4GAWA

Crystal structure of active human granzyme h
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
226
structure length
224
Chain Sequence
IIGGHEAKPHSRPYMAFVQFLQERKRCGGILVRKDFVLTAAHCQGSSINVTLGAHNIKEQERTQQFIPVKRPIPHPAYNPKNFSNDIMLLQLERKAKWTTAVRPLRLPSSKAQVKPGQLCSVAGWGYVSMSTLATTLQEVLLTVQKDCQCERLFHGNYSRATEICVGDPKKTQTGFKGDSGGPLVCKDVAQGILSYGNKKGTPPGVYIKVSHFLPWIKRTMKRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Granzyme H
publication title Identification of SERPINB1 as a physiological inhibitor of human granzyme H
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 36
structure length 224
sequence length 226
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature ec 3.4.21.-:
pdb deposition date 2012-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4gawA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4gawA02
3QO6A 1P2KA 4ZKRU 1Y3UA 1G37A 1THPB 1NRNH 1NFUA 2AGEX 4BAQB 3L6PA 1CU1A 1LTOA 1GI9B 4BTUB 1C5ZB 4Z0KA 2P8OB 2OBOA 7ESTE 2ZPRA 4IC5A 1GBIA 1TMUH 3VB7A 4AB8A 1AFQB 4THNH 3V7TA 2OUAA 2XW9A 2FM2A 1F0UA 3KEEA 1P9SA 2HNTE 4MTBA 1O2ZA 1GMDF 1HJ8A 1O2GH 1W3CA 2OP9A 2VVUA 2SGAA 3ENSB 1PPZA 3UWJH 4IS5A 2ESTE 1NC6A 1S83A 2TGDA 2BY6X 2ZDKA 2SGDE 3GYLB 2B7DH 1JRTA 1FPHH 1D3TB 2ASUB 1ETSH 1YCPH 5E8EH 2CXVA 3MH4A 5E0JA 1GCDA 2ANKH 4ZXYH 2O8MA 2BZ6H 2Y82A 3EAJA 2QY0B 3SU4A 1TRYA 3QTVH 4TPIZ 1WCZA 2GVFA 5ABWA 3P8OA 2XWBI 1BRCE 1C1WH 1EZSC 2C8WB 1L4ZA 2J94A 2TGTA 4KGAA 3VGCC 4ZKOU 4YTAA 3BV9B 1YBWA 3TGJE 1MAXA 2ZGHA 5L2ZH 2PUXB 5FX5A 1HYLA 1BT7A 1JIMA 1TB6H 2WPLS 1FJSA 1W8BH 1EZUC 3EGKH 1AZZA 3GY8A 3TH2H 1O2HA 3PM3A 2C90B 1VJAU 3BN9A 1H8DH 1QURH 4DIHH 3ELAH 1AMHA 2TBSA 2GTBA 1C5TA 3MH5A 1ORFA 5T3HA 1CE5A 3P8NA 1QL8A 1MU6B 5FAHA 2ZHFH 3LU9B 2UWOA 3KQDA 3WY8A 6CHAB 1DWBH 3DA9B 4OGYA 1S0RA 4Y8ZA 2ZA5A 5A0BA 2VIPA 1F0RA 1HIAB 1DUEA 3SJOA 2SNVA 3P95A 4Q7XA 3ZZ7A 1GBMA 1KLIH 1MD8A 3P8GA 1C5RA 1JBUH 4BNRA 1ELAA 2SGEE 2XBYA 2OQUA 4R0IA 1IQMA 1GBJA 2FOAA 2BLVA 1H9LB 1V2MT 1MUEB 1XVMA 1N8OB 3EA7A 3KCGH 3M7UA 3QGJA 1C5XB 1QJ6B 1AQ7A 4TWYA 1ACBE 3MOCA 1TMBH 2QAAA 1IQJA 1TGSZ 2Q6FA 2HVXA 3RMNH 2PUQH 3SJ8A 1A5IA 1G30B 4GPGA 1AB9C 5DGJA 1GMHG 4ZROA 1W14U 3A87A 1EJMA 1MTWA 3LT3A 1GJ4H 2FDAA 1A3BH 4X8VH 3SI4H 3MMGA 3D65E 2ODPA 1ZMNA 3U98H 1Y8TA 3RXEA 1AZ8A 1F0SA 2FX6A 7LPRA 1M9UA 2IN2A 3LGWA 4CHAC 5GDSH 1C2FA 1O32A 5DP4A 1INCA 2ZDAH 1O3MA 2BOKA 1O5AB 3LGTA 5JB8S 1EZQA 4O97A 1GBKA 3AAUA 2ZDLA 4NFFA 4D76A 8LPRA 5IDKA 4RSPA 1QL7A 1UCYH 4ZKNU 2Q6DA 2GZ9A 4F49A 1GI4A 4D8NA 1ZGIA 5C20A 1LHCH 2BVXH 1IQEA 3AW0A 2GCTC 3MO9A 3I78A 1CT4E 4NG9H 4X2VA 3TK9A 4I8GA 2A7CA 3ZYEA 1BRAA 1KLTA 2G4TA 1IQHA 1T8OA 2ZECA 5IYTA 3F1SB 3BTKE 1BQYA 1DICA 1DPOA 1SLXB 4K60A 4BTTB 1IQGA 1UTLM 2O8WA 3QDZB 4GLYA 4INHA 3SGBE 5JYIA 2V6NA 1K1MA 3URCA 5DJ7A 5EW1H 1PPHE 1SLUB 1LVBA 2BDYA 3RXGA 4M7GA 1W10U 1ZHPA 1PQ5A 3DD2H 3ZZ5A 2GGVB 2UUKB 1GG6B 1WTGH 1SG8B 1X7AC 2CMYA 3F9FA 1V2VT 2FI3E 4SGBE 3UOPA 5AF9H 4ABHA 2ZU5A 1TPOA 2Y80A 3PO1B 1B7XB 3RXQA 1GI6A 3K6YA 5E2OA 2PKSC 5EPYA 5EU8A 1LPZB 3BTQE 4FUEA 1Q2WA 1GJ6A 3OX7U 1DLKB 3RXIA 1A7SA 1SPJA 3A81A 1OWDA 1O2YA 3M61U 3OU0A 3TGKE 1CA8B 5EXMA 1ZSKA 2AGIX 3IG6B 3E0NB 1O2NA 1BTPA 2UWLA 5HMAA 3SUEA 3F9HA 1IHSH 1C5WB 3LH3A 4CRDA 4O3TA 1C2LA 3TPIZ 3RP2A 1ELBA 2P93A 1GJDB 1V2QT 1G2MA 1V2UT 2G51A 1BMMH 1MKXK 1FXYA 2BDCA 3EDXB 3RXVA 3TK5A 3ZZ9A 1HXFH 1O2RA 2VINA 2PW8H 3KF2A 5C67A 1O3OA 3PMAB 1S5SA 5AVDA 1TX7A 3N7OA 3URDA 4JK5A 1ELFA 3ZZCA 3GDSA 5EGMA 2XCNA 3GICB 2ZFSA 1O30A 2XNIA 4K1SA 1AKSB 2STBE 3GCHB 2AIPA 1SQAA 1QY6A 2CGAA 4NIVA 3QZQA 4BOHA 1SVPA 3SHCH 4UFFH 3RU4E 1ELEE 1HAZB 4B76A 3U8RH 4NZQA 1FMGA 4X1QU 2R0LA 1BHXF 1NFYA 1ZSJA 1MQ5A 1XMNB 4AG1A 1T8NA 1ZTKA 3RXAA 2QF3A 3T26A 1OXGA 4Q2KA 4IN1A 1AKSA 1GI2A 2O9QA 1AO5A 3BG4B 4B74A 5FBEA 4INLA 1AUJA 3H7OA 3EE0B 1YPHE 2IOTA 2TGAA 1VITF 1GBTA 1O2LA 1C5PA 5DPAA 4LK4A 3SW2B 2ANMH 2VVVA 3RXLA 2HALA 5DG6A 3DFLA 1S85A 2ULLA 4ISOA 3RC6A 1TFXA 3VPKA 1HAVA 1U6QA 3ATMA 4Y11E 1YKTA 4CH8B 3OY5U 1OSSA 1KLJH 3UQOA 4ABDA 5FPYA 2R2MB 3RXOA 3O8DA 1EZXC 3NXPA 1Z7KA 1Z8IB 3M37A 1C1VH 2GMTC 3RU4D 1VGCB 1GHVH 1FY3A 3W94A 4I8JA 2VWLA 1A4WH 3ATLA 5GWZA 1OWIA 1MZAA 2JETB 1GDQA 1MZDA 5FBIA 3PMJA 5JBBS 5EQRA 4DT7B 5JBTA 2J2UA 3ESTA 2Y5HA 2V35A 1C1QA 3VB4A 4TY6A 3VB5A 2CN0H 2W3IA 1TNJA 2WPIS 1GJ8B 1O2SA 1P03A 3BTWE 1PFXC 1DX5M 7GCHF 4ZHLU 1LHGH 1YPLH 1O36A 2BVSH 2NU0E 1VR1H 2F91A 1GHAF 4AFUA 5HM9A 1C5UA 3GDUA 1UTKA 3E8LA 3LKWA 1QCPA 3HGPA 3KHVA 1FY1A 2VVCA 2G8TA 3ATWA 1AVWA 1FNIA 1KDQB 1K9OE 2BZAA 2THFB 1ANDA 4DGJA 2ZIQH 1O3IA 2BD5A 2Y7ZA 4E06H 2BLWA 2PR3A 3QTOH 1W13U 2VNTA 4K5ZA 1GBHA 3M5LA 1L2EA 4FVBA 3PV4A 4NSYA 4GCHF 1DVAH 1DANH 3VXFH 4Y71A 1WV7H 3UPEA 2J9NA 5EOKA 1ZYOA 3UFAA 1EOJA 3TNSA 4XDEA 4A1XA 2OXSA 1FY5A 1P06A 1XXDA 2V3OH 1NFXA 2ZG0H 1QNJA 4PROA 4XFQA 5GCHG 3KGPA 1QFKH 2UUYA 4JZ1A 1L0ZA 3LJOA 2FX4A 5DP8A 5GPIB 2C8ZB 1BBRH 4OS7A 1DUAA 1GI1A 1RD3B 1THRH 1SGFG 4NWLA 2AH4X 4K1TA 5FPSA 2ZZUH 1Y59T 1Z8GA 2ALVA 2XTTB 3T28A 2XWAA 1L1GA 1BMNH 2BD9A 2ZKSA 5LPFA 1O2PA 2PLXA 2ZCKP 1V2ST 1FN8A 5PTPA 4YLQH 2FPZA 3GY3A 1TQ7B 2FYRA 5C5NA 1SLVB 3GISB 3FANA 4Y7AA 4BTIB 1ZJKA 5ETXA 1OKXA 3RXDA 2A4OA 2CV3A 5EQSA 1C5QA 3A82A 4NGAH 4X1NU 1GL0E 1KXFA 3S7KB 1HAXB 1S82A 4GHTA 4YT7H 2XYAA 1HJAB 1FAKH 3BEUA 1P3EA 1AE8H 2QF0A 1XXFA 2BD2A 1BTWA 1J17T 1EX3A 4CRAA 1QHRB 2NU1E 1MU8B 2G81E 4SGAE 3U69H 3U9AH 3UTUH 2BY7X 1GDNA 4DOQA 1K21H 3AVZA 4X2YA 1V3XA 9LPRA 2ZF0H 5LPRA 1P8VC 1LPKB 1K1LA 4UONA 1O3JA 4NIWA 3BTFE 3MI4A 2CF8H 8GCHG 1TRMA 2GD4B 1YYY1 3B8JA 3HK3B 3MU8A 1GI3A 1Z8RA 3PYHA 4VGCC 1NROH 1YCPM 3KQCA 1MBMA 1QBNA 4Q7ZA 1NZQH 3MTYA 2VIQA 1D9IA 4NSVA 2J4IA 2ZFTA 4ZAEA 1SGPE 2BQ7B 1JWTA 1TPPA 5LPEA 1O31A 3RXPA 2BD4A 1C1OA 2OD3B 3LJJA 5GJ4B 4DG4A 1NRPH 3FVFB 2Z9LA 1CA0B 1C5YB 3SU0A 2A4QA 1ZSLA 4AG2A 1O2OA 2GX4A 5J4QA 2F9UA 1N6XA 3GY4A 4DY7B 4QT8C 1MTNB 2WV4A 2VGCB 2FP7B 1GVLA 1O3HA 1QB9A 2H9TH 1IQKA 2FOHA 3TH3H 1EP6A 3UREA 1T4UH 3H5CB 4AGKA 1P2OA 1UTOA 1O5GH 1TPSA 1VZQH 1Z1IA 2R0KA 3ITIA 1EPTC 3TVJB 4HZHA 3ZZBA 2GT8A 4AYYB 2AEIH 3RXRA 4MQAA 1K1OA 2P3TB 2F9NA 2ZQ1A 1UK2A 1YC0A 1O35A 3ZYDA 4NIYA 2BQ6B 3AASA 4KKDA 2ODQA 1XUHA 1Y3WA 4ZMAH 5EXNA 3BEIB 3MU4A 2FODA 3UY9A 3P70B 1PQ8A 3BIUH 1V2PT 1GDUA 3M7TA 3MYWA 4ABAA 1ELGA 2Z3CA 2WUBA 3SUFA 1GWAA 2BD8A 3S69A 2Y6TA 2GCHF 4NWKA 1XUIA 1ZTJA 4BANB 1Z8JB 2PTCE 4B73A 1TRNA 1O0DH 2HGTH 1Q31A 1DS2E 1HAHH 3K6ZA 4RKJB 4B75A 3SUDA 1GGDC 4WH8A 5FPTA 5BRRE 5LGOA 2C93B 5DP5A 5AFYH 2AS9A 1QJ7B 2STAE 3VFEA 1HAPH 3NPSA 3DT0H 3ZV9A 1MTUA 2B8OH 2BDIA 3ODDA 1O2UA 1A0HB 3KIDU 1TBZH 2R9PA 1V2NT 3D49H 1CBWB 5H4IB 5C3NA 4WMEA 1RTFB 2HOBA 3RXBA 1HFDA 3K2UA 2A45B 1O5FH 3BTDE 1A46H 4NA8A 3MO3A 1K28D 3O8CA 1AGJA 1OX1A 1QA0A 1KTTB 1PPGE 4HI3A 1DXWA 5DO4H 2H2ZA 1WQVH 1MMJN 1LQEA 4X2WA 6GCHG 4FUBA 4WWYA 5SGAE 1W2KH 1KXBA 3M3VA 1W7XH 3SZNA 2EC9H 1NRQH 1V2KT 2BDAA 2J92A 1TMTH 4ZHMU 5A8YA 3PB1E 4AZ2B 1AWFH 4JYTA 3P92A 2ZCLP 4JCNA 1TYNA 2H9EH 1O34A 3HPTB 2AMPA 1AUTC 4TYDA 2Y7XA 2TIOA 4MVNA 3TNTA 2XC0A 1QQUA 2F83A 2FI4E 1TE0A 5A09A 3A8CA 1UJ1A 4MDSA 1RJXB 2BYAX 1QL9A 4A1VA 2W5EA 2ZTXA 4YO9A 3SU3A 2DE9A 4ABIA 1LHDH 1OS8A 2OLGA 3T29A 3NCLA 1MCTA 2A5AA 5HGGA 2QXJA 1C1RA 1LCYA 2WPHS 3DUXH 1UTMA 2OC8A 2A1DB 1HIAA 1PPCE 1FI8A 2VH6A 3S9AA 1KTSB 1GVKB 4GVUA 4AB9A 2Z3DA 3AAVA 1E36B 3AW1A 4IMQA 4FVDA 5FX6A 2KAIB 2CHAB 1BB0B 3LDXH 3TH4H 1JMOH 1ZTLA 1MBQA 2Q6GA 3ZZ4A 1RTLA 3KQEA 4IW4E 1Y3XA 5C2ZA 5EG4A 3VB3A 1A3EH 1O2XA 1K22H 4ESTE 1ESAA 1GMCF 3A7YA 4DJZB 1EAXA 3TITA 2XBVA 1GBDA 1QIXB 1E38B 2VWOA 2SNWA 2R3YA 2KAIA 1PQ7A 3W95A 3A8AA 5K0HA 1TWXB 2BY5X 1E0FD 4OS4A 1TAWA 2FOCA 3IITA 2IPHA 1KXDA 1TONA 1V6DA 1SQTA 3F68H 2ZU4A 4JZFH 2BQWB 5FXLA 4X6NA 1D3DB 4JYUH 2FZZA 4INKA 1TGCA 1P2NA 4O9VA 1G3CA 1GVZA 1WU1A 1ANEA 1C2EA 3EA9A 3Q77A 5CHAB 1TX8A 2LNCA 1A1RA 1SGEE 4WJG2 3F6UH 3NUMA 1H9HE 1TNGA 1W0YH 1TGBA 1VCQA 1ZPZA 4MPVA 4FU7A 1P02A 3MNCA 1C5VA 2NWNA 1SGNE 1ZZZA 3M7QA 3PLBA 4H6TA 2WINI 3GDVA 3UNSA 1NY22 3SO3A 2O8LA 4XOJA 1PYTC 1BDAA 8GCHF 1CHOG 6CHAC 4OS6A 2BX3A 1LKBA 1Q3XA 4Y0YE 5EQQA 1TGTA 1E37B 1BCUH 3BIVH 1DWEH 1AFEH 1SFQB 2WYGA 1T31A 3A7VA 3PWCA 1UTNA 1BTYA 2VIOA 1O2TA 1OP0A 1FONA 2PGBB 1DY8A 3E6PH 5L30H 4E7NA 4BAHB 2ZHQH 6ESTA 4LZ1H 3RMOH 2AFQB 2ILNA 3LGUA 3OYPA 3SV6A 1OPHB 1AY6H 1V2JT 1A5GH 1O37A 4I8LA 4J1YA 2P8OC 2WV5A 2BDGA 4B1TA 3BTTE 3LPRA 1AFQC 4B2AA 1WOFA 1BBRK 1ARBA 1NPMA 3V3MA 1GL1A 2FOMB 2QIQA 1SSXA 3MU1A 5FCKA 4CH2B 1P2QA 2VB0A 1HCGA 1SC8U 1SHYA 1CVWH 4NZLA 4AGJA 3UIRA 3TIUA 4TY7A 3OSYA 1O2JA 1YPMH 2Y5FA 1AI8H 2QC2A 4MG3A 4RKOB 4I8KA 1GJCB 3GCTG 3SUGA 1SL3A 4A92A 1ESTA 5TJXA 1E34B 1NO9H 4BXSA 1TNLA 2PTNA 3GY2A 1ZRBA 2BDBA 3V0XA 3C1KA 2VIVA 3B23B 3FP7E 1FN6A 2ZPSA 1YPGH 2BVRH 4Q7YA 3ZVBA 1KY9A 3BG8A 2HPQH 3LGVA 2QV1A 1XKAC 1YF4A 1W11U 3FZZA 1A0LA 3EQ0H 3UUZA 4FUHA 1O3GA 1MCVA 1XUFA 2XRCA 3RDZA 1V2WT 3SNAA 4BAOB 2ZFPH 4UDWH 5LH8A 3SN8A 5ESTE 1XUKA 4K1EA 5EXLA 1G9IE 1XM1A 2TRMA 1HAIH 1AIXH 2W7UA 1O3NA 1K1IA 1YPKH 3RXUA 1NT1A 1IQNA 4ABEA 3T25A 4JZIA 1TABE 1KYNA 1JIRA 4UFDH 1A61H 2ZQ2A 4JK6A 1SI5H 3ZVDA 1G36A 1BRUP 2ZNKH 3TJOA 3DFJA 3SU1A 3M35A 1C1PA 4NA7A 1GJBB 1PPBH 3L3TA 1BRBE 1GI8B 3RC4A 1Y3YA 2BB4A 4YESB 5A0CA 1CT2E 1FUJA 2HWLB 4K3JA 3E1XB 1HV7A 3QX5H 2VJ1A 4XSKU 3SJ9A 1OP8A 1UTPA 3S0NA 4XBBA 1TGNA 2C8YB 1GHBG 4ZUHA 3KN2A 1KXAA 1C4Y2 2ZDNA 2ZI2H 3LC5A 2J95A 1TBRH 1P12E 1P2JA 5GIBA 2JH6D 1O5CB 3ATIA 1KSNA 2RA3A 4YOIA 4WH6A 4CBOA 2FWWA 1UVPA 2EI8A 4FUJA 4F4OC 3V12A 1QJ1B 1YP9A 1O3KA 1OWKA 1O5BB 2HLCA 4FUGA 1RIWB 3Q00A 3NWUA 1RRKA 1J15A 3LGYA 4IGDA 1BIOA 1B0EA 2FTMA 3RLWH 2AMQA 2C3SA 3KL6A 4FXGH 3Q3XA 4UFGH 1TBQH 4XBCA 1S84A 3NZIA 3A88A 1EQ9A 4FUIA 5A8XA 1QBOA 1EKBB 1GMHF 1HXEH 3A8DA 1ZJDA 1C2MA 3FP6E 3LC3A 2RG3A 4JZEH 2AERH 4XE4A 4ZXXH 5CMXH 4BAMB 1GBEA 4DCDA 5AHGH 3SOSA 3ZVEA 3T5FH 1OP2A 1F5KU 3MNBA 3GY7A 3HKIB 4A7IB 4AOQA 1L1NA 3ZZAA 2AMDA 5F8ZA 1GCTC 1O2KA 1YCPK 3GOVB 4DIIH 1VCWA 2ZHWH 1TALA 1F0TA 3P17H 2PHBA 1HGTH 3RXMA 5T6FA 4FUCA 3SQHE 1IOEA 5TCCA 2Y81A 2ZHEH 4IMZA 3S7HB 1ARCA 1UVOA 1HAGE 3VEQB 2BHGA 4WXVA 1WAYB 5HYOA 2A2XH 1A5HA 4D7FA 1W0ZU 4NIXA 3Q3KA 2OCVB 1O3LA 3BTGE 1SGCA 1ELVA 1K1PA 2D8WA 3V13A 1UHBB 1C9PA 4O3UA 1EAWA 1HLTH 3VGCB 1C1MA 2H6MA 3LH1A 1SGIB 2BDHA 4CRFA 1KDQA 1HAYB 1Z6EA 4WF8A 1DOJA 1EB2A 1GHXH 1HAOH 1G3BA 3T2NA 4Y10E 3GCNA 3RXTA 1NU7B 1GG6C 3QGNB 1C2GA 2V3HH 1NM6A 3TK6A 2JKHA 1O2WA 2W7SA 3UWIA 2ZTYA 1C1UH 1O38A 2XC5A 1PJPA 1QRWA 2XXLA 1ZLRA 3R0FA 4B2CA 4R8TB 1EUFA 2BM2A 3PO1C 1ELDE 1O3CA 2BXUH 2SFAA 2UWPA 3JZ2B 2GT7A 4NA9H 4WMDA 1AWHB 1SGFA 3ODFA 4AFZA 1LDTT 2ZGXH 1OYTH 1QA7A 1P09A 3SGQE 3PROA 2ZFRH 2XBXA 1XUJA 3PMBB 1P9UA 5DP7A 2C8XB 4NFEA 3MNSA 2VWMA 2CJIA 4RN6A 2I6QA 3OTJE 4FU9A 3QLPH 2W3KA 1YM0A 3KNXA 3ZVGA 4Z6AH 2ZO3H 3ZVCA 3RM2H 1FAXA 5JB9S 2P59A 1C2DA 1D6RA 3F9GA 4ABGA 1LVYA 3I77A 4Y8XA 1AVXA 1CGIE 1FY4A 1CSOE 3F9EA 2JH5D 2FO9A 1AB9B 1BTUA 2BTCE 2EI6A 2UUFB 3MH7A 2RDLA 4K2YA 2XC4A 5HXFA 1D3QB 1QQ4A 2HPPH 3OY6U 2QA9E 3ZVAA 1FLEE 3QK1A 1MKXH 1KXEA 1L1JA 5BPEA 3GCHC 3UR6A 2BY8X 5K7RA 1N6YA 1QRZA 4Y7BA 4CHAB 1UCYK 2GDEH 2HNTC 1SLWB 3TJNA 3E3TA 3SHAH 2H1UA 2OQ5A 4ABFA 1K2I1 4BAKB 4HGCA 2ZTZA 4FUDA 3PTBA 5I25A 3MU5A 4I7YH 2XBWA 3SGAE 4Q80A 1OYQA 1GJ9B 1LVMA 3ZZ6A 2A4GA 2YNAA 3BG4C 3A8BA 2QGRA 3RXCA 3A7WA 1QGFA 2AIQA 2QXIA 4X0WU 3SORA 4MNXA 1T4VH 1HRTH 4KTCA 3M5MA 2GCTB 4GUXA 9ESTA 4LOYH 2EA3A 4YZUA 3SJKA 3RXHA 4AFSA 1RXPA 3BTHE 1O5EH 1QB6A 2FOEA 1EAUA 2H5DA 4OS2A 4CBNA 1IQFA 4GHQA 1V2OT 1DSUA 1ZOMA 2HNTF 3HKJB 5C1XA 3A7ZA 2OC1A 1W7GH 3S9CA 1C5OH 1NFWA 4X6PA 1Z1JA 1TPAE 2B0FA 1VGCC 1S6FA 2F9OA 4DVAU 4MLFB 4KP0A 3CENA 4Y79A 1SQOA 2JETC 3RXJA 1C2JA 3RXKA 5JBCS 2YOLA 2G5NA 3LGIA 4WVPE 1ZPCA 3BEFB 4UEHH 3LIWA 3VXEH 4UD9H 1BTZA 4CRGA 1QR3E 1DITH 2PV9B 1PQAA 2LPRA 2WPJS 3QZRA 4GSOA 5G4BA 1AE5A 4YLUA 1V2LT 2A2QH 1GHZA 4ISIH 1P11E 3TJUA 1LQDB 3O8RA 4JYVH 1RFNA 1WTHD 2FI5E 1XKBC 1IAUA 2ZEBA 2GDDA 1O3BA 1LVOA 2FS8A 2PKSB 1PPEE 5JDUB 1H4WA 3SNCA 3UOUA 4Y0ZE 5DP6A 4YOJA 2XCFA 4JZDH 1FQ3A 3PWBA 2HRVA 2I6SA 4X6OA 2P94A 3IWMA 4D9RA 5JBAS 3PLPA 1FDPA 1AHTH 3STJA 3U8OH 1T8MA 2TPIZ 1O3FA 5DP3A 1ID5H 1F2SE 1EAIA 1GPZA 2D2DA 1O5DH 2BMGB 1F5LA 4ISLA 1BHXB 2H5CA 1Y5UT 1NU9A 3JZ1B 2DUCA 2G55A 4AX9H 4X6MA 3Q76A 3M3SA 1UK3A 1BJUA 3SNBA 3UQVA 3FP8E 2VH0A 1HDTH 2ZFQH 1Z71A 4I32A 4ISNA 1SGTA 4I8HA 1EP5A 1NTPA 1D6WA 3RC5A 2FLBH 2PKAB 3A89A 4H4FA 2OC7A 1SGYE 2GKVE 3SU6A 3KQBA 3QN7A 3LOXA 3BTME 1AU8A 1SMFE 1OOKB 2AYWA 1OWJA 1CGHA 2FOBA 5E0GA 1O2QA 5GXPA 1VITG 5GCHF 2F3CE 4X1RU 1BMLA 2NU2E 1MKWH 1PPFE 2ZDMA 1ZHRA 3HGNA 4E05H 1BOQA 1NESE 3A86A 2PKAA 1FY8E 4X8SH 4AN7A 4U32A 3FZDA 5L6NH 1C1NA 1O33A 4LZ4B 3UNRA 4AORA 2VWNA 3NK8A 4Y8YA 4K69A 4AYVB 1G32B 4WY3A 4CR5A 4CR9A 4XBDA 3BF6H 1CGJE 1ZGVA 1HPGA 2ZPQA 3U1IB 2P16A 3M36A 1EATA 1HJAC 4WMFA 1SBWA 1C5SA 3CS7A 3PMHB 1CO7E 2FTLE 1UVTH 3G01A 1DFPA 1ESBA 2R3UA 3A85A 4FU8A 2F9VA 2GMTB 4OS5A 1ZHMA 4UE7H 2ANWA 1RGQA 5L2YH 2UUJB 7GCHG 1WUNH 1B0FA 4YM9A 3RXSA 1UTQA 1EXFA 2P3UB 3GY6A 3QWCH 4KTSA 4E7RG 3SV9A 4LXBH 1QTFA 1Y5AT 4D9QA 5HM2A 1BUIA 2ZU2A 1NS3A 1GHAG 2A4RA 1XVOA 1DSTA 2ZGBH 4K8YA 3RLYH 5EPNA 1AVGH 1BTHH 1ZR0A 2G4UA 3A7XA 5T6DA 2D1JA 3R3GB 2TGPZ 1GCTB 1P04A 1TOCB 2PSYA 2ZDVH 1QRXA 1ELCA 1V2TT 2ZU3A 3SI3H 4NCYA 1BZXE 1FV9A 2QCYA 2A32A 1YPEH 4GCHG 3SNEA 3QUMP 3EYDA 1CA0C 4I33A 2YNBA 1K1JA 1O2MA 3GCOA 5TCAA 2V0BA 1UTJA 2Z6BD 1JRSA 4BXWA 1MTNC 1KXCA 1WQSA 3UNQA 2VGCC 2H9HA 1G3DA 1GJ7B 1BA8B 1YPJH 2Q1JA 3PTNA 2J34A 1ANCA 3SNDA 2FXRA 1C2KA 5J4SA 1C1SA 1SOTA 1O3DA 2K1QA 4ZKSU 3RUOA 3SQEE 3MFJA 8KME2 4X2XA 5F03A 1DM4B 1MH0A 5CE1A 4X1PU 3SU5A 1ABIH 3A80A 1V2RT 3SV8A 3SV2H 3TU7H 4CREA 3S9BA 3GY5A 2ALPA 1S81A 2Z9JA 1P10A 2B9LA 4MNWA 1O3AA 1D4PB 2F9BH 2ZU1A 1ETTH 1UVSH 3T27A 2DE8A 3P6ZB 2A7JA 3B9FH 1DWDH 4MPXA 1C4U2 3K65B 5DP9A 4HFPB 1YPHC 3PLKA 1FIZA 2SGFE 1UCYE 1N1LA 3GYMA 4TWWA 1ZMLA 1IQIA 1VCPA 2A7HA 1FPCH 1TNIA 1T7CA 1F7ZA 5E2PA 1DLEA 1GI7B 1YLCA 2IJOB 1KIGH 2Z9KA 1C5LH 2PWXA 5DKMA 1F92A 2FOGA 4IC6A 1P2MA 1CBWC 4MPUA 1A0JA 4ASHA 1VITH 2BY9X 1F5RA 4Y76A 4A1TA 1P05A 1H9IE 1BMAA 1YGCH 4FUFA 4HTCH 3A84A 4H42U 1ELTA 1IQLA 2O8UA 1WBGB 2FEQH 3FFGA 5A8ZA 2Z9GA 3ZV8A 1BTXA 2BXTH 2ZHDA 5EW2H 3ATKA 2SGPE 4B71A 1MQ6A 3C27B 4I31A 2O8TA 1GBBA 1ABJH 2BOHB 1B5GH 2ZWLH 1HUTH 1Z6JH 1EJNA 1Y5BT 2BLOA 2FLRH 2SGQE 4DW2U 2J38A 5F8XA 1SGDE 1DDJA 1K1NA 3D62A 1H8IH 3RMLH 3M5NA 1AD8H 1N8OC 6GCHF 3HK6B 2GZ8A 2Y5GA 1P0SH 3LONA 5T6GA 1PYTD 2ODYB 3ZZ8A 3FAOA 1HAVB 2GP9B 1S0QA 2OBQA 4VGCB 3SU2A 3H7TA 4CRCA 1WSSH 3D23A 2A0QB 1CQQA 1S6HA 2CHAC 5AFZH 4A6LA 2ZFFH 4D7GA 4KTUA 4ZHAA 1T32A 2Z94A 1ZRKA 4IN2A 1RS0A 3MO6A 3E16B 1LPGB 1TX6A 4X8TH 1ETRH 1HBTH 1MAYA 1TNHA 1GBFA 1RTKA 2GZ7A 2RA0A 2PGQB 1GMDG 1C2HA 1G3EA 3RMMH 5F6MA 3E90B 2BD7A 3CS0A 1UVUH 1GHYH 5FHTA 4MNYA 1C5NH 4ISHH 1LO6A 4ABBA 4X8UH 1XUGA 1BJVA 1EPTB 2RCEA 3STIA 4CRBA 5DK1A 1O2IA 2ZC9H 4X1SU 2WYJA 1J9CH 2G5VA 5F8TA 3P8FA 2WUCA 2GCHG 1GJAB 1SR5C 4YOGA 1QBVH 2G00A 3TJVA 5JPMH 3E91A 1JXPA 2FIRH 1LMWB 3HATH 3M3TA 5CHAC 3I29A 4ZH8A 1GHWH 1O3PB 2OTVA 2QYIA 1ANBA 3O8BA 1P57B 1EPTA 2FESH 5ESBA 4KELA 1Y3VA 2JH0D 1NRRH 2Z9IA 1DY9A 4IBLH 2WPKS 4TPYA 1LHEH 1G2LA 3TGIE 5C1YA 1SGRE 5I46H 2A5IA 1QB1A 1P01A 4B2BA 3CP7A 2P95A 2ZGCA 3Q3YA 4UFEH 2PFEA 3VB6A 1IHTH 1TLDA 1TIOA 5FCRA 1MTSA 2Z7FE 5B6OA 6LPRA 1CT0E 1GGDB 1JOUB 3BTEE 1P3CA 2B5TB 2C4FH 2VU8E 2ZP0H 3MHWU 3ZZDA 1J16A 5A2MH 1H1BA 3UR9A 3MH6A 3E0PB 1CHOF 1UHBA 2Z3EA 5C5OA 1LHFH 1NRSH 1MD7A 3T62A 1CHGA 1GJ5H 5C1UA 3ZVFA 1C9TA 1J8AA 2VIWA 1D3PB 2PSXA 2NU3E 1OWEA 3SJIA 1DWCH 1A2CH 1GI0A 1MKWK 1SGQE 4GAWA 4WXIA 1O39A 4K8BA 1NN6A 3RM0H 1EB1H 2QXHA 1E35B 1L4DA 1DXPA 3U1JB 4U2WA 2EI7A 4U30A 2P3FH 4ABJA 8ESTE 1MTVA 2BLQA 5EODA 1EASA 2FOFA 1W12U 4Y6DA 2A31A 3MNXA 1O2VA 1GI5A 2OC0A 1GBLA 1GBCA 2QN5T 2FYQA 2GV6A 1SB1H 3GCTF 1GMCG 1HB0B 1VJ9U 2ANYA 1C2IA 2BX4A 3K9XB 1TA2A 2D26C 1C1TA 2G52A 1T8LA 3BSQA 2F9PA 2NU4E 1THSH 1FIWA 3ZZ3A 3SBKA 1TQ0B 3NKKA 1J14A 1OWHA 1TA6A 2FS9A 3SV7A 4AFQA 5A0AE 4O03A 1ZMJA 3RU4T 1TNKA 4DURA 1ZPBA 3A7TA 1O3EA 1WYKA 1UK4A 4J2YB 4A5TS 3A83A 3DHKH 1C5MD 4U01A 4MNVA 1SHHB 1UO6A 1EJAA 1HNEE 1TOMH 2CF9H 2M5TA 3EA8A 1YLDA 1P2IA 1BITA 1BBRE 1XX9A 4OGXA 4H6SB 1EOLA 1LKAA 2ZGJA 3M5OA 4JMYA 3TLOA 1HJ9A 1UMAH 2AGGX 1DT2A 2QXGA 2WPMS 4YT6H 3MU0A 3MWIU 4OS1A 2BD3A 2OINA 2W26A 2VIDA 2EEKA 2ZCHP 1GHBF 1SOZA 1SFIA 1RIWC 2GV7A 1AN1E 1FZZA 2A5KA 2FMJA 2R2WU 3RXFA 3U8TH 7KMEH 1DE7H 5E0HA 1C4V2 1GBAA 4MPWA 3L33A
chains in the Genus database with same CATH superfamily
3QO6A 1P2KA 4ZKRU 1Y3UA 1G37A 1THPB 1NRNH 1NFUA 2AGEX 4BAQB 3L6PA 1CU1A 1LTOA 1GI9B 4BTUB 1C5ZB 1QZ8A 4Z0KA 2P8OB 2KX4A 2OBOA 7ESTE 2ZPRA 4IC5A 1GBIA 1TMUH 3VB7A 4AB8A 1AFQB 4THNH 3V7TA 2OUAA 2XW9A 2FM2A 1F0UA 3KEEA 1P9SA 2HNTE 4MTBA 1O2ZA 1GMDF 1HJ8A 1O2GH 1W3CA 2OP9A 2VVUA 2SGAA 3ENSB 1PPZA 3UWJH 4IS5A 5EIYA 2ESTE 1NC6A 1S83A 2TGDA 2BY6X 2ZDKA 2SGDE 3GYLB 2B7DH 1JRTA 1FPHH 1D3TB 2ASUB 1ETSH 1YCPH 5E8EH 2CXVA 3MH4A 5E0JA 1GCDA 2ANKH 4ZXYH 2O8MA 2BZ6H 2Y82A 3EAJA 2QY0B 3SU4A 1TRYA 3QTVH 4TPIZ 1WCZA 2GVFA 5ABWA 3P8OA 4F48B 2XWBI 1BRCE 1C1WH 1EZSC 2C8WB 1L4ZA 2J94A 2TGTA 4KGAA 3VGCC 4ZKOU 4YTAA 3BV9B 1YBWA 3TGJE 1MAXA 2ZGHA 5L2ZH 2PUXB 5FX5A 1K0HA 1HYLA 1BT7A 3F2FA 1JIMA 1TB6H 2WPLS 1FJSA 1W8BH 1EZUC 3EGKH 1AZZA 3GY8A 3TH2H 1O2HA 3PM3A 2C90B 1VJAU 2V3MA 5CDFE 3BN9A 1H8DH 1QURH 4DIHH 3ELAH 1AMHA 2TBSA 2GTBA 1C5TA 3MH5A 1ORFA 5T3HA 1CE5A 3P8NA 1QL8A 1MU6B 5FAHA 2ZHFH 3LU9B 2UWOA 3KQDA 3WY8A 6CHAB 1DWBH 3DA9B 4OGYA 1S0RA 4Y8ZA 2ZA5A 1FX0B 5A0BA 2VIPA 1F0RA 1HIAB 1DUEA 3SJOA 2SNVA 3P95A 4Q7XA 3ZZ7A 1GBMA 1KLIH 1MD8A 3P8GA 1C5RA 1JBUH 4BNRA 1ELAA 2SGEE 2XBYA 2OQUA 4R0IA 1IQMA 1GBJA 2FOAA 2BLVA 1H9LB 1V2MT 1MUEB 1XVMA 1N8OB 3EA7A 3KCGH 3M7UA 3QGJA 1C5XB 1QJ6B 2EY4C 1AQ7A 4TWYA 1ACBE 3MOCA 1TMBH 2QAAA 1IQJA 1TGSZ 2Q6FA 2HVXA 3RMNH 2PUQH 1E79D 3SJ8A 1A5IA 1G30B 4GPGA 3KYFA 1AB9C 5DGJA 1GMHG 4ZROA 1W14U 3A87A 1EJMA 1MTWA 2K0QA 3LT3A 1GJ4H 2FDAA 1A3BH 4X8VH 3SI4H 3MMGA 3D65E 2ODPA 1ZMNA 3U98H 1Y8TA 3RXEA 1AZ8A 1F0SA 2WZQA 2FX6A 7LPRA 1M9UA 2IN2A 3LGWA 4CHAC 5GDSH 3OTPA 1C2FA 1O32A 5DP4A 1INCA 2ZDAH 1O3MA 2BOKA 1O5AB 2IPQX 3LGTA 5JB8S 1EZQA 4O97A 1GBKA 3AAUA 2ZDLA 4NFFA 4D76A 8LPRA 5IDKA 4RSPA 1QL7A 1UCYH 4ZKNU 2Q6DA 2GZ9A 4F49A 1GI4A 4D8NA 1ZGIA 5C20A 1LHCH 2BVXH 1IQEA 3AW0A 2GCTC 3MO9A 3I78A 1CT4E 4NG9H 4X2VA 3TK9A 4I8GA 2A7CA 3ZYEA 1BRAA 1KLTA 2G4TA 1IQHA 1T8OA 2ZECA 4DT4A 5IYTA 3F1SB 3BTKE 1BQYA 1DICA 1DPOA 1SLXB 4K60A 4BTTB 1IQGA 1UTLM 2O8WA 3QDZB 4GLYA 4INHA 3SGBE 5JYIA 2V6NA 1K1MA 3URCA 5DJ7A 2HLDD 5EW1H 1PPHE 1SLUB 1LVBA 2BDYA 3RXGA 4M7GA 5DN6D 1W10U 1ZHPA 1PQ5A 3DD2H 3ZZ5A 2W6ID 2GGVB 2UUKB 2KZ4A 2XOKD 1GG6B 1WTGH 1SG8B 1X7AC 2CMYA 3F9FA 1V2VT 2FI3E 4SGBE 3UOPA 5AF9H 4ABHA 2ZU5A 1TPOA 2Y80A 3PO1B 1B7XB 3RXQA 1BMFD 3DSGA 1GI6A 3K6YA 5E2OA 2PKSC 5EPYA 5EU8A 1LPZB 3BTQE 4FUEA 2CK3D 1Q2WA 1GJ6A 3OX7U 1DLKB 3RXIA 2KCPA 1A7SA 1SPJA 3A81A 1OWDA 1O2YA 3M61U 3OU0A 3TGKE 1CA8B 3DCLA 5EXMA 1ZSKA 2AGIX 3IG6B 3E0NB 1O2NA 1BTPA 2UWLA 5HMAA 3SUEA 3F9HA 1IHSH 1C5WB 3LH3A 4CRDA 4O3TA 1C2LA 3F0PA 3TPIZ 3RP2A 1ELBA 2PP6A 2P93A 1GJDB 1V2QT 1G2MA 1V2UT 5C94A 2G51A 1BMMH 1MKXK 1FXYA 2BDCA 3EDXB 3RXVA 3TK5A 3ZZ9A 1HXFH 1O2RA 2VINA 2PW8H 3KF2A 5C67A 1O3OA 3PMAB 1S5SA 5AVDA 1TX7A 3N7OA 3URDA 4JK5A 1ELFA 3ZZCA 3GDSA 5EGMA 2XCNA 3GICB 2ZFSA 2EQNA 1O30A 2XNIA 4K1SA 1AKSB 2STBE 3GCHB 2AIPA 1SQAA 1QY6A 2CGAA 4NIVA 3QZQA 4BOHA 1SVPA 3SHCH 4UFFH 3RU4E 1ELEE 1HAZB 4B76A 3U8RH 4NZQA 1FMGA 4X1QU 2R0LA 1BHXF 1NFYA 1ZSJA 1MQ5A 1XMNB 4AG1A 1T8NA 1ZTKA 5KGOA 3RXAA 2QF3A 3T26A 1OXGA 4Q2KA 1H8ED 4IN1A 1AKSA 1GI2A 2O9QA 1AO5A 3BG4B 4B74A 5FBEA 4INLA 1AUJA 3H7OA 3EE0B 1YPHE 2IOTA 2TGAA 1VITF 4HG6A 1GBTA 1O2LA 1C5PA 5DPAA 4LK4A 3SW2B 2ANMH 2VVVA 3RXLA 2HALA 5DG6A 3DFLA 1S85A 2ULLA 4ISOA 3RC6A 1TFXA 3VPKA 1HAVA 1U6QA 3ATMA 4Y11E 1YKTA 4CH8B 3OY5U 1OSSA 1KLJH 3UQOA 4ABDA 5FPYA 2R2MB 3RXOA 3O8DA 1EZXC 3NXPA 1Z7KA 1Z8IB 3M37A 1C1VH 2GMTC 3RU4D 1VGCB 1GHVH 1FY3A 3W94A 4I8JA 2VWLA 1A4WH 3ATLA 5GWZA 1OWIA 1MZAA 2JETB 1GDQA 1MZDA 5FBIA 3PMJA 5JBBS 5EQRA 4DT7B 5JBTA 2J2UA 3ESTA 2Y5HA 2V35A 1C1QA 3VB4A 4TY6A 3VB5A 2CN0H 2W3IA 1TNJA 2WPIS 1GJ8B 1O2SA 1P03A 3BTWE 1PFXC 1DX5M 7GCHF 4ZHLU 2J97A 1LHGH 1YPLH 1O36A 2BVSH 2NU0E 1VR1H 2F91A 1GHAF 4AFUA 5HM9A 1C5UA 3GDUA 1UTKA 3E8LA 3LKWA 1EFRD 1QCPA 3HGPA 3KHVA 1FY1A 2VVCA 2G8TA 3ATWA 1AVWA 1FNIA 1KDQB 1K9OE 2BZAA 2THFB 1ANDA 4DGJA 2ZIQH 1O3IA 2BD5A 2Y7ZA 4E06H 2BLWA 2PR3A 3QTOH 1W13U 2VNTA 4K5ZA 1GBHA 3M5LA 1E1RD 1L2EA 4FVBA 3PV4A 4NSYA 4GCHF 1DVAH 1DANH 3VXFH 4Y71A 1WV7H 3UPEA 2J9NA 2YMSD 5EOKA 1ZYOA 3UFAA 1EOJA 3TNSA 4XDEA 4A1XA 2OXSA 1FY5A 1P06A 1XXDA 2V3OH 1NFXA 2K8IA 1QNJA 2ZG0H 4FETA 4PROA 4XFQA 5GCHG 3KGPA 1QFKH 2UUYA 4JZ1A 1L0ZA 4P00A 3LJOA 2FX4A 5DP8A 5GPIB 2C8ZB 1BBRH 4OS7A 1DUAA 1GI1A 1RD3B 1THRH 1SGFG 3CNRA 2AH4X 4K1TA 4NWLA 5FPSA 2ZZUH 1Y59T 1Z8GA 2ALVA 2XTTB 3T28A 2XWAA 1L1GA 1BMNH 2BD9A 2ZKSA 5LPFA 1O2PA 2PLXA 2ZCKP 1V2ST 1FN8A 2JDID 5PTPA 4YLQH 2FPZA 3GY3A 1TQ7B 2FYRA 5C5NA 1SLVB 3GISB 3FANA 4XD7D 3GS9A 4Y7AA 4BTIB 1ZJKA 5ETXA 1OKXA 3RXDA 2A4OA 2CV3A 5EQSA 1C5QA 3A82A 4NGAH 4X1NU 1GL0E 1KXFA 3S7KB 1HAXB 1S82A 4GHTA 5DSFA 3H09A 4YT7H 2XYAA 1HJAB 1FAKH 3F2HA 2WSSD 3BEUA 1P3EA 1AE8H 2QF0A 1XXFA 2BD2A 1BTWA 1J17T 1EX3A 1WXRA 4CRAA 1QHRB 2NU1E 1MU8B 2G81E 4SGAE 3U69H 3U9AH 3UTUH 2BY7X 1GDNA 4XRNA 1K21H 4DOQA 3AVZA 4X2YA 1V3XA 9LPRA 2ZF0H 5LPRA 1P8VC 1LPKB 1W0KD 1K1LA 4UONA 1O3JA 4NIWA 3BTFE 3MI4A 2CF8H 8GCHG 1TRMA 2GD4B 1YYY1 3B8JA 3HK3B 3MU8A 1GI3A 1Z8RA 3PYHA 4VGCC 1NROH 1YCPM 3KQCA 1MBMA 1QBNA 2KCOA 4Q7ZA 1NZQH 3MTYA 4FOUC 2VIQA 1D9IA 4NSVA 2J4IA 2ZFTA 4ZAEA 1SGPE 2BQ7B 1JWTA 1TPPA 5LPEA 1O31A 3RXPA 2BD4A 1C1OA 2OD3B 3LJJA 5GJ4B 4DG4A 1NRPH 3FVFB 2Z9LA 1CA0B 1C5YB 3SU0A 2A4QA 1ZSLA 4AG2A 1O2OA 2GX4A 5J4QA 2F9UA 1N6XA 3GY4A 4DY7B 4QT8C 1MTNB 2WV4A 2VGCB 2FP7B 1GVLA 1O3HA 1QB9A 2H9TH 1IQKA 2FOHA 3TH3H 1EP6A 3UREA 1T4UH 3H5CB 4AGKA 1P2OA 1UTOA 1O5GH 1TPSA 1VZQH 1Z1IA 2R0KA 3ITIA 1EPTC 3TVJB 4HZHA 3N7EA 3ZZBA 2GT8A 4AYYB 2AEIH 3RXRA 4MQAA 1K1OA 2P3TB 2F9NA 2ZQ1A 1UK2A 1YC0A 1O35A 3ZYDA 4NIYA 2BQ6B 3AASA 4KKDA 2ODQA 1XUHA 1Y3WA 2J98B 4ZMAH 5EXNA 3BEIB 3MU4A 2FODA 3UY9A 3P70B 1PQ8A 3BIUH 1V2PT 1GDUA 3M7TA 3MYWA 4ABAA 1ELGA 2AHME 2Z3CA 2WUBA 3SUFA 1GWAA 2BD8A 3S69A 2Y6TA 2GCHF 4NWKA 1XUIA 1ZTJA 4BANB 1Z8JB 2PTCE 4B73A 1TRNA 1O0DH 2J98A 2HGTH 1Q31A 1DS2E 1HAHH 3K6ZA 4RKJB 4B75A 3SUDA 1GGDC 4WH8A 5FPTA 5BRRE 5LGOA 2C93B 5DP5A 5AFYH 2AS9A 1QJ7B 2STAE 3VFEA 1HAPH 3NPSA 3DT0H 3ZV9A 1MTUA 2B8OH 2BDIA 3ODDA 1O2UA 1A0HB 3KIDU 1TBZH 3EE7A 2R9PA 1V2NT 3D49H 1CBWB 5H4IB 5C3NA 4WMEA 1RTFB 2HOBA 4RI0A 3RXBA 1HFDA 3K2UA 2A45B 1O5FH 3BTDE 1A46H 4NA8A 3MO3A 1K28D 3O8CA 1AGJA 1OX1A 1QA0A 1KTTB 1PPGE 4HI3A 1DXWA 5DO4H 2H2ZA 1WQVH 1MMJN 1LQEA 4X2WA 6GCHG 4FUBA 4WWYA 5SGAE 1W2KH 1KXBA 3M3VA 1W7XH 3SZNA 2EC9H 1NRQH 1V2KT 2BDAA 2J92A 2YMSB 2W6JD 1TMTH 4ZHMU 5A8YA 3PB1E 4AZ2B 1AWFH 4JYTA 3P92A 2ZCLP 4JCNA 1TYNA 2H9EH 1O34A 3HPTB 2AMPA 1AUTC 4TYDA 2Y7XA 2TIOA 3FOAA 4MVNA 3TNTA 2XC0A 2WHXA 3PV5A 1QQUA 2F83A 2FI4E 3UAIC 1TE0A 5A09A 3A8CA 1UJ1A 4MDSA 1RJXB 2BYAX 1QL9A 4A1VA 2W5EA 2ZTXA 4YO9A 3SU3A 2DE9A 4ABIA 1LHDH 1OS8A 2OLGA 3PV2A 3T29A 3NCLA 1MCTA 2A5AA 5HGGA 2QXJA 1C1RA 1LCYA 2WPHS 3DUXH 1UTMA 2OC8A 2A1DB 1HIAA 1PPCE 1FI8A 2VH6A 2WPDD 3S9AA 1KTSB 1GVKB 2HVYB 4GVUA 4AB9A 2Z3DA 3AAVA 1E36B 3AW1A 4IMQA 4FVDA 5FX6A 2KAIB 2CHAB 1BB0B 3LDXH 3TH4H 1JMOH 1ZTLA 1MBQA 2Q6GA 3ZZ4A 1RTLA 3KQEA 4IW4E 1Y3XA 5C2ZA 5EG4A 3VB3A 5EJLA 1A3EH 1O2XA 1K22H 4ESTE 1ESAA 1GMCF 3A7YA 4DJZB 1EAXA 3TITA 2XBVA 1GBDA 1QIXB 1E38B 5CHBA 2VWOA 2SNWA 2R3YA 2KAIA 1PQ7A 3W95A 3A8AA 5K0HA 1TWXB 2BY5X 1E0FD 4OS4A 1TAWA 2FOCA 3FKSD 3IITA 2IPHA 1KXDA 1TONA 1V6DA 1SQTA 3F68H 2ZU4A 4JZFH 2BQWB 5FXLA 4X6NA 1D3DB 4JYUH 2FZZA 4INKA 1TGCA 1P2NA 4O9VA 1G3CA 1GVZA 1WU1A 1ANEA 1C2EA 3EA9A 3Q77A 5CHAB 1TX8A 2LNCA 1A1RA 1SGEE 4WJG2 3F6UH 3NUMA 1H9HE 2KM0A 1TNGA 1W0YH 1TGBA 1VCQA 1ZPZA 4MPVA 4FU7A 1P02A 3MNCA 1C5VA 2NWNA 1SGNE 1ZZZA 3M7QA 3PLBA 4H6TA 2WINI 3GDVA 3UNSA 1NY22 3SO3A 2O8LA 4XOJA 1PYTC 1BDAA 8GCHF 1CHOG 6CHAC 2QE7D 4OS6A 2BX3A 1LKBA 1Q3XA 4Y0YE 5EQQA 1TGTA 1E37B 1BCUH 3BIVH 1DWEH 1AFEH 1SFQB 2WYGA 1T31A 3A7VA 3PWCA 1UTNA 1BTYA 2VIOA 1O2TA 1OP0A 1FONA 2PGBB 1DY8A 3E6PH 5L30H 4E7NA 4BAHB 2ZHQH 6ESTA 4LZ1H 3RMOH 2AFQB 2ILNA 3LGUA 3OYPA 3SV6A 3MQKC 1OPHB 1AY6H 1V2JT 1A5GH 1O37A 4I8LA 4J1YA 2P8OC 2WV5A 2BDGA 4B1TA 3BTTE 3LPRA 1AFQC 4B2AA 1WOFA 1BBRK 1ARBA 3NRLA 1NPMA 3V3MA 1GL1A 2FOMB 2QIQA 1SSXA 3MU1A 5FCKA 4CH2B 1P2QA 2VB0A 1HCGA 1SC8U 1SHYA 1CVWH 4NZLA 4AGJA 3UIRA 3TIUA 4TY7A 3OSYA 1O2JA 1YPMH 4B6EA 2Y5FA 1AI8H 2QC2A 4MG3A 4RKOB 2RDEA 4I8KA 1GJCB 3GCTG 3F0OA 3SUGA 1SL3A 4A92A 1ESTA 5TJXA 1E34B 1NO9H 4BXSA 1TNLA 2PTNA 3GY2A 1ZRBA 2BDBA 3V0XA 3C1KA 2VIVA 1WDIA 3B23B 3FP7E 1FN6A 2ZPSA 1YPGH 2BVRH 4Q7YA 3ZVBA 1KY9A 3BG8A 2HPQH 3LGVA 2QV1A 1XKAC 1YF4A 2J5UA 1W11U 3FZZA 1A0LA 3EQ0H 3UUZA 4FUHA 1O3GA 1MCVA 1XUFA 2XRCA 2KCYA 3RDZA 1V2WT 3SNAA 4BAOB 2ZFPH 4UDWH 1COWD 5LH8A 3SN8A 5ESTE 1XUKA 4K1EA 5EXLA 1G9IE 1XM1A 4OM9A 2TRMA 1HAIH 1AIXH 2W7UA 1O3NA 1K1IA 1YPKH 3RXUA 1NT1A 1IQNA 4ABEA 3T25A 4JZIA 1TABE 1KYNA 1JIRA 4UFDH 1A61H 2ZQ2A 4JK6A 1SI5H 3ZVDA 1G36A 1BRUP 2ZNKH 3TJOA 3DFJA 3SU1A 3M35A 1C1PA 4NA7A 1GJBB 1PPBH 3L3TA 1BRBE 1GI8B 3RC4A 1Y3YA 2BB4A 4YESB 5A0CA 1CT2E 4Z1MD 1FUJA 2HWLB 4K3JA 3E1XB 1HV7A 3QX5H 2VJ1A 4XSKU 3SJ9A 1OP8A 1UTPA 3S0NA 4XBBA 1TGNA 2C8YB 1GHBG 4ZUHA 3KN2A 1KXAA 1C4Y2 2ZDNA 2ZI2H 3LC5A 2J95A 1TBRH 1P12E 1P2JA 5GIBA 4I86A 2JH6D 1O5CB 3ATIA 1KSNA 2RA3A 4YOIA 4WH6A 4CBOA 2FWWA 1UVPA 2EI8A 4FUJA 4F4OC 4RT0A 3V12A 1QJ1B 5EJ1A 1YP9A 1O3KA 1OWKA 1O5BB 2HLCA 4FUGA 1RIWB 3Q00A 3NWUA 1RRKA 1J15A 3LGYA 4IGDA 1BIOA 1B0EA 2FTMA 3RLWH 2AMQA 2C3SA 3KL6A 4FXGH 3Q3XA 4UFGH 1TBQH 4XBCA 1S84A 1YWUA 3NZIA 3DSPA 3A88A 1EQ9A 4FUIA 5A8XA 1QBOA 1EKBB 1GMHF 1HXEH 3A8DA 3FO8D 1ZJDA 1C2MA 3FP6E 3LC3A 2RG3A 4JZEH 2AERH 4XE4A 4ZXXH 5CMXH 4BAMB 1GBEA 4DCDA 5AHGH 3SOSA 3ZVEA 3T5FH 5F53A 1OP2A 1F5KU 3MNBA 3GY7A 3HKIB 4A7IB 4AOQA 1L1NA 3ZZAA 2AMDA 5F8ZA 1GCTC 2LELA 1O2KA 1YCPK 3GOVB 4DIIH 1VCWA 2KCAA 2ZHWH 1TALA 1F0TA 3P17H 2PHBA 1HGTH 1SKYE 3RXMA 5T6FA 5HKKD 4FUCA 3SQHE 1IOEA 5TCCA 2Y81A 2ZHEH 4IMZA 3S7HB 1ARCA 1UVOA 1HAGE 3VEQB 2BHGA 3WWFA 3WWBA 4WXVA 1WAYB 5HYOA 4Q4LA 2A2XH 5KEDA 1A5HA 4D7FA 1W0ZU 4NIXA 3Q3KA 2OCVB 1O3LA 3BTGE 1SGCA 1ELVA 1K1PA 2D8WA 3V13A 1UHBB 1C9PA 4O3UA 1EAWA 1HLTH 3VGCB 1C1MA 2H6MA 3ZIAD 3LH1A 1SGIB 2BDHA 4CRFA 1KDQA 1HAYB 1Z6EA 4WF8A 1DOJA 1EB2A 1GHXH 1HAOH 1G3BA 2KR7A 3T2NA 4Y10E 3GCNA 3RXTA 1NU7B 1GG6C 1YY3A 3QGNB 1C2GA 2V3HH 1NM6A 3TK6A 2JKHA 1O2WA 2W7SA 3UWIA 2ZTYA 1C1UH 1O38A 2XC5A 1PJPA 1QRWA 2XXLA 1ZLRA 3R0FA 4B2CA 4R8TB 1EUFA 2BM2A 3PO1C 1ELDE 1O3CA 2BXUH 2SFAA 2UWPA 3JZ2B 2GT7A 4NA9H 4WMDA 1AWHB 1SGFA 3ODFA 4AFZA 1LDTT 2ZGXH 1OYTH 1QA7A 1P09A 3SGQE 3SYJA 3PROA 2F43B 2ZFRH 2XBXA 1XUJA 3PMBB 1P9UA 5DP7A 2C8XB 4NFEA 3MNSA 2VWMA 2CJIA 4RN6A 2I6QA 3OTJE 4FU9A 3QLPH 2W3KA 1YM0A 3KNXA 3ZVGA 4Z6AH 2ZO3H 3ZVCA 3RM2H 1FAXA 5JB9S 2P59A 1C2DA 4TT3D 1D6RA 3F9GA 4ABGA 3OEED 1LVYA 3I77A 4Y8XA 1AVXA 1CGIE 1FY4A 1CSOE 3F9EA 2JH5D 2FO9A 1AB9B 1BTUA 2BTCE 2EI6A 2UUFB 4ACAA 3MH7A 1YLNA 2RDLA 2GJGA 4K2YA 2XC4A 5HXFA 1D3QB 1QQ4A 2HPPH 3OY6U 2QA9E 3ZVAA 1FLEE 3QK1A 1MKXH 1KXEA 1L1JA 5BPEA 3GCHC 3UR6A 2BY8X 5K7RA 1N6YA 1QRZA 4Y7BA 4CHAB 1UCYK 2GDEH 2HNTC 1SLWB 3TJNA 3E3TA 3SHAH 3F2GA 2H1UA 2OQ5A 4ABFA 1K2I1 4BAKB 4HGCA 2ZTZA 4FUDA 3PTBA 5I25A 3MU5A 4I7YH 2XBWA 3SGAE 4Q80A 1OYQA 1GJ9B 1LVMA 3ZZ6A 2A4GA 2YNAA 3BG4C 3A8BA 2QGRA 3RXCA 3A7WA 2V7QD 2VBCA 1QGFA 2AIQA 2QXIA 3OAAD 4X0WU 3SORA 4MNXA 1T4VH 1HRTH 4KTCA 3M5MA 2GCTB 4GUXA 9ESTA 4LOYH 2EA3A 4YZUA 3SJKA 3RXHA 4AFSA 1RXPA 3BTHE 1O5EH 1QB6A 2FOEA 1EAUA 2H5DA 4OS2A 4CBNA 1IQFA 4GHQA 1V2OT 1DSUA 1ZOMA 2HNTF 3HKJB 5C1XA 3A7ZA 2OC1A 1W7GH 3S9CA 1C5OH 1NFWA 4X6PA 1Z1JA 1TPAE 2B0FA 1VGCC 1S6FA 2F9OA 4DVAU 4MLFB 4KP0A 3CENA 4Y79A 1SQOA 2JETC 3RXJA 1C2JA 3RXKA 5JBCS 2YOLA 2G5NA 3LGIA 4WVPE 1ZPCA 3BEFB 4UEHH 3LIWA 3VXEH 4UD9H 5KECA 1BTZA 4CRGA 1QR3E 1DITH 2PV9B 1PQAA 2LPRA 2WPJS 3QZRA 4GSOA 5G4BA 1AE5A 4YLUA 1V2LT 2A2QH 1GHZA 4ISIH 4M9FA 1P11E 3TJUA 1LQDB 3O8RA 4JYVH 1RFNA 1WTHD 2FI5E 3UB0A 1XKBC 1IAUA 2ZEBA 2GDDA 1O3BA 1LVOA 2FS8A 2PKSB 1PPEE 5JDUB 1H4WA 3SNCA 3UOUA 4Y0ZE 5DP6A 4YOJA 2XCFA 4JZDH 1H8HD 1FQ3A 3PWBA 2HRVA 2I6SA 4X6OA 2P94A 3IWMA 4D9RA 5JBAS 3PLPA 1FDPA 1AHTH 3STJA 3U8OH 1T8MA 2TPIZ 1O3FA 5DP3A 1ID5H 3OE7D 1F2SE 1EAIA 1GPZA 2D2DA 1O5DH 2BMGB 1F5LA 1NBME 4ISLA 1BHXB 2H5CA 1Y5UT 1NU9A 3JZ1B 2DUCA 2G55A 4AX9H 4X6MA 3Q76A 3M3SA 1UK3A 1BJUA 3SNBA 3UQVA 3FP8E 4TSFD 2VH0A 1HDTH 2ZFQH 3U28C 1Z71A 4I32A 4ISNA 1SGTA 4I8HA 2QF4A 1EP5A 1NTPA 1D6WA 3RC5A 2FLBH 1W0JD 2PKAB 5T1VA 3A89A 4H4FA 2OC7A 1SGYE 2GKVE 3SU6A 3KQBA 3QN7A 3LOXA 3BTME 1AU8A 1SMFE 1OOKB 4ACBA 2AYWA 5C0TA 1OWJA 1CGHA 2FOBA 5E0GA 1O2QA 5GXPA 1VITG 5GCHF 2F3CE 5C0UA 4X1RU 1BMLA 2NU2E 1MKWH 1PPFE 1NBMD 2ZDMA 1ZHRA 3HGNA 3KYGA 4E05H 1BOQA 1NESE 3A86A 2PKAA 1FY8E 3FN8A 4X8SH 4AN7A 4U32A 3FZDA 5L6NH 1C1NA 1O33A 4LZ4B 3UNRA 4AORA 2VWNA 3PRBA 3NK8A 4Y8YA 4K69A 4AYVB 4YXWD 1G32B 4WY3A 4CR5A 2WV9A 2L6OA 4CR9A 4XBDA 3BF6H 1CGJE 1ZGVA 1HPGA 2ZPQA 3U1IB 2P16A 3M36A 3N7DA 1EATA 1HJAC 4WMFA 1SBWA 1C5SA 3CS7A 3PMHB 1CO7E 2FTLE 1UVTH 3G01A 1DFPA 1ESBA 2R3UA 3A85A 3DSOA 4FU8A 1E1QD 2F9VA 2GMTB 4OS5A 1ZHMA 4UE7H 2ANWA 1RGQA 5GNDA 2OK5A 5L2YH 2UUJB 7GCHG 1WUNH 1B0FA 4YM9A 3RXSA 1UTQA 1EXFA 2P3UB 3GY6A 3QWCH 4KTSA 4E7RG 3SV9A 4LXBH 1QTFA 1Y5AT 4D9QA 5HM2A 1BUIA 2ZU2A 1NS3A 1GHAG 2A4RA 1XVOA 1DSTA 2ZGBH 4K8YA 3PRDA 3RLYH 5EPNA 1AVGH 1BTHH 1ZR0A 2G4UA 3A7XA 5T6DA 2D1JA 3R3GB 2TGPZ 1GCTB 1P04A 1TOCB 2PSYA 2ZDVH 1QRXA 1ELCA 1V2TT 1VKYA 2ZU3A 3SI3H 4NCYA 1BZXE 1FV9A 2QCYA 2A32A 1YPEH 4GCHG 3SNEA 3QUMP 3AK5A 3EYDA 1CA0C 4I33A 2YNBA 1K1JA 1O2MA 3GCOA 3OEHD 2V0BA 1UTJA 2Z6BD 5TCAA 1JRSA 4BXWA 1MTNC 1KXCA 1WQSA 3UNQA 2VGCC 2H9HA 1G3DA 1GJ7B 1BA8B 1YPJH 2Q1JA 3PTNA 2J34A 1ANCA 3SNDA 2FXRA 1C2KA 5J4SA 1C1SA 1SOTA 1O3DA 2K1QA 4ZKSU 3RUOA 3SQEE 3MFJA 8KME2 4X2XA 3KQ5A 5F03A 1DM4B 4P02A 1MH0A 5CE1A 4X1PU 3SU5A 1ABIH 3A80A 2M2AA 3SZEA 4AC9A 1V2RT 3SV8A 3SV2H 3TU7H 4CREA 3S9BA 1OHHD 3GY5A 2ALPA 1S81A 2Z9JA 1P10A 2B9LA 5C17A 4MNWA 1O3AA 1D4PB 2F9BH 2ZU1A 1ETTH 1UVSH 3T27A 2DE8A 3P6ZB 2A7JA 3B9FH 1DWDH 4MPXA 1C4U2 3K65B 5DP9A 4HFPB 1YPHC 3PLKA 1FIZA 2SGFE 1UCYE 1N1LA 3GYMA 4TWWA 1ZMLA 1IQIA 1VCPA 2A7HA 1FPCH 1TNIA 1T7CA 1F7ZA 3N99A 5E2PA 1DLEA 1GI7B 1YLCA 4Q63A 2IJOB 1KIGH 2Z9KA 1C5LH 2PWXA 5DKMA 1F92A 2FOGA 4IC6A 1P2MA 5HIZA 1CBWC 4MPUA 1A0JA 4ASHA 1VITH 2BY9X 1F5RA 4Y76A 4A1TA 1P05A 1H9IE 1BMAA 1YGCH 4FUFA 4HTCH 3A84A 4H42U 1ELTA 1IQLA 2O8UA 1WBGB 2FEQH 3FFGA 5A8ZA 2Z9GA 3ZV8A 1BTXA 2BXTH 2ZHDA 5EW2H 3ATKA 2SGPE 4B71A 1MQ6A 3C27B 4I31A 2O8TA 1GBBA 1ABJH 2BOHB 1B5GH 2ZWLH 1HUTH 1Z6JH 1EJNA 1Y5BT 2BLOA 2YMSC 2FLRH 2SGQE 4DW2U 2J38A 5F8XA 1SGDE 2JIZD 1DDJA 1K1NA 3D62A 1H8IH 3RMLH 3M5NA 1AD8H 1N8OC 2JJ1D 6GCHF 2XNDD 3HK6B 2GZ8A 2Y5GA 1P0SH 1S6LA 3LONA 5T6GA 1PYTD 2ODYB 3ZZ8A 3FAOA 1HAVB 2GP9B 1S0QA 2OBQA 4VGCB 3SU2A 3H7TA 4CRCA 1WSSH 3D23A 2A0QB 1CQQA 1S6HA 2CHAC 5AFZH 4A6LA 2ZFFH 4D7GA 4ZCNA 4KTUA 4ZHAA 1T32A 2Z94A 1ZRKA 4IN2A 1RS0A 3MO6A 3E16B 1LPGB 1TX6A 4X8TH 3F3BA 1ETRH 1HBTH 1MAYA 1TNHA 1GBFA 1RTKA 2GZ7A 2RA0A 3VG8A 2PGQB 1GMDG 1C2HA 5IK2D 1G3EA 3RMMH 5F6MA 3E90B 2BD7A 3CS0A 1UVUH 2JJ2D 1GHYH 5FHTA 4MNYA 1C5NH 4ISHH 1LO6A 4ABBA 4X8UH 1XUGA 1BJVA 1EPTB 2RCEA 3STIA 4CRBA 5DK1A 1O2IA 2ZC9H 4X1SU 2WYJA 1J9CH 2G5VA 2IJD1 5F8TA 3P8FA 2WUCA 2GCHG 1GJAB 1SR5C 4YOGA 5EJZA 1QBVH 2G00A 3TJVA 5JPMH 3E91A 1JXPA 2FIRH 1LMWB 3HATH 3M3TA 5CHAC 3I29A 4ZH8A 1GHWH 1O3PB 2OTVA 2QYIA 1ANBA 3O8BA 1P57B 1EPTA 2FESH 5ESBA 4KELA 1Y3VA 2JH0D 1NRRH 2Z9IA 1DY9A 4IBLH 2WPKS 4TPYA 1LHEH 3OFND 1G2LA 3TGIE 5C1YA 1SGRE 5I46H 2A5IA 1QB1A 1P01A 4B2BA 3CP7A 2P95A 2ZGCA 3Q3YA 4UFEH 2PFEA 3VB6A 1IHTH 1TLDA 1TIOA 5FCRA 1MTSA 2Z7FE 5B6OA 6LPRA 1CT0E 4ASUD 1GGDB 1JOUB 1SQRA 3BTEE 1P3CA 2B5TB 2C4FH 2VU8E 2ZP0H 3MHWU 3ZZDA 1J16A 5A2MH 1H1BA 3UR9A 3MH6A 3E0PB 2QF5A 1CHOF 1UHBA 2F4LA 5B6LA 2Z3EA 5C5OA 1LHFH 1NRSH 1MD7A 3T62A 1CHGA 1GJ5H 5C1UA 3ZVFA 1C9TA 4RT1A 1J8AA 2VIWA 2KFWA 1D3PB 2PSXA 2NU3E 1OWEA 3SJIA 1DWCH 1A2CH 5FL7D 1GI0A 1MKWK 1SGQE 4GAWA 4WXIA 1O39A 4K8BA 1NN6A 3RM0H 1EB1H 2QXHA 1E35B 1L4DA 1DXPA 3U1JB 4U2WA 2EI7A 4U30A 2P3FH 4ABJA 8ESTE 1MTVA 2BLQA 5EODA 1EASA 2FOFA 1W12U 4Y6DA 2A31A 3MNXA 1O2VA 1GI5A 2OC0A 1GBLA 1GBCA 2QN5T 2FYQA 2GV6A 1SB1H 5HIYA 3GCTF 1GMCG 1HB0B 1VJ9U 2ANYA 1C2IA 2RFKC 2BX4A 3K9XB 3WW7A 1TA2A 2D26C 1C1TA 4B6FA 2G52A 1T8LA 3BSQA 2F9PA 2NU4E 1THSH 1FIWA 3ZZ3A 3SBKA 1TQ0B 3NKKA 1J14A 1OWHA 4F55A 2L74A 1TA6A 2FS9A 3SV7A 4AFQA 5A0AE 4O03A 1ZMJA 3RU4T 1TNKA 4DURA 1KMHB 1UW7A 1ZPBA 3A7TA 1O3EA 1WYKA 1UK4A 4J2YB 4A5TS 3A83A 3DHKH 1C5MD 4U01A 4MNVA 1SHHB 3W1EA 1UO6A 1EJAA 1HNEE 1TOMH 2CF9H 2M5TA 3EA8A 1YLDA 1P2IA 1BITA 1BBRE 1XX9A 4OGXA 4H6SB 1EOLA 1LKAA 2ZGJA 3M5OA 4JMYA 3TLOA 1HJ9A 1MABB 1UMAH 2AGGX 1DT2A 2QXGA 2WPMS 4YT6H 3MU0A 3MWIU 4OS1A 2BD3A 2OINA 2W26A 2VIDA 2EEKA 2ZCHP 1GHBF 1SOZA 1SFIA 1RIWC 2GV7A 1AN1E 1FZZA 2A5KA 2FMJA 2R2WU 3RXFA 3U8TH 7KMEH 1DE7H 5E0HA 1C4V2 1GBAA 4MPWA 3L33A 2LP6A
chains in the Genus database with same CATH topology
3QO6A 1P2KA 4ZKRU 1Y3UA 1G37A 1THPB 1NRNH 1NFUA 2AGEX 4BAQB 3L6PA 1CU1A 1LTOA 1GI9B 4BTUB 1C5ZB 4Z0KA 2P8OB 2OBOA 7ESTE 2ZPRA 4IC5A 1GBIA 1TMUH 3VB7A 4AB8A 1AFQB 4THNH 3V7TA 2OUAA 2XW9A 2FM2A 1F0UA 3KEEA 1P9SA 2HNTE 4MTBA 1O2ZA 1GMDF 1HJ8A 1O2GH 1W3CA 2OP9A 2VVUA 2SGAA 3ENSB 1PPZA 3UWJH 4IS5A 2ESTE 1NC6A 1S83A 2TGDA 2BY6X 2ZDKA 2SGDE 3GYLB 2B7DH 1JRTA 1FPHH 1D3TB 2ASUB 1ETSH 1YCPH 5E8EH 2CXVA 3MH4A 5E0JA 1GCDA 2ANKH 4ZXYH 2O8MA 2BZ6H 2Y82A 3EAJA 2QY0B 3SU4A 1TRYA 3QTVH 4TPIZ 1WCZA 2GVFA 5ABWA 3P8OA 2XWBI 1BRCE 1C1WH 1EZSC 2C8WB 1L4ZA 2J94A 2TGTA 4KGAA 3VGCC 4ZKOU 4YTAA 3BV9B 1YBWA 3TGJE 1MAXA 2ZGHA 5L2ZH 2PUXB 5FX5A 1HYLA 1BT7A 1JIMA 1TB6H 2WPLS 1FJSA 1W8BH 1EZUC 3EGKH 1AZZA 3GY8A 3TH2H 1O2HA 3PM3A 2C90B 1VJAU 3BN9A 1H8DH 1QURH 4DIHH 3ELAH 1AMHA 2TBSA 2GTBA 1C5TA 3MH5A 1ORFA 5T3HA 1CE5A 3P8NA 1QL8A 1MU6B 5FAHA 2ZHFH 3LU9B 2UWOA 3KQDA 3WY8A 6CHAB 1DWBH 3DA9B 4OGYA 1S0RA 4Y8ZA 2ZA5A 5A0BA 2VIPA 1F0RA 1HIAB 1DUEA 3SJOA 2SNVA 3P95A 4Q7XA 3ZZ7A 1GBMA 1KLIH 1MD8A 3P8GA 1C5RA 1JBUH 4BNRA 1ELAA 2SGEE 2XBYA 2OQUA 4R0IA 1IQMA 1GBJA 2FOAA 2BLVA 1H9LB 1V2MT 1MUEB 1XVMA 1N8OB 3EA7A 3KCGH 3M7UA 3QGJA 1C5XB 1QJ6B 1AQ7A 4TWYA 1ACBE 3MOCA 1TMBH 2QAAA 1IQJA 1TGSZ 2Q6FA 2HVXA 3RMNH 2PUQH 3SJ8A 1A5IA 1G30B 4GPGA 1AB9C 5DGJA 1GMHG 4ZROA 1W14U 3A87A 1EJMA 1MTWA 3LT3A 1GJ4H 2FDAA 1A3BH 4X8VH 3SI4H 3MMGA 3D65E 2ODPA 1ZMNA 3U98H 1Y8TA 3RXEA 1AZ8A 1F0SA 2FX6A 7LPRA 1M9UA 2IN2A 3LGWA 4CHAC 5GDSH 1C2FA 1O32A 5DP4A 1INCA 2ZDAH 1O3MA 2BOKA 1O5AB 3LGTA 5JB8S 1EZQA 4O97A 1GBKA 3AAUA 2ZDLA 4NFFA 4D76A 8LPRA 5IDKA 4RSPA 1QL7A 1UCYH 4ZKNU 2Q6DA 2GZ9A 4F49A 1GI4A 4D8NA 1ZGIA 5C20A 1LHCH 2BVXH 1IQEA 3AW0A 2GCTC 3MO9A 3I78A 1CT4E 4NG9H 4X2VA 3TK9A 4I8GA 2A7CA 3ZYEA 1BRAA 1KLTA 2G4TA 1IQHA 1T8OA 2ZECA 5IYTA 3F1SB 3BTKE 1BQYA 1DICA 1DPOA 1SLXB 4K60A 4BTTB 1IQGA 1UTLM 2O8WA 3QDZB 4GLYA 4INHA 3SGBE 5JYIA 2V6NA 1K1MA 3URCA 5DJ7A 5EW1H 1PPHE 1SLUB 1LVBA 2BDYA 3RXGA 4M7GA 1W10U 1ZHPA 1PQ5A 3DD2H 3ZZ5A 2GGVB 2UUKB 1GG6B 1WTGH 1SG8B 1X7AC 2CMYA 3F9FA 1V2VT 2FI3E 4SGBE 3UOPA 5AF9H 4ABHA 2ZU5A 1TPOA 2Y80A 3PO1B 1B7XB 3RXQA 1GI6A 3K6YA 5E2OA 2PKSC 5EPYA 5EU8A 1LPZB 3BTQE 4FUEA 1Q2WA 1GJ6A 3OX7U 1DLKB 3RXIA 1A7SA 1SPJA 3A81A 1OWDA 1O2YA 3M61U 3OU0A 3TGKE 1CA8B 5EXMA 1ZSKA 2AGIX 3IG6B 3E0NB 1O2NA 1BTPA 2UWLA 5HMAA 3SUEA 3F9HA 1IHSH 1C5WB 3LH3A 4CRDA 4O3TA 1C2LA 3TPIZ 3RP2A 1ELBA 2P93A 1GJDB 1V2QT 1G2MA 1V2UT 2G51A 1BMMH 1MKXK 1FXYA 2BDCA 3EDXB 3RXVA 3TK5A 3ZZ9A 1HXFH 1O2RA 2VINA 2PW8H 3KF2A 5C67A 1O3OA 3PMAB 1S5SA 5AVDA 1TX7A 3N7OA 3URDA 4JK5A 1ELFA 3ZZCA 3GDSA 5EGMA 2XCNA 3GICB 2ZFSA 1O30A 2XNIA 4K1SA 1AKSB 2STBE 3GCHB 2AIPA 1SQAA 1QY6A 2CGAA 4NIVA 3QZQA 4BOHA 1SVPA 3SHCH 4UFFH 3RU4E 1ELEE 1HAZB 4B76A 3U8RH 4NZQA 1FMGA 4X1QU 2R0LA 1BHXF 1NFYA 1ZSJA 1MQ5A 1XMNB 4AG1A 1T8NA 1ZTKA 3RXAA 2QF3A 3T26A 1OXGA 4Q2KA 4IN1A 1AKSA 1GI2A 2O9QA 1AO5A 3BG4B 4B74A 5FBEA 4INLA 1AUJA 3H7OA 3EE0B 1YPHE 2IOTA 2TGAA 1VITF 1GBTA 1O2LA 1C5PA 5DPAA 4LK4A 3SW2B 2ANMH 2VVVA 3RXLA 2HALA 5DG6A 3DFLA 1S85A 2ULLA 4ISOA 3RC6A 1TFXA 3VPKA 1HAVA 1U6QA 3ATMA 4Y11E 1YKTA 4CH8B 3OY5U 1OSSA 1KLJH 3UQOA 4ABDA 5FPYA 2R2MB 3RXOA 3O8DA 1EZXC 3NXPA 1Z7KA 1Z8IB 3M37A 1C1VH 2GMTC 3RU4D 1VGCB 1GHVH 1FY3A 3W94A 4I8JA 2VWLA 1A4WH 3ATLA 5GWZA 1OWIA 1MZAA 2JETB 1GDQA 1MZDA 5FBIA 3PMJA 5JBBS 5EQRA 4DT7B 5JBTA 2J2UA 3ESTA 2Y5HA 2V35A 1C1QA 3VB4A 4TY6A 3VB5A 2CN0H 2W3IA 1TNJA 2WPIS 1GJ8B 1O2SA 1P03A 3BTWE 1PFXC 1DX5M 7GCHF 4ZHLU 1LHGH 1YPLH 1O36A 2BVSH 2NU0E 1VR1H 2F91A 1GHAF 4AFUA 5HM9A 1C5UA 3GDUA 1UTKA 3E8LA 3LKWA 1QCPA 3HGPA 3KHVA 1FY1A 2VVCA 2G8TA 3ATWA 1AVWA 1FNIA 1KDQB 1K9OE 2BZAA 2THFB 1ANDA 4DGJA 2ZIQH 1O3IA 2BD5A 2Y7ZA 4E06H 2BLWA 2PR3A 3QTOH 1W13U 2VNTA 4K5ZA 1GBHA 3M5LA 1L2EA 4FVBA 3PV4A 4NSYA 4GCHF 1DVAH 1DANH 3VXFH 4Y71A 1WV7H 3UPEA 2J9NA 5EOKA 1ZYOA 3UFAA 1EOJA 3TNSA 4XDEA 4A1XA 2OXSA 1FY5A 1P06A 1XXDA 2V3OH 1NFXA 2ZG0H 1QNJA 4PROA 4XFQA 5GCHG 3KGPA 1QFKH 2UUYA 4JZ1A 1L0ZA 3LJOA 2FX4A 5DP8A 5GPIB 2C8ZB 1BBRH 4OS7A 1DUAA 1GI1A 1RD3B 1THRH 1SGFG 4NWLA 2AH4X 4K1TA 5FPSA 2ZZUH 1Y59T 1Z8GA 2ALVA 2XTTB 3T28A 2XWAA 1L1GA 1BMNH 2BD9A 2ZKSA 5LPFA 1O2PA 2PLXA 2ZCKP 1V2ST 1FN8A 5PTPA 4YLQH 2FPZA 3GY3A 1TQ7B 2FYRA 5C5NA 1SLVB 3GISB 3FANA 4Y7AA 4BTIB 1ZJKA 5ETXA 1OKXA 3RXDA 2A4OA 2CV3A 5EQSA 1C5QA 3A82A 4NGAH 4X1NU 1GL0E 1KXFA 3S7KB 1HAXB 1S82A 4GHTA 4YT7H 2XYAA 1HJAB 1FAKH 3BEUA 1P3EA 1AE8H 2QF0A 1XXFA 2BD2A 1BTWA 1J17T 1EX3A 4CRAA 1QHRB 2NU1E 1MU8B 2G81E 4SGAE 3U69H 3U9AH 3UTUH 2BY7X 1GDNA 4DOQA 1K21H 3AVZA 4X2YA 1V3XA 9LPRA 2ZF0H 5LPRA 1P8VC 1LPKB 1K1LA 4UONA 1O3JA 4NIWA 3BTFE 3MI4A 2CF8H 8GCHG 1TRMA 2GD4B 1YYY1 3B8JA 3HK3B 3MU8A 1GI3A 1Z8RA 3PYHA 4VGCC 1NROH 1YCPM 3KQCA 1MBMA 1QBNA 4Q7ZA 1NZQH 3MTYA 2VIQA 1D9IA 4NSVA 2J4IA 2ZFTA 4ZAEA 1SGPE 2BQ7B 1JWTA 1TPPA 5LPEA 1O31A 3RXPA 2BD4A 1C1OA 2OD3B 3LJJA 5GJ4B 4DG4A 1NRPH 3FVFB 2Z9LA 1CA0B 1C5YB 3SU0A 2A4QA 1ZSLA 4AG2A 1O2OA 2GX4A 5J4QA 2F9UA 1N6XA 3GY4A 4DY7B 4QT8C 1MTNB 2WV4A 2VGCB 2FP7B 1GVLA 1O3HA 1QB9A 2H9TH 1IQKA 2FOHA 3TH3H 1EP6A 3UREA 1T4UH 3H5CB 4AGKA 1P2OA 1UTOA 1O5GH 1TPSA 1VZQH 1Z1IA 2R0KA 3ITIA 1EPTC 3TVJB 4HZHA 3ZZBA 2GT8A 4AYYB 2AEIH 3RXRA 4MQAA 1K1OA 2P3TB 2F9NA 2ZQ1A 1UK2A 1YC0A 1O35A 3ZYDA 4NIYA 2BQ6B 3AASA 4KKDA 2ODQA 1XUHA 1Y3WA 4ZMAH 5EXNA 3BEIB 3MU4A 2FODA 3UY9A 3P70B 1PQ8A 3BIUH 1V2PT 1GDUA 3M7TA 3MYWA 4ABAA 1ELGA 2Z3CA 2WUBA 3SUFA 1GWAA 2BD8A 3S69A 2Y6TA 2GCHF 4NWKA 1XUIA 1ZTJA 4BANB 1Z8JB 2PTCE 4B73A 1TRNA 1O0DH 2HGTH 1Q31A 1DS2E 1HAHH 3K6ZA 4RKJB 4B75A 3SUDA 1GGDC 4WH8A 5FPTA 5BRRE 5LGOA 2C93B 5DP5A 5AFYH 2AS9A 1QJ7B 2STAE 3VFEA 1HAPH 3NPSA 3DT0H 3ZV9A 1MTUA 2B8OH 2BDIA 3ODDA 1O2UA 1A0HB 3KIDU 1TBZH 2R9PA 1V2NT 3D49H 1CBWB 5H4IB 5C3NA 4WMEA 1RTFB 2HOBA 3RXBA 1HFDA 3K2UA 2A45B 1O5FH 3BTDE 1A46H 4NA8A 3MO3A 1K28D 3O8CA 1AGJA 1OX1A 1QA0A 1KTTB 1PPGE 4HI3A 1DXWA 5DO4H 2H2ZA 1WQVH 1MMJN 1LQEA 4X2WA 6GCHG 4FUBA 4WWYA 5SGAE 1W2KH 1KXBA 3M3VA 1W7XH 3SZNA 2EC9H 1NRQH 1V2KT 2BDAA 2J92A 1TMTH 4ZHMU 5A8YA 3PB1E 4AZ2B 1AWFH 4JYTA 3P92A 2ZCLP 4JCNA 1TYNA 2H9EH 1O34A 3HPTB 2AMPA 1AUTC 4TYDA 2Y7XA 2TIOA 4MVNA 3TNTA 2XC0A 1QQUA 2F83A 2FI4E 1TE0A 5A09A 3A8CA 1UJ1A 4MDSA 1RJXB 2BYAX 1QL9A 4A1VA 2W5EA 2ZTXA 4YO9A 3SU3A 2DE9A 4ABIA 1LHDH 1OS8A 2OLGA 3T29A 3NCLA 1MCTA 2A5AA 5HGGA 2QXJA 1C1RA 1LCYA 2WPHS 3DUXH 1UTMA 2OC8A 2A1DB 1HIAA 1PPCE 1FI8A 2VH6A 3S9AA 1KTSB 1GVKB 4GVUA 4AB9A 2Z3DA 3AAVA 1E36B 3AW1A 4IMQA 4FVDA 5FX6A 2KAIB 2CHAB 1BB0B 3LDXH 3TH4H 1JMOH 1ZTLA 1MBQA 2Q6GA 3ZZ4A 1RTLA 3KQEA 4IW4E 1Y3XA 5C2ZA 5EG4A 3VB3A 1A3EH 1O2XA 1K22H 4ESTE 1ESAA 1GMCF 3A7YA 4DJZB 1EAXA 3TITA 2XBVA 1GBDA 1QIXB 1E38B 2VWOA 2SNWA 2R3YA 2KAIA 1PQ7A 3W95A 3A8AA 5K0HA 1TWXB 2BY5X 1E0FD 4OS4A 1TAWA 2FOCA 3IITA 2IPHA 1KXDA 1TONA 1V6DA 1SQTA 3F68H 2ZU4A 4JZFH 2BQWB 5FXLA 4X6NA 1D3DB 4JYUH 2FZZA 4INKA 1TGCA 1P2NA 4O9VA 1G3CA 1GVZA 1WU1A 1ANEA 1C2EA 3EA9A 3Q77A 5CHAB 1TX8A 2LNCA 1A1RA 1SGEE 4WJG2 3F6UH 3NUMA 1H9HE 1TNGA 1W0YH 1TGBA 1VCQA 1ZPZA 4MPVA 4FU7A 1P02A 3MNCA 1C5VA 2NWNA 1SGNE 1ZZZA 3M7QA 3PLBA 4H6TA 2WINI 3GDVA 3UNSA 1NY22 3SO3A 2O8LA 4XOJA 1PYTC 1BDAA 8GCHF 1CHOG 6CHAC 4OS6A 2BX3A 1LKBA 1Q3XA 4Y0YE 5EQQA 1TGTA 1E37B 1BCUH 3BIVH 1DWEH 1AFEH 1SFQB 2WYGA 1T31A 3A7VA 3PWCA 1UTNA 1BTYA 2VIOA 1O2TA 1OP0A 1FONA 2PGBB 1DY8A 3E6PH 5L30H 4E7NA 4BAHB 2ZHQH 6ESTA 4LZ1H 3RMOH 2AFQB 2ILNA 3LGUA 3OYPA 3SV6A 1OPHB 1AY6H 1V2JT 1A5GH 1O37A 4I8LA 4J1YA 2P8OC 2WV5A 2BDGA 4B1TA 3BTTE 3LPRA 1AFQC 4B2AA 1WOFA 1BBRK 1ARBA 1NPMA 3V3MA 1GL1A 2FOMB 2QIQA 1SSXA 3MU1A 5FCKA 4CH2B 1P2QA 2VB0A 1HCGA 1SC8U 1SHYA 1CVWH 4NZLA 4AGJA 3UIRA 3TIUA 4TY7A 3OSYA 1O2JA 1YPMH 2Y5FA 1AI8H 2QC2A 4MG3A 4RKOB 4I8KA 1GJCB 3GCTG 3SUGA 1SL3A 4A92A 1ESTA 5TJXA 1E34B 1NO9H 4BXSA 1TNLA 2PTNA 3GY2A 1ZRBA 2BDBA 3V0XA 3C1KA 2VIVA 3B23B 3FP7E 1FN6A 2ZPSA 1YPGH 2BVRH 4Q7YA 3ZVBA 1KY9A 3BG8A 2HPQH 3LGVA 2QV1A 1XKAC 1YF4A 1W11U 3FZZA 1A0LA 3EQ0H 3UUZA <