3M3TA

Sars-cov main protease monomeric arg298ala mutant with n-terminal additional residues (gly-ser)
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
307
structure length
307
Chain Sequence
GSSGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRKSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKFYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVAQCSGVTF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3C-like proteinase
publication title SARS-CoV main protease with N-terminal extension regulated by mutation on C-terminal domain
rcsb
source organism Sars coronavirus
molecule tags Hydrolase
total genus 74
structure length 307
sequence length 307
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2010-03-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1840.10 Mainly Alpha Orthogonal Bundle main proteinase (3clpro) structure, domain 3 main proteinase (3clpro) structure, domain 3 3m3tA03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3m3tA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3m3tA02
3A85A 3EA9A 1O3DA 2XXLA 1MTNC 2QF3A 1GDUA 4R8TB 1WV7H 1EASA 4WH8A 1K1LA 1ELGA 2B7DH 3LU9B 1CSOE 2A7HA 4YOGA 1HJ8A 2PTCE 2VVUA 1ZTKA 3OTJE 2QY0B 3C1KA 1BITA 3RUOA 1YPMH 1S0QA 1XUFA 2OC1A 3ZYDA 3GDUA 1YPJH 1O5CB 2PW8H 4K8YA 3UQOA 3MO3A 1P3CA 2XCNA 3OU0A 2AYWA 1AKSB 4ZHLU 1BRBE 2FWWA 3PB1E 3SJIA 4CRGA 4ZHMU 1QURH 2Z7FE 1ZHPA 5CE1A 1E38B 3GY3A 3SU1A 1AVGH 1G9IE 1G30B 2ZFRH 3T29A 1TBRH 2OUAA 3SUGA 1ZPCA 5GXPA 1CE5A 4MPUA 4B2CA 1MCVA 1O33A 4FUGA 3KIDU 5LPEA 3BN9A 4ZXXH 3QDZB 2P3FH 5EU8A 3DUXH 1CGIE 2J2UA 2FTMA 3E3TA 4MG3A 2XBVA 3F9FA 1FIZA 4K69A 1EPTB 2EEKA 3OX7U 1PQ7A 2G4UA 1C2HA 3RMLH 1Q3XA 3ZVAA 4E7NA 1HAGE 3O8CA 1DLEA 2Y82A 3CS7A 4U01A 2CHAB 3BTDE 1O2YA 5ABWA 2PTNA 2WPJS 3M37A 2YNAA 3RXRA 1EAIA 5EOKA 1O36A 3ATKA 1AMHA 2CGAA 4FUFA 1TMUH 1VGCB 4WMEA 3FP8E 1MTVA 2W7UA 1TQ7B 3RMNH 1C1WH 2P16A 1THRH 5L2ZH 2UWLA 3CS0A 1GI0A 2AMQA 4I8JA 3GCTG 1HAHH 1UTKA 2W26A 3SU2A 3ZVFA 1V2QT 1K21H 4MLFB 2BVRH 3EA8A 1CA8B 1L4DA 4DJZB 3MWIU 5A2MH 1SG8B 1O3OA 3STIA 2G52A 1QB1A 2G4TA 4YESB 1V2WT 1SL3A 2A45B 3ELAH 1NFYA 3L3TA 3U1JB 2XWAA 1O2OA 3RC6A 4DOQA 2ZGJA 2FODA 2GCTB 1QGFA 3MNCA 2R9PA 1Y5AT 1DICA 1BCUH 3SGAE 4NSVA 3SJ8A 4CH8B 1OP2A 6CHAB 2A7JA 1MU6B 3TPIZ 3A86A 3BTWE 1KLJH 3SV6A 4FVDA 4RKOB 4X1NU 3U9AH 3NKKA 3T62A 3QK1A 1TNGA 1LVMA 1A1RA 4UFDH 1C1RA 3TK5A 1ZPBA 4ZUHA 3E0PB 2Y5HA 2BM2A 1EAXA 6LPRA 4Z0KA 5DP7A 1MZDA 1V2VT 2A0QB 1C5YB 1FN6A 4JMYA 1D9IA 3SI4H 1Q2WA 3FZZA 4O3UA 3SV9A 2D8WA 5JB8S 3SHAH 3P8OA 4DG4A 7KMEH 8KME2 1GBTA 2W7SA 1Y3WA 2TPIZ 1DPOA 1ELEE 2GMTC 5EODA 5EW2H 1F5RA 3VB6A 4Y11E 4X6NA 1NPMA 1ZOMA 1AGJA 4K1TA 1QTFA 3PYHA 4B76A 4Q7ZA 4RSPA 1GHYH 1K28D 1KXBA 3ZVCA 4FUHA 1BOQA 2C93B 1LQEA 3MOCA 1LPZB 3A84A 1T32A 1Y3UA 2VIVA 3F9EA 1MZAA 2ZTYA 3Q77A 2ZFFH 4I8HA 3E0NB 3SGBE 7LPRA 1QIXB 2YOLA 1IQHA 3GY5A 1UJ1A 4WMFA 1YCPM 1W10U 5L6NH 4FUEA 1GBBA 1SGEE 5GJ4B 3F9GA 5E8EH 1QFKH 4I8GA 1XXDA 2PUQH 1AZZA 3U98H 1MTSA 1EQ9A 1GBMA 4H42U 1LHFH 3Q76A 4NSYA 1LKAA 1QJ7B 1ELVA 2ASUB 5A8YA 1GCTC 1TA6A 2EC9H 2FI3E 1J8AA 1WTHD 4MDSA 1JMOH 4MVNA 2Y5GA 4A5TS 4I33A 4D8NA 2GVFA 1CVWH 1E34B 3GCHC 2R2MB 3ZZBA 4CRDA 1P9SA 3GOVB 1BTYA 1FXYA 1BRCE 1O3FA 2ZU3A 2UUFB 4UDWH 1S6HA 4WVPE 4WY3A 2ZU5A 2O8TA 4PROA 1YPLH 1ZTJA 3BTFE 4CHAB 2ODYB 4Y8YA 3A8DA 4THNH 4BOHA 1Z8RA 3M36A 1LKBA 1C2DA 3P95A 1BMNH 3RXDA 1GMHG 4MPVA 1FLEE 2R2WU 1E35B 2SGQE 1AFEH 2PWXA 1OS8A 2J9NA 1MAYA 4GAWA 5EPYA 1N8OC 1BTXA 5HM9A 1NC6A 5H4IB 4NIVA 1ZGIA 1F5LA 3IWMA 1AQ7A 2BY6X 4BNRA 3JZ1B 1KXAA 2ZFSA 4UFGH 4BXSA 5JYIA 1GHXH 4K2YA 5DP8A 2BY9X 1F0RA 4AB8A 1O2VA 1YP9A 1S84A 2IN2A 3RXVA 2ZCLP 1FAXA 1TGNA 1PQ8A 8LPRA 1O5BB 2ZP0H 2FLRH 3MU5A 1C5UA 1RRKA 5JBBS 4ZHAA 3BTME 2FS8A 1YM0A 2ULLA 4FUCA 1S81A 2VGCC 1GI7B 2XWBI 1KYNA 2A2QH 3A7YA 1NROH 4K8BA 1BJUA 1P2OA 4INLA 2JKHA 2RG3A 1TWXB 3EYDA 1GJBB 1RJXB 2OQUA 2ZTXA 2G81E 4ABAA 4H6TA 3HPTB 2FESH 4GCHG 4SGAE 1TGCA 5DG6A 9ESTA 4GLYA 1RTKA 4KTSA 2XBYA 1EATA 3MNBA 1OWDA 1ANEA 2AEIH 4JZEH 1O32A 1GGDB 2D26C 3DFLA 3SQEE 3RXBA 1ELCA 4WMDA 2FOFA 2QGRA 4I7YH 2JETB 2Z9JA 2F9NA 2DUCA 3PMHB 4I32A 4X1QU 5JBCS 3OY5U 4OS5A 5AFZH 1V2MT 1ZGVA 4NFFA 2J95A 3SNEA 1P05A 1TNJA 5E0JA 5DO4H 1UHBA 4I8LA 2B8OH 4HI3A 1YC0A 4K5ZA 4XFQA 2BOKA 2Q6DA 2FI5E 4JZIA 3RXJA 1V6DA 1C2LA 4IS5A 5AF9H 1A5IA 1AWFH 2PV9B 5FBEA 1FNIA 5E0GA 3IG6B 1YPGH 2ZU4A 2WV4A 2NU4E 3T27A 2Z9KA 4ZAEA 2H2ZA 4ABJA 1NM6A 1P57B 4TY6A 2NU3E 2ODQA 1BTUA 4TPIZ 1V2PT 3SUEA 2K7XA 3RXGA 4U30A 1PYTD 2ZGBH 1KTSB 1DM4B 1SMFE 1QL7A 4UD9H 1SPJA 3F6UH 1Z8JB 2GGVB 3VGCB 1GCDA 3ZZ9A 3BEFB 4OS4A 5F8XA 1B5GH 1XUGA 2Y80A 3A7ZA 1ZSKA 1GWAA 2BLQA 3LOXA 1C5TA 4KGAA 2G00A 4YLUA 4CREA 3UOUA 1WTGH 1HIAA 4MPXA 4OS1A 4XBCA 3LKWA 4TY7A 1C9PA 2VH0A 3NUMA 3RXAA 4IBLH 2W5EA 4XE4A 1ZSLA 3NCLA 1C5MD 1IQGA 1FQ3A 3C27B 3UNRA 3LC5A 2ZQ1A 1A3EH 4MNXA 1YPKH 1VITG 3GYLB 4X1SU 3EGKH 4OS2A 4X8UH 1O2NA 3LGYA 2WPIS 3ZZ5A 1P2NA 3FANA 5I46H 4WXIA 3RXMA 4ABDA 1W13U 3SV8A 4AN7A 5FCKA 1HAVA 3FAOA 1TPAE 2ZU1A 3LPRA 3A7VA 1CU1A 4ZKOU 1PJPA 1A7SA 2PGQB 3MU1A 2BQWB 1QQ4A 2G5NA 1THSH 4NWLA 5DK1A 2OINA 1PQAA 1AVXA 1C2JA 2BDHA 1BBRK 4BANB 5E0HA 1WQSA 1S0RA 1BBRH 2C8WB 3A83A 2SGPE 4O03A 5C1YA 4GHQA 2P8OC 1DDJA 5FX5A 1O3CA 2ZGXH 1TLDA 5F03A 3LDXH 2A1DB 2IJOB 3ESTA 1C2EA 2BXUH 1ELBA 3A81A 2HPQH 2PKAA 1V2UT 1ANDA 1O2JA 1YPEH 2M5TA 1BT7A 3CP7A 3CENA 4DURA 1BMLA 2C8ZB 2FOBA 3SU5A 2VWMA 3E90B 3SUDA 1TNKA 1Z1IA 2NU2E 1HXEH 1D3QB 2BTCE 1EJMA 4IC6A 1ZR0A 1ZMJA 3S7HB 4SGBE 1CO7E 4X2XA 2C4FH 4ZKNU 5GCHF 1GHAF 3LIWA 1A0HB 1AWHB 1PPZA 1AB9C 2BY5X 6GCHG 3LONA 4ZROA 1S5SA 4BTTB 1YBWA 2G51A 1MKWK 2UUYA 3SU0A 1HBTH 1DFPA 3MNSA 2ZDVH 1MKWH 2Y7ZA 3ZZCA 3LC3A 3AW0A 3V3MA 2VU8E 4MNVA 5A0AE 1L1GA 2HPPH 1CA0B 2Z94A 1GI4A 1HJ9A 5GIBA 1P0SH 1CHOF 4F49A 3B8JA 3KF2A 1LHEH 1P3EA 1NFUA 1SLVB 4BTIB 2VIDA 1GHBG 5HYOA 2Y5FA 1SVPA 1PPGE 4Y7AA 5L2YH 4NZQA 2UWOA 3ZZ8A 2GDDA 4D7GA 2FYQA 2THFB 1PFXC 1N6YA 2BX3A 1BA8B 2FS9A 4IMQA 1QB6A 1SGRE 3HGPA 1GBEA 1GJ6A 2A32A 1LCYA 2H9EH 1O2IA 3SORA 1C2KA 3TJNA 3M7UA 1TX7A 4FXGH 1XM1A 2Z9IA 1S6FA 3UOPA 3QX5H 3RXOA 1UVSH 2FOCA 1UTLM 2ZDLA 5EG4A 1UTJA 2BY8X 1ZZZA 1GJDB 3QTVH 3MHWU 1QR3E 2AH4X 2WPKS 1SLXB 4OGXA 3RXTA 1O3GA 1JRSA 4FUJA 1SGIB 1O2MA 1VJ9U 1O3BA 9LPRA 3RU4D 2QXGA 1ZRKA 3UREA 2FEQH 2Z3CA 2I6QA 3Q3YA 5JDUB 2SGFE 1KLTA 4X1PU 1EPTC 3GY4A 2GV7A 3SW2B 2QF0A 1GBAA 2TGDA 1MD8A 1RD3B 3M3SA 1GI6A 2ZPQA 3BTQE 2C8XB 1P2QA 2D1JA 1O0DH 2F83A 2UUKB 2ZFQH 3KL6A 3OYPA 3V12A 1NESE 1DWEH 1ARBA 1O3IA 1O30A 1BRAA 1O2ZA 3NPSA 3I29A 3RC4A 2BD7A 3SJKA 4GUXA 1IQKA 1TPOA 2SGAA 1TB6H 2OP9A 1YPHE 3QZRA 5FPYA 4K3JA 2AS9A 4YM9A 3M5LA 3T25A 1VITH 1FY3A 2HGTH 1T4VH 2FOMB 3U8OH 4X8TH 3AAUA 4Y8XA 3SNCA 4ISOA 1ZSJA 1CBWB 3R3GB 1FY4A 2O8WA 2ZDNA 1THPB 2Z3EA 1O2HA 2ZDKA 3BF6H 1GL1A 1F5KU 2PLXA 2GCTC 2ZCHP 2STAE 1RTFB 5HXFA 2ZZUH 1Y5UT 4DT7B 3GICB 2ZA5A 4CR5A 4YT6H 5DKMA 5TCAA 1Y5BT 4YLQH 5EXMA 1TPSA 1GHVH 2QV1A 2ANMH 3Q00A 1GJ9B 1TMBH 1H9IE 3B23B 1DWCH 2KAIA 4KTUA 7ESTE 3FZDA 5LPRA 1MTNB 1C5NH 2BQ7B 1ELTA 1KXCA 4X1RU 5JBTA 1O5GH 3GCTF 3M61U 5FHTA 4NCYA 1C2IA 2AMDA 2TGTA 2ZIQH 1B0EA 1ZMLA 1G3BA 4YOJA 1OYTH 3I77A 1MD7A 3LGTA 5TJXA 1C4Y2 1GJ8B 3MI4A 1HJAB 4JK5A 2ZHEH 1U6QA 1NRNH 4TPYA 1BDAA 1QL8A 1UVPA 4MNWA 4JYUH 1MKXK 1O3PB 2ZPRA 1HAZB 1SI5H 2WUCA 2VB0A 4AFSA 1LVBA 1JOUB 1W8BH 4ZMAH 1MKXH 1GVZA 3MTYA 2OC8A 2J92A 2XCFA 5CHAB 4DIHH 1IQFA 1O2UA 2HWLB 1T4UH 2BY7X 3RXKA 4B71A 1HUTH 1F7ZA 4J1YA 1ZYOA 5BRRE 2OXSA 1NRQH 1C5PA 1QL9A 1DX5M 1MCTA 3E8LA 1NY22 1UTQA 5DP4A 1G36A 3A8AA 1SQOA 1J17T 1ZJDA 2ZI2H 5TCCA 4IMZA 3ZZ3A 4NIYA 2WYJA 1B0FA 1BB0B 2A4GA 3UY9A 1O5EH 1EAUA 1BBRE 3I78A 2XNIA 1KLIH 2XTTB 1ZHMA 1TBQH 1EB1H 2ZO3H 1NO9H 2VH6A 5AVDA 3E91A 2QAAA 2EI6A 1CT4E 4HTCH 4RKJB 2ZNKH 1K9OE 1WBGB 1K1IA 3BIUH 5DPAA 1PPFE 1FZZA 2ZHWH 2HRVA 2F9OA 3ZVGA 1O3KA 3T5FH 4ZH8A 2OC7A 1V3XA 2BLOA 2VVVA 5ESTE 2SGDE 3TH2H 3EAJA 2RA0A 1HFDA 2Y81A 4YZUA 3TJVA 5F8ZA 2V3OH 3HK3B 5T3HA 1CT0E 1ACBE 1TAWA 3BTTE 3ITIA 1P9UA 1EZXC 1V2RT 1O3HA 4I31A 1V2KT 4Y0ZE 1FAKH 5DP9A 1BUIA 3HKJB 1LPGB 4A1VA 1HAVB 4XOJA 3ZZ7A 8GCHF 1AFQC 3MH6A 1Z8IB 2P93A 4ZKSU 1GBIA 2B9LA 1TNHA 2OBQA 4LK4A 3QLPH 3H5CB 3OY6U 1F2SE 3TNTA 4ABIA 4Q2KA 2O8MA 3VFEA 4HGCA 3EQ0H 5AFYH 2C3SA 1TONA 1E36B 4K1EA 3BIVH 1C4V2 4X0WU 1T8OA 2JH5D 4FUBA 1FUJA 1J15A 1TMTH 1BJVA 3TGIE 2OLGA 2ZEBA 3FP6E 3BG4B 4OS6A 1TOCB 4IW4E 3S69A 3A87A 3UUZA 5A09A 1P2KA 1P2IA 1MBMA 3SQHE 2BOHB 5G4BA 3ENSB 1HB0B 4Y0YE 2BVSH 1BTPA 1V2TT 1SLUB 1GMHF 2XC0A 1D3DB 4ZXYH 1P04A 4IN2A 1HAPH 3GY8A 4X2YA 3TK9A 3SHCH 1UK4A 3TGJE 4R0IA 5FBIA 5A8XA 2H5DA 2ZHQH 1EP5A 3ZZ6A 3RU4E 1GDNA 1HAYB 1O3AA 2EI8A 4CRBA 2ZGCA 1AN1E 1TX6A 2FPZA 2P3UB 3TH3H 5EQQA 1KSNA 5JPMH 5L30H 2AERH 5C1XA 1GMCF 4BAQB 1QY6A 1OXGA 3P17H 2O8LA 1GVLA 1YPHC 5B6OA 1QA0A 2PHBA 4MQAA 1J9CH 1NZQH 2JETC 3PTNA 2WPMS 3ODFA 2FP7B 4ISNA 1GBKA 4NFEA 2BD8A 4NZLA 1L1NA 1RXPA 2V3HH 3K2UA 4CBOA 4K1SA 3UIRA 1ID5H 4NGAH 2BYAX 1HLTH 2ESTE 1GCTB 3MFJA 1J14A 1PYTC 1TX8A 1AUTC 3F68H 5K0HA 2WPHS 1GHZA 1PPBH 1Y3XA 2BLVA 3LGUA 3ZZ4A 3VB3A 2P94A 1L1JA 1LDTT 5JB9S 1GHWH 3PMBB 2GP9B 1DS2E 1GI1A 2BD2A 1VCQA 1GPZA 4GCHF 1D4PB 3LGWA 1UMAH 1G32B 2O8UA 3QGNB 4D7FA 1ZHRA 2Y6TA 3SJ9A 4ISIH 4ABGA 1FI8A 4JYTA 3VGCC 1B7XB 3JZ2B 1GJ4H 4CRCA 3D65E 1P06A 4CR9A 2Q6FA 1C1PA 1T31A 1ZMNA 1C1MA 2BDBA 4CH2B 3SU3A 2ANWA 4RN6A 1N8OB 3RXCA 5LGOA 5EXLA 2BDYA 1QJ6B 1S85A 3V7TA 2VWLA 2PUXB 1ANBA 1YF4A 2ZGHA 4IC5A 2QA9E 4WXVA 3TJUA 3BTHE 2AMPA 1UVTH 1SQTA 3T2NA 1DWBH 4KKDA 3RDZA 5GWZA 4O97A 2A2XH 1HRTH 1TYNA 1VZQH 2PKSB 4FUIA 3RXIA 1NFXA 4TYDA 3BTGE 2EA3A 5C5NA 1IQJA 2J94A 1E37B 1GJAB 3MO6A 1K1MA 3A8CA 3HKIB 1DVAH 2Z3DA 3PMAB 2FDAA 2VGCB 1D3TB 1BQYA 1T8MA 4B75A 4U32A 3U8RH 3SV7A 1AE5A 1BTZA 1Z7KA 2G8TA 5FPTA 2ANKH 1PQ5A 1UO6A 3E16B 1TNIA 1IOEA 5DJ7A 3P6ZB 1FY5A 1A5HA 3MO9A 4B2AA 1Y59T 3STJA 1XKAC 3RC5A 1O2SA 2XC4A 1ARCA 1EX3A 2PR3A 1EOJA 5AHGH 1QHRB 4ESTE 2GZ9A 3BG8A 1JIMA 2CF8H 2CF9H 1FY8E 3BSQA 3RMOH 2VINA 4D76A 1W12U 7GCHF 1YKTA 4X6PA 3D49H 2OCVB 2KAIB 4Y6DA 1XVMA 1VITF 2W3IA 1SB1H 4JK6A 4O3TA 3H7TA 4NG9H 1F0SA 1OWEA 4GHTA 1AI8H 1NFWA 1AIXH 4NA8A 2LIZA 2PFEA 4X8SH 1BRUP 1TRMA 1LHGH 4U2WA 1O3LA 1Z6EA 1ESBA 3GDVA 5FCRA 3RXPA 2FX4A 1GG6B 2ZWLH 3ZVDA 1SR5C 2FM2A 3M5MA 5EQSA 1DITH 1C2MA 1MTUA 2R3YA 3RXFA 1K1PA 3LH3A 2O9QA 4E06H 1GI3A 2R3UA 1FPHH 4DW2U 4JCNA 4NIXA 2BDIA 3LJOA 3W95A 3MMGA 4ISLA 1GMDG 5HGGA 1H1BA 3U8TH 2QXJA 5C5OA 5DP6A 3QZQA 2A5AA 4K60A 3BV9B 2WV5A 1GDQA 1V2NT 1MUEB 1C5ZB 1H8DH 3A8BA 4NA7A 1C4U2 4B1TA 3TGKE 4B73A 2ZF0H 3GCNA 4VGCC 4AYYB 4JZFH 3Q3KA 1OX1A 1IQEA 1GBDA 4AGJA 5E2PA 2GZ7A 4XDEA 3UTUH 4AOQA 4NWKA 1BHXB 1LTOA 1LHCH 4UFEH 2ZDAH 3F1SB 3PROA 1C1UH 1SGQE 1G2LA 1JWTA 1XUIA 5BPEA 3VXEH 1P09A 2WUBA 1FDPA 1FIWA 3M7TA 2J38A 1BTHH 1LHDH 1W3CA 2BB4A 2BMGB 2R0KA 2TRMA 1QQUA 4F4OC 3TK6A 1PPHE 1KDQA 4D9RA 1VCWA 4IGDA 1CQQA 1QRZA 1GHAG 4Y7BA 2YNBA 5ETXA 4GVUA 1TA2A 2FOAA 1ZTLA 1GHBF 1GL0E 3ZV9A 2VIWA 2FOHA 1C5VA 4QT8C 5T6FA 2BHGA 4YT7H 1QRXA 4X6OA 1EZSC 4X2WA 2FMJA 2H9HA 2ZFPH 1MBQA 1ETRH 1ZLRA 1OOKB 2SGEE 1CHOG 3KGPA 1C5OH 2NWNA 1RIWB 1C1VH 1FV9A 3TH4H 5C3NA 1EZQA 1ESAA 1AO5A 3SU6A 1S82A 3M5NA 2IOTA 1ABIH 2WINI 3TNSA 4UFFH 4YOIA 3DD2H 3RLYH 1A0JA 1BMAA 3GISB 1CBWC 2BDCA 1C1QA 1QRWA 1CGHA 1GBHA 4WJG2 3RM0H 5FAHA 3SOSA 3MU0A 2C90B 5T6DA 2OD3B 1UCYK 2Y7XA 1BTWA 4I8KA 3TJOA 2GT7A 3A88A 3S9AA 1UCYH 1WOFA 1KIGH 2C8YB 2GCHG 4H4FA 2BD9A 3ATWA 1AB9B 8ESTE 4NA9H 3PMJA 1Q31A 3UWIA 1OKXA 4ISHH 4E05H 4AZ2B 3URDA 5JBAS 3KQCA 2V6NA 1TQ0B 2LPRA 2CJIA 4AGKA 2CHAC 3RU4T 1FY1A 1IQNA 3AAVA 3GY2A 1H8IH 1TNLA 2FYRA 2TGPZ 3O8BA 1IAUA 5DP3A 1VGCC 3ZYEA 3D62A 4AFUA 3P92A 4AORA 4INHA 3ATLA 5A8ZA 3K65B 2BXTH 2FOEA 3ZV8A 3S0NA 2HOBA 1UTMA 1VR1H 2F91A 2VVCA 1M9UA 4FU7A 3VB4A 1BIOA 1DLKB 1OP8A 5C20A 3ATIA 1FN8A 1MU8B 5LH8A 1DUAA 3PO1B 4BAMB 1BMMH 1FONA 1HJAC 1Z8GA 1NTPA 2VWOA 1F0TA 1QBVH 3LJJA 3QTOH 3T28A 3UNQA 1IQLA 2CV3A 4KP0A 3ZVBA 1G3CA 1YCPK 2BD4A 1ZPZA 3MU4A 4ZKRU 3IITA 1YCPH 3T26A 4JZ1A 5CHAC 1C5QA 2Q1JA 4Q7XA 6CHAC 4OGYA 2B0FA 4A7IB 1ETTH 3LT3A 1EZUC 1QA7A 2GZ8A 1SGDE 2V35A 4A92A 3W94A 4TWWA 1C9TA 4BXWA 4B74A 1A4WH 1H4WA 5C1UA 1TGTA 3PV4A 4ABFA 3N7OA 1C5LH 1W7XH 5DGJA 1MMJN 4Q80A 1LMWB 1XXFA 2XRCA 5SGAE 1SGNE 3VXFH 1HNEE 2BLWA 1RGQA 1E0FD 4GSOA 1ANCA 3L6PA 1SFQB 3FVFB 2ODPA 2GX4A 3UWJH 1K1NA 2BD5A 2ILNA 3A80A 1P10A 1Z1JA 1L4ZA 1UK3A 1NRRH 2HALA 3ZZAA 5J4QA 1DANH 3QO6A 2ZQ2A 3PTBA 1TABE 1NS3A 3KEEA 4X6MA 1UHBB 3HGNA 1J16A 2QCYA 3KN2A 1GJCB 4A6LA 2P3TB 1GJ7B 1XVOA 5T6GA 3TLOA 3EA7A 2SFAA 1JIRA 1HV7A 2DE8A 1FMGA 1AHTH 2B5TB 2BDAA 1PPCE 4X2VA 5HMAA 1T7CA 2GKVE 1O2QA 3SJOA 5PTPA 3VB5A 3H7OA 2H9TH 2LNCA 1O2XA 4OS7A 4X8VH 2A31A 4ABHA 5DP5A 3PLBA 2WYGA 1ABJH 4JYVH 1LVOA 1P11E 3DA9B 3GY7A 6ESTA 2AIQA 2FOGA 1KXFA 1O38A 1QCPA 2ZHDA 3PWBA 1SFIA 1KY9A 4FU9A 1O3MA 2F9BH 2GDEH 5IDKA 1LO6A 3SV2H 1SOZA 1LPKB 1EJNA 3ZVEA 1P8VC 1O3EA 3RXQA 3DHKH 4UE7H 1HIAB 1DXPA 2ALPA 3QUMP 4GPGA 1P12E 1MTWA 1TOMH 1TGBA 1O3NA 1T8LA 4O9VA 1ESTA 2BDGA 4BTUB 2H5CA 1DSTA 4Z6AH 4KTCA 1WU1A 3VB7A 1ORFA 3BG4C 3A7WA 2UWPA 1Z6JH 2AGIX 3AASA 3M35A 4LXBH 1O5DH 1F92A 1SGFA 2CXVA 2J4IA 4CHAC 1SLWB 1HYLA 3NZIA 5E2OA 1SGPE 1TPPA 1IQMA 2GTBA 1HAIH 1Y3VA 1T8NA 2FX6A 4LZ1H 2AGEX 1W0YH 2BQ6B 2AIPA 2H6MA 3UPEA 1DY8A 3TVJB 3L33A 3PLPA 1NT1A 1EAWA 1H9HE 2RDLA 3MH7A 3V0XA 1EUFA 4LZ4B 4TWYA 2AFQB 1GI9B 4ASHA 3OSYA 1RS0A 3M7QA 1TFXA 1WAYB 3Q3XA 3U1IB 3P8GA 1P2MA 4UONA 1VJAU 1SBWA 5GDSH 2FZZA 2STBE 1EB2A 2WPLS 5F8TA 5C2ZA 3QGJA 4ABBA 8GCHG 2BVXH 3V13A 3BTEE 2XW9A 1UK2A 3KQDA 1AD8H 1C5SA 2UUJB 1QBOA 2PKAB 1JBUH 3SGQE 3ZZDA 2RA3A 3SO3A 3BEUA 3TITA 3GYMA 3M5OA 1FPCH 1AY6H 2VWNA 2ZTZA 3SUFA 2AGGX 3ATMA 2GMTB 4AB9A 3NXPA 1TBZH 3P8NA 3UNSA 1XKBC 5ESBA 1OSSA 1EP6A 4FUDA 4E7RG 2ZC9H 2OBOA 1ETSH 1K22H 4D9QA 3RXUA 3UR6A 2D2DA 3O8RA 2NU1E 5F6MA 1RTLA 1P03A 1GGDC 4B2BA 4Y8ZA 2FI4E 3A7TA 1OPHB 2R0LA 5EPNA 1UCYE 3PM3A 1KDQB 1GI8B 1D6WA 1SHYA 3NWUA 1WYKA 2VIPA 1OYQA 1O37A 2A7CA 1KXDA 2HNTE 4AX9H 1AFQB 1EKBB 1V2LT 4Y71A 1AKSA 1CHGA 2GV6A 1GMCG 2HLCA 3K6YA 2TGAA 1KXEA 2ZU2A 1BZXE 2BZ6H 1DSUA 1DXWA 2V0BA 2K1QA 3A89A 1A2CH 3EBNA 1BHXF 1HPGA 2JH0D 1A3BH 1OWKA 3S7KB 1YLCA 2PKSC 3GCHB 2Q6GA 4INKA 4FVBA 2GT8A 5FXLA 5LPFA 3RXEA 1AUJA 1W14U 3S9BA 1C5WB 1HAXB 4WF8A 1L0ZA 4HFPB 4BAKB 2PSYA 1GI5A 1O31A 2SNWA 1RFNA 4FU8A 4YTAA 2A4QA 1C5RA 1NN6A 3HATH 1MQ5A 2ZPSA 1G3EA 2OC0A 3RP2A 3GCOA 1EPTA 2NU0E 4MPWA 1TE0A 2EI7A 1SGFG 2TBSA 3RMMH 4CBNA 2A5KA 1C1SA 1O34A 2I6SA 2P59A 4LOYH 1O5AB 1TRYA 2BD3A 2ZCKP 1C2FA 1C1OA 4NIWA 4Y10E 1IHSH 3KHVA 1ELFA 1N6XA 1TRNA 5K7RA 1P02A 1UVUH 1NU7B 3DT0H 1QBNA 4WH6A 3AW1A 2QIQA 5HM2A 1HCGA 1HAOH 1WCZA 2OTVA 1F0UA 2ALVA 2FLBH 1ELAA 1AZ8A 1SSXA 1WSSH 1SC8U 3QWCH 2ZDMA 2F3CE 4DCDA 1DT2A 1C2GA 1CT2E 5I25A 3SNBA 3KCGH 4HZHA 4J2YB 2GD4B 3SN8A 1D6RA 2A5IA 1GBFA 1DOJA 4WWYA 1O5FH 1GVKB 2VNTA 1G2MA 2FTLE 4A1TA 1XX9A 1ELDE 2BZAA 4MNYA 2CN0H 4Q7YA 3S9CA 2Z9LA 1GJ5H 1OWJA 1GG6C 1IHTH 3BEIB 2Z9GA 5A0CA 2HNTF 1Y3YA 4Y76A 2F9UA 4DGJA 3BTKE 1VCPA 2P95A 3KQBA 1W7GH 1O2WA 1XUHA 4IN1A 3URCA 1W2KH 1OWHA 2A4RA 1K1JA 3UFAA 5EW1H 1UTOA 4CRFA 1NRSH 3RM2H 3NK8A 2F9VA 1XUJA 2Z6BD 1SGTA 4JZDH 3MH5A 3VPKA 1EXFA 1SGYE 3P8FA 2J34A 2F9PA 2ZECA 1K1OA 4AG2A 1C1TA 1V2JT 1TGSZ 1QNJA 1O2LA 2JH6D 3UR9A 1GBJA 1L2EA 5C67A 2PGBB 1WUNH 4XBBA 1O2GH 3SI3H 1P01A 1A61H 3MNXA 1N1LA 7GCHG 1ZRBA 3QN7A 5EQRA 1SHHB 1O2RA 5J4SA 2RCEA 1C1NA 1PPEE 3AVZA 1C5XB 2XYAA 3SBKA 5FPSA 3R0FA 4DVAU 3A82A 5IYTA 1UTPA 1XUKA 4H6SB 2FO9A 3U69H 2PSXA 1Y8TA 5EXNA 1CA0C 3HK6B 3MYWA 1MAXA 1GMDF 1TIOA 1YLDA 1D3PB 3EDXB 4Y79A 4AFQA 4A1XA 2SNVA 3P70B 1UVOA 3A7XA 3ODDA 1HXFH 1W11U 3F9HA 3TIUA 1GBLA 3B9FH 2QXHA 3M3VA 1RIWC 3FP7E 1AVWA 4BAOB 3PLKA 4KELA 2G55A 2QYIA 3VEQB 1NRPH 1OWIA 3TU7H 2HVXA 1INCA 4AFZA 1WQVH 2QN5T 1CGJE 6GCHF 1K2I1 3K6ZA 2ANYA 1A46H 3KQEA 3LH1A 2BX4A 3E6PH 1MQ6A 1HDTH 1O3JA 3RXSA 1YGCH 1GBCA 1HGTH 1DE7H 1QB9A 1EJAA 1A0LA 3FFGA 2ZG0H 2IPHA 3UQVA 1LQDB 3SNAA 3G01A 5GCHG 1O35A 2VIOA 2XBXA 4YO9A 2HNTC 4CRAA 1JXPA 1P2JA 2CMYA 2H1UA 1G37A 1DUEA 2VJ1A 2ZFTA 1AE8H 1TALA 2XBWA 1W0ZU 3K9XB 3LGVA 3RLWH 3MH4A 3SNDA 1SGCA 5GPIB 1JRTA 3M3TA 1XMNB 2P8OB 4XBDA 1SOTA 1O2TA 3PWCA 4AG1A 5A0BA 3D23A 2G5VA 1AU8A 1DWDH 3SZNA 5FX6A 3SU4A 1LVYA 2ZKSA 2W3KA 1S83A 1FJSA 1G3DA 2DE9A 5CMXH 1UTNA 1QJ1B 3GDSA 3E1XB 2A4OA 3EE0B 1IQIA 3KNXA 1A5GH 4UEHH 3WY8A 4VGCB 2QXIA 3PO1C 3O8DA 3DFJA 3MU8A 1MH0A 1H9LB 1O2PA 1Z71A 1O39A 4DIIH 2XC5A 4AYVB 2ZHFH 2TIOA 2FXRA 1EOLA 1KTTB 2FIRH 2GCHF 4ABEA 1GI2A 1V2OT 5EGMA 3LGIA 4M7GA 4BAHB 1YYY1 1SQAA 2VIQA 1OP0A 4DY7B 4XSKU 1X7AC 3RXHA 1ZJKA 1V2ST 3GY6A 1DY9A 2QC2A 3RXLA 4MTBA 1NU9A 1O2KA 2OQ5A
chains in the Genus database with same CATH superfamily
3A85A 3SZEA 3EA9A 1O3DA 1WDIA 2XXLA 1MTNC 2QF3A 1GDUA 4R8TB 1WV7H 3DCLA 1EASA 4WH8A 1K1LA 1ELGA 2B7DH 3LU9B 1CSOE 2A7HA 4YOGA 1HJ8A 2QE7D 2PTCE 2VVUA 1ZTKA 3OTJE 2QY0B 3C1KA 1BITA 3RUOA 1YPMH 1S0QA 1XUFA 2OC1A 3ZYDA 3GDUA 1YPJH 1O5CB 2PW8H 4K8YA 3UQOA 3MO3A 1P3CA 1FX0B 2XCNA 3FKSD 2AYWA 1AKSB 3OU0A 4ZHLU 1BRBE 4YXWD 2FWWA 3PB1E 3SJIA 4CRGA 4ZHMU 1QURH 2Z7FE 1ZHPA 5CE1A 1E38B 3GY3A 3SU1A 1AVGH 1G9IE 1G30B 2ZFRH 3T29A 1TBRH 2OUAA 3SUGA 1ZPCA 5GXPA 1CE5A 4MPUA 4B2CA 1MCVA 1O33A 4FUGA 3KIDU 5LPEA 3BN9A 4ZXXH 3QDZB 2P3FH 5EU8A 3DUXH 1CGIE 2J2UA 2FTMA 3E3TA 4MG3A 2XBVA 3F9FA 1FIZA 4K69A 1EPTB 2EEKA 3OX7U 1PQ7A 2G4UA 1C2HA 3RMLH 1Q3XA 3ZVAA 4E7NA 1HAGE 3O8CA 1DLEA 2Y82A 3CS7A 4U01A 2CHAB 3BTDE 1O2YA 5ABWA 2PTNA 2WPJS 3M37A 2YNAA 3RXRA 1EAIA 5EOKA 1O36A 3ATKA 1AMHA 2CGAA 4FUFA 1TMUH 1VGCB 4WMEA 3FP8E 1MTVA 1YLNA 2W7UA 1TQ7B 3RMNH 1C1WH 2P16A 1THRH 5L2ZH 2UWLA 3CS0A 1GI0A 2AMQA 4I8JA 3GCTG 1HAHH 1UTKA 2W26A 3SU2A 3ZVFA 1V2QT 1K21H 4MLFB 2BVRH 3EA8A 1CA8B 1L4DA 4DJZB 3MWIU 5A2MH 1SG8B 1O3OA 2J97A 3STIA 2G52A 5DN6D 1QB1A 2G4TA 4YESB 4B6EA 1V2WT 1SL3A 3DSGA 2A45B 3ELAH 1NFYA 3L3TA 3U1JB 2XWAA 1O2OA 3RC6A 4DOQA 2ZGJA 2FODA 2GCTB 1QGFA 3F2HA 3MNCA 2R9PA 1Y5AT 1DICA 1BCUH 3SGAE 4NSVA 3SJ8A 4CH8B 1OP2A 6CHAB 2A7JA 1MU6B 3TPIZ 3A86A 3BTWE 1KLJH 1UW7A 3FOAA 3SV6A 4FVDA 4RKOB 4X1NU 3U9AH 3NKKA 3T62A 3QK1A 1TNGA 1LVMA 1A1RA 4UFDH 1C1RA 3TK5A 1ZPBA 4ZUHA 3E0PB 2Y5HA 2BM2A 1EAXA 6LPRA 4Z0KA 5DP7A 1MZDA 1V2VT 2A0QB 1C5YB 1FN6A 4JMYA 1D9IA 3SI4H 1Q2WA 3FZZA 4O3UA 3SV9A 2D8WA 5JB8S 3SHAH 3P8OA 4DG4A 7KMEH 8KME2 1GBTA 2W7SA 1Y3WA 2TPIZ 1DPOA 1ELEE 2GMTC 5EODA 5EW2H 1F5RA 3VB6A 4Y11E 4X6NA 1NPMA 1ZOMA 1AGJA 4K1TA 1QTFA 3PYHA 4B76A 4Q7ZA 4RSPA 1GHYH 1K28D 1KXBA 3ZVCA 4FUHA 4RI0A 1BOQA 2C93B 1LQEA 3MOCA 1LPZB 3A84A 1T32A 1Y3UA 2VIVA 3F9EA 1MZAA 2ZTYA 3Q77A 2ZFFH 4I8HA 3E0NB 3SGBE 7LPRA 1QIXB 2YOLA 2WHXA 1IQHA 3GY5A 1UJ1A 4WMFA 1YCPM 1W10U 5L6NH 4FUEA 1GBBA 1SGEE 5GJ4B 3F9GA 5E8EH 1QFKH 4I8GA 1XXDA 2PUQH 1AZZA 3U98H 1MTSA 1EQ9A 1GBMA 4H42U 1LHFH 5HIZA 3Q76A 4NSYA 1LKAA 1QJ7B 1ELVA 2ASUB 5A8YA 1GCTC 1TA6A 2EC9H 2FI3E 1J8AA 1WTHD 4MDSA 1JMOH 4MVNA 2Y5GA 4A5TS 4I33A 4D8NA 2GVFA 1CVWH 1E34B 3GCHC 2QF5A 2R2MB 3ZZBA 2WZQA 4Q63A 1P9SA 3GOVB 4CRDA 1BTYA 1FXYA 1BRCE 1O3FA 2ZU3A 2UUFB 4UDWH 1S6HA 4WVPE 4WY3A 2ZU5A 1YWUA 2O8TA 4PROA 1YPLH 1ZTJA 4ZCNA 3BTFE 4CHAB 2ODYB 4Y8YA 3A8DA 4THNH 4BOHA 1Z8RA 3M36A 1LKBA 1C2DA 3P95A 1BMNH 3RXDA 1GMHG 4MPVA 1FLEE 2R2WU 1E35B 2SGQE 1AFEH 2PWXA 1OS8A 2J9NA 1MAYA 4GAWA 5EPYA 1N8OC 1BTXA 5HM9A 1NC6A 5H4IB 4NIVA 1ZGIA 1F5LA 3IWMA 1AQ7A 2BY6X 4BNRA 3JZ1B 1KXAA 2ZFSA 4UFGH 4BXSA 1VKYA 5JYIA 1GHXH 4K2YA 5DP8A 2BY9X 1F0RA 4AB8A 1O2VA 1YP9A 1S84A 2IN2A 3RXVA 2ZCLP 1FAXA 1TGNA 1PQ8A 8LPRA 1O5BB 2ZP0H 2FLRH 3MU5A 1C5UA 1RRKA 5JBBS 4ZHAA 3BTME 2FS8A 1YM0A 2ULLA 4FUCA 1S81A 2VGCC 1GI7B 2XWBI 1KYNA 2A2QH 3A7YA 1NROH 4K8BA 1BJUA 1P2OA 4INLA 2JKHA 2RG3A 1TWXB 3EYDA 1GJBB 1RJXB 2OQUA 2ZTXA 2G81E 4ABAA 4H6TA 3HPTB 2FESH 4GCHG 4SGAE 1TGCA 5DG6A 9ESTA 4GLYA 5IK2D 1RTKA 4KTSA 2XBYA 1EATA 3MNBA 1OWDA 1ANEA 2AEIH 4JZEH 1O32A 1GGDB 2D26C 3DFLA 3SQEE 1OHHD 3RXBA 1ELCA 4WMDA 2FOFA 2QGRA 4I7YH 2JETB 2Z9JA 2F9NA 2DUCA 3PMHB 4I32A 4X1QU 5JBCS 3FO8D 3OY5U 4OS5A 5AFZH 1V2MT 1ZGVA 4NFFA 2J95A 3SNEA 1P05A 1TNJA 5E0JA 5HIYA 5DO4H 1UHBA 4I8LA 2B8OH 4HI3A 1YC0A 4K5ZA 4XFQA 2BOKA 2KR7A 2Q6DA 2FI5E 4JZIA 3RXJA 1V6DA 1C2LA 4IS5A 5AF9H 1WXRA 1A5IA 1AWFH 3OFND 2PV9B 5FBEA 1FNIA 5E0GA 3IG6B 1YPGH 2ZU4A 2WV4A 2NU4E 3T27A 2Z9KA 4ZAEA 2H2ZA 4ABJA 1NM6A 1P57B 4TY6A 2NU3E 2ODQA 1BTUA 4TPIZ 1V2PT 3SUEA 2K7XA 3RXGA 4U30A 1PYTD 2ZGBH 1KTSB 1DM4B 1SMFE 1QL7A 4UD9H 1SPJA 3F6UH 1Z8JB 2GGVB 3VGCB 1GCDA 3ZZ9A 3BEFB 4OS4A 5F8XA 1B5GH 1XUGA 5KECA 2Y80A 3A7ZA 1ZSKA 1GWAA 2BLQA 3LOXA 1C5TA 4KGAA 2G00A 4YLUA 2OK5A 3KYGA 4CREA 2KCOA 3UOUA 1WTGH 1HIAA 4MPXA 4OS1A 4XBCA 3LKWA 4TY7A 1C9PA 2VH0A 3NUMA 3RXAA 4IBLH 2W5EA 4XE4A 1ZSLA 3NCLA 1C5MD 1IQGA 1FQ3A 3C27B 1COWD 3UNRA 3LC5A 4ASUD 2ZQ1A 4XRNA 1A3EH 4MNXA 1YPKH 1VITG 3GYLB 4X1SU 3EGKH 4OS2A 4X8UH 1O2NA 3LGYA 2WPIS 3ZZ5A 1P2NA 3FANA 1MABB 5I46H 4WXIA 3RXMA 4ABDA 1W13U 3SV8A 4AN7A 5FCKA 1HAVA 3FAOA 1TPAE 2ZU1A 3LPRA 3N7EA 3A7VA 1CU1A 4ZKOU 1PJPA 1A7SA 2PGQB 3MU1A 2WPDD 2BQWB 1QQ4A 2G5NA 1THSH 4NWLA 5DK1A 2OINA 1PQAA 1AVXA 1C2JA 2BDHA 2KFWA 1BBRK 4BANB 5E0HA 1WQSA 1S0RA 1BBRH 2C8WB 3A83A 2SGPE 4O03A 5C1YA 4GHQA 2P8OC 1DDJA 5FX5A 1O3CA 2ZGXH 5C0UA 1TLDA 5F03A 3LDXH 2A1DB 2IJOB 3ESTA 1C2EA 2BXUH 1ELBA 3A81A 2HPQH 2PKAA 1V2UT 4Q4LA 1ANDA 1O2JA 1YPEH 2M5TA 1BT7A 3CP7A 3CENA 4DURA 1BMLA 2C8ZB 2FOBA 3SU5A 2VWMA 3E90B 3SUDA 1TNKA 1Z1IA 2NU2E 1HXEH 1D3QB 5C94A 2BTCE 1EJMA 4IC6A 1ZR0A 1ZMJA 3S7HB 4SGBE 2KCAA 1CO7E 4X2XA 2C4FH 4ZKNU 5GCHF 1GHAF 3LIWA 1A0HB 1AWHB 1PPZA 1AB9C 2BY5X 5GNDA 4FOUC 6GCHG 3LONA 4ZROA 1S5SA 4BTTB 1YBWA 2G51A 1MKWK 2UUYA 3SU0A 1HBTH 1DFPA 3MNSA 2ZDVH 1MKWH 2Y7ZA 3ZZCA 3LC3A 3AW0A 3V3MA 2VU8E 4MNVA 5A0AE 1L1GA 2HPPH 1CA0B 2Z94A 1GI4A 1HJ9A 5GIBA 1P0SH 1CHOF 4F49A 3B8JA 3KF2A 1LHEH 1P3EA 1NFUA 1SLVB 4BTIB 2VIDA 1GHBG 3KYFA 5HYOA 2Y5FA 1SVPA 1PPGE 4Y7AA 5L2YH 4NZQA 2UWOA 3ZZ8A 2GDDA 4D7GA 2FYQA 2THFB 1PFXC 1N6YA 2BX3A 1BA8B 2FS9A 4IMQA 1QB6A 1SGRE 3HGPA 1GBEA 1GJ6A 3UAIC 2A32A 1LCYA 2H9EH 1O2IA 3SORA 1C2KA 3TJNA 3M7UA 1TX7A 4FXGH 1XM1A 2Z9IA 1S6FA 3UOPA 3QX5H 3RXOA 1UVSH 2FOCA 1UTLM 2ZDLA 5EG4A 1UTJA 2BY8X 1ZZZA 1GJDB 3QTVH 3MHWU 1QR3E 3N99A 2AH4X 2WPKS 1SLXB 4OGXA 3RXTA 1O3GA 1JRSA 4FUJA 1SGIB 3SYJA 1O2MA 1VJ9U 1O3BA 3U28C 9LPRA 3RU4D 2QXGA 1ZRKA 3UREA 2FEQH 2Z3CA 2I6QA 2WV9A 3Q3YA 5JDUB 2SGFE 1KLTA 4X1PU 1EPTC 3GY4A 2GV7A 3SW2B 2QF0A 1GBAA 2TGDA 1MD8A 1RD3B 3M3SA 1GI6A 2ZPQA 3BTQE 2C8XB 2XOKD 1P2QA 2D1JA 1H8ED 1O0DH 2F83A 2UUKB 2ZFQH 3KL6A 3F0OA 3OYPA 3V12A 1NESE 1DWEH 1ARBA 1O3IA 2JIZD 1O30A 1BRAA 2QF4A 2W6JD 1O2ZA 3NPSA 3I29A 3RC4A 2BD7A 3SJKA 4GUXA 1IQKA 1TPOA 2SGAA 1TB6H 2OP9A 1YPHE 3QZRA 5FPYA 4K3JA 2AS9A 4YM9A 3M5LA 3T25A 1VITH 1FY3A 2HGTH 1T4VH 2FOMB 3U8OH 4X8TH 3AAUA 4Y8XA 3SNCA 2LELA 2KCPA 4ISOA 2PP6A 1ZSJA 1CBWB 3R3GB 1FY4A 2O8WA 2ZDNA 1THPB 2Z3EA 1O2HA 2ZDKA 3BF6H 1GL1A 1F5KU 2PLXA 2GCTC 2ZCHP 2STAE 1RTFB 5HXFA 2ZZUH 1Y5UT 4DT7B 3GICB 2ZA5A 4CR5A 4YT6H 3NRLA 5DKMA 5TCAA 1Y5BT 4YLQH 5EXMA 1TPSA 1GHVH 2YMSB 2QV1A 2ANMH 3Q00A 1GJ9B 3OEED 1TMBH 2F4LA 1H9IE 3B23B 1DWCH 2KAIA 4KTUA 7ESTE 3FZDA 5LPRA 1MTNB 1C5NH 2BQ7B 1ELTA 1KXCA 4X1RU 5JBTA 1SKYE 1O5GH 2YMSD 3GCTF 3M61U 5FHTA 4NCYA 5EJLA 1C2IA 2AMDA 2TGTA 2ZIQH 1B0EA 1ZMLA 1G3BA 4YOJA 1OYTH 3I77A 1MD7A 3LGTA 5TJXA 1C4Y2 1GJ8B 3MI4A 1HJAB 4JK5A 2ZHEH 1U6QA 1NRNH 4TPYA 1BDAA 1QL8A 1UVPA 4MNWA 4JYUH 1MKXK 1O3PB 2ZPRA 1HAZB 1SI5H 2WUCA 2VB0A 4AFSA 1LVBA 1JOUB 1W8BH 4ZMAH 1MKXH 1GVZA 4P00A 3MTYA 2OC8A 2J92A 2XCFA 5CHAB 4DIHH 1IQFA 1O2UA 2HWLB 1T4UH 2BY7X 3RXKA 4B71A 1HUTH 1F7ZA 4J1YA 1ZYOA 5BRRE 2OXSA 1NRQH 1C5PA 1QL9A 1DX5M 1MCTA 3E8LA 1NY22 1UTQA 5DP4A 1G36A 3A8AA 1SQOA 1J17T 4TT3D 1ZJDA 2ZI2H 5TCCA 4IMZA 3ZZ3A 4NIYA 2WYJA 1B0FA 1BB0B 2A4GA 3CNRA 3UY9A 1O5EH 1EAUA 1BBRE 3I78A 2XNIA 1KLIH 2XTTB 1ZHMA 1TBQH 1EB1H 2ZO3H 1NO9H 2VH6A 5AVDA 3E91A 2QAAA 2EI6A 1CT4E 4HTCH 4RKJB 2ZNKH 1K9OE 1WBGB 1K1IA 3FN8A 3BIUH 5DPAA 1PPFE 1FZZA 2ZHWH 2HRVA 2F9OA 2J98A 3ZVGA 1O3KA 3T5FH 4ZH8A 2OC7A 1V3XA 2BLOA 2VVVA 5ESTE 2SGDE 3TH2H 3EAJA 2RA0A 1HFDA 2Y81A 4YZUA 3TJVA 5F8ZA 3PV2A 2V3OH 3HK3B 5T3HA 1CT0E 1ACBE 1TAWA 3BTTE 3ITIA 1P9UA 1EZXC 1V2RT 1W0KD 1O3HA 4I31A 1V2KT 4Y0ZE 1FAKH 2XNDD 5DP9A 1BUIA 3HKJB 1LPGB 4A1VA 1HAVB 4P02A 4XOJA 3ZZ7A 8GCHF 1AFQC 3MH6A 1Z8IB 2P93A 4ZKSU 1GBIA 2B9LA 1TNHA 2OBQA 4TSFD 4LK4A 3QLPH 3H5CB 3OY6U 1F2SE 3TNTA 4ABIA 4Q2KA 2O8MA 3VFEA 4HGCA 3EQ0H 5AFYH 2C3SA 1TONA 1E36B 4K1EA 3BIVH 1C4V2 4X0WU 1T8OA 2JH5D 4FUBA 1FUJA 1J15A 1TMTH 1BJVA 3TGIE 2OLGA 2ZEBA 3FP6E 3BG4B 4OS6A 1TOCB 4IW4E 3S69A 3A87A 3PRBA 3UUZA 5A09A 2AHME 2RFKC 1P2KA 1P2IA 4FETA 1MBMA 3SQHE 2BOHB 5G4BA 3ENSB 1HB0B 4Y0YE 2BVSH 1BTPA 1V2TT 1SLUB 1GMHF 2XC0A 1D3DB 4ZXYH 1P04A 4IN2A 1HAPH 3GY8A 4X2YA 3TK9A 3SHCH 1UK4A 3TGJE 4R0IA 5FBIA 5A8XA 2H5DA 2ZHQH 1EP5A 3ZZ6A 3RU4E 1GDNA 1HAYB 1O3AA 2EI8A 4CRBA 2ZGCA 1AN1E 1TX6A 2FPZA 2P3UB 3TH3H 5EQQA 1KSNA 5JPMH 5L30H 2AERH 2V7QD 5C1XA 1GMCF 4BAQB 1QY6A 1OXGA 3P17H 2O8LA 1GVLA 1YPHC 1NBMD 5B6OA 1QA0A 2PHBA 4MQAA 1J9CH 1NZQH 2JETC 3PTNA 2WPMS 3ODFA 2FP7B 4ISNA 1GBKA 4NFEA 2BD8A 4NZLA 1L1NA 1RXPA 2V3HH 3K2UA 4CBOA 4K1SA 3UIRA 1ID5H 4NGAH 2BYAX 1HLTH 2ESTE 1GCTB 3MFJA 3ZIAD 4DT4A 1J14A 1PYTC 1TX8A 1AUTC 3F68H 5K0HA 2WPHS 1GHZA 1PPBH 1Y3XA 2BLVA 3LGUA 3ZZ4A 3VB3A 2P94A 1L1JA 1LDTT 5JB9S 1GHWH 3PMBB 2GP9B 1DS2E 1GI1A 2BD2A 1VCQA 1GPZA 4GCHF 1D4PB 3LGWA 1UMAH 1G32B 2O8UA 3QGNB 4D7FA 1ZHRA 2Y6TA 3SJ9A 4ISIH 4ABGA 2F43B 1FI8A 4JYTA 3PV5A 3VGCC 1E1QD 1B7XB 5KEDA 3JZ2B 1GJ4H 4CRCA 3D65E 1P06A 4CR9A 2Q6FA 1C1PA 1T31A 1ZMNA 3WW7A 1C1MA 2BDBA 4CH2B 3SU3A 2ANWA 4RN6A 1N8OB 3RXCA 5LGOA 5EXLA 2BDYA 1QJ6B 3KQ5A 1S85A 3V7TA 2VWLA 2PUXB 1ANBA 3F2FA 1YF4A 2ZGHA 4IC5A 2QA9E 4WXVA 3TJUA 3BTHE 2AMPA 1UVTH 1SQTA 3T2NA 1DWBH 4KKDA 3RDZA 5GWZA 4O97A 2A2XH 1HRTH 5B6LA 1TYNA 1VZQH 2PKSB 4FUIA 3RXIA 1NFXA 4TYDA 3BTGE 2EA3A 5C5NA 1IQJA 2J94A 1E37B 1GJAB 3MO6A 1K1MA 3A8CA 3HKIB 1DVAH 2Z3DA 2LP6A 3PMAB 2FDAA 2VGCB 1D3TB 1BQYA 1T8MA 4B75A 4U32A 3U8RH 3SV7A 1AE5A 1BTZA 1Z7KA 2G8TA 5FPTA 2ANKH 1PQ5A 1UO6A 3E16B 1TNIA 1IOEA 5DJ7A 3P6ZB 1FY5A 1A5HA 3MO9A 4B2AA 1Y59T 3STJA 1XKAC 3RC5A 1O2SA 2XC4A 1ARCA 1EX3A 2PR3A 3VG8A 1EOJA 5AHGH 1QHRB 4ESTE 2GZ9A 3BG8A 1JIMA 2CF8H 2CF9H 1FY8E 3BSQA 3RMOH 2V3MA 2VINA 4D76A 1W12U 7GCHF 1YKTA 4X6PA 3D49H 2OCVB 2KAIB 4Y6DA 1XVMA 1VITF 2W3IA 5EJ1A 1SB1H 4JK6A 4O3TA 3H7TA 4NG9H 1F0SA 1OWEA 4GHTA 1AI8H 1NFWA 2W6ID 1AIXH 4NA8A 2LIZA 2PFEA 4X8SH 1BRUP 1TRMA 1LHGH 4U2WA 1O3LA 1Z6EA 1ESBA 3GDVA 5FCRA 3RXPA 2K0QA 2FX4A 1GG6B 2ZWLH 3ZVDA 2JJ2D 1SR5C 2FM2A 3M5MA 5EQSA 1DITH 1C2MA 1MTUA 2R3YA 3RXFA 1K1PA 3LH3A 2O9QA 3EE7A 4E06H 1GI3A 2R3UA 1FPHH 4DW2U 4JCNA 4NIXA 2BDIA 3LJOA 2KM0A 3MMGA 3W95A 4ISLA 1GMDG 5HGGA 1H1BA 3F0PA 3U8TH 2QXJA 5C5OA 5DP6A 3QZQA 2A5AA 4K60A 3BV9B 2WV5A 1GDQA 1V2NT 1MUEB 5FL7D 1C5ZB 1H8DH 3A8BA 4NA7A 1C4U2 4B1TA 3TGKE 4B73A 2ZF0H 3GCNA 4VGCC 4AYYB 4B6FA 4JZFH 3WWBA 3Q3KA 1OX1A 1IQEA 1GBDA 4AGJA 5E2PA 2GZ7A 4XDEA 3UTUH 4AOQA 4NWKA 1BHXB 1LTOA 1LHCH 4UFEH 2ZDAH 3F1SB 3PROA 1C1UH 1SGQE 1G2LA 1JWTA 1XUIA 5BPEA 3VXEH 1P09A 2WUBA 1FDPA 1FIWA 3M7TA 2J38A 1BTHH 2J98B 1LHDH 1W3CA 2BB4A 2BMGB 2R0KA 2TRMA 1QQUA 4F4OC 3TK6A 1PPHE 1KDQA 4D9RA 5CHBA 1VCWA 4IGDA 2JDID 1CQQA 1QRZA 4AC9A 1GHAG 4Y7BA 2YNBA 5ETXA 4GVUA 1TA2A 2FOAA 1ZTLA 1GHBF 1GL0E 3ZV9A 2VIWA 1NBME 2FOHA 1C5VA 4QT8C 5T6FA 2BHGA 4YT7H 1QRXA 4X6OA 1EZSC 4X2WA 2FMJA 4RT0A 2H9HA 2ZFPH 1MBQA 1ETRH 1ZLRA 1OOKB 2SGEE 1CHOG 3KGPA 5EIYA 1C5OH 2NWNA 1RIWB 1C1VH 1FV9A 3TH4H 5C3NA 1EZQA 1ESAA 1AO5A 3SU6A 1S82A 3M5NA 4XD7D 1E79D 2IOTA 1ABIH 2WINI 3TNSA 4UFFH 4YOIA 3DD2H 3RLYH 1A0JA 1BMAA 3GISB 1CBWC 2BDCA 1C1QA 1QRWA 1CGHA 1GBHA 4WJG2 3RM0H 5FAHA 3SOSA 3MU0A 2C90B 5T6DA 2OD3B 1UCYK 2Y7XA 1BTWA 4I8KA 3WWFA 3TJOA 2GT7A 3A88A 3S9AA 1UCYH 1WOFA 1KIGH 2C8YB 2GCHG 4H4FA 2BD9A 3ATWA 1AB9B 8ESTE 4NA9H 3PMJA 1Q31A 3UWIA 1OKXA 4ISHH 4E05H 4AZ2B 3URDA 5JBAS 3KQCA 2V6NA 2YMSC 1TQ0B 2LPRA 2CJIA 4AGKA 2IJD1 2CHAC 3RU4T 1FY1A 1IQNA 3AAVA 3GY2A 1H8IH 1TNLA 2FYRA 2TGPZ 3O8BA 1IAUA 5DP3A 1VGCC 3ZYEA 3D62A 4AFUA 3P92A 4AORA 4INHA 3ATLA 5A8ZA 3K65B 2BXTH 2FOEA 3ZV8A 3S0NA 2HOBA 1UTMA 1VR1H 2F91A 2VVCA 1M9UA 4FU7A 3VB4A 1BIOA 1DLKB 1OP8A 5C20A 3ATIA 1FN8A 1MU8B 5LH8A 1DUAA 3PO1B 4BAMB 1BMMH 1FONA 1HJAC 1Z8GA 1NTPA 2VWOA 1F0TA 2HLDD 1QBVH 3LJJA 3QTOH 3T28A 3UNQA 1IQLA 2CV3A 4KP0A 3ZVBA 1G3CA 1YCPK 2BD4A 1ZPZA 3MU4A 4ZKRU 3IITA 1YCPH 3T26A 4JZ1A 5CHAC 1C5QA 2Q1JA 4Q7XA 6CHAC 4OGYA 2B0FA 4A7IB 1ETTH 3LT3A 1EZUC 1QA7A 2GZ8A 3AK5A 1SGDE 2V35A 4A92A 5C0TA 3W94A 4TWWA 1C9TA 4BXWA 4B74A 1A4WH 1H4WA 5C1UA 1TGTA 3PV4A 4ABFA 3N7OA 1C5LH 1W7XH 5DGJA 1MMJN 4Q80A 1LMWB 1XXFA 2XRCA 5SGAE 1SGNE 3VXFH 1HNEE 2BLWA 1RGQA 1E0FD 4GSOA 1ANCA 3L6PA 1SFQB 3FVFB 2ODPA 2GX4A 3UWJH 1K1NA 2BD5A 2ILNA 3A80A 1P10A 1Z1JA 1L4ZA 1UK3A 1NRRH 2HALA 3ZZAA 5J4QA 1DANH 3QO6A 2ZQ2A 1QZ8A 3PTBA 1TABE 1NS3A 3KEEA 3W1EA 4X6MA 1UHBB 3HGNA 1J16A 2QCYA 2K8IA 3KN2A 1GJCB 4A6LA 2P3TB 1GJ7B 1XVOA 5T6GA 3TLOA 3EA7A 2VBCA 2SFAA 1JIRA 1HV7A 2DE8A 1FMGA 1AHTH 2B5TB 2BDAA 1PPCE 4X2VA 5HMAA 1T7CA 2GKVE 1O2QA 3SJOA 5PTPA 3VB5A 3H7OA 2H9TH 2LNCA 5DSFA 1O2XA 4OS7A 4X8VH 2A31A 4ABHA 5DP5A 3PLBA 2WYGA 1ABJH 4JYVH 1LVOA 1P11E 3DA9B 3GY7A 6ESTA 1E1RD 2IPQX 2KCYA 2AIQA 2FOGA 3DSOA 1KXFA 1O38A 1QCPA 2ZHDA 3PWBA 1SFIA 1KY9A 2GJGA 1O3MA 2F9BH 2GDEH 4FU9A 5IDKA 2EY4C 1LO6A 3SV2H 1SOZA 1LPKB 1EJNA 3ZVEA 1P8VC 1O3EA 3RXQA 3DHKH 4UE7H 1HIAB 1DXPA 2ALPA 3H09A 3QUMP 4GPGA 1P12E 1MTWA 1TOMH 1TGBA 1O3NA 1T8LA 4O9VA 1ESTA 2BDGA 4BTUB 2H5CA 1DSTA 4Z6AH 4KTCA 1WU1A 3VB7A 1ORFA 3BG4C 3A7WA 2UWPA 1Z6JH 2AGIX 3AASA 3M35A 4LXBH 1O5DH 1F92A 1SGFA 2CXVA 2HVYB 1YY3A 2J4IA 5T1VA 1SLWB 4CHAC 1HYLA 3NZIA 5E2OA 4F55A 1SGPE 1TPPA 1IQMA 2GTBA 1HAIH 1Y3VA 1T8NA 2FX6A 4Z1MD 4LZ1H 2AGEX 1W0YH 2BQ6B 2AIPA 2H6MA 3UPEA 1DY8A 3TVJB 3L33A 3PLPA 1NT1A 1EAWA 1H9HE 2RDLA 3MH7A 3V0XA 1EUFA 4LZ4B 4TWYA 2AFQB 1GI9B 4ASHA 3OSYA 1RS0A 3M7QA 1TFXA 1WAYB 3Q3XA 3U1IB 3P8GA 1P2MA 4UONA 1VJAU 1SBWA 5GDSH 2FZZA 2STBE 1EB2A 2WPLS 5F8TA 5C2ZA 4I86A 3QGJA 4ABBA 8GCHG 2BVXH 3V13A 3BTEE 2XW9A 1UK2A 3KQDA 1AD8H 1C5SA 2UUJB 1QBOA 3DSPA 5CDFE 2PKAB 1JBUH 3OAAD 3SGQE 3ZZDA 2RA3A 3SO3A 3BEUA 3TITA 3GYMA 3M5OA 1FPCH 1AY6H 2VWNA 2ZTZA 3SUFA 2AGGX 3ATMA 2GMTB 3PRDA 4AB9A 3NXPA 1TBZH 3P8NA 3UNSA 1XKBC 5ESBA 1OSSA 1EP6A 4FUDA 4E7RG 2ZC9H 2OBOA 1ETSH 1K22H 4D9QA 3RXUA 3UR6A 2D2DA 3O8RA 2NU1E 3GS9A 5F6MA 1RTLA 1P03A 1GGDC 4B2BA 4Y8ZA 2FI4E 3A7TA 1OPHB 2R0LA 5EPNA 1UCYE 3PM3A 1KDQB 1GI8B 1D6WA 1SHYA 3NWUA 1WYKA 2VIPA 1OYQA 1O37A 2A7CA 1KXDA 2HNTE 4HG6A 4AX9H 1AFQB 1BMFD 1EKBB 1V2LT 4Y71A 1AKSA 1CHGA 2GV6A 1GMCG 2HLCA 3K6YA 2TGAA 1KXEA 2ZU2A 1BZXE 2BZ6H 1DSUA 1DXWA 2L6OA 2V0BA 2K1QA 3A89A 1A2CH 3EBNA 1BHXF 1HPGA 2JH0D 1A3BH 1OWKA 3S7KB 1YLCA 2PKSC 3GCHB 2Q6GA 4INKA 4FVBA 5KGOA 2GT8A 5FXLA 5LPFA 3RXEA 1SQRA 1AUJA 2WSSD 1W14U 2L74A 3S9BA 1C5WB 1HAXB 4WF8A 4RT1A 1L0ZA 4HFPB 4BAKB 2JJ1D 2PSYA 1GI5A 1O31A 2SNWA 1RFNA 4FU8A 4YTAA 2A4QA 1C5RA 1NN6A 3HATH 1MQ5A 2ZPSA 1G3EA 2OC0A 3RP2A 3GCOA 1EPTA 2NU0E 4MPWA 1TE0A 2EI7A 1SGFG 2TBSA 3RMMH 4CBNA 2A5KA 1C1SA 1O34A 2I6SA 2P59A 4LOYH 1O5AB 1TRYA 2BD3A 2ZCKP 1C2FA 1C1OA 2CK3D 1W0JD 1IHSH 4NIWA 4Y10E 2KZ4A 3KHVA 1K0HA 1ELFA 1N6XA 1TRNA 5K7RA 1P02A 1UVUH 1NU7B 3DT0H 1QBNA 4WH6A 3AW1A 2QIQA 1S6LA 5HM2A 1HCGA 1HAOH 1WCZA 2OTVA 1KMHB 1F0UA 2ALVA 2FLBH 1ELAA 2J5UA 1AZ8A 1SSXA 4M9FA 1WSSH 1SC8U 3QWCH 2ZDMA 2F3CE 4DCDA 1DT2A 1C2GA 1CT2E 5I25A 3SNBA 3KCGH 4HZHA 3N7DA 4J2YB 2GD4B 3SN8A 1D6RA 2A5IA 1GBFA 1DOJA 4WWYA 1O5FH 1GVKB 2VNTA 1G2MA 2FTLE 4A1TA 1XX9A 1ELDE 2BZAA 4MNYA 2CN0H 4Q7YA 3S9CA 2Z9LA 1GJ5H 1OWJA 1GG6C 1IHTH 3BEIB 2Z9GA 5A0CA 2HNTF 1Y3YA 4Y76A 2F9UA 4DGJA 3BTKE 3F2GA 1VCPA 2P95A 3KQBA 1W7GH 1O2WA 1XUHA 4IN1A 3URCA 1W2KH 1OWHA 2A4RA 1K1JA 3UFAA 5EW1H 1UTOA 4CRFA 1NRSH 3RM2H 2KX4A 3NK8A 2F9VA 1XUJA 2Z6BD 1SGTA 4JZDH 3MH5A 3VPKA 3MQKC 1EXFA 1SGYE 3P8FA 2J34A 2F9PA 2ZECA 1K1OA 4AG2A 1C1TA 1V2JT 1TGSZ 1QNJA 1O2LA 2JH6D 3UR9A 1GBJA 1L2EA 5C67A 3F3BA 2PGBB 1WUNH 4XBBA 1O2GH 3SI3H 1P01A 1A61H 3MNXA 1N1LA 7GCHG 1ZRBA 3QN7A 4F48B 5EQRA 1SHHB 1O2RA 5J4SA 2RCEA 1C1NA 1PPEE 3AVZA 1C5XB 2XYAA 3SBKA 5FPSA 3R0FA 4DVAU 3A82A 5IYTA 1UTPA 1XUKA 4H6SB 2FO9A 3U69H 3UB0A 2PSXA 1Y8TA 5EXNA 1CA0C 3HK6B 3MYWA 1MAXA 1GMDF 1TIOA 1YLDA 1D3PB 3EDXB 4Y79A 4AFQA 4A1XA 2SNVA 3P70B 1UVOA 3A7XA 3ODDA 1HXFH 1W11U 3F9HA 3TIUA 1GBLA 3B9FH 2QXHA 3M3VA 1RIWC 3FP7E 1AVWA 3OTPA 4BAOB 3PLKA 4KELA 2G55A 2QYIA 3VEQB 1NRPH 1OWIA 3TU7H 2HVXA 1INCA 4AFZA 1WQVH 2QN5T 1CGJE 6GCHF 1K2I1 3K6ZA 2ANYA 1A46H 3KQEA 3LH1A 2BX4A 3E6PH 1MQ6A 1HDTH 1O3JA 3RXSA 1YGCH 2EQNA 1GBCA 1HGTH 1DE7H 1QB9A 1EJAA 1A0LA 3FFGA 2ZG0H 5F53A 2IPHA 3UQVA 1LQDB 3SNAA 3G01A 5GCHG 1H8HD 1O35A 2VIOA 2XBXA 4YO9A 5HKKD 2HNTC 4CRAA 1JXPA 1P2JA 5EJZA 2CMYA 2H1UA 1G37A 1DUEA 2VJ1A 2ZFTA 1AE8H 1TALA 4ACBA 2XBWA 1W0ZU 3K9XB 3LGVA 3RLWH 2M2AA 3MH4A 3SNDA 1SGCA 5GPIB 1JRTA 3M3TA 1XMNB 2P8OB 4XBDA 1SOTA 1O2TA 3PWCA 4AG1A 5C17A 5A0BA 3D23A 2G5VA 1AU8A 1DWDH 3OEHD 3SZNA 5FX6A 3SU4A 1LVYA 2ZKSA 2W3KA 1S83A 1FJSA 1G3DA 4OM9A 2DE9A 5CMXH 1UTNA 1QJ1B 3GDSA 3E1XB 2A4OA 3EE0B 1IQIA 3KNXA 4ACAA 1A5GH 4UEHH 3WY8A 4VGCB 2QXIA 3PO1C 3O8DA 3DFJA 3MU8A 1MH0A 1H9LB 1O2PA 1Z71A 1O39A 4DIIH 2XC5A 4AYVB 2ZHFH 2TIOA 2FXRA 1EOLA 1KTTB 2FIRH 2GCHF 4ABEA 1GI2A 1V2OT 5EGMA 3LGIA 4M7GA 4BAHB 1YYY1 1SQAA 2VIQA 3OE7D 1OP0A 4DY7B 4XSKU 1X7AC 2RDEA 3RXHA 1ZJKA 1V2ST 3GY6A 1DY9A 2QC2A 3RXLA 4MTBA 1NU9A 1O2KA 2OQ5A 1EFRD
chains in the Genus database with same CATH topology
3A85A 3EA9A 1O3DA 2XXLA 1MTNC 2QF3A 1GDUA 4R8TB 1WV7H 1EASA 4WH8A 1K1LA 1ELGA 2B7DH 3LU9B 1CSOE 2A7HA 4YOGA 1HJ8A 2PTCE 2VVUA 1ZTKA 3OTJE 2QY0B 3C1KA 1BITA 3RUOA 1YPMH 1S0QA 1XUFA 2OC1A 3ZYDA 3GDUA 1YPJH 1O5CB 2PW8H 4K8YA 3UQOA 3MO3A 1P3CA 2XCNA 3OU0A 2AYWA 1AKSB 4ZHLU 1BRBE 2FWWA 3PB1E 3SJIA 4CRGA 4ZHMU 1QURH 2Z7FE 1ZHPA 5CE1A 1E38B 3GY3A 3SU1A 1AVGH 1G9IE 1G30B 2ZFRH 3T29A 1TBRH 2OUAA 3SUGA 1ZPCA 5GXPA 1CE5A 4MPUA 4B2CA 1MCVA 1O33A 4FUGA 3KIDU 5LPEA 3BN9A 4ZXXH 3QDZB 2P3FH 5EU8A 3DUXH 1CGIE 2J2UA 2FTMA 3E3TA 4MG3A 2XBVA 3F9FA 1FIZA 4K69A 1EPTB 2EEKA 3OX7U 1PQ7A 2G4UA 1C2HA 3RMLH 1Q3XA 3ZVAA 4E7NA 1HAGE 3O8CA 1DLEA 2Y82A 3CS7A 4U01A 2CHAB 3BTDE 1O2YA 5ABWA 2PTNA 2WPJS 3M37A 2YNAA 3RXRA 1EAIA 5EOKA 1O36A 3ATKA 1AMHA 2CGAA 4FUFA 1TMUH 1VGCB 4WMEA 3FP8E 1MTVA 2W7UA 1TQ7B 3RMNH 1C1WH 2P16A 1THRH 5L2ZH 2UWLA 3CS0A 1GI0A 2AMQA 4I8JA 3GCTG 1HAHH 1UTKA 2W26A 3SU2A 3ZVFA 1V2QT 1K21H 4MLFB 2BVRH 3EA8A 1CA8B 1L4DA 4DJZB 3MWIU 5A2MH 1SG8B 1O3OA 3STIA 2G52A 1QB1A 2G4TA 4YESB 1V2WT 1SL3A 2A45B 3ELAH 1NFYA 3L3TA 3U1JB 2XWAA 1O2OA 3RC6A 4DOQA 2ZGJA 2FODA 2GCTB 1QGFA 3MNCA 2R9PA 1Y5AT 1DICA 1BCUH 3SGAE 4NSVA 3SJ8A 4CH8B 1OP2A 6CHAB 2A7JA 1MU6B 3TPIZ 3A86A 3BTWE 1KLJH 3SV6A 4FVDA 4RKOB 4X1NU 3U9AH 3NKKA 3T62A 3QK1A 1TNGA 1LVMA 1A1RA 4UFDH 1C1RA 3TK5A 1ZPBA 4ZUHA 3E0PB 2Y5HA 2BM2A 1EAXA 6LPRA 4Z0KA 5DP7A 1MZDA 1V2VT 2A0QB 1C5YB 1FN6A 4JMYA 1D9IA 3SI4H 1Q2WA 3FZZA 4O3UA 3SV9A 2D8WA 5JB8S 3SHAH 3P8OA 4DG4A 7KMEH 8KME2 1GBTA 2W7SA 1Y3WA 2TPIZ 1DPOA 1ELEE 2GMTC 5EODA 5EW2H 1F5RA 3VB6A 4Y11E 4X6NA 1NPMA 1ZOMA 1AGJA 4K1TA 1QTFA 3PYHA 4B76A 4Q7ZA 4RSPA 1GHYH 1K28D 1KXBA 3ZVCA 4FUHA 1BOQA 2C93B 1LQEA 3MOCA 1LPZB 3A84A 1T32A 1Y3UA 2VIVA 3F9EA 1MZAA 2ZTYA 3Q77A 2ZFFH 4I8HA 3E0NB 3SGBE 7LPRA 1QIXB 2YOLA 1IQHA 3GY5A 1UJ1A 4WMFA 1YCPM 1W10U 5L6NH 4FUEA 1GBBA 1SGEE 5GJ4B 3F9GA 5E8EH 1QFKH 4I8GA 1XXDA 2PUQH 1AZZA 3U98H 1MTSA 1EQ9A 1GBMA 4H42U 1LHFH 3Q76A 4NSYA 1LKAA 1QJ7B 1ELVA 2ASUB 5A8YA 1GCTC 1TA6A 2EC9H 2FI3E 1J8AA 1WTHD 4MDSA 1JMOH 4MVNA 2Y5GA 4A5TS 4I33A 4D8NA 2GVFA 1CVWH 1E34B 3GCHC 2R2MB 3ZZBA 4CRDA 1P9SA 3GOVB 1BTYA 1FXYA 1BRCE 1O3FA 2ZU3A 2UUFB 4UDWH 1S6HA 4WVPE 4WY3A 2ZU5A 2O8TA 4PROA 1YPLH 1ZTJA 3BTFE 4CHAB 2ODYB 4Y8YA 3A8DA 4THNH 4BOHA 1Z8RA 3M36A 1LKBA 1C2DA 3P95A 1BMNH 3RXDA 1GMHG 4MPVA 1FLEE 2R2WU 1E35B 2SGQE 1AFEH 2PWXA 1OS8A 2J9NA 1MAYA 4GAWA 5EPYA 1N8OC 1BTXA 5HM9A 1NC6A 5H4IB 4NIVA 1ZGIA 1F5LA 3IWMA 1AQ7A 2BY6X 4BNRA 3JZ1B 1KXAA 2ZFSA 4UFGH 4BXSA 5JYIA 1GHXH 4K2YA 5DP8A 2BY9X 1F0RA 4AB8A 1O2VA 1YP9A 1S84A 2IN2A 3RXVA 2ZCLP 1FAXA 1TGNA 1PQ8A 8LPRA 1O5BB 2ZP0H 2FLRH 3MU5A 1C5UA 1RRKA 5JBBS 4ZHAA 3BTME 2FS8A 1YM0A 2ULLA 4FUCA 1S81A 2VGCC 1GI7B 2XWBI 1KYNA 2A2QH 3A7YA 1NROH 4K8BA 1BJUA 1P2OA 4INLA 2JKHA 2RG3A 1TWXB 3EYDA 1GJBB 1RJXB 2OQUA 2ZTXA 2G81E 4ABAA 4H6TA 3HPTB 2FESH 4GCHG 4SGAE 1TGCA 5DG6A 9ESTA 4GLYA 1RTKA 4KTSA 2XBYA 1EATA 3MNBA 1OWDA 1ANEA 2AEIH 4JZEH 1O32A 1GGDB 2D26C 3DFLA 3SQEE 3RXBA 1ELCA 4WMDA 2FOFA 2QGRA 4I7YH 2JETB 2Z9JA 2F9NA 2DUCA 3PMHB 4I32A 4X1QU 5JBCS 3OY5U 4OS5A 5AFZH 1V2MT 1ZGVA 4NFFA 2J95A 3SNEA 1P05A 1TNJA 5E0JA 5DO4H 1UHBA 4I8LA 2B8OH 4HI3A 1YC0A 4K5ZA 4XFQA 2BOKA 2Q6DA 2FI5E 4JZIA 3RXJA 1V6DA 1C2LA 4IS5A 5AF9H 1A5IA 1AWFH 2PV9B 5FBEA 1FNIA 5E0GA 3IG6B 1YPGH 2ZU4A 2WV4A 2NU4E 3T27A 2Z9KA 4ZAEA 2H2ZA 4ABJA 1NM6A 1P57B 4TY6A 2NU3E 2ODQA 1BTUA 4TPIZ 1V2PT 3SUEA 2K7XA 3RXGA 4U30A 1PYTD 2ZGBH 1KTSB 1DM4B 1SMFE 1QL7A 4UD9H 1SPJA 3F6UH 1Z8JB 2GGVB 3VGCB 1GCDA 3ZZ9A 3BEFB 4OS4A 5F8XA 1B5GH 1XUGA 2Y80A 3A7ZA 1ZSKA 1GWAA 2BLQA 3LOXA 1C5TA 4KGAA 2G00A 4YLUA 4CREA 3UOUA 1WTGH 1HIAA 4MPXA 4OS1A 4XBCA 3LKWA 4TY7A 1C9PA 2VH0A 3NUMA 3RXAA 4IBLH 2W5EA 4XE4A 1ZSLA 3NCLA 1C5MD 1IQGA 1FQ3A 3C27B 3UNRA 3LC5A 2ZQ1A 1A3EH 4MNXA 1YPKH 1VITG 3GYLB 4X1SU 3EGKH 4OS2A 4X8UH 1O2NA 3LGYA 2WPIS 3ZZ5A 1P2NA 3FANA 5I46H 4WXIA 3RXMA 4ABDA 1W13U 3SV8A 4AN7A 5FCKA 1HAVA 3FAOA 1TPAE 2ZU1A 3LPRA 3A7VA 1CU1A 4ZKOU 1PJPA 1A7SA 2PGQB 3MU1A 2BQWB 1QQ4A 2G5NA 1THSH 4NWLA 5DK1A 2OINA 1PQAA 1AVXA 1C2JA 2BDHA 1BBRK 4BANB 5E0HA 1WQSA 1S0RA 1BBRH 2C8WB 3A83A 2SGPE 4O03A 5C1YA 4GHQA 2P8OC 1DDJA 5FX5A 1O3CA 2ZGXH 1TLDA 5F03A 3LDXH 2A1DB 2IJOB 3ESTA 1C2EA 2BXUH 1ELBA 3A81A 2HPQH 2PKAA 1V2UT 1ANDA 1O2JA 1YPEH 2M5TA 1BT7A 3CP7A 3CENA 4DURA 1BMLA 2C8ZB 2FOBA 3SU5A 2VWMA 3E90B 3SUDA 1TNKA 1Z1IA 2NU2E 1HXEH 1D3QB 2BTCE 1EJMA 4IC6A 1ZR0A 1ZMJA 3S7HB 4SGBE 1CO7E 4X2XA 2C4FH 4ZKNU 5GCHF 1GHAF 3LIWA 1A0HB 1AWHB 1PPZA 1AB9C 2BY5X 6GCHG 3LONA 4ZROA 1S5SA 4BTTB 1YBWA 2G51A 1MKWK 2UUYA 3SU0A 1HBTH 1DFPA 3MNSA 2ZDVH 1MKWH 2Y7ZA 3ZZCA 3LC3A 3AW0A 3V3MA 2VU8E 4MNVA 5A0AE 1L1GA 2HPPH 1CA0B 2Z94A 1GI4A 1HJ9A 5GIBA 1P0SH 1CHOF 4F49A 3B8JA 3KF2A 1LHEH 1P3EA 1NFUA 1SLVB 4BTIB 2VIDA 1GHBG 5HYOA 2Y5FA 1SVPA 1PPGE 4Y7AA 5L2YH 4NZQA 2UWOA 3ZZ8A 2GDDA 4D7GA 2FYQA 2THFB 1PFXC 1N6YA 2BX3A 1BA8B 2FS9A 4IMQA 1QB6A 1SGRE 3HGPA 1GBEA 1GJ6A 2A32A 1LCYA 2H9EH 1O2IA 3SORA 1C2KA 3TJNA 3M7UA 1TX7A 4FXGH 1XM1A 2Z9IA 1S6FA 3UOPA 3QX5H 3RXOA 1UVSH 2FOCA 1UTLM 2ZDLA 5EG4A 1UTJA 2BY8X 1ZZZA 1GJDB 3QTVH 3MHWU 1QR3E 2AH4X 2WPKS 1SLXB 4OGXA 3RXTA 1O3GA 1JRSA 4FUJA 1SGIB 1O2MA 1VJ9U 1O3BA 9LPRA 3RU4D 2QXGA 1ZRKA 3UREA 2FEQH 2Z3CA 2I6QA 3Q3YA 5JDUB 2SGFE 1KLTA 4X1PU 1EPTC 3GY4A 2GV7A 3SW2B 2QF0A 1GBAA 2TGDA 1MD8A 1RD3B 3M3SA 1GI6A 2ZPQA 3BTQE 2C8XB 1P2QA 2D1JA 1O0DH 2F83A 2UUKB 2ZFQH 3KL6A 3OYPA 3V12A 1NESE 1DWEH 1ARBA 1O3IA 1O30A 1BRAA 1O2ZA 3NPSA 3I29A 3RC4A 2BD7A 3SJKA 4GUXA 1IQKA 1TPOA 2SGAA 1TB6H 2OP9A 1YPHE 3QZRA 5FPYA 4K3JA 2AS9A 4YM9A 3M5LA 3T25A 1VITH 1FY3A 2HGTH 1T4VH 2FOMB 3U8OH 4X8TH 3AAUA 4Y8XA 3SNCA 4ISOA 1ZSJA 1CBWB 3R3GB 1FY4A 2O8WA 2ZDNA 1THPB 2Z3EA 1O2HA 2ZDKA 3BF6H 1GL1A 1F5KU 2PLXA 2GCTC 2ZCHP 2STAE 1RTFB 5HXFA 2ZZUH 1Y5UT 4DT7B 3GICB 2ZA5A 4CR5A 4YT6H 5DKMA 5TCAA 1Y5BT 4YLQH 5EXMA 1TPSA 1GHVH 2QV1A 2ANMH 3Q00A 1GJ9B 1TMBH 1H9IE 3B23B 1DWCH 2KAIA 4KTUA 7ESTE 3FZDA 5LPRA 1MTNB 1C5NH 2BQ7B 1ELTA 1KXCA 4X1RU 5JBTA 1O5GH 3GCTF 3M61U 5FHTA 4NCYA 1C2IA 2AMDA 2TGTA 2ZIQH 1B0EA 1ZMLA 1G3BA 4YOJA 1OYTH 3I77A 1MD7A 3LGTA 5TJXA 1C4Y2 1GJ8B 3MI4A 1HJAB 4JK5A 2ZHEH 1U6QA 1NRNH 4TPYA 1BDAA 1QL8A 1UVPA 4MNWA 4JYUH 1MKXK 1O3PB 2ZPRA 1HAZB 1SI5H 2WUCA 2VB0A 4AFSA 1LVBA 1JOUB 1W8BH 4ZMAH 1MKXH 1GVZA 3MTYA 2OC8A 2J92A 2XCFA 5CHAB 4DIHH 1IQFA 1O2UA 2HWLB 1T4UH 2BY7X 3RXKA 4B71A 1HUTH 1F7ZA 4J1YA 1ZYOA 5BRRE 2OXSA 1NRQH 1C5PA 1QL9A 1DX5M 1MCTA 3E8LA 1NY22 1UTQA 5DP4A 1G36A 3A8AA 1SQOA 1J17T 1ZJDA 2ZI2H 5TCCA 4IMZA 3ZZ3A 4NIYA 2WYJA 1B0FA 1BB0B 2A4GA 3UY9A 1O5EH 1EAUA 1BBRE 3I78A 2XNIA 1KLIH 2XTTB 1ZHMA 1TBQH 1EB1H 2ZO3H 1NO9H 2VH6A 5AVDA 3E91A 2QAAA 2EI6A 1CT4E 4HTCH 4RKJB 2ZNKH 1K9OE 1WBGB 1K1IA 3BIUH 5DPAA 1PPFE 1FZZA 2ZHWH 2HRVA 2F9OA 3ZVGA 1O3KA 3T5FH 4ZH8A 2OC7A 1V3XA 2BLOA 2VVVA 5ESTE 2SGDE 3TH2H 3EAJA 2RA0A 1HFDA 2Y81A 4YZUA 3TJVA 5F8ZA 2V3OH 3HK3B 5T3HA 1CT0E 1ACBE 1TAWA 3BTTE 3ITIA 1P9UA 1EZXC 1V2RT 1O3HA 4I31A 1V2KT 4Y0ZE 1FAKH 5DP9A 1BUIA 3HKJB 1LPGB 4A1VA 1HAVB 4XOJA 3ZZ7A 8GCHF 1AFQC 3MH6A 1Z8IB 2P93A 4ZKSU 1GBIA 2B9LA 1TNHA 2OBQA 4LK4A 3QLPH 3H5CB 3OY6U 1F2SE 3TNTA 4ABIA 4Q2KA 2O8MA 3VFEA 4HGCA 3EQ0H 5AFYH 2C3SA 1TONA 1E36B 4K1EA 3BIVH 1C4V2 4X0WU 1T8OA 2JH5D 4FUBA 1FUJA 1J15A 1TMTH 1BJVA 3TGIE 2OLGA 2ZEBA 3FP6E 3BG4B 4OS6A 1TOCB 4IW4E 3S69A 3A87A 3UUZA 5A09A 1P2KA 1P2IA 1MBMA 3SQHE 2BOHB 5G4BA 3ENSB 1HB0B 4Y0YE 2BVSH 1BTPA 1V2TT 1SLUB 1GMHF 2XC0A 1D3DB 4ZXYH 1P04A 4IN2A 1HAPH 3GY8A 4X2YA 3TK9A 3SHCH 1UK4A 3TGJE 4R0IA 5FBIA 5A8XA 2H5DA 2ZHQH 1EP5A 3ZZ6A 3RU4E 1GDNA 1HAYB 1O3AA 2EI8A 4CRBA 2ZGCA 1AN1E 1TX6A 2FPZA 2P3UB 3TH3H 5EQQA 1KSNA 5JPMH 5L30H 2AERH 5C1XA 1GMCF 4BAQB 1QY6A 1OXGA 3P17H 2O8LA 1GVLA 1YPHC 5B6OA 1QA0A 2PHBA 4MQAA 1J9CH 1NZQH 2JETC 3PTNA 2WPMS 3ODFA 2FP7B 4ISNA 1GBKA 4NFEA 2BD8A 4NZLA 1L1NA 1RXPA 2V3HH 3K2UA 4CBOA 4K1SA 3UIRA 1ID5H 4NGAH 2BYAX 1HLTH 2ESTE 1GCTB 3MFJA 1J14A 1PYTC 1TX8A 1AU