWDA 5DG6A 4TPIZ 2ZG0H 2BOKA 3MI4A 2ILNA 2FIRH 3PMBB 1Q3XA 1KTTB 1ZLRA 1BHXB 2Y5GA 1MU6B 3ATIA 3F68H 1D4PB 1EXFA 4NIWA 3Q00A 1ZMLA 1C5VA 1DSUA 1Y3VA 3LC3A 4WH6A 3SNCA 1O5GH 5I25A 1YPHE 1BHXF 1OX1A 5AVDA 1V6DA 2G55A 1TA6A 3SJKA 5LPFA 3DFJA 4ISNA 4Z6AH 1P2QA 3ZZ5A 1DDJA 5L2ZH 1VJAU 5T6DA 1DOJA 2PLXA 4JZIA 4MPXA 1P10A 3LGTA 1MZDA 5I46H 3T28A 1RIWB 4CRFA 3NWUA 1BTZA 3STJA 4INHA 1C1SA 2UUJB 1YPJH 2VH6A 1AMHA 1CT4E 6ESTA 1HAOH 1IQMA 3ZZ7A 1SR5C 2QXIA 4QT8C 1ZJDA 1JOUB 1MAXA 1TOCB 4VGCB 1ZPBA 3BSQA 2H2ZA 3JZ2B 3RXSA 1CHGA 2VVUA 1SGQE 1O3JA 3ENSB 1ZMJA 4KTSA 1UTOA 3LGUA 3QGJA 3VGCB 1LKAA 3GCNA 2EA3A 2ZHWH 1A7SA 2GV6A 3D23A 2OQ5A 2PHBA 4H6TA 3TJVA 1V2TT 1QCPA 3VPKA 3ZZCA 1LPZB 2XC5A 1BQYA 1P0SH 2GZ8A 3UOPA 1O3EA 3PROA 1EB1H 2CMYA 2O8TA 3C1KA 1K2I1 3IG6B 2PWXA 3U98H 1BJVA 4ZROA 4CRAA 1EP6A 2RCEA 3ZZ9A 2BD9A 5ETXA 1MBMA 1QJ7B 5GWZA 2UUFB 3K65B 3SN8A 1G30B 2ZDKA 3SU0A 1TNHA 2CXVA 1C1TA 1SLXB 1L1GA 1WTHD 2ZC9H 4GSOA 3TK9A 3AW0A 2FZZA 2BD2A 3SUDA 5FAHA 1SQOA 1GMCG 2QAAA 4HI3A 1A5GH 1BA8B 3SJ8A 1QA0A 1W13U 6GCHF 3SJ9A 4A1VA 1LHEH 1TBRH 1CA0C 2PSYA 2ZTXA 3BF6H 3SGQE 2VIQA 5EQQA 5EODA 1UMAH 1W7GH 4H6SB 1IQLA 2VVVA 1WQVH 1LHDH 1GI2A 5C1YA 1NU9A 1P11E 1VCQA 5CE1A 5JBTA 3S0NA 1KDQA 2BTCE 1KLTA 3Q3XA 1AD8H 1Z6JH 1LVOA 1O5AB 2BDBA 2BZ6H 2CV3A 1BBRE 2P95A 4X1NU 2NU2E 2D2DA 3SUGA 1FY1A 3E90B 2JH6D 2Y7ZA 1O3AA 3PLBA 2W7SA 4CRCA 5DO4H 1ELFA 3A88A 2NU0E 4AYVB 3SI4H 1Y5UT 4GCHG 2FMJA 2KAIA 1D6RA 1THPB 2BM2A 1W10U 5FBIA 4IS5A 1O3DA 1GBMA 3SU4A 2ZPRA 2ANKH 5FPSA 2OUAA 3TJUA 4X8SH 2FTLE 4WMDA 2VNTA 3E91A 3MNXA 4AB8A 5A2MH 1NU7B 2XBYA 3D62A 1TNGA 3MNSA 4JZFH 5JB8S 5A0CA 1VCPA 2B7DH 1ETRH 1O2SA 1BTWA 1XKAC 2C8WB 1UHBA 3MHWU 1SLWB 3S9BA 1T8OA 2ZA5A 1BOQA 1ETSH 3BTFE 2PW8H 3OX7U 4KTCA 4Y8XA 5A8XA 1UK4A 1ID5H 2EI8A 4Y8ZA 3TVJB 4K60A 5EXNA 1SBWA 2VGCB 2Y5HA 5F03A 3LIWA 4ZH8A 1WQSA 1ARBA 3RDZA 1WOFA 3TJOA 1SPJA 3ZZDA 3ELAH 1PPCE 4GVUA 2GKVE 1QB1A 1IQIA 2WUCA 3BTHE 4DT7B 1O34A 3P6ZB 4ABHA 4BTUB 2PSXA 1HRTH 1T8NA 5DP8A 2VWOA 3BTDE 3TH4H 2QA9E 4YLQH 3B9FH 1EUFA 1GI8B 2GGVB 3E8LA 3A87A 3O8DA 1GBFA 3M5NA 1A1RA 3E3TA 5DP5A 3H7TA 5DP4A 4X2XA 4DW2U 2CHAC 1ZHRA 2DUCA 2FESH 2BLOA 1GJ8B 2J2UA 1SLVB 1EOJA 1F7ZA 4Y79A 1YCPM 1AN1E 4CH2B 3RXOA 3UTUH 7ESTE 2OBQA 4NIXA 1PPZA 2OBOA 4XOJA 3AW1A 2ASUB 5A09A 1MCVA 1CBWB 1VITG 2XNIA 1S81A 2P16A 2BY5X 1GMHF 1C2GA 2PUXB 1C9PA 3LGWA 1QQUA 4U30A 3BIUH 3LOXA 1AFQC 3GCHB 3RXVA 1DWCH 3T26A 2ANYA 3S7KB 2O9QA 1O3LA 5C2ZA 1H1BA 4ISOA 1C2IA 1E0FD 2PGBB 1Q2WA 1S0RA 1KXBA 2ANWA 4RN6A 1ZRBA 1QBNA 3M7QA 3NZIA 1YYY1 3A7VA 1AKSB 1W14U 3MNCA 4NA7A 1O2VA 4A1TA 3K2UA 2OC0A 3A83A 1O36A 4NA9H 1C2FA 3MU8A 5A8ZA 1W0ZU 4FU8A 1OWKA 1P2MA 1YPMH 2R0LA 3MMGA 5SGAE 2R3UA 1MAYA 1ZSLA 1P57B 2PR3A 1GI4A 4K8YA 1MTUA 3RMLH 1ZTKA 1WCZA 1OS8A 1GJ5H 2H5CA 3BTQE 3GYLB 5EQRA 5F6MA 1FDPA 3GDSA 1O38A 2Z9LA 1TGTA 5EPYA 1PYTC 1XM1A 3KF2A 1GMDF 5FPTA 4NWLA 3HPTB 3SU3A 1C1MA 3GY6A 2AGEX 4I8GA 3AASA 2PV9B 1IQGA 4ABJA 1DM4B 4JMYA 3M35A 1V2RT 1P12E 5EW2H 3EAJA 3RXHA 4DURA 3RXRA 1O3MA 4XE4A 1JRTA 2W5EA 3P8GA 1JRSA 2QYIA 4WWYA 1T8MA 5AFZH 3TH3H 3KQBA 3UR6A 1AZ8A 3FP7E 4ABAA 1AGJA 3URDA 1O3BA 2A2QH 2FOGA 1HDTH 3EA9A 3H5CB 4Y8YA 3A7XA 1NTPA 2FOBA 3HKIB 3E16B 4XBBA 4DY7B 2QXJA 1PQ7A 7GCHG 1W0YH 1YGCH 4X1SU 1L2EA 1QB9A 1VGCC 3I77A 3KQEA 2ZTYA 2PKAB 3UUZA 1GHWH 6GCHG 3GY7A 2Z3DA 1RGQA 4HTCH 3ITIA 1E37B 1LPKB 2PTNA 3RM0H 1V2MT 1BRUP 3KN2A 4BAKB 3N7OA 1O2LA 1IOEA 1BJUA 4I32A 1EZXC 1V2PT 1OWHA 2W7UA 3LDXH 1ZHPA 1VR1H 5E8EH 3SHCH 1VZQH 4JK6A 3P95A 3RXMA 4B74A 1VCWA 2SGEE 3V0XA 2FDAA 2HNTF 2ZU3A 2A4GA 1PPHE 4INLA 5CHAB 1EZUC 1CO7E 1O2MA 1PJPA 2YNBA 1HV7A 1TWXB 2NU4E 1JIMA 1F5KU 1XVMA 4DJZB 5JB9S 1UTLM 2Q1JA 4OS5A 1TGCA 1O2WA 1GBTA 1WSSH 1C1NA 3QTVH 4AYYB 5DP7A 4JZEH 2ZDVH 2P8OB 2Y6TA 4CREA 1JWTA 1TYNA 2GMTC 3LGIA 1MTWA 2AERH 2BVXH 4WH8A 3PLKA 1B7XB 1GVLA 1HIAA 3I29A 3SW2B 1ANEA 1MKXK 4KP0A 2UUKB 4UFEH 5TCCA 3SZNA 2Z9KA 2FM2A 1GMCF 1CVWH 4BNRA 2OTVA 3DD2H 2ALPA 2P93A 3A84A 1Y5AT 2ZI2H 4Y0ZE 3ZVEA 4JYUH 2ZQ1A 3TGKE 1ELAA 2WV5A 3CP7A 3NUMA 3OY5U 2QCYA 4M7GA 1AZZA 1WV7H 3A82A 1AWFH 1DLEA 1K1JA 1IQNA 3FVFB 4WXVA 1O33A 2Q6FA 3P92A 4BAMB 1GCTC 4AOQA 1V2OT 5K0HA 3ATMA 4IMZA 4WJG2 4BOHA 1FAKH 3K6ZA 1ETTH 1F5LA 1BCUH 1G3EA 1YM0A 2V0BA 3O8BA 4IN2A 4XSKU 3PB1E 1K1LA 1ABIH 1DVAH 1FAXA 2SGQE 2BVSH 4TYDA 1ELDE 4WXIA 1O0DH 5AHGH 3TITA 4A1XA 1HAVA 1Z8IB 1GDNA 2A32A 1QQ4A 3BTKE 1EASA 1C2HA 1BUIA 3FP6E 1F92A 5HMAA 1C1RA 2WINI 3T5FH 1NFWA 4I8JA 3QX5H 1SFQB 4YZUA 1F5RA 1F0SA 4BXSA 1RFNA 3MU5A 1L1NA 1GBKA 1TQ0B 3KHVA 4E05H 1T31A 1MTNB 4XBCA 2BDGA 2BDYA 1H4WA 3RC4A 1GJAB 2ZU2A 3KQCA 5C5OA 1GHXH 3MO9A 1B5GH 2ZFFH 1W7XH 3QDZB 2Y5FA 1GG6B 1FPCH 1S6HA 1AO5A 5G4BA 2FOFA 1QFKH 3GCTF 4TY7A 3P17H 4ABEA 4LZ1H 4D7FA 1MKXH 3SJOA 2ANMH 3SGAE 4HGCA 5T6GA 4A6LA 2BD5A 2PKSB 2GVFA 3GISB 1S82A 2F9OA 3HKJB 1LQEA 3P8OA 3TU7H 4HFPB 1THRH 1D6WA 2W26A 3ATLA 1N6XA 4BANB 1IAUA 3PV4A 1IQHA 2ZHQH 4CHAB 1FZZA 3BTME 4IGDA 3UR9A 1HAYB 3LC5A 1A3BH 2QF0A 5TCAA 1C5SA 5JPMH 4MNYA 4BAOB 1GL0E 3GY2A 1MD8A 4HZHA 3RXFA 2G8TA 2HOBA 2R2WU 3RXTA 1C5OH 1NFYA 2IOTA 5A0AE 3BEFB 3LJJA 4ZMAH 1AB9C 1EX3A 1SGYE 1T4UH 4NZLA 2CGAA 8GCHG 4O03A 4Y0YE 1HAXB 1A61H 1DY9A 3M36A 1O2HA 2SGPE 3A80A 1BRCE 2ZFSA 1L4DA 2BY7X 4A92A 1ZPZA 3D49H 3BG4C 1BMNH 5EOKA 2JETB 1DY8A 1X7AC 3RXDA 1BT7A 1SOTA 2A5AA 1NT1A 1ELVA 4K69A 1GDQA 1C1WH 1QGFA 3I78A 4D9QA 3A7ZA 5EPNA 3MWIU 2BDAA 1TNKA 4B1TA 3U8RH 1H9LB 1BRBE 1V2JT 5T6FA 1ZHMA 3NKKA 3U1JB 1HUTH 2FP7B 3UQVA 4MDSA 1O2PA 3ZZ6A 3ZV9A 2Q6DA 1GHAG 1NC6A 5ESTE 1SLUB 2ZWLH 5IYTA 1MBQA 1C5XB 1DUEA 1S84A 2ZO3H 5H4IB 1RJXB 3SU5A 3UNSA 1Y5BT 5DK1A 5E2PA 1T7CA 3GY4A 3MU4A 1J9CH 3SQHE 1YKTA 4X8VH 3ZZAA 3M7UA 3UQOA 2GZ7A 4DIHH 3TK5A 1KXFA 5LPEA 4X1QU 3A7YA 1ANCA 4ZKRU 4WF8A 3U9AH 1PPBH 4MVNA 1GJCB 1FY5A 4B73A 2W3KA 3OU0A 1GCDA 1MTVA 2FI3E 1QL9A 1SOZA 1THSH 1TPPA 3LJOA 2QN5T 1PPEE 1HJ9A 2WV4A 4ISHH 4GHQA 3U8TH 4UFDH 2HWLB 3A89A 1IQJA 2BB4A 2BDIA 2XRCA 3A7TA 4I8HA 1LTOA 1NFXA 3M61U 1TGBA 3V7TA 1C2EA 1QRZA 1W12U 4I8LA 1LVMA 2BLWA 3F9FA 3A7WA 3VXFH 4UDWH 1O5EH 1GGDC 1Y3UA 3SJIA 3D65E 2IN2A 2J34A 3K6YA 7GCHF 3T2NA 3MU1A 1LDTT 3TNSA 1SI5H 4LOYH 1DITH 3LH1A 5HXFA 1NRQH 1EZQA 4X8TH 3ZVGA 3TGIE 3GYMA 2FWWA 1K1PA 1YLDA 2BY8X 1HB0B 4AG2A 1XUKA 3RXLA 2WPMS 2D1JA 4X6PA 3RXEA 4AORA 3UWJH 4JZ1A 2P59A 5DGJA 4NG9H 2WYGA 2Q6GA 1TGSZ 1ESBA 1EP5A 1MU8B 1KLIH 4JYTA 1LO6A 1YPKH 1J16A 1KYNA 4FUFA 4NFEA 1XXDA 3FP8E 1SG8B 1W11U 1C5YB 1Z71A 1DICA 3QO6A 4Y7BA 4UE7H 1ZYOA 4DVAU 1TPAE 2FTMA 2BOHB 1GVZA 1H8DH 3OTJE 1TBZH 1ZR0A 5T3HA 4Y71A 2O8LA 1TNLA 2VIDA 4BAHB 1SVPA 2QXGA 1P01A 2VU8E 3C27B 2G4UA 4INKA 3SNBA 3SI3H 1UK3A 4H42U 1QHRB 1T8LA 4CBNA 1RTLA 2NU3E 2TIOA 2FI5E 3RLWH 3AVZA 3S69A 1RD3B 1TGNA 1O39A 4RKOB 4FUDA 1NROH 4Q7YA 1HFDA 3BTEE 1A46H 1EAWA 3QWCH 1C4V2 4UFGH 3P8NA 4ABGA 5LPRA 1BMLA 1RIWC 2SGAA 2ZCHP 1C2LA 1TRNA 3QZRA 2FEQH 2AFQB 3A85A 1SQTA 3GY8A 3GCTG 5IDKA 1GI9B 1GHZA 1P2KA 2VINA 5JBBS 1DFPA 2TGTA 5E0JA 3ZZBA 1O2YA 4ABFA 2VIWA 1P2JA 4VGCC 2A2XH 2C4FH 1NY22 1KIGH 3SBKA 1GBLA 3PWCA 1UTPA 2OINA 1IHTH 3VGCC 3SORA 1G3DA 4ABDA 2XBXA 2F9NA 1TX8A 1PYTD 1SGPE 2AGGX 2Z3CA 3QLPH 2AIPA 4OS7A 5C67A 1W3CA 2UWPA 2GCTB 2XBWA 3MH6A 1O3KA 2PFEA 2RG3A 2ZGBH 1L1JA 2FLRH 2XCFA 1TNIA 2Y7XA 4K1TA 1LHGH 2J9NA 2ZCKP 4Q80A 2ZIQH 1O2KA 3SNDA 1SGCA 1SQAA 1YLCA 4KGAA 1C1QA 2FOEA 4YESB 1GI3A 1IQKA 1SGNE 1RS0A 4FUJA 1BZXE 1D3TB 1DXWA 3S9CA 5DJ7A 4LZ4B 2NU1E 4NSVA 5EU8A 5A0BA 3UFAA 1UVOA 5JBCS 4K8BA 2JH0D 1ESTA 2ZKSA 2F9PA 2BY6X 2SGFE 1G3CA 5GXPA 1DWDH 2FYRA 3RMOH 1GBEA 4CRBA 1HCGA 1GHBF 3LONA 1OOKB 5GDSH 1GI6A 5JDUB 2AH4X 1ACBE 3RXCA 3ZVFA 1BB0B 3SV8A 1O5BB 4YOJA 5EXMA 1C5TA 1EAXA 3PLPA 4BTIB 4TWYA 2ZNKH 1AUJA 3R3GB 1ELGA 1O5FH 1NZQH 2QF3A 4THNH 3AAUA 3MTYA 4ZKNU 1TPOA 1HXFH 4Y10E 3SO3A 1JIRA 1AY6H 1KY9A 1XUFA 3P70B 4TWWA 1Z8RA 5C1UA 2WPIS 4K2YA 1UTQA 5J4SA 1QTFA 8GCHF 3UNRA 1HYLA 1IHSH 1DS2E 1CU1A 1FPHH 4X0WU 1GBAA 3GOVB 1LKBA 1RTKA 2GP9B 2SNVA 2ZU1A 3MNBA 5DPAA 3SU6A 3UNQA 1GWAA 3KL6A 4YOGA 3PO1B 2BQ6B 3EDXB 4ASHA 4KTUA 1EPTB 2VGCC 2XBVA 1N8OB 1WAYB 4R8TB 2BX3A 4ISIH 5FPYA 1GHAF 2K1QA 4U2WA 1P2NA 1HAHH 5GIBA 1CSOE 2SNWA 2ZFTA 2W3IA 1PQAA 3EGKH 1Y3YA 3WY8A 1E36B 1L0ZA 1O30A 4DCDA 3Q3YA 4I31A 4BTTB 4CH8B 1C5ZB 4AGKA 3KEEA 2BLVA 1S85A 3TNTA 2XCNA 1ESAA 1C1PA 3BIVH 1UCYK 2O8MA 4JCNA 1GHVH 1ZSJA 2QC2A 3UREA 4GLYA 2ALVA 4ZXXH 2VB0A 5ABWA 1F0TA 3GICB 4I33A 4O9VA 3F1SB 1NN6A 4NFFA 1BTPA 1O5DH 3A8DA 1CBWC 2THFB 1V2NT 1BRAA 1EAUA 1GBIA 1QY6A 4XBDA 9ESTA 4NWKA 1FMGA 5FCKA 1AE5A 3MFJA 3GCHC 3B23B 4FUCA 1C5MD 3M37A 3KGPA 2VVCA 2QXHA 2BVRH 3UPEA 5HYOA 3PYHA 1ABJH 1G37A 1FLEE 1C1VH 1INCA 2RA3A 1GI5A 3CENA 2ZECA 3BEIB 2H9EH 2HPQH 1SGFA 6CHAB 3Q3KA 3ATKA 3GY3A 2WUBA 1FNIA 2A7CA 2VWMA 3UOUA 1Z1IA 1JXPA 2UWLA 2A4QA 4X2WA 1FY4A 2P3TB 1UVPA 1HXEH 4AX9H 3VB5A 2FS8A 3W95A 1P9UA 1GI1A 3CS7A 4NIVA 3RUOA 2OXSA 1L4ZA 2STBE 1KXAA 1GBDA 1HPGA 1MTSA 1MQ6A 1GJ9B 2G52A 4OS4A 3MO3A 1O2RA 1V2QT 4ABIA 1XUJA 2AMDA 1CGIE 1O3NA 3BN9A 1GVKB 4Y11E 2GZ9A 1WYKA 4NIYA 2ZFRH 2O8UA 5FBEA 3UIRA 3BG8A 4DOQA 1JBUH 4J1YA 4MPWA 3VXEH 1D3PB 1V3XA 3SHAH 4BAQB 4ZHAA 1UTNA 4SGBE 1H8IH 2ZGCA 4ESTE 1C2DA 2BQ7B 2V3HH 4K1EA 1O3CA 1Z7KA 2XW9A 1C5UA 3E0NB 2UWOA 1TONA 1S5SA 1O37A 3M3TA 2ZPQA 1YPGH 4JK5A 5C20A 1O3PB 1A0HB 3BTTE 1O2NA 1TMTH 3ZZ4A 3SQEE 1UO6A 1AKSA 2R0KA 4FXGH 1KDQB 5C5NA 2D26C 3SNEA 1N1LA 1P9SA 4B2BA 3NXPA 5F8XA 3Q76A 3GDVA 4F49A 4OS2A 1ANBA 1BTUA 4H4FA 2G00A 5DP9A 3EQ0H 1Y59T 1GJ6A 2HNTC 3TGJE 1GHBG 2ZHDA 5ESBA 1QR3E 1QJ6B 4DGJA 1SGTA 1C4U2 1TABE 1QL8A 1FJSA 1O2TA 2TGPZ 2KAIB 1JMOH 2ZDMA 3ODDA 3ZZ3A 3BTWE 2ZDNA 5E2OA 5CHAC 4YM9A 1C2MA 3V12A 2A1DB 1SHYA 4J2YB 2UUYA 1O3OA 1ZPCA 4X6NA 2Y80A 3RLYH 1O31A 1MD7A 2A4RA 1NRRH 4AFQA 4DIIH 1MZAA 4AG1A 1SSXA 2A5KA 5FCRA 3KQDA 1UHBB 1G2MA 1N6YA 2WYJA 1CA8B 1CA0B 2BDCA 4B75A 1TA2A 1O2ZA 1KXCA 1TOMH 1TAWA 2P8OC 1V2WT 4CR5A 2GT7A 1RTFB 1TNJA 2CN0H 1O2QA 3H7OA 4FUIA 1OWIA 2DE8A 3E6PH 1FN8A 2HNTE 1W2KH 2ZCLP 1BITA 2GT8A 1QNJA 3ZVBA 2JH5D 1DX5M 3LGYA 2PKAA 4WY3A 3TIUA 3RM2H 4UFFH 1AVGH 2ZTZA 1TFXA 2HLCA 1P09A 4WMEA 1AI8H 1TRMA 2HALA 2BY9X 1YC0A 2J95A 2Z9JA 3L3TA 2D8WA 5F8TA 8KME2 1DT2A 3GY5A 2P3UB 1C9TA 2F9UA 4IBLH 1ZMNA 1GHYH 1J17T 1V2KT 3FAOA 1CGJE 3GDUA 2SFAA 1G3BA 3ZZ8A 2R3YA 1GBJA 1FXYA 5FX5A 5GCHF 2BD8A 3TJNA 3A8CA 3UWIA 1P3CA 1C5NH 1RXPA 2C93B 2QV1A 1A5HA 1O3GA 1S0QA 1FONA 1YF4A 2ZFPH 4FU7A 1D3DB 5B6OA 3BV9B 1C5QA 1A4WH 1P8VC 2OCVB 3O8RA 1OYTH 1DE7H 2HGTH 1GJBB 1P3EA 5FXLA 1EB2A 1P06A 1GI0A 4ABBA 2WPJS 1KSNA 5C1XA 2F3CE 1HJAC 1P2IA 3M5LA 4WVPE 4YOIA 1BMAA 4BXWA 5L2YH 4OGYA 4MTBA 1NFUA 4TPYA 3LH3A 1ANDA 2BZAA 5BPEA 7KMEH 4GUXA 1FN6A 1OXGA 3FZDA 4I7YH 4UD9H 1TPSA 1CT2E
chains in the Genus database with same CATH superfamily
1MTNC 2WHXA 3MO6A 5DP6A 1LHFH 5GNDA 2G5NA 4CRDA 2TPIZ 2FX4A 1FY3A 4JZDH 2XWAA 3SZEA 2H9HA 4FOUC 4IMQA 2GV7A 1BMMH 1WTGH 4PROA 1DSTA 1GG6C 1NRPH 2ZGJA 1D9IA 4D8NA 1EQ9A 1MMJN 2O8WA 2VIOA 1K1OA 1XMNB 2XWBI 5E0GA 1TMBH 2GD4B 2J38A 2PKSC 1V2VT 1HBTH 4XFQA 2CHAB 1ELTA 3U28C 4D7GA 4D9RA 1NPMA 1TIOA 3ZVDA 2ZPSA 2XTTB 1YWUA 3SU1A 1OWJA 2V6NA 1QZ8A 1A5IA 2VJ1A 3OSYA 1AE8H 5PTPA 1TB6H 2BHGA 1YCPK 1W8BH 3QGNB 2J94A 5EGMA 1FQ3A 3FFGA 2HLDD 3Q77A 4MPUA 4CHAC 1OYQA 3BEUA 2ZEBA 4TT3D 4UONA 3VB7A 3URCA 3U8OH 3SV6A 2GDEH 3RC6A 1SFIA 2EC9H 2A31A 1U6QA 1TBQH 4X6OA 1ZSKA 2JKHA 4X1PU 3OY6U 2XC4A 1AFQB 1FIZA 2P3FH 1GBBA 1C4Y2 1C5PA 4MNVA 1K22H 4FUEA 1G9IE 3BTGE 4AFSA 4Q7XA 5HM9A 3FO8D 1NO9H 1MQ5A 1P04A 3NK8A 1S6FA 1KLJH 3CS0A 1AVXA 4JYVH 3RU4E 2H5DA 1DPOA 2WV9A 3T62A 2EEKA 1HGTH 2B5TB 2JETC 2ZU5A 4Q2KA 4YT7H 3LKWA 3STIA 1O2XA 1DANH 4ZKSU 1M9UA 3SOSA 2ZGHA 1EJMA 2AIQA 3T29A 2ZF0H 1C2JA 1HAIH 1YBWA 1Z8GA 2PTCE 1QRWA 4A5TS 2VWNA 1V2LT 5EG4A 2BQWB 1UVUH 4NSYA 1UTKA 1E34B 1LPGB 5JYIA 4AGJA 2C3SA 2IJOB 4FU9A 3NCLA 1RRKA 3LPRA 1OP2A 2FS9A 3E1XB 3IITA 3VFEA 2QGRA 2FX6A 3QK1A 3PM3A 4K5ZA 3DT0H 3F2HA 1LVYA 4I86A 1KTSB 2H1UA 3ZYEA 5AF9H 3QTOH 2BXUH 5DKMA 3PMJA 5L30H 3R0FA 5FHTA 1MH0A 2GCHG 2ZHFH 2LP6A 4YT6H 4YTAA 4K3JA 1VJ9U 4E06H 1B0EA 1ZGVA 3HK3B 5E0HA 3PMHB 3EE0B 1P03A 4ASUD 2YNAA 4U32A 1GL1A 2KM0A 4B2AA 3NRLA 1FUJA 3A8AA 3HATH 1HIAB 4AFUA 2FOMB 2PGQB 4F55A 1YCPH 2QY0B 3DA9B 4DT4A 2BYAX 3DUXH 1NRNH 1VGCB 1DLKB 1XUGA 2TGDA 4IC5A 2ODPA 4SGAE 2RA0A 1QRXA 5GJ4B 4AZ2B 8LPRA 1A0JA 3M3SA 4KKDA 1UJ1A 1SHHB 2ESTE 1XUIA 3TLOA 5K7RA 1BTHH 3LT3A 1UVSH 2PUQH 1P2OA 1BBRK 3SGBE 2GTBA 4ISLA 1K1MA 2GX4A 3RXGA 4MQAA 1NRSH 2BD3A 1PFXC 2AMPA 2ZFQH 3KYFA 2Y81A 2A45B 1NM6A 4WMFA 3RMNH 3ESTA 1O32A 1TALA 1PPFE 1P05A 4LK4A 1J8AA 2G4TA 2V3OH 2A7JA 2Z7FE 3M5OA 2Y82A 1PQ8A 2F9VA 3EYDA 2I6SA 4I8KA 2J92A 1E35B 4Y76A 4A7IB 2TGAA 1YP9A 1GBCA 2GMTB 1XVOA 1HAVB 1GI7B 2ODYB 5GCHG 3TH2H 2F9BH 4XDEA 2Z9GA 4ZKOU 2TBSA 1ZJKA 2FXRA 2WPDD 4O97A 3OAAD 4CBOA 3RXQA 4X1RU 1Y8TA 3MH7A 1AWHB 2FOAA 4NA8A 5LH8A 3S7HB 4Y6DA 3O8CA 4AB9A 3A86A 4R0IA 4XD7D 3M3VA 1O2UA 3MOCA 1NESE 1K1IA 2L6OA 4ZHMU 1UCYE 5HGGA 3SV2H 1AFEH 4IW4E 2C8YB 2ZDAH 3B8JA 1TX7A 3RXAA 1KXDA 4MPVA 4DG4A 2Z94A 1G36A 4FUGA 3RP2A 1MUEB 4IC6A 3GCOA 3ZVAA 2STAE 1FIWA 2ZZUH 1ZTLA 1HJ8A 2A5IA 3RXIA 3UY9A 1QBVH 1O3HA 3VB3A 3ZYDA 3W94A 5EJ1A 1O2IA 5A8YA 1YPLH 3ZIAD 4Y7AA 1OKXA 5LGOA 1K1NA 6LPRA 3RXKA 5FX6A 1CHOF 2C90B 1IQFA 2K0QA 1T4VH 3RXJA 1DUAA 2OD3B 3IWMA 2F4LA 3PV2A 3E0PB 1GCTB 1GPZA 4GAWA 3MH5A 1MKWK 1ZZZA 2AEIH 1AU8A 5EW1H 1BBRH 2HRVA 2WPKS 2G5VA 2G51A 4ZUHA 3F9EA 3MU0A 3FANA 3EA7A 5HM2A 4UEHH 1WUNH 2QIQA 2SGDE 4ZHLU 4XRNA 2DE9A 4K1SA 3HK6B 2AYWA 1VKYA 3VB6A 3RU4T 1K21H 5EQSA 3KIDU 2ULLA 4RKJB 2J4IA 1O5CB 3HGPA 2Z6BD 1GJ4H 1Y3XA 2KFWA 4CRGA 1E79D 1VITH 2GCTC 3VB4A 1AUTC 2B8OH 2VIPA 4AC9A 5L6NH 1XXFA 4MNWA 1CQQA 1SC8U 5TJXA 8ESTE 1A0LA 4MLFB 3SUEA 2V7QD 2VIVA 1C1UH 1ELCA 2Z9IA 1LHCH 4NCYA 4TY6A 5J4QA 1T32A 1WU1A 5CMXH 1YY3A 4FUBA 1EOLA 4U01A 2CF9H 2BD4A 2FI4E 1QL7A 3RXBA 1J14A 4OS1A 2F83A 3U69H 3DFLA 2FLBH 2VH0A 3RC5A 4B76A 1AQ7A 1H9IE 1SGDE 1GBHA 2BXTH 3QZQA 1TLDA 5DP3A 2OQUA 3NPSA 1V2ST 4GPGA 3AAVA 1EZSC 3LU9B 1C5WB 1GDUA 3V13A 2XXLA 1V2UT 1AVWA 3MH4A 1O2GH 1UK2A 2ZHEH 1LVBA 2OC1A 1F0RA 4E7RG 3L33A 1OP0A 1G2LA 2RDLA 1CE5A 4MG3A 2AGIX 2WPLS 3SV9A 1GJ7B 2HPPH 3S9AA 1UVTH 4X6MA 2P94A 1BTYA 3QUMP 4OGXA 1FI8A 3RXPA 1HNEE 1OP8A 1QB6A 1AB9B 2FOHA 2BMGB 1UTMA 2YMSB 3U1IB 4ZXYH 2EI6A 1J15A 2OC7A 1HLTH 1DXPA 3KYGA 1SGRE 1MCTA 4FUHA 1YPEH 2BD7A 3BG4B 1MKWH 1ZGIA 1PPGE 2GDDA 1K28D 2A4OA 3VEQB 2ODQA 1EAIA 2A7HA 2AMQA 1EJAA 1A3EH 3V3MA 2C8XB 1NS3A 1CT0E 1O2OA 1SGEE 2OC8A 1C5RA 1KXEA 1LCYA 1F2SE 4KELA 1OSSA 2YOLA 4RSPA 2LPRA 4O3UA 1LMWB 1FY8E 3LGVA 2H9TH 1LQDB 1QIXB 3RXUA 2B9LA 5F8ZA 1QURH 2ZDLA 2NWNA 2YMSD 1QBOA 4CR9A 2R2MB 1ZTJA 2WPHS 1CGHA 3SU2A 5C0TA 1B0FA 1BIOA 3FZZA 4B71A 1FV9A 2ZGXH 3MYWA 4FVBA 3EA8A 3SV7A 2IPHA 3F9GA 5C3NA 1Q31A 1UTJA 2XYAA 5AFYH 3KNXA 3TPIZ 3DSPA 2FO9A 1SGFG 1ZOMA 1SMFE 3PO1C 1UCYH 3DHKH 1C2KA 1ELEE 2VWLA 1ARCA 3PWBA 1EPTC 4NGAH 4P00A 1TQ7B 1N8OC 1E38B 2FODA 2AS9A 2FYQA 1BTXA 3DCLA 4GCHF 3T27A 2ZQ2A 3PTBA 4O3TA 1SB1H 4OS6A 1S83A 1HJAB 1QJ1B 1EKBB 4D76A 2H6MA 2ZU4A 4FVDA 3F9HA 4GHTA 2TRMA 2F91A 1O3FA 4X2YA 2LNCA 5T1VA 3RMMH 4YO9A 5GPIB 1Z8JB 2XC0A 3HGNA 2GCHF 4AFZA 4AN7A 3T25A 1K9OE 1HAPH 1AIXH 1XX9A 1GJDB 1ZRKA 3OYPA 1TX6A 1UW7A 4IN1A 1PQ5A 3A8BA 1EATA 4YLUA 1SGIB 2K8IA 1BDAA 1GMHG 2C8ZB 1ORFA 1AHTH 1EJNA 2R9PA 3F6UH 1Z6EA 1A2CH 1Z1JA 9LPRA 1HAGE 1GGDB 2CF8H 2CJIA 1DWEH 2I6QA 3K9XB 2Z3EA 3KCGH 1XUHA 1C1OA 1DWBH 1OWEA 3ZV8A 1F0UA 1H8ED 4Z0KA 7LPRA 2B0FA 1QA7A 4X8UH 1D3QB 3ODFA 1TRYA 2ZP0H 1WBGB 1ELBA 3A81A 3M5MA 5BRRE 1TMUH 2BLQA 4F4OC 4MNXA 4Q7ZA 2BX4A 2RDEA 4B2CA 3P8FA 1P02A 4E7NA 1SL3A 1EPTA 2OP9A 3JZ1B 1IQEA 4X2VA 3SUFA 1KMHB 3QN7A 2EI7A 1Y3WA 2HVXA 2OK5A 2BDHA 2FOCA 5JBAS 1YPHC 1OPHB 3F2FA 4LXBH 1H9HE 1XKBC 6CHAC 1HAZB 1C5LH 1GMDG 3PTNA 2M5TA 4NZQA 5C94A 1CHOG 2V35A 3RU4D 3L6PA 3PMAB 1G32B 1O2JA 1O3IA 3ZVCA 3ATWA 3F2GA 3TK6A 2FPZA 4ZAEA 2OLGA 1O35A 3KQ5A 3M7TA 1MABB 3G01A 2G81E 1TE0A 3SNAA 5EXLA 1VITF 2A0QB 1OWDA 5DG6A 4TPIZ 2ZG0H 2BOKA 3MI4A 4RT0A 2ILNA 1NBMD 2FIRH 3PMBB 1Q3XA 1KTTB 1ZLRA 1BHXB 2Y5GA 1MU6B 3ATIA 3F68H 1D4PB 1EXFA 4NIWA 3Q00A 1ZMLA 1C5VA 1DSUA 1Y3VA 3FN8A 3LC3A 4WH6A 3SNCA 1O5GH 5I25A 1YPHE 1BHXF 1OX1A 2LELA 5AVDA 1V6DA 2G55A 1TA6A 3SJKA 5LPFA 3DFJA 4ISNA 4Z6AH 5DSFA 1P2QA 3ZZ5A 1DDJA 5L2ZH 1VJAU 5T6DA 1DOJA 2PLXA 4JZIA 4MPXA 1P10A 3LGTA 1MZDA 5I46H 3T28A 1RIWB 4CRFA 3NWUA 1BTZA 3STJA 1W0JD 4INHA 1C1SA 2UUJB 1YPJH 2VH6A 1AMHA 1CT4E 6ESTA 1HAOH 1IQMA 3ZZ7A 1SR5C 2QXIA 4QT8C 1ZJDA 1JOUB 1MAXA 1TOCB 4VGCB 2CK3D 1ZPBA 3BSQA 2XOKD 2H2ZA 3JZ2B 3RXSA 1CHGA 2VVUA 1SGQE 1O3JA 3ENSB 1ZMJA 4Z1MD 4KTSA 1UTOA 3LGUA 3QGJA 3VGCB 1LKAA 3GCNA 2EA3A 2ZHWH 1A7SA 2GV6A 3D23A 2OQ5A 2PHBA 4H6TA 3TJVA 1V2TT 1QCPA 3VPKA 3ZZCA 1LPZB 2XC5A 1BQYA 1P0SH 2GZ8A 3UOPA 1O3EA 3PROA 1EB1H 2CMYA 2O8TA 3C1KA 1K2I1 3IG6B 2PWXA 3U98H 1BJVA 4ZROA 4CRAA 1EP6A 2RCEA 3ZZ9A 2BD9A 5ETXA 1MBMA 1QJ7B 5GWZA 2UUFB 3K65B 3SN8A 1G30B 2ZDKA 4TSFD 3SU0A 1TNHA 2CXVA 1C1TA 1SLXB 1L1GA 1WTHD 2ZC9H 4GSOA 3TK9A 3AW0A 2FZZA 2BD2A 3SUDA 5FAHA 1SQOA 1GMCG 2QAAA 4HI3A 1A5GH 1BA8B 3SJ8A 1QA0A 1W13U 6GCHF 3SJ9A 4A1VA 1LHEH 1TBRH 1CA0C 2PSYA 2ZTXA 3BF6H 3SGQE 2VIQA 5EQQA 5EODA 3WW7A 1UMAH 1W7GH 4H6SB 1IQLA 2VVVA 1WQVH 1LHDH 1GI2A 5C1YA 1NU9A 1P11E 1VCQA 5CE1A 5JBTA 2KCPA 4F48B 3OEED 3S0NA 1KDQA 2BTCE 1KLTA 3Q3XA 2L74A 1AD8H 1Z6JH 1LVOA 1O5AB 2BDBA 2BZ6H 2CV3A 1BBRE 2P95A 4X1NU 2NU2E 2D2DA 3SUGA 1FY1A 3E90B 3PRDA 2JH6D 2Y7ZA 1O3AA 3PLBA 2W7SA 4CRCA 5DO4H 1ELFA 3A88A 2NU0E 1E1RD 4AYVB 3SI4H 1Y5UT 4GCHG 2FMJA 2KAIA 1D6RA 1THPB 2BM2A 4ZCNA 1W10U 5FBIA 5IK2D 4IS5A 1O3DA 1GBMA 3SU4A 2ZPRA 2ANKH 5FPSA 2OUAA 3TJUA 4X8SH 2FTLE 4WMDA 2VNTA 3E91A 3MNXA 4AB8A 5A2MH 1NU7B 5HKKD 2XBYA 3D62A 1TNGA 3MNSA 3OTPA 4JZFH 5JB8S 5A0CA 1VCPA 2B7DH 1ETRH 1O2SA 1BTWA 1XKAC 3CNRA 2C8WB 1UHBA 3MHWU 1SLWB 3S9BA 1T8OA 2ZA5A 1BOQA 1ETSH 3BTFE 2PW8H 3OX7U 4KTCA 4Y8XA 5A8XA 1UK4A 1ID5H 2EI8A 4Y8ZA 1EFRD 2KZ4A 3TVJB 4K60A 5EXNA 1SBWA 2VGCB 2Y5HA 5F03A 3LIWA 4ZH8A 1WQSA 1ARBA 3RDZA 1WOFA 3TJOA 1SPJA 3ZZDA 3ELAH 1PPCE 4GVUA 2GKVE 1QB1A 1IQIA 2JJ2D 2WUCA 3BTHE 4DT7B 1O34A 3P6ZB 4ABHA 4BTUB 1WDIA 5CHBA 2PSXA 1HRTH 1T8NA 5DP8A 2VWOA 3BTDE 2PP6A 3TH4H 2QA9E 4YLQH 3B9FH 1EUFA 1GI8B 2GGVB 3E8LA 3A87A 3O8DA 1GBFA 3M5NA 1A1RA 3E3TA 3N7DA 5DP5A 3H7TA 5DP4A 4X2XA 4DW2U 4FETA 5HIYA 2CHAC 1ZHRA 2DUCA 2FESH 2BLOA 1GJ8B 2J2UA 1SLVB 1EOJA 1F7ZA 4Y79A 1YCPM 1AN1E 4CH2B 3RXOA 3UTUH 7ESTE 2OBQA 4NIXA 1PPZA 2OBOA 4XOJA 4ACBA 3AW1A 2ASUB 5A09A 1MCVA 1CBWB 5C0UA 1VITG 2XNIA 1S81A 2BY5X 2P16A 1GMHF 1C2GA 2PUXB 3N7EA 1C9PA 3LGWA 1QQUA 4U30A 3BIUH 3LOXA 1AFQC 3GCHB 3RXVA 1DWCH 3T26A 2ANYA 3S7KB 2O9QA 1O3LA 5C2ZA 1H1BA 4ISOA 1C2IA 1E0FD 2PGBB 1Q2WA 1S0RA 1KXBA 2ANWA 4RN6A 1ZRBA 1QBNA 3M7QA 3NZIA 1YYY1 3A7VA 1AKSB 1W14U 3MNCA 4NA7A 1O2VA 4A1TA 3K2UA 2OC0A 3A83A 1O36A 4NA9H 1C2FA 3MU8A 5A8ZA 1W0ZU 4FU8A 1OWKA 1P2MA 1YPMH 2R0LA 3MMGA 5SGAE 1E1QD 2R3UA 1MAYA 1ZSLA 1P57B 2PR3A 1BMFD 1GI4A 4K8YA 1MTUA 3RMLH 1ZTKA 1WCZA 1OS8A 1GJ5H 2H5CA 4B6FA 3BTQE 3GYLB 5EQRA 5F6MA 1FDPA 3GDSA 1O38A 2Z9LA 1TGTA 5EPYA 1PYTC 1XM1A 3KF2A 1GMDF 5FPTA 4NWLA 3HPTB 3SU3A 1C1MA 3GY6A 3F0OA 2AGEX 4I8GA 3AASA 2PV9B 1IQGA 4ABJA 1DM4B 4JMYA 3M35A 1V2RT 1P12E 5EW2H 3EAJA 3RXHA 4DURA 3RXRA 1O3MA 4XE4A 1JRTA 2W5EA 3P8GA 1JRSA 2QYIA 2XNDD 4WWYA 1T8MA 5AFZH 3TH3H 3KQBA 3UR6A 1WXRA 1AZ8A 3FP7E 4ABAA 1AGJA 3URDA 1O3BA 2A2QH 2FOGA 1HDTH 3EA9A 3H5CB 4Y8YA 3A7XA 1NTPA 2FOBA 3HKIB 3E16B 4XBBA 4DY7B 2QXJA 1PQ7A 7GCHG 1W0YH 1YGCH 4X1SU 1L2EA 1QB9A 1VGCC 3I77A 3KQEA 2ZTYA 2GJGA 2PKAB 3UUZA 1GHWH 6GCHG 2KX4A 1S6LA 2Z3DA 3GY7A 1RGQA 4HTCH 3ITIA 1E37B 1LPKB 2PTNA 3RM0H 1V2MT 1BRUP 3KN2A 4BAKB 3N7OA 1O2LA 1IOEA 4ACAA 1BJUA 4I32A 1EZXC 1V2PT 1OWHA 2W7UA 3LDXH 1ZHPA 1VR1H 5E8EH 3SHCH 2J98B 1VZQH 4JK6A 3P95A 3RXMA 3DSGA 4B74A 1VCWA 2SGEE 3V0XA 2FDAA 2HNTF 2ZU3A 2A4GA 1PPHE 4INLA 5CHAB 1EZUC 1CO7E 1O2MA 1PJPA 2YNBA 1HV7A 1TWXB 2NU4E 1JIMA 1F5KU 1XVMA 4DJZB 5JB9S 1UTLM 2Q1JA 4OS5A 1TGCA 1O2WA 4P02A 1GBTA 1WSSH 1C1NA 3QTVH 4AYYB 5DP7A 4JZEH 2ZDVH 2P8OB 2Y6TA 4CREA 1JWTA 1TYNA 2GMTC 5B6LA 3LGIA 1MTWA 2AERH 2BVXH 4WH8A 3PLKA 1H8HD 1B7XB 1SQRA 1GVLA 1HIAA 3I29A 3SW2B 1ANEA 1MKXK 4KP0A 2UUKB 4UFEH 5TCCA 3SZNA 2Z9KA 2FM2A 1GMCF 1CVWH 4BNRA 2OTVA 3DD2H 2ALPA 2P93A 3A84A 1Y5AT 2ZI2H 4Y0ZE 3ZVEA 4JYUH 2ZQ1A 3TGKE 1ELAA 2WV5A 3CP7A 3NUMA 3OY5U 2QCYA 2KCOA 4M7GA 1AZZA 1WV7H 3A82A 1AWFH 1DLEA 1K1JA 3DSOA 5FL7D 1IQNA 3FVFB 4WXVA 1O33A 2Q6FA 3P92A 4BAMB 1GCTC 4AOQA 1V2OT 5K0HA 3ATMA 4IMZA 4WJG2 4BOHA 1FAKH 3K6ZA 1ETTH 1F5LA 1BCUH 1G3EA 1YM0A 2V0BA 3O8BA 4IN2A 4M9FA 4XSKU 3PB1E 1K1LA 1ABIH 1DVAH 1FAXA 2SGQE 2BVSH 4TYDA 4HG6A 1ELDE 4WXIA 1O0DH 5AHGH 3TITA 4A1XA 1HAVA 1Z8IB 1GDNA 2A32A 1QQ4A 3BTKE 1EASA 1C2HA 1BUIA 3FP6E 1F92A 5HMAA 1C1RA 2WINI 3T5FH 1NFWA 4I8JA 3QX5H 1SFQB 4YZUA 1F5RA 1F0SA 4BXSA 4OM9A 1RFNA 3MU5A 1L1NA 1GBKA 1TQ0B 3KHVA 4E05H 1T31A 1MTNB 4XBCA 2BDGA 2BDYA 1H4WA 3RC4A 1GJAB 2ZU2A 3KQCA 5C5OA 1GHXH 3MO9A 1B5GH 2ZFFH 1W7XH 3QDZB 2Y5FA 1GG6B 1FPCH 1S6HA 1AO5A 5G4BA 2FOFA 1QFKH 3GCTF 4TY7A 3P17H 4ABEA 4LZ1H 4D7FA 1MKXH 3SJOA 2ANMH 3SGAE 4HGCA 5T6GA 4A6LA 2BD5A 2PKSB 2GVFA 3GISB 1S82A 2F9OA 3HKJB 1LQEA 3P8OA 3TU7H 4HFPB 5CDFE 1THRH 1D6WA 2W26A 2JJ1D 3ATLA 1N6XA 4BANB 1IAUA 3PV4A 1IQHA 2ZHQH 4CHAB 1FZZA 3BTME 4IGDA 3UR9A 1HAYB 3LC5A 3AK5A 1A3BH 2QF0A 5TCAA 1C5SA 5JPMH 4MNYA 4BAOB 1GL0E 3GY2A 1MD8A 4HZHA 3RXFA 2G8TA 2HOBA 2R2WU 4RI0A 3RXTA 1C5OH 1NFYA 2IOTA 2QE7D 5A0AE 3BEFB 3LJJA 4ZMAH 1AB9C 1EX3A 1SGYE 1T4UH 2YMSC 2CGAA 4NZLA 4O03A 8GCHG 4Y0YE 1HAXB 1A61H 1DY9A 3M36A 1O2HA 2SGPE 3A80A 1BRCE 2ZFSA 1L4DA 2BY7X 4A92A 1ZPZA 3D49H 3BG4C 1BMNH 5EOKA 2JETB 1DY8A 1X7AC 3RXDA 1BT7A 1SOTA 2A5AA 1NT1A 1ELVA 4K69A 1GDQA 1C1WH 1QGFA 3I78A 4D9QA 3A7ZA 5EPNA 3MWIU 2BDAA 1TNKA 4B1TA 3U8RH 1H9LB 1BRBE 1V2JT 5T6FA 1ZHMA 3NKKA 3U1JB 1HUTH 2FP7B 3UQVA 4MDSA 1O2PA 3ZZ6A 1SKYE 3OEHD 3ZV9A 2Q6DA 3EE7A 1GHAG 5C17A 1NC6A 5ESTE 1SLUB 2ZWLH 5IYTA 1MBQA 3OE7D 1C5XB 1DUEA 1S84A 2ZO3H 5H4IB 1RJXB 3SU5A 3UNSA 1Y5BT 5DK1A 5E2PA 1T7CA 3GY4A 3MU4A 1J9CH 3SQHE 1YKTA 4X8VH 3ZZAA 3M7UA 3UQOA 2GZ7A 4DIHH 3TK5A 1KXFA 5LPEA 4X1QU 3A7YA 1ANCA 4ZKRU 4WF8A 3U9AH 1PPBH 4MVNA 1GJCB 1FY5A 4B73A 4B6EA 2W3KA 3OU0A 1GCDA 1MTVA 2FI3E 1QL9A 1SOZA 1THSH 1TPPA 3LJOA 2QN5T 1PPEE 1HJ9A 2WV4A 4ISHH 4GHQA 3U8TH 3UB0A 4UFDH 2HWLB 3A89A 1IQJA 2BB4A 2BDIA 2XRCA 3A7TA 4I8HA 1LTOA 1NFXA 3M61U 1TGBA 3V7TA 1C2EA 1QRZA 1W12U 4I8LA 1LVMA 2BLWA 3F9FA 3A7WA 3VXFH 4UDWH 1O5EH 1GGDC 1Y3UA 3SJIA 3D65E 2IN2A 2J34A 2VBCA 2KCAA 3K6YA 5EIYA 7GCHF 3T2NA 3MU1A 1LDTT 3TNSA 1SI5H 4LOYH 1DITH 3LH1A 5HXFA 1NRQH 1COWD 1EZQA 4X8TH 3ZVGA 3TGIE 3GYMA 2FWWA 1K1PA 1YLDA 2BY8X 1HB0B 4AG2A 1XUKA 3RXLA 2WPMS 2D1JA 4X6PA 3RXEA 4AORA 3UWJH 4JZ1A 2P59A 5DGJA 4NG9H 2WYGA 2Q6GA 1TGSZ 2QF5A 1ESBA 1EP5A 1MU8B 1KLIH 4JYTA 1LO6A 1YPKH 1J16A 1KYNA 4FUFA 4NFEA 1XXDA 3FP8E 1SG8B 1W11U 4Q4LA 2IJD1 1C5YB 1Z71A 1DICA 3QO6A 4Y7BA 5KEDA 2QF4A 4UE7H 1ZYOA 4DVAU 2JIZD 1TPAE 2FTMA 2BOHB 2EQNA 1GVZA 1H8DH 3OTJE 1TBZH 1ZR0A 5T3HA 4Y71A 2O8LA 1TNLA 2VIDA 5EJZA 4BAHB 1SVPA 2RFKC 2QXGA 1P01A 2VU8E 3C27B 2G4UA 4INKA 3SNBA 3SI3H 1UK3A 4H42U 2J5UA 1QHRB 1NBME 1T8LA 4CBNA 1RTLA 2NU3E 2TIOA 2FI5E 5EJLA 3RLWH 3AVZA 5F53A 3S69A 1RD3B 1TGNA 1O39A 4RKOB 4FUDA 1NROH 4Q7YA 1HFDA 3BTEE 1A46H 1EAWA 3QWCH 1C4V2 4UFGH 3P8NA 4ABGA 5LPRA 1BMLA 1RIWC 2SGAA 2W6JD 2ZCHP 1C2LA 1TRNA 3QZRA 2FEQH 2AFQB 3A85A 1SQTA 3GY8A 3GCTG 5IDKA 1GI9B 1GHZA 1P2KA 2VINA 5JBBS 1DFPA 2TGTA 5E0JA 3ZZBA 1O2YA 4ABFA 2VIWA 1P2JA 4VGCC 1YLNA 3MQKC 2A2XH 2C4FH 1NY22 1KIGH 2F43B 3SBKA 5DN6D 1GBLA 3PWCA 1UTPA 2OINA 1IHTH 3VGCC 3SORA 1G3DA 4ABDA 2XBXA 2F9NA 5KECA 1TX8A 1PYTD 4YXWD 1SGPE 2AGGX 2Z3CA 3QLPH 2AIPA 4OS7A 5C67A 1W3CA 2UWPA 2GCTB 2AHME 2XBWA 3MH6A 1O3KA 2PFEA 2RG3A 2ZGBH 1L1JA 2FLRH 2XCFA 1TNIA 2Y7XA 4K1TA 1LHGH 2J9NA 2ZCKP 4Q80A 2ZIQH 1O2KA 3SNDA 1SGCA 1SQAA 1YLCA 4KGAA 1C1QA 2FOEA 4YESB 1GI3A 1IQKA 1SGNE 1RS0A 4FUJA 1BZXE 1D3TB 1DXWA 3S9CA 5DJ7A 4LZ4B 2NU1E 4NSVA 5EU8A 5A0BA 3UFAA 1K0HA 1UVOA 5JBCS 4K8BA 2JH0D 1ESTA 2ZKSA 2F9PA 2BY6X 2SGFE 1G3CA 5GXPA 1DWDH 2FYRA 3RMOH 1GBEA 4CRBA 1HCGA 1GHBF 3LONA 3F0PA 1OOKB 5GDSH 1GI6A 5JDUB 2AH4X 1ACBE 3RXCA 3ZVFA 1BB0B 3SV8A 1O5BB 4YOJA 5EXMA 5HIZA 1C5TA 1EAXA 3PLPA 4BTIB 4TWYA 2ZNKH 1AUJA 3R3GB 3F3BA 5KGOA 1ELGA 1O5FH 1NZQH 2QF3A 4THNH 3AAUA 3MTYA 4ZKNU 1TPOA 1HXFH 4Y10E 3SO3A 1JIRA 1AY6H 1KY9A 1XUFA 4RT1A 3P70B 4TWWA 1Z8RA 5C1UA 3PRBA 2WPIS 4K2YA 1UTQA 5J4SA 1QTFA 8GCHF 3UNRA 1HYLA 1IHSH 1DS2E 1CU1A 1FPHH 4X0WU 1GBAA 3GOVB 1LKBA 1RTKA 2GP9B 2SNVA 2ZU1A 3MNBA 5DPAA 3SU6A 3UNQA 1GWAA 3KL6A 4YOGA 3FOAA 2IPQX 3PO1B 2BQ6B 3EDXB 4ASHA 3UAIC 4KTUA 1EPTB 2VGCC 2XBVA 1N8OB 1WAYB 4R8TB 2BX3A 4ISIH 5FPYA 1GHAF 2K1QA 4U2WA 1P2NA 1HAHH 2M2AA 5GIBA 1CSOE 2SNWA 2ZFTA 2W3IA 1PQAA 3EGKH 1Y3YA 3WY8A 2WZQA 1E36B 1L0ZA 1O30A 4DCDA 3Q3YA 4I31A 4BTTB 4CH8B 1C5ZB 2EY4C 4AGKA 3KEEA 2BLVA 1S85A 2W6ID 2XCNA 3TNTA 1ESAA 1C1PA 3BIVH 1UCYK 2O8MA 4JCNA 1GHVH 1ZSJA 2QC2A 3UREA 4Q63A 4GLYA 3PV5A 2ALVA 4ZXXH 2VB0A 5ABWA 1F0TA 3GICB 4I33A 4O9VA 3F1SB 1NN6A 4NFFA 1BTPA 1O5DH 3A8DA 1CBWC 2THFB 1V2NT 1BRAA 1EAUA 1GBIA 1QY6A 4XBDA 9ESTA 4NWKA 1FMGA 5FCKA 1AE5A 3MFJA 3GCHC 3B23B 4FUCA 1C5MD 3M37A 3KGPA 2VVCA 2QXHA 2BVRH 3UPEA 5HYOA 3PYHA 1ABJH 1G37A 1FLEE 1C1VH 1INCA 2RA3A 1GI5A 3CENA 2ZECA 3BEIB 2H9EH 2HPQH 1SGFA 6CHAB 3Q3KA 3ATKA 3GY3A 2WUBA 1FNIA 2A7CA 2VWMA 3UOUA 1Z1IA 2HVYB 1JXPA 2UWLA 2A4QA 4X2WA 3W1EA 1FY4A 2P3TB 1UVPA 1HXEH 4AX9H 3VB5A 2FS8A 3W95A 1P9UA 1GI1A 2WSSD 3CS7A 4NIVA 3RUOA 2OXSA 1L4ZA 2STBE 1KXAA 1GBDA 1HPGA 1MTSA 1MQ6A 1GJ9B 2G52A 4OS4A 3MO3A 1O2RA 1V2QT 1FX0B 4ABIA 1XUJA 2AMDA 1CGIE 1O3NA 3BN9A 1GVKB 4Y11E 2GZ9A 1WYKA 4NIYA 2ZFRH 2O8UA 5FBEA 3UIRA 3BG8A 4DOQA 1JBUH 4J1YA 4MPWA 3VXEH 1D3PB 1V3XA 3SHAH 3WWFA 4BAQB 4ZHAA 1UTNA 4SGBE 1H8IH 2ZGCA 4ESTE 1C2DA 2BQ7B 2KR7A 2V3HH 4K1EA 1O3CA 1Z7KA 2XW9A 1C5UA 3E0NB 2UWOA 1TONA 1S5SA 1O37A 3M3TA 2ZPQA 1YPGH 4JK5A 5C20A 1O3PB 1A0HB 3GS9A 3BTTE 1O2NA 1TMTH 3ZZ4A 3SQEE 1UO6A 1AKSA 2R0KA 4FXGH 1KDQB 5C5NA 2D26C 3SNEA 1N1LA 1P9SA 4B2BA 3NXPA 5F8XA 3Q76A 3GDVA 4F49A 4OS2A 1OHHD 1ANBA 1BTUA 4H4FA 2G00A 5DP9A 3EQ0H 1Y59T 1GJ6A 2HNTC 3TGJE 1GHBG 2ZHDA 5ESBA 1QR3E 1QJ6B 4DGJA 1SGTA 1C4U2 1TABE 1QL8A 1FJSA 1O2TA 2TGPZ 2KAIB 1JMOH 2ZDMA 3ODDA 3OFND 3ZZ3A 3BTWE 2ZDNA 5E2OA 5CHAC 4YM9A 1C2MA 3V12A 2A1DB 1SHYA 4J2YB 2UUYA 1O3OA 1ZPCA 4X6NA 2Y80A 3RLYH 1O31A 1MD7A 2A4RA 1NRRH 4AFQA 4DIIH 1MZAA 4AG1A 1SSXA 2A5KA 5FCRA 3KQDA 1UHBB 1G2MA 1N6YA 2V3MA 2WYJA 1CA8B 1CA0B 2BDCA 4B75A 1TA2A 1O2ZA 1KXCA 1TOMH 1TAWA 2P8OC 3H09A 1V2WT 1W0KD 4CR5A 2GT7A 1RTFB 1TNJA 2CN0H 1O2QA 3H7OA 4FUIA 1OWIA 2DE8A 2JDID 3E6PH 1FN8A 2HNTE 1W2KH 2ZCLP 1BITA 2GT8A 1QNJA 3ZVBA 2JH5D 1DX5M 3LGYA 2PKAA 4WY3A 3TIUA 3RM2H 4UFFH 1AVGH 2ZTZA 1TFXA 2HLCA 1P09A 4WMEA 1AI8H 1TRMA 2HALA 2BY9X 1YC0A 2J95A 2Z9JA 3L3TA 2D8WA 5F8TA 8KME2 3FKSD 1DT2A 3GY5A 2J98A 2P3UB 1C9TA 2F9UA 4IBLH 1ZMNA 1GHYH 1J17T 1V2KT 3FAOA 1CGJE 3GDUA 2SFAA 3WWBA 1G3BA 3ZZ8A 2R3YA 1GBJA 1FXYA 5FX5A 5GCHF 2BD8A 3TJNA 3A8CA 3UWIA 3VG8A 1P3CA 1C5NH 1RXPA 2C93B 2J97A 2QV1A 1A5HA 3N99A 1O3GA 1S0QA 1FONA 1YF4A 2ZFPH 4FU7A 1D3DB 5B6OA 3BV9B 1C5QA 1A4WH 1P8VC 2OCVB 3O8RA 1OYTH 1DE7H 2HGTH 1GJBB 1P3EA 5FXLA 1EB2A 1P06A 1GI0A 4ABBA 2WPJS 1KSNA 5C1XA 2F3CE 2KCYA 1HJAC 3SYJA 1P2IA 3M5LA 4WVPE 4YOIA 1BMAA 4BXWA 5L2YH 4OGYA 4MTBA 1NFUA 4TPYA 3LH3A 1ANDA 2BZAA 5BPEA 7KMEH 4GUXA 1FN6A 1OXGA 3FZDA 4I7YH 4UD9H 1TPSA 1CT2E
chains in the Genus database with same CATH topology
1MTNC 3MO6A 5DP6A 1LHFH 2G5NA 4CRDA 2TPIZ 2FX4A 1FY3A 4JZDH 2XWAA 2H9HA 4IMQA 2GV7A 1BMMH 1WTGH 4PROA 1DSTA 1GG6C 1NRPH 2ZGJA 1D9IA 4D8NA 1EQ9A 1MMJN 2O8WA 2VIOA 1K1OA 1XMNB 2XWBI 5E0GA 1TMBH 2GD4B 2PKSC 2J38A 1V2VT 1HBTH 4XFQA 2CHAB 1ELTA 4D7GA 4D9RA 1NPMA 1TIOA 3ZVDA 2ZPSA 2XTTB 3SU1A 1OWJA 2V6NA 2VJ1A 1A5IA 3OSYA 1AE8H 5PTPA 1TB6H 2BHGA 1YCPK 1W8BH 3QGNB 2J94A 5EGMA 1FQ3A 3FFGA 3Q77A 4MPUA 4CHAC 1OYQA 3BEUA 2ZEBA 4UONA 3VB7A 3URCA 3U8OH 3SV6A 2GDEH 3RC6A 1SFIA 2EC9H 2A31A 1U6QA 1TBQH 4X6OA 1ZSKA 2JKHA 4X1PU 3OY6U 2XC4A 1AFQB 1FIZA 2P3FH 1GBBA 1C4Y2 1C5PA 4MNVA 1K22H 4FUEA 1G9IE 3BTGE 4AFSA 4Q7XA 5HM9A 1NO9H 1MQ5A 1P04A 3NK8A 1S6FA 1KLJH 3CS0A 1AVXA 4JYVH 3RU4E 2H5DA 1DPOA 3T62A 2EEKA 1HGTH 2B5TB 2JETC 2ZU5A 4Q2KA 4YT7H 3LKWA 3STIA 1O2XA 1DANH 4ZKSU 1M9UA 3SOSA 2ZGHA 1EJMA 2AIQA 3T29A 2ZF0H 1C2JA 1HAIH 1YBWA 1Z8GA 2PTCE 1QRWA 4A5TS 2VWNA 1V2LT 5EG4A 2BQWB 1UVUH 4NSYA 1UTKA 1E34B 1LPGB 5JYIA 4AGJA 2C3SA 2IJOB 4FU9A 3NCLA 1RRKA 3LPRA 1OP2A 2FS9A 3E1XB 3IITA 3VFEA 2QGRA 2FX6A 3QK1A 3PM3A 4K5ZA 3DT0H 1LVYA 1KTSB 2H1UA 3ZYEA 5AF9H 3QTOH 2BXUH 5DKMA 3PMJA 5L30H 3R0FA 5FHTA 1MH0A 2GCHG 2ZHFH 4YT6H 4YTAA 4K3JA 1VJ9U 4E06H 1B0EA 1ZGVA 3HK3B 5E0HA 3PMHB 3EE0B 1P03A 2YNAA 4U32A 1GL1A 4B2AA 1FUJA 3A8AA 3HATH 1HIAB 4AFUA 2FOMB 2PGQB 1YCPH 2QY0B 3DA9B 2BYAX 3DUXH 1NRNH 1VGCB 1DLKB 1XUGA 2TGDA 4IC5A 2ODPA 4SGAE 2RA0A 1QRXA 5GJ4B 4AZ2B 8LPRA 1A0JA 3M3SA 4KKDA 1UJ1A 1SHHB 2ESTE 1XUIA 3TLOA 5K7RA 1BTHH 3LT3A 1UVSH 2PUQH 1P2OA 1BBRK 3SGBE 2GTBA 4ISLA 1K1MA 2GX4A 3RXGA 4MQAA 1NRSH 2BD3A 1PFXC 2AMPA 2ZFQH 2Y81A 2A45B 1NM6A 4WMFA 3RMNH 3ESTA 1O32A 1TALA 1PPFE 1P05A 4LK4A 1J8AA 2G4TA 2V3OH 2A7JA 2Z7FE 3M5OA 2Y82A 1PQ8A 2F9VA 3EYDA 2I6SA 4I8KA 2J92A 1E35B 4Y76A 4A7IB 2TGAA 1YP9A 1GBCA 2GMTB 1XVOA 1HAVB 1GI7B 2ODYB 5GCHG 3TH2H 2F9BH 4XDEA 2Z9GA 4ZKOU 2TBSA 1ZJKA 2FXRA 4O97A 4CBOA 3RXQA 4X1RU 1Y8TA 3MH7A 1AWHB 2FOAA 4NA8A 5LH8A 3S7HB 4Y6DA 3O8CA 4AB9A 3A86A 4R0IA 3M3VA 1O2UA 3MOCA 1NESE 1K1IA 4ZHMU 1UCYE 5HGGA 3SV2H 1AFEH 4IW4E 2C8YB 2ZDAH 3B8JA 1TX7A 3RXAA 1KXDA 4MPVA 4DG4A 2Z94A 1G36A 4FUGA 3RP2A 1MUEB 4IC6A 3GCOA 3ZVAA 2STAE 1FIWA 2ZZUH 1ZTLA 1HJ8A 2A5IA 3RXIA 3UY9A 1QBVH 1O3HA 3VB3A 3ZYDA 3W94A 1O2IA 5A8YA 1YPLH 5LGOA 4Y7AA 1OKXA 1K1NA 6LPRA 3RXKA 5FX6A 1CHOF 2C90B 1IQFA 1T4VH 3RXJA 1DUAA 2OD3B 3IWMA 3E0PB 1GCTB 1GPZA 4GAWA 3MH5A 1MKWK 1ZZZA 2AEIH 1AU8A 5EW1H 1BBRH 2HRVA 2WPKS 2G5VA 2G51A 4ZUHA 3F9EA 3MU0A 3FANA 3EA7A 5HM2A 4UEHH 1WUNH 2QIQA 2SGDE 4ZHLU 2DE9A 4K1SA 3HK6B 2AYWA 3VB6A 3RU4T 1K21H 5EQSA 3KIDU 2ULLA 4RKJB 2J4IA 1O5CB 3HGPA 2Z6BD 1GJ4H 1Y3XA 4CRGA 1VITH 2GCTC 3VB4A 1AUTC 2B8OH 2VIPA 5L6NH 1XXFA 4MNWA 1CQQA 1SC8U 5TJXA 8ESTE 1A0LA 4MLFB 3SUEA 2VIVA 1C1UH 1ELCA 2Z9IA 1LHCH 4NCYA 4TY6A 5J4QA 1T32A 1WU1A 5CMXH 4FUBA 1EOLA 4U01A 2CF9H 2BD4A 2FI4E 1QL7A 3RXBA 1J14A 4OS1A 2F83A 3U69H 3DFLA 2FLBH 2VH0A 3RC5A 4B76A 1AQ7A 1H9IE 1SGDE 1GBHA 2BXTH 3QZQA 1TLDA 5DP3A 2OQUA 3NPSA 1V2ST 4GPGA 3AAVA 1EZSC 3LU9B 1C5WB 1GDUA 3V13A 2XXLA 1V2UT 1AVWA 3MH4A 1O2GH 1UK2A 2ZHEH 1LVBA 2OC1A 1F0RA 4E7RG 3L33A 1OP0A 1G2LA 2RDLA 1CE5A 4MG3A 2AGIX 2WPLS 3SV9A 1GJ7B 2HPPH 3S9AA 1UVTH 4X6MA 2P94A 1BTYA 3QUMP 4OGXA 1FI8A 3RXPA 1HNEE 1OP8A 1QB6A 1AB9B 2FOHA 2BMGB 1UTMA 3U1IB 4ZXYH 2EI6A 1J15A 2OC7A 1HLTH 1DXPA 1SGRE 1MCTA 4FUHA 1YPEH 2BD7A 3BG4B 1MKWH 1ZGIA 1PPGE 2GDDA 1K28D 2A4OA 3VEQB 2ODQA 1EAIA 2A7HA 2AMQA 1EJAA 1A3EH 3V3MA 2C8XB 1NS3A 1CT0E 1O2OA 1SGEE 2OC8A 1C5RA 1KXEA 1LCYA 1F2SE 4KELA 1OSSA 2YOLA 4RSPA 2LPRA 4O3UA 1LMWB 1FY8E 3LGVA 2H9TH 1LQDB 1QIXB 3RXUA 2B9LA 5F8ZA 1QURH 2ZDLA 2NWNA 1QBOA 4CR9A 2R2MB 1ZTJA 2WPHS 1CGHA 3SU2A 1B0FA 1BIOA 3FZZA 4B71A 1FV9A 2ZGXH 3MYWA 4FVBA 3EA8A 3SV7A 2IPHA 3F9GA 5C3NA 1Q31A 1UTJA 2XYAA 5AFYH 3KNXA 3TPIZ 2FO9A 1SGFG 1ZOMA 1SMFE 3PO1C 1UCYH 3DHKH 1C2KA 1ELEE 2VWLA 1ARCA 3PWBA 1EPTC 4NGAH 1TQ7B 1N8OC 1E38B 2FODA 2AS9A 2FYQA 1BTXA 4GCHF 3T27A 2ZQ2A 3PTBA 4O3TA 1SB1H 4OS6A 1S83A 1HJAB 1QJ1B 1EKBB 4D76A 2H6MA 2ZU4A 4FVDA 3F9HA 4GHTA 2TRMA 2F91A 1O3FA 4X2YA 2LNCA 3RMMH 4YO9A 5GPIB 1Z8JB 2XC0A 3HGNA 2GCHF 4AFZA 4AN7A 3T25A 1K9OE 1HAPH 1AIXH 1XX9A 1GJDB 1ZRKA 3OYPA 1TX6A 4IN1A 1PQ5A 3A8BA 1EATA 4YLUA 1SGIB 2R9PA 1BDAA 1GMHG 2C8ZB 1ORFA 1AHTH 1EJNA 3F6UH 1Z6EA 1A2CH 1Z1JA 9LPRA 1HAGE 1GGDB 2CF8H 2CJIA 1DWEH 2I6QA 3K9XB 2Z3EA 3KCGH 1XUHA 1C1OA 1DWBH 1OWEA 3ZV8A 1F0UA 4Z0KA 7LPRA 2B0FA 1QA7A 4X8UH 1D3QB 3ODFA 1TRYA 2ZP0H 1WBGB 1ELBA 3A81A 3M5MA 5BRRE 1TMUH 2BLQA 4F4OC 4MNXA 4Q7ZA 2BX4A 4B2CA 3P8FA 1P02A 4E7NA 1SL3A 1EPTA 2OP9A 3JZ1B 1IQEA 4X2VA 3SUFA 3QN7A 2EI7A 1Y3WA 2HVXA 2BDHA 2FOCA 5JBAS 1YPHC 1OPHB 4LXBH 1H9HE 1XKBC 6CHAC 1HAZB 1C5LH 1GMDG 3PTNA 2M5TA 4NZQA 1CHOG 2V35A 3RU4D 3L6PA 3PMAB 1G32B 1O2JA 1O3IA 3ZVCA 3ATWA 3TK6A 2FPZA 4ZAEA 2OLGA 1O35A 3M7TA 3G01A 2G81E 1TE0A 3SNAA 5EXLA 1VITF 2A0QB 1OWDA 5DG6A 4TPIZ 2ZG0H 2BOKA 3MI4A 2ILNA 2FIRH 3PMBB 1Q3XA 1KTTB 1ZLRA 1BHXB 2Y5GA 1MU6B 3ATIA 3F68H 1D4PB 1EXFA 4NIWA 3Q00A 1ZMLA 1C5VA 1DSUA 1Y3VA 3LC3A 4WH6A 3SNCA 1O5GH 5I25A 1YPHE 1BHXF 1OX1A 5AVDA 1V6DA 2G55A 1TA6A 3SJKA 5LPFA 3DFJA 4ISNA 4Z6AH 1P2QA 3ZZ5A 1DDJA 5L2ZH 1VJAU 5T6DA 1DOJA 2PLXA 4JZIA 4MPXA 1P10A 3LGTA 1MZDA 5I46H 3T28A 1RIWB 4CRFA 3NWUA 1BTZA 3STJA 4INHA 1C1SA 2UUJB 1YPJH 2VH6A 1AMHA 1CT4E 6ESTA 1HAOH 1IQMA 3ZZ7A 1SR5C 2QXIA 4QT8C 1ZJDA 1JOUB 1MAXA 1TOCB 4VGCB 1ZPBA 3BSQA 2H2ZA 3JZ2B 3RXSA 1CHGA 2VVUA 1SGQE 1O3JA 3ENSB 1ZMJA 4KTSA 1UTOA 3LGUA 3QGJA 3VGCB 1LKAA 3GCNA 2EA3A 2ZHWH 1A7SA 2GV6A 3D23A 2OQ5A 2PHBA 4H6TA 3TJVA 1V2TT 1QCPA 3VPKA 3ZZCA 1LPZB 2XC5A 1BQYA 1P0SH 2GZ8A 3UOPA 1O3EA 3PROA 1EB1H 2CMYA 2O8TA 3C1KA 1K2I1 3IG6B 2PWXA 3U98H 1BJVA 4ZROA 4CRAA 1EP6A 2RCEA 3ZZ9A 2BD9A 5ETXA 1MBMA 1QJ7B 5GWZA 2UUFB 3K65B 3SN8A 1G30B 2ZDKA 3SU0A 1TNHA 2CXVA 1C1TA 1SLXB 1L1GA 1WTHD 2ZC9H 4GSOA 3TK9A 3AW0A 2FZZA 2BD2A 3SUDA 5FAHA 1SQOA 1GMCG 2QAAA 4HI3A 1A5GH 1BA8B 3SJ8A 1QA0A 1W13U 6GCHF 3SJ9A 4A1VA 1LHEH 1TBRH 1CA0C 2PSYA 2ZTXA 3BF6H 3SGQE 2VIQA 5EQQA 5EODA 1UMAH 1W7GH 4H6SB 1IQLA 2VVVA 1WQVH 1LHDH 1GI2A 5C1YA 1NU9A 1P11E 1VCQA 5CE1A 5JBTA 3S0NA 1KDQA 2BTCE 1KLTA 3Q3XA 1AD8H 1Z6JH 1LVOA 1O5AB 2BDBA 2BZ6H 2CV3A 1BBRE 2P95A 4X1NU 2NU2E 2D2DA 3SUGA 1FY1A 3E90B 2JH6D 2Y7ZA 1O3AA 3PLBA 2W7SA 4CRCA 5DO4H 1ELFA 3A88A 2NU0E 4AYVB 3SI4H 1Y5UT 4GCHG 2FMJA 2KAIA 1D6RA 1THPB 2BM2A 1W10U 5FBIA 4IS5A 1O3DA 1GBMA 3SU4A 2ZPRA 2ANKH 5FPSA 2OUAA 3TJUA 4X8SH 2FTLE 4WMDA 2VNTA 3E91A 3MNXA 4AB8A 5A2MH 1NU7B 2XBYA 3D62A 1TNGA 3MNSA 4JZFH 5JB8S 5A0CA 1VCPA 2B7DH 1ETRH 1O2SA 1BTWA 1XKAC 2C8WB 1UHBA 3MHWU 1SLWB 3S9BA 1T8OA 2ZA5A 1BOQA 1ETSH 3BTFE 2PW8H 3OX7U 4KTCA 4Y8XA 5A8XA 1UK4A 1ID5H 2EI8A 4Y8ZA 3TVJB 4K60A 5EXNA 1SBWA 2VGCB 2Y5HA 5F03A 3LIWA 4ZH8A 1WQSA 1ARBA 3RDZA 1WOFA 3TJOA 1SPJA 3ZZDA 3ELAH 1PPCE 4GVUA 2GKVE 1QB1A 1IQIA 2WUCA 3BTHE 4DT7B 1O34A 3P6ZB 4ABHA 4BTUB 2PSXA 1HRTH 1T8NA 5DP8A 2VWOA 3BTDE 3TH4H 2QA9E 4YLQH 3B9FH 1EUFA 1GI8B 2GGVB 3E8LA 3A87A 3O8DA 1GBFA 3M5NA 1A1RA 3E3TA 5DP5A 3H7TA 5DP4A 4X2XA 4DW2U 2CHAC 1ZHRA 2DUCA 2FESH 2BLOA 1GJ8B 2J2UA 1SLVB 1EOJA 1F7ZA 4Y79A 1YCPM 1AN1E 4CH2B 3RXOA 3UTUH 7ESTE 2OBQA 4NIXA 1PPZA 2OBOA 4XOJA 3AW1A 2ASUB 5A09A 1MCVA 1CBWB 1VITG 2XNIA 1S81A 2P16A 2BY5X 1GMHF 1C2GA 2PUXB 1C9PA 3LGWA 1QQUA 4U30A 3BIUH 3LOXA 1AFQC 3GCHB 3RXVA 1DWCH 3T26A 2ANYA 3S7KB 2O9QA 1O3LA 5C2ZA 1H1BA 4ISOA 1C2IA 1E0FD 2PGBB 1Q2WA 1S0RA 1KXBA 2ANWA 4RN6A 1ZRBA 1QBNA 3M7QA 3NZIA 1YYY1 3A7VA 1AKSB 1W14U 3MNCA 4NA7A 1O2VA 4A1TA 3K2UA 2OC0A 3A83A 1O36A 4NA9H 1C2FA 3MU8A 5A8ZA 1W0ZU 4FU8A 1OWKA 1P2MA 1YPMH 2R0LA 3MMGA 5SGAE 2R3UA 1MAYA 1ZSLA 1P57B 2PR3A 1GI4A 4K8YA 1MTUA 3RMLH 1ZTKA 1WCZA 1OS8A 1GJ5H 2H5CA 3BTQE 3GYLB 5EQRA 5F6MA 1FDPA 3GDSA 1O38A 2Z9LA 1TGTA 5EPYA 1PYTC 1XM1A 3KF2A 1GMDF 5FPTA 4NWLA 3HPTB 3SU3A 1C1MA 3GY6A 2AGEX 4I8GA 3AASA 2PV9B 1IQGA 4ABJA 1DM4B 4JMYA 3M35A 1V2RT 1P12E 5EW2H 3EAJA 3RXHA 4DURA 3RXRA 1O3MA 4XE4A 1JRTA 2W5EA 3P8GA <