4GAWA

Crystal structure of active human granzyme h
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
226
structure length
224
Chain Sequence
IIGGHEAKPHSRPYMAFVQFLQERKRCGGILVRKDFVLTAAHCQGSSINVTLGAHNIKEQERTQQFIPVKRPIPHPAYNPKNFSNDIMLLQLERKAKWTTAVRPLRLPSSKAQVKPGQLCSVAGWGYVSMSTLATTLQEVLLTVQKDCQCERLFHGNYSRATEICVGDPKKTQTGFKGDSGGPLVCKDVAQGILSYGNKKGTPPGVYIKVSHFLPWIKRTMKRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Identification of SERPINB1 as a physiological inhibitor of human granzyme H
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Granzyme H
total genus 36
structure length 224
sequence length 226
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature ec 3.4.21.-:
pdb deposition date 2012-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4gawA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4gawA02
3AVZA 2ZO3H 1GL0E 3K65B 2VIOA 5ABWA 3SJ9A 1F0UA 1Z8IB 4LOYH 2A7HA 2WPMS 1AI8H 3OSYA 3LGYA 1EB2A 1TPOA 1HAZB 4OS5A 1ETSH 1D3QB 2OTVA 2ZDLA 4CR9A 1UK4A 5GWZA 4BTUB 4AFSA 2J95A 1PYTC 2NU1E 1C5RA 4CREA 1TBRH 1BTHH 1WTGH 3SJKA 2D1JA 2F9PA 1S85A 2A31A 1SQTA 1ZYOA 1BTXA 2R0LA 3ZVFA 2XBXA 2IPHA 3M5MA 3PTBA 4AZ2B 5EXLA 1ZTKA 1G3EA 2PR3A 1C1UH 7ESTE 2BD2A 5FCKA 1EASA 3D65E 5EGMA 4BTTB 3A85A 1OOKB 1K1IA 3GDVA 4BNRA 3A87A 1P05A 2PHBA 1SLUB 1NESE 2HALA 1SGIB 2UWLA 2XCFA 3FANA 3SGQE 4WMDA 1LKBA 2FXRA 1QBNA 1YPKH 1DSUA 2BD3A 1AQ7A 2W7SA 3VGCC 1O2MA 1V2MT 4INLA 5C3NA 2XWBI 3ZYDA 1SSXA 1KIGH 1QQ4A 1SGFG 2ZIQH 2G5VA 2FS8A 1N6XA 4B2BA 2VB0A 1FPCH 2ILNA 3U9AH 2A4GA 2ZPSA 3PO1B 2PWXA 5CHAB 4GSOA 3L6PA 2CHAB 3U1JB 1CHGA 1ZRKA 3LJOA 1CGJE 5L2ZH 1AWHB 5A8YA 7GCHG 2UWPA 3PWBA 4Z6AH 3A7VA 1W7XH 1KXEA 1MMJN 1V2RT 4KTSA 1T8LA 2PKSC 4CRFA 5A0CA 1YPHE 3OY6U 1K1LA 4UEHH 1OS8A 4K1EA 2SNWA 1K1PA 1P2KA 1SB1H 3LOXA 3K2UA 2BLQA 2VGCC 4HI3A 4B75A 3S7KB 2XC0A 5A8ZA 1HB0B 3D62A 3F9FA 4F49A 1TRMA 1FAKH 2R3YA 3M36A 4DCDA 4JZEH 4ZKSU 2ZA5A 1G9IE 4OGYA 1XUIA 2WPJS 3T29A 1N8OC 1EAXA 3ZVDA 5E2OA 1UMAH 2GT7A 3MU4A 4I33A 5JDUB 4IC6A 1XX9A 1ANBA 3ZZBA 1BTWA 4YT7H 1Y3VA 4X6OA 2BM2A 1TNJA 3BTHE 1VJAU 3FFGA 1O3LA 1BMNH 1OYQA 2B0FA 1Y3UA 2IN2A 1VGCB 2ZQ2A 4I31A 2PUXB 1B0EA 1FY4A 3FAOA 4X8UH 2XXLA 1DVAH 2BHGA 1L1JA 3BTFE 1O3AA 3MTYA 1MQ5A 2P8OC 2ALVA 2QC2A 4PROA 5EQSA 1HAGE 1UK3A 3LONA 3F6UH 1VITH 4Q7ZA 4U01A 2FX4A 1KSNA 3SOSA 4ABIA 3S9BA 3SJOA 1AKSB 2AEIH 1QIXB 2ZDAH 3M7QA 2F91A 4JYTA 1GBDA 2A0QB 3E8LA 1SGDE 3QGJA 4BXSA 4GCHG 1C1MA 3NKKA 5BPEA 2LNCA 2Z3CA 4WMFA 3SV2H 4YT6H 2ZI2H 4YOGA 1BRUP 1MTNB 2FOGA 4JCNA 1W10U 3GYLB 1FXYA 1ZPCA 1O2XA 3BTQE 4ZAEA 2JH5D 3SUGA 4HZHA 1DICA 2VINA 4O03A 1LHCH 2TGAA 3E3TA 1SLVB 3BTDE 3FP7E 5HGGA 2QA9E 1GCTC 1O2VA 2BX3A 3O8DA 4Y6DA 3B8JA 3BG8A 2AERH 5TCCA 2G52A 3DFLA 1PQ8A 3IITA 2BMGB 5JYIA 1XUKA 1SGEE 3SNCA 1EOLA 1W2KH 1T4UH 1RXPA 1AFQC 1W12U 1Y59T 1L1NA 1CGIE 3NZIA 3SU0A 1HIAB 1OSSA 3BV9B 3SU5A 1OXGA 1EX3A 9LPRA 1EUFA 1MTWA 5T6DA 1YF4A 4Y8ZA 1EAIA 5EXMA 2W3IA 1AZ8A 1YC0A 2V35A 5F6MA 1Z7KA 1A0JA 3AAVA 2CF9H 1OWKA 1IOEA 4Z0KA 1O2IA 1ETTH 2YNBA 4CH8B 3FZZA 4KTCA 1UVOA 1WUNH 1O34A 2JH0D 1UVSH 4JK5A 4OS7A 1O5BB 3RXAA 2A5KA 3UWIA 2FPZA 2VIQA 2PKAA 3DFJA 1H8IH 2ZGCA 2ZC9H 1YPHC 3KF2A 1HXEH 3S69A 4DJZB 3UUZA 3LKWA 4VGCC 1FONA 1RIWC 1TBQH 5FX5A 2QF3A 2BZAA 1BTZA 4LZ4B 5LPEA 1E34B 2TIOA 1HAVB 2G00A 3Q76A 1HYLA 2SGFE 1O31A 1S83A 1BTYA 1BJVA 5DP6A 3MNSA 3MNCA 5JB8S 2G5NA 2ZKSA 2HPPH 3P8GA 4H6SB 1NPMA 3ZVEA 4CHAC 1SHHB 1TQ7B 3SBKA 1SBWA 1LQEA 1AU8A 2FI3E 1J16A 2TRMA 1ESTA 2VVVA 3VB3A 2BVRH 2CN0H 4FUIA 1FIWA 4K8YA 1HXFH 2FTMA 3GOVB 2Z9IA 5I46H 3F1SB 4X8SH 3BG4B 3RM0H 1Y5UT 3RUOA 1NS3A 3ZV9A 2FYRA 5AFYH 2I6SA 1ZJDA 1ELFA 3VFEA 3M3SA 1GMDF 2P3UB 3TVJB 1TE0A 2R3UA 1E36B 4ESTE 3HPTB 1TAWA 3RC5A 1UO6A 4UFDH 1P2JA 1O36A 4MPVA 2VWOA 1FIZA 4ISHH 4A6LA 1Q31A 4ZMAH 1AY6H 2XCNA 4A7IB 1C5YB 3M5NA 1OYTH 3RXIA 3BN9A 1C5PA 1O2NA 2HNTC 3F9GA 2OXSA 1TMBH 3RU4E 5L6NH 1BUIA 1YPLH 2Q6FA 2C8YB 3K9XB 2P16A 3AW0A 4X1SU 2CF8H 4YM9A 5IDKA 1C2MA 2FESH 1C5MD 2PKAB 2P8OB 3P17H 2AGIX 2JETC 1C1NA 1BHXF 1CA0B 1GJDB 4IN2A 4MG3A 5FX6A 6GCHG 1WQVH 3CP7A 4D8NA 5JBAS 3V3MA 1A1RA 4R8TB 4DVAU 1ZTJA 4MNYA 1O37A 3RLYH 2WYGA 4XDEA 1SFIA 1RTFB 3SZNA 3VPKA 1C5ZB 1G3DA 3LC5A 3JZ1B 2SFAA 3MNXA 3EA8A 4O3UA 2R9PA 1GHBF 3KNXA 4AYVB 2ZDKA 1TX8A 3MOCA 2Q6DA 3RXKA 3RXVA 3G01A 5E0GA 3MHWU 4MQAA 1J17T 1QNJA 4OS4A 3QTVH 2OCVB 1IQFA 1GBFA 2A4QA 3BTTE 1K1OA 1XVMA 1TALA 1BRCE 1MTVA 1LDTT 3PO1C 3LT3A 1CU1A 2WV5A 4M7GA 2XC5A 3SGBE 3URCA 1SC8U 2TGTA 1Q3XA 4ASHA 1WAYB 4Q7YA 5DG6A 2FS9A 2ZHEH 2F9UA 1O5AB 3E0PB 3ODFA 3M35A 4CRCA 1WBGB 1MZAA 4CRGA 4UFFH 2FYQA 4IW4E 3UQOA 1GMDG 2XTTB 4ABAA 1OP0A 1YGCH 1T8NA 2Q1JA 1D3PB 3VXEH 1BMLA 2A2QH 4ABJA 1O2PA 4OS6A 1MKXH 1P2QA 1G3BA 1HAIH 1THPB 3BTME 3DT0H 2P3FH 2HVXA 1EPTA 1GJ6A 1P03A 3SHCH 4YOJA 1W0YH 2FDAA 2GMTB 4X8TH 2ZCKP 4OGXA 3T25A 1O3IA 2VWLA 1GHXH 2ZDVH 4AOQA 4NWKA 1Y5BT 1T32A 1GJ7B 2STAE 3SUFA 1ELTA 3DHKH 4WY3A 1GI1A 4IGDA 3AW1A 1O2WA 5B6OA 3IG6B 5EW1H 1GCDA 4Q80A 3ZVAA 2BOHB 1GHYH 3TLOA 1MKXK 1FZZA 1X7AC 3F9HA 1F5KU 1EAWA 2GZ8A 1QQUA 3RXPA 1BOQA 1ELAA 2BB4A 3ATWA 3BTKE 3Q00A 3GCNA 1MKWH 2B8OH 3RXUA 3NWUA 3T5FH 1T8MA 2FP7B 1GHZA 4UFGH 2FOCA 3STIA 1O32A 1Y3YA 3LH1A 1EJAA 1C1PA 3BIUH 1WCZA 3VB7A 1F0SA 2ZFFH 2ZU5A 5K7RA 3FVFB 1IAUA 3ZVCA 1LKAA 3U69H 1DLEA 1BMMH 1ZZZA 4Y11E 3NXPA 2Y5GA 2QXHA 1CA0C 5EPYA 1O3CA 5SGAE 1MKWK 2PW8H 1C4V2 3GCTG 4ABHA 2AGEX 1C2DA 1O2QA 3LJJA 5LGOA 4SGAE 2G51A 2A4OA 4X6NA 1L4DA 1O38A 1U6QA 4DT7B 1TLDA 2O8LA 1BDAA 1TNKA 1V2WT 4IMQA 1C5WB 2HRVA 2ZGHA 3PV4A 3BEUA 5J4QA 1NO9H 1MTUA 4Y10E 3UNQA 1G30B 1O3BA 1PPGE 1HV7A 1HGTH 2BY6X 2QF0A 1LVOA 3SNDA 1O5DH 4FVBA 1IQJA 1NM6A 2PUQH 4E7NA 2Z9GA 1IHTH 2QCYA 4Y71A 4LK4A 3BTEE 4RSPA 5F8XA 2QV1A 1BCUH 4K2YA 4AN7A 1YP9A 3RXDA 1GJAB 1YPJH 4F4OC 1S6HA 3GCOA 5LPRA 4RKOB 1SGYE 1UTNA 1RRKA 3ZZAA 2F9BH 4J1YA 2BDYA 5DGJA 2ZPQA 1O2LA 1PQ5A 2OUAA 2G4TA 2QY0B 5DP9A 4NSVA 3NCLA 1LPZB 3QZRA 1LVMA 1ZTLA 4NSYA 2JKHA 1AB9B 2GCHF 2RA3A 1A4WH 3LGVA 1DS2E 1F2SE 4AYYB 1A2CH 1CVWH 2O8TA 1DWCH 1GI3A 1RIWB 2H1UA 3MU5A 1GHBG 5I25A 1IQEA 2HOBA 1FY5A 2OBOA 2KAIB 4MVNA 2Z9JA 4E06H 2FOEA 3RXEA 1ZJKA 3MFJA 2HWLB 1LHFH 1K22H 2BLVA 4CHAB 1AE5A 1CT2E 1C5OH 1SQAA 1C5VA 1YYY1 3U8TH 4ABEA 1AMHA 2O9QA 3TK5A 3GY7A 2BD7A 3OX7U 2LPRA 2ODYB 1NU7B 2J9NA 1Z1IA 5DP4A 2Z7FE 1GVLA 1PPBH 3H5CB 2WUBA 5EOKA 2WPKS 2QAAA 1SLWB 3I78A 4U2WA 5EQQA 1KLIH 5E2PA 4MLFB 1S0RA 1A0LA 1HIAA 2F3CE 1UCYK 5A2MH 1ELVA 2BDIA 2PSXA 2NU0E 3A7XA 5C5NA 4X1NU 1SLXB 4THNH 1OWHA 2BDAA 4FU8A 2HNTF 5ESTE 3KGPA 3GY8A 3RDZA 4YO9A 1P2MA 5GCHG 4ZXYH 4NIWA 1TYNA 2BY7X 3AAUA 1AFEH 4TWWA 1KXFA 1TA2A 3TJOA 1YPMH 4ZH8A 1TIOA 2UUJB 3QWCH 1ZSLA 3GDSA 1DLKB 3I77A 1NTPA 2BQWB 1GDQA 2RG3A 1PPCE 3ENSB 1KY9A 1GBTA 2ODQA 4I8HA 1C2EA 1J9CH 4BXWA 2A45B 2C8WB 3E90B 4BANB 5T3HA 4Y76A 4HFPB 3CENA 5GXPA 1A5HA 2UUKB 1AGJA 2IOTA 2OD3B 1YPEH 3UIRA 4X2XA 1L0ZA 2CXVA 1ZMJA 2UUYA 4AFUA 2H2ZA 4BAOB 1PJPA 2BLWA 1SMFE 4UD9H 1C2FA 2RDLA 4GCHF 4JK6A 2ANWA 4D9RA 4FUCA 5CE1A 1B0FA 4MTBA 1ANDA 1HAHH 2ZEBA 5LPFA 1G3CA 1XKBC 4D9QA 2SNVA 1DOJA 1EJMA 1GI8B 4HTCH 1ELCA 1VCWA 1XUHA 3A7YA 3KIDU 3PMAB 1YCPK 4BAHB 2D26C 3V12A 1A0HB 4E7RG 3RXCA 1Y5AT 3KN2A 1GJ9B 1A3EH 1F92A 1VCPA 1CHOF 4FVDA 1J14A 1LQDB 2W3KA 5C20A 5EQRA 1P3EA 1TNLA 2NU2E 1DDJA 2Y81A 4MPXA 4NZQA 3Q77A 3VXFH 2R2MB 2BVSH 5EODA 1C1RA 1CE5A 4YLQH 5JBTA 3GCTF 4AB8A 4KP0A 2WV4A 4CBOA 3BSQA 8LPRA 1YCPH 2C90B 4A92A 4FUFA 4CBNA 3Q3YA 3RXJA 1D6RA 1HJAC 1NY22 2H9TH 1FLEE 2A5AA 1V2JT 2NU4E 2SGPE 2OQUA 5GPIB 1DWBH 1IQNA 1TBZH 4DURA 1TNHA 4ZXXH 3SJIA 4B74A 1UTMA 3MNBA 4HGCA 1O3PB 1SR5C 4JYUH 1V3XA 2RA0A 3RU4T 2PTNA 1ZMNA 2CJIA 4FUGA 2CHAC 3UNRA 2H9EH 1C5TA 2FOFA 1OWDA 1FPHH 2BVXH 3W94A 1KXDA 1HCGA 1KDQB 3F9EA 1UVPA 1VZQH 1RJXB 1B7XB 2ZCHP 2GDEH 4IBLH 3VB6A 3WY8A 7LPRA 2SGDE 1GDUA 1AVWA 4X2YA 4Y0ZE 2J94A 5FPTA 5CMXH 1NROH 1HDTH 3LDXH 2G81E 1EKBB 1QJ6B 4YZUA 2GP9B 1ARCA 2GZ7A 2J4IA 1ELBA 1C5LH 1K28D 1DT2A 1DY8A 1RTKA 3P8FA 2ZFPH 2BY9X 1NFXA 2GTBA 1UHBA 2GD4B 3A88A 2ZU1A 1Q2WA 3FP8E 2ANKH 3TGKE 4CRAA 3BTGE 5EU8A 3SHAH 1A3BH 1KLJH 5A8XA 2ZHQH 4D76A 1MAYA 1T31A 1GHAG 4MDSA 1PPFE 4KGAA 1TQ0B 1TA6A 2EEKA 1QJ7B 1T7CA 2ALPA 3SW2B 3B9FH 5C5OA 4DIIH 1QR3E 1S6FA 4ZKOU 4TY7A 2WPHS 1QBVH 1O3DA 2G8TA 1JOUB 1HAYB 1N6YA 1G36A 4RKJB 4GAWA 1THSH 2KAIA 2AYWA 2STBE 1HLTH 3C1KA 1LO6A 1TX6A 1W0ZU 3M37A 3LGWA 2P59A 2ZP0H 5TCAA 2Z3EA 4NCYA 1FMGA 4CH2B 1TNGA 1C1TA 1UCYE 2C3SA 3ZV8A 3I29A 3M5LA 4U30A 2TPIZ 1EPTB 3ODDA 5F8TA 1IQIA 2ZGXH 1P2NA 3DA9B 2BQ7B 3KEEA 2AGGX 2XYAA 1PPEE 1O3OA 3O8BA 3C27B 1VCQA 1XMNB 1BBRE 1F0RA 2R0KA 4Q7XA 3ZZ3A 3GY5A 2XW9A 3M3VA 2XBVA 5AHGH 5A09A 5FPYA 4NFFA 5DP8A 3GY2A 2J92A 4GVUA 1RD3B 3ATKA 2ZF0H 1SGTA 2ZFSA 5DK1A 1UTQA 1DWDH 4I8KA 1D4PB 1QRZA 1UTOA 3A8BA 4I7YH 1UTKA 1O3JA 1ZGIA 2F83A 3SI3H 2AMDA 1ABJH 1O5EH 3AASA 6GCHF 3RXSA 1SOTA 1C4U2 1UK2A 1GI9B 1JWTA 3ZYEA 2NU3E 1CA8B 8GCHG 3EQ0H 5HMAA 4XOJA 3ZZ8A 2FOMB 4NZLA 4INHA 3Q3KA 1P12E 5DJ7A 4X6MA 1KXAA 1Z6JH 1AUJA 7GCHF 3PM3A 4QT8C 3SV8A 2YOLA 1H8DH 3UFAA 5FBEA 1XUFA 5K0HA 3OY5U 2D2DA 1F5RA 5F8ZA 4XFQA 1NN6A 1O30A 2PFEA 1TGTA 3MU8A 1INCA 2FO9A 3MH7A 5EG4A 3OU0A 1BTUA 3TITA 1DWEH 3SNEA 4KTUA 1FY1A 2P95A 1SHYA 1ZOMA 1SFQB 3KQBA 3ZZ9A 4WVPE 3UOUA 1O2SA 2ZTXA 2GT8A 4UDWH 2FTLE 6CHAC 4WJG2 3BF6H 1UTPA 1KDQA 1UVTH 3MU0A 3QX5H 2Y80A 3PLBA 2VIWA 1AUTC 1P57B 3SO3A 1QFKH 4TWYA 1IQHA 1W7GH 4MPUA 2F9OA 1YLCA 2J34A 4NFEA 1C1OA 1FAXA 3S7HB 1OX1A 2AMQA 1BTPA 3SU6A 3ZZ7A 2QXIA 2FLRH 4B2CA 4B76A 3L3TA 3VEQB 4NGAH 1L1GA 1SL3A 2CMYA 2VIPA 1OWJA 1K9OE 2FM2A 2ZPRA 1RGQA 1TWXB 2CV3A 4NIXA 2BY8X 1WU1A 2YNAA 3TIUA 1LMWB 3RMLH 4BAKB 1GDNA 1EJNA 1V2TT 1YBWA 5E0JA 4SGBE 1QL7A 2PV9B 2VWNA 3PMJA 3GDUA 1O3GA 1S0QA 1GJBB 1PFXC 1QURH 4X6PA 3LGIA 2ZHDA 5DKMA 1H1BA 2OP9A 1SQOA 1GBAA 2EC9H 1AKSA 1HUTH 2BLOA 3UY9A 1TABE 1NFWA 3SQEE 1GVZA 1M9UA 3SUEA 1HAVA 1AWFH 1P11E 5FAHA 4NIVA 4FUHA 1TGSZ 2QXJA 2ZFQH 3RU4D 1EATA 3RXMA 7KMEH 1P8VC 2J38A 3U1IB 5J4SA 1MUEB 2ANYA 1GL1A 4E05H 1OPHB 3MO6A 1ANCA 1GMCF 1GGDB 1HAPH 3QO6A 3ZZ6A 1HNEE 2TBSA 1TONA 3BTWE 5DO4H 1GBIA 4O97A 2AMPA 1TOCB 2EI6A 2JETB 2GGVB 2AFQB 1QL8A 3A8CA 3HATH 3DUXH 4AFZA 1KXCA 2H6MA 1V6DA 2WUCA 5F03A 2SGAA 2ZU2A 1QCPA 2ZCLP 1KXBA 3GICB 1TPSA 1GJ5H 1Z8RA 1KLTA 2WINI 1FI8A 5T6GA 1QHRB 2ZU3A 1QJ1B 3SQHE 4H4FA 3SU2A 1G2LA 1ELGA 1H9HE 4K8BA 2A5IA 3TH3H 4Y7BA 4VGCB 1K1MA 4DG4A 2ZDMA 1P06A 2V3OH 2A32A 4UE7H 3SI4H 4WWYA 1SVPA 1JBUH 1DY9A 3H7OA 2FIRH 4ABBA 1K2I1 3A81A 3EDXB 4X1QU 2Y82A 1DE7H 1K21H 5PTPA 4INKA 1SGQE 3MO3A 3RXOA 4IN1A 3E91A 4Y7AA 1E37B 1VGCC 1QTFA 3V7TA 3QTOH 4ISOA 2XWAA 5EPNA 1HAXB 4B1TA 4XE4A 1MQ6A 1TPPA 1LHDH 2Z9KA 1TB6H 2EI8A 2H5DA 1O2ZA 1SPJA 3A80A 3A7ZA 2PGQB 3PLKA 1L4ZA 2C93B 1DX5M 4ZHMU 4FU9A 3QN7A 3W95A 4MNXA 1TMTH 3UOPA 1HRTH 1O3HA 3DD2H 2UWOA 1ACBE 2XBWA 1C1SA 4WXVA 1OWEA 4LXBH 2FZZA 4XBCA 1AVGH 2GCTC 5JBBS 1UJ1A 3A8AA 1P2IA 1QL9A 1ORFA 4O9VA 3O8CA 2Z94A 2TGPZ 3RP2A 1DXWA 3ZZ4A 1A46H 1C1QA 3GCHB 4AGKA 2FEQH 4FU7A 1NZQH 1GJ4H 1BMAA 1MTSA 5E0HA 2R2WU 3MI4A 1OP8A 3UQVA 2ZTYA 1BBRH 2WPIS 3SUDA 1ESBA 1HJ9A 3JZ2B 4I8LA 1Z6EA 4YLUA 1AE8H 1BRBE 1UTJA 1EP5A 1RTLA 1AB9C 3RXFA 4AB9A 1O3KA 2OLGA 1PQ7A 3E16B 3M3TA 4ZROA 1NRPH 2GCHG 3ATIA 5JB9S 3UREA 5L2YH 4Q2KA 2ZFTA 1ZSKA 1GJ8B 2DE9A 3SORA 3E0NB 4O3TA 4AORA 4YOIA 3RXHA 1MH0A 4IS5A 3EA9A 1EP6A 1AFQB 1O35A 1THRH 2SGEE 1O3EA 3TU7H 1AZZA 1XXFA 4R0IA 1BBRK 2M5TA 3M7UA 3RLWH 2PGBB 3FZDA 5GCHF 1YLDA 1V2LT 1XUJA 2G55A 2ZHFH 1RFNA 3R0FA 4K1TA 1WSSH 3SU4A 4WMEA 1GHVH 2Z6BD 8GCHF 4ISNA 1ZPZA 1ZSJA 3QLPH 1NFUA 1P04A 1GBKA 1BHXB 3RXQA 1WV7H 2BOKA 1AD8H 1F7ZA 5FXLA 2BD4A 3HKIB 3MWIU 1FY3A 1QB6A 2Q6GA 1GG6B 2FODA 4X1RU 4ABGA 5T6FA 5FBIA 2F9VA 1FQ3A 3TJUA 3MH4A 6LPRA 3S0NA 3HK3B 1SOZA 4MNWA 1N8OB 4XSKU 1BIOA 1L2EA 5G4BA 3V13A 4NA8A 3MH5A 3EGKH 2VVCA 1GGDC 2BDGA 3QZQA 1GWAA 1SGPE 3RXLA 1SG8B 1C2KA 2P3TB 2TGDA 1PYTD 3SGAE 1GBJA 4X0WU 2VJ1A 1K1NA 1SGNE 1NRQH 1VITF 3EA7A 1HJ8A 1HFDA 1P01A 3PMHB 1ZGVA 2GVFA 3PTNA 1C5QA 1O39A 1A7SA 2P93A 1DITH 3SV6A 4NA9H 1ANEA 3CS7A 1O3MA 6CHAB 4WH8A 5GJ4B 1O2YA 2VNTA 3EE0B 1EZXC 2BYAX 2VVUA 1O5GH 2WYJA 2O8MA 1TNIA 1V2PT 5DP7A 1W8BH 1O5CB 2FWWA 1YKTA 4ZKNU 4NWLA 3T62A 3QGNB 1ABIH 2FOBA 1ZRBA 4YESB 3U8OH 1TRYA 2FOAA 4ABDA 1F0TA 1H9IE 2GX4A 1ETRH 4BOHA 3UTUH 3KCGH 3NUMA 2ZGBH 1GPZA 3P95A 2BXTH 4JZFH 5FPSA 2BXUH 4KELA 3D23A 2W5EA 1ESAA 1V2NT 1FNIA 1C5UA 4FUDA 1IQGA 2A1DB 4DGJA 2K1QA 5CHAC 2DUCA 4NIYA 1QRXA 3TNSA 4UONA 2ZZUH 1QY6A 2ZGJA 3ITIA 3PYHA 1BQYA 1D3TB 2Z9LA 3UPEA 1E35B 3KHVA 3GY4A 5A0AE 1G32B 1A5IA 4K69A 1GMHF 4DY7B 3D49H 3U8RH 3URDA 4JZIA 1DSTA 3E1XB 1O2UA 3HGPA 1CSOE 1ZHMA 3TGIE 2Z3DA 1LPKB 2PSYA 1JIRA 4NG9H 3V0XA 2C8XB 2HPQH 2GDDA 3HK6B 2PLXA 1DPOA 2OC7A 5AVDA 2W7UA 3TJNA 4D7FA 1GBEA 1QRWA 1EZQA 3PWCA 2ZG0H 2IJOB 2ZQ1A 1ZMLA 4D7GA 3ESTA 1G2MA 1EPTC 1C5NH 3ZZDA 1S81A 3EAJA 1F5LA 5EW2H 2BQ6B 2Y6TA 3RXRA 1Y3XA 4X2VA 3S9CA 2ZHWH 1GI4A 1GI6A 8KME2 1TGCA 2HNTE 1QGFA 1DFPA 2B7DH 4DW2U 3A86A 3TH2H 2HLCA 2AIPA 2FOHA 2GKVE 3A7TA 2O8WA 3GY6A 1OWIA 1PPHE 1PQAA 5DPAA 1GHWH 2V6NA 3RXGA 4JZ1A 4B73A 3M7TA 3KQCA 3SU3A 4J2YB 2ZTZA 1QA7A 3B23B 3A7WA 3VB4A 1SGCA 5TJXA 3KQEA 1C1VH 1P10A 3GY3A 3SV9A 3TGJE 1GG6C 4Y8YA 1NC6A 1CO7E 5AFZH 5H4IB 1JRTA 1VR1H 1XVOA 3A89A 3OTJE 1HBTH 1T8OA 1XM1A 3HGNA 1GI2A 1SGRE 1GMCG 1RS0A 1ZHPA 4GHQA 4GUXA 5IYTA 2BDCA 4XBBA 1DUEA 3UNSA 1WTHD 3T26A 4X2WA 3KL6A 3RMMH 5A0BA 1TOMH 1LHEH 3LIWA 1C1WH 1NRSH 4WF8A 3PLPA 2ZDNA 4Y8XA 1S84A 1CT4E 1C2JA 2V3HH 1OKXA 2QGRA 2V0BA 2B9LA 1C4Y2 2UUFB 2WPLS 3RMOH 1V2KT 1ZPBA 1OP2A 3S9AA 3K6YA 2FLBH 2ZWLH 2VH0A 4A1XA 1MD8A 2ULLA 3MO9A 2GMTC 2VIVA 1XUGA 2O8UA 1YCPM 4ZHLU 3T28A 3ZVGA 2OC1A 1C2GA 1KTSB 5ETXA 1GBHA 1O2RA 2DE8A 1TMUH 2ANMH 2FMJA 2OBQA 4BTIB 4JZDH 4A1TA 1AN1E 1MU8B 1NRNH 4Y0YE 3MH6A 1C2HA 3A8DA 1NU9A 4A1VA 2GZ9A 1AIXH 1SGFA 1P3CA 3EYDA 1MCVA 8ESTE 1G37A 1SI5H 1LPGB 4ISLA 3PMBB 1Y8TA 2OQ5A 2VH6A 3LPRA 3T2NA 3E6PH 3GCHC 1MU6B 1O3FA 2H9HA 3A82A 3SJ8A 4TYDA 1TGBA 1BITA 2QN5T 2GV6A 2PTCE 2BD8A 4K1SA 2C4FH 2ASUB 2RCEA 1P2OA 3P6ZB 3MU1A 3ZZCA 1EQ9A 2BDBA 2GCTB 4Y79A 3ATMA 1B5GH 3ELAH 1V2QT 1BZXE 4TPIZ 1QB1A 4AG1A 4I8JA 3H7TA 1ARBA 2FI4E 1TX7A 5C67A 4B71A 1BT7A 1LVBA 3M5OA 3LGTA 1FJSA 3QUMP 2I6QA 4K60A 1GHAF 2QIQA 4FUEA 1CGHA 1MZDA 4WH6A 1UTLM 3QK1A 1O2OA 3RXBA 3UR9A 3TK6A 1C2LA 4BAQB 4X8VH 6ESTA 4YTAA 2ZFRH 2QYIA 1P9UA 3N7OA 4GHTA 4DIHH 1O0DH 4K3JA 5EXNA 4GPGA 1CT0E 1Z1JA 2XBYA 1JXPA 1P02A 1E38B 2Y5FA 1MTNC 4I32A 4MNVA 3STJA 1AHTH 3A84A 2OINA 1ELDE 4ZHAA 1Z8GA 2AH4X 3F68H 1GMHG 1HJAB 2G4UA 1GCTB 3T27A 2OC0A 1WQSA 1YPGH 1QB9A 5C1UA 3RC6A 4LZ1H 1O33A 3UR6A 1Z71A 4ZKRU 3P8NA 5JBCS 4AG2A 1C9TA 3SNAA 3P8OA 1EOJA 4CR5A 2Y5HA 1O2GH 1J8AA 1DANH 3PROA 3OYPA 2EI7A 1AVXA 1MAXA 1UHBB 1FV9A 3RXTA 4H6TA 5E8EH 1PPZA 4ABFA 2ZNKH 2P94A 1CBWC 1J15A 4IMZA 4DOQA 3O8RA 2FX6A 1TRNA 2VU8E 1CQQA 1NRRH 1O2JA 1C2IA 4XBDA 3BEIB 1C5SA 3SN8A 1FUJA 3Q3XA 1S82A 5DP5A 4JMYA 5BRRE 1FY8E 3K6ZA 4K5ZA 2QXGA 1QBOA 1H4WA 2XNIA 1D6WA 1HPGA 1LCYA 1BRAA 1P9SA 1EXFA 1JRSA 3BG4C 3SV7A 1UVUH 3P92A 1IQKA 3UWJH 1EB1H 1ZLRA 1GJCB 1O3NA 3A83A 3SNBA 1LHGH 1XKAC 3SU1A 4UFEH 1A61H 3GISB 5L30H 4OS2A 1GBLA 3VB5A 4B2AA 1TFXA 5HM2A 2VIDA 3RC4A 4WXIA 1V2OT 1S5SA 2Y7ZA 1EZUC 2EA3A 2W26A 1NT1A 1GBBA 3PB1E 2F9NA 1CHOG 1O2TA 1TPAE 2BD5A 1CBWB 2ZU4A 3LGUA 2ESTE 3IWMA 2FI5E 1W13U 3QDZB 3R3GB 1GVKB 3RM2H 2BTCE 4U32A 2XRCA 1A5GH 1KYNA 1P09A 1V2UT 3CS0A 2J2UA 5LH8A 5HM9A 1FN6A 1W14U 2BY5X 4GLYA 4A5TS 4FUBA 2NWNA 1IQMA 2HGTH 1XXDA 4JYVH 1LTOA 4CRBA 1JIMA 1FN8A 5GDSH 1V2VT 1W11U 1ELEE 2PKSB 5JPMH 1V2ST 2ZECA 3MMGA 3FP6E 3NPSA 1VJ9U 5C1XA 2H5CA 5DP3A 2A4RA 4RN6A 3L33A 1FDPA 4NA7A 1EAUA 3U98H 1K1JA 1JMOH 2THFB 5FHTA 1C9PA 4TPYA 3HKJB 4KKDA 2VGCB 3P70B 3BEFB 4H42U 1H9LB 1T4VH 4ISIH 3TH4H 1NFYA 3ZVBA 1O2HA 3TJVA 3LH3A 1MD7A 5AF9H 2JH6D 3GYMA 1MCTA 1YM0A 1E0FD 1O5FH 3TPIZ 3ATLA 3TK9A 3TNTA 1C5XB 1WOFA 2ODPA 1GI0A 1MBQA 1HAOH 1LVYA 4TY6A 2XC4A 1D3DB 4BAMB 1UCYH 3ZZ5A 2OC8A 9ESTA 1D9IA 2BZ6H 1GI5A 1GBMA 5HYOA 1TGNA 1ZHRA 4FXGH 3LU9B 5FCRA 4CRDA 5ESBA 3RMNH 2D8WA 1QA0A 4AFQA 3NK8A 1DUAA 5HXFA 1ID5H 2SGQE 2A7JA 4X1PU 1IHSH 1DM4B 2BDHA 5C1YA 4ZUHA 3MYWA 1O2KA 1ZR0A 4MPWA 3BIVH 2CGAA 1W3CA 4I8GA 5GIBA 5C2ZA 1AO5A 4OS1A 3VGCB 4AX9H 2C8ZB 2B5TB 3LC3A 4IC5A 4FUJA 1VITG 1BJUA 1GI7B 1BB0B 2BX4A 1GBCA 3KQDA 2A2XH 2VWMA 1WYKA 1EZSC 1BA8B 1Y3WA 1DXPA 2BD9A 1P0SH 1N1LA 2AS9A 1IQLA 1Z8JB 4AGJA 3M61U 2GV7A 1MBMA 2A7CA 1KTTB 2Y7XA 2AIQA
chains in the Genus database with same CATH superfamily
3AVZA 2ZO3H 1GL0E 3K65B 2VIOA 5ABWA 3SJ9A 1E79D 1F0UA 1Z8IB 4LOYH 2A7HA 2WPMS 1AI8H 3OSYA 3LGYA 1EB2A 1TPOA 1HAZB 4OS5A 1ETSH 1D3QB 2OTVA 2ZDLA 3F0PA 4CR9A 1UK4A 1W0KD 5GWZA 4BTUB 4AFSA 2J95A 1PYTC 2NU1E 1C5RA 4CREA 1TBRH 1BTHH 2YMSD 1WTGH 3SJKA 2D1JA 2F9PA 2LELA 1S85A 2A31A 1SQTA 1ZYOA 1BTXA 2R0LA 3ZVFA 2XBXA 2IPHA 3M5MA 3PTBA 1WXRA 1WDIA 4AZ2B 5EXLA 1ZTKA 1G3EA 2PR3A 1C1UH 7ESTE 2BD2A 5FCKA 1EASA 3D65E 5EGMA 4BTTB 3A85A 1E1QD 1OOKB 1K1IA 3GDVA 4BNRA 3A87A 1P05A 2PHBA 1SLUB 1NESE 2HALA 1SGIB 2UWLA 2XCFA 3FANA 3SGQE 4WMDA 1LKBA 2FXRA 1QBNA 1YPKH 1DSUA 2BD3A 1AQ7A 2W7SA 3VGCC 1O2MA 1V2MT 4INLA 5C3NA 2XWBI 3ZYDA 1SSXA 1KIGH 1QQ4A 1SGFG 2ZIQH 2G5VA 2FS8A 1N6XA 4B2BA 2VB0A 1FPCH 2ILNA 3U9AH 2A4GA 2ZPSA 3PO1B 2L74A 2PWXA 5CHAB 4GSOA 3L6PA 2CHAB 3U1JB 1CHGA 1ZRKA 3LJOA 1CGJE 5L2ZH 1AWHB 5A8YA 7GCHG 2UWPA 3PWBA 4Z6AH 2WV9A 3A7VA 1W7XH 1KXEA 1MMJN 1V2RT 4KTSA 1T8LA 2PKSC 4CRFA 5A0CA 1YPHE 3OY6U 1K1LA 4UEHH 1OS8A 4K1EA 2SNWA 1K1PA 1P2KA 1SB1H 3LOXA 3K2UA 2BLQA 2VGCC 4HI3A 4B75A 3S7KB 2XC0A 5A8ZA 1HB0B 3D62A 3F9FA 4F49A 1TRMA 1FAKH 2R3YA 3M36A 4DCDA 4JZEH 4ZKSU 2ZA5A 1G9IE 5KECA 4OGYA 1XUIA 2WPJS 2JDID 3T29A 2WZQA 1N8OC 1EAXA 3ZVDA 5E2OA 1UMAH 2GT7A 3MU4A 4I33A 5JDUB 4IC6A 1XX9A 1ANBA 3ZZBA 1BTWA 4YT7H 1Y3VA 4X6OA 2BM2A 1TNJA 3BTHE 1VJAU 3FFGA 1O3LA 1BMNH 1OYQA 2B0FA 1Y3UA 2IN2A 1VGCB 2ZQ2A 4I31A 2PUXB 1B0EA 1FY4A 3FAOA 4X8UH 2XXLA 1DVAH 1E1RD 2BHGA 1L1JA 3BTFE 1O3AA 3MTYA 1MQ5A 1SQRA 2P8OC 4FETA 4RT1A 2ALVA 2QC2A 4PROA 4Q4LA 1HAGE 1UK3A 3LONA 5EQSA 3F6UH 1VITH 4ACBA 4Q7ZA 4U01A 1UW7A 2FX4A 1KSNA 3SOSA 4ABIA 3S9BA 3SJOA 1AKSB 2AEIH 1QIXB 2ZDAH 3M7QA 2F91A 4JYTA 1GBDA 2A0QB 3E8LA 1SGDE 3QGJA 4BXSA 4GCHG 1C1MA 3NKKA 5BPEA 2LNCA 2Z3CA 4WMFA 5C0UA 3SV2H 4YT6H 2ZI2H 4YOGA 1BRUP 1MTNB 2FOGA 4JCNA 1W10U 3GYLB 1FXYA 1ZPCA 1O2XA 3BTQE 4ZAEA 2JH5D 3SUGA 4HZHA 1DICA 2VINA 2J98A 4O03A 1LHCH 2TGAA 3E3TA 2RDEA 1SLVB 3BTDE 2KCOA 3FP7E 5HGGA 2QA9E 1GCTC 1O2VA 2BX3A 3O8DA 4Y6DA 3B8JA 3BG8A 2AERH 5TCCA 2G52A 3DFLA 1PQ8A 3IITA 2BMGB 5JYIA 1XUKA 1SGEE 3SNCA 1EOLA 1W2KH 1T4UH 1RXPA 1AFQC 1W12U 1Y59T 1L1NA 1CGIE 3NZIA 3SU0A 1HIAB 1OSSA 3BV9B 3SU5A 1OXGA 1EX3A 9LPRA 1EUFA 2YMSC 1MTWA 5T6DA 1YF4A 4Y8ZA 1EAIA 5EXMA 2W3IA 1AZ8A 1YC0A 2V35A 5F6MA 1Z7KA 1A0JA 3AAVA 2CF9H 3UB0A 1OWKA 1IOEA 2KR7A 5T1VA 4Z0KA 1O2IA 1ETTH 2YNBA 4CH8B 3FZZA 4KTCA 1UVOA 1WUNH 1O34A 2JH0D 1UVSH 4JK5A 4OS7A 1O5BB 3RXAA 2A5KA 3UWIA 2FPZA 2VIQA 2PKAA 2EQNA 3DFJA 1H8IH 5KEDA 2ZGCA 2ZC9H 1YPHC 3KF2A 1HXEH 3F0OA 3S69A 4DJZB 3UUZA 3LKWA 4VGCC 1FONA 1RIWC 1TBQH 5FX5A 2QF3A 2BZAA 1BTZA 4LZ4B 5LPEA 1E34B 2TIOA 1HAVB 2G00A 3Q76A 1HYLA 3PV2A 2SGFE 1O31A 1S83A 1BTYA 1BJVA 5DP6A 3MNSA 3MNCA 5JB8S 2G5NA 2ZKSA 2HPPH 3P8GA 4H6SB 1NPMA 3ZVEA 4CHAC 1SHHB 1TQ7B 3SBKA 1SBWA 1LQEA 1AU8A 2YMSB 2FI3E 1J16A 2TRMA 1ESTA 2VVVA 3VB3A 2BVRH 2CN0H 4FUIA 1FIWA 4K8YA 1HXFH 2FTMA 3DSOA 3GOVB 2Z9IA 5I46H 3F1SB 1H8ED 2LP6A 4ACAA 4X8SH 3BG4B 3RM0H 1Y5UT 3RUOA 1NS3A 3ZV9A 2FYRA 5AFYH 2I6SA 1ZJDA 1ELFA 3VFEA 3M3SA 1GMDF 2P3UB 3TVJB 1TE0A 2R3UA 1E36B 4ESTE 3HPTB 3FO8D 1TAWA 3KYGA 3RC5A 1UO6A 4UFDH 1P2JA 5FL7D 1O36A 4MPVA 2VWOA 1FIZA 4ISHH 4A6LA 1Q31A 4ZMAH 1AY6H 2XCNA 4A7IB 1C5YB 3M5NA 1OYTH 3RXIA 3BN9A 1C5PA 1O2NA 2HNTC 3F9GA 2OXSA 1TMBH 3RU4E 5L6NH 1BUIA 1YPLH 2Q6FA 2C8YB 3K9XB 2P16A 2L6OA 3AW0A 2CF8H 4X1SU 4YM9A 5IDKA 1C2MA 2FESH 1C5MD 2PKAB 2P8OB 3P17H 2AGIX 2JETC 1C1NA 1BHXF 1CA0B 1GJDB 4IN2A 4MG3A 5FX6A 6GCHG 1WQVH 3CP7A 4D8NA 5JBAS 3V3MA 1A1RA 4R8TB 4DVAU 1ZTJA 4MNYA 1O37A 3RLYH 2WYGA 4XDEA 1SFIA 1RTFB 1SKYE 3SZNA 3VPKA 1C5ZB 1G3DA 3LC5A 3JZ1B 2SFAA 3MNXA 3EA8A 4O3UA 2AHME 2R9PA 1GHBF 3KNXA 4AYVB 2ZDKA 1TX8A 3MOCA 2Q6DA 3RXKA 3RXVA 3G01A 5E0GA 3MHWU 4MQAA 1J17T 1QNJA 4OS4A 3QTVH 2OCVB 3KYFA 1IQFA 1GBFA 2A4QA 3BTTE 1K1OA 1XVMA 1TALA 1BRCE 1MTVA 1LDTT 3PO1C 3LT3A 1CU1A 2WV5A 4M7GA 2XC5A 1QZ8A 3SGBE 3URCA 1SC8U 2TGTA 1Q3XA 2XNDD 4ASHA 1WAYB 4Q7YA 5HIYA 5DG6A 2FS9A 2ZHEH 2F9UA 1O5AB 2EY4C 3E0PB 3ODFA 5HIZA 3M35A 4CRCA 1NBME 1WBGB 1MZAA 4CRGA 4UFFH 2F4LA 2FYQA 4IW4E 3UQOA 1GMDG 2XTTB 4ABAA 1OP0A 1YGCH 1T8NA 2Q1JA 1D3PB 3VXEH 1BMLA 2A2QH 4ABJA 1O2PA 4OS6A 1MKXH 1P2QA 1G3BA 1HAIH 1THPB 3BTME 3DT0H 2P3FH 2HVXA 1EPTA 1GJ6A 1P03A 3SHCH 4YOJA 1W0YH 2FDAA 2GMTB 4X8TH 2ZCKP 4OGXA 3T25A 1O3IA 2VWLA 1GHXH 2ZDVH 4AOQA 4NWKA 1Y5BT 1T32A 1GJ7B 2STAE 3SUFA 1ELTA 3DHKH 4WY3A 1GI1A 4IGDA 3AW1A 1O2WA 5B6OA 3IG6B 5EW1H 1GCDA 4Q80A 3ZVAA 2BOHB 3AK5A 1GHYH 1COWD 3TLOA 1MKXK 1FZZA 1X7AC 3F9HA 1F5KU 1EAWA 2GZ8A 1QQUA 3RXPA 1BOQA 1ELAA 2BB4A 3ATWA 3BTKE 2KZ4A 3Q00A 5CHBA 4FOUC 4XD7D 3GCNA 1MKWH 2B8OH 3RXUA 3NWUA 3T5FH 1T8MA 2FP7B 3F2FA 1GHZA 2IJD1 4UFGH 2FOCA 3STIA 1O32A 1Y3YA 3LH1A 2KCYA 1EJAA 1C1PA 3BIUH 3F2GA 1WCZA 3VB7A 1F0SA 2ZFFH 2ZU5A 5K7RA 3FVFB 1IAUA 3ZVCA 1LKAA 3U69H 1DLEA 1BMMH 1ZZZA 4Y11E 3N7DA 3NXPA 2Y5GA 2QXHA 1CA0C 5EPYA 1O3CA 5SGAE 1MKWK 2PW8H 1C4V2 3GCTG 4ABHA 2AGEX 1C2DA 1O2QA 3LJJA 5LGOA 3DSPA 4SGAE 2G51A 2A4OA 4X6NA 1L4DA 1O38A 1U6QA 4DT7B 1TLDA 2O8LA 1BDAA 1TNKA 1V2WT 4IMQA 1C5WB 2HRVA 2ZGHA 3PV4A 3BEUA 2XOKD 5J4QA 1NO9H 1MTUA 4Y10E 3UNQA 1G30B 1O3BA 1PPGE 1HV7A 1HGTH 2BY6X 2JIZD 2QF0A 1LVOA 3SNDA 1O5DH 4HG6A 4FVBA 1IQJA 1NM6A 2PUQH 4E7NA 4ZCNA 2Z9GA 1IHTH 2QCYA 4Y71A 3UAIC 4LK4A 3BTEE 4RSPA 5F8XA 2QV1A 1BCUH 4K2YA 4AN7A 1YP9A 3RXDA 3SYJA 1GJAB 1YPJH 4F4OC 1S6HA 3GCOA 5LPRA 4RKOB 1SGYE 1UTNA 1RRKA 3ZZAA 2F9BH 4J1YA 2BDYA 5DGJA 2ZPQA 1O2LA 1MABB 1PQ5A 2OUAA 2G4TA 2QY0B 5DP9A 4NSVA 2KX4A 3NCLA 1LPZB 3QZRA 1LVMA 1ZTLA 4NSYA 2JKHA 1AB9B 2GCHF 2RA3A 1A4WH 3LGVA 1DS2E 1F2SE 4AYYB 1A2CH 4YXWD 1CVWH 2O8TA 1DWCH 1S6LA 1GI3A 1RIWB 2H1UA 3MU5A 1GHBG 5I25A 1IQEA 2HOBA 1FY5A 2OBOA 2KAIB 4MVNA 2Z9JA 4E06H 2FOEA 3RXEA 1ZJKA 2M2AA 3MFJA 2HWLB 1LHFH 1K22H 2BLVA 4CHAB 1AE5A 1CT2E 1C5OH 1SQAA 1C5VA 1YYY1 3U8TH 4ABEA 3PV5A 1AMHA 2O9QA 3TK5A 3GY7A 1VKYA 2BD7A 3OX7U 2LPRA 2ODYB 1NU7B 2J9NA 1Z1IA 5DP4A 2Z7FE 1GVLA 1PPBH 3H5CB 2WUBA 2IPQX 5EOKA 2WPKS 2QAAA 1SLWB 3I78A 4U2WA 5EQQA 1KLIH 5E2PA 4MLFB 1S0RA 1A0LA 1HIAA 2F3CE 1UCYK 5A2MH 1ELVA 2BDIA 2PSXA 3FOAA 2NU0E 3A7XA 5C5NA 4X1NU 1SLXB 4THNH 1OWHA 2BDAA 4FU8A 2HNTF 5ESTE 3KGPA 3GY8A 3RDZA 4YO9A 1P2MA 5GCHG 4ZXYH 4NIWA 1TYNA 2BY7X 3AAUA 1AFEH 4TWWA 1KXFA 1TA2A 3TJOA 1YPMH 3EE7A 1TIOA 4ZH8A 2UUJB 3QWCH 1ZSLA 3GDSA 1DLKB 3I77A 1NTPA 2BQWB 1GDQA 2KCPA 3PRDA 2RG3A 1PPCE 3ENSB 1KY9A 1GBTA 2ODQA 4I8HA 3F3BA 1C2EA 1J9CH 4BXWA 2A45B 2C8WB 3E90B 4BANB 5T3HA 4Y76A 4HFPB 3CENA 5GXPA 1A5HA 2UUKB 1AGJA 2IOTA 2OD3B 1YPEH 3UIRA 4X2XA 1L0ZA 2CXVA 1ZMJA 2UUYA 4AFUA 2H2ZA 4BAOB 1PJPA 2BLWA 1SMFE 4UD9H 1C2FA 2RDLA 4TT3D 4GCHF 4JK6A 2ANWA 4D9RA 4FUCA 5CE1A 1B0FA 4MTBA 1ANDA 1HAHH 2ZEBA 5LPFA 1G3CA 1XKBC 4D9QA 2SNVA 1DOJA 1EJMA 1GI8B 4HTCH 1ELCA 1VCWA 1XUHA 3A7YA 3KIDU 3PMAB 1YCPK 4BAHB 2D26C 3V12A 1A0HB 4E7RG 1FX0B 3RXCA 1Y5AT 3KN2A 1GJ9B 1A3EH 1F92A 3N99A 1VCPA 1CHOF 4FVDA 1J14A 1LQDB 2W3KA 5C20A 5EQRA 1P3EA 1TNLA 2NU2E 1DDJA 2Y81A 4MPXA 4NZQA 3Q77A 3VXFH 2R2MB 2BVSH 5EODA 1C1RA 1CE5A 4YLQH 5JBTA 3GCTF 4AB8A 4KP0A 2WV4A 4CBOA 3BSQA 8LPRA 1YCPH 2C90B 4A92A 4FUFA 4CBNA 3Q3YA 3RXJA 1D6RA 3MQKC 2J97A 1HJAC 2H9TH 1FLEE 1NY22 4Q63A 2A5AA 1V2JT 2NU4E 2SGPE 2OQUA 5GPIB 1DWBH 1IQNA 1TBZH 4Z1MD 4DURA 1TNHA 4ZXXH 3SJIA 4B74A 1UTMA 3MNBA 4HGCA 1O3PB 1SR5C 4JYUH 1V3XA 2RA0A 3RU4T 2PTNA 1ZMNA 2CJIA 4FUGA 2CHAC 3UNRA 2H9EH 1C5TA 2FOFA 1OWDA 1FPHH 2BVXH 3W94A 1KXDA 1HCGA 1KDQB 3F9EA 1UVPA 1VZQH 1RJXB 1B7XB 2ZCHP 2GDEH 3U28C 4IBLH 2W6JD 3GS9A 3VB6A 3WY8A 7LPRA 2SGDE 1GDUA 1AVWA 1YWUA 4X2YA 2J94A 3N7EA 4Y0ZE 1NROH 5FPTA 5CMXH 1HDTH 3LDXH 2G81E 1EKBB 1QJ6B 4YZUA 2GP9B 1ARCA 2GZ7A 2J4IA 1ELBA 1C5LH 1K28D 1DT2A 1DY8A 1RTKA 3P8FA 2ZFPH 2BY9X 1NFXA 2GTBA 1UHBA 2GD4B 3A88A 2ZU1A 1Q2WA 3FP8E 2ANKH 3TGKE 4CRAA 3BTGE 5EU8A 3SHAH 1A3BH 1KLJH 5A8XA 2ZHQH 4D76A 1MAYA 1W0JD 2W6ID 1T31A 1GHAG 3ZIAD 4MDSA 1PPFE 4KGAA 1TQ0B 1TA6A 2EEKA 1QJ7B 1T7CA 2ALPA 5C94A 3SW2B 3B9FH 5C5OA 4DIIH 1QR3E 1S6FA 5EJZA 4ZKOU 4TY7A 2WPHS 3OFND 1QBVH 1O3DA 2WSSD 2G8TA 1JOUB 1HAYB 1N6YA 1G36A 4RKJB 4GAWA 1THSH 2KAIA 2AYWA 2STBE 1HLTH 3C1KA 1LO6A 1TX6A 1W0ZU 3M37A 3LGWA 2P59A 2ZP0H 5TCAA 2Z3EA 4NCYA 1FMGA 4CH2B 1TNGA 1C1TA 1UCYE 2C3SA 3ZV8A 3I29A 3M5LA 4U30A 2TPIZ 1EPTB 3ODDA 5F8TA 1IQIA 2ZGXH 1P2NA 3DA9B 2BQ7B 3KEEA 1KMHB 2AGGX 2XYAA 1PPEE 1O3OA 4I86A 3O8BA 3C27B 1VCQA 3KQ5A 1XMNB 1BBRE 1F0RA 2R0KA 4Q7XA 3ZZ3A 3GY5A 2XW9A 3M3VA 2XBVA 5AHGH 5A09A 5FPYA 4NFFA 5DP8A 3GY2A 2J92A 4GVUA 1RD3B 3ATKA 2ZF0H 1SGTA 2ZFSA 5DK1A 1UTQA 1DWDH 4I8KA 1D4PB 1QRZA 1UTOA 3A8BA 4I7YH 1UTKA 1O3JA 1ZGIA 2F83A 3SI3H 2AMDA 1ABJH 1O5EH 3AASA 6GCHF 1H8HD 3RXSA 1SOTA 2F43B 1C4U2 1UK2A 1GI9B 1JWTA 3ZYEA 2NU3E 1CA8B 8GCHG 3EQ0H 4F55A 5HMAA 4XOJA 3ZZ8A 2FOMB 3OEHD 4NZLA 4INHA 3Q3KA 1P12E 5DJ7A 4X6MA 2HLDD 1KXAA 1Z6JH 1AUJA 7GCHF 1K0HA 3PM3A 4QT8C 3SV8A 2YOLA 1H8DH 3UFAA 5FBEA 1XUFA 5K0HA 3OY5U 2D2DA 1F5RA 2JJ2D 5F8ZA 4XFQA 1NN6A 1O30A 2PFEA 1TGTA 3MU8A 1INCA 2FO9A 3MH7A 5EG4A 3OU0A 1BTUA 3TITA 1DWEH 3SNEA 4KTUA 1FY1A 2P95A 2WHXA 1SHYA 1ZOMA 1SFQB 3KQBA 3ZZ9A 4WVPE 3UOUA 1O2SA 2ZTXA 2GT8A 4UDWH 2FTLE 6CHAC 4WJG2 3BF6H 1UTPA 1KDQA 2K0QA 1UVTH 3MU0A 3QX5H 2Y80A 3PLBA 2VIWA 1AUTC 1P57B 3OEED 3SO3A 1QFKH 4TWYA 1IQHA 1W7GH 4MPUA 2F9OA 1YLCA 2J34A 4NFEA 1C1OA 1FAXA 3S7HB 1OX1A 2AMQA 1BTPA 3SU6A 3ZZ7A 2QXIA 2FLRH 4B2CA 4B76A 3L3TA 3VEQB 4NGAH 1L1GA 1SL3A 2CMYA 2VIPA 1OWJA 1K9OE 2FM2A 2ZPRA 1RGQA 1TWXB 2CV3A 4NIXA 2BY8X 1WU1A 2YNAA 5C0TA 3TIUA 4RI0A 1LMWB 3RMLH 4BAKB 1GDNA 1EJNA 1V2TT 1YBWA 5E0JA 3OAAD 4SGBE 1QL7A 2PV9B 2VWNA 3PMJA 3GDUA 1O3GA 1S0QA 1GJBB 1PFXC 2J5UA 1QURH 4X6PA 3LGIA 2ZHDA 5DKMA 1H1BA 2OP9A 1SQOA 1GBAA 2EC9H 1AKSA 1HUTH 2BLOA 3UY9A 1TABE 1NFWA 3SQEE 1GVZA 1M9UA 3SUEA 1HAVA 1AWFH 3NRLA 1P11E 5FAHA 4NIVA 4FUHA 1TGSZ 2QXJA 2ZFQH 3RU4D 1EATA 3RXMA 5B6LA 7KMEH 1P8VC 2J38A 3U1IB 5J4SA 1MUEB 2ANYA 1GL1A 4E05H 1OPHB 3OE7D 3MO6A 1ANCA 1GMCF 1GGDB 1HAPH 3QO6A 3ZZ6A 1HNEE 2TBSA 1TONA 3BTWE 5DO4H 1GBIA 4O97A 5CDFE 2AMPA 1TOCB 2EI6A 2JETB 2GGVB 5F53A 2AFQB 1QL8A 3A8CA 3HATH 3DUXH 4AFZA 1KXCA 2H6MA 1V6DA 2WUCA 5F03A 2SGAA 2ZU2A 1QCPA 2ZCLP 1KXBA 3GICB 1TPSA 1GJ5H 1Z8RA 1KLTA 2WINI 2HVYB 1FI8A 5T6GA 1QHRB 2ZU3A 1QJ1B 3SQHE 4H4FA 3SU2A 1G2LA 1ELGA 1H9HE 4K8BA 2A5IA 3TH3H 4Y7BA 4VGCB 1K1MA 4DG4A 2ZDMA 1P06A 2V3OH 2A32A 4UE7H 3SI4H 4WWYA 1SVPA 1JBUH 1DY9A 3H7OA 2FIRH 4ABBA 1K2I1 3A81A 3EDXB 4X1QU 3WWBA 2Y82A 1DE7H 1K21H 5PTPA 4INKA 1SGQE 3MO3A 3RXOA 4IN1A 3E91A 3W1EA 4Y7AA 1E37B 2KFWA 1VGCC 1QTFA 2V7QD 3QTOH 5EJLA 3V7TA 4ISOA 2XWAA 5EPNA 1HAXB 4B1TA 4XE4A 1MQ6A 1TPPA 1LHDH 2Z9KA 1TB6H 2EI8A 2H5DA 1O2ZA 1SPJA 3A80A 3A7ZA 2PGQB 3PLKA 1L4ZA 2C93B 1DX5M 4ZHMU 1NBMD 4FU9A 2K8IA 3QN7A 1YY3A 4MNXA 3W95A 1TMTH 3UOPA 1HRTH 1O3HA 3DD2H 2UWOA 1ACBE 2XBWA 1C1SA 4WXVA 1OWEA 4LXBH 2FZZA 4XBCA 1AVGH 2GCTC 5JBBS 1UJ1A 3A8AA 1P2IA 1QL9A 1ORFA 4O9VA 3O8CA 2Z94A 2TGPZ 3RP2A 1DXWA 3ZZ4A 1A46H 1C1QA 3GCHB 4AGKA 2FEQH 4FU7A 1NZQH 1GJ4H 1BMAA 1MTSA 5E0HA 2R2WU 3MI4A 1OP8A 3UQVA 2ZTYA 1BBRH 2WPIS 3SUDA 5C17A 1ESBA 1HJ9A 3JZ2B 4I8LA 1Z6EA 4YLUA 1AE8H 1BRBE 1UTJA 1EP5A 1RTLA 1AB9C 3RXFA 4AB9A 1O3KA 2OLGA 1PQ7A 3E16B 3M3TA 4ZROA 5DN6D 1NRPH 2GCHG 3ATIA 5JB9S 3UREA 5L2YH 4Q2KA 2ZFTA 1ZSKA 1GJ8B 2DE9A 3SORA 3E0NB 4O3TA 4AORA 4YOIA 3RXHA 1MH0A 4IS5A 3EA9A 1EP6A 1AFQB 1O35A 1THRH 2OK5A 2SGEE 1O3EA 3TU7H 1AZZA 1XXFA 4R0IA 1BBRK 2M5TA 3M7UA 3RLWH 2PGBB 3FZDA 5GCHF 1YLDA 1V2LT 1XUJA 2G55A 2ZHFH 1RFNA 3R0FA 4K1TA 1WSSH 3SU4A 4WMEA 4F48B 1GHVH 1YLNA 2Z6BD 8GCHF 4ISNA 1ZPZA 1ZSJA 3QLPH 1NFUA 1P04A 1GBKA 1BHXB 3RXQA 1WV7H 2BOKA 1AD8H 1F7ZA 5FXLA 2BD4A 2QF5A 3HKIB 3MWIU 1FY3A 1QB6A 2Q6GA 1BMFD 1GG6B 2FODA 4X1RU 4ABGA 5T6FA 5FBIA 2F9VA 1FQ3A 3TJUA 3MH4A 6LPRA 3S0NA 3HK3B 1SOZA 4MNWA 1N8OB 4DT4A 4XSKU 1BIOA 1L2EA 5G4BA 3V13A 4NA8A 3MH5A 3EGKH 2VVCA 1GGDC 2BDGA 3QZQA 1GWAA 1SGPE 3RXLA 1SG8B 1C2KA 2P3TB 2TGDA 1PYTD 3SGAE 1GBJA 4X0WU 2VJ1A 1K1NA 1SGNE 1NRQH 1VITF 3EA7A 1HJ8A 1HFDA 1P01A 3PMHB 1ZGVA 2GVFA 3PTNA 1C5QA 1O39A 1A7SA 2P93A 1OHHD 1DITH 3SV6A 4NA9H 1ANEA 3CS7A 1O3MA 6CHAB 4WH8A 3H09A 5GJ4B 5DSFA 1O2YA 2VNTA 3EE0B 1EZXC 2BYAX 2VVUA 1O5GH 2O8MA 1TNIA 2WYJA 1V2PT 5DP7A 1W8BH 1O5CB 2FWWA 3DSGA 1YKTA 4ZKNU 4NWLA 3T62A 3QGNB 1ABIH 2FOBA 1ZRBA 4YESB 3U8OH 1TRYA 2FOAA 4ABDA 1F0TA 1H9IE 2GX4A 1ETRH 4BOHA 3UTUH 3KCGH 3NUMA 2ZGBH 1GPZA 3P95A 2BXTH 4JZFH 5FPSA 2BXUH 4KELA 3D23A 2W5EA 1ESAA 1V2NT 1FNIA 1C5UA 4FUDA 1IQGA 2A1DB 2VBCA 4DGJA 2K1QA 5CHAC 2DUCA 4NIYA 1QRXA 3TNSA 4UONA 2ZZUH 1QY6A 2ZGJA 3ITIA 3PYHA 1BQYA 1D3TB 2Z9LA 3UPEA 1E35B 3KHVA 3GY4A 5A0AE 1G32B 1A5IA 4K69A 1GMHF 4DY7B 3D49H 3U8RH 3URDA 4B6EA 4JZIA 1DSTA 3E1XB 1O2UA 3HGPA 1CSOE 3CNRA 1ZHMA 3TGIE 2Z3DA 1LPKB 2PSYA 1JIRA 4NG9H 3V0XA 2C8XB 2HPQH 2GDDA 3HK6B 2PLXA 1DPOA 2OC7A 5AVDA 2W7UA 3TJNA 4D7FA 1GBEA 1QRWA 1EZQA 3PWCA 2ZG0H 2IJOB 2ZQ1A 1ZMLA 4D7GA 3ESTA 1G2MA 1EPTC 1C5NH 3ZZDA 1S81A 3EAJA 1F5LA 5EW2H 2BQ6B 2Y6TA 3RXRA 1Y3XA 4X2VA 3S9CA 2ZHWH 1GI4A 1GI6A 8KME2 1TGCA 2HNTE 1QGFA 1DFPA 2B7DH 4DW2U 3A86A 3TH2H 2HLCA 2AIPA 2FOHA 2GKVE 3A7TA 2O8WA 3GY6A 3WW7A 5EIYA 1OWIA 1PPHE 1PQAA 5DPAA 1GHWH 2V6NA 3RXGA 4JZ1A 4B73A 3M7TA 3KQCA 3SU3A 4J2YB 2ZTZA 1QA7A 3B23B 3A7WA 3VB4A 1SGCA 5TJXA 3KQEA 2WPDD 1C1VH 1P10A 3GY3A 3SV9A 3TGJE 1GG6C 4Y8YA 1NC6A 1CO7E 5AFZH 5H4IB 1JRTA 1VR1H 1XVOA 3A89A 3OTJE 1HBTH 1T8OA 1XM1A 4TSFD 3HGNA 1GI2A 1SGRE 1GMCG 1RS0A 1ZHPA 4GHQA 4GUXA 5IYTA 2BDCA 4XBBA 1DUEA 3UNSA 1WTHD 3T26A 4X2WA 3KL6A 3RMMH 5A0BA 3F2HA 1TOMH 1LHEH 3LIWA 1C1WH 1NRSH 4RT0A 4WF8A 3PLPA 2ZDNA 4Y8XA 1S84A 1CT4E 1C2JA 2V3HH 1OKXA 2QGRA 2V0BA 2B9LA 1C4Y2 2UUFB 2WPLS 3RMOH 1V2KT 1ZPBA 1OP2A 3S9AA 3K6YA 2FLBH 2ZWLH 2VH0A 4A1XA 1MD8A 2ULLA 3MO9A 2GMTC 2VIVA 1XUGA 2O8UA 5EJ1A 1YCPM 4ZHLU 3T28A 3ZVGA 2OC1A 1C2GA 1KTSB 5ETXA 1GBHA 1O2RA 2DE8A 1TMUH 2ANMH 2FMJA 2OBQA 4BTIB 4JZDH 4A1TA 1AN1E 1MU8B 1NRNH 4Y0YE 3MH6A 1C2HA 3A8DA 1NU9A 4A1VA 2GZ9A 1AIXH 1SGFA 1P3CA 3EYDA 1MCVA 8ESTE 1G37A 1SI5H 1LPGB 4ISLA 3DCLA 3PMBB 1Y8TA 2OQ5A 2VH6A 3LPRA 3T2NA 3E6PH 3GCHC 1MU6B 1O3FA 2H9HA 3A82A 3SJ8A 4TYDA 1TGBA 1BITA 2QN5T 2GV6A 2PTCE 2BD8A 4K1SA 2C4FH 2ASUB 2RCEA 1P2OA 3P6ZB 3MU1A 3ZZCA 1EQ9A 2BDBA 2GCTB 2RFKC 4Y79A 3ATMA 1B5GH 3ELAH 1V2QT 1BZXE 4TPIZ 1QB1A 4AG1A 2KCAA 4I8JA 3H7TA 1ARBA 2FI4E 1TX7A 2V3MA 5C67A 4B71A 1BT7A 1LVBA 3M5OA 3LGTA 1FJSA 3QUMP 2I6QA 4K60A 1GHAF 2QIQA 4FUEA 1CGHA 1MZDA 4WH6A 1UTLM 3QK1A 1O2OA 3RXBA 3UR9A 3TK6A 1C2LA 3FN8A 4BAQB 4X8VH 6ESTA 4YTAA 2ZFRH 2QYIA 1P9UA 3N7OA 4GHTA 4DIHH 1O0DH 4K3JA 5EXNA 4GPGA 1CT0E 1Z1JA 2XBYA 1JXPA 1P02A 1E38B 2Y5FA 1MTNC 4I32A 4MNVA 3STJA 1AHTH 3A84A 2OINA 2QE7D 1ELDE 4ZHAA 1Z8GA 2AH4X 3F68H 1GMHG 1HJAB 2G4UA 1GCTB 2J98B 3T27A 2OC0A 1WQSA 1YPGH 1QB9A 5C1UA 3RC6A 4LZ1H 1O33A 2KM0A 1Z71A 3UR6A 4ZKRU 3P8NA 3OTPA 5JBCS 5GNDA 4AG2A 4XRNA 1C9TA 3SNAA 3P8OA 3WWFA 1EOJA 4CR5A 2Y5HA 1O2GH 1J8AA 1DANH 3PROA 3OYPA 2EI7A 1AVXA 1MAXA 1UHBB 1FV9A 3RXTA 4H6TA 5E8EH 1PPZA 4ABFA 2ZNKH 2P94A 1CBWC 1J15A 3SZEA 4IMZA 4DOQA 3O8RA 2FX6A 1TRNA 2VU8E 1CQQA 1NRRH 1O2JA 1C2IA 4XBDA 3BEIB 1C5SA 3SN8A 1FUJA 3Q3XA 1S82A 5DP5A 4OM9A 4JMYA 5BRRE 1FY8E 3K6ZA 4K5ZA 2QXGA 1QBOA 1H4WA 1D6WA 1HPGA 1LCYA 2XNIA 1BRAA 1P9SA 1EXFA 1JRSA 2CK3D 3BG4C 3SV7A 1UVUH 3P92A 1IQKA 3UWJH 1EB1H 1ZLRA 1GJCB 1O3NA 3A83A 3SNBA 1LHGH 1XKAC 3SU1A 4UFEH 1A61H 3GISB 5L30H 4OS2A 1GBLA 3VB5A 4B2AA 1TFXA 5HM2A 2VIDA 3RC4A 4WXIA 1V2OT 1S5SA 2Y7ZA 1EZUC 2EA3A 2W26A 1NT1A 1GBBA 3PB1E 5HKKD 2F9NA 2QF4A 1CHOG 1O2TA 1TPAE 2BD5A 1CBWB 2ZU4A 3LGUA 2ESTE 3IWMA 2FI5E 1W13U 3QDZB 3R3GB 1GVKB 3RM2H 2BTCE 4U32A 1A5GH 2XRCA 1KYNA 1P09A 1V2UT 4ASUD 3CS0A 2J2UA 5LH8A 5HM9A 1FN6A 1W14U 2BY5X 4GLYA 4A5TS 4FUBA 2PP6A 2NWNA 1IQMA 2HGTH 1XXDA 4JYVH 1LTOA 4CRBA 1JIMA 5IK2D 1FN8A 5GDSH 1V2VT 1W11U 1ELEE 2PKSB 2GJGA 5JPMH 1V2ST 1EFRD 2ZECA 3MMGA 3FP6E 3NPSA 1VJ9U 5C1XA 2H5CA 5DP3A 2A4RA 4RN6A 3L33A 1FDPA 4NA7A 1EAUA 3U98H 4P02A 2JJ1D 1K1JA 1JMOH 2THFB 5FHTA 1C9PA 4TPYA 3HKJB 4KKDA 2VGCB 3P70B 3BEFB 4H42U 4M9FA 1H9LB 1T4VH 4ISIH 3TH4H 1NFYA 3ZVBA 1O2HA 3TJVA 3LH3A 1MD7A 5AF9H 2JH6D 3GYMA 1MCTA 1YM0A 1E0FD 1O5FH 3TPIZ 3ATLA 3TK9A 3TNTA 1C5XB 1WOFA 2ODPA 1GI0A 1MBQA 4AC9A 1HAOH 3PRBA 1LVYA 4TY6A 2XC4A 1D3DB 4BAMB 1UCYH 3ZZ5A 2OC8A 4P00A 9ESTA 1D9IA 2BZ6H 1GI5A 1GBMA 3VG8A 5HYOA 1TGNA 1ZHRA 4FXGH 3LU9B 5FCRA 4CRDA 5ESBA 3RMNH 2D8WA 1QA0A 4AFQA 3NK8A 1DUAA 5HXFA 1ID5H 2SGQE 5KGOA 2A7JA 4X1PU 3FKSD 1IHSH 1DM4B 2BDHA 5C1YA 4ZUHA 3MYWA 1O2KA 1ZR0A 4MPWA 3BIVH 2CGAA 1W3CA 4I8GA 5GIBA 5C2ZA 1AO5A 4OS1A 3VGCB 4AX9H 2C8ZB 2B5TB 3LC3A 4IC5A 4FUJA 1VITG 1BJUA 1GI7B 1BB0B 2BX4A 1GBCA 3KQDA 2A2XH 2VWMA 1WYKA 1EZSC 1BA8B 1Y3WA 1DXPA 2BD9A 1P0SH 1N1LA 2AS9A 1IQLA 1Z8JB 4AGJA 4B6FA 3M61U 2GV7A 1MBMA 2A7CA 1KTTB 2Y7XA 2AIQA
chains in the Genus database with same CATH topology
3AVZA 2ZO3H 1GL0E 3K65B 2VIOA 5ABWA 3SJ9A 1F0UA 1Z8IB 4LOYH 2A7HA 2WPMS 1AI8H 3OSYA 3LGYA 1EB2A 1TPOA 1HAZB 4OS5A 1ETSH 1D3QB 2OTVA 2ZDLA 4CR9A 1UK4A 5GWZA 4BTUB 4AFSA 2J95A 1PYTC 2NU1E 1C5RA 4CREA 1TBRH 1BTHH 1WTGH 3SJKA 2D1JA 2F9PA 1S85A 2A31A 1SQTA 1ZYOA 1BTXA 2R0LA 3ZVFA 2XBXA 2IPHA 3M5MA 3PTBA 4AZ2B 5EXLA 1ZTKA 1G3EA 2PR3A 1C1UH 7ESTE 2BD2A 5FCKA 1EASA 3D65E 5EGMA 4BTTB 3A85A 1OOKB 1K1IA 3GDVA 4BNRA 3A87A 1P05A 2PHBA 1SLUB 1NESE 2HALA 1SGIB 2UWLA 2XCFA 3FANA 3SGQE 4WMDA 1LKBA 2FXRA 1QBNA 1YPKH 1DSUA 2BD3A 1AQ7A 2W7SA 3VGCC 1O2MA 1V2MT 4INLA 5C3NA 2XWBI 3ZYDA 1SSXA 1KIGH 1QQ4A 1SGFG 2ZIQH 2G5VA 2FS8A 1N6XA 4B2BA 2VB0A 1FPCH 2ILNA 3U9AH 2A4GA 2ZPSA 3PO1B 2PWXA 5CHAB 4GSOA 3L6PA 2CHAB 3U1JB 1CHGA 1ZRKA 3LJOA 1CGJE 5L2ZH 1AWHB 5A8YA 7GCHG 2UWPA 3PWBA 4Z6AH 3A7VA 1W7XH 1KXEA 1MMJN 1V2RT 4KTSA 1T8LA 2PKSC 4CRFA 5A0CA 1YPHE 3OY6U 1K1LA 4UEHH 1OS8A 4K1EA 2SNWA 1K1PA 1P2KA 1SB1H 3LOXA 3K2UA 2BLQA 2VGCC 4HI3A 4B75A 3S7KB 2XC0A 5A8ZA 1HB0B 3D62A 3F9FA 4F49A 1TRMA 1FAKH 2R3YA 3M36A 4DCDA 4JZEH 4ZKSU 2ZA5A 1G9IE 4OGYA 1XUIA 2WPJS 3T29A 1N8OC 1EAXA 3ZVDA 5E2OA 1UMAH 2GT7A 3MU4A 4I33A 5JDUB 4IC6A 1XX9A 1ANBA 3ZZBA 1BTWA 4YT7H 1Y3VA 4X6OA 2BM2A 1TNJA 3BTHE 1VJAU 3FFGA 1O3LA 1BMNH 1OYQA 2B0FA 1Y3UA 2IN2A 1VGCB 2ZQ2A 4I31A 2PUXB 1B0EA 1FY4A 3FAOA 4X8UH 2XXLA 1DVAH 2BHGA 1L1JA 3BTFE 1O3AA 3MTYA 1MQ5A 2P8OC 2ALVA 2QC2A 4PROA 5EQSA 1HAGE 1UK3A 3LONA 3F6UH 1VITH 4Q7ZA 4U01A 2FX4A 1KSNA 3SOSA 4ABIA 3S9BA 3SJOA 1AKSB 2AEIH 1QIXB 2ZDAH 3M7QA 2F91A 4JYTA 1GBDA 2A0QB 3E8LA 1SGDE 3QGJA 4BXSA 4GCHG 1C1MA 3NKKA 5BPEA 2LNCA 2Z3CA 4WMFA 3SV2H 4YT6H 2ZI2H 4YOGA 1BRUP 1MTNB 2FOGA 4JCNA 1W10U 3GYLB 1FXYA 1ZPCA 1O2XA 3BTQE 4ZAEA 2JH5D 3SUGA 4HZHA 1DICA 2VINA 4O03A 1LHCH 2TGAA 3E3TA 1SLVB 3BTDE 3FP7E 5HGGA 2QA9E 1GCTC 1O2VA 2BX3A 3O8DA 4Y6DA 3B8JA 3BG8A 2AERH 5TCCA 2G52A 3DFLA 1PQ8A 3IITA 2BMGB 5JYIA 1XUKA 1SGEE 3SNCA 1EOLA 1W2KH 1T4UH 1RXPA 1AFQC 1W12U 1Y59T 1L1NA 1CGIE 3NZIA 3SU0A 1HIAB 1OSSA 3BV9B 3SU5A 1OXGA 1EX3A 9LPRA 1EUFA 1MTWA 5T6DA 1YF4A 4Y8ZA 1EAIA 5EXMA 2W3IA 1AZ8A 1YC0A 2V35A 5F6MA 1Z7KA 1A0JA 3AAVA 2CF9H 1OWKA 1IOEA 4Z0KA 1O2IA 1ETTH 2YNBA 4CH8B 3FZZA 4KTCA 1UVOA 1WUNH 1O34A 2JH0D 1UVSH 4JK5A 4OS7A 1O5BB 3RXAA 2A5KA 3UWIA 2FPZA 2VIQA 2PKAA 3DFJA 1H8IH 2ZGCA 2ZC9H 1YPHC 3KF2A 1HXEH 3S69A 4DJZB 3UUZA 3LKWA 4VGCC 1FONA 1RIWC 1TBQH 5FX5A 2QF3A 2BZAA 1BTZA 4LZ4B 5LPEA 1E34B 2TIOA 1HAVB 2G00A 3Q76A 1HYLA 2SGFE 1O31A 1S83A 1BTYA 1BJVA 5DP6A 3MNSA 3MNCA 5JB8S 2G5NA 2ZKSA 2HPPH 3P8GA 4H6SB 1NPMA 3ZVEA 4CHAC 1SHHB 1TQ7B 3SBKA 1SBWA 1LQEA 1AU8A 2FI3E 1J16A 2TRMA 1ESTA 2VVVA 3VB3A 2BVRH 2CN0H 4FUIA 1FIWA 4K8YA 1HXFH 2FTMA 3GOVB 2Z9IA 5I46H 3F1SB 4X8SH 3BG4B 3RM0H 1Y5UT 3RUOA 1NS3A 3ZV9A 2FYRA 5AFYH 2I6SA 1ZJDA 1ELFA 3VFEA 3M3SA 1GMDF 2P3UB 3TVJB 1TE0A 2R3UA 1E36B 4ESTE 3HPTB 1TAWA 3RC5A 1UO6A 4UFDH 1P2JA 1O36A 4MPVA 2VWOA 1FIZA 4ISHH 4A6LA 1Q31A 4ZMAH 1AY6H 2XCNA 4A7IB 1C5YB 3M5NA 1OYTH 3RXIA 3BN9A 1C5PA 1O2NA 2HNTC 3F9GA 2OXSA 1TMBH 3RU4E 5L6NH 1BUIA 1YPLH 2Q6FA 2C8YB 3K9XB 2P16A 3AW0A 4X1SU 2CF8H 4YM9A 5IDKA 1C2MA 2FESH 1C5MD 2PKAB 2P8OB 3P17H 2AGIX 2JETC 1C1NA 1BHXF 1CA0B 1GJDB 4IN2A 4MG3A 5FX6A 6GCHG 1WQVH 3CP7A 4D8NA 5JBAS 3V3MA 1A1RA 4R8TB 4DVAU 1ZTJA 4MNYA 1O37A 3RLYH 2WYGA 4XDEA 1SFIA 1RTFB 3SZNA 3VPKA 1C5ZB 1G3DA 3LC5A 3JZ1B 2SFAA 3MNXA 3EA8A 4O3UA 2R9PA 1GHBF 3KNXA 4AYVB 2ZDKA 1TX8A 3MOCA 2Q6DA 3RXKA 3RXVA 3G01A 5E0GA 3MHWU 4MQAA 1J17T 1QNJA 4OS4A 3QTVH 2OCVB 1IQFA 1GBFA 2A4QA 3BTTE 1K1OA 1XVMA 1TALA 1BRCE 1MTVA 1LDTT 3PO1C 3LT3A 1CU1A 2WV5A 4M7GA 2XC5A 3SGBE 3URCA 1SC8U 2TGTA 1Q3XA 4ASHA 1WAYB 4Q7YA 5DG6A 2FS9A 2ZHEH 2F9UA 1O5AB 3E0PB 3ODFA 3M35A 4CRCA 1WBGB 1MZAA 4CRGA 4UFFH 2FYQA 4IW4E 3UQOA 1GMDG 2XTTB 4ABAA 1OP0A 1YGCH 1T8NA 2Q1JA 1D3PB 3VXEH 1BMLA 2A2QH 4ABJA 1O2PA 4OS6A 1MKXH 1P2QA 1G3BA 1HAIH 1THPB 3BTME 3DT0H 2P3FH 2HVXA 1EPTA 1GJ6A 1P03A 3SHCH 4YOJA 1W0YH 2FDAA 2GMTB 4X8TH 2ZCKP 4OGXA 3T25A 1O3IA 2VWLA 1GHXH 2ZDVH 4AOQA 4NWKA 1Y5BT 1T32A 1GJ7B 2STAE 3SUFA 1ELTA 3DHKH 4WY3A 1GI1A 4IGDA 3AW1A 1O2WA 5B6OA 3IG6B 5EW1H 1GCDA 4Q80A 3ZVAA 2BOHB 1GHYH 3TLOA 1MKXK 1FZZA 1X7AC 3F9HA 1F5KU 1EAWA 2GZ8A 1QQUA 3RXPA 1BOQA 1ELAA 2BB4A 3ATWA 3BTKE 3Q00A 3GCNA 1MKWH 2B8OH 3RXUA 3NWUA 3T5FH 1T8MA 2FP7B 1GHZA 4UFGH 2FOCA 3STIA 1O32A 1Y3YA 3LH1A 1EJAA 1C1PA 3BIUH 1WCZA 3VB7A 1F0SA 2ZFFH 2ZU5A 5K7RA 3FVFB 1IAUA 3ZVCA 1LKAA 3U69H 1DLEA 1BMMH 1ZZZA 4Y11E 3NXPA 2Y5GA 2QXHA 1CA0C 5EPYA 1O3CA 5SGAE 1MKWK 2PW8H 1C4V2 3GCTG 4ABHA 2AGEX 1C2DA 1O2QA 3LJJA 5LGOA 4SGAE 2G51A 2A4OA 4X6NA 1L4DA 1O38A 1U6QA 4DT7B 1TLDA 2O8LA 1BDAA 1TNKA 1V2WT 4IMQA 1C5WB 2HRVA 2ZGHA 3PV4A 3BEUA 5J4QA 1NO9H 1MTUA 4Y10E 3UNQA 1G30B 1O3BA 1PPGE 1HV7A 1HGTH 2BY6X 2QF0A 1LVOA 3SNDA 1O5DH 4FVBA 1IQJA 1NM6A 2PUQH 4E7NA 2Z9GA 1IHTH 2QCYA 4Y71A 4LK4A 3BTEE 4RSPA 5F8XA 2QV1A 1BCUH 4K2YA 4AN7A 1YP9A 3RXDA 1GJAB 1YPJH 4F4OC 1S6HA 3GCOA 5LPRA 4RKOB 1SGYE 1UTNA 1RRKA 3ZZAA 2F9BH 4J1YA 2BDYA 5DGJA 2ZPQA 1O2LA 1PQ5A 2OUAA 2G4TA 2QY0B 5DP9A 4NSVA 3NCLA 1LPZB 3QZRA 1LVMA 1ZTLA 4NSYA 2JKHA 1AB9B 2GCHF 2RA3A 1A4WH 3LGVA 1DS2E 1F2SE 4AYYB 1A2CH 1CVWH 2O8TA 1DWCH 1GI3A 1RIWB 2H1UA 3MU5A 1GHBG 5I25A 1IQEA 2HOBA 1FY5A 2OBOA 2KAIB 4MVNA 2Z9JA 4E06H 2FOEA 3RXEA 1ZJKA 3MFJA 2HWLB 1LHFH 1K22H 2BLVA 4CHAB 1AE5A 1CT2E 1C5OH 1SQAA 1C5VA 1YYY1 3U8TH 4ABEA 1AMHA 2O9QA 3TK5A 3GY7A 2BD7A 3OX7U 2LPRA 2ODYB 1NU7B 2J9NA 1Z1IA 5DP4A 2Z7FE 1GVLA 1PPBH 3H5CB 2WUBA 5EOKA 2WPKS 2QAAA 1SLWB 3I78A 4U2WA 5EQQA 1KLIH 5E2PA 4MLFB 1S0RA 1A0LA 1HIAA 2F3CE 1UCYK 5A2MH 1ELVA 2BDIA 2PSXA 2NU0E 3A7XA 5C5NA 4X1NU 1SLXB 4THNH 1OWHA 2BDAA 4FU8A 2HNTF 5ESTE 3KGPA 3GY8A 3RDZA 4YO9A 1P2MA 5GCHG 4ZXYH 4NIWA 1TYNA 2BY7X 3AAUA 1AFEH 4TWWA 1KXFA 1TA2A 3TJOA 1YPMH 4ZH8A 1TIOA 2UUJB 3QWCH 1ZSLA 3GDSA 1DLKB 3I77A 1NTPA 2BQWB 1GDQA 2RG3A 1PPCE 3ENSB 1KY9A 1GBTA 2ODQA 4I8HA 1C2EA 1J9CH 4BXWA 2A45B 2C8WB 3E90B 4BANB 5T3HA 4Y76A 4HFPB 3CENA 5GXPA 1A5HA 2UUKB 1AGJA 2IOTA 2OD3B 1YPEH 3UIRA 4X2XA 1L0ZA 2CXVA 1ZMJA 2UUYA 4AFUA 2H2ZA 4BAOB 1PJPA 2BLWA 1SMFE 4UD9H 1C2FA 2RDLA 4GCHF 4JK6A 2ANWA 4D9RA 4FUCA 5CE1A 1B0FA 4MTBA 1ANDA 1HAHH 2ZEBA 5LPFA 1G3CA 1XKBC 4D9QA 2SNVA 1DOJA 1EJMA 1GI8B 4HTCH 1ELCA 1VCWA 1XUHA 3A7YA 3KIDU 3PMAB 1YCPK 4BAHB 2D26C 3V12A 1A0HB 4E7RG 3RXCA 1Y5AT 3KN2A 1GJ9B 1A3EH 1F92A 1VCPA 1CHOF 4FVDA 1J14A 1LQDB 2W3KA 5C20A 5EQRA 1P3EA 1TNLA 2NU2E 1DDJA 2Y81A 4MPXA 4NZQA 3Q77A 3VXFH 2R2MB 2BVSH 5EODA 1C1RA 1CE5A 4YLQH 5JBTA 3GCTF 4AB8A 4KP0A 2WV4A 4CBOA 3BSQA 8LPRA 1YCPH 2C90B 4A92A 4FUFA 4CBNA 3Q3YA 3RXJA 1D6RA 1HJAC 1NY22 2H9TH 1FLEE 2A5AA 1V2JT 2NU4E 2SGPE 2OQUA 5GPIB 1DWBH 1IQNA 1TBZH 4DURA 1TNHA 4ZXXH 3SJIA 4B74A 1UTMA 3MNBA 4HGCA 1O3PB 1SR5C 4JYUH 1V3XA 2RA0A 3RU4T 2PTNA 1ZMNA 2CJIA 4FUGA 2CHAC 3UNRA 2H9EH 1C5TA 2FOFA 1OWDA 1FPHH 2BVXH 3W94A 1KXDA 1HCGA 1KDQB 3F9EA 1UVPA 1VZQH 1RJXB 1B7XB 2ZCHP 2GDEH 4IBLH 3VB6A 3WY8A 7LPRA 2SGDE 1GDUA 1AVWA 4X2YA 4Y0ZE 2J94A 5FPTA 5CMXH 1NROH 1HDTH 3LDXH 2G81E 1EKBB 1QJ6B 4YZUA 2GP9B 1ARCA 2GZ7A 2J4IA 1ELBA 1C5LH 1K28D 1DT2A 1DY8A 1RTKA 3P8FA 2ZFPH 2BY9X 1NFXA 2GTBA 1UHBA 2GD4B 3A88A 2ZU1A 1Q2WA 3FP8E 2ANKH 3TGKE 4CRAA 3BTGE 5EU8A 3SHAH 1A3BH 1KLJH 5A8XA 2ZHQH 4D76A 1MAYA 1T31A 1GHAG 4MDSA 1PPFE 4KGAA 1TQ0B 1TA6A 2EEKA 1QJ7B 1T7CA 2ALPA 3SW2B 3B9FH 5C5OA 4DIIH 1QR3E 1S6FA 4ZKOU 4TY7A 2WPHS 1QBVH 1O3DA 2G8TA 1JOUB 1HAYB 1N6YA 1G36A 4RKJB 4GAWA 1THSH 2KAIA 2AYWA 2STBE 1HLTH 3C1KA 1LO6A 1TX6A 1W0ZU 3M37A 3LGWA 2P59A 2ZP0H 5TCAA 2Z3EA 4NCYA 1FMGA 4CH2B 1TNGA 1C1TA 1UCYE 2C3SA 3ZV8A 3I29A 3M5LA 4U30A 2TPIZ 1EPTB 3ODDA 5F8TA 1IQIA 2ZGXH 1P2NA 3DA9B 2BQ7B 3KEEA 2AGGX 2XYAA 1PPEE 1O3OA 3O8BA 3C27B 1VCQA 1XMNB 1BBRE 1F0RA 2R0KA 4Q7XA 3ZZ3A 3GY5A 2XW9A 3M3VA 2XBVA 5AHGH 5A09A 5FPYA 4NFFA 5DP8A 3GY2A 2J92A 4GVUA 1RD3B 3ATKA 2ZF0H 1SGTA 2ZFSA 5DK1A 1UTQA 1DWDH 4I8KA 1D4PB 1QRZA 1UTOA 3A8BA 4I7YH 1UTKA 1O3JA 1ZGIA 2F83A 3SI3H