4GAWA

Crystal structure of active human granzyme h
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
226
structure length
224
Chain Sequence
b'IIGGHEAKPHSRPYMAFVQFLQERKRCGGILVRKDFVLTAAHCQGSSINVTLGAHNIKEQERTQQFIPVKRPIPHPAYNPKNFSNDIMLLQLERKAKWTTAVRPLRLPSSKAQVKPGQLCSVAGWGYVSMSTLATTLQEVLLTVQKDCQCERLFHGNYSRATEICVGDPKKTQTGFKGDSGGPLVCKDVAQGILSYGNKKGTPPGVYIKVSHFLPWIKRTMKRL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Granzyme H
publication title Identification of SERPINB1 as a physiological inhibitor of human granzyme H
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 36
structure length 224
sequence length 226
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature ec 3.4.21.-:
pdb deposition date 2012-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4gawA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4gawA02
2ZWLH 2SNVA 3OSYA 1F0SA 1S82A 3SNAA 3ZZDA 1J8AA 5EW2H 4K1TA 4Y8XA 3MNSA 1V2MT 2Z9LA 3BSQA 1DITH 1N6XA 2BY8X 1C1PA 4IN1A 1SPJA 1NFXA 3AW0A 3VGCB 1UK2A 3DT0H 5EXNA 1WTGH 3BTTE 1LPGB 1CE5A 5HXFA 5FX5A 2TIOA 2SGFE 3MH5A 5E0GA 1UCYE 1UVSH 1NTPA 2OQUA 1C1OA 1HYLA 4ZKOU 1KXDA 1MUEB 3ZVGA 2PR3A 1ABJH 2FTLE 1XXDA 1AVWA 2ALVA 5C5NA 4JZEH 3I29A 2R3YA 1YYY1 3M5NA 1OYQA 4YTAA 1GDUA 4ABJA 4DW2U 3M35A 1ELDE 1C1TA 3H7TA 4A5TS 4AFQA 1L2EA 5JYIA 2ZQ1A 1SOZA 1IQJA 1GCDA 3RXBA 1EPTB 3M3TA 2ZFQH 1T8NA 2PW8H 1MTWA 3UOPA 3GY8A 3Q3KA 4K5ZA 1W13U 2ZGXH 1F0RA 2HRVA 5DJ7A 5GWZA 3K6YA 3RUOA 5F8XA 1P9UA 1T8LA 3BEFB 1P03A 5JBCS 5EU8A 2OCVB 1W0ZU 1TBQH 2AGGX 4BXWA 1Q3XA 1L0ZA 3TGIE 3TJVA 1WSSH 4INKA 1F0TA 1G36A 1DUEA 4XFQA 1QURH 1GI9B 1FN6A 3N7OA 5FPTA 3P8FA 1LTOA 3A87A 3BIUH 2H6MA 3MNCA 1FUJA 3KQCA 1ANBA 4K2YA 7ESTE 2EEKA 1C9TA 3TIUA 2ZGHA 2BD7A 1D6WA 4Y11E 2G52A 1K1LA 4CRBA 2IPHA 6GCHG 3O8RA 1TYNA 1TRNA 1HJAB 4Y71A 3GDUA 3SU3A 3ATKA 2VVUA 1O3LA 2DE9A 3SU5A 6CHAB 1RXPA 1SMFE 5DP7A 2P3FH 4MNXA 1GDQA 4D9QA 2ZI2H 3F1SB 2J34A 1A0LA 3RU4E 1NFUA 1P8VC 1ZTKA 2PKAB 2ZU1A 5K0HA 1MKXK 1CT2E 3FZDA 3LJOA 4NWKA 2VB0A 2OD3B 1XUHA 3ZVFA 2BLVA 7GCHF 2QXGA 4LK4A 4UFDH 1NC6A 1MBMA 3KQEA 1EP6A 3K6ZA 1UJ1A 1FY3A 2NU2E 3V0XA 1V2ST 3Q3YA 3RC5A 3K9XB 4Y10E 3ZZ5A 1TPAE 3LGYA 1CA0C 1OXGA 1UVUH 2ZTXA 1O2RA 1GI7B 3F9GA 1S0QA 3IITA 4X2WA 4SGAE 1HAVB 5LH8A 1RTFB 4XBBA 1Y5BT 4U32A 2Y6TA 1GJBB 1XMNB 3BG4B 1C1WH 1C5OH 2O8TA 4WMDA 1L1GA 3QLPH 1BBRK 2WPJS 2W7SA 1BTPA 3B8JA 4NA9H 3SNDA 3ESTA 1MH0A 3S9AA 3UY9A 4K69A 3BF6H 1EOLA 1CGJE 1GL0E 1KLIH 3M37A 3ATWA 2UWPA 1GHAG 1DUAA 1SLUB 1SGEE 3F9HA 1MCVA 4NA8A 2Y7ZA 3TK9A 5F03A 1SGFG 1BRBE 1XUIA 1SC8U 5L30H 2P8OC 3LGVA 3VB5A 1LHEH 3RC4A 3UNSA 4ZHLU 4ZH8A 2ZGJA 1ZSKA 1BCUH 1T31A 3SJIA 3IWMA 3M36A 1AIXH 1P57B 1KSNA 2OUAA 1J17T 3GCTG 2P3TB 2CF8H 2STBE 3HPTB 1CGIE 2A4RA 3QWCH 2ZF0H 2BDGA 2TGAA 1YPEH 4ABBA 4CRAA 4H4FA 1MZAA 1AKSA 1JXPA 4TPIZ 1CQQA 5C3NA 1DE7H 2GDEH 2H5DA 3VB3A 1MD8A 4Y8YA 1D6RA 1LO6A 2ZA5A 4Q2KA 1G2MA 2NU0E 3ZZ3A 4FUDA 4MVNA 1YCPM 2BLQA 2EI6A 3SNBA 3VGCC 3E91A 4ZXXH 2HLCA 3RM2H 5LGOA 5DP5A 4H6SB 1LHFH 2Y5GA 3SJ9A 1GHBF 1A46H 1QGFA 3SQEE 2G5VA 3ODDA 1V2RT 1GBKA 2I6QA 3BTDE 4IMZA 2G81E 5GPIB 1OWJA 2Q6DA 2ZZUH 3RXRA 1GG6B 3SUFA 4GAWA 4ABDA 1VITG 4CHAB 1DXWA 4FU9A 2QF0A 2G55A 1GI4A 1VCWA 2XBWA 2R2WU 3LH3A 1EB2A 1O5GH 3GCHB 1SSXA 5CHAB 2XTTB 5F6MA 1C5XB 1SGIB 2XYAA 5EW1H 1TALA 4GLYA 1ESAA 2SGAA 2B5TB 3A8BA 2NWNA 2JETC 1KDQB 2H9HA 1GI0A 2BDBA 2XC5A 4RKOB 2XCNA 1K1IA 1A5IA 1NESE 2DUCA 1O2PA 2ANWA 2BQ6B 4UE7H 2XRCA 3BTKE 3FVFB 1FQ3A 1MU8B 2A2XH 1B0EA 1OSSA 1VGCB 1AQ7A 2XC0A 2QYIA 5FPSA 1FPCH 1NRQH 1W7GH 2XWAA 3A8AA 4AG2A 4U30A 3GCOA 4MNWA 3CENA 3M7TA 2FP7B 1SGYE 1LHDH 3ATMA 2GKVE 2CHAB 1D9IA 2FM2A 1V2QT 1YPGH 3RU4T 2FYRA 1C5WB 1C5ZB 3SGQE 1BUIA 6GCHF 1C5NH 4HTCH 1OWHA 4CBOA 2F9PA 3TGKE 2FS8A 1GJ4H 1V2OT 1TB6H 4GUXA 5TJXA 1DY9A 1O3CA 1O3KA 2CF9H 2Z3EA 4ZKSU 2ODYB 1DANH 2G4UA 3EAJA 3SV8A 3SZNA 2UUJB 1A5GH 3D62A 4K60A 3P8GA 1W7XH 2W7UA 1O3OA 4I7YH 5FBEA 4UFGH 1TPPA 3O8BA 3UQVA 3SV6A 5A8YA 2R0LA 3BIVH 1KY9A 5J4SA 1DDJA 1G2LA 1E38B 5AFZH 5JBAS 3SBKA 1ZGIA 2AMPA 4B73A 4OS7A 1ETSH 1PPGE 3LC3A 4B2AA 3RC6A 4ZMAH 1GPZA 1D3QB 2H9EH 1AFQC 3BN9A 3S9BA 3V3MA 1FJSA 2A1DB 4VGCC 3AAUA 5C67A 5EXMA 3E3TA 1OP0A 3SGBE 1ESTA 1ZTLA 2FOAA 3SU1A 1QJ7B 2PHBA 1TE0A 3TU7H 2FEQH 1GHAF 4ZXYH 1UVPA 2D1JA 1SLWB 1BHXB 4IC5A 1TMBH 1GVKB 1AUJA 1QCPA 1YC0A 2RCEA 3SJOA 2BDHA 1ANCA 3L3TA 3PLKA 2B0FA 3TNTA 2SGPE 1EZSC 3QTVH 2D26C 2WYJA 1P2MA 1EB1H 1V2PT 3U8RH 1BTWA 2QV1A 2O9QA 4YLUA 1OWKA 1B5GH 3OY5U 1WU1A 1A3BH 3NWUA 3HK3B 2VVVA 2OQ5A 4AGKA 3A82A 2AGIX 4DT7B 4M7GA 1P2IA 3TGJE 1TFXA 1YP9A 1ZPZA 8ESTE 1IQHA 2HGTH 3UWJH 1LDTT 3GDSA 1GMCG 2QY0B 1CU1A 1NRSH 4GSOA 2C3SA 3MHWU 1HIAB 1KIGH 3OTJE 4E7RG 2VVCA 5DP3A 1H9LB 1WQVH 2H9TH 1W0YH 4FVDA 2BVRH 4AYYB 3U1JB 2OXSA 1ANEA 3RXMA 3O8DA 4ISHH 3AAVA 3LC5A 1JOUB 1NROH 1S6HA 1ORFA 1ARBA 3LGTA 3PLPA 2R9PA 4NZQA 1JMOH 1HAOH 4X1QU 1ZMJA 1SLXB 2CV3A 2FTMA 1H8DH 1YKTA 1MCTA 1OYTH 2B7DH 1NRRH 2SGQE 1WQSA 1HXEH 1EZUC 2ZP0H 3ZZ8A 2P16A 3U69H 3S7HB 1ZJKA 1BZXE 2ALPA 3RXGA 3ZVAA 1KLJH 5J4QA 3MO3A 2TRMA 3U8TH 3SU0A 1F5LA 3ZZ4A 2OTVA 4NWLA 3LOXA 2ZFRH 4KP0A 4WJG2 3DD2H 4JYVH 5DP6A 1V2KT 2J4IA 5E0HA 1C5TA 4Y76A 2A2QH 1AD8H 1GJ8B 2XXLA 3SV2H 3UNRA 2BD5A 1TWXB 1YCPK 1IQNA 3KEEA 2BDCA 4J1YA 1HV7A 1O5BB 2VWMA 2GT7A 1EXFA 1SGDE 4THNH 4FU7A 2BXUH 4ISLA 5TCCA 1O2TA 1HAXB 2ZCLP 1AB9C 1AUTC 4A92A 3ZZ9A 1MBQA 2C90B 1QTFA 1GL1A 2HOBA 4JMYA 2J9NA 3MNBA 4MPWA 5A8XA 1SI5H 1YPHE 3P6ZB 1X7AC 1O37A 4CRCA 1CHOG 1O3FA 2A0QB 3F9FA 5LPRA 1AVXA 3R0FA 2KAIA 2ASUB 1Z1IA 2PUXB 1FXYA 4Z6AH 1FMGA 2ZFSA 1GI6A 3EA9A 5IDKA 3T29A 2ZDNA 1CA0B 1O2WA 3MNXA 1C2DA 4ISNA 2PV9B 1B0FA 2GV7A 3ZVDA 2ZPQA 8KME2 3MI4A 1K1PA 5LPFA 3SV9A 1SQAA 2ANMH 7GCHG 3LGIA 5HM9A 3SUEA 1AKSB 1PPZA 2FZZA 2WPIS 1NPMA 4TYDA 1HFDA 1TNHA 1GHYH 3M5OA 3P95A 1CBWC 1FN8A 4DIIH 3PO1C 2Z9IA 5DP4A 1XXFA 1LKAA 5T3HA 4X6NA 2FIRH 2BQWB 3MWIU 4WWYA 1D3DB 3NZIA 3KQBA 2P8OB 3K2UA 3OX7U 3E1XB 1QNJA 1ABIH 1GBTA 2HALA 3KQDA 4D9RA 3EGKH 3SV7A 4MTBA 1SGNE 3M5MA 3A86A 3L33A 3MU4A 4O9VA 1Y3UA 4KKDA 4CRDA 1DY8A 4X6OA 2AS9A 1YF4A 3LONA 1Y59T 2QF3A 4HGCA 1LHGH 3GICB 2J92A 1GMCF 1O3MA 1TQ7B 1UO6A 2BHGA 2ZHEH 3GY2A 3RM0H 2VWNA 3RU4D 1MTVA 1GWAA 2GDDA 1O36A 2Z6BD 4X8SH 1PQ5A 3E6PH 4LXBH 3U8OH 3SO3A 1GBAA 2JH0D 2UUYA 4INLA 3BTWE 2STAE 1RIWC 3GY5A 1C2KA 2GVFA 3PWCA 5CE1A 3V13A 2GV6A 1WOFA 1P3CA 1WV7H 3JZ1B 1EAXA 4NSYA 5EG4A 1BB0B 4XOJA 1DWEH 3ELAH 3BTGE 1AI8H 1DWBH 1GHBG 3UREA 2A7CA 1C2JA 1NN6A 4X8VH 1AZ8A 4YESB 3NXPA 1ZZZA 2BDYA 2JETB 3B23B 4UEHH 3GOVB 4YOJA 2F9VA 3TH4H 4INHA 1VJAU 4KGAA 3E8LA 2ZU2A 1KLTA 1EX3A 1TGBA 1AO5A 2O8LA 4YZUA 1O5DH 1O3AA 3LU9B 4E05H 4DJZB 1FONA 3PWBA 4X6PA 1THRH 1MQ6A 2GCTC 2Y5FA 3FFGA 2ZFTA 3RXTA 4ZHAA 8GCHF 1Z8GA 2G8TA 4U01A 1F5RA 2P94A 2Y81A 5JDUB 5A2MH 2BY9X 1Y3XA 1V2NT 1HJ8A 5E2OA 1EOJA 1RRKA 4AFSA 4FUBA 4B76A 1W10U 3VXFH 2K1QA 3ATIA 3S0NA 1OX1A 4I32A 2BY7X 3UUZA 1EASA 1TNIA 5ABWA 1LHCH 1GJCB 1Z8RA 3NCLA 2IN2A 4WF8A 3LGWA 3RMNH 3ZV8A 3HK6B 3ZVEA 1HRTH 1SGPE 2BX4A 3MU1A 1JIRA 1BTXA 1MAXA 1G32B 3RXLA 1E36B 4UFEH 1ZMLA 1A4WH 1CHOF 2XWBI 5GJ4B 4I8HA 1ETRH 2TPIZ 1XX9A 4BAQB 3TNSA 1YLCA 2V0BA 2AFQB 2V35A 5EGMA 1UTJA 1GVZA 3SNCA 3FANA 4X1SU 1C9PA 3STJA 1KTSB 4F4OC 3PROA 3OY6U 2ZEBA 2QXIA 4TWYA 5DO4H 4AGJA 1V2JT 1AFQB 3A7TA 3GY6A 1T4UH 3MFJA 4VGCB 1C1MA 4AYVB 3STIA 4BTIB 1V2VT 3A85A 4K1SA 3E16B 4A6LA 1RFNA 1TBZH 1O3JA 4XBDA 1J14A 1LPZB 4SGBE 2CN0H 1OWEA 2GT8A 3CS7A 1BMAA 1A7SA 1TNGA 3BV9B 1C5LH 3ZZ6A 4Y8ZA 2A31A 4O03A 1RGQA 1TA6A 4IMQA 1PJPA 1FY8E 4Y0ZE 1G9IE 3ZVCA 3HGPA 1W3CA 1GBEA 1CO7E 2FODA 1TX7A 2EC9H 1SQOA 1GBFA 4R8TB 1FLEE 4F49A 3SUGA 4WXIA 4ABAA 4NGAH 4ABGA 1OWIA 1XVMA 2B8OH 1Q31A 2QIQA 3ZZCA 1HAYB 3SUDA 1F0UA 4MNVA 1V2UT 4Q7XA 1KYNA 1ZHRA 5E0JA 3V12A 4WMEA 1ELGA 4OS6A 1RS0A 2A32A 4ISOA 4CBNA 4GHQA 3LH1A 1UHBA 2ESTE 4FUGA 2XBXA 2ZKSA 1SFQB 1P3EA 3A84A 2Z3CA 1XKBC 4X8TH 1P0SH 3ZZ7A 1SGTA 5ESTE 2WYGA 2XC4A 4IS5A 4DIHH 5HM2A 1P05A 1O5CB 2J2UA 1VZQH 1QA7A 1UTLM 1ZYOA 1PYTC 2FESH 3P70B 2BD9A 1UCYH 2A4GA 4WMFA 1THPB 5I25A 3S69A 4CH2B 2BYAX 3K65B 3VPKA 2PSXA 1GDNA 2FI5E 3F9EA 1DVAH 2XCFA 2AGEX 1BTYA 1E34B 4YOIA 3D65E 1WYKA 2FI3E 1F5KU 2ANKH 3D23A 2VWLA 1W2KH 3H7OA 2ODPA 3I77A 2BY6X 1WAYB 2VNTA 1M9UA 4BNRA 1LPKB 4MDSA 1FI8A 4QT8C 9LPRA 1BTZA 1QJ6B 5GXPA 3RLYH 1L4ZA 3VFEA 1RJXB 3MH7A 1O3DA 2TGPZ 2FDAA 5C1UA 1LVYA 2OC1A 4JK5A 1AZZA 2C4FH 3SOSA 1W12U 3DFJA 3QX5H 2F83A 1GHVH 3A7WA 4CREA 1IQEA 2FWWA 1BT7A 3EQ0H 2RA3A 2P93A 4NIVA 5A0CA 2FPZA 1TX8A 2PWXA 3C1KA 1AB9B 1KXCA 1OS8A 3VEQB 4DURA 7KMEH 4X0WU 1GBMA 1O2NA 5F8TA 1D4PB 1AHTH 3RXDA 2Y82A 3RXEA 1P2NA 2HWLB 1CGHA 4BAOB 1QQUA 3MOCA 1TNLA 1ZOMA 2WPMS 4A1XA 1QBVH 4UDWH 4FVBA 1LQEA 5G4BA 1Q2WA 1GVLA 4ASHA 1NO9H 4X2VA 1C5SA 3SHAH 2ZHFH 1S85A 2V3HH 2A4QA 1TOMH 2ZFFH 1YPKH 1G37A 1S5SA 1QRZA 4Y6DA 1EAWA 3ZVBA 1ZHPA 1P2OA 3UOUA 5I46H 3FP8E 1EPTA 6LPRA 2M5TA 4U2WA 1DLKB 1DWDH 4YT7H 2JKHA 3P17H 9ESTA 3BEIB 2Q6FA 4Y7AA 3GYMA 5AVDA 1E0FD 1ZGVA 1Z6JH 1ZHMA 1ZR0A 4D76A 5H4IB 1OKXA 1CBWB 4ZAEA 1DOJA 1C2LA 1F92A 3P8NA 3PO1B 4I8LA 4AOQA 4X8UH 4NIYA 3PMAB 3M7UA 5FHTA 2D8WA 1ELAA 4NA7A 3IG6B 1O2IA 1NM6A 4BTTB 4BAHB 1YPLH 1BA8B 3UQOA 2BVXH 3E90B 3G01A 1S84A 5A09A 1MMJN 3NUMA 1EAIA 3T28A 1DSUA 4WH8A 2VIOA 2GX4A 1TOCB 3C27B 1MKWH 3RMLH 1O3PB 4FUJA 1LCYA 2G5NA 1PPFE 1BBRE 1O2JA 1DSTA 4H42U 1O3EA 1WBGB 1Z6EA 4WXVA 1T8OA 2HNTF 3QGJA 1C1NA 2A5IA 2JH5D 1SLVB 4O3UA 1UTPA 4CRFA 5HMAA 1C2HA 4A7IB 1UMAH 2QA9E 4Y7BA 4E7NA 1PQAA 2AH4X 1P2JA 3ATLA 4Q80A 4BAKB 1O38A 1RIWB 1O2LA 1HAHH 1C2IA 1D3TB 1ZJDA 4ABEA 2EA3A 4ZKNU 1BJUA 2C8YB 4JZIA 1F2SE 2ZTZA 3MO6A 4K8YA 2PTCE 2XW9A 2D2DA 4CH8B 2ZDKA 2CMYA 2P59A 4RN6A 2FMJA 1HCGA 1TBRH 1HAVA 1TRYA 1U6QA 2XBYA 1GJAB 3RXAA 1GMDF 2BD4A 3KGPA 3KN2A 4I33A 5C5OA 1FPHH 1MTSA 1EQ9A 1F7ZA 4ISIH 1YBWA 3FP6E 1HB0B 2TGDA 1EZQA 3ZV9A 1EKBB 2GCTB 3EDXB 2ZU4A 1ID5H 1H1BA 3GY7A 4KELA 1O5FH 5ESBA 1A0JA 2HNTC 1BIOA 1O2VA 1QIXB 2XBVA 4ABFA 1O3NA 1C2FA 1IHTH 4OGYA 5HYOA 4B74A 2PKSC 1AE5A 3AW1A 3EE0B 3SJKA 3SU2A 1TGSZ 5B6OA 1SVPA 1K9OE 4KTCA 1CVWH 2NU3E 1NZQH 1QB1A 3LGUA 1DX5M 2YNAA 4K1EA 8GCHG 3PLBA 1UVOA 4K8BA 2ZHWH 2Q6GA 2BDAA 3T26A 5JB8S 2QGRA 4O97A 4AB9A 4A1TA 8LPRA 1BRAA 4OS4A 5T6FA 5DKMA 1N6YA 2ZQ2A 4UFFH 3T25A 2Z94A 2LPRA 3EA7A 3V7TA 3DFLA 2O8WA 1XUJA 1H8IH 1ZSJA 1G30B 4FUEA 4IN2A 1PPEE 1UTOA 1ELVA 1Z8IB 1NFYA 1YPMH 1C5PA 1H9IE 4DOQA 3MYWA 4MPVA 1N1LA 2I6SA 1ELEE 2FOMB 3VB6A 3SGAE 1AFEH 4KTSA 1PQ7A 2AIQA 3ZZBA 2B9LA 1K28D 1B7XB 3M5LA 4BOHA 1BDAA 4I8JA 4Q7YA 1L4DA 5SGAE 1EATA 3LT3A 2VIPA 2SGDE 1MU6B 1O2XA 5FXLA 4LZ1H 3A8DA 2R2MB 1HGTH 5C2ZA 1QB6A 1QL7A 1K1OA 1GJ5H 1QFKH 1SHHB 4BXSA 1G3BA 3TK6A 1O2YA 4ABHA 1N8OC 2C8ZB 2GGVB 1DXPA 1BHXF 1HJ9A 1O35A 5FBIA 4X2YA 3PV4A 1JBUH 1S83A 2F9BH 1A61H 3UNQA 2PTNA 1HAPH 1Y8TA 1LVBA 1RTKA 2IOTA 3AVZA 3OYPA 3A88A 4NIWA 5LPEA 1EZXC 5FAHA 2BY5X 2ULLA 4JCNA 1GI8B 1IQLA 4ZROA 3A81A 3JZ2B 1GBDA 1EJNA 2ZPRA 4IW4E 5L2YH 1GBCA 3TK5A 3PYHA 4FUFA 4JK6A 1A5HA 2ZCKP 2QXHA 1UTQA 1RTLA 4HZHA 3TJOA 1AU8A 2Y7XA 5EODA 3BTME 1QY6A 3T27A 1IQIA 3PB1E 3ZYDA 1GHXH 4ZUHA 5AF9H 1C4U2 1C1QA 3FZZA 3OU0A 2F9NA 1ACBE 4OS5A 3URCA 3ZYEA 1TMUH 2FX4A 3UPEA 2ZHQH 2BOKA 2W5EA 1C5YB 4DVAU 3TITA 1H9HE 5T6GA 1TGNA 5EQRA 1E37B 1DLEA 1GHWH 1OP8A 2YNBA 2H1UA 5C1XA 4GCHG 2GZ9A 4ESTE 2Z9JA 2HVXA 1Y3WA 3RXSA 1ELTA 2GTBA 3VXEH 3MH6A 5GCHF 1QR3E 5EOKA 5DK1A 2BMGB 1GCTC 1WCZA 1GI2A 3P8OA 5A0BA 1D3PB 4RKJB 1AGJA 1MTNC 2W26A 5FCKA 4R0IA 3RXFA 1LKBA 2RA0A 4LZ4B 1OWDA 2BDIA 5IYTA 2VWOA 1V2TT 1P2KA 3T2NA 4IC6A 1SGCA 1CT4E 4JYTA 4DY7B 1FIZA 2A4OA 1TLDA 4DG4A 4WH6A 1GI1A 3RXCA 1GGDC 1K1JA 1ZTJA 2UUFB 3S7KB 1BQYA 1H4WA 2VGCC 1OOKB 1INCA 1IOEA 1MAYA 1NU7B 1DS2E 1LVMA 4HFPB 3A89A 4JZFH 1C2MA 2J95A 2SFAA 1CHGA 1TRMA 1HUTH 3PTBA 3HKIB 2ZG0H 4BTUB 2FOBA 1IQGA 1HAZB 2ZIQH 2FOEA 4BAMB 1K21H 4D7GA 5C20A 1C4V2 1DT2A 3SNEA 3SW2B 1LVOA 1QBOA 1E35B 2FOCA 4DGJA 4WY3A 1SBWA 3GCNA 2QAAA 1HBTH 2OINA 3MU0A 4FUIA 1A0HB 2ZC9H 1SOTA 2G4TA 1HIAA 3LIWA 4RSPA 1OPHB 4CR9A 2UUKB 3TJUA 1NFWA 1ESBA 1C1SA 1C2EA 1O3IA 1KXFA 1GBHA 1THSH 4E06H 3KHVA 1O3HA 4TY6A 2Z7FE 2GCHG 1O3BA 5DP9A 1ARCA 1IQMA 1Y5AT 1Y5UT 2RDLA 5TCAA 1SB1H 4O3TA 2GZ7A 2ZTYA 3W94A 1ELBA 4TY7A 1T4VH 1BRCE 2AYWA 1XM1A 2BVSH 2QXJA 3P92A 3Q3XA 1PFXC 1Z8JB 1FDPA 1O2QA 5JPMH 1XUFA 2GZ8A 2F9UA 2C8WB 2J94A 1O5AB 1ELCA 3KIDU 4FU8A 4I31A 4AN7A 1ZPCA 4Y0YE 3DUXH 1GJ9B 1GBBA 5GDSH 3KNXA 3LPRA 4XE4A 2AMDA 1C1VH 1V2WT 2J38A 3SI3H 2ANYA 1YGCH 4NFEA 3RXOA 1L1NA 2VU8E 1ZSLA 4OS1A 3CP7A 3BG8A 1PQ8A 3F6UH 2JH6D 1TX6A 2GD4B 4NG9H 2ZFPH 1GJ7B 4K3JA 1O2SA 5EQSA 1TAWA 2Z3DA 3TLOA 1AWFH 6ESTA 1IHSH 1SG8B 1O2HA 1GBIA 1FY5A 1TIOA 2BB4A 2SGEE 2WPHS 3RXKA 1P10A 5DGJA 4MLFB 2FYQA 1ETTH 2VIWA 3RMMH 3T62A 3RXJA 1VITH 1PYTD 2OP9A 3EYDA 2VIVA 2OC0A 4GCHF 1SGRE 5GIBA 1QA0A 4B2CA 2WPLS 3BTQE 5AHGH 2GMTC 1TABE 2PSYA 1C4Y2 3Q77A 3QDZB 2A5KA 4H6TA 4OS2A 4TPYA 2H2ZA 3URDA 1NY22 1JIMA 3UR6A 2UWOA 1A3EH 1C5QA 3QTOH 4ZKRU 1O0DH 1QL8A 4ABIA 2BLOA 2THFB 3DA9B 5FX6A 3GY4A 3PMHB 2A45B 1O2OA 4TWWA 4NIXA 4XSKU 1J15A 2QC2A 1AMHA 1SFIA 2V3OH 4DCDA 1O34A 2ZDMA 5BRRE 4X1RU 1C2GA 1V3XA 1YM0A 1J9CH 1UTNA 4Y79A 3RMOH 1LMWB 3M61U 1HDTH 1A1RA 1MD7A 2EI8A 1O5EH 3HATH 1TMTH 2Q1JA 1TGCA 2H5CA 1QRXA 4AB8A 3U98H 1TNJA 3MU8A 2ODQA 2AIPA 2ZCHP 2HPQH 1GMDG 1FY4A 2FOHA 2PKSB 3LJJA 2WPKS 4MPUA 2A5AA 4X1NU 1TNKA 2QCYA 2SNWA 1K2I1 2G00A 2CJIA 1AY6H 3RXVA 3M3VA 1FAXA 2FOGA 1TA2A 1ZLRA 3VB7A 1AVGH 1PPCE 4GPGA 3NPSA 1C5UA 2KAIB 3KF2A 1P11E 2BX3A 1T8MA 1CSOE 4UONA 1GJDB 1P04A 2G51A 4JYUH 3ZZAA 2VH6A 1S0RA 7LPRA 3M7QA 1UTKA 5DP8A 3MTYA 1MQ5A 4GHTA 4YOGA 3A80A 1P01A 2TBSA 1S6FA 1P02A 3KL6A 2FO9A 5E8EH 1EPTC 3MU5A 1O39A 1TQ0B 3SU4A 1HXFH 2WUCA 4AFZA 3E0NB 5L6NH 1G3EA 1KXAA 1O30A 2FOFA 2GCHF 2PLXA 1QQ4A 3RXHA 1PPBH 1K1NA 3GISB 2FI4E 2VIDA 3Q00A 1SL3A 3QO6A 4A1VA 2VJ1A 3ITIA 3LDXH 2BZ6H 3TH2H 1NRNH 1ZPBA 1FY1A 3UWIA 2ZU5A 3TPIZ 2BD3A 1O31A 1WTHD 1BOQA 3RXQA 2FLBH 1YCPH 5EQQA 2TGTA 1EJAA 1HAGE 2Z9GA 1Y3VA 4AX9H 1C5MD 2C8XB 2CGAA 3ENSB 3GDVA 4ZHMU 1N8OB 4Z0KA 5JBBS 4B2BA 3M3SA 1BMNH 2OC8A 3KCGH 2A7HA 2FLRH 4KTUA 3QGNB 3MH4A 3ODFA 1NS3A 5CMXH 1DICA 1BMLA 2BTCE 1UTMA 3FP7E 3A8CA 3H5CB 3MMGA 3TVJB 4LOYH 4MG3A 1EUFA 1AE8H 1HAIH 1HJAC 1QHRB 1CA8B 1EJMA 1GMHG 5A8ZA 1V6DA 1G3CA 6CHAC 2BQ7B 1K1MA 1BRUP 4X2XA 3FAOA 1BJVA 1DM4B 1SGQE 4UD9H 2Z9KA 3QZQA 4B71A 1GI5A 3A83A 3RXUA 3SJ8A 1QJ1B 1IQKA 3QK1A 5PTPA 5EXLA 1HLTH 1NRPH 2NU4E 3BTEE 3F68H 3NKKA 3MO9A 4PROA 1Z7KA 1KXBA 1FZZA 1BTHH 2WV5A 3NK8A 1ZRBA 2ZPSA 4I8GA 2P3UB 1GHZA 2OBOA 2O8MA 1P06A 2BZAA 2BD2A 3QUMP 1O2KA 2BLWA 1T32A 3Q76A 1V2LT 1YPJH 2EI7A 3BG4C 3SU6A 3HKJB 4I8KA 1O2GH 5A0AE 1FIWA 2NU1E 1XUKA 2ZNKH 1J16A 3U1IB 1DWCH 3DHKH 3R3GB 5E2PA 5FPYA 3RP2A 1GCTB 2PKAA 5C1YA 2Y80A 4Q7ZA 1MTNB 1A2CH 3GCTF 2Y5HA 1EAUA 4X1PU 3BTHE 5HGGA 5GCHG 1TONA 1UCYK 1VCPA 1PPHE 4X6MA 1KXEA 1T7CA 3AASA 1HPGA 2WV4A 2ZDVH 4HI3A 3RDZA 3SN8A 3SORA 2VINA 1GGDB 2ZDLA 3UR9A 2PGBB 1Y3YA 2XNIA 3S9CA 2VGCB 2RG3A 2OBQA 1BTUA 1C1UH 3A7XA 4FUCA 4BANB 1QRWA 1S81A 4JZDH 5JBTA 1SHYA 4NSVA 1ZRKA 3UIRA 4WVPE 4AZ2B 1AWHB 2AMQA 2AERH 3PTNA 1VITF 1WUNH 1XUGA 1YPHC 4FUHA 2WUBA 1W8BH 1W14U 4MQAA 1FV9A 1VR1H 2VH0A 3QZRA 2R3UA 3UTUH 2BD8A 1GI3A 5DPAA 1GG6C 1YLDA 4NZLA 4CHAC 5BPEA 1DFPA 5EPYA 1BMMH 1OP2A 2A7JA 1HNEE 1SQTA 3GCHC 4YO9A 5CHAC 1W11U 2AEIH 4IGDA 2FS9A 1QBNA 1O2ZA 1O2MA 2R0KA 5DG6A 3O8CA 1GBJA 3SI4H 1UVTH 1P12E 4B75A 1QB9A 4XBCA 1K22H 2F3CE 2O8UA 2GP9B 1RD3B 3HGNA 2OLGA 1SR5C 4NFFA 1SGFA 1BITA 1VGCC 1C1RA 2P95A 3BTFE 1GJ6A 3L6PA 1TPOA 3B9FH 3VB4A 1GBLA 4FXGH 3TH3H 1O2UA 1KTTB 1ANDA 1Z71A 2F9OA 5T6DA 2CHAC 1P9SA 5K7RA 3PM3A 4CR5A 1O3GA 1JRSA 4IBLH 2V6NA 1O32A 3CS0A 4YT6H 4B1TA 4YM9A 2YOLA 3WY8A 2WINI 2ZECA 5EPNA 3TJNA 1MZDA 1ZMNA 2ZGCA 3D49H 1EP5A 1FNIA 1TGTA 3W95A 3PMJA 3SHCH 1KDQA 1GMHF 1ELFA 1FAKH 2PUQH 3QN7A 1TPSA 5FCRA 2ZDAH 2BXTH 2LNCA 2UWLA 2HNTE 2FX6A 4XDEA 1MTUA 1XVOA 2CXVA 3GYLB 3UFAA 3T5FH 3U9AH 1P2QA 1UHBB 1IAUA 2DE8A 2OC7A 4AORA 1C5RA 2W3KA 1MKXH 4JZ1A 3LKWA 4D7FA 3GY3A 2VIQA 1VCQA 2BOHB 5AFYH 1G3DA 3PMBB 4GVUA 5ETXA 3RXPA 1MKWK 2W3IA 1QL9A 2C93B 4YLQH 1Z1JA 3A7YA 1AN1E 1DPOA 1VJ9U 1JWTA 4MPXA 2HPPH 2PFEA 1JRTA 1O33A 5L2ZH 3BEUA 4NCYA 1NT1A 2GMTB 4CRGA 1P09A 1IQFA 1L1JA 3A7VA 2IJOB 2ILNA 4AFUA 4AG1A 2F91A 1LQDB 1BBRH 4MNYA 1XKAC 2ZGBH 3A7ZA 3SQHE 2ZU3A 3EA8A 4J2YB 5F8ZA 5JB9S 3E0PB 2BM2A 3I78A 2ZO3H 2ZHDA 4OGXA 2FXRA 1CT0E 4D8NA 2QN5T 3RXIA 1C5VA 1UK3A 3RLWH 1NU9A 1UK4A 2PGQB
chains in the Genus database with same CATH superfamily
2ZWLH 2SNVA 3OSYA 1F0SA 1S82A 3SNAA 3ZZDA 1J8AA 5EW2H 4K1TA 3PV5A 4Y8XA 3MNSA 1WXRA 1V2MT 2Z9LA 3BSQA 1DITH 3H09A 1N6XA 2BY8X 1C1PA 2KCYA 1SPJA 1NFXA 3AW0A 4IN1A 3VGCB 1UK2A 3DT0H 5EXNA 1WTGH 3BTTE 1LPGB 1CE5A 5HXFA 5FX5A 2TIOA 2SGFE 3MH5A 5E0GA 1UCYE 1UVSH 1NTPA 2OQUA 1C1OA 1HYLA 5FL7D 1KXDA 4ZKOU 1MUEB 3ZVGA 2PR3A 1ABJH 2FTLE 2RDEA 1XXDA 1AVWA 2ALVA 5C5NA 4JZEH 3I29A 2R3YA 1YYY1 3M5NA 1OYQA 4YTAA 1GDUA 4ABJA 4DW2U 3M35A 1ELDE 1C1TA 3H7TA 4A5TS 4AFQA 5KECA 1L2EA 5JYIA 2ZQ1A 1SOZA 1IQJA 1GCDA 3RXBA 1EPTB 3M3TA 2ZFQH 1T8NA 2PW8H 1MTWA 3UOPA 3GY8A 3Q3KA 4K5ZA 1W13U 2ZGXH 1F0RA 2HRVA 2J97A 5DJ7A 5GWZA 3K6YA 3RUOA 5F8XA 1P9UA 1T8LA 3BEFB 1P03A 5JBCS 5EU8A 2OCVB 1W0ZU 1TBQH 2AGGX 4BXWA 1Q3XA 1L0ZA 3TGIE 3TJVA 1WSSH 4INKA 1F0TA 1G36A 1DUEA 4XFQA 1QURH 1GI9B 5C94A 1FN6A 3N7OA 5FPTA 3P8FA 1LTOA 3A87A 3BIUH 2EQNA 2H6MA 3MNCA 1FUJA 2JJ1D 3KQCA 1ANBA 2VBCA 4K2YA 4RI0A 7ESTE 2EEKA 1C9TA 3TIUA 2ZGHA 2BD7A 1D6WA 4Y11E 2G52A 1K1LA 4CRBA 2IPHA 6GCHG 3O8RA 1TYNA 1TRNA 1HJAB 4Y71A 3GDUA 3SU3A 3ATKA 2VVUA 1O3LA 2DE9A 3SU5A 6CHAB 1RXPA 1SMFE 5DP7A 2P3FH 4MNXA 1GDQA 4D9QA 2ZI2H 3F1SB 2J34A 1A0LA 3RU4E 1NFUA 1P8VC 1ZTKA 2PKAB 2ZU1A 5K0HA 1MKXK 1CT2E 3FZDA 3LJOA 4NWKA 2VB0A 2OD3B 1XUHA 3ZVFA 2BLVA 7GCHF 2QXGA 4LK4A 4UFDH 1NC6A 1MBMA 3KQEA 1EP6A 3K6ZA 1UJ1A 1FY3A 2NU2E 3V0XA 1V2ST 3Q3YA 3RC5A 3K9XB 4Y10E 3ZZ5A 1TPAE 3LGYA 1CA0C 1OXGA 1UVUH 2ZTXA 1O2RA 1GI7B 3F9GA 1S0QA 3IITA 4X2WA 3PV2A 5HKKD 4SGAE 1HAVB 5LH8A 3OEED 1RTFB 4XBBA 1Y5BT 4U32A 2Y6TA 1GJBB 1XMNB 3BG4B 4FETA 1C1WH 1C5OH 1UK4A 2O8TA 3DSOA 4WMDA 1L1GA 3QLPH 1BBRK 2WPJS 2W7SA 1BTPA 3B8JA 4NA9H 3SNDA 3ESTA 1MH0A 3S9AA 3UY9A 4K69A 3BF6H 1EOLA 1CGJE 1GL0E 1KLIH 3M37A 3ATWA 2UWPA 5EJ1A 1GHAG 1DUAA 1SLUB 1SGEE 3F9HA 1MCVA 4NA8A 2EY4C 2Y7ZA 3TK9A 5F03A 1SGFG 1BRBE 1XUIA 1SC8U 5L30H 2P8OC 3LGVA 3VB5A 1LHEH 3RC4A 3UNSA 4ZHLU 4ZH8A 2ZGJA 4B6FA 1ZSKA 1BCUH 2YMSB 1T31A 3SJIA 3IWMA 3M36A 1AIXH 1P57B 1KSNA 2OUAA 1J17T 3GCTG 2P3TB 2CF8H 2STBE 3HPTB 1CGIE 2A4RA 3QWCH 2ZF0H 2BDGA 2TGAA 1YPEH 2KZ4A 4ABBA 4H4FA 1MZAA 1AKSA 4CRAA 1JXPA 4TPIZ 1CQQA 5C3NA 1DE7H 2PP6A 2GDEH 2H5DA 3VB3A 1MD8A 4Y8YA 1D6RA 1LO6A 2ZA5A 4Q2KA 1G2MA 2NU0E 3ZZ3A 4FUDA 4MVNA 1YCPM 2QF4A 2BLQA 2EI6A 3SNBA 3VGCC 5C0UA 3E91A 4ZXXH 2HLCA 3RM2H 5LGOA 5DP5A 4H6SB 1LHFH 2Y5GA 3SJ9A 1GHBF 1A46H 1QGFA 3SQEE 2LP6A 2G5VA 3ODDA 1V2RT 1GBKA 2I6QA 3BTDE 4IMZA 2G81E 5GPIB 1OWJA 2Q6DA 2ZZUH 2IJD1 3RXRA 1GG6B 3SUFA 4GAWA 4ABDA 1VITG 4CHAB 1DXWA 4FU9A 2QF0A 2G55A 1GI4A 1VCWA 3PRDA 2XBWA 2R2WU 3LH3A 1EB2A 1O5GH 3GCHB 1SSXA 5CHAB 2XTTB 4XRNA 1C5XB 1SGIB 2XYAA 3ZIAD 5F6MA 5EW1H 1TALA 4GLYA 1ESAA 2SGAA 2B5TB 3A8BA 2NWNA 2JETC 1KDQB 2H9HA 1GI0A 2BDBA 2XC5A 4RKOB 2XCNA 1K1IA 1A5IA 1NESE 2DUCA 1O2PA 2ANWA 2BQ6B 4UE7H 2QF5A 2XRCA 4YXWD 3BTKE 3FVFB 1FQ3A 1MU8B 2A2XH 1B0EA 1OSSA 1VGCB 1AQ7A 2XC0A 2QYIA 5FPSA 1FPCH 1NRQH 1W7GH 2XWAA 3A8AA 4AG2A 4U30A 3GCOA 4MNWA 3CENA 3M7TA 2FP7B 1SGYE 1LHDH 3ATMA 2GKVE 2CHAB 1D9IA 3AK5A 2KFWA 2FM2A 1V2QT 3WW7A 1YPGH 3RU4T 2FYRA 1C5WB 1C5ZB 3SGQE 1BUIA 6GCHF 1C5NH 4HTCH 1OWHA 4CBOA 2F9PA 3TGKE 2FS8A 1GJ4H 1V2OT 1TB6H 4GUXA 5TJXA 1DY9A 1O3CA 1O3KA 2CF9H 2Z3EA 4ZKSU 3WWBA 2ODYB 1DANH 2G4UA 3EAJA 3SV8A 3SZNA 2AHME 2UUJB 1A5GH 3D62A 4K60A 2W6JD 4B6EA 1W0JD 3OFND 3P8GA 1W7XH 2W7UA 1O3OA 4I7YH 5FBEA 4UFGH 1TPPA 3O8BA 3UQVA 3SV6A 5A8YA 2R0LA 3BIVH 1KY9A 5J4SA 1DDJA 2KCAA 3CNRA 1G2LA 1E38B 4FOUC 5AFZH 5JBAS 3SBKA 1ZGIA 2AMPA 4B73A 4OS7A 1ETSH 1PPGE 3LC3A 4B2AA 3RC6A 4ZMAH 1GPZA 1D3QB 2H9EH 1AFQC 3BN9A 3S9BA 3F2GA 1FJSA 2A1DB 3V3MA 4VGCC 3AAUA 3FO8D 5C67A 5EXMA 3E3TA 1OP0A 3SGBE 1ESTA 1ZTLA 2FOAA 3SU1A 1QJ7B 2PHBA 1TE0A 3TU7H 2FEQH 1GHAF 4ZXYH 1UVPA 2D1JA 1SLWB 2YMSD 1BHXB 4IC5A 1TMBH 1BMFD 1AUJA 1GVKB 1QCPA 5F53A 1YC0A 2RCEA 5HIZA 3SJOA 2BDHA 1ANCA 3L3TA 3PLKA 2B0FA 3TNTA 2SGPE 1EZSC 3QTVH 2D26C 2WYJA 1P2MA 1EB1H 1V2PT 3U8RH 1BTWA 2QV1A 2O9QA 4YLUA 1OWKA 1B5GH 3OY5U 1WU1A 1A3BH 3NWUA 3HK3B 2VVVA 2OQ5A 4AGKA 3A82A 2AGIX 4DT7B 4M7GA 1P2IA 3TGJE 1TFXA 1YP9A 1ZPZA 8ESTE 1IQHA 2HGTH 3UWJH 1LDTT 3DCLA 1GMCG 2QY0B 3GDSA 1CU1A 1NRSH 4GSOA 2C3SA 3KYGA 3MHWU 1HIAB 1KIGH 3OTJE 4E7RG 2VVCA 5DP3A 3FN8A 1H9LB 3F0OA 1WQVH 2H9TH 1W0YH 4FVDA 2BVRH 4AYYB 3U1JB 2OXSA 1ANEA 3RXMA 3O8DA 4ISHH 3AAVA 1FX0B 3LC5A 1JOUB 1NROH 1S6HA 1ORFA 1ARBA 3LGTA 3PLPA 2R9PA 3SZEA 4NZQA 1JMOH 1HAOH 4X1QU 1ZMJA 1SLXB 3KYFA 2CV3A 2FTMA 1H8DH 1YKTA 1MCTA 3OEHD 1OYTH 2B7DH 1NRRH 2SGQE 1WQSA 1HXEH 1EZUC 2ZP0H 3ZZ8A 2P16A 3U69H 3S7HB 1ZJKA 1BZXE 2KM0A 2ALPA 3RXGA 3ZVAA 1KLJH 5J4QA 3MO3A 2TRMA 2LELA 3U8TH 3SU0A 1F5LA 3ZZ4A 2OTVA 4NWLA 3LOXA 2ZFRH 4KP0A 4WJG2 3DD2H 4F55A 4JYVH 5DP6A 1V2KT 2J4IA 5E0HA 1C5TA 4Y76A 2A2QH 5KGOA 1AD8H 1GJ8B 2XXLA 3UAIC 3SV2H 3UNRA 2BD5A 1TWXB 1YCPK 1IQNA 3KEEA 2BDCA 4J1YA 1HV7A 1O5BB 2VWMA 2GT7A 1EXFA 1SGDE 4THNH 5T1VA 4FU7A 2BXUH 4ISLA 5TCCA 1O2TA 1HAXB 2ZCLP 1AB9C 1AUTC 4A92A 3ZZ9A 1MBQA 2C90B 1QTFA 1GL1A 2HOBA 4JMYA 2J9NA 3MNBA 4MPWA 5A8XA 1SI5H 1YPHE 2F4LA 3P6ZB 1X7AC 1O37A 4CRCA 1CHOG 1O3FA 2A0QB 3F9FA 5LPRA 1AVXA 3R0FA 2KAIA 2ASUB 1Z1IA 4RT0A 2PUXB 1FXYA 4Z6AH 1FMGA 2ZFSA 1GI6A 3EA9A 5IDKA 3T29A 2ZDNA 1CA0B 1O2WA 3MNXA 1C2DA 4ISNA 2PV9B 1B0FA 2GV7A 3ZVDA 2ZPQA 4DT4A 1E1QD 8KME2 3MI4A 1K1PA 4RT1A 5LPFA 3SV9A 1SQAA 2ANMH 7GCHG 3LGIA 5HM9A 3SUEA 1AKSB 1PPZA 2FZZA 2WPIS 1NPMA 4TYDA 1HFDA 1TNHA 1GHYH 3M5OA 1UW7A 3P95A 1CBWC 1FN8A 4DIIH 3PO1C 2Z9IA 5DP4A 1XXFA 1LKAA 5T3HA 4X6NA 2FIRH 2BQWB 3MWIU 4WWYA 1D3DB 3NZIA 3KQBA 2P8OB 3K2UA 3OX7U 3E1XB 1QNJA 1ABIH 1GBTA 2HALA 3KQDA 4D9RA 3EGKH 3SV7A 4MTBA 1SGNE 3M5MA 3A86A 3L33A 3MU4A 4O9VA 1Y3UA 4KKDA 4CRDA 1DY8A 4X6OA 2AS9A 1YF4A 3LONA 1Y59T 2QF3A 4HGCA 1LHGH 3GICB 2J92A 1GMCF 1O3MA 1TQ7B 1UO6A 2L6OA 2BHGA 2ZHEH 3GY2A 3RM0H 2VWNA 3RU4D 1MTVA 1GWAA 2GDDA 2J98B 1O36A 2Z6BD 4X8SH 1PQ5A 3E6PH 4LXBH 3U8OH 3SO3A 1GBAA 2JH0D 2UUYA 4INLA 3BTWE 2STAE 1RIWC 3GY5A 3F3BA 1C2KA 2GVFA 3PWCA 5CE1A 3V13A 2GV6A 1WOFA 1P3CA 1WV7H 3JZ1B 1EAXA 4NSYA 5EG4A 1BB0B 4XOJA 2W6ID 1DWEH 3ELAH 3BTGE 1AI8H 1DWBH 1GHBG 3UREA 2A7CA 1C2JA 1NN6A 4X8VH 1AZ8A 4YESB 3NXPA 1ZZZA 2BDYA 2JETB 3B23B 4UEHH 3GOVB 4YOJA 2F9VA 3TH4H 4INHA 1VJAU 4KGAA 3E8LA 2ZU2A 1KLTA 1EX3A 4I86A 1TGBA 1AO5A 2O8LA 4YZUA 1O5DH 1O3AA 3LU9B 4E05H 5EIYA 4DJZB 1FONA 3PWBA 4X6PA 1THRH 1MQ6A 2GCTC 2Y5FA 3FFGA 2ZFTA 3RXTA 4ZHAA 8GCHF 1Z8GA 2G8TA 4U01A 1F5RA 2P94A 2Y81A 5JDUB 5A2MH 2BY9X 1Y3XA 1V2NT 1YY3A 1HJ8A 5E2OA 1EOJA 1RRKA 4AFSA 4FUBA 4B76A 1W10U 3VXFH 2K1QA 3ATIA 3S0NA 1OX1A 4I32A 2BY7X 3UUZA 1EASA 1TNIA 5ABWA 1LHCH 1GJCB 1Z8RA 3NCLA 2IN2A 4WF8A 3LGWA 3RMNH 3ZV8A 3HK6B 3ZVEA 1HRTH 1SGPE 3EE7A 2BX4A 3MU1A 1JIRA 2OK5A 1BTXA 1MAXA 1G32B 3RXLA 1E36B 4UFEH 1ZMLA 1A4WH 1CHOF 2XWBI 3MQKC 5GJ4B 4I8HA 1ETRH 2TPIZ 1XX9A 4BAQB 3TNSA 5KEDA 1YLCA 2V0BA 2AFQB 2V35A 3F0PA 5EGMA 2XOKD 1UTJA 1GVZA 3SNCA 3FANA 4X1SU 1C9PA 3STJA 4HG6A 1KTSB 4F4OC 3PROA 3OY6U 2ZEBA 2QXIA 4TWYA 5DO4H 4AGJA 1V2JT 1AFQB 3A7TA 3GY6A 1T4UH 3MFJA 3OAAD 4VGCB 1C1MA 4AYVB 3STIA 4BTIB 1V2VT 3A85A 4K1SA 3E16B 4A6LA 1RFNA 1TBZH 1O3JA 4XBDA 1J14A 1LPZB 4SGBE 2CN0H 1OWEA 3U28C 2GT8A 3CS7A 1BMAA 1A7SA 1TNGA 3BV9B 1C5LH 3ZZ6A 4Y8ZA 2A31A 4O03A 1RGQA 5CHBA 1TA6A 4IMQA 1PJPA 1FY8E 4Y0ZE 1G9IE 3ZVCA 3HGPA 1W3CA 1GBEA 1CO7E 2FODA 1TX7A 2EC9H 1SQOA 1GBFA 4R8TB 4AC9A 1FLEE 4F49A 3SUGA 2JDID 4WXIA 4ABAA 4NGAH 4ABGA 1OWIA 1XVMA 2B8OH 1Q31A 2QIQA 3ZZCA 1HAYB 3SUDA 1F0UA 2KR7A 4MNVA 1V2UT 4Q7XA 3WWFA 1KYNA 1ZHRA 5E0JA 3V12A 4WMEA 1K0HA 1ELGA 4OS6A 1RS0A 2A32A 4ISOA 4CBNA 4GHQA 3LH1A 1UHBA 2ESTE 3W1EA 2KCOA 4FUGA 2XBXA 2ZKSA 1SFQB 1P3EA 3A84A 2Z3CA 1XKBC 4X8TH 1P0SH 3ZZ7A 1SGTA 5ESTE 2WYGA 2XC4A 4IS5A 4DIHH 5HM2A 1P05A 1O5CB 2J2UA 1VZQH 1QA7A 1UTLM 1ZYOA 1PYTC 2FESH 3P70B 2BD9A 1UCYH 2A4GA 4WMFA 1THPB 5I25A 3S69A 4CH2B 2BYAX 3K65B 3VPKA 2PSXA 1GDNA 2FI5E 3F9EA 1DVAH 2XCFA 2AGEX 1BTYA 1E34B 4YOIA 3D65E 1WYKA 2FI3E 1F5KU 2ANKH 3D23A 2VWLA 1W2KH 3H7OA 2ODPA 3I77A 2BY6X 1WAYB 2VNTA 1M9UA 4BNRA 1LPKB 4MDSA 1FI8A 4QT8C 9LPRA 1BTZA 1QJ6B 5GXPA 3RLYH 1L4ZA 3VFEA 1RJXB 3MH7A 1O3DA 2TGPZ 2FDAA 1COWD 5C1UA 1LVYA 2OC1A 4JK5A 1AZZA 2C4FH 3KQ5A 3SOSA 1W12U 3DFJA 3QX5H 2F83A 1GHVH 3A7WA 4CREA 1IQEA 2FWWA 1BT7A 2K0QA 3EQ0H 2RA3A 2P93A 4NIVA 5A0CA 2FPZA 1TX8A 2PWXA 3C1KA 1AB9B 1KXCA 1OS8A 5EJZA 3VEQB 4DURA 4X0WU 1GBMA 1O2NA 5F8TA 1D4PB 1AHTH 3RXDA 2Y82A 3RXEA 1P2NA 2HWLB 1CGHA 4BAOB 1QQUA 3MOCA 1TNLA 1ZOMA 1YLNA 2WPMS 4A1XA 1QBVH 4UDWH 4FVBA 1LQEA 5G4BA 1Q2WA 3SYJA 1GVLA 4ASHA 1NO9H 4X2VA 1C5SA 3SHAH 2ZHFH 1S85A 2V3HH 2A4QA 1TOMH 2ZFFH 1YPKH 1G37A 1S5SA 1QRZA 4Y6DA 1EAWA 3ZVBA 1ZHPA 1P2OA 2JIZD 3UOUA 5I46H 3FP8E 1EPTA 6LPRA 2M5TA 4U2WA 1DLKB 1DWDH 1QZ8A 4YT7H 2JKHA 3P17H 9ESTA 3BEIB 2Q6FA 4Y7AA 3GYMA 5AVDA 1E0FD 1ZGVA 1Z6JH 1ZHMA 1ZR0A 4D76A 5H4IB 1OKXA 1CBWB 4ZAEA 1DOJA 1C2LA 1F92A 3P8NA 3PO1B 4I8LA 4AOQA 4X8UH 4NIYA 3PMAB 3M7UA 5FHTA 2D8WA 1ELAA 4NA7A 3IG6B 1O2IA 1NM6A 4BTTB 4BAHB 1YPLH 1BA8B 3UQOA 5DN6D 2BVXH 3E90B 3G01A 1S84A 5A09A 1MMJN 3NUMA 1EAIA 3T28A 1DSUA 4WH8A 2VIOA 2GX4A 3N99A 1TOCB 3C27B 1MKWH 1VKYA 3RMLH 1O3PB 4FUJA 3NRLA 1LCYA 2G5NA 1PPFE 1BBRE 2V3MA 1O2JA 1DSTA 4H42U 1O3EA 1WBGB 1Z6EA 4WXVA 1T8OA 2HNTF 3QGJA 1C1NA 2A5IA 2JH5D 1SLVB 4O3UA 2J5UA 1UTPA 4CRFA 5HMAA 1C2HA 4A7IB 1UMAH 2QA9E 4Y7BA 4E7NA 1PQAA 2AH4X 1P2JA 3ATLA 4Q80A 4BAKB 1O38A 1RIWB 1O2LA 1HAHH 1C2IA 1D3TB 1ZJDA 2WZQA 4ABEA 2EA3A 4ZKNU 1BJUA 2C8YB 4JZIA 1F2SE 2ZTZA 3MO6A 2V7QD 4K8YA 2PTCE 2XW9A 2D2DA 4CH8B 2ZDKA 2CMYA 2P59A 4RN6A 2FMJA 1HCGA 1TBRH 1HAVA 1TRYA 1U6QA 2XBYA 1GJAB 3RXAA 1GMDF 2BD4A 3KGPA 3KN2A 4I33A 5C5OA 1FPHH 1MTSA 4Q4LA 1EQ9A 1F7ZA 4ISIH 1YBWA 3FP6E 1HB0B 2TGDA 1EZQA 3ZV9A 1EKBB 2GCTB 3EDXB 2ZU4A 1ID5H 1H1BA 3GY7A 4KELA 1O5FH 5ESBA 1A0JA 2HNTC 1BIOA 1O2VA 1QIXB 2XBVA 4ABFA 1O3NA 1C2FA 1IHTH 4OGYA 5HYOA 4B74A 2PKSC 1AE5A 3AW1A 3EE0B 1KMHB 3SJKA 3N7EA 3SU2A 1TGSZ 5B6OA 1SVPA 1K9OE 4KTCA 1CVWH 2NU3E 2WSSD 1NZQH 1QB1A 3LGUA 1DX5M 3OTPA 2YNAA 4K1EA 8GCHG 3PLBA 1UVOA 4P00A 4K8BA 2ZHWH 2Q6GA 2BDAA 3T26A 5JB8S 2QGRA 4O97A 4AB9A 4A1TA 8LPRA 1BRAA 4OS4A 5T6FA 5DKMA 1N6YA 2ZQ2A 4UFFH 3T25A 2Z94A 2LPRA 3EA7A 3FKSD 3V7TA 3DFLA 2O8WA 3DSGA 1XUJA 1H8IH 1ZSJA 1G30B 4FUEA 4IN2A 1PPEE 1UTOA 1ELVA 1Z8IB 1NFYA 1YPMH 1C5PA 1H9IE 4DOQA 3MYWA 4MPVA 1N1LA 2I6SA 3N7DA 1ELEE 2FOMB 3VB6A 3SGAE 1AFEH 4KTSA 1PQ7A 2AIQA 3ZZBA 2B9LA 1K28D 1B7XB 3M5LA 4BOHA 1BDAA 4I8JA 4Q7YA 1L4DA 5SGAE 1EATA 3LT3A 2VIPA 2SGDE 1MU6B 1O2XA 5FXLA 4LZ1H 3A8DA 2R2MB 1HGTH 5C2ZA 1QB6A 1QL7A 1K1OA 1GJ5H 1QFKH 1SHHB 4BXSA 1G3BA 3TK6A 1O2YA 4ABHA 1N8OC 2C8ZB 2GGVB 1DXPA 1BHXF 1HJ9A 4ACBA 1O35A 5FBIA 4X2YA 3PV4A 1JBUH 1S83A 2F9BH 1A61H 2M2AA 3UNQA 2PTNA 1HAPH 2JJ2D 1Y8TA 1LVBA 1RTKA 2IOTA 3AVZA 3OYPA 3A88A 4NIWA 5LPEA 1EZXC 5FAHA 2BY5X 3F2FA 2ULLA 4JCNA 1GI8B 1IQLA 4ZROA 1EFRD 3A81A 3JZ2B 1GBDA 1EJNA 2ZPRA 4IW4E 5L2YH 1GBCA 3TK5A 3PYHA 4FUFA 4JK6A 1A5HA 2ZCKP 2QXHA 1UTQA 1RTLA 4HZHA 3TJOA 5EJLA 1AU8A 2Y7XA 5EODA 3BTME 1QY6A 3T27A 1IQIA 3PB1E 3ZYDA 1GHXH 4ZUHA 5AF9H 1C4U2 1C1QA 3FZZA 3OU0A 2F9NA 1ACBE 4ACAA 4OS5A 3URCA 3ZYEA 1TMUH 2FX4A 3UPEA 2ZHQH 2BOKA 2W5EA 1C5YB 4DVAU 2HLDD 1H9HE 3TITA 5T6GA 1TGNA 5EQRA 1E37B 1DLEA 1GHWH 1OP8A 2YNBA 2H1UA 5C1XA 4GCHG 2GZ9A 4ESTE 2Z9JA 2HVXA 1Y3WA 3RXSA 1ELTA 2GTBA 3VXEH 3MH6A 5GCHF 1QR3E 5EOKA 5DK1A 2BMGB 1GCTC 1WCZA 1GI2A 3P8OA 5A0BA 1D3PB 4RKJB 1AGJA 1MTNC 2W26A 5FCKA 3DSPA 4R0IA 3RXFA 1LKBA 2RA0A 4LZ4B 1OWDA 2BDIA 5IYTA 2VWOA 1V2TT 1P2KA 3T2NA 4IC6A 1SGCA 1CT4E 4JYTA 4DY7B 1FIZA 2A4OA 1TLDA 4DG4A 4WH6A 1GI1A 3RXCA 1GGDC 1K1JA 1ZTJA 2UUFB 3S7KB 1BQYA 3F2HA 1H4WA 2VGCC 1OOKB 1INCA 1IOEA 1MAYA 1NU7B 1DS2E 1LVMA 4HFPB 3A89A 4JZFH 1C2MA 2J95A 2SFAA 1CHGA 1TRMA 1HUTH 3PTBA 3HKIB 2ZG0H 4BTUB 2FOBA 1IQGA 1HAZB 2HVYB 2ZIQH 2FOEA 4BAMB 1K21H 4D7GA 5C20A 1C4V2 1DT2A 3SNEA 3SW2B 5C0TA 1LVOA 1QBOA 1E35B 2FOCA 4DGJA 4WY3A 1SBWA 3GCNA 2QAAA 4TSFD 1HBTH 2OINA 3MU0A 4FUIA 1A0HB 2ZC9H 1SOTA 2G4TA 1HIAA 1WDIA 3LIWA 1OPHB 1SKYE 2IPQX 4RSPA 4CR9A 2UUKB 3TJUA 1NFWA 1ESBA 1C1SA 1C2EA 1O3IA 1KXFA 1GBHA 1THSH 4E06H 3KHVA 1O3HA 4TY6A 2Z7FE 2GCHG 1O3BA 5DP9A 1ARCA 1IQMA 1Y5AT 1Y5UT 2RDLA 5TCAA 1SB1H 3PRBA 4O3TA 2GZ7A 1E1RD 2ZTYA 1YWUA 3W94A 1ELBA 4TY7A 1T4VH 1BRCE 2AYWA 1XM1A 2BVSH 2QXJA 3P92A 3Q3XA 1PFXC 1Z8JB 1FDPA 1O2QA 5JPMH 1XUFA 2GZ8A 2F9UA 2C8WB 2J94A 1O5AB 1ELCA 3KIDU 4FU8A 4I31A 4AN7A 1ZPCA 4Y0YE 3DUXH 1GJ9B 1GBBA 4Z1MD 5GDSH 3KNXA 3LPRA 4XE4A 2RFKC 2AMDA 1C1VH 1NBMD 1V2WT 2J38A 3SI3H 4XD7D 2ANYA 1YGCH 4NFEA 4Q63A 3RXOA 1L1NA 2VU8E 1ZSLA 4OS1A 3CP7A 3BG8A 1PQ8A 3F6UH 2JH6D 1TX6A 1SQRA 2GD4B 4NG9H 2ZFPH 1GJ7B 4K3JA 1O2SA 5EQSA 1TAWA 2Z3DA 3TLOA 1AWFH 6ESTA 1IHSH 1SG8B 1O2HA 1GBIA 1FY5A 1TIOA 2BB4A 2SGEE 2WPHS 3RXKA 1P10A 5DGJA 4MLFB 2FYQA 1ETTH 2VIWA 3RMMH 3T62A 3RXJA 1VITH 1PYTD 2OP9A 2L74A 3EYDA 5IK2D 2VIVA 2OC0A 4GCHF 1SGRE 5GIBA 1QA0A 4B2CA 2WPLS 3BTQE 5AHGH 2GMTC 1TABE 2PSYA 1C4Y2 3Q77A 2K8IA 3QDZB 2A5KA 4H6TA 4OS2A 4TPYA 2QE7D 2H2ZA 3URDA 1NY22 1JIMA 3UR6A 2UWOA 1A3EH 1C5QA 3QTOH 4ZKRU 1O0DH 1QL8A 4ABIA 2BLOA 2THFB 3DA9B 5FX6A 3GY4A 3PMHB 2A45B 1O2OA 4TWWA 4NIXA 4XSKU 1J15A 2QC2A 1AMHA 1SFIA 2V3OH 4DCDA 1O34A 2WV9A 2ZDMA 5BRRE 4X1RU 1C2GA 1S6LA 1V3XA 1YM0A 1J9CH 1UTNA 4Y79A 3RMOH 1LMWB 3M61U 1HDTH 1A1RA 1MD7A 2EI8A 1O5EH 3HATH 1TMTH 2Q1JA 1TGCA 2H5CA 1QRXA 4AB8A 3U98H 1TNJA 3MU8A 2ODQA 2AIPA 2ZCHP 2HPQH 1GMDG 1FY4A 2FOHA 2PKSB 3LJJA 2WPKS 4MPUA 2A5AA 4X1NU 1TNKA 2QCYA 2SNWA 1K2I1 2G00A 2CJIA 1AY6H 3RXVA 5CDFE 3M3VA 1FAXA 2FOGA 1TA2A 1ZLRA 3VB7A 1AVGH 1PPCE 4GPGA 3NPSA 1C5UA 2KAIB 3KF2A 1P11E 2BX3A 1T8MA 1CSOE 4UONA 1GJDB 1P04A 2G51A 4JYUH 3ZZAA 2VH6A 1S0RA 7LPRA 1NBME 3M7QA 1UTKA 5DP8A 3MTYA 1MQ5A 4GHTA 4YOGA 3A80A 1P01A 2TBSA 1S6FA 1P02A 3KL6A 2FO9A 5E8EH 1EPTC 3MU5A 1O39A 1TQ0B 2J98A 3SU4A 1HXFH 2WUCA 4AFZA 3E0NB 5L6NH 1G3EA 1KXAA 1O30A 2FOFA 2GCHF 2PLXA 1QQ4A 3RXHA 1PPBH 1K1NA 3GISB 2FI4E 2VIDA 3Q00A 1SL3A 3QO6A 4A1VA 2VJ1A 3ITIA 3FOAA 3LDXH 2BZ6H 3TH2H 1NRNH 1ZPBA 1FY1A 3UWIA 2ZU5A 3TPIZ 2BD3A 1O31A 1WTHD 1BOQA 3RXQA 2FLBH 1YCPH 5EQQA 2TGTA 1EJAA 1HAGE 2Z9GA 1Y3VA 5C17A 4AX9H 1C5MD 2C8XB 2CGAA 3ENSB 3GDVA 4ZHMU 1N8OB 4Z0KA 5JBBS 4ASUD 4B2BA 3M3SA 1BMNH 2OC8A 4TT3D 5B6LA 3KCGH 2A7HA 2FLRH 4KTUA 3QGNB 3MH4A 5GNDA 3ODFA 1NS3A 5CMXH 1DICA 1BMLA 2BTCE 1UTMA 3FP7E 3A8CA 3H5CB 3MMGA 3TVJB 4LOYH 4MG3A 1EUFA 5DSFA 1AE8H 1HAIH 1HJAC 1QHRB 1CA8B 1EJMA 1GMHG 5A8ZA 1V6DA 1G3CA 6CHAC 2BQ7B 1K1MA 1BRUP 4X2XA 2XNDD 3FAOA 1BJVA 1DM4B 1SGQE 4UD9H 2Z9KA 3QZQA 4B71A 1GI5A 3A83A 3RXUA 3SJ8A 1QJ1B 1IQKA 3QK1A 5PTPA 5EXLA 1HLTH 1NRPH 2NU4E 3BTEE 3F68H 3NKKA 3MO9A 4PROA 1Z7KA 1KXBA 1FZZA 1BTHH 2WV5A 3NK8A 1ZRBA 2ZPSA 4I8GA 2P3UB 1GHZA 2OBOA 2O8MA 1P06A 2BZAA 2BD2A 3QUMP 1O2KA 2BLWA 1E79D 1T32A 3Q76A 2CK3D 1V2LT 1YPJH 2EI7A 3BG4C 3SU6A 3HKJB 4I8KA 1O2GH 5A0AE 1FIWA 2NU1E 1XUKA 2ZNKH 1J16A 3U1IB 1DWCH 3DHKH 3R3GB 3GS9A 5E2PA 5FPYA 3RP2A 1GCTB 2PKAA 5C1YA 2Y80A 4Q7ZA 1MTNB 4P02A 1A2CH 3GCTF 2Y5HA 1EAUA 4X1PU 3BTHE 5HGGA 5GCHG 1TONA 1UCYK 1VCPA 1PPHE 4X6MA 1KXEA 1T7CA 2WHXA 1HPGA 2WV4A 2YMSC 2ZDVH 3AASA 4HI3A 3RDZA 3SN8A 3SORA 2VINA 1GGDB 2ZDLA 3UR9A 4M9FA 2PGBB 1Y3YA 2XNIA 3S9CA 2VGCB 2RG3A 2OBQA 1BTUA 1C1UH 3A7XA 4FUCA 4BANB 1QRWA 1S81A 4JZDH 5JBTA 1SHYA 4NSVA 1ZRKA 3UIRA 4WVPE 4AZ2B 1AWHB 2AMQA 2AERH 3PTNA 1VITF 1WUNH 1XUGA 1YPHC 4FUHA 2WUBA 1W8BH 1W14U 4MQAA 1FV9A 1VR1H 2VH0A 3QZRA 2R3UA 4OM9A 2WPDD 3UTUH 2BD8A 1GI3A 5DPAA 1GG6C 1YLDA 4NZLA 4CHAC 5BPEA 1DFPA 5EPYA 1BMMH 1OP2A 2A7JA 1HNEE 1SQTA 3GCHC 4YO9A 5CHAC 1W11U 2AEIH 1H8HD 4IGDA 2FS9A 1QBNA 1O2ZA 1O2MA 2R0KA 5DG6A 3O8CA 1GBJA 3SI4H 1UVTH 1P12E 4B75A 1QB9A 4XBCA 1K22H 2F3CE 2O8UA 2GP9B 1RD3B 3HGNA 2OLGA 1SR5C 4NFFA 3VG8A 5HIYA 2KX4A 1SGFA 1BITA 1VGCC 1C1RA 2P95A 3BTFE 1GJ6A 3L6PA 1TPOA 3B9FH 3VB4A 1GBLA 4FXGH 3TH3H 1O2UA 1KTTB 1ANDA 1Z71A 2F9OA 5T6DA 2CHAC 2F43B 1P9SA 5K7RA 3PM3A 4CR5A 1O3GA 1JRSA 4IBLH 2V6NA 1O32A 3CS0A 4YT6H 4B1TA 4YM9A 2YOLA 3WY8A 2WINI 2ZECA 5EPNA 3TJNA 1MZDA 1ZMNA 2ZGCA 3D49H 1EP5A 1FNIA 1TGTA 3W95A 3PMJA 3SHCH 1KDQA 1GMHF 1ELFA 1FAKH 2PUQH 3QN7A 1TPSA 5FCRA 2ZDAH 2BXTH 3UB0A 2LNCA 2UWLA 2HNTE 2FX6A 4XDEA 1MTUA 1XVOA 2CXVA 3GYLB 3UFAA 3T5FH 3U9AH 4ZCNA 1P2QA 1UHBB 1IAUA 2DE8A 2OC7A 4AORA 1C5RA 2W3KA 1MABB 1MKXH 4JZ1A 7KMEH 3LKWA 4D7FA 3GY3A 2KCPA 2GJGA 2VIQA 1VCQA 2BOHB 5AFYH 1G3DA 3PMBB 4GVUA 5ETXA 3RXPA 1MKWK 2W3IA 1QL9A 2C93B 4YLQH 1Z1JA 3A7YA 1AN1E 1DPOA 1OHHD 1VJ9U 1JWTA 4MPXA 2HPPH 2PFEA 4F48B 1JRTA 1O33A 5L2ZH 3BEUA 4NCYA 1NT1A 2GMTB 4CRGA 1P09A 1IQFA 1L1JA 3A7VA 2IJOB 2ILNA 4AFUA 4AG1A 3OE7D 2F91A 1LQDB 1BBRH 4MNYA 1XKAC 2ZGBH 1H8ED 3A7ZA 3SQHE 2ZU3A 3EA8A 4J2YB 5F8ZA 5JB9S 3E0PB 2BM2A 3I78A 2ZO3H 2ZHDA 4OGXA 2FXRA 1CT0E 4D8NA 2QN5T 3RXIA 1C5VA 1UK3A 3RLWH 1NU9A 1W0KD 2PGQB
chains in the Genus database with same CATH topology
2ZWLH 2SNVA 3OSYA 1F0SA 1S82A 3SNAA 3ZZDA 1J8AA 5EW2H 4K1TA 4Y8XA 3MNSA 1V2MT 2Z9LA 3BSQA 1DITH 1N6XA 2BY8X 1C1PA 4IN1A 1SPJA 1NFXA 3AW0A 3VGCB 1UK2A 3DT0H 5EXNA 1WTGH 3BTTE 1LPGB 1CE5A 5HXFA 5FX5A 2TIOA 2SGFE 3MH5A 5E0GA 1UCYE 1UVSH 1NTPA 2OQUA 1C1OA 1HYLA 4ZKOU 1KXDA 1MUEB 3ZVGA 2PR3A 1ABJH 2FTLE 1XXDA 1AVWA 2ALVA 5C5NA 4JZEH 3I29A 2R3YA 1YYY1 3M5NA 1OYQA 4YTAA 1GDUA 4ABJA 4DW2U 3M35A 1ELDE 1C1TA 3H7TA 4A5TS 4AFQA 1L2EA 5JYIA 2ZQ1A 1SOZA 1IQJA 1GCDA 3RXBA 1EPTB 3M3TA 2ZFQH 1T8NA 2PW8H 1MTWA 3UOPA 3GY8A 3Q3KA 4K5ZA 1W13U 2ZGXH 1F0RA 2HRVA 5DJ7A 5GWZA 3K6YA 3RUOA 5F8XA 1P9UA 1T8LA 3BEFB 1P03A 5JBCS 5EU8A 2OCVB 1W0ZU 1TBQH 2AGGX 4BXWA 1Q3XA 1L0ZA 3TGIE 3TJVA 1WSSH 4INKA 1F0TA 1G36A 1DUEA 4XFQA 1QURH 1GI9B 1FN6A 3N7OA 5FPTA 3P8FA 1LTOA 3A87A 3BIUH 2H6MA 3MNCA 1FUJA 3KQCA 1ANBA 4K2YA 7ESTE 2EEKA 1C9TA 3TIUA 2ZGHA 2BD7A 1D6WA 4Y11E 2G52A 1K1LA 4CRBA 2IPHA 6GCHG 3O8RA 1TYNA 1TRNA 1HJAB 4Y71A 3GDUA 3SU3A 3ATKA 2VVUA 1O3LA 2DE9A 3SU5A 6CHAB 1RXPA 1SMFE 5DP7A 2P3FH 4MNXA 1GDQA 4D9QA 2ZI2H 3F1SB 2J34A 1A0LA 3RU4E 1NFUA 1P8VC 1ZTKA 2PKAB 2ZU1A 5K0HA 1MKXK 1CT2E 3FZDA 3LJOA 4NWKA 2VB0A 2OD3B 1XUHA 3ZVFA 2BLVA 7GCHF 2QXGA 4LK4A 4UFDH 1NC6A 1MBMA 3KQEA 1EP6A 3K6ZA 1UJ1A 1FY3A 2NU2E 3V0XA 1V2ST 3Q3YA 3RC5A 3K9XB 4Y10E 3ZZ5A 1TPAE 3LGYA 1CA0C 1OXGA 1UVUH 2ZTXA 1O2RA 1GI7B 3F9GA 1S0QA 3IITA 4X2WA 4SGAE 1HAVB 5LH8A 1RTFB 4XBBA 1Y5BT 4U32A 2Y6TA 1GJBB 1XMNB 3BG4B 1C1WH 1C5OH 2O8TA 4WMDA 1L1GA 3QLPH 1BBRK 2WPJS 2W7SA 1BTPA 3B8JA 4NA9H 3SNDA 3ESTA 1MH0A 3S9AA 3UY9A 4K69A 3BF6H 1EOLA 1CGJE 1GL0E 1KLIH 3M37A 3ATWA 2UWPA 1GHAG 1DUAA 1SLUB 1SGEE 3F9HA 1MCVA 4NA8A 2Y7ZA 3TK9A 5F03A 1SGFG 1BRBE 1XUIA 1SC8U 5L30H 2P8OC 3LGVA 3VB5A 1LHEH 3RC4A 3UNSA 4ZHLU 4ZH8A 2ZGJA 1ZSKA 1BCUH 1T31A 3SJIA 3IWMA 3M36A 1AIXH 1P57B 1KSNA 2OUAA 1J17T 3GCTG 2P3TB 2CF8H 2STBE 3HPTB 1CGIE 2A4RA 3QWCH 2ZF0H 2BDGA 2TGAA 1YPEH 4ABBA 4CRAA 4H4FA 1MZAA 1AKSA 1JXPA 4TPIZ 1CQQA 5C3NA 1DE7H 2GDEH 2H5DA 3VB3A 1MD8A 4Y8YA 1D6RA 1LO6A 2ZA5A 4Q2KA 1G2MA 2NU0E 3ZZ3A 4FUDA 4MVNA 1YCPM 2BLQA 2EI6A 3SNBA 3VGCC 3E91A 4ZXXH 2HLCA 3RM2H 5LGOA 5DP5A 4H6SB 1LHFH 2Y5GA 3SJ9A 1GHBF 1A46H 1QGFA 3SQEE 2G5VA 3ODDA 1V2RT 1GBKA 2I6QA 3BTDE 4IMZA 2G81E 5GPIB 1OWJA 2Q6DA 2ZZUH 3RXRA 1GG6B 3SUFA 4GAWA 4ABDA 1VITG 4CHAB 1DXWA 4FU9A 2QF0A 2G55A 1GI4A 1VCWA 2XBWA 2R2WU 3LH3A 1EB2A 1O5GH 3GCHB 1SSXA 5CHAB 2XTTB 5F6MA 1C5XB 1SGIB 2XYAA 5EW1H 1TALA 4GLYA 1ESAA 2SGAA 2B5TB 3A8BA 2NWNA 2JETC 1KDQB 2H9HA 1GI0A 2BDBA 2XC5A 4RKOB 2XCNA 1K1IA 1A5IA 1NESE 2DUCA 1O2PA 2ANWA 2BQ6B 4UE7H 2XRCA 3BTKE 3FVFB 1FQ3A 1MU8B 2A2XH 1B0EA 1OSSA 1VGCB 1AQ7A 2XC0A 2QYIA 5FPSA 1FPCH 1NRQH 1W7GH 2XWAA 3A8AA 4AG2A 4U30A 3GCOA 4MNWA 3CENA 3M7TA 2FP7B 1SGYE 1LHDH 3ATMA 2GKVE 2CHAB 1D9IA 2FM2A 1V2QT 1YPGH 3RU4T 2FYRA 1C5WB 1C5ZB 3SGQE 1BUIA 6GCHF 1C5NH 4HTCH 1OWHA 4CBOA 2F9PA 3TGKE 2FS8A 1GJ4H 1V2OT 1TB6H 4GUXA 5TJXA 1DY9A 1O3CA 1O3KA 2CF9H 2Z3EA 4ZKSU 2ODYB 1DANH 2G4UA 3EAJA 3SV8A 3SZNA 2UUJB 1A5GH 3D62A 4K60A 3P8GA 1W7XH 2W7UA 1O3OA 4I7YH 5FBEA 4UFGH 1TPPA 3O8BA 3UQVA 3SV6A 5A8YA 2R0LA 3BIVH 1KY9A 5J4SA 1DDJA 1G2LA 1E38B 5AFZH 5JBAS 3SBKA 1ZGIA 2AMPA 4B73A 4OS7A 1ETSH 1PPGE 3LC3A 4B2AA 3RC6A 4ZMAH 1GPZA 1D3QB 2H9EH 1AFQC 3BN9A 3S9BA 3V3MA 1FJSA 2A1DB 4VGCC 3AAUA 5C67A 5EXMA 3E3TA 1OP0A 3SGBE 1ESTA 1ZTLA 2FOAA 3SU1A 1QJ7B 2PHBA 1TE0A 3TU7H 2FEQH 1GHAF 4ZXYH 1UVPA 2D1JA 1SLWB 1BHXB 4IC5A 1TMBH 1GVKB 1AUJA 1QCPA 1YC0A 2RCEA 3SJOA 2BDHA 1ANCA 3L3TA 3PLKA 2B0FA 3TNTA 2SGPE 1EZSC 3QTVH 2D26C 2WYJA 1P2MA 1EB1H 1V2PT 3U8RH 1BTWA 2QV1A 2O9QA 4YLUA 1OWKA 1B5GH 3OY5U 1WU1A 1A3BH 3NWUA 3HK3B 2VVVA 2OQ5A 4AGKA 3A82A 2AGIX 4DT7B 4M7GA 1P2IA 3TGJE 1TFXA 1YP9A 1ZPZA 8ESTE 1IQHA 2HGTH 3UWJH 1LDTT 3GDSA 1GMCG 2QY0B 1CU1A 1NRSH 4GSOA 2C3SA 3MHWU 1HIAB 1KIGH 3OTJE 4E7RG 2VVCA 5DP3A 1H9LB 1WQVH 2H9TH 1W0YH 4FVDA 2BVRH 4AYYB 3U1JB 2OXSA 1ANEA 3RXMA 3O8DA 4ISHH 3AAVA 3LC5A 1JOUB 1NROH 1S6HA 1ORFA 1ARBA 3LGTA 3PLPA 2R9PA 4NZQA 1JMOH 1HAOH 4X1QU 1ZMJA 1SLXB 2CV3A 2FTMA 1H8DH 1YKTA 1MCTA 1OYTH 2B7DH 1NRRH 2SGQE 1WQSA 1HXEH 1EZUC 2ZP0H 3ZZ8A 2P16A 3U69H 3S7HB 1ZJKA 1BZXE 2ALPA 3RXGA 3ZVAA 1KLJH 5J4QA 3MO3A 2TRMA 3U8TH 3SU0A 1F5LA 3ZZ4A 2OTVA 4NWLA 3LOXA 2ZFRH 4KP0A 4WJG2 3DD2H 4JYVH 5DP6A 1V2KT 2J4IA 5E0HA 1C5TA 4Y76A 2A2QH 1AD8H 1GJ8B 2XXLA 3SV2H 3UNRA 2BD5A 1TWXB 1YCPK 1IQNA 3KEEA 2BDCA 4J1YA 1HV7A 1O5BB 2VWMA 2GT7A 1EXFA 1SGDE 4THNH 4FU7A 2BXUH 4ISLA 5TCCA 1O2TA 1HAXB 2ZCLP 1AB9C 1AUTC 4A92A 3ZZ9A 1MBQA 2C90B 1QTFA 1GL1A 2HOBA 4JMYA 2J9NA 3MNBA 4MPWA 5A8XA 1SI5H 1YPHE 3P6ZB 1X7AC 1O37A 4CRCA 1CHOG 1O3FA 2A0QB 3F9FA 5LPRA 1AVXA 3R0FA 2KAIA 2ASUB 1Z1IA 2PUXB 1FXYA 4Z6AH 1FMGA 2ZFSA 1GI6A 3EA9A 5IDKA 3T29A 2ZDNA 1CA0B 1O2WA 3MNXA 1C2DA 4ISNA 2PV9B 1B0FA 2GV7A 3ZVDA 2ZPQA 8KME2 3MI4A 1K1PA 5LPFA 3SV9A 1SQAA 2ANMH 7GCHG 3LGIA 5HM9A 3SUEA 1AKSB 1PPZA 2FZZA 2WPIS 1NPMA 4TYDA 1HFDA 1TNHA 1GHYH 3M5OA 3P95A 1CBWC 1FN8A 4DIIH 3PO1C 2Z9IA 5DP4A 1XXFA 1LKAA 5T3HA 4X6NA 2FIRH 2BQWB 3MWIU 4WWYA 1D3DB 3NZIA 3KQBA 2P8OB 3K2UA 3OX7U 3E1XB 1QNJA 1ABIH 1GBTA 2HALA 3KQDA 4D9RA 3EGKH 3SV7A 4MTBA 1SGNE 3M5MA 3A86A 3L33A 3MU4A 4O9VA 1Y3UA 4KKDA 4CRDA 1DY8A 4X6OA 2AS9A 1YF4A 3LONA 1Y59T 2QF3A 4HGCA 1LHGH 3GICB 2J92A 1GMCF 1O3MA 1TQ7B 1UO6A 2BHGA 2ZHEH 3GY2A 3RM0H 2VWNA 3RU4D 1MTVA 1GWAA 2GDDA 1O36A 2Z6BD 4X8SH 1PQ5A 3E6PH 4LXBH 3U8OH 3SO3A 1GBAA 2JH0D 2UUYA 4INLA 3BTWE 2STAE 1RIWC 3GY5A 1C2KA 2GVFA 3PWCA 5CE1A 3V13A 2GV6A 1WOFA 1P3CA 1WV7H 3JZ1B 1EAXA 4NSYA 5EG4A 1BB0B 4XOJA 1DWEH 3ELAH 3BTGE 1AI8H 1DWBH 1GHBG 3UREA 2A7CA 1C2JA 1NN6A 4X8VH 1AZ8A 4YESB 3NXPA 1ZZZA 2BDYA 2JETB 3B23B 4UEHH 3GOVB 4YOJA 2F9VA 3TH4H 4INHA 1VJAU 4KGAA 3E8LA 2ZU2A 1KLTA 1EX3A 1TGBA 1AO5A 2O8LA 4YZUA 1O5DH 1O3AA 3LU9B 4E05H 4DJZB 1FONA 3PWBA 4X6PA 1THRH 1MQ6A 2GCTC 2Y5FA 3FFGA 2ZFTA 3RXTA 4ZHAA 8GCHF 1Z8GA 2G8TA 4U01A 1F5RA 2P94A 2Y81A 5JDUB 5A2MH 2BY9X 1Y3XA 1V2NT 1HJ8A 5E2OA 1EOJA 1RRKA 4AFSA 4FUBA 4B76A 1W10U 3VXFH 2K1QA 3ATIA 3S0NA 1OX1A 4I32A 2BY7X 3UUZA 1EASA 1TNIA 5ABWA 1LHCH 1GJCB 1Z8RA 3NCLA 2IN2A 4WF8A 3LGWA 3RMNH 3ZV8A 3HK6B 3ZVEA 1HRTH 1SGPE 2BX4A 3MU1A 1JIRA 1BTXA 1MAXA 1G32B 3RXLA 1E36B 4UFEH 1ZMLA 1A4WH 1CHOF 2XWBI 5GJ4B 4I8HA 1ETRH 2TPIZ 1XX9A 4BAQB 3TNSA 1YLCA 2V0BA 2AFQB 2V35A 5EGMA 1UTJA 1GVZA 3SNCA 3FANA 4X1SU 1C9PA 3STJA 1KTSB 4F4OC 3PROA 3OY6U 2ZEBA 2QXIA 4TWYA 5DO4H 4AGJA 1V2JT 1AFQB 3A7TA 3GY6A 1T4UH 3MFJA 4VGCB 1C1MA 4AYVB 3STIA 4BTIB 1V2VT 3A85A 4K1SA 3E16B 4A6LA 1RFNA 1TBZH 1O3JA 4XBDA 1J14A 1LPZB 4SGBE 2CN0H 1OWEA 2GT8A 3CS7A 1BMAA 1A7SA 1TNGA 3BV9B 1C5LH 3ZZ6A 4Y8ZA 2A31A 4O03A 1RGQA 1TA6A 4IMQA 1PJPA 1FY8E 4Y0ZE 1G9IE 3ZVCA 3HGPA 1W3CA 1GBEA 1CO7E 2FODA 1TX7A 2EC9H 1SQOA 1GBFA 4R8TB 1FLEE 4F49A 3SUGA 4WXIA 4ABAA 4NGAH 4ABGA 1OWIA 1XVMA 2B8OH 1Q31A 2QIQA 3ZZCA 1HAYB 3SUDA 1F0UA 4MNVA 1V2UT 4Q7XA 1KYNA 1ZHRA 5E0JA 3V12A 4WMEA 1ELGA 4OS6A 1RS0A 2A32A 4ISOA 4CBNA 4GHQA 3LH1A 1UHBA 2ESTE 4FUGA 2XBXA 2ZKSA 1SFQB 1P3EA 3A84A 2Z3CA 1XKBC 4X8TH 1P0SH 3ZZ7A 1SGTA 5ESTE 2WYGA 2XC4A 4IS5A 4DIHH 5HM2A 1P05A 1O5CB 2J2UA 1VZQH 1QA7A 1UTLM 1ZYOA 1PYTC 2FESH 3P70B 2BD9A 1UCYH 2A4GA 4WMFA 1THPB 5I25A 3S69A 4CH2B 2BYAX 3K65B 3VPKA 2PSXA 1GDNA 2FI5E 3F9EA 1DVAH 2XCFA 2AGEX 1BTYA 1E34B 4YOIA 3D65E 1WYKA 2FI3E 1F5KU 2ANKH 3D23A 2VWLA 1W2KH 3H7OA 2ODPA 3I77A 2BY6X 1WAYB 2VNTA 1M9UA 4BNRA 1LPKB 4MDSA 1FI8A 4QT8C 9LPRA 1BTZA 1QJ6B 5GXPA 3RLYH 1L4ZA 3VFEA 1RJXB 3MH7A 1O3DA 2TGPZ 2FDAA 5C1UA 1LVYA 2OC1A 4JK5A 1AZZA 2C4FH 3SOSA 1W12U 3DFJA 3QX5H 2F83A 1GHVH 3A7WA 4CREA 1IQEA 2FWWA 1BT7A 3EQ0H 2RA3A 2P93A 4NIVA 5A0CA 2FPZA 1TX8A 2PWXA 3C1KA 1AB9B 1KXCA 1OS8A 3VEQB 4DURA 7KMEH 4X0WU 1GBMA 1O2NA 5F8TA 1D4PB 1AHTH 3RXDA 2Y82A 3RXEA 1P2NA 2HWLB 1CGHA 4BAOB 1QQUA 3MOCA 1TNLA 1ZOMA 2WPMS 4A1XA 1QBVH 4UDWH 4FVBA 1LQEA 5G4BA 1Q2WA 1GVLA 4ASHA 1NO9H 4X2VA 1C5SA 3SHAH 2ZHFH 1S85A 2V3HH 2A4QA 1TOMH 2ZFFH 1YPKH 1G37A 1S5SA 1QRZA