4GAWA

Crystal structure of active human granzyme h
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
226
structure length
224
Chain Sequence
IIGGHEAKPHSRPYMAFVQFLQERKRCGGILVRKDFVLTAAHCQGSSINVTLGAHNIKEQERTQQFIPVKRPIPHPAYNPKNFSNDIMLLQLERKAKWTTAVRPLRLPSSKAQVKPGQLCSVAGWGYVSMSTLATTLQEVLLTVQKDCQCERLFHGNYSRATEICVGDPKKTQTGFKGDSGGPLVCKDVAQGILSYGNKKGTPPGVYIKVSHFLPWIKRTMKRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Granzyme H
publication title Identification of SERPINB1 as a physiological inhibitor of human granzyme H
pubmed doi rcsb
source organism Homo sapiens
total genus 36
structure length 224
sequence length 226
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature ec 3.4.21.-:
pdb deposition date 2012-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4gawA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4gawA02
3K65B 1AZ8A 1WSSH 2BQ7B 4X1NU 3ZVGA 1SOZA 2ZEBA 4MG3A 3T62A 1GHXH 1QA7A 3V3MA 3VGCC 3L33A 3M7QA 2ZPRA 1AWHB 5EXLA 1EJNA 1NZQH 2BOHB 5EXMA 3D65E 3SHAH 3TK6A 4X1PU 4DCDA 1EOJA 2OCVB 1DWBH 1P2KA 4Y6DA 3MH4A 3GCNA 3F9FA 1J14A 3ZVCA 3VGCB 1DX5M 4Y7AA 1X7AC 3SUGA 1TQ7B 3ZZBA 4B2CA 2BD3A 1EPTA 5C20A 3RP2A 4MPUA 3P95A 1C4Y2 4AB9A 3ATLA 1BRUP 3LT3A 3E1XB 1SR5C 3I78A 3LGVA 1UTJA 2DUCA 3BTHE 3FVFB 2ZP0H 1Q2WA 4NZLA 3TH4H 1DITH 2BXTH 3MO3A 3BEFB 3PTBA 3RDZA 3RXJA 1C1SA 1H9LB 1P06A 2FOAA 4JK5A 2UWOA 1LHGH 3SV6A 4OS7A 3SU4A 3BTFE 5DP5A 3VB6A 1INCA 3RLYH 3H7OA 1ZSKA 4ZH8A 1AVWA 4HTCH 1TGNA 1CQQA 2Z3CA 1Z7KA 3TJUA 2B8OH 4B73A 3A8DA 2VGCB 2I6QA 1PPFE 2XNIA 3UNRA 5FAHA 4I32A 2NWNA 1VCQA 1FAXA 2THFB 4Y76A 1NESE 1BJUA 2V0BA 1GBJA 1ZPZA 2ZDMA 1L0ZA 2BDCA 1O2WA 1GJDB 1TPAE 2C90B 1PPBH 2G00A 3E16B 1P10A 1DM4B 5DP8A 3M36A 1KIGH 3E6PH 3CENA 4MQAA 3BIUH 1XM1A 1HFDA 2VWMA 3DFJA 4YO9A 4X1RU 4A1TA 2ODQA 4UONA 4ABFA 1DLEA 4NA8A 3ZYDA 1ZGVA 5PTPA 1EOLA 4K3JA 1ELGA 1ZSJA 3M3VA 2F9VA 2FPZA 2TGAA 4DJZB 1NRNH 1ID5H 2UUFB 1HJ8A 3F9EA 2Q6FA 4CRAA 2D8WA 3NK8A 1HV7A 1C5YB 1AFQC 3BN9A 5T6DA 4MPWA 2ZHDA 5CHAB 3SGBE 2GX4A 5C5NA 5LPFA 2AMDA 3MH6A 3PROA 4ISHH 3TH3H 4FUHA 4ZUHA 1L2EA 1C5LH 3U69H 2V35A 1Y5AT 1Y5BT 1FQ3A 1DXWA 2NU0E 3FZZA 4X6OA 1C1PA 1V2MT 1K22H 1HAHH 3VEQB 1BA8B 2EC9H 1TLDA 1BITA 3LC3A 2GDEH 4XBBA 4JCNA 1ZPBA 2H9EH 1GJ9B 1O3DA 2FTMA 3SBKA 4CRFA 2Z9JA 1GDUA 2XBXA 1DPOA 1IQHA 4RN6A 3OY6U 5IDKA 3A80A 1FV9A 4CRCA 5E2OA 4H6SB 4LZ4B 3SOSA 2NU2E 4OS2A 3UTUH 1YPHE 2ALVA 1NO9H 1TYNA 2OP9A 1SGEE 1V2ST 1QB6A 3M3SA 1UJ1A 4MLFB 1O2YA 1TNGA 1W13U 3SUFA 2GT7A 4AFUA 1JOUB 2ZI2H 5TCAA 4DY7B 4I33A 2W5EA 2PV9B 1TPPA 1QHRB 1PPHE 1C2MA 2A1DB 4NSVA 1EZXC 1GI5A 1IHSH 2GGVB 4YT7H 2A5IA 2AGIX 3TGKE 3RXKA 1CE5A 3KQBA 8ESTE 2Y7ZA 2CF9H 3F6UH 4UFEH 2UUJB 2ZU3A 1GHBF 4WXIA 1BQYA 1O36A 3W95A 1ZOMA 1WTHD 1DE7H 4FUFA 1RGQA 1AQ7A 4K2YA 1ZSLA 1BT7A 3UOUA 3HK3B 2R3UA 2ZDAH 1ANBA 2JKHA 1GHAF 2VINA 1T32A 1HXEH 3PMBB 4JZEH 5H4IB 1UHBB 4INLA 1VGCC 1SSXA 2ZU1A 1UCYH 3D62A 2HPPH 3A8CA 1V2UT 2P3FH 1GMCG 1MZAA 5F6MA 2G55A 3A7VA 1OX1A 3KIDU 1ABIH 2W7UA 1GHWH 1S0QA 1VGCB 1DICA 3RUOA 2EI6A 2VWNA 2F9BH 1FPHH 1D3TB 2A32A 2C8ZB 1XX9A 4CHAC 1ETTH 4TPIZ 1W3CA 2Z9KA 4I8GA 1GI8B 1L1NA 1NM6A 1P2NA 1SHHB 2PUQH 1A0HB 1W7XH 3E0PB 1UTNA 5JBCS 3SU2A 2CV3A 1HAVA 1XXFA 3I77A 1A4WH 5EGMA 4CHAB 1P09A 1C2FA 1MKWK 1AGJA 1QRWA 1KLJH 2NU4E 1BBRK 1K21H 4ZHMU 1KTTB 2H6MA 3VXEH 3D49H 3S0NA 1C1UH 2G4TA 5A09A 1UK4A 1THSH 3MU5A 1S82A 4ABGA 2R3YA 3KGPA 1OXGA 1GCTC 1UVTH 1HB0B 1FDPA 4ABEA 3ESTA 1O31A 2PFEA 2QGRA 3GY6A 5JPMH 1O2PA 5K7RA 2H5DA 1C5XB 2HOBA 2Z9GA 1DXPA 2BVRH 3Q3KA 4WY3A 1PPZA 3VPKA 2BB4A 1O2RA 1G36A 3FAOA 3TNSA 1ZJKA 3RMLH 2ZFRH 4H6TA 1FIWA 1SGIB 4BTUB 1GJ4H 1ANCA 3P70B 3SQEE 2ZCLP 4IN1A 4ZROA 3BEUA 2OQ5A 3UY9A 1GI3A 1PPEE 4GAWA 1EAWA 2Y7XA 2GCTC 2ZHQH 1WAYB 1XUJA 1YCPM 2BD8A 1JIRA 3VXFH 1O2LA 1OWDA 1BOQA 1KY9A 3P8FA 1T8OA 1N8OC 1W8BH 4OGXA 4X2YA 2GCTB 5J4QA 5C1UA 3V7TA 2WUCA 5FXLA 1EASA 5C1YA 1E35B 2Y80A 2VWOA 4I31A 1D3PB 1NS3A 3MTYA 5GDSH 3ZYEA 3UOPA 3IWMA 1TMTH 5F8ZA 2BTCE 2TPIZ 1ZHPA 1ZHMA 3LIWA 4Y11E 1F5KU 3NXPA 4I8LA 2ZDNA 1L1GA 4ZKSU 3AAUA 1WQSA 1UTQA 1WBGB 1CT2E 2GCHF 2C4FH 5GCHG 2R2MB 1BTZA 1XUGA 1SLWB 1Y5UT 1AU8A 3M7TA 4YTAA 3SORA 1FNIA 3BSQA 4INKA 2RA0A 3LGWA 4X8TH 2STAE 1CT0E 4B74A 1T8NA 3SJOA 1WV7H 4X6MA 1PPCE 3QO6A 7GCHG 1A61H 5I25A 3D23A 4KGAA 4Y8YA 5JBBS 1DWDH 3SI4H 3TIUA 2BD4A 2ZGBH 3BTGE 2SNWA 1K1JA 3SZNA 2ZHEH 3SO3A 3TH2H 2P16A 1AZZA 3A7TA 3OU0A 4D7GA 4J2YB 4YOJA 1IQEA 1Y59T 1Z1JA 5FCRA 4ZXXH 5EW1H 3AVZA 2LPRA 1BMMH 5FCKA 3ZZ4A 1Y8TA 2QXIA 2QC2A 3KQDA 1GJBB 1AB9B 3M35A 4SGBE 1XUKA 4Y10E 2A0QB 2QIQA 3RM2H 1YM0A 1DOJA 2TRMA 1NT1A 1GMHG 2OINA 1RJXB 2GV6A 3RU4T 1N1LA 1RTLA 4F49A 2DE8A 1T4UH 1W12U 4FUBA 1GG6C 1O35A 1AIXH 1P8VC 1LKBA 2R0KA 1HXFH 1O3LA 1YLCA 2WYJA 4NFFA 2ANMH 4YLQH 3QZRA 1NY22 1TB6H 2SGPE 4WMEA 5ABWA 1MCTA 1D6WA 1PQ7A 2J92A 5AHGH 1GG6B 2FOGA 1J16A 7KMEH 4DURA 4FU8A 5TCCA 3S9BA 1SGFG 2ZNKH 1MU8B 2JH0D 2HVXA 3HPTB 4O97A 1UK2A 3EAJA 1DWEH 1DT2A 2FOMB 1C5ZB 3VB3A 1ORFA 2FOHA 2J9NA 3RXGA 2ZTXA 1KXAA 4LXBH 1O38A 1QL7A 1O5FH 1GBFA 4WXVA 1GI0A 1JRSA 3SUEA 4ISIH 4A7IB 2O8WA 1F7ZA 4ZHAA 1RXPA 1OKXA 1TNIA 2Z6BD 1GJAB 1MUEB 2AGEX 1K1MA 5DP7A 3QTOH 1K1NA 1GDQA 1NPMA 1YPLH 1C5PA 2PSYA 3U98H 3RXLA 2BQ6B 1C1VH 2PLXA 5A8ZA 1B0EA 2QN5T 4X6PA 3A85A 4Y0YE 3HK6B 5E0HA 1IQNA 1GBBA 1OWJA 4K1EA 3GY7A 1SGRE 1FPCH 4GVUA 4CH8B 1TPOA 5FPSA 4NWLA 4HGCA 1MKXK 1C2DA 1OS8A 1BCUH 2XWAA 1P11E 1F0UA 1N6XA 1V2WT 4IC6A 5C2ZA 1O3IA 1EZSC 1TIOA 2PKAA 3Q3YA 5F8XA 5EQRA 1MAXA 3QDZB 1P02A 1NFUA 2F9UA 1TNKA 2BDIA 1OSSA 1S6HA 3MNBA 1DDJA 3O8CA 1Z8IB 1TRNA 1YKTA 1GBTA 3T28A 1D3DB 3KQCA 2BD7A 3LJOA 2IPHA 1GBHA 3STIA 4DVAU 4NG9H 2Q6GA 1KTSB 4IMQA 2BLWA 8LPRA 2RDLA 4K5ZA 1YPMH 3DD2H 1QQ4A 1JWTA 1QA0A 1QTFA 4D76A 1YPJH 4A1XA 1O3CA 1SQTA 3LGYA 3TGJE 1B5GH 4D9QA 1TONA 3RXVA 5FPYA 3F68H 1TMUH 4R0IA 1LO6A 1OWKA 2PKSC 2FWWA 1BMAA 3A7WA 5DP6A 4LZ1H 1GI2A 2FIRH 1H9HE 3T26A 2SGAA 5FX6A 1SGPE 2B0FA 1GI4A 1TE0A 1O2OA 4XFQA 3QGNB 4E06H 5CMXH 2FI4E 2SGQE 4UFFH 1FLEE 2GDDA 3BV9B 5J4SA 6LPRA 2QF0A 2ZKSA 4CR5A 1Q31A 1TNLA 1O5CB 4OS1A 4FVBA 3F9HA 1HIAA 2D2DA 4LK4A 2XYAA 4ZKOU 1FN8A 2ZPQA 3FP8E 1FY5A 3MNXA 4Y7BA 4XBCA 2PTCE 1MD8A 3TJNA 5EW2H 3M5MA 4ZHLU 2FOEA 1DFPA 1MAYA 3VFEA 1IQKA 1J9CH 2F91A 3PWCA 4AFQA 4WWYA 1C1MA 2D1JA 1OOKB 3MOCA 4IC5A 2XCNA 2ZZUH 1OWHA 2VIOA 2VNTA 5AFZH 1TBQH 2P3TB 2G8TA 1LPZB 2OC1A 1QRZA 2FM2A 3RMMH 1XUHA 3CS7A 3QN7A 3TK9A 1GCDA 4KTSA 2BM2A 4WF8A 1G37A 2G4UA 1S84A 1VCPA 4X8UH 2BDBA 1LKAA 2A2QH 5A0BA 2O9QA 5EU8A 3HGNA 1GDNA 4X2VA 2ESTE 1E36B 1SGNE 4U32A 3SV9A 1YGCH 1BZXE 2CJIA 2NU3E 2J34A 2P3UB 2JETC 4FUEA 1TALA 1DUAA 3QK1A 1KXFA 4SGAE 3Q77A 2QXGA 1NFXA 1LPKB 1LVBA 1ANEA 1TPSA 2OUAA 4F4OC 1OWIA 2Z3DA 1RS0A 3UUZA 1G9IE 1S85A 1RRKA 1L1JA 2ZPSA 2W3IA 1HPGA 1SGDE 2ZCKP 3JZ1B 1ZZZA 2ZQ2A 1GVKB 2F3CE 3E3TA 5LPRA 2BY5X 1MH0A 1ELEE 5JBAS 4TY7A 3E90B 2EI7A 1LQDB 2FX4A 3ATIA 6ESTA 3ZZCA 4BAHB 4XBDA 1EXFA 1S81A 4O9VA 2JH6D 3ZVFA 1C5VA 3P8OA 1IQFA 1YLDA 1QY6A 1FN6A 5TJXA 3U8TH 3O8BA 1DWCH 3V13A 4MNVA 1SFIA 2ZC9H 1LHFH 4B75A 1FUJA 4Z0KA 3KNXA 2GZ8A 1F0RA 2SNVA 3IG6B 2J94A 4AYYB 2HRVA 1J8AA 3UR6A 1PYTD 1KXBA 1MTSA 3U1IB 4WVPE 1BTWA 1WU1A 2RCEA 3UIRA 2TBSA 4B2BA 2V6NA 2ZFPH 2TGPZ 2BDAA 2BY8X 3A89A 4Y79A 4JK6A 4BAQB 2ZU2A 5C5OA 1GBKA 2VB0A 3GYMA 3F9GA 1YBWA 1BMNH 4MTBA 4ASHA 3U1JB 5EPNA 1AFQB 4DOQA 3RXIA 4CRBA 4GCHG 2VVCA 3RXMA 1HRTH 2UUYA 2KAIB 2ZGCA 4BOHA 4PROA 1SFQB 3GCTF 4K1SA 4ABBA 1UCYK 4Z6AH 1UTPA 3QTVH 2Y6TA 3LPRA 1BHXB 2A7HA 2Y81A 5F8TA 2GZ9A 3MO6A 5ESTE 3SU3A 3ODDA 1TFXA 1EPTC 3DFLA 1KXCA 1IOEA 4JYTA 1C1OA 1CHGA 1GJ7B 2ZHFH 5L30H 3FP7E 3M61U 1D3QB 1KDQA 1O30A 4YZUA 1GMCF 1O3MA 2ZO3H 1O5AB 1SGYE 4I8HA 3RXFA 3EA7A 1EPTB 2ZFSA 4WJG2 3NWUA 3KCGH 4O3UA 2VIQA 1GI6A 3Q76A 3SJKA 1QRXA 1G3CA 1NFWA 1OP0A 1P01A 1SGFA 1O3NA 4BAOB 2GT8A 4FUGA 1BHXF 1G3BA 3ZZAA 3EYDA 1VCWA 3S9CA 2PGQB 2BDYA 1Z6EA 3MH7A 1C5QA 2VIWA 1OPHB 2FP7B 4CRDA 1G30B 2ODYB 1O5BB 2A4QA 1Z71A 4OS4A 1AUTC 4NIYA 3SU5A 1PQ5A 4MNWA 1GJCB 1GI1A 1C2LA 4LOYH 2A7JA 1H4WA 1GPZA 4TPYA 1FONA 1PYTC 2XCFA 1C5OH 3SNEA 1GBDA 1SGTA 1BTPA 3RLWH 5A8XA 3BG4C 4BTTB 3SU0A 1W11U 1TQ0B 3EA8A 2EA3A 3RMOH 4FUIA 2ZECA 5DO4H 2UWLA 1F0SA 1HYLA 5EXNA 4MNYA 4AFZA 2BD5A 2FXRA 1C5UA 1Z6JH 3RXPA 1AMHA 2GD4B 1VJ9U 4E05H 2A45B 1A0JA 3KL6A 3MU4A 3MHWU 2XC5A 3PLPA 3P8GA 3S7KB 3A8BA 1ARBA 1SHYA 3EQ0H 2P8OC 1BTUA 3STJA 1V6DA 3MO9A 1F2SE 2ZIQH 2FS9A 2O8MA 4JYUH 5B6OA 1SG8B 2BX3A 2H9TH 3BF6H 2ZCHP 2H1UA 3LH1A 2H9HA 1O5GH 1TA6A 3UPEA 1MBQA 5DK1A 1C4V2 2ZHWH 1ZYOA 4X2XA 5DKMA 2AH4X 2B5TB 1C1RA 3A88A 3HKIB 4HZHA 1CHOG 3QUMP 1SGQE 4CBOA 3SQHE 2NU1E 1DSTA 1DUEA 2OLGA 1ELTA 1A3EH 3KHVA 2OC7A 2C3SA 2WPIS 1GCTB 1ZRKA 5EQQA 1HLTH 1K1PA 3OTJE 1GJ6A 2YOLA 3PMHB 3AAVA 1MTNC 1PQAA 3A7ZA 1FY8E 2I6SA 2BVXH 4BTIB 1O2JA 1BB0B 1GMDG 1HJ9A 2FI5E 2SGFE 3RXOA 1AHTH 1GI7B 4GHQA 1F5RA 2W3KA 1O3EA 1EB2A 3M3TA 1EZQA 3A81A 1E37B 5F03A 1O2IA 1O3JA 1QL9A 1S83A 1JBUH 3FZDA 3B23B 3ZVDA 2YNBA 5DP4A 1RFNA 4K69A 4Q80A 1IQMA 1QJ1B 7GCHF 1UTMA 2P94A 5T6FA 3MYWA 2FMJA 2ZTYA 2QCYA 4ZAEA 1AI8H 3SI3H 1HGTH 4I8KA 1FAKH 3UQVA 1DS2E 1H9IE 3PMAB 1AO5A 1GHZA 1N8OB 3E0NB 1PFXC 4A1VA 1YCPH 1AVXA 4NCYA 4NWKA 5AVDA 2AGGX 5HXFA 4UFGH 4UFDH 2GKVE 5GJ4B 2B9LA 1GBMA 4GUXA 3TPIZ 3BTKE 4ABHA 1NU7B 3H7TA 4B71A 3ODFA 1LMWB 3NPSA 4IGDA 1GMHF 2UUKB 1AKSA 3JZ2B 3PO1C 1V2TT 1CO7E 1SQAA 4OGYA 2CN0H 2DE9A 1W0YH 5HGGA 1EQ9A 1O2GH 1O3OA 3MMGA 4VGCC 3P8NA 3ZVBA 1GJ5H 6GCHF 1IQIA 1C5MD 1SQOA 4THNH 1A0LA 1K9OE 3ENSB 3LC5A 3TJOA 1CBWC 4VGCB 1QJ6B 3N7OA 1YPGH 2F9OA 2JH5D 3U8OH 3ATKA 3SN8A 1HAVB 2FOCA 2HNTE 1JRTA 1F92A 1GI9B 5E0JA 2XC4A 1W14U 2ZFQH 3RC5A 1SI5H 1TABE 1A3BH 1JXPA 2O8UA 4O03A 3SNBA 1C2JA 1TOMH 5AF9H 2VH0A 1MD7A 2FOBA 3RXAA 2BHGA 1EUFA 4MPXA 3GDSA 2WUBA 5FHTA 1TAWA 3ZVEA 8GCHG 2C8YB 1D6RA 1P3CA 1TRMA 3VB7A 2GCHG 4K8BA 1O37A 1SVPA 2VJ1A 2VH6A 1MTVA 4WMDA 3M5NA 2VVUA 1SLVB 1ZMJA 1RTFB 1NRPH 4KTCA 3VB4A 4WMFA 1OYQA 4MVNA 2H5CA 5HM2A 1AWFH 5LH8A 1AN1E 1XKAC 1FI8A 1TA2A 2XWBI 3OX7U 1ARCA 2C93B 3T25A 2TGDA 1J15A 1UVUH 1Y3WA 5T6GA 1A46H 2FLRH 3T5FH 4ABDA 3AW0A 1O3PB 1MZDA 1V2PT 3SV8A 1QR3E 1C1NA 1EP5A 1CGIE 3K9XB 4GPGA 1XVMA 2QXJA 3BTQE 1T8MA 4Y0ZE 3C27B 2GMTC 1P03A 4B2AA 2XC0A 2ZTZA 3TVJB 4AG2A 3RM0H 4X2WA 3EE0B 1QB9A 1QURH 1ELCA 1P3EA 4AGKA 3F1SB 5DP3A 1FY3A 4FUCA 1QBVH 1B7XB 1O2SA 3UFAA 1T7CA 4DG4A 1QGFA 3TK5A 2OC0A 1AY6H 1S0RA 4OS5A 2WYGA 3SJ8A 4IMZA 4YT6H 3GOVB 1T31A 2ZDLA 4BNRA 2VVVA 3SGAE 1EX3A 4M7GA 5L6NH 3ITIA 3R3GB 4A6LA 3MI4A 2ANKH 1GBCA 1V2QT 3C1KA 5AFYH 2BLQA 1GWAA 3SU1A 3TU7H 1CT4E 1Z8JB 2ANWA 3E8LA 3QX5H 4ISLA 1LCYA 3V0XA 1ELVA 4H4FA 3RC4A 1MTWA 4AFSA 2G5NA 3GDUA 1C5NH 4YOGA 3MWIU 1ANDA 1EKBB 4CBNA 1OYTH 1EB1H 1ELBA 1FMGA 5I46H 3UNSA 3ATMA 2QYIA 3ZZ5A 2WPKS 1LHEH 3K6ZA 1LDTT 1E38B 2B7DH 1KXEA 3RXDA 2PWXA 1MTUA 4B1TA 1RIWC 1OP8A 1VITH 1VITG 4AYVB 5GXPA 2F83A 1UO6A 2O8LA 4AZ2B 2IN2A 2RG3A 3SJIA 1RTKA 1IQGA 4INHA 1GBAA 1P57B 1V2KT 1K2I1 4YM9A 1P2QA 1ZTLA 2PKSB 3GICB 5FBIA 3T2NA 1QBNA 4KKDA 1LHCH 2XBYA 1ESBA 1TWXB 1AE8H 1O2TA 3EDXB 4UDWH 5E2PA 1HAIH 1C5RA 1LQEA 2ZF0H 2Z9IA 3BTEE 4AORA 2ZQ1A 3PV4A 2AEIH 3P92A 1ABJH 2H2ZA 4JYVH 3O8RA 1ESTA 4RKOB 1BTXA 3ZV9A 5EQSA 3UWIA 4BANB 3IITA 1GL1A 4KTUA 2FYQA 3SV7A 2QA9E 4Q7ZA 4TWWA 3KEEA 4R8TB 1FJSA 2CHAC 3PLKA 1O34A 1BIOA 2OBOA 1V3XA 1UMAH 2OQUA 2M5TA 3L3TA 4CREA 1TGBA 1EZUC 2OC8A 1SC8U 3LGIA 5ESBA 3BTME 3LH3A 2CHAB 1ESAA 1TMBH 1W2KH 3LONA 1WQVH 4Q2KA 5C3NA 2A31A 5EOKA 5JB9S 3BIVH 2BQWB 2VIDA 1GVLA 3U9AH 1O3GA 1HCGA 6CHAC 1H8DH 1UVPA 1C2HA 4UD9H 1HAPH 1MMJN 3UQOA 1NN6A 1IAUA 2P95A 3ZZ3A 4BAMB 2QF3A 1XXDA 1HAYB 1T4VH 4TWYA 6CHAB 3S7HB 3PB1E 4NIXA 3K6YA 1P2MA 2BZAA 1E34B 2ALPA 3GDVA 2PKAB 2GV7A 2TIOA 2V3OH 2CGAA 1AD8H 4AG1A 5JDUB 2JETB 4JZDH 1CA8B 2VGCC 1UCYE 5FX5A 2OXSA 2VIPA 4GCHF 3S9AA 3MH5A 1UHBA 1QCPA 2D26C 1ELDE 1XUFA 2CXVA 1EP6A 1VR1H 1W0ZU 1B0FA 2BDGA 2ODPA 1UK3A 1SPJA 3A87A 1KSNA 5K0HA 1Y3VA 1TNJA 1BRCE 4HI3A 5HYOA 5JBTA 1C9TA 2FODA 3P6ZB 5E8EH 4I8JA 1A2CH 1C2IA 2A7CA 2Q6DA 3FP6E 2AYWA 1AVGH 3Q3XA 2OD3B 1JIMA 4E7NA 3OSYA 1TBZH 3P17H 4FVDA 2AFQB 1C5SA 5A0CA 2ZGHA 2ZGXH 2C8XB 2WPHS 4AB8A 5JYIA 1WCZA 4D9RA 1HAXB 7LPRA 5CHAC 3TGIE 8KME2 1ELAA 3KN2A 2IOTA 3RXCA 1IQJA 1HIAB 2ZGJA 4JZIA 3E91A 1BTHH 2XRCA 4KELA 3ZZDA 1TX8A 3M37A 1HAOH 1V2NT 1W10U 2SGEE 1G32B 4IS5A 3MFJA 3NCLA 3V12A 4DT7B 5DP9A 1FIZA 2FYRA 3Q00A 2GZ7A 3ZZ6A 3K2UA 3EA9A 1SL3A 2BMGB 2BD2A 1D4PB 1O3AA 2PHBA 3M7UA 1L4DA 3MU0A 5HM9A 1UTLM 1HNEE 1TOCB 2GTBA 1NROH 1WOFA 5GWZA 1SOTA 4ISNA 3RXUA 5DG6A 3URDA 1ACBE 4WH6A 2PW8H 4AGJA 1LTOA 1JMOH 2BDHA 2FS8A 2Q1JA 3QLPH 1GGDC 4ESTE 1YPKH 4GHTA 4XOJA 4NGAH 2V3HH 3ZZ8A 1O5EH 1ETSH 2BYAX 4IW4E 1GHYH 1HAGE 3M5OA 1TNHA 1FY4A 1BBRE 1CU1A 4ISOA 3OYPA 1SLUB 1V2LT 2VIVA 2FEQH 1Z8GA 1GGDB 4JZ1A 2BZ6H 3RC6A 2F9PA 1Z1IA 4X1QU 2XXLA 1QNJA 4XDEA 1ZTKA 2XTTB 3GCHC 2R0LA 1K1IA 1ZPCA 5DJ7A 1G2LA 4AN7A 1MU6B 4RKJB 1C2EA 2QAAA 4Q7YA 5EODA 2PTNA 3UREA 1UTKA 2QV1A 1HDTH 1YPHC 1C2GA 3MNCA 1O3HA 1EAIA 3GCHB 3BG8A 3GCTG 4ZMAH 1XMNB 1CHOF 2ZG0H 1NFYA 1TGTA 4H42U 1HUTH 1TBRH 5EG4A 4FXGH 4GSOA 3MU1A 4FUDA 4MPVA 1SB1H 3LU9B 4J1YA 2TGTA 1KLTA 4TY6A 1A7SA 2UWPA 3BG4B 3A8AA 1LVYA 1O2QA 3LGTA 2ULLA 3GISB 3ZZ7A 3RXHA 5L2YH 1CGJE 1YF4A 4ABAA 4QT8C 2WV5A 1GMDF 1K1LA 1ELFA 1WUNH 2EEKA 2BD9A 3UWJH 1NRQH 1HBTH 4D8NA 5A0AE 3GYLB 3L6PA 3TNTA 1RD3B 2G81E 3HATH 2R9PA 1E0FD 2Y82A 1P05A 3RU4D 1QBOA 1YPEH 1WTGH 2P8OB 1YCPK 2FOFA 3M5LA 2PR3A 3MNSA 5JB8S 1H1BA 3B9FH 3BTWE 3UNQA 3SUDA 1BRAA 2AMQA 2FDAA 2ANYA 1SGCA 3A82A 4NIWA 1A5IA 1EATA 1GHBG 3SHCH 2ZFTA 1O2NA 3QGJA 3NKKA 4KP0A 1FXYA 3SNCA 1KLIH 1ZLRA 4FU9A 1TX6A 2CMYA 1O5DH 1GHAG 4A5TS 1XUIA 1ZGIA 2J95A 3FFGA 2ZDKA 1QJ7B 1GBIA 2CF8H 3ZZ9A 2G52A 3WY8A 1VJAU 5C67A 1O39A 2AS9A 4XSKU 2BLOA 1P9SA 1M9UA 5GCHF 1BMLA 2J38A 3SV2H 1VZQH 1O2MA 1QL8A 4E7RG 1S6FA 1AFEH 5C1XA 1MTNB 4FUJA 4X0WU 3W94A 1O3FA 1KDQB 1C5TA 2BOKA 3PYHA 1GHVH 2ZA5A 1O2ZA 4DIIH 3RXTA 1AUJA 4K1TA 2GP9B 1O0DH 1O2XA 1MQ5A 2BY9X 5CE1A 2WPMS 2F9NA 3BTDE 1O2UA 4NIVA 4U2WA 1NC6A 4BXWA 2FZZA 2Z94A 2VU8E 2HGTH 3RU4E 1LVOA 2A5KA 1QFKH 3UR9A 3BEIB 1SLXB 3DA9B 3FANA 5DPAA 2QXHA 1MKWH 1V2RT 4HFPB 2Y5FA 3DT0H 1BBRH 2STBE 5GIBA 3KQEA 1UVOA 2OBQA 3OY5U 1Q3XA 5A8YA 4K60A 1DY8A 1O3KA 3LDXH 1C5WB 1QB1A 4DIHH 1P04A 1G3EA 3DHKH 5LGOA 3QWCH 1W7GH 8GCHF 3QZQA 1F0TA 3A83A 2FESH 2BLVA 1C1QA 1ZMNA 3A86A 1Y3XA 4YLUA 2HLCA 1P2IA 1C9PA 1PQ8A 3PO1B 3B8JA 3A84A 1G3DA 1THPB 1U6QA 2A2XH 4O3TA 1PPGE 2HWLB 1MCVA 2SGDE 1FY1A 4NSYA 4YOIA 3LGUA 2A4RA 2HALA 1O33A 1ZHRA 2P93A 3NUMA 1ETRH 1YC0A 1CBWB 3GY5A 4BXSA 4NZQA 1DY9A 2ZU5A 4ZKRU 3SNDA 3SW2B 5LPEA 1DSUA 2AIPA 1AB9C 3T29A 1SBWA 4Q7XA 1C2KA 2Y5GA 1BUIA 4ZXYH 1DVAH 2BY6X 4NFEA 3I29A 1LVMA 4K8YA 3U8RH 3NZIA 3RMNH 1HAZB 2LNCA 3EGKH 3RXSA 1UTOA 1XKBC 4IN2A 3ELAH 3RXEA 5DGJA 3G01A 2K1QA 2RA3A 4FU7A 4UEHH 4UE7H 4AOQA 1C1WH 1K28D 3PWBA 1CSOE 1THRH 3GCOA 4OS6A 2WINI 3R0FA 1BRBE 4X1SU 1KYNA 3RXBA 2Z7FE 1S5SA 1A1RA 1BJVA 1Y3YA 2W7SA 1AE5A 3CS0A 2HNTC 2VWLA 3PTNA 2G5VA 3A7XA 6GCHG 2PSXA 1P9UA 4DGJA 3HGPA 1GJ8B 1H8IH 2Z3EA 5IYTA 2J4IA 2YNAA 1PJPA 1ZJDA 1L4ZA 5ETXA 2P59A 2FO9A 1TRYA 4MDSA 2BVSH 1Z8RA 1MBMA 1CA0C 2BX4A 5L2ZH 3GY3A 3VB5A 2A5AA 2BXUH 1F5LA 1YP9A 1CVWH 1NRRH 1V2OT 2WPLS 3S69A 3LOXA 3LJJA 9ESTA 1GL0E 4TYDA 1O2VA 4X8SH 1CA0B 3ATWA 4I7YH 1ZMLA 5EPYA 1O3BA 1MQ6A 1WYKA 2PUXB 1EAXA 2GMTB 1NTPA 1ZR0A 1LPGB 3KF2A 4JMYA 4CRGA 5E0GA 2FI3E 1TGCA 1VITF 2G51A 2J2UA 3A7YA 1LHDH 1OWEA 2AMPA 4GLYA 3URCA 1QQUA 1V2VT 1DLKB 1P0SH 4B76A 2FX6A 2A4GA 3DUXH 3SJ9A 5SGAE 2ILNA 3ZVAA 2HNTF 2HPQH 2XBVA 1A5HA 1AKSB 1GBEA 4X6NA 3SU6A 5A2MH 1K1OA 3CP7A 1V2JT 3HKJB 1ZTJA 3MU8A 1O2KA 2W26A 3RXQA 2FLBH 3PM3A 1GVZA 4Y8ZA 3SGQE 5HMAA 4AX9H 2ZU4A 4ABIA 4ABJA 1P2JA 2QY0B 2ZDVH 1G2MA 1BTYA 1T8LA 1XVOA 2ZWLH 2XW9A 2O8TA 3TJVA 4NA9H 2EI8A 4MNXA 1O32A 3GY2A 1C1TA 5G4BA 4NA7A 5FBEA 2AIQA 3SNAA 1BDAA 2SFAA 2GVFA 1C4U2 5GPIB 1A5GH 2IJOB 1IHTH 1DANH 2PGBB 1TGSZ 1OP2A 3AW1A 1SMFE 1Y3UA 1NU9A 4CR9A 5BRRE 5BPEA 4WH8A 1O2HA 2XBWA 4U30A 3TLOA 7ESTE 2OTVA 1QIXB 1GBLA 1YYY1 4JZFH 1UVSH 1P12E 1RIWB 5T3HA 4RSPA 3TITA 1J17T 1ZRBA 3T27A 2BY7X 1D9IA 1EAUA 4D7FA 4Y71A 2WV4A 3GY8A 4A92A 3BTTE 2Y5HA 2FTLE 2C8WB 4U01A 2ASUB 1HJAC 2R2WU 1CGHA 3PMJA 1P2OA 4ZKNU 2WPJS 1MKXH 4CH2B 4YESB 1N6YA 9LPRA 4X8VH 2Z9LA 4IBLH 2AERH 1KXDA 4XE4A 1HJAB 1IQLA 2A4OA 3H5CB 3O8DA 3PLBA 4Y8XA 5FPTA 1TX7A 4DW2U 1EJAA 3AASA 1NRSH 3ZV8A 2KAIA 4BAKB 1EJMA 3RXRA 1FZZA 2ZFFH 3GY4A 3LKWA
chains in the Genus database with same CATH superfamily
3K65B 1AZ8A 5IK2D 1WSSH 2BQ7B 4X1NU 3ZVGA 1SOZA 2ZEBA 4MG3A 3T62A 1COWD 1GHXH 1QA7A 3V3MA 3L33A 3VGCC 3M7QA 2ZPRA 1AWHB 2LP6A 5EXLA 1EJNA 1NZQH 2BOHB 5EXMA 3D65E 3SHAH 3TK6A 4X1PU 4DCDA 1EOJA 2OCVB 1DWBH 1P2KA 4Y6DA 3MH4A 3GCNA 3F9FA 1J14A 3ZVCA 3VGCB 1DX5M 4Y7AA 1X7AC 3SUGA 1TQ7B 3ZZBA 4B2CA 2BD3A 1EPTA 5C20A 3RP2A 4MPUA 3P95A 1C4Y2 4AB9A 3ATLA 1BRUP 3LT3A 3E1XB 1SR5C 3I78A 3LGVA 2WHXA 1UTJA 2DUCA 3BTHE 3FVFB 2ZP0H 1Q2WA 4NZLA 3TH4H 1DITH 2BXTH 3MO3A 3BEFB 3PTBA 3RDZA 3RXJA 1C1SA 2W6JD 1H9LB 1P06A 2FOAA 2YMSD 4JK5A 2RDEA 2UWOA 1LHGH 3SV6A 4OS7A 3SU4A 3BTFE 5DP5A 3VB6A 1INCA 3RLYH 3H7OA 1ZSKA 4ZH8A 1AVWA 4HTCH 1TGNA 1CQQA 2Z3CA 1Z7KA 3TJUA 2B8OH 4B73A 3A8DA 2VGCB 2I6QA 1PPFE 2XNIA 3UNRA 5FAHA 4I32A 2NWNA 1VCQA 1FAXA 2THFB 4Y76A 1NESE 1BJUA 2V0BA 1GBJA 1ZPZA 2ZDMA 1L0ZA 2BDCA 1O2WA 1GJDB 1YY3A 1TPAE 2C90B 1PPBH 2G00A 3E16B 1P10A 3OEED 1DM4B 5DP8A 3M36A 1KIGH 3E6PH 3CENA 4MQAA 3BIUH 1XM1A 1HFDA 2VWMA 3DFJA 4YO9A 4X1RU 4A1TA 2ODQA 4UONA 4ABFA 1DLEA 4NA8A 3ZYDA 1ZGVA 5PTPA 1EOLA 4K3JA 1ELGA 1ZSJA 3M3VA 2F9VA 2FPZA 2TGAA 4DJZB 1NRNH 3H09A 1ID5H 2UUFB 1HJ8A 2KM0A 3F9EA 2Q6FA 4CRAA 2D8WA 3NK8A 1HV7A 1C5YB 1NBME 4TSFD 1AFQC 3BN9A 5T6DA 4MPWA 2ZHDA 5CHAB 3SGBE 2GX4A 4YXWD 5C5NA 5LPFA 2AMDA 3MH6A 3PROA 2KCPA 4ISHH 3TH3H 4FUHA 4ZUHA 1L2EA 1C5LH 3U69H 2V35A 1Y5AT 1Y5BT 3F0OA 1FQ3A 1DXWA 2NU0E 3FZZA 4X6OA 1BMFD 1C1PA 1V2MT 1K22H 1HAHH 3VEQB 1BA8B 2EC9H 1TLDA 1BITA 3LC3A 2GDEH 4XBBA 4JCNA 1ZPBA 2YMSC 2H9EH 1GJ9B 1O3DA 2FTMA 3OFND 3SBKA 4CRFA 2Z9JA 1GDUA 2XBXA 1DPOA 1IQHA 4RN6A 3OY6U 5IDKA 3A80A 1FV9A 4CRCA 5E2OA 4H6SB 4LZ4B 3SOSA 2NU2E 4OS2A 3UTUH 1YPHE 2ALVA 1NO9H 1TYNA 2YMSB 2OP9A 1SGEE 1V2ST 1QB6A 3M3SA 4F48B 1UJ1A 3N7DA 4MLFB 1O2YA 1TNGA 1W13U 3SUFA 2GT7A 4AFUA 1JOUB 2IPQX 2ZI2H 5TCAA 4DY7B 4I33A 2J5UA 2PV9B 2W5EA 1TPPA 1QHRB 1PPHE 1C2MA 2A1DB 4NSVA 1EZXC 1GI5A 1IHSH 2GGVB 4YT7H 2A5IA 2AGIX 3TGKE 3RXKA 1CE5A 3KQBA 8ESTE 2Y7ZA 2CF9H 3F6UH 4UFEH 2UUJB 2ZU3A 1GHBF 4WXIA 1BQYA 1O36A 3W95A 1ZOMA 1WTHD 1DE7H 4FUFA 1RGQA 1AQ7A 4ASUD 4K2YA 1ZSLA 1BT7A 3UOUA 3HK3B 2R3UA 2ZDAH 4B6EA 1ANBA 2IJD1 2JKHA 3DCLA 1GHAF 2VINA 1T32A 1HXEH 3PMBB 4JZEH 5H4IB 1UHBB 4INLA 1VGCC 1SSXA 2ZU1A 1UCYH 3D62A 2HPPH 3A8CA 1V2UT 2P3FH 1GMCG 1MZAA 3KYGA 5F6MA 2G55A 3A7VA 1OX1A 5C17A 3KIDU 1ABIH 2W7UA 1GHWH 1S0QA 1VGCB 1DICA 3RUOA 2EI6A 2VWNA 2F9BH 1FPHH 1D3TB 2A32A 2C8ZB 1XX9A 4CHAC 1ETTH 4TPIZ 1W3CA 4XD7D 2Z9KA 4I8GA 1GI8B 1L1NA 1NM6A 1P2NA 1SHHB 2PUQH 1A0HB 1W7XH 3E0PB 1UTNA 5JBCS 3SU2A 2CV3A 1HAVA 1XXFA 3I77A 1A4WH 5EJ1A 5EGMA 4CHAB 1P09A 1C2FA 1MKWK 1AGJA 1QRWA 1KLJH 2NU4E 1BBRK 1K21H 4ZHMU 1KTTB 2H6MA 3VXEH 3D49H 3S0NA 1C1UH 2G4TA 5A09A 1UK4A 1THSH 3MU5A 1S82A 4ABGA 2R3YA 3KGPA 1OXGA 1GCTC 1UVTH 1HB0B 1WDIA 1FDPA 4ABEA 3ESTA 1O31A 2PFEA 2QGRA 3GY6A 1E1RD 5JPMH 1O2PA 5K7RA 2H5DA 1C5XB 2HOBA 2Z9GA 1DXPA 2BVRH 3Q3KA 4WY3A 1PPZA 3VPKA 2BB4A 1O2RA 1G36A 3FAOA 3TNSA 1ZJKA 3RMLH 2ZFRH 4H6TA 1FIWA 1SGIB 4BTUB 1GJ4H 1ANCA 2CK3D 3P70B 3SQEE 2ZCLP 4IN1A 4ZROA 3BEUA 2V7QD 2OQ5A 3UY9A 1GI3A 1PPEE 4GAWA 1EAWA 2Y7XA 2GCTC 2ZHQH 1WAYB 1XUJA 1YCPM 2BD8A 1JIRA 3VXFH 1O2LA 1OWDA 1BOQA 1KY9A 3P8FA 1T8OA 1N8OC 1W8BH 3GS9A 4OGXA 4X2YA 5CHBA 2GCTB 5J4QA 5C1UA 3V7TA 2WUCA 5FXLA 1EASA 5C1YA 1E35B 2Y80A 2VWOA 4I31A 1D3PB 1NS3A 2JIZD 3MTYA 5GDSH 3UOPA 3ZYEA 3IWMA 1TMTH 5F8ZA 2BTCE 2TPIZ 1ZHPA 1ZHMA 3LIWA 4Y11E 1F5KU 3NXPA 4I8LA 2ZDNA 2J98A 1L1GA 4ZKSU 3AAUA 1WQSA 1UTQA 1WBGB 1CT2E 2GCHF 2C4FH 5GCHG 2R2MB 1BTZA 1XUGA 1SLWB 1Y5UT 1AU8A 3M7TA 4YTAA 3SORA 1FNIA 3BSQA 4INKA 2RA0A 3LGWA 4X8TH 2STAE 1CT0E 4B74A 1T8NA 3SJOA 1WV7H 4X6MA 1PPCE 3QO6A 7GCHG 1A61H 5I25A 3D23A 4KGAA 4Y8YA 5JBBS 1DWDH 3SI4H 3TIUA 3UB0A 2BD4A 2ZGBH 3BTGE 2SNWA 1K1JA 3SZNA 2ZHEH 3SO3A 3TH2H 2P16A 1AZZA 3A7TA 3OU0A 2WZQA 4D7GA 4J2YB 4YOJA 1IQEA 1Y59T 1Z1JA 5FCRA 4ZXXH 5EW1H 3AVZA 2LPRA 2KX4A 1BMMH 5FCKA 3ZZ4A 1Y8TA 2QXIA 2QC2A 2QF5A 3KQDA 1GJBB 1AB9B 3M35A 4SGBE 1XUKA 4Y10E 2A0QB 2QIQA 3RM2H 1YM0A 1DOJA 2TRMA 1NT1A 1GMHG 2OINA 1RJXB 2GV6A 3RU4T 1N1LA 1RTLA 4F49A 2DE8A 1T4UH 1W12U 4FUBA 1GG6C 1O35A 1AIXH 1P8VC 1LKBA 2R0KA 1HXFH 1O3LA 1YLCA 2WYJA 4NFFA 2ANMH 4YLQH 5FL7D 3QZRA 1NY22 1TB6H 2SGPE 4WMEA 5ABWA 1MCTA 1D6WA 1PQ7A 2J92A 5AHGH 1GG6B 2FOGA 1J16A 7KMEH 3FOAA 4FU8A 5TCCA 4DURA 3S9BA 1SGFG 2ZNKH 1MU8B 2JH0D 2HVXA 3HPTB 4O97A 1UK2A 3FO8D 3EAJA 1DWEH 1DT2A 2FOMB 1C5ZB 3VB3A 1ORFA 2FOHA 2J9NA 3RXGA 2ZTXA 1KXAA 4LXBH 1O38A 1QL7A 3KYFA 1O5FH 1GBFA 4WXVA 1GI0A 5EJLA 1JRSA 3SUEA 4ISIH 4A7IB 2O8WA 1F7ZA 4ZHAA 1RXPA 1OKXA 1TNIA 2Z6BD 1GJAB 1MUEB 2AGEX 1K1MA 5DP7A 1YLNA 1K1NA 3QTOH 1GDQA 1NPMA 1YPLH 1C5PA 2PSYA 3U98H 4M9FA 1E79D 3RXLA 2BQ6B 1C1VH 2PLXA 5A8ZA 1B0EA 2QN5T 4X6PA 3A85A 4Y0YE 3HK6B 5E0HA 1IQNA 1GBBA 1OWJA 4K1EA 3GY7A 1SGRE 1FPCH 4GVUA 4CH8B 1TPOA 4F55A 5FPSA 4NWLA 4HGCA 1MKXK 1C2DA 1OS8A 1BCUH 2XWAA 1P11E 1F0UA 1N6XA 1V2WT 4IC6A 5C2ZA 1O3IA 1EZSC 1TIOA 2PKAA 3F0PA 3Q3YA 5F8XA 5EQRA 1MAXA 1EFRD 3QDZB 1P02A 4ZCNA 1NFUA 2F9UA 1TNKA 2BDIA 1OSSA 1S6HA 3MNBA 1DDJA 3O8CA 4Z1MD 1Z8IB 1TRNA 1YKTA 1GBTA 3T28A 1D3DB 3KQCA 2BD7A 3LJOA 5C94A 2IPHA 1GBHA 3STIA 4DVAU 4NG9H 2JJ2D 2Q6GA 1KTSB 4IMQA 2BLWA 8LPRA 2RDLA 4K5ZA 1YPMH 3PRBA 3DD2H 1QQ4A 1JWTA 1QA0A 1QTFA 4D76A 2QE7D 1YPJH 4A1XA 1O3CA 1SQTA 2XNDD 3LGYA 3TGJE 1B5GH 4D9QA 1TONA 3RXVA 5FPYA 3F68H 1TMUH 5HKKD 2KZ4A 1LO6A 1OWKA 3F2HA 4R0IA 2PKSC 2FWWA 1BMAA 3A7WA 5DP6A 4LZ1H 1GI2A 2FIRH 1H9HE 3T26A 2SGAA 5FX6A 1SGPE 2B0FA 1GI4A 1TE0A 1O2OA 4XFQA 3QGNB 4E06H 5CMXH 2FI4E 2SGQE 4UFFH 1FLEE 2GDDA 2F4LA 3BV9B 5J4SA 6LPRA 2QF0A 2ZKSA 4CR5A 1Q31A 1TNLA 1H8ED 1O5CB 4OS1A 4FVBA 3F9HA 1HIAA 2D2DA 4LK4A 2XYAA 4ZKOU 1FN8A 2ZPQA 3FP8E 1FY5A 3MNXA 4Y7BA 4XBCA 2PTCE 1MD8A 3TJNA 5EW2H 4HG6A 3M5MA 4ZHLU 2FOEA 1DFPA 1MAYA 3VFEA 1IQKA 1J9CH 2F91A 3PWCA 4AFQA 4WWYA 1C1MA 2V3MA 2D1JA 1OOKB 3MOCA 4IC5A 2XCNA 2ZZUH 1OWHA 2VIOA 2VNTA 5AFZH 1TBQH 2P3TB 2G8TA 1LPZB 2OC1A 1QRZA 2FM2A 3RMMH 1XUHA 3CS7A 3QN7A 3TK9A 3SZEA 1GCDA 4KTSA 2BM2A 4WF8A 1G37A 2G4UA 1S84A 1VCPA 4X8UH 2BDBA 1LKAA 3SYJA 2A2QH 5A0BA 2O9QA 5EU8A 3HGNA 1GDNA 4X2VA 2ESTE 1E36B 1SGNE 4U32A 3SV9A 1YGCH 1BZXE 2CJIA 2NU3E 2J34A 2P3UB 2JETC 4FUEA 1TALA 1DUAA 2KCYA 3QK1A 1KXFA 4SGAE 3Q77A 2QXGA 1NFXA 4XRNA 1LPKB 1LVBA 1ANEA 1TPSA 2OUAA 4F4OC 1OWIA 2Z3DA 1RS0A 3UUZA 1G9IE 1S85A 1RRKA 1L1JA 2ZPSA 2W3IA 1HPGA 1SGDE 2ZCKP 3JZ1B 1ZZZA 2ZQ2A 1GVKB 2F3CE 3E3TA 5LPRA 2BY5X 1MH0A 1ELEE 5JBAS 4TY7A 3E90B 2EI7A 1LQDB 2FX4A 3ATIA 6ESTA 3ZZCA 4I86A 4BAHB 4XBDA 1EXFA 1S81A 3F2GA 4O9VA 2JH6D 5C0TA 3ZVFA 1C5VA 3P8OA 1IQFA 1YLDA 1QY6A 1FN6A 5TJXA 3U8TH 3W1EA 3O8BA 1DWCH 3V13A 4MNVA 1SFIA 2ZC9H 1LHFH 4B75A 1FUJA 4Z0KA 3KNXA 2GZ8A 1F0RA 2SNVA 3IG6B 2J94A 2WSSD 2HRVA 4ACBA 1J8AA 3UR6A 4AYYB 1PYTD 1KXBA 1MTSA 3U1IB 2RFKC 4WVPE 1BTWA 1WU1A 2RCEA 3UIRA 2TBSA 4B2BA 2V6NA 2ZFPH 2TGPZ 2BDAA 3PV2A 2BY8X 3A89A 4Y79A 4JK6A 4BAQB 2ZU2A 5C5OA 1GBKA 2VB0A 3GYMA 3F9GA 1YBWA 1BMNH 4MTBA 4ASHA 3U1JB 5EPNA 1AFQB 4DOQA 3RXIA 4CRBA 4GCHG 2VVCA 3RXMA 2VBCA 1HRTH 2UUYA 2KAIB 2ZGCA 4BOHA 4PROA 1SFQB 3GCTF 4K1SA 4ABBA 1UCYK 4Z6AH 1UTPA 3QTVH 2Y6TA 3LPRA 1BHXB 2A7HA 2Y81A 5F8TA 2GZ9A 3MO6A 5ESTE 3SU3A 3ODDA 1TFXA 1EPTC 2HLDD 3DFLA 1KXCA 1IOEA 4JYTA 1C1OA 1SKYE 1CHGA 1GJ7B 2ZHFH 5L30H 3FP7E 3M61U 1D3QB 1KDQA 1O30A 4YZUA 1GMCF 1O3MA 2ZO3H 1O5AB 1SGYE 4I8HA 3RXFA 3EA7A 1EPTB 2ZFSA 3F2FA 4WJG2 3NWUA 3KCGH 4O3UA 2VIQA 1GI6A 3NRLA 3Q76A 1QRXA 1G3CA 1NFWA 3SJKA 1OP0A 1P01A 1SGFA 1O3NA 4BAOB 2GT8A 4FUGA 1BHXF 1G3BA 3ZZAA 3EYDA 1VCWA 3S9CA 2PGQB 2BDYA 1Z6EA 3MH7A 1C5QA 2VIWA 1OPHB 2FP7B 4CRDA 1G30B 1O5BB 2ODYB 2A4QA 1Z71A 4OS4A 1AUTC 4NIYA 3SU5A 1PQ5A 4MNWA 1GJCB 1GI1A 1C2LA 4LOYH 2A7JA 1H4WA 1GPZA 4TPYA 1FONA 1PYTC 2XCFA 1C5OH 3SNEA 1GBDA 1SGTA 1BTPA 3RLWH 5A8XA 3BG4C 4P00A 4BTTB 3SU0A 1W11U 1TQ0B 3EA8A 2EA3A 3RMOH 4FUIA 2ZECA 5DO4H 2UWLA 3WW7A 1F0SA 1HYLA 5EXNA 4MNYA 5EJZA 4AFZA 2BD5A 2FXRA 1C5UA 1Z6JH 3RXPA 1AMHA 2GD4B 1VJ9U 4E05H 2A45B 1A0JA 3KL6A 3MU4A 3MHWU 2XC5A 3PLPA 3P8GA 3S7KB 3A8BA 1ARBA 1SHYA 3EQ0H 2P8OC 1BTUA 3STJA 1V6DA 3MO9A 1F2SE 2ZIQH 2FS9A 2O8MA 4JYUH 5B6OA 1SG8B 2BX3A 2H9TH 3BF6H 2ZCHP 2H1UA 3LH1A 2H9HA 1O5GH 2KCOA 1TA6A 1W0JD 3UPEA 1MBQA 5DK1A 1C4V2 2ZHWH 1ZYOA 4X2XA 3AK5A 5DKMA 2AH4X 2B5TB 1C1RA 3A88A 3HKIB 4HZHA 1CHOG 3QUMP 1SGQE 4CBOA 3SQHE 2NU1E 1DSTA 1DUEA 2OLGA 1ELTA 1A3EH 1UW7A 3KHVA 2GJGA 2OC7A 2C3SA 2WPIS 1GCTB 4TT3D 1ZRKA 5EQQA 1HLTH 1K1PA 3OTJE 1GJ6A 2YOLA 3PMHB 3AAVA 1MTNC 1PQAA 3A7ZA 1FY8E 2I6SA 2BVXH 4BTIB 1O2JA 1BB0B 1GMDG 1HJ9A 2FI5E 2SGFE 3RXOA 1AHTH 1GI7B 4GHQA 1F5RA 2W3KA 1O3EA 1EB2A 3CNRA 3M3TA 1EZQA 3A81A 1E37B 5F03A 5KGOA 1O2IA 1O3JA 1QL9A 1S83A 1JBUH 3FZDA 3B23B 3ZVDA 2YNBA 5DP4A 1RFNA 5C0UA 4K69A 4Q80A 1IQMA 1QJ1B 7GCHF 1UTMA 2P94A 5T6FA 3MYWA 3FKSD 2FMJA 2ZTYA 2QCYA 4ZAEA 1AI8H 2AHME 3SI3H 1HGTH 4I8KA 1FAKH 3UQVA 1DS2E 1H9IE 3PMAB 1AO5A 1GHZA 1N8OB 3E0NB 1PFXC 4A1VA 1YCPH 1AVXA 4NCYA 4NWKA 5AVDA 2AGGX 5HXFA 4UFGH 4UFDH 2EY4C 2GKVE 2B9LA 1GBMA 4GUXA 5GJ4B 3TPIZ 3BTKE 4ABHA 1NU7B 3H7TA 3WWBA 4B71A 3ODFA 1LMWB 3NPSA 4IGDA 1GMHF 2UUKB 1AKSA 3JZ2B 3PO1C 1V2TT 1CO7E 1SQAA 4OGYA 2CN0H 2DE9A 1W0YH 5HGGA 1EQ9A 1O2GH 1O3OA 3VG8A 3MMGA 4VGCC 3P8NA 3ZVBA 1GJ5H 6GCHF 1IQIA 1C5MD 1SQOA 4THNH 1A0LA 1K9OE 3ENSB 1S6LA 2F43B 3LC5A 1CBWC 3TJOA 4VGCB 1QJ6B 3N7OA 1YPGH 2F9OA 2JH5D 3U8OH 3ATKA 3SN8A 1HAVB 2FOCA 2HNTE 1JRTA 1F92A 1GI9B 5E0JA 2XC4A 1W14U 2ZFQH 3RC5A 1SI5H 1TABE 1A3BH 1JXPA 4RT0A 2O8UA 4O03A 3SNBA 5KEDA 1C2JA 1TOMH 5AF9H 2VH0A 1MD7A 2FOBA 3RXAA 2BHGA 1EUFA 4MPXA 3GDSA 2WUBA 5FHTA 1TAWA 3ZVEA 8GCHG 2C8YB 1D6RA 1P3CA 1TRMA 3VB7A 2GCHG 4K8BA 1O37A 1SVPA 2VJ1A 2VH6A 1MTVA 4WMDA 3M5NA 2VVUA 1SLVB 1ZMJA 1RTFB 1NRPH 4KTCA 1QZ8A 3VB4A 4WMFA 1OYQA 4MVNA 2H5CA 5HM2A 1AWFH 5LH8A 1AN1E 1XKAC 1FI8A 1TA2A 2XWBI 3OX7U 1ARCA 2C93B 3T25A 2TGDA 1J15A 1UVUH 1Y3WA 5T6GA 1A46H 2FLRH 3T5FH 4ABDA 3AW0A 1O3PB 1MZDA 1V2PT 3SV8A 1QR3E 1C1NA 1EP5A 1CGIE 3K9XB 4GPGA 1XVMA 2QXJA 3BTQE 1T8MA 4Y0ZE 3C27B 2GMTC 1P03A 4B2AA 2XC0A 2ZTZA 3TVJB 4AG2A 3RM0H 4X2WA 3EE0B 1QB9A 1QURH 1ELCA 1P3EA 4AGKA 3F1SB 5DP3A 1FY3A 4FUCA 1QBVH 1B7XB 3F3BA 1O2SA 3N7EA 3UFAA 1T7CA 3N99A 4DG4A 1QGFA 3TK5A 2OK5A 2W6ID 2OC0A 1AY6H 1S0RA 4OS5A 2J98B 2WYGA 4FETA 4OM9A 3SJ8A 4IMZA 4YT6H 3GOVB 1T31A 2ZDLA 4BNRA 2VVVA 3SGAE 1EX3A 4M7GA 5L6NH 3ITIA 3R3GB 1VKYA 4A6LA 3MI4A 2ANKH 1GBCA 1V2QT 3C1KA 5AFYH 2BLQA 1GWAA 3SU1A 3TU7H 1CT4E 1Z8JB 2ANWA 3E8LA 2QF4A 3QX5H 4ISLA 1LCYA 3V0XA 1ELVA 4H4FA 3RC4A 1MTWA 4AFSA 3MQKC 2G5NA 3GDUA 1C5NH 4YOGA 3MWIU 1ANDA 1EKBB 2K0QA 4CBNA 1OYTH 1EB1H 1ELBA 2LELA 1FMGA 5I46H 3UNSA 3ATMA 2QYIA 3ZZ5A 2WPKS 1LHEH 5B6LA 3K6ZA 1LDTT 1E38B 2B7DH 1KXEA 2HVYB 3RXDA 2PWXA 1MTUA 4B1TA 1RIWC 1OP8A 1VITH 1VITG 4AYVB 5GXPA 4P02A 2F83A 1UO6A 2O8LA 4AZ2B 3PRDA 2IN2A 2RG3A 3SJIA 1RTKA 1IQGA 4INHA 1GBAA 1P57B 5T1VA 1V2KT 1K2I1 1WXRA 4YM9A 1P2QA 1ZTLA 2PKSB 3GICB 5FBIA 3T2NA 1QBNA 4KKDA 1LHCH 2XBYA 1ESBA 1TWXB 1AE8H 1O2TA 3EDXB 4UDWH 5E2PA 1HAIH 1C5RA 1LQEA 2ZF0H 2Z9IA 3BTEE 4AORA 2ZQ1A 3PV4A 2AEIH 3P92A 1ABJH 2H2ZA 4JYVH 3O8RA 3DSGA 1ESTA 4RKOB 1BTXA 3ZV9A 5EQSA 1KMHB 3UWIA 4BANB 3IITA 1GL1A 4KTUA 2FYQA 3SV7A 2QA9E 4Q7ZA 4TWWA 3KEEA 4R8TB 1FJSA 2CHAC 3PLKA 1O34A 1BIOA 3OE7D 2OBOA 1V3XA 1UMAH 2OQUA 2M5TA 3L3TA 4CREA 1TGBA 1EZUC 2OC8A 1SC8U 3LGIA 5ESBA 3BTME 3LH3A 2CHAB 1ESAA 1TMBH 1W2KH 3LONA 1WQVH 4Q2KA 5C3NA 2A31A 5EOKA 5JB9S 3BIVH 2BQWB 3UAIC 2VIDA 1GVLA 3U9AH 1O3GA 1HCGA 6CHAC 1H8DH 1UVPA 1C2HA 4UD9H 1HAPH 1MMJN 3UQOA 1NN6A 1IAUA 2P95A 3ZZ3A 4BAMB 2QF3A 1XXDA 1HAYB 1T4VH 4TWYA 6CHAB 3S7HB 3PB1E 4NIXA 3K6YA 1P2MA 2BZAA 4Q4LA 1E34B 2ALPA 3GDVA 2PKAB 1NBMD 2GV7A 2TIOA 2V3OH 2CGAA 1AD8H 4AG1A 5JDUB 2JETB 5DSFA 4JZDH 1CA8B 2JJ1D 2VGCC 1UCYE 5FX5A 3ZIAD 4DT4A 2OXSA 2VIPA 4GCHF 3S9AA 3MH5A 1UHBA 1QCPA 2D26C 5DN6D 1ELDE 1XUFA 2CXVA 1EP6A 1VR1H 1W0ZU 1B0FA 2BDGA 2ODPA 1UK3A 1SPJA 3A87A 1KSNA 5K0HA 1Y3VA 1TNJA 1BRCE 4HI3A 5HYOA 5JBTA 1C9TA 2FODA 3P6ZB 5E8EH 4I8JA 1A2CH 1C2IA 2A7CA 2Q6DA 3FP6E 2AYWA 1AVGH 3Q3XA 2OD3B 1JIMA 4E7NA 3OSYA 1TBZH 2J97A 3P17H 4FVDA 2AFQB 1C5SA 5A0CA 2ZGHA 2ZGXH 2C8XB 2WPHS 4AB8A 5JYIA 1WCZA 4D9RA 1HAXB 3KQ5A 7LPRA 5CHAC 3TGIE 8KME2 1ELAA 3KN2A 2IOTA 3RXCA 1IQJA 1HIAB 2ZGJA 4JZIA 3E91A 1BTHH 5GNDA 2XRCA 4KELA 3ZZDA 1TX8A 3M37A 1HAOH 1V2NT 1W10U 2SGEE 1SQRA 1G32B 4IS5A 3MFJA 3NCLA 3V12A 4DT7B 5DP9A 1FIZA 2FYRA 3Q00A 2GZ7A 3ZZ6A 3K2UA 3EA9A 1SL3A 2BMGB 2BD2A 1D4PB 1O3AA 2PHBA 3M7UA 1L4DA 3MU0A 5HM9A 1UTLM 1HNEE 1TOCB 2GTBA 1NROH 1WOFA 5GWZA 1SOTA 4ISNA 3RXUA 5DG6A 3URDA 1ACBE 4WH6A 2PW8H 4AGJA 1LTOA 1JMOH 2BDHA 2FS8A 2Q1JA 1E1QD 3QLPH 1GGDC 4ESTE 1YPKH 4GHTA 4XOJA 4NGAH 2V3HH 3ZZ8A 1O5EH 1ETSH 2BYAX 4IW4E 1GHYH 1HAGE 3M5OA 1TNHA 1FY4A 1BBRE 1CU1A 4ISOA 3OYPA 1SLUB 1V2LT 2VIVA 2FEQH 1Z8GA 1GGDB 4JZ1A 2BZ6H 3RC6A 2F9PA 1Z1IA 4X1QU 2XXLA 1QNJA 4XDEA 1ZTKA 2XTTB 3GCHC 2R0LA 1K1IA 1ZPCA 5DJ7A 1G2LA 4AN7A 1MU6B 4RKJB 1C2EA 2QAAA 4Q7YA 5EODA 2PTNA 3UREA 1UTKA 2QV1A 1HDTH 1YPHC 1C2GA 3MNCA 1O3HA 1YWUA 1EAIA 3GCHB 3BG8A 3GCTG 4ZMAH 1XMNB 1CHOF 2ZG0H 1NFYA 1TGTA 4H42U 1HUTH 1TBRH 5EG4A 4FXGH 4GSOA 3MU1A 4FUDA 4MPVA 1SB1H 3LU9B 4J1YA 2TGTA 1KLTA 4TY6A 1A7SA 2UWPA 3BG4B 3A8AA 1LVYA 1O2QA 3LGTA 4RI0A 2ULLA 3GISB 4Q63A 3ZZ7A 3RXHA 3DSOA 5L2YH 1CGJE 1YF4A 4ABAA 5F53A 4QT8C 2WV5A 1GMDF 1K1LA 1ELFA 1WUNH 2EEKA 2BD9A 3UWJH 1NRQH 1HBTH 4D8NA 5A0AE 3GYLB 3L6PA 3TNTA 1RD3B 2G81E 3HATH 2R9PA 1E0FD 2Y82A 1MABB 1P05A 3RU4D 1QBOA 1YPEH 2JDID 3EE7A 1WTGH 2P8OB 1YCPK 2FOFA 3M5LA 2PR3A 3MNSA 3U28C 1H1BA 5JB8S 3B9FH 3BTWE 2L74A 3UNQA 3SUDA 1BRAA 5HIZA 2AMQA 2FDAA 2ANYA 1SGCA 3A82A 4NIWA 1A5IA 1EATA 1GHBG 3SHCH 4AC9A 2ZFTA 1O2NA 3QGJA 3NKKA 5KECA 4KP0A 1FXYA 3SNCA 2K8IA 3DSPA 1KLIH 1ZLRA 4FU9A 1TX6A 2CMYA 1O5DH 1GHAG 4A5TS 1XUIA 1ZGIA 2J95A 3FFGA 2ZDKA 1QJ7B 1GBIA 2CF8H 3ZZ9A 2G52A 3WY8A 1VJAU 5C67A 1O39A 2AS9A 4XSKU 2BLOA 1P9SA 1M9UA 5GCHF 1BMLA 2J38A 3SV2H 1VZQH 1O2MA 1QL8A 4FOUC 4E7RG 1S6FA 1AFEH 5C1XA 1MTNB 4FUJA 4X0WU 3W94A 1O3FA 1KDQB 1C5TA 2BOKA 3PYHA 1GHVH 2ZA5A 1O2ZA 4DIIH 3RXTA 1AUJA 4K1TA 2GP9B 1O0DH 1O2XA 1MQ5A 2BY9X 5CE1A 2WPMS 2F9NA 3FN8A 2M2AA 3BTDE 1O2UA 4NIVA 4U2WA 1NC6A 4BXWA 2FZZA 2WV9A 2Z94A 2VU8E 2HGTH 3RU4E 1LVOA 2EQNA 2PP6A 3OTPA 2A5KA 1QFKH 3UR9A 3BEIB 1SLXB 3DA9B 3FANA 5DPAA 2QXHA 1MKWH 1V2RT 4HFPB 2WPDD 2Y5FA 3DT0H 1BBRH 1H8HD 2STBE 5GIBA 3KQEA 1UVOA 2OBQA 3OY5U 1Q3XA 5A8YA 4K60A 1DY8A 1O3KA 3LDXH 1C5WB 1QB1A 4DIHH 1P04A 1G3EA 3DHKH 5LGOA 3QWCH 1W7GH 8GCHF 3QZQA 1F0TA 3A83A 2FESH 2BLVA 1C1QA 1ZMNA 3A86A 1Y3XA 4YLUA 2HLCA 1P2IA 1C9PA 1PQ8A 3PO1B 3B8JA 3A84A 1G3DA 1THPB 1U6QA 2A2XH 4O3TA 1PPGE 4ACAA 2HWLB 1MCVA 2SGDE 1FY1A 4NSYA 4YOIA 3LGUA 2A4RA 2HALA 1O33A 1ZHRA 2P93A 3NUMA 1ETRH 1YC0A 1CBWB 3GY5A 4BXSA 4NZQA 5HIYA 4RT1A 1DY9A 2ZU5A 4ZKRU 3SNDA 3SW2B 5LPEA 3OAAD 1DSUA 2AIPA 1AB9C 3T29A 1SBWA 4Q7XA 1C2KA 2Y5GA 3PV5A 1BUIA 4ZXYH 3OEHD 1DVAH 1OHHD 2BY6X 4NFEA 3I29A 1LVMA 4K8YA 3U8RH 3NZIA 3RMNH 1HAZB 2LNCA 3EGKH 3RXSA 1UTOA 1XKBC 4IN2A 3ELAH 3RXEA 5DGJA 3G01A 2K1QA 2RA3A 4FU7A 4UEHH 4UE7H 4AOQA 1C1WH 1K28D 3PWBA 1CSOE 1THRH 3GCOA 4OS6A 2WINI 3R0FA 1BRBE 4X1SU 1KYNA 3RXBA 2Z7FE 1S5SA 1A1RA 1BJVA 1Y3YA 2W7SA 1AE5A 3CS0A 2HNTC 2VWLA 3PTNA 2G5VA 3A7XA 6GCHG 2PSXA 1P9UA 4DGJA 3HGPA 1GJ8B 1H8IH 2Z3EA 5IYTA 2J4IA 2YNAA 1PJPA 1ZJDA 1L4ZA 5ETXA 2P59A 2FO9A 1TRYA 4MDSA 2BVSH 1Z8RA 1MBMA 1K0HA 1CA0C 2BX4A 5L2ZH 3GY3A 3VB5A 2A5AA 2BXUH 1F5LA 1YP9A 1CVWH 1NRRH 1V2OT 2WPLS 3S69A 3LOXA 3LJJA 9ESTA 1GL0E 4TYDA 1O2VA 4X8SH 1CA0B 3ATWA 4I7YH 1ZMLA 5EPYA 1O3BA 1MQ6A 5CDFE 1WYKA 2PUXB 1EAXA 2GMTB 1NTPA 1ZR0A 1LPGB 3KF2A 4JMYA 4CRGA 5EIYA 5E0GA 2FI3E 1TGCA 1VITF 2G51A 2J2UA 3A7YA 1LHDH 1OWEA 2AMPA 4GLYA 3URCA 1QQUA 1V2VT 1DLKB 1P0SH 4B76A 2FX6A 2A4GA 3DUXH 3SJ9A 5SGAE 2ILNA 3ZVAA 2HNTF 2HPQH 2XBVA 1A5HA 1AKSB 1GBEA 4X6NA 3SU6A 5A2MH 1K1OA 3CP7A 1V2JT 3HKJB 1ZTJA 3MU8A 1O2KA 2W26A 3RXQA 2FLBH 3PM3A 1GVZA 4Y8ZA 3SGQE 5HMAA 4AX9H 2ZU4A 4ABIA 4ABJA 1P2JA 2QY0B 2ZDVH 1G2MA 1BTYA 1T8LA 1XVOA 2ZWLH 2XW9A 2O8TA 3TJVA 4NA9H 2EI8A 4MNXA 1O32A 3GY2A 1C1TA 5G4BA 4NA7A 5FBEA 2AIQA 3SNAA 1BDAA 2SFAA 2GVFA 1C4U2 5GPIB 4B6FA 3WWFA 2KR7A 1A5GH 2IJOB 1IHTH 1DANH 2PGBB 1TGSZ 1OP2A 3AW1A 1SMFE 1Y3UA 1NU9A 4CR9A 5BRRE 5BPEA 4WH8A 1O2HA 2XBWA 4U30A 3TLOA 7ESTE 2OTVA 1W0KD 1QIXB 1GBLA 1YYY1 4JZFH 2KFWA 1P12E 1RIWB 1UVSH 5T3HA 4RSPA 3TITA 1J17T 1ZRBA 3T27A 2BY7X 1D9IA 1EAUA 4D7FA 4Y71A 2WV4A 3GY8A 4A92A 3BTTE 2Y5HA 2FTLE 2C8WB 2XOKD 4U01A 2ASUB 1HJAC 2R2WU 1CGHA 3PMJA 1P2OA 4ZKNU 2WPJS 1MKXH 4CH2B 1FX0B 1N6YA 4YESB 9LPRA 4X8VH 2Z9LA 4IBLH 2AERH 1KXDA 2KCAA 4XE4A 1HJAB 1IQLA 2A4OA 3H5CB 3O8DA 3PLBA 4Y8XA 5FPTA 1TX7A 4DW2U 1EJAA 3AASA 1NRSH 3ZV8A 2KAIA 4BAKB 1EJMA 2L6OA 3RXRA 1FZZA 2ZFFH 3GY4A 3LKWA
chains in the Genus database with same CATH topology
3K65B 1AZ8A 1WSSH 2BQ7B 4X1NU 3ZVGA 1SOZA 2ZEBA 4MG3A 3T62A 1GHXH 1QA7A 3V3MA 3VGCC 3L33A 3M7QA 2ZPRA 1AWHB 5EXLA 1EJNA 1NZQH 2BOHB 5EXMA 3D65E 3SHAH 3TK6A 4X1PU 4DCDA 1EOJA 2OCVB 1DWBH 1P2KA 4Y6DA 3MH4A 3GCNA 3F9FA 1J14A 3ZVCA 3VGCB 1DX5M 4Y7AA 1X7AC 3SUGA 1TQ7B 3ZZBA 4B2CA 2BD3A 1EPTA 5C20A 3RP2A 4MPUA 3P95A 1C4Y2 4AB9A 3ATLA 1BRUP 3LT3A 3E1XB 1SR5C 3I78A 3LGVA 1UTJA 2DUCA 3BTHE 3FVFB 2ZP0H 1Q2WA 4NZLA 3TH4H 1DITH 2BXTH 3MO3A 3BEFB 3PTBA 3RDZA 3RXJA 1C1SA 1H9LB 1P06A 2FOAA 4JK5A 2UWOA 1LHGH 3SV6A 4OS7A 3SU4A 3BTFE 5DP5A 3VB6A 1INCA 3RLYH 3H7OA 1ZSKA 4ZH8A 1AVWA 4HTCH 1TGNA 1CQQA 2Z3CA 1Z7KA 3TJUA 2B8OH 4B73A 3A8DA 2VGCB 2I6QA 1PPFE 2XNIA 3UNRA 5FAHA 4I32A 2NWNA 1VCQA 1FAXA 2THFB 4Y76A 1NESE 1BJUA 2V0BA 1GBJA 1ZPZA 2ZDMA 1L0ZA 2BDCA 1O2WA 1GJDB 1TPAE 2C90B 1PPBH 2G00A 3E16B 1P10A 1DM4B 5DP8A 3M36A 1KIGH 3E6PH 3CENA 4MQAA 3BIUH 1XM1A 1HFDA 2VWMA 3DFJA 4YO9A 4X1RU 4A1TA 2ODQA 4UONA 4ABFA 1DLEA 4NA8A 3ZYDA 1ZGVA 5PTPA 1EOLA 4K3JA 1ELGA 1ZSJA 3M3VA 2F9VA 2FPZA 2TGAA 4DJZB 1NRNH 1ID5H 2UUFB 1HJ8A 3F9EA 2Q6FA 4CRAA 2D8WA 3NK8A 1HV7A 1C5YB 1AFQC 3BN9A 5T6DA 4MPWA 2ZHDA 5CHAB 3SGBE 2GX4A 5C5NA 5LPFA 2AMDA 3MH6A 3PROA 4ISHH 3TH3H 4FUHA 4ZUHA 1L2EA 1C5LH 3U69H 2V35A 1Y5AT 1Y5BT 1FQ3A 1DXWA 2NU0E 3FZZA 4X6OA 1C1PA 1V2MT 1K22H 1HAHH 3VEQB 1BA8B 2EC9H 1TLDA 1BITA 3LC3A 2GDEH 4XBBA 4JCNA 1ZPBA 2H9EH 1GJ9B 1O3DA 2FTMA 3SBKA 4CRFA 2Z9JA 1GDUA 2XBXA 1DPOA 1IQHA 4RN6A 3OY6U 5IDKA 3A80A 1FV9A 4CRCA 5E2OA 4H6SB 4LZ4B 3SOSA 2NU2E 4OS2A 3UTUH 1YPHE 2ALVA 1NO9H 1TYNA 2OP9A 1SGEE 1V2ST 1QB6A 3M3SA 1UJ1A 4MLFB 1O2YA 1TNGA 1W13U 3SUFA 2GT7A 4AFUA 1JOUB 2ZI2H 5TCAA 4DY7B 4I33A 2W5EA 2PV9B 1TPPA 1QHRB 1PPHE 1C2MA 2A1DB 4NSVA 1EZXC 1GI5A 1IHSH 2GGVB 4YT7H 2A5IA 2AGIX 3TGKE 3RXKA 1CE5A 3KQBA 8ESTE 2Y7ZA 2CF9H 3F6UH 4UFEH 2UUJB 2ZU3A 1GHBF 4WXIA 1BQYA 1O36A 3W95A 1ZOMA 1WTHD 1DE7H 4FUFA 1RGQA 1AQ7A 4K2YA 1ZSLA 1BT7A 3UOUA 3HK3B 2R3UA 2ZDAH 1ANBA 2JKHA 1GHAF 2VINA 1T32A 1HXEH 3PMBB 4JZEH 5H4IB 1UHBB 4INLA 1VGCC 1SSXA 2ZU1A 1UCYH 3D62A 2HPPH 3A8CA 1V2UT 2P3FH 1GMCG 1MZAA 5F6MA 2G55A 3A7VA 1OX1A 3KIDU 1ABIH 2W7UA 1GHWH 1S0QA 1VGCB 1DICA 3RUOA 2EI6A 2VWNA 2F9BH 1FPHH 1D3TB 2A32A 2C8ZB 1XX9A 4CHAC 1ETTH 4TPIZ 1W3CA 2Z9KA 4I8GA 1GI8B 1L1NA 1NM6A 1P2NA 1SHHB 2PUQH 1A0HB 1W7XH 3E0PB 1UTNA 5JBCS 3SU2A 2CV3A 1HAVA 1XXFA 3I77A 1A4WH 5EGMA 4CHAB 1P09A 1C2FA 1MKWK 1AGJA 1QRWA 1KLJH 2NU4E 1BBRK 1K21H 4ZHMU 1KTTB 2H6MA 3VXEH 3D49H 3S0NA 1C1UH 2G4TA 5A09A 1UK4A 1THSH 3MU5A 1S82A 4ABGA 2R3YA 3KGPA 1OXGA 1GCTC 1UVTH 1HB0B 1FDPA 4ABEA 3ESTA 1O31A 2PFEA 2QGRA 3GY6A 5JPMH 1O2PA 5K7RA 2H5DA 1C5XB 2HOBA 2Z9GA 1DXPA 2BVRH 3Q3KA 4WY3A 1PPZA 3VPKA 2BB4A 1O2RA 1G36A 3FAOA 3TNSA 1ZJKA 3RMLH 2ZFRH 4H6TA 1FIWA 1SGIB 4BTUB 1GJ4H 1ANCA 3P70B 3SQEE 2ZCLP 4IN1A 4ZROA 3BEUA 2OQ5A 3UY9A 1GI3A 1PPEE 4GAWA 1EAWA 2Y7XA 2GCTC 2ZHQH 1WAYB 1XUJA 1YCPM 2BD8A 1JIRA 3VXFH 1O2LA 1OWDA 1BOQA 1KY9A 3P8FA 1T8OA 1N8OC 1W8BH 4OGXA 4X2YA 2GCTB 5J4QA 5C1UA 3V7TA 2WUCA 5FXLA 1EASA 5C1YA 1E35B 2Y80A 2VWOA 4I31A 1D3PB 1NS3A 3MTYA 5GDSH 3ZYEA 3UOPA 3IWMA 1TMTH 5F8ZA 2BTCE 2TPIZ 1ZHPA 1ZHMA 3LIWA 4Y11E 1F5KU 3NXPA 4I8LA 2ZDNA 1L1GA 4ZKSU 3AAUA 1WQSA 1UTQA 1WBGB 1CT2E 2GCHF 2C4FH 5GCHG 2R2MB 1BTZA 1XUGA 1SLWB 1Y5UT 1AU8A 3M7TA 4YTAA 3SORA 1FNIA 3BSQA 4INKA 2RA0A 3LGWA 4X8TH 2STAE 1CT0E 4B74A 1T8NA 3SJOA 1WV7H 4X6MA 1PPCE 3QO6A 7GCHG 1A61H 5I25A 3D23A 4KGAA 4Y8YA 5JBBS 1DWDH 3SI4H 3TIUA 2BD4A 2ZGBH 3BTGE 2SNWA 1K1JA 3SZNA 2ZHEH 3SO3A 3TH2H 2P16A 1AZZA 3A7TA 3OU0A 4D7GA 4J2YB 4YOJA 1IQEA 1Y59T 1Z1JA 5FCRA 4ZXXH 5EW1H 3AVZA 2LPRA 1BMMH 5FCKA 3ZZ4A 1Y8TA 2QXIA 2QC2A 3KQDA 1GJBB 1AB9B 3M35A 4SGBE 1XUKA 4Y10E 2A0QB 2QIQA 3RM2H 1YM0A 1DOJA 2TRMA 1NT1A 1GMHG 2OINA 1RJXB 2GV6A 3RU4T 1N1LA 1RTLA 4F49A 2DE8A 1T4UH 1W12U 4FUBA 1GG6C 1O35A 1AIXH 1P8VC 1LKBA 2R0KA 1HXFH 1O3LA 1YLCA 2WYJA 4NFFA 2ANMH 4YLQH 3QZRA 1NY22 1TB6H 2SGPE 4WMEA 5ABWA 1MCTA 1D6WA 1PQ7A 2J92A 5AHGH 1GG6B 2FOGA 1J16A 7KMEH 4DURA 4FU8A 5TCCA 3S9BA 1SGFG 2ZNKH 1MU8B 2JH0D 2HVXA 3HPTB 4O97A 1UK2A 3EAJA 1DWEH 1DT2A 2FOMB 1C5ZB 3VB3A 1ORFA 2FOHA 2J9NA 3RXGA 2ZTXA 1KXAA 4LXBH 1O38A 1QL7A 1O5FH 1GBFA 4WXVA 1GI0A 1JRSA 3SUEA 4ISIH 4A7IB 2O8WA 1F7ZA 4ZHAA 1RXPA 1OKXA 1TNIA 2Z6BD 1GJAB 1MUEB 2AGEX 1K1MA 5DP7A 3QTOH 1K1NA 1GDQA 1NPMA 1YPLH 1C5PA 2PSYA 3U98H 3RXLA 2BQ6B 1C1VH 2PLXA 5A8ZA 1B0EA 2QN5T 4X6PA 3A85A 4Y0YE 3HK6B 5E0HA 1IQNA 1GBBA 1OWJA 4K1EA 3GY7A 1SGRE 1FPCH 4GVUA 4CH8B 1TPOA 5FPSA 4NWLA 4HGCA 1MKXK 1C2DA 1OS8A 1BCUH 2XWAA 1P11E 1F0UA 1N6XA 1V2WT 4IC6A 5C2ZA 1O3IA 1EZSC 1TIOA 2PKAA 3Q3YA 5F8XA 5EQRA 1MAXA 3QDZB 1P02A 1NFUA 2F9UA 1TNKA 2BDIA 1OSSA 1S6HA 3MNBA 1DDJA 3O8CA 1Z8IB 1TRNA 1YKTA 1GBTA 3T28A 1D3DB 3KQCA 2BD7A 3LJOA 2IPHA 1GBHA 3STIA 4DVAU 4NG9H 2Q6GA 1KTSB 4IMQA 2BLWA 8LPRA 2RDLA 4K5ZA 1YPMH 3DD2H 1QQ4A 1JWTA 1QA0A 1QTFA 4D76A 1YPJH 4A1XA 1O3CA 1SQTA 3LGYA 3TGJE 1B5GH 4D9QA 1TONA 3RXVA 5FPYA 3F68H 1TMUH 4R0IA 1LO6A 1OWKA 2PKSC 2FWWA 1BMAA 3A7WA 5DP6A 4LZ1H 1GI2A 2FIRH 1H9HE 3T26A 2SGAA 5FX6A 1SGPE 2B0FA 1GI4A 1TE0A 1O2OA 4XFQA 3QGNB 4E06H 5CMXH 2FI4E 2SGQE 4UFFH 1FLEE 2GDDA 3BV9B 5J4SA 6LPRA 2QF0A 2ZKSA 4CR5A 1Q31A 1TNLA 1O5CB 4OS1A 4FVBA 3F9HA 1HIAA 2D2DA 4LK4A 2XYAA 4ZKOU 1FN8A 2ZPQA 3FP8E 1FY5A 3MNXA 4Y7BA 4XBCA 2PTCE 1MD8A 3TJNA 5EW2H 3M5MA 4ZHLU 2FOEA 1DFPA 1MAYA 3VFEA 1IQKA 1J9CH 2F91A 3PWCA 4AFQA 4WWYA 1C1MA 2D1JA 1OOKB 3MOCA 4IC5A 2XCNA 2ZZUH 1OWHA 2VIOA 2VNTA 5AFZH 1TBQH 2P3TB 2G8TA 1LPZB 2OC1A 1QRZA 2FM2A 3RMMH 1XUHA 3CS7A 3QN7A 3TK9A 1GCDA 4KTSA 2BM2A 4WF8A 1G37A 2G4UA 1S84A 1VCPA 4X8UH 2BDBA 1LKAA 2A2QH 5A0BA 2O9QA 5EU8A 3HGNA 1GDNA 4X2VA 2ESTE 1E36B 1SGNE 4U32A 3SV9A 1YGCH 1BZXE 2CJIA 2NU3E 2J34A 2P3UB 2JETC 4FUEA 1TALA 1DUAA 3QK1A 1KXFA 4SGAE 3Q77A 2QXGA 1NFXA 1LPKB 1LVBA 1ANEA 1TPSA 2OUAA 4F4OC 1OWIA 2Z3DA 1RS0A 3UUZA 1G9IE 1S85A 1RRKA 1L1JA 2ZPSA 2W3IA 1HPGA 1SGDE 2ZCKP 3JZ1B 1ZZZA 2ZQ2A 1GVKB 2F3CE 3E3TA 5LPRA 2BY5X 1MH0A 1ELEE 5JBAS 4TY7A 3E90B 2EI7A 1LQDB 2FX4A 3ATIA 6ESTA 3ZZCA 4BAHB 4XBDA 1EXFA 1S81A 4O9VA 2JH6D 3ZVFA 1C5VA 3P8OA 1IQFA 1YLDA 1QY6A 1FN6A 5TJXA 3U8TH 3O8BA 1DWCH 3V13A 4MNVA 1SFIA 2ZC9H 1LHFH 4B75A 1FUJA 4Z0KA 3KNXA 2GZ8A 1F0RA 2SNVA 3IG6B 2J94A 4AYYB 2HRVA 1J8AA 3UR6A 1PYTD 1KXBA 1MTSA 3U1IB 4WVPE 1BTWA 1WU1A 2RCEA 3UIRA 2TBSA 4B2BA 2V6NA 2ZFPH 2TGPZ 2BDAA 2BY8X 3A89A 4Y79A 4JK6A 4BAQB 2ZU2A 5C5OA 1GBKA 2VB0A 3GYMA 3F9GA 1YBWA 1BMNH 4MTBA 4ASHA 3U1JB 5EPNA 1AFQB 4DOQA 3RXIA 4CRBA 4GCHG 2VVCA 3RXMA 1HRTH 2UUYA 2KAIB 2ZGCA 4BOHA 4PROA 1SFQB 3GCTF 4K1SA 4ABBA 1UCYK 4Z6AH 1UTPA 3QTVH 2Y6TA 3LPRA 1BHXB 2A7HA 2Y81A 5F8TA 2GZ9A 3MO6A 5ESTE 3SU3A 3ODDA 1TFXA 1EPTC 3DFLA 1KXCA 1IOEA 4JYTA 1C1OA 1CHGA 1GJ7B 2ZHFH 5L30H 3FP7E 3M61U 1D3QB 1KDQA 1O30A 4YZUA 1GMCF 1O3MA 2ZO3H 1O5AB 1SGYE 4I8HA 3RXFA 3EA7A 1EPTB 2ZFSA 4WJG2 3NWUA 3KCGH 4O3UA 2VIQA 1GI6A 3Q76A 3SJKA 1QRXA 1G3CA 1NFWA 1OP0A 1P01A 1SGFA 1O3NA 4BAOB 2GT8A 4FUGA 1BHXF 1G3BA 3ZZAA 3EYDA 1VCWA 3S9CA 2PGQB 2BDYA 1Z6EA 3MH7A 1C5QA 2VIWA 1OPHB 2FP7B 4CRDA 1G30B 2ODYB 1O5BB 2A4QA 1Z71A 4OS4A 1AUTC 4NIYA 3SU5A 1PQ5A 4MNWA 1GJCB 1GI1A 1C2LA 4LOYH 2A7JA 1H4WA 1GPZA 4TPYA 1FONA 1PYTC 2XCFA 1C5OH 3SNEA 1GBDA 1SGTA 1BTPA 3RLWH 5A8XA 3BG4C 4BTTB 3SU0A 1W11U 1TQ0B 3EA8A 2EA3A 3RMOH 4FUIA 2ZECA 5DO4H 2UWLA 1F0SA 1HYLA 5EXNA 4MNYA 4AFZA 2BD5A 2FXRA 1C5UA 1Z6JH 3RXPA 1AMHA 2GD4B 1VJ9U 4E05H 2A45B 1A0JA 3KL6A 3MU4A 3MHWU 2XC5A 3PLPA 3P8GA 3S7KB 3A8BA 1ARBA 1SHYA 3EQ0H 2P8OC 1BTUA 3STJA 1V6DA 3MO9A 1F2SE 2ZIQH 2FS9A 2O8MA 4JYUH 5B6OA 1SG8B 2BX3A 2H9TH 3BF6H 2ZCHP 2H1UA 3LH1A 2H9HA 1O5GH 1TA6A 3UPEA 1MBQA 5DK1A 1C4V2 2ZHWH 1ZYOA 4X2XA 5DKMA 2AH4X 2B5TB 1C1RA 3A88A 3HKIB 4HZHA 1CHOG 3QUMP 1SGQE 4CBOA 3SQHE 2NU1E 1DSTA 1DUEA 2OLGA 1ELTA 1A3EH 3KHVA 2OC7A 2C3SA 2WPIS 1GCTB 1ZRKA 5EQQA 1HLTH 1K1PA 3OTJE 1GJ6A 2YOLA 3PMHB 3AAVA 1MTNC 1PQAA 3A7ZA 1FY8E 2I6SA 2BVXH 4BTIB 1O2JA 1BB0B 1GMDG 1HJ9A 2FI5E