3M3TA

Sars-cov main protease monomeric arg298ala mutant with n-terminal additional residues (gly-ser)
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
307
structure length
307
Chain Sequence
GSSGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRKSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKFYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVAQCSGVTF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords 3C-like proteinase
publication title SARS-CoV main protease with N-terminal extension regulated by mutation on C-terminal domain
rcsb
source organism Sars coronavirus
total genus 74
structure length 307
sequence length 307
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2010-03-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1840.10 Mainly Alpha Orthogonal Bundle main proteinase (3clpro) structure, domain 3 main proteinase (3clpro) structure, domain 3 3m3tA03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3m3tA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3m3tA02
3BV9B 1BBRH 3EQ0H 1PQ8A 2WPMS 5C1UA 2VWLA 1Y5AT 4ABFA 3SW2B 3RXKA 3SU5A 1L4DA 1GI2A 1UK4A 5TJXA 1N6YA 2PUQH 3LGYA 1GI0A 1UVPA 2F9UA 4FU9A 4Z6AH 1HJAC 2CMYA 3DA9B 5GCHF 1GHZA 2BY8X 1HAIH 2J92A 1GI7B 4JYTA 1AFEH 1C1OA 2FTLE 3P8FA 2Y7ZA 1TMBH 7KMEH 3PLKA 1QQUA 2CHAC 3ZVBA 4WMDA 1QHRB 1PPFE 3ZZ8A 1QQ4A 1SOZA 1QJ7B 1V2TT 2NU2E 3PO1B 4NIVA 2FI5E 2FIRH 3MU4A 5T3HA 1F2SE 4ISLA 3V13A 4YM9A 1HYLA 4DT7B 1PYTD 2BQWB 4B73A 1EUFA 4DVAU 1E38B 1ABJH 3EDXB 3F9FA 1F5KU 3MMGA 1M9UA 1C5XB 1ESAA 1BDAA 4NG9H 2BQ6B 2VGCC 5HMAA 2B9LA 1RD3B 1C5UA 2P3TB 2WPIS 4YO9A 3MNCA 3GDVA 2NU3E 3BG8A 3GYLB 5HM9A 2J95A 1P01A 4X0WU 1GI3A 3LJJA 1A1RA 8LPRA 2VH0A 3ATLA 2C4FH 3SNAA 1ESBA 1FPHH 1GCTC 1UTJA 4VGCC 1DITH 2VVUA 1UCYE 1TGTA 1TX8A 1W7GH 2Z9LA 2TPIZ 1OOKB 2QXIA 3LJOA 2UWLA 4AB9A 1DANH 1TONA 5GXPA 2VU8E 3M3VA 2JH6D 4LOYH 1GVLA 1THSH 1O3DA 5DP3A 3RXOA 3TVJB 2STBE 1L0ZA 1BBRE 4YESB 2EI7A 1FY8E 3LPRA 4K5ZA 3D65E 2DUCA 3GOVB 1ELVA 1OS8A 4GAWA 1VZQH 2VWMA 2GCTC 4CRFA 4WMEA 2BQ7B 4RKJB 1ETRH 1HJAB 1H1BA 2ALPA 5HGGA 1GJ6A 1JRSA 2XC4A 1VJ9U 5I46H 1A0LA 1LO6A 4OGYA 1O36A 5I25A 1ANBA 2FOEA 3MU1A 2BY6X 2CHAB 2BY5X 1ARBA 3Q77A 2QIQA 1SFQB 3RXHA 3KHVA 3SGQE 3VGCC 1VITG 1ZHPA 3U1JB 1NFYA 1DXWA 1GMDG 2BY9X 4XBDA 2GD4B 2FI4E 2BLVA 1TMUH 3JZ1B 3MU8A 4I8JA 2QXJA 4B71A 5LGOA 2C8YB 4ISHH 2KAIA 4CRGA 4ZKSU 1NM6A 5AF9H 1TPPA 1TWXB 1IQIA 3GY3A 4X6NA 1ELBA 4E06H 4Y7AA 2ZPRA 3CS0A 3HK3B 4HI3A 1L1GA 3K6YA 8ESTE 1SLWB 1LCYA 9LPRA 4K1EA 4UDWH 1GDQA 2ESTE 1O2UA 4NCYA 1SGYE 1KLJH 4IBLH 2SGQE 1E37B 1O39A 1JMOH 3SJKA 1O2LA 3SI4H 3SV8A 1JXPA 1V2JT 4B2CA 3KEEA 2BYAX 1PJPA 1GCTB 1UTOA 1W12U 1TRMA 1C2HA 1AFQC 2Z6BD 4Y8ZA 4NA9H 2Z3EA 4FU8A 1VCWA 3BEFB 2Z94A 1YCPK 3FVFB 3SV6A 4F4OC 3F9GA 3KL6A 2AYWA 2DE9A 1CT2E 1HXEH 3RXQA 4ISOA 3VB4A 1C1SA 1TLDA 1ELDE 1W8BH 2W7UA 4BTUB 2ANYA 3A7YA 4NA7A 1QBNA 1YCPM 4XBBA 4E05H 2GCTB 1O2SA 2YNBA 1O3OA 2A7CA 3DUXH 3LH1A 2VNTA 1RTKA 3KQCA 6ESTA 2FZZA 2FOGA 3RXLA 1OYQA 1AVWA 4H4FA 1BUIA 1C9TA 4IN2A 1O33A 1B0FA 1LPGB 4A6LA 1C2KA 1BQYA 1GBBA 1CVWH 1TOCB 2J34A 2RCEA 3V7TA 4H6TA 1TX6A 4CH2B 3U1IB 3Q00A 1ZSKA 4IMZA 4X8SH 1FMGA 1CE5A 2BZAA 3NXPA 1FN8A 1F0RA 1FY3A 1C4U2 2TGDA 4ABDA 3K9XB 4WF8A 5CHAC 1TALA 2A2QH 4TYDA 2SGDE 1P8VC 3RC6A 2QN5T 3LGUA 1N8OC 4AX9H 1DT2A 1Z8RA 5C5OA 3SJIA 5T6GA 1IQLA 1DLEA 1TGCA 2OBOA 4BTIB 2FI3E 1Z6EA 4I8LA 3K65B 1HIAB 2BXTH 1SSXA 1OWDA 1NFWA 4GLYA 4IC6A 3P17H 3SU6A 3WY8A 2V3OH 4X1RU 4IW4E 4NIWA 1LVMA 4ISNA 2FEQH 1P05A 3TH4H 4ABAA 1SGFA 4Q7YA 1OWEA 2BLWA 4H6SB 5TCAA 2XC0A 1H8IH 2JH5D 1BOQA 1F0SA 1TX7A 1AFQB 3HGPA 3C27B 2ZEBA 2ZIQH 3STIA 2B8OH 3QO6A 1SQOA 4Y11E 1D3QB 2AH4X 2Z9KA 1CO7E 2FS8A 3ZZCA 1LMWB 2WV5A 1ZMJA 3NKKA 1MCVA 2G5VA 3VXFH 4KTCA 4Q80A 1ZSLA 2OC7A 1MTNB 1O2VA 1JWTA 1TB6H 1QRZA 4ZKNU 3PYHA 4JYVH 1A5GH 1FZZA 1SVPA 2HVXA 5ESTE 5EPNA 2ZCLP 1AZZA 1LHEH 1GCDA 1C4Y2 2BOKA 1SGCA 3BIVH 2GVFA 3K2UA 1P2QA 3RU4T 1GJCB 2A45B 1SGRE 1O3BA 2J2UA 4K3JA 1QGFA 1WTHD 4O3TA 3SBKA 1ELGA 1YPLH 3M5NA 3PMBB 3AW1A 4B75A 3ODDA 2BD8A 4GHTA 1P2OA 3Q76A 1IQMA 1QL7A 1DE7H 5CHAB 1DM4B 2QGRA 1SGEE 4ZKOU 4KP0A 2XTTB 2W5EA 1N8OB 2FX4A 4AFQA 1WOFA 4OS5A 1W0YH 2PTCE 1KXDA 2F9PA 4XFQA 1O5GH 1C5QA 3MO9A 1T32A 1DY8A 3RC5A 1ANDA 2R2WU 1FNIA 1RFNA 1K1OA 3A7ZA 2FWWA 1HBTH 1GHBF 3A8AA 3GCNA 3MNSA 4E7NA 4AORA 4DGJA 2P3UB 1V6DA 1SB1H 1CGJE 3GDSA 1EZXC 2CJIA 1SGTA 3SN8A 2BZ6H 3A7WA 3T25A 3M5OA 2IJOB 3LDXH 2GDDA 2QF0A 2TGTA 1MH0A 1XXDA 2ZKSA 2G4TA 2CF8H 4Y71A 2Y82A 1C2LA 6CHAC 4Y8YA 1EAXA 1MCTA 4TWWA 4X2VA 1Y5UT 5LPRA 1KSNA 5FX6A 5DG6A 4AGKA 3SUFA 3VFEA 5C3NA 5EXMA 5EXNA 1G3DA 4NZQA 3AVZA 5H4IB 3NK8A 1O2ZA 1TOMH 1MAYA 3ZZ3A 4XBCA 1O3PB 5GDSH 2WPHS 3SQHE 1QB9A 1C1PA 2H5CA 1T8MA 3EA8A 1YPEH 4NSYA 4DY7B 2GV6A 4Y79A 1EB2A 4LXBH 2EA3A 4ZROA 1GMHF 4OS2A 3M37A 3BTHE 4UONA 2B0FA 1P9SA 3AW0A 7ESTE 4MNYA 1JIMA 3FP6E 1NC6A 4JMYA 1NRSH 3O8RA 1NN6A 2QCYA 1FJSA 1YPHC 2BTCE 1Y8TA 1Q3XA 4Y7BA 1IQKA 3LGWA 4GCHG 3E1XB 3MI4A 1XUIA 1ZTLA 5C20A 3F68H 2FX6A 2BY7X 2HPPH 5AHGH 1BRCE 1AHTH 1TRNA 1T8NA 2B5TB 2FOBA 2R2MB 3GICB 2Y80A 3RDZA 2A2XH 4X2WA 2BDYA 1K1PA 1MKXH 1SLUB 4ZHAA 4D9QA 3BTQE 3A83A 1GHVH 1AMHA 3RU4D 2I6SA 2R9PA 2RA0A 3PV4A 2C93B 1CBWC 1CGHA 1NROH 5ETXA 4DG4A 2QXHA 1AUTC 1O3LA 1TRYA 2ZU3A 1BTXA 5FCKA 1UMAH 1BB0B 2PTNA 3H5CB 6CHAB 1MBQA 2VIQA 4U01A 5DKMA 5F8ZA 1Z1IA 1O3IA 5L2YH 4K69A 5F6MA 4LK4A 3SUGA 5HXFA 5EGMA 2SGFE 1C5LH 4ZXXH 1H9HE 2P3FH 1CT4E 2VH6A 2ZQ2A 1UJ1A 1L1NA 3E0PB 3A81A 2BD9A 1MUEB 1KTTB 3SUDA 3TGIE 1LTOA 1V2MT 4JZDH 2GZ8A 2QY0B 2LPRA 4IN1A 4JZIA 2WPKS 3GCTF 3MNBA 1BMMH 1HXFH 4K2YA 2FOAA 3FFGA 1UK2A 2XBXA 3Q3YA 4RN6A 1SGQE 3M35A 1GJ9B 1YC0A 1HGTH 1GMCG 3PLPA 2FESH 1ELTA 3E91A 2A5IA 1GHXH 1ZOMA 3MO3A 8GCHF 1E36B 5JBAS 2BDIA 2H1UA 1MKWK 4U2WA 3UR6A 3UWIA 2O8TA 1F5RA 1GJ5H 2WUCA 2Z9GA 1EPTC 4WH8A 1O2TA 1W7XH 1QURH 5GPIB 2HWLB 3RC4A 3LGIA 1NY22 2NU4E 3PWBA 1UVUH 2BOHB 3PMHB 3A8CA 3PO1C 5ESBA 1HAOH 1FY4A 2CXVA 2WV4A 4DURA 1GBHA 1AQ7A 3LKWA 2FMJA 3TITA 1NT1A 1FIZA 2B7DH 1LVYA 1GJAB 1NFUA 2ZDVH 4X1SU 3RXUA 1G9IE 1YPJH 4DJZB 2V6NA 1HNEE 3SNCA 3QGJA 3SJ8A 1RRKA 5FPYA 4X8VH 1G3EA 4X6OA 1U6QA 2FOHA 3AAVA 1HAXB 5JYIA 4FUBA 1ACBE 3RXCA 1OSSA 1BMLA 4FXGH 2TGAA 1YLDA 1Q2WA 1BRBE 1GBJA 3BIUH 3TJNA 4INHA 1XUGA 1O31A 1NRRH 1P02A 1A2CH 4CBOA 2AMDA 1LVBA 1T4UH 2ODPA 1QJ6B 4AG2A 4GPGA 4ABGA 1V2PT 1H8DH 4ASHA 1N6XA 1KXCA 1RJXB 2PGBB 5AFZH 4AZ2B 1JBUH 1ARCA 3TIUA 2TIOA 2ZFSA 3M5LA 4KTUA 2SFAA 3SI3H 1MZDA 5A8XA 4CHAC 1H9IE 1H9LB 3A85A 2J38A 3F9EA 1GI8B 1O2KA 2AIQA 2C8XB 4R8TB 2GCHG 2GX4A 1P57B 1P9UA 3TJUA 3STJA 4JZ1A 2ZHEH 1V2OT 1SQTA 1BIOA 2GV7A 2ZHQH 3RU4E 1XX9A 1NZQH 1EPTB 1YP9A 1TGSZ 1V2ST 1UCYK 1C1QA 4NSVA 1FV9A 1UVTH 3ZZBA 1FXYA 3SJOA 1TIOA 2THFB 2VINA 4FUJA 4X8TH 1DPOA 1BBRK 1MD8A 3D23A 2GZ9A 2ZU5A 1C5MD 2IPHA 1UVSH 2A4OA 2FS9A 1DICA 4YOJA 2BDBA 3QZRA 4U32A 4ZKRU 1UHBB 5LPFA 1QRWA 4JK5A 6GCHG 2XRCA 1WU1A 4TPYA 1ZPZA 2H6MA 1BTHH 6LPRA 1ZPCA 1FIWA 4B74A 3PMJA 4CR5A 1ABIH 1BTZA 2F9VA 2WYGA 2F91A 1K9OE 4DOQA 3O8BA 3MWIU 1YPGH 4GUXA 3F9HA 1Y3VA 2R0LA 2TRMA 3MTYA 3KIDU 1FPCH 1K1IA 1HAPH 4FUIA 1KXBA 3T26A 5JDUB 1O2WA 2ODQA 1CA8B 1DSTA 1D3TB 1LHGH 2R3YA 2Y6TA 3TU7H 1FAKH 2BDCA 3TGKE 5K7RA 3U8RH 1O30A 4A1XA 1O35A 4MG3A 1CA0B 3A87A 1DWEH 3V3MA 4CHAB 5JBBS 3PMAB 4KGAA 1UVOA 3RP2A 1YPKH 4X6MA 4ESTE 4IGDA 3S9BA 1FONA 5JBCS 4NZLA 1GDUA 2H9HA 1FI8A 4RKOB 3GY7A 3OY6U 3H7TA 1AE8H 1OPHB 3ZVGA 1C1WH 2BD7A 1VITH 3RLWH 4JK6A 4X1PU 1FQ3A 2EC9H 2F3CE 5FCRA 5E2PA 1AO5A 2BX4A 1WQSA 1WCZA 3ITIA 1XUFA 3BTTE 3T27A 3ZYEA 3W94A 2FTMA 1W0ZU 2GZ7A 4AFZA 1E34B 2QV1A 1Q31A 2GKVE 2QC2A 1C5OH 2ZHFH 1XKAC 1GBFA 1NRPH 2HALA 1A0JA 1LDTT 3DFLA 1XVMA 1G3BA 5A0CA 1XUJA 3MU0A 1QBVH 1N1LA 1F0UA 1HAZB 4Y0YE 3ATMA 1O2MA 2ZGXH 4NFFA 1OP8A 1HV7A 2ZFTA 1V2KT 1LKBA 1AU8A 3E3TA 3KQDA 3A7TA 3S7KB 1P0SH 1GHAG 1O2JA 1UO6A 3OYPA 3B23B 1S84A 3TK6A 1P3EA 3PTNA 2HNTC 1VJAU 3M7TA 1ZR0A 2F83A 3FAOA 1PQ5A 5EODA 1F7ZA 1SGFG 2O8MA 2ZO3H 3NPSA 3ZZ5A 4AG1A 3M3SA 4BXSA 2G5NA 1O5CB 2ZFQH 1P04A 2VIOA 1TYNA 2O8LA 1UTPA 2XNIA 3ATIA 1HLTH 3Q3XA 2VIWA 2JETC 4JCNA 5F8XA 1AGJA 1W11U 1TQ0B 2PKAA 5FBEA 4OGXA 2ZHDA 1C5PA 1P3CA 3QN7A 3SNBA 1O2PA 5DK1A 1Y59T 3QK1A 3SGAE 1MTNC 2F9NA 2AMPA 1ZJDA 3EGKH 3B9FH 1C9PA 4BOHA 3LC5A 2BVXH 2P16A 4A92A 1RTFB 4AYYB 5EQSA 4BNRA 3SOSA 3LH3A 1AVGH 2PHBA 1ZJKA 2BD3A 2BVRH 2OUAA 1C1VH 1F5LA 3AASA 1AN1E 1SQAA 2A5KA 1MZAA 2QAAA 4I8KA 3EAJA 2GDEH 2ULLA 5EXLA 1ZGVA 3P6ZB 2ZU1A 1NS3A 3URDA 7GCHG 1IHSH 3ZZ9A 4UD9H 3UOUA 1YPHE 2H9EH 1OP2A 4MPWA 3VXEH 4GVUA 1WYKA 3M3TA 3QX5H 3VB6A 3SJ9A 1O2OA 1CHOF 3T5FH 4D9RA 1C1NA 1DUEA 2ODYB 5DGJA 1PPEE 5T6FA 3TK9A 1IHTH 1TE0A 8KME2 2ALVA 1ELEE 3BG4C 1C1UH 1V2QT 2SGPE 1EAIA 1EATA 1C2DA 2FOFA 5FAHA 1NU7B 5HYOA 1V2WT 1P11E 2AGIX 3ENSB 4MNVA 1NFXA 1GI6A 1UTKA 4ZH8A 1YGCH 4Y6DA 3FZDA 1EXFA 1T31A 3CP7A 2ZGHA 3NUMA 4CR9A 1O2HA 2Q6FA 3CS7A 2VWNA 4BTTB 2JETB 1PPHE 2FO9A 2BLOA 3ZZDA 2XBYA 1C5WB 3SGBE 4CBNA 3NZIA 3RXEA 3TNSA 2BX3A 1K1LA 1YLCA 5AFYH 2AEIH 2PKSB 4YT6H 4ABEA 1O3AA 1K21H 1ZTKA 1FN6A 1S6HA 2HGTH 3KQEA 3D49H 5DP7A 1GJ8B 1K1MA 1QA0A 1Z8GA 3RMLH 4UFDH 3UQOA 1UTLM 2G81E 1THPB 1O2XA 1EOLA 1O2RA 1QJ1B 2BB4A 2PSXA 1P2IA 4A5TS 2A4RA 3NCLA 1J16A 3SZNA 4CRBA 2BXUH 4ZMAH 3UWJH 3MH6A 3GCTG 4Q7ZA 2J4IA 1MQ6A 1S85A 1VITF 4IS5A 2WPLS 4AGJA 4BANB 3ZVAA 2ZPQA 1GMDF 5E0HA 1IQHA 2IN2A 1G32B 3F1SB 5DJ7A 5A0AE 1O2IA 1GI9B 3O8CA 1C1MA 5C1XA 3ESTA 3DHKH 1RGQA 1EX3A 2P59A 1ETTH 4AFUA 4GSOA 2GT8A 4MNWA 2YOLA 1GBMA 1ETSH 4MVNA 1PPGE 4Q7XA 2ASUB 4AB8A 3D62A 2Z9JA 3BG4B 1ELCA 4ZUHA 2LNCA 2ZQ1A 2ZGBH 5FPTA 1QR3E 2VVVA 2ZI2H 3UNSA 3UFAA 1AD8H 4WH6A 5A0BA 1C1RA 4O9VA 2CGAA 1Y3XA 3GY6A 1IQJA 4BAQB 5GIBA 2AMQA 2ANWA 5DP5A 3A88A 2ZECA 1PPCE 5F03A 1FDPA 4B2AA 3R0FA 1MTSA 4WY3A 3B8JA 9ESTA 1BMAA 4YOIA 2Z7FE 1UHBA 4NFEA 4YLQH 4WXIA 1CT0E 1IQEA 2Z3DA 1TPSA 2ZFPH 4J1YA 1VCPA 1A0HB 2XCFA 3TPIZ 4E7RG 1PFXC 2C3SA 1TNIA 4X2XA 1Z6JH 4UEHH 5G4BA 4D7GA 3BTDE 3MHWU 3MH7A 1GHYH 4KELA 4ABBA 1VR1H 1PYTC 2TGPZ 3ZZ7A 1OWKA 4AYVB 1GBCA 3URCA 2ZDKA 5DP6A 2ZTXA 1K1JA 2BD5A 1T8LA 1AZ8A 2VB0A 5C2ZA 1BTWA 1FUJA 1EQ9A 5EQQA 1IQGA 1GI5A 2GP9B 2HRVA 3S7HB 4DIHH 3BEIB 2FDAA 3IITA 2KAIB 4IMQA 2W7SA 1MU8B 3KF2A 1QTFA 1OWIA 1UK3A 1V2NT 3M61U 5GCHG 1LHDH 2BDHA 2Y5GA 1AB9B 1TFXA 1KLIH 2ZP0H 1HAVB 2VJ1A 2LIZA 2W26A 4YT7H 4U30A 3HPTB 3PWCA 3LGVA 2Y7XA 1V2LT 3U69H 1MTWA 3VEQB 1EB1H 1KIGH 1DWCH 1RTLA 1KDQB 5CMXH 1YYY1 3S0NA 3H7OA 4FU7A 1MQ5A 4ZHMU 4MPVA 1AVXA 1J14A 4NIXA 5EU8A 1PPBH 2ZHWH 1AUJA 3TH2H 3SV7A 3P70B 2J9NA 3BTEE 1V2UT 1EP5A 1MTUA 3A86A 3VB7A 1QB1A 1DDJA 1SGDE 1A7SA 1ZPBA 2FLRH 1HB0B 1BMNH 1LHCH 2CF9H 1C4V2 1EZUC 1Z8IB 3MNXA 1BT7A 3IG6B 4AN7A 1MKXK 1C5NH 1MAXA 3RMOH 3E16B 2XBWA 1OX1A 1EJAA 1C1TA 1ID5H 4WVPE 1JRTA 3UNRA 1KXEA 3K6ZA 1SGIB 1OP0A 4QT8C 4Y8XA 3S69A 1QCPA 3GY4A 3U8OH 1MU6B 4INLA 2UWPA 4O3UA 5DP4A 3RXVA 1IQFA 2WPJS 2F9BH 3BTKE 2VWOA 1GG6C 3GY2A 3ZVFA 5E2OA 1C5VA 1G2MA 1GJ4H 4Q2KA 2ZGCA 1X7AC 5DPAA 5BPEA 3KNXA 3RM2H 1NO9H 3FANA 1B0EA 1QA7A 1PQ7A 5F8TA 3ATWA 3MH5A 1LPKB 3PROA 1D3PB 1JOUB 1HDTH 1UTQA 3KQBA 1YPMH 1RIWB 3ZVCA 3M36A 1BTPA 1O5FH 1XM1A 2ZTYA 2A5AA 2ZFFH 5A8ZA 4X6PA 2XCNA 3JZ2B 1ZSJA 1Y3UA 2ZCKP 4WXVA 4WWYA 1SHYA 1QL8A 3F6UH 1HAGE 1HFDA 3BTWE 3P8NA 1LQDB 2FM2A 1Z8JB 3FP7E 2ZC9H 3U8TH 4ZHLU 3SQEE 2H9TH 1NRNH 4BAHB 1ELAA 2Q1JA 4UFFH 3RMMH 1XUHA 4PROA 3L6PA 2G4UA 1O3FA 2WUBA 1OWJA 1S6FA 4NIYA 2HNTE 2AGEX 3SNEA 3OU0A 1GVZA 2ZGJA 2R0KA 3SHAH 1HIAA 1TA6A 5FXLA 4UFEH 3M7QA 1O34A 2FODA 3A8DA 1CA0C 1TAWA 2CV3A 3PLBA 3QZQA 1DFPA 5SGAE 4OS4A 2BDAA 4AFSA 2RG3A 1DOJA 4I8HA 2Z9IA 3SV2H 1O2NA 2EI6A 1AE5A 4HGCA 2OQ5A 4BAOB 1S0RA 1EASA 1KXAA 5FPSA 1ZTJA 1GG6B 1ZYOA 2BVSH 2OBQA 1BRAA 1J17T 1G3CA 3SUEA 3TJVA 4BAKB 2Q6GA 3GCHC 1P2MA 3A84A 1QNJA 4FVBA 1DXPA 1RXPA 1AWFH 1Y3YA 5JB8S 4GCHF 3E8LA 4FUHA 1ZMLA 3A7XA 3A8BA 2W3KA 1TGBA 2JH0D 3T28A 1TNKA 4K1TA 2F9OA 4HFPB 2C8WB 2Q6DA 2SNWA 3R3GB 1O3HA 2OC1A 5FX5A 2A31A 2UUJB 1WUNH 3M5MA 5JBTA 3RLYH 3VPKA 3S9CA 3P95A 3PM3A 1O5DH 1XXFA 1NRQH 1C2FA 1SLXB 4TY6A 2FOMB 5FHTA 3TJOA 3HGNA 4O03A 1HPGA 4I8GA 1BITA 1ZMNA 1E35B 1V3XA 3RXDA 1ZLRA 1SLVB 3TNTA 3LOXA 1DWBH 1YKTA 1QRXA 1WQVH 1WV7H 5GJ4B 5EG4A 3LONA 1A5HA 1CHOG 1GI4A 4UFGH 3RXMA 4MPXA 1O2QA 1O3MA 4MQAA 1OWHA 2XXLA 1HJ9A 3QUMP 3UOPA 4MDSA 4K8YA 5PTPA 2HNTF 1P09A 4MLFB 2CN0H 2XWBI 2Y5FA 3BTGE 1ANCA 3TGJE 4ZXYH 2UUYA 1O5EH 3RXJA 1C2IA 3LIWA 4FVDA 2XWAA 1SBWA 1K1NA 4HTCH 1NU9A 2XW9A 2ILNA 1S83A 3RXIA 1TA2A 1S5SA 2UUKB 1KXFA 1GMCF 1SOTA 2ZF0H 1W13U 1F0TA 4LZ1H 3GCHB 4Y0ZE 4D8NA 4XSKU 1AY6H 1SG8B 1VCQA 1J8AA 3UR9A 1GBAA 3A89A 3UY9A 2Y5HA 2QF3A 3C1KA 2OP9A 2OC8A 3SV9A 1EZSC 4ABHA 1G2LA 4FUDA 1DUAA 4TY7A 1TNGA 3ZVEA 1TPAE 2ZFRH 1LPZB 1DX5M 3OTJE 2G55A 2P93A 2BD4A 1FY1A 4Y10E 4X1QU 1TNLA 4WMFA 4INKA 1B5GH 3VB3A 1GDNA 3BEUA 2DE8A 2ZU2A 2NWNA 3GDUA 5FBIA 2VIPA 1S82A 3RXGA 4CREA 1O5AB 1FAXA 1TGNA 2OXSA 1GVKB 2H2ZA 1SFIA 3W95A 2WYJA 2OQUA 1WSSH 2GTBA 5TCCA 1UTMA 5IDKA 1QL9A 1GWAA 1INCA 2FXRA 1YCPH 4M7GA 4D7FA 1BHXB 1VGCC 2G00A 4JYUH 1C5SA 1SHHB 1GHBG 3E6PH 2OLGA 1AI8H 2VGCB 1D9IA 1KY9A 1SGPE 2QA9E 1GJ7B 1EAUA 1ZHRA 1L4ZA 3RXFA 3E0NB 1HAVA 2OINA 3EBNA 1SPJA 2K1QA 3RXSA 3MOCA 3QDZB 4Z0KA 1DLKB 1O3CA 2QYIA 3I77A 1Z71A 1AKSB 3ZZ4A 3OSYA 5K0HA 1IQNA 5AVDA 2ZDAH 1TPOA 3QWCH 1GBLA 2YNAA 2UUFB 2ZDMA 2RA3A 1SL3A 4VGCB 4A1VA 2D1JA 4F49A 3I29A 1KDQA 1C5ZB 2PKSC 3SU4A 1MBMA 1UTNA 5C1YA 3SU2A 2BMGB 1O3KA 2GCHF 1GGDC 3SU3A 2AGGX 5L30H 2A32A 1XUKA 5L6NH 3HATH 1C2EA 2P8OC 4K60A 5B6OA 5C5NA 1GBIA 2ZCHP 4NWKA 5E0GA 1O37A 2GGVB 4NA8A 2G8TA 2PWXA 1S0QA 1DSUA 1H4WA 3CENA 1ZRBA 1TABE 3U9AH 2HOBA 1O32A 5CE1A 1DY9A 4D76A 2ZPSA 4Y76A 1EKBB 1E0FD 4XOJA 2XC5A 1O3GA 2Z3CA 1GMHG 1D4PB 3A80A 4FUEA 4BXWA 4THNH 1GBEA 1BZXE 2PR3A 2STAE 3QTVH 3BTME 1SI5H 4O97A 3T2NA 1C2JA 1KTSB 3A82A 3VGCB 3DFJA 3V12A 1GL0E 6GCHF 2NU0E 3M7UA 3FP8E 1BJVA 1P06A 1Y3WA 4TWYA 2C8ZB 1PQAA 3HKIB 1FLEE 4JZFH 1D6WA 1G37A 4WJG2 3LC3A 3QGNB 1XKBC 1VGCB 3OY5U 3E90B 3OX7U 1O0DH 1EJMA 2J94A 4X2YA 3UIRA 1GPZA 4YZUA 2ANMH 3P8GA 2A7HA 3S9AA 2BDGA 5IYTA 5DP9A 3UQVA 1J15A 3KGPA 1O3NA 5L2ZH 1W3CA 2G52A 2GT7A 1TBRH 3SHCH 7LPRA 2C90B 4RSPA 1ELFA 1CHGA 1W2KH 2XBVA 1W10U 2GMTC 1G36A 2WINI 2BD2A 2P94A 5J4QA 2FYRA 3RXBA 1A3BH 1AIXH 1KLTA 2V0BA 4NWLA 1QBOA 2R3UA 1GGDB 1TMTH 2A7JA 2PGQB 1CSOE 3RMNH 1MD7A 1F92A 4UE7H 2P8OB 1A61H 3L3TA 4DIIH 3RXAA 3ZV9A 3RXTA 1OKXA 3FZZA 2OD3B 1WBGB 2K7XA 1C5TA 4I33A 1ORFA 4H42U 2SGAA 1HJ8A 1EAWA 3SO3A 1CQQA 2FP7B 3N7OA 2BHGA 4B76A 2AS9A 2NU1E 2ZDNA 4KKDA 1DS2E 1GI1A 1DVAH 1GL1A 1SC8U 1V2VT 2BLQA 8GCHG 1PPZA 2ANKH 5JPMH 2PLXA 3ODFA 3SORA 3A7VA 1AB9C 3SU1A 5A8YA 3EA7A 2PW8H 2ZA5A 5BRRE 2BM2A 1NTPA 5GWZA 3Q3KA 2IOTA 4ZAEA 3LU9B 1BTYA 1BJUA 1EPTA 1LHFH 4TPIZ 3UPEA 2D2DA 1DWDH 1C2GA 1GHAF 2JKHA 1CGIE 4KTSA 1GHWH 4K8BA 3ZZ6A 1QIXB 1NPMA 2AERH 2P95A 3BN9A 1SR5C 4B2BA 1TQ7B 3QTOH 3EYDA 3O8DA 1ZHMA 1THRH 1C5RA 3PB1E 2GMTB 2EEKA 5LPEA 2VIVA 5DO4H 3BSQA 1RS0A 2QXGA 4A1TA 4OS6A 4YOGA 1D6RA 4FUCA 4YLUA 1C5YB 2HPQH 2UWOA 4I32A 4GHQA 4CRAA 4MTBA 3TK5A 2O8WA 4IC5A 3T62A 3IWMA 1HCGA 1ANEA 3BF6H 4OS7A 1P2NA 4I31A 1MTVA 4SGBE 2VIDA 2A4GA 2PV9B 3V0XA 4I7YH 1EP6A 1CU1A 2A1DB 3LGTA 3MO6A 2ZWLH 5E8EH 4X8UH 3GYMA 7GCHF 4XDEA 3UNQA 1EOJA 4ABJA 1EZQA 3LT3A 1TBQH 3HK6B 5J4SA 1MMJN 1OYTH 1K22H 3KN2A 3BTFE 3P92A 3PTBA 1BCUH 4ABIA 4CRDA 3ZV8A 1W14U 3UTUH 3EE0B 4SGAE 1RIWC 5A09A 1AWHB 3DD2H 1GJDB 4AOQA 1K2I1 1YM0A 1A3EH 2SGEE 3GY8A 1XVOA 1YF4A 1TNHA 3T29A 2AIPA 1O38A 2V3HH 1OXGA 2SNVA 3I78A 3HKJB 3RM0H 2FPZA 1ESTA 2PKAB 2ZU4A 2A0QB 3EA9A 1O2YA 4B1TA 2Y81A 1HUTH 3GISB 1G30B 1LQEA 2HLCA 3AAUA 1ZZZA 1LVOA 4JZEH 1KYNA 1O2GH 1WAYB 2G51A 5C67A 1P12E 2ZG0H 3ZYDA 4FUFA 2ZDLA 3P8OA 1K28D 1WTGH 5JB9S 5EPYA 1MKWH 1BA8B 4LZ4B 1QB6A 1ZRKA 2FLBH 3QLPH 5E0JA 3ATKA 5DP8A 1QFKH 3ZVDA 4MNXA 2I6QA 2TBSA 3L33A 1L2EA 2ZNKH 3G01A 3RXRA 1S81A 2EI8A 4BAMB 1O3JA 1P2JA 1A46H 1J9CH 1IOEA 1LKAA 3ELAH 1AKSA 5EOKA 1T7CA 1Z1JA 5T6DA 5A2MH 1V2RT 2A4QA 2H5DA 3RUOA 2O8UA 2PSYA 5EW1H 2PUXB 1XMNB 1P10A 3UREA 5EW2H 4DW2U 4MPUA 2M5TA 2OTVA 2ZZUH 3SU0A 4NGAH 1T8OA 3VB5A 1O3EA 4ISIH 1FY5A 1IAUA 4K1SA 2O9QA 1B7XB 1QY6A 1P2KA 1A5IA 3MYWA 2OCVB 3GCOA 3NWUA 4OS1A 1GBDA 1GJBB 1JIRA 3SNDA 1A4WH 2XYAA 4DCDA 2RDLA 4FUGA 3ZZAA 5LH8A 2FOCA 3MH4A 3MFJA 3MU5A 3GY5A 4CH8B 1HRTH 4J2YB 1CBWB 3RXPA 2PFEA 4XE4A 1P03A 1C2MA 1ZGIA 5ABWA 2VVCA 2ZTZA 4HZHA 1BTUA 2AFQB 2W3IA 1BHXF 1YBWA 2FYQA 2D8WA 1Y5BT 5EQRA 4CRCA 1SGNE 4R0IA 1NESE 3UUZA 3TH3H 4X1NU 4A7IB 1BRUP 1GBKA 2V35A 1O5BB 1EJNA 1UCYH 1GBTA 1L1JA 1Z7KA 1HAHH 4YTAA 1D3DB 1TNJA 3U98H 1T4VH 5HM2A 3KCGH 1HAYB 1SMFE 1TBZH 3TLOA 2D26C 3DT0H 2OC0A
chains in the Genus database with same CATH superfamily
3BV9B 3PV5A 1BBRH 3EQ0H 1PQ8A 2K8IA 2WPMS 5C1UA 2VWLA 1Y5AT 4ABFA 3SW2B 3W1EA 3RXKA 3SU5A 1L4DA 1GI2A 1UK4A 5KECA 5TJXA 1N6YA 2PUQH 3LGYA 1GI0A 1UVPA 2F9UA 4FU9A 4Z6AH 1HJAC 2CMYA 3DA9B 5GCHF 1GHZA 2BY8X 1HAIH 2J92A 1GI7B 4JYTA 1AFEH 1C1OA 2FTLE 3P8FA 2Y7ZA 1TMBH 7KMEH 3PLKA 1QQUA 2CHAC 3ZVBA 4WMDA 1QHRB 1PPFE 3ZZ8A 1QQ4A 1SOZA 1QJ7B 1V2TT 2NU2E 3PO1B 4NIVA 2FI5E 2FIRH 3MU4A 5T3HA 1F2SE 4ISLA 3V13A 4YM9A 1HYLA 4DT7B 1PYTD 2BQWB 4B73A 1EUFA 4DVAU 1E38B 1ABJH 3EDXB 3F9FA 1F5KU 3MMGA 1M9UA 1C5XB 1ESAA 1BDAA 4NG9H 5CDFE 2BQ6B 2VGCC 5HMAA 2B9LA 1RD3B 1C5UA 2P3TB 2WPIS 4YO9A 3MNCA 3GDVA 2NU3E 3BG8A 3GYLB 5HM9A 2J95A 5DSFA 1P01A 4X0WU 1GI3A 3LJJA 1A1RA 8LPRA 2VH0A 3ATLA 2C4FH 3SNAA 5EJZA 1ESBA 1FPHH 1GCTC 2KZ4A 1UTJA 4VGCC 1DITH 2VVUA 5F53A 1UCYE 1TGTA 1TX8A 1W7GH 2Z9LA 2TPIZ 1OOKB 2QXIA 3LJOA 2UWLA 4AB9A 1DANH 1TONA 5GXPA 2VU8E 3M3VA 2JH6D 4LOYH 1GVLA 1THSH 1O3DA 5DP3A 3RXOA 3TVJB 2STBE 1L0ZA 1BBRE 4YESB 5C0UA 2EI7A 1FY8E 3LPRA 4K5ZA 3D65E 2DUCA 3GOVB 1ELVA 1OS8A 4GAWA 1VZQH 2VWMA 2GCTC 4CRFA 4WMEA 2BQ7B 4RKJB 3VG8A 1ETRH 1HJAB 1H1BA 2ALPA 5HGGA 1GJ6A 1JRSA 2XC4A 1VJ9U 5I46H 1A0LA 1LO6A 5CHBA 4OGYA 1O36A 5I25A 1ANBA 2FOEA 2QF4A 3MU1A 2BY6X 2CHAB 2BY5X 1ARBA 3Q77A 2QIQA 1SFQB 3RXHA 3KHVA 3SGQE 3VGCC 1VITG 1ZHPA 3U1JB 1NFYA 1DXWA 1COWD 1GMDG 2KR7A 2BY9X 4XBDA 2GD4B 2FI4E 2BLVA 1TMUH 2XNDD 3JZ1B 3MU8A 4I8JA 2QXJA 4B71A 5LGOA 2C8YB 4ISHH 2KAIA 4CRGA 4ZKSU 1NM6A 5AF9H 1TPPA 1TWXB 1IQIA 3GY3A 4X6NA 1ELBA 4E06H 4Y7AA 2ZPRA 3CS0A 3HK3B 4HI3A 1OHHD 1L1GA 3K6YA 2QF5A 8ESTE 1SLWB 1LCYA 9LPRA 4K1EA 4UDWH 1GDQA 2WZQA 2ESTE 1O2UA 4NCYA 1SGYE 1KLJH 4IBLH 2SGQE 1E37B 1O39A 1JMOH 3SJKA 1O2LA 3SI4H 3SV8A 1JXPA 1V2JT 4B2CA 3KEEA 2BYAX 1PJPA 1GCTB 1UTOA 1W12U 1TRMA 1C2HA 1AFQC 2Z6BD 4Y8ZA 4NA9H 2Z3EA 4FU8A 1VCWA 3BEFB 2Z94A 1YCPK 3FVFB 3SV6A 4F4OC 5HIZA 3F9GA 3KL6A 2AYWA 2DE9A 1CT2E 1HXEH 3RXQA 4ISOA 3VB4A 1C1SA 1TLDA 1ELDE 1W8BH 2W7UA 4BTUB 2ANYA 3A7YA 4NA7A 1QBNA 1YCPM 4XBBA 1UW7A 4E05H 2GCTB 2JJ1D 1O2SA 2YNBA 1O3OA 2A7CA 3DUXH 3LH1A 2VNTA 1RTKA 3KQCA 6ESTA 2FZZA 2FOGA 3RXLA 1OYQA 1AVWA 4H4FA 1BUIA 1C9TA 4IN2A 1O33A 1B0FA 1LPGB 4A6LA 1C2KA 1BQYA 1GBBA 1CVWH 1TOCB 2J34A 2V3MA 2W6ID 2RCEA 3V7TA 4H6TA 1TX6A 4CH2B 3U1IB 3Q00A 1ZSKA 4IMZA 4X8SH 1FMGA 1CE5A 2BZAA 3NXPA 1FN8A 1F0RA 1FY3A 1C4U2 2TGDA 4ABDA 3K9XB 4WF8A 5CHAC 1TALA 2A2QH 2GJGA 4TYDA 2SGDE 1P8VC 3RC6A 2QN5T 3LGUA 1N8OC 4AX9H 1DT2A 1Z8RA 3MQKC 5C5OA 3SJIA 5T6GA 1IQLA 1DLEA 1TGCA 2OBOA 4BTIB 2FI3E 1Z6EA 4I8LA 3K65B 1HIAB 2BXTH 1SSXA 1OWDA 1NFWA 3FOAA 4GLYA 4IC6A 3P17H 5FL7D 3SU6A 3WY8A 2V3OH 4X1RU 4IW4E 4NIWA 1LVMA 4ISNA 3N99A 2FEQH 1P05A 3F2GA 3TH4H 4ABAA 1SGFA 4Q7YA 1OWEA 2BLWA 4H6SB 5TCAA 2XC0A 1H8IH 2JH5D 1BOQA 1F0SA 1TX7A 1AFQB 3HGPA 3DSPA 3C27B 2ZEBA 4AC9A 2ZIQH 3STIA 2B8OH 3QO6A 1SQOA 4Y11E 1D3QB 2AH4X 2Z9KA 1CO7E 2FS8A 3ZZCA 1LMWB 2WV5A 1ZMJA 3NKKA 1MCVA 2G5VA 3VXFH 3AK5A 4KTCA 4Q80A 1ZSLA 2OC7A 1MTNB 1O2VA 2XOKD 1JWTA 1TB6H 1QRZA 4ZKNU 3PYHA 4JYVH 1A5GH 1FZZA 1SVPA 2HVXA 5ESTE 5EPNA 2ZCLP 1AZZA 1LHEH 1GCDA 1C4Y2 2BOKA 1SGCA 3BIVH 2GVFA 3K2UA 1P2QA 3RU4T 1GJCB 2A45B 1SGRE 1O3BA 2J2UA 4K3JA 1QGFA 1WTHD 4O3TA 3SBKA 1ELGA 1YPLH 3M5NA 3PMBB 3OEED 3AW1A 4B75A 3ODDA 2BD8A 4GHTA 1P2OA 3Q76A 1IQMA 1QL7A 3FKSD 1DE7H 5CHAB 1DM4B 2QGRA 1SGEE 4ZKOU 4KP0A 2XTTB 2W5EA 1N8OB 2FX4A 4AFQA 1WOFA 4OS5A 1W0YH 2PTCE 1KXDA 2F9PA 4XFQA 1O5GH 1C5QA 1SKYE 3MO9A 1T32A 1DY8A 2LELA 3RC5A 1ANDA 2R2WU 1FNIA 1RFNA 1K1OA 3A7ZA 2FWWA 1HBTH 1GHBF 3A8AA 3GCNA 3MNSA 4E7NA 4AORA 4DGJA 2P3UB 1V6DA 1SB1H 1CGJE 3GDSA 2RDEA 1EZXC 2CJIA 1SGTA 3SN8A 2BZ6H 3A7WA 3T25A 3M5OA 2IJOB 3LDXH 2GDDA 2QF0A 2TGTA 3N7DA 1MH0A 1XXDA 2ZKSA 2G4TA 2CF8H 4Y71A 2Y82A 1C2LA 6CHAC 4Y8YA 1EAXA 1MCTA 4TWWA 4X2VA 1Y5UT 5LPRA 1KSNA 5FX6A 1YY3A 5DG6A 4AGKA 3SUFA 3VFEA 5C3NA 5EXMA 5EXNA 1G3DA 4NZQA 3AVZA 5H4IB 3NK8A 1O2ZA 1TOMH 1MAYA 3ZZ3A 4XBCA 1O3PB 5GDSH 2WPHS 3SQHE 1QB9A 1C1PA 1YPEH 1T8MA 3EA8A 2H5CA 4NSYA 4DY7B 2GV6A 4Y79A 1EB2A 4LXBH 3OAAD 2EA3A 4ZROA 1GMHF 4OS2A 2F43B 3M37A 3BTHE 4UONA 2B0FA 1P9SA 3OTPA 3AW0A 7ESTE 4MNYA 1JIMA 3FP6E 1NC6A 4JMYA 1NRSH 3O8RA 1NN6A 2QCYA 1FJSA 1YPHC 2BTCE 1Y8TA 1Q3XA 4Y7BA 1IQKA 3LGWA 4GCHG 3E1XB 3MI4A 1XUIA 1ZTLA 5C20A 3F68H 2FX6A 2BY7X 2HPPH 5AHGH 1BRCE 1AHTH 1TRNA 1T8NA 2B5TB 2FOBA 2R2MB 3GICB 2Y80A 3RDZA 2A2XH 4X2WA 2BDYA 1K1PA 1MKXH 1SLUB 4ZHAA 1BMFD 4D9QA 3BTQE 3A83A 1GHVH 1AMHA 3RU4D 2I6SA 4Q4LA 2R9PA 2RA0A 3PV4A 2C93B 1CBWC 1CGHA 1NROH 5ETXA 4RT0A 4DG4A 2QXHA 1AUTC 1O3LA 1TRYA 2ZU3A 1BTXA 5FCKA 1UMAH 1BB0B 2PTNA 3H5CB 6CHAB 1MBQA 2VIQA 4U01A 5DKMA 3KQ5A 1Z1IA 1O3IA 5F8ZA 5L2YH 4K69A 5F6MA 4LK4A 3SUGA 5HXFA 5EGMA 2SGFE 1C5LH 4ZXXH 1H9HE 2P3FH 1CT4E 2VH6A 2ZQ2A 1UJ1A 5B6LA 1L1NA 3E0PB 3A81A 2BD9A 1MUEB 1KTTB 3SUDA 3TGIE 3PRDA 1LTOA 1V2MT 4JZDH 2GZ8A 2QY0B 2LPRA 4IN1A 4JZIA 2WPKS 3GCTF 1WDIA 3MNBA 1BMMH 1W0KD 1HXFH 4K2YA 2FOAA 3FFGA 1UK2A 2XBXA 3Q3YA 4RN6A 1SGQE 2J98B 3M35A 1GJ9B 1YC0A 1HGTH 2WV9A 1GMCG 3PLPA 2FESH 1ELTA 3E91A 2A5IA 1GHXH 1ZOMA 3MO3A 8GCHF 1E36B 5JBAS 2BDIA 2H1UA 1MKWK 4U2WA 3UR6A 3UWIA 2O8TA 1F5RA 1GJ5H 2WUCA 2Z9GA 1EPTC 4WH8A 1O2TA 1W7XH 1QURH 5GPIB 2HWLB 3RC4A 3LGIA 1NY22 2NU4E 3PWBA 1E79D 1UVUH 2BOHB 3PMHB 5EIYA 3PV2A 3A8CA 3PO1C 5ESBA 3FO8D 1HAOH 1FY4A 2CXVA 2WV4A 4DURA 1GBHA 1AQ7A 3LKWA 2FMJA 3TITA 1NT1A 1FIZA 2B7DH 1LVYA 1GJAB 1NFUA 2ZDVH 4X1SU 3RXUA 1G9IE 1YPJH 4DJZB 2V6NA 1HNEE 3SNCA 3QGJA 3SJ8A 3PRBA 1RRKA 5FPYA 4RT1A 4X8VH 1G3EA 4X6OA 1U6QA 2FOHA 3AAVA 1HAXB 5JYIA 4FUBA 1ACBE 3RXCA 1VKYA 1OSSA 1BMLA 4FXGH 2TGAA 1YLDA 1Q2WA 1BRBE 1GBJA 3BIUH 3TJNA 4INHA 1XUGA 1O31A 1NRRH 1P02A 1A2CH 4CBOA 2AMDA 1LVBA 1T4UH 2ODPA 1QJ6B 4AG2A 4GPGA 4ABGA 1V2PT 1H8DH 4ASHA 1N6XA 1KXCA 1RJXB 2PGBB 1WXRA 5AFZH 4AZ2B 1JBUH 1ARCA 3TIUA 2TIOA 2ZFSA 3M5LA 4KTUA 2SFAA 3SI3H 1S6LA 3OEHD 1MZDA 5A8XA 4CHAC 1H9IE 1H9LB 3A85A 2J38A 3F9EA 1GI8B 1O2KA 2AIQA 2C8XB 4R8TB 2L74A 2GCHG 2GX4A 1P57B 1P9UA 3TJUA 3STJA 4JZ1A 2ZHEH 1V2OT 1SQTA 1SQRA 1BIOA 2GV7A 2ZHQH 1H8HD 3RU4E 3EE7A 1XX9A 1NZQH 1EPTB 1YP9A 1TGSZ 1V2ST 1UCYK 1C1QA 4NSVA 1FV9A 1QZ8A 1UVTH 3ZZBA 1FXYA 3SJOA 1TIOA 2THFB 2VINA 4FUJA 4X8TH 1DPOA 1BBRK 1MD8A 3D23A 2GZ9A 2ZU5A 1C5MD 2IPHA 1UVSH 2A4OA 2FS9A 1DICA 4YOJA 2BDBA 3QZRA 4HG6A 4U32A 1UHBB 4ZKRU 1QRWA 4JK5A 6GCHG 2XRCA 1WU1A 3OE7D 4TPYA 1ZPZA 2H6MA 1BTHH 6LPRA 1ZPCA 1FIWA 4B74A 3PMJA 4CR5A 1ABIH 1BTZA 2F9VA 2WYGA 2F91A 1K9OE 4DOQA 3O8BA 3MWIU 1YPGH 4GUXA 3F9HA 1Y3VA 2R0LA 2JJ2D 2TRMA 3MTYA 3KIDU 1FPCH 1K1IA 1HAPH 4FUIA 1KXBA 3T26A 5JDUB 1O2WA 2ODQA 1CA8B 1DSTA 1D3TB 1LHGH 2R3YA 2Y6TA 3TU7H 1FAKH 2BDCA 3TGKE 5K7RA 3U8RH 1O30A 4A1XA 1O35A 4MG3A 1CA0B 3A87A 1DWEH 3V3MA 4CHAB 5JBBS 3PMAB 4KGAA 5GNDA 1UVOA 3RP2A 1YPKH 4X6MA 4ESTE 4IGDA 3S9BA 1FONA 5JBCS 4NZLA 1GDUA 2H9HA 1FI8A 4RKOB 3GY7A 3OY6U 3H7TA 1AE8H 1OPHB 3ZVGA 1C1WH 1NBMD 2BD7A 2IJD1 1VITH 3RLWH 1E1QD 4JK6A 4X1PU 1FQ3A 2EC9H 2F3CE 5FCRA 5E2PA 2OK5A 1AO5A 2BX4A 3DSGA 1WQSA 1WCZA 3ITIA 1XUFA 3BTTE 3T27A 3ZYEA 3W94A 2FTMA 1W0ZU 2GZ7A 4AFZA 1E34B 2QV1A 1Q31A 2GKVE 2QC2A 1C5OH 2ZHFH 2AHME 1XKAC 1GBFA 1NRPH 2HALA 1A0JA 1LDTT 3DFLA 1XVMA 1G3BA 5A0CA 1XUJA 3MU0A 1QBVH 1N1LA 1F0UA 1HAZB 4Y0YE 3ATMA 1O2MA 2ZGXH 4NFFA 1OP8A 1HV7A 2ZFTA 1V2KT 1LKBA 1AU8A 3E3TA 3KQDA 3A7TA 3S7KB 5EJ1A 1P0SH 1GHAG 1O2JA 1UO6A 3OYPA 3B23B 1S84A 3TK6A 1P3EA 3PTNA 2HNTC 1VJAU 3M7TA 1ZR0A 2F83A 3FAOA 1PQ5A 5EODA 1F7ZA 1SGFG 2O8MA 2ZO3H 3NPSA 3ZZ5A 4AG1A 3M3SA 4BXSA 2G5NA 1O5CB 2ZFQH 1P04A 2VIOA 1TYNA 2O8LA 1UTPA 2XNIA 3ATIA 1HLTH 3Q3XA 2VIWA 2K0QA 2JETC 4JCNA 5F8XA 1AGJA 1W11U 1TQ0B 2PKAA 5FBEA 4OGXA 2ZHDA 1C5PA 1P3CA 3QN7A 3SNBA 1O2PA 5DK1A 3SYJA 1Y59T 3QK1A 3SGAE 1MTNC 2F9NA 2AMPA 1ZJDA 3EGKH 3B9FH 1C9PA 4BOHA 3LC5A 3CNRA 2BVXH 2P16A 4A92A 1RTFB 4AYYB 5EQSA 4BNRA 3SOSA 3LH3A 1AVGH 2PHBA 1ZJKA 2BD3A 2BVRH 2OUAA 3GS9A 1C1VH 1F5LA 3AASA 1AN1E 1SQAA 2A5KA 1MZAA 2QAAA 4I8KA 3EAJA 2GDEH 2ULLA 4P00A 5EXLA 1ZGVA 3P6ZB 2ZU1A 1NS3A 3URDA 7GCHG 1IHSH 3ZZ9A 4UD9H 3UOUA 1KMHB 1YPHE 2H9EH 1OP2A 2KCOA 4MPWA 3VXEH 4GVUA 1WYKA 3M3TA 3QX5H 3VB6A 3SJ9A 1O2OA 1CHOF 3T5FH 4D9RA 1C1NA 1DUEA 2ODYB 5DGJA 1PPEE 5T6FA 3TK9A 1IHTH 1TE0A 8KME2 2ALVA 1ELEE 3BG4C 1C1UH 1V2QT 2SGPE 1EAIA 1EATA 1C2DA 2FOFA 5FAHA 1NU7B 5HYOA 1V2WT 1P11E 2AGIX 5EJLA 3ENSB 4MNVA 1NFXA 1GI6A 1UTKA 4ZH8A 1YGCH 4Y6DA 3FZDA 1EXFA 1T31A 3CP7A 2ZGHA 3NUMA 4CR9A 1O2HA 2Q6FA 3CS7A 1NBME 2VWNA 4BTTB 2JETB 1PPHE 2FO9A 2BLOA 2YMSB 5IK2D 3ZZDA 2XBYA 1C5WB 3SGBE 4CBNA 3NZIA 3RXEA 3TNSA 2KM0A 2BX3A 1K1LA 1YLCA 5AFYH 2AEIH 2PKSB 4YT6H 4ABEA 1O3AA 1K21H 1ZTKA 1FN6A 1S6HA 2HGTH 3KQEA 3D49H 5DP7A 1GJ8B 1K1MA 2J5UA 1QA0A 1Z8GA 3RMLH 4UFDH 3UQOA 1UTLM 2G81E 1THPB 2KCPA 1O2XA 1EOLA 1O2RA 1QJ1B 2BB4A 2PSXA 1P2IA 4A5TS 2A4RA 3NCLA 1J16A 3SZNA 4CRBA 2BXUH 4DT4A 4ZMAH 3DSOA 3UWJH 3MH6A 2CK3D 3GCTG 4Q7ZA 3F3BA 2J4IA 4ZCNA 1MQ6A 1S85A 1VITF 4IS5A 2WPLS 4AGJA 4BANB 3ZVAA 2ZPQA 1GMDF 5E0HA 1IQHA 3UAIC 2IN2A 1G32B 3F1SB 4M9FA 5DJ7A 5A0AE 1O2IA 1GI9B 3O8CA 1C1MA 5C1XA 3ESTA 3DHKH 1RGQA 1EX3A 2P59A 1ETTH 4AFUA 4GSOA 2GT8A 1EFRD 4MNWA 1K0HA 2YOLA 1GBMA 1ETSH 4MVNA 1PPGE 4Q7XA 2ASUB 1YWUA 4AB8A 3D62A 2Z9JA 3BG4B 1ELCA 4ZUHA 2LNCA 2ZQ1A 2ZGBH 5FPTA 1QR3E 2VVVA 2ZI2H 3UNSA 3UFAA 1AD8H 4WH6A 5A0BA 1C1RA 4P02A 4O9VA 2CGAA 1Y3XA 3GY6A 1IQJA 4BAQB 5GIBA 2AMQA 2ANWA 5DP5A 3A88A 2ZECA 1PPCE 5F03A 1FDPA 4B2AA 3R0FA 1MTSA 4WY3A 3B8JA 9ESTA 1BMAA 4YOIA 2Z7FE 1UHBA 4NFEA 4YLQH 4WXIA 1CT0E 1IQEA 2Z3DA 1TPSA 2ZFPH 4J1YA 1VCPA 1A0HB 2XCFA 3TPIZ 4E7RG 2WHXA 1PFXC 2C3SA 1TNIA 4X2XA 1Z6JH 4UEHH 5G4BA 3SZEA 4D7GA 3BTDE 3MHWU 3MH7A 1GHYH 2HLDD 4KELA 4ABBA 2WSSD 1VR1H 1PYTC 2TGPZ 4OM9A 1OWKA 3ZZ7A 4AYVB 4TSFD 1GBCA 3URCA 2ZDKA 5DP6A 2ZTXA 1K1JA 2BD5A 1T8LA 1AZ8A 2VB0A 5C2ZA 1BTWA 1FUJA 1EQ9A 5EQQA 1IQGA 1GI5A 2GP9B 2HRVA 3S7HB 4DIHH 3BEIB 2FDAA 1E1RD 3IITA 2KAIB 4IMQA 2W7SA 1MU8B 3KF2A 1QTFA 1OWIA 1UK3A 1V2NT 3M61U 5GCHG 1LHDH 2BDHA 2Y5GA 3DCLA 1AB9B 1TFXA 1KLIH 2ZP0H 1HAVB 2VJ1A 2LIZA 2W26A 4YT7H 4U30A 3HPTB 3PWCA 3LGVA 2Y7XA 1V2LT 3F0PA 3U69H 1MTWA 3VEQB 1EB1H 1KIGH 1DWCH 1RTLA 1KDQB 2KCYA 5CMXH 1YYY1 3S0NA 3H7OA 4FU7A 1MQ5A 4ZHMU 4MPVA 1AVXA 1J14A 4NIXA 5EU8A 1PPBH 2ZHWH 1AUJA 3TH2H 3SV7A 3P70B 2J9NA 3BTEE 1V2UT 1EP5A 1MTUA 3A86A 3VB7A 1QB1A 1DDJA 1SGDE 1A7SA 5T1VA 1ZPBA 2FLRH 1HB0B 1BMNH 1LHCH 2CF9H 1C4V2 1EZUC 1Z8IB 3MNXA 1BT7A 3IG6B 4AN7A 1MKXK 1C5NH 1MAXA 3RMOH 3E16B 2XBWA 3ZIAD 1OX1A 1EJAA 2QE7D 1C1TA 1ID5H 4WVPE 1JRTA 5LPFA 3UNRA 1KXEA 3K6ZA 1SGIB 1OP0A 5DN6D 4QT8C 4Y8XA 3S69A 1QCPA 3GY4A 3U8OH 1MU6B 4INLA 2UWPA 4O3UA 5DP4A 3RXVA 1IQFA 2WPJS 2RFKC 2F9BH 3BTKE 2VWOA 1GG6C 3GY2A 3ZVFA 5E2OA 1C5VA 1G2MA 1GJ4H 4Q2KA 2ZGCA 1X7AC 5DPAA 5BPEA 3KNXA 3RM2H 1NO9H 3FANA 1B0EA 1QA7A 1PQ7A 5F8TA 3ATWA 4F48B 3MH5A 5C17A 3WWBA 1LPKB 3PROA 1D3PB 1JOUB 1HDTH 1UTQA 3KQBA 1YPMH 1RIWB 3ZVCA 3M36A 1BTPA 1O5FH 1XM1A 2ZTYA 2A5AA 1MABB 2ZFFH 5A8ZA 4X6PA 2XCNA 3JZ2B 1ZSJA 1Y3UA 2ZCKP 4WXVA 4WWYA 1SHYA 1QL8A 3F6UH 1HAGE 1HFDA 3BTWE 3P8NA 1LQDB 2FM2A 1Z8JB 3FP7E 2ZC9H 3U8TH 4ZHLU 3SQEE 2H9TH 1NRNH 4BAHB 1ELAA 2Q1JA 4Q63A 4UFFH 3RMMH 1XUHA 4PROA 3L6PA 2G4UA 1O3FA 2WUBA 1OWJA 1S6FA 4NIYA 2HNTE 2AGEX 4TT3D 3SNEA 3OU0A 1GVZA 2ZGJA 2R0KA 3SHAH 1HIAA 1TA6A 5FXLA 4UFEH 3M7QA 1O34A 2FODA 3A8DA 1CA0C 1TAWA 2CV3A 3PLBA 3QZQA 1DFPA 5SGAE 4OS4A 2BDAA 4AFSA 2RG3A 5C94A 1DOJA 4I8HA 2Z9IA 3SV2H 1O2NA 4FOUC 2EI6A 1AE5A 4HGCA 2OQ5A 4BAOB 3U28C 2KFWA 1S0RA 1EASA 1KXAA 5FPSA 1ZTJA 1GG6B 1ZYOA 2BVSH 2OBQA 1BRAA 1J17T 1G3CA 3SUEA 3TJVA 4BAKB 2Q6GA 3GCHC 1P2MA 3A84A 4B6FA 1QNJA 4FVBA 1DXPA 1RXPA 1AWFH 1Y3YA 5JB8S 1FX0B 4GCHF 3E8LA 4FUHA 1ZMLA 3A7XA 3A8BA 2W3KA 1TGBA 2JH0D 3T28A 1TNKA 4K1TA 2F9OA 4HFPB 2C8WB 2EY4C 2Q6DA 2SNWA 3R3GB 1O3HA 2OC1A 5FX5A 2A31A 2UUJB 1WUNH 3M5MA 3FN8A 5JBTA 3RLYH 3VPKA 3KYGA 3S9CA 3P95A 3PM3A 1O5DH 1XXFA 1NRQH 3N7EA 1C2FA 1SLXB 4TY6A 2FOMB 4RI0A 5FHTA 3TJOA 3HGNA 4O03A 1HPGA 4I8GA 1BITA 1ZMNA 1E35B 1V3XA 3RXDA 1ZLRA 1SLVB 3TNTA 3LOXA 1DWBH 1YKTA 1QRXA 1WQVH 1WV7H 5GJ4B 5EG4A 3LONA 1A5HA 1CHOG 1GI4A 4UFGH 3RXMA 4MPXA 1O2QA 1O3MA 4MQAA 1OWHA 2XXLA 3KYFA 1HJ9A 3QUMP 3UOPA 4MDSA 4K8YA 5PTPA 1H8ED 2HNTF 2W6JD 1P09A 4B6EA 4MLFB 2CN0H 2XWBI 2Y5FA 3BTGE 1ANCA 3TGJE 4ZXYH 2UUYA 1O5EH 3RXJA 1C2IA 3LIWA 2JIZD 4FVDA 2XWAA 1SBWA 1K1NA 4XRNA 4HTCH 1NU9A 4ASUD 2XW9A 2ILNA 1S83A 3RXIA 1TA2A 1S5SA 2UUKB 1KXFA 1GMCF 1SOTA 2ZF0H 1W13U 1F0TA 4LZ1H 3GCHB 4Y0ZE 1W0JD 4XSKU 1AY6H 1SG8B 4D8NA 1VCQA 1J8AA 3UR9A 1GBAA 3A89A 3UY9A 2Y5HA 2QF3A 3C1KA 2OP9A 2OC8A 3SV9A 1EZSC 4ABHA 1G2LA 4FUDA 1DUAA 4TY7A 1TNGA 3ZVEA 1TPAE 2ZFRH 1LPZB 1DX5M 3OTJE 2G55A 3UB0A 2P93A 2BD4A 1FY1A 4Y10E 4X1QU 1TNLA 4WMFA 4INKA 1B5GH 3VB3A 1GDNA 3BEUA 2DE8A 2ZU2A 2NWNA 3GDUA 5FBIA 2VIPA 3WWFA 1S82A 3RXGA 4CREA 1O5AB 1FAXA 1TGNA 2OXSA 1GVKB 2H2ZA 1SFIA 3W95A 2WYJA 2OQUA 1WSSH 2GTBA 5TCCA 1UTMA 5IDKA 1QL9A 1GWAA 1INCA 2FXRA 1YCPH 4M7GA 4D7FA 1BHXB 1VGCC 2G00A 4JYUH 1C5SA 1SHHB 4ACAA 1GHBG 3E6PH 2OLGA 1AI8H 2VGCB 1D9IA 1KY9A 1SGPE 2QA9E 2EQNA 1GJ7B 1EAUA 1ZHRA 1L4ZA 3RXFA 3E0NB 1HAVA 2OINA 3EBNA 1SPJA 2K1QA 3RXSA 3MOCA 3QDZB 4Z0KA 1DLKB 1O3CA 2QYIA 3I77A 1Z71A 1AKSB 2YMSC 3ZZ4A 3OSYA 5K0HA 1IQNA 5AVDA 2ZDAH 1TPOA 3QWCH 1GBLA 2YNAA 2UUFB 2ZDMA 2RA3A 1SL3A 4VGCB 4A1VA 5C0TA 2D1JA 4F49A 3I29A 1KDQA 1C5ZB 2PKSC 3SU4A 1MBMA 1UTNA 5C1YA 3SU2A 2BMGB 1O3KA 2GCHF 3NRLA 1GGDC 3SU3A 2AGGX 5L30H 2A32A 1XUKA 5L6NH 3HATH 1C2EA 2P8OC 4K60A 5B6OA 5C5NA 1GBIA 2PP6A 2ZCHP 4NWKA 5E0GA 1O37A 2GGVB 4NA8A 2G8TA 2WPDD 2PWXA 1S0QA 5KEDA 1DSUA 1H4WA 3CENA 1ZRBA 1TABE 3U9AH 2HOBA 1O32A 5CE1A 1DY9A 4D76A 2ZPSA 4Y76A 1EKBB 1E0FD 4XOJA 2XC5A 1O3GA 2Z3CA 3OFND 2IPQX 1GMHG 1D4PB 3A80A 4FUEA 4BXWA 4THNH 1GBEA 1BZXE 2PR3A 2STAE 3QTVH 3BTME 1SI5H 4O97A 3T2NA 1C2JA 1KTSB 3A82A 3VGCB 3DFJA 2J98A 3V12A 1GL0E 6GCHF 2NU0E 3M7UA 3FP8E 1BJVA 1P06A 1Y3WA 4TWYA 2C8ZB 1PQAA 3HKIB 1FLEE 4JZFH 1D6WA 1G37A 4WJG2 3LC3A 3QGNB 1XKBC 1VGCB 3OY5U 3E90B 3OX7U 1O0DH 1EJMA 2J94A 4X2YA 3UIRA 1GPZA 4YZUA 2ANMH 3P8GA 2A7HA 3S9AA 2BDGA 5IYTA 5DP9A 3UQVA 4Z1MD 1J15A 3KGPA 1O3NA 5L2ZH 1W3CA 2G52A 2L6OA 2GT7A 1TBRH 5KGOA 3SHCH 7LPRA 2C90B 4RSPA 1ELFA 1CHGA 1W2KH 2XBVA 1W10U 2GMTC 1G36A 2WINI 2BD2A 2P94A 5J4QA 2FYRA 3RXBA 3F0OA 1A3BH 1AIXH 1KLTA 2V0BA 4NWLA 1QBOA 2R3UA 1GGDB 1TMTH 3F2HA 2A7JA 2PGQB 1CSOE 3RMNH 1MD7A 2F4LA 2V7QD 1F92A 4UE7H 2P8OB 1A61H 3L3TA 4DIIH 3RXAA 3ZV9A 3RXTA 5HIYA 1OKXA 3FZZA 2OD3B 1WBGB 2K7XA 1C5TA 4I33A 1ORFA 4H42U 2SGAA 1HJ8A 1EAWA 3SO3A 1CQQA 2FP7B 2J97A 3N7OA 2BHGA 4B76A 2AS9A 2NU1E 2ZDNA 4KKDA 1DS2E 1GI1A 1DVAH 1GL1A 1SC8U 1V2VT 2BLQA 8GCHG 1PPZA 2ANKH 5JPMH 2PLXA 3ODFA 3SORA 3A7VA 1AB9C 3SU1A 5A8YA 3EA7A 2PW8H 2ZA5A 5BRRE 2BM2A 1NTPA 5GWZA 3Q3KA 2IOTA 4ZAEA 4F55A 3LU9B 1BTYA 1BJUA 1EPTA 1LHFH 4TPIZ 3UPEA 2D2DA 1DWDH 1C2GA 1GHAF 2JKHA 1CGIE 4KTSA 1GHWH 4K8BA 3ZZ6A 1QIXB 1NPMA 2AERH 2P95A 3BN9A 1SR5C 4B2BA 1TQ7B 2KCAA 3QTOH 3EYDA 3O8DA 1ZHMA 1THRH 1C5RA 3PB1E 2GMTB 2EEKA 5LPEA 2VIVA 5DO4H 3BSQA 1RS0A 2QXGA 4A1TA 4OS6A 4YOGA 1D6RA 4FETA 4FUCA 4YLUA 1C5YB 2HPQH 2HVYB 2UWOA 4I32A 4GHQA 4CRAA 4MTBA 3TK5A 2O8WA 4IC5A 3T62A 3IWMA 1HCGA 1ANEA 3BF6H 4OS7A 1P2NA 4I31A 1MTVA 4SGBE 2VIDA 2A4GA 2PV9B 3V0XA 4I7YH 1EP6A 1CU1A 4ACBA 2A1DB 3LGTA 3MO6A 2ZWLH 5E8EH 4X8UH 3GYMA 7GCHF 5HKKD 4XDEA 3UNQA 1EOJA 4ABJA 1EZQA 3LT3A 1TBQH 3HK6B 5J4SA 4YXWD 1MMJN 1OYTH 1K22H 3KN2A 3BTFE 3P92A 3WW7A 2YMSD 3PTBA 1BCUH 4ABIA 4CRDA 3ZV8A 1W14U 3UTUH 3EE0B 4SGAE 1RIWC 5A09A 1AWHB 3DD2H 1GJDB 4AOQA 1K2I1 1YM0A 1A3EH 2SGEE 2LP6A 3GY8A 1XVOA 1YF4A 1TNHA 3T29A 2AIPA 1O38A 2V3HH 1OXGA 2SNVA 3I78A 3HKJB 3RM0H 2FPZA 2JDID 1ESTA 4XD7D 2PKAB 2ZU4A 2A0QB 3EA9A 1O2YA 4B1TA 2Y81A 1HUTH 3GISB 1G30B 1LQEA 2HLCA 3AAUA 1ZZZA 1LVOA 3F2FA 4JZEH 1KYNA 1O2GH 1WAYB 2G51A 5C67A 1P12E 2ZG0H 3ZYDA 4FUFA 2ZDLA 3P8OA 1K28D 1WTGH 5JB9S 5EPYA 1MKWH 1BA8B 4LZ4B 1QB6A 1ZRKA 2FLBH 3QLPH 5E0JA 3ATKA 5DP8A 1QFKH 3ZVDA 4MNXA 2I6QA 2TBSA 3L33A 1L2EA 2ZNKH 3G01A 3RXRA 1S81A 2EI8A 4BAMB 1O3JA 1P2JA 1A46H 1J9CH 1IOEA 2VBCA 1LKAA 3ELAH 1AKSA 5EOKA 1T7CA 1Z1JA 5T6DA 5A2MH 1V2RT 2A4QA 2H5DA 3RUOA 2O8UA 2PSYA 5EW1H 2PUXB 1XMNB 1P10A 3UREA 5EW2H 4DW2U 4MPUA 2M5TA 2OTVA 2ZZUH 3SU0A 2KX4A 4NGAH 1T8OA 3H09A 4I86A 3VB5A 2M2AA 1O3EA 4ISIH 1FY5A 1IAUA 4K1SA 2O9QA 1B7XB 1QY6A 1P2KA 1A5IA 3MYWA 2OCVB 3GCOA 3NWUA 4OS1A 1GBDA 1GJBB 1JIRA 3SNDA 1A4WH 2XYAA 4DCDA 2RDLA 4FUGA 3ZZAA 5LH8A 2FOCA 3MH4A 3MFJA 3MU5A 3GY5A 1YLNA 4CH8B 1HRTH 4J2YB 1CBWB 3RXPA 2PFEA 4XE4A 1P03A 1C2MA 1ZGIA 5ABWA 2VVCA 2ZTZA 4HZHA 1BTUA 2AFQB 2W3IA 1BHXF 1YBWA 2FYQA 2D8WA 1Y5BT 5EQRA 4CRCA 1SGNE 4R0IA 1NESE 3UUZA 3TH3H 4X1NU 4A7IB 1BRUP 1GBKA 2V35A 1O5BB 1EJNA 1UCYH 1GBTA 1L1JA 1Z7KA 1HAHH 4YTAA 1D3DB 1TNJA 3U98H 1T4VH 5HM2A 3KCGH 1HAYB 1SMFE 1TBZH 3TLOA 2D26C 3DT0H 2OC0A
chains in the Genus database with same CATH topology
3BV9B 1BBRH 3EQ0H 1PQ8A 2WPMS 5C1UA 2VWLA 1Y5AT 4ABFA 3SW2B 3RXKA 3SU5A 1L4DA 1GI2A 1UK4A 5TJXA 1N6YA 2PUQH 3LGYA 1GI0A 1UVPA 2F9UA 4FU9A 4Z6AH 1HJAC 2CMYA 3DA9B 5GCHF 1GHZA 2BY8X 1HAIH 2J92A 1GI7B 4JYTA 1AFEH 1C1OA 2FTLE 3P8FA 2Y7ZA 1TMBH 7KMEH 3PLKA 1QQUA 2CHAC 3ZVBA 4WMDA 1QHRB 1PPFE 3ZZ8A 1QQ4A 1SOZA 1QJ7B 1V2TT 2NU2E 3PO1B 4NIVA 2FI5E 2FIRH 3MU4A 5T3HA 1F2SE 4ISLA 3V13A 4YM9A 1HYLA 4DT7B 1PYTD 2BQWB 4B73A 1EUFA 4DVAU 1E38B 1ABJH 3EDXB 3F9FA 1F5KU 3MMGA 1M9UA 1C5XB 1ESAA 1BDAA 4NG9H 2BQ6B 2VGCC 5HMAA 2B9LA 1RD3B 1C5UA 2P3TB 2WPIS 4YO9A 3MNCA 3GDVA 2NU3E 3BG8A 3GYLB 5HM9A 2J95A 1P01A 4X0WU 1GI3A 3LJJA 1A1RA 8LPRA 2VH0A 3ATLA 2C4FH 3SNAA 1ESBA 1FPHH 1GCTC 1UTJA 4VGCC 1DITH 2VVUA 1UCYE 1TGTA 1TX8A 1W7GH 2Z9LA 2TPIZ 1OOKB 2QXIA 3LJOA 2UWLA 4AB9A 1DANH 1TONA 5GXPA 2VU8E 3M3VA 2JH6D 4LOYH 1GVLA 1THSH 1O3DA 5DP3A 3RXOA 3TVJB 2STBE 1L0ZA 1BBRE 4YESB 2EI7A 1FY8E 3LPRA 4K5ZA 3D65E 2DUCA 3GOVB 1ELVA 1OS8A 4GAWA 1VZQH 2VWMA 2GCTC 4CRFA 4WMEA 2BQ7B 4RKJB 1ETRH 1HJAB 1H1BA 2ALPA 5HGGA 1GJ6A 1JRSA 2XC4A 1VJ9U 5I46H 1A0LA 1LO6A 4OGYA 1O36A 5I25A 1ANBA 2FOEA 3MU1A 2BY6X 2CHAB 2BY5X 1ARBA 3Q77A 2QIQA 1SFQB 3RXHA 3KHVA 3SGQE 3VGCC 1VITG 1ZHPA 3U1JB 1NFYA 1DXWA 1GMDG 2BY9X 4XBDA 2GD4B 2FI4E 2BLVA 1TMUH 3JZ1B 3MU8A 4I8JA 2QXJA 4B71A 5LGOA 2C8YB 4ISHH 2KAIA 4CRGA 4ZKSU 1NM6A 5AF9H 1TPPA 1TWXB 1IQIA 3GY3A 4X6NA 1ELBA 4E06H 4Y7AA 2ZPRA 3CS0A 3HK3B 4HI3A 1L1GA 3K6YA 8ESTE 1SLWB 1LCYA 9LPRA 4K1EA 4UDWH 1GDQA 2ESTE 1O2UA 4NCYA 1SGYE 1KLJH 4IBLH 2SGQE 1E37B 1O39A 1JMOH 3SJKA 1O2LA 3SI4H 3SV8A 1JXPA 1V2JT 4B2CA 3KEEA 2BYAX 1PJPA 1GCTB 1UTOA 1W12U 1TRMA 1C2HA 1AFQC 2Z6BD 4Y8ZA 4NA9H 2Z3EA 4FU8A 1VCWA 3BEFB 2Z94A 1YCPK 3FVFB 3SV6A 4F4OC 3F9GA 3KL6A 2AYWA 2DE9A 1CT2E 1HXEH 3RXQA 4ISOA 3VB4A 1C1SA 1TLDA 1ELDE 1W8BH 2W7UA 4BTUB 2ANYA 3A7YA 4NA7A 1QBNA 1YCPM 4XBBA 4E05H 2GCTB 1O2SA 2YNBA 1O3OA 2A7CA 3DUXH 3LH1A 2VNTA 1RTKA 3KQCA 6ESTA 2FZZA 2FOGA 3RXLA 1OYQA 1AVWA 4H4FA 1BUIA 1C9TA 4IN2A 1O33A 1B0FA 1LPGB 4A6LA 1C2KA 1BQYA 1GBBA 1CVWH 1TOCB 2J34A 2RCEA 3V7TA 4H6TA 1TX6A 4CH2B 3U1IB 3Q00A 1ZSKA 4IMZA 4X8SH 1FMGA 1CE5A 2BZAA 3NXPA 1FN8A 1F0RA 1FY3A 1C4U2 2TGDA 4ABDA 3K9XB 4WF8A 5CHAC 1TALA 2A2QH 4TYDA 2SGDE 1P8VC 3RC6A 2QN5T 3LGUA 1N8OC 4AX9H 1DT2A 1Z8RA 5C5OA 3SJIA 5T6GA 1IQLA 1DLEA 1TGCA 2OBOA 4BTIB 2FI3E 1Z6EA 4I8LA 3K65B 1HIAB 2BXTH 1SSXA 1OWDA 1NFWA 4GLYA 4IC6A 3P17H 3SU6A 3WY8A 2V3OH 4X1RU 4IW4E 4NIWA 1LVMA 4ISNA 2FEQH 1P05A 3TH4H 4ABAA 1SGFA 4Q7YA 1OWEA 2BLWA 4H6SB 5TCAA 2XC0A 1H8IH 2JH5D 1BOQA 1F0SA 1TX7A 1AFQB 3HGPA 3C27B 2ZEBA 2ZIQH 3STIA 2B8OH 3QO6A 1SQOA 4Y11E 1D3QB 2AH4X 2Z9KA 1CO7E 2FS8A 3ZZCA 1LMWB 2WV5A 1ZMJA 3NKKA 1MCVA 2G5VA 3VXFH 4KTCA 4Q80A 1ZSLA 2OC7A 1MTNB 1O2VA 1JWTA 1TB6H 1QRZA 4ZKNU 3PYHA 4JYVH 1A5GH 1FZZA 1SVPA 2HVXA 5ESTE 5EPNA 2ZCLP 1AZZA 1LHEH 1GCDA 1C4Y2 2BOKA 1SGCA 3BIVH 2GVFA 3K2UA 1P2QA 3RU4T 1GJCB 2A45B 1SGRE 1O3BA 2J2UA 4K3JA 1QGFA 1WTHD 4O3TA 3SBKA 1ELGA 1YPLH 3M5NA 3PMBB 3AW1A 4B75A 3ODDA 2BD8A 4GHTA 1P2OA 3Q76A 1IQMA 1QL7A 1DE7H 5CHAB 1DM4B 2QGRA 1SGEE 4ZKOU 4KP0A 2XTTB 2W5EA 1N8OB 2FX4A 4AFQA 1WOFA 4OS5A 1W0YH 2PTCE 1KXDA 2F9PA 4XFQA 1O5GH 1C5QA 3MO9A 1T32A 1DY8A 3RC5A 1ANDA 2R2WU 1FNIA 1RFNA 1K1OA 3A7ZA 2FWWA 1HBTH 1GHBF 3A8AA 3GCNA 3MNSA 4E7NA 4AORA 4DGJA 2P3UB 1V6DA 1SB1H 1CGJE 3GDSA 1EZXC 2CJIA 1SGTA 3SN8A 2BZ6H 3A7WA 3T25A 3M5OA 2IJOB 3LDXH 2GDDA 2QF0A 2TGTA 1MH0A 1XXDA 2ZKSA 2G4TA 2CF8H 4Y71A 2Y82A 1C2LA 6CHAC 4Y8YA 1EAXA 1MCTA 4TWWA 4X2VA 1Y5UT 5LPRA 1KSNA 5FX6A 5DG6A 4AGKA 3SUFA 3VFEA 5C3NA 5EXMA 5EXNA 1G3DA 4NZQA 3AVZA 5H4IB 3NK8A 1O2ZA 1TOMH 1MAYA 3ZZ3A 4XBCA 1O3PB 5GDSH 2WPHS 3SQHE 1QB9A 1C1PA 2H5CA 1T8MA 3EA8A 1YPEH 4NSYA 4DY7B 2GV6A 4Y79A 1EB2A 4LXBH 2EA3A 4ZROA 1GMHF 4OS2A 3M37A 3BTHE 4UONA 2B0FA 1P9SA 3AW0A 7ESTE 4MNYA 1JIMA 3FP6E 1NC6A 4JMYA 1NRSH 3O8RA 1NN6A 2QCYA 1FJSA 1YPHC 2BTCE 1Y8TA 1Q3XA 4Y7BA 1IQKA 3LGWA 4GCHG 3E1XB 3MI4A 1XUIA 1ZTLA 5C20A 3F68H 2FX6A 2BY7X 2HPPH 5AHGH 1BRCE 1AHTH 1TRNA 1T8NA 2B5TB 2FOBA 2R2MB 3GICB 2Y80A 3RDZA 2A2XH 4X2WA 2BDYA 1K1PA 1MKXH 1SLUB 4ZHAA 4D9QA 3BTQE 3A83A 1GHVH 1AMHA 3RU4D 2I6SA 2R9PA 2RA0A 3PV4A 2C93B 1CBWC 1CGHA 1NROH 5ETXA 4DG4A 2QXHA 1AUTC 1O3LA 1TRYA 2ZU3A 1BTXA 5FCKA 1UMAH 1BB0B 2PTNA 3H5CB 6CHAB 1MBQA 2VIQA 4U01A 5DKMA 5F8ZA 1Z1IA 1O3IA 5L2YH 4K69A 5F6MA 4LK4A 3SUGA 5HXFA 5EGMA 2SGFE 1C5LH 4ZXXH 1H9HE 2P3FH 1CT4E 2VH6A 2ZQ2A 1UJ1A 1L1NA 3E0PB 3A81A 2BD9A 1MUEB 1KTTB 3SUDA 3TGIE 1LTOA 1V2MT 4JZDH 2GZ8A 2QY0B 2LPRA 4IN1A 4JZIA 2WPKS 3GCTF 3MNBA 1BMMH 1HXFH 4K2YA 2FOAA 3FFGA 1UK2A 2XBXA 3Q3YA 4RN6A 1SGQE 3M35A 1GJ9B 1YC0A 1HGTH 1GMCG 3PLPA 2FESH 1ELTA 3E91A 2A5IA 1GHXH 1ZOMA 3MO3A 8GCHF 1E36B 5JBAS 2BDIA 2H1UA 1MKWK 4U2WA 3UR6A 3UWIA 2O8TA 1F5RA 1GJ5H 2WUCA 2Z9GA 1EPTC 4WH8A 1O2TA 1W7XH 1QURH 5GPIB 2HWLB 3RC4A 3LGIA 1NY22 2NU4E 3PWBA 1UVUH 2BOHB 3PMHB 3A8CA 3PO1C 5ESBA 1HAOH 1FY4A 2CXVA 2WV4A 4DURA 1GBHA 1AQ7A 3LKWA 2FMJA 3TITA 1NT1A 1FIZA 2B7DH 1LVYA 1GJAB 1NFUA 2ZDVH 4X1SU 3RXUA 1G9IE 1YPJH 4DJZB 2V6NA 1HNEE 3SNCA 3QGJA 3SJ8A 1RRKA 5FPYA 4X8VH 1G3EA 4X6OA 1U6QA 2FOHA 3AAVA 1HAXB 5JYIA 4FUBA 1ACBE 3RXCA 1OSSA 1BMLA 4FXGH 2TGAA 1YLDA 1Q2WA 1BRBE 1GBJA 3BIUH 3TJNA 4INHA 1XUGA 1O31A 1NRRH 1P02A 1A2CH 4CBOA 2AMDA 1LVBA 1T4UH 2ODPA 1QJ6B 4AG2A 4GPGA 4ABGA 1V2PT 1H8DH 4ASHA 1N6XA 1KXCA 1RJXB 2PGBB 5AFZH 4AZ2B 1JBUH 1ARCA 3TIUA 2TIOA 2ZFSA 3M5LA 4KTUA 2SFAA 3SI3H 1MZDA 5A8XA 4CHAC 1H9IE 1H9LB 3A85A 2J38A 3F9EA 1GI8B 1O2KA 2AIQA 2C8XB 4R8TB 2GCHG 2GX4A 1P57B 1P9UA 3TJUA 3STJA 4JZ1A 2ZHEH 1V2OT 1SQTA 1BIOA 2GV7A 2ZHQH 3RU4E 1XX9A 1NZQH 1EPTB 1YP9A 1TGSZ 1V2ST 1UCYK 1C1QA 4NSVA 1FV9A 1UVTH 3ZZBA 1FXYA 3SJOA 1TIOA 2THFB 2VINA 4FUJA 4X8TH 1DPOA 1BBRK 1MD8A 3D23A 2GZ9A 2ZU5A 1C5MD 2IPHA 1UVSH 2A4OA 2FS9A 1DICA 4YOJA 2BDBA 3QZRA 4U32A 4ZKRU 1UHBB 5LPFA 1QRWA 4JK5A 6GCHG 2XRCA 1WU1A 4TPYA 1ZPZA 2H6MA 1BTHH 6LPRA 1ZPCA 1FIWA 4B74A 3PMJA 4CR5A 1ABIH 1BTZA 2F9VA 2WYGA 2F91A 1K9OE 4DOQA 3O8BA 3MWIU 1YPGH 4GUXA 3F9HA 1Y3VA 2R0LA 2TRMA 3MTYA 3KIDU 1FPCH 1K1IA 1HAPH 4FUIA 1KXBA 3T26A 5JDUB 1O2WA 2ODQA 1CA8B 1DSTA 1D3TB 1LHGH 2R3YA 2Y6TA 3TU7H 1FAKH 2BDCA 3TGKE 5K7RA 3U8RH 1O30A 4A1XA 1O35A 4MG3A 1CA0B 3A87A 1DWEH 3V3MA 4CHAB 5JBBS 3PMAB 4KGAA 1UVOA 3RP2A 1YPKH 4X6MA 4ESTE 4IGDA 3S9BA 1FONA 5JBCS 4NZLA 1GDUA 2H9HA 1FI8A 4RKOB 3GY7A 3OY6U 3H7TA 1AE8H 1OPHB 3ZVGA 1C1WH 2BD7A 1VITH 3RLWH 4JK6A 4X1PU 1FQ3A 2EC9H 2F3CE 5FCRA 5E2PA 1AO5A 2BX4A 1WQSA 1WCZA 3ITIA 1XUFA 3BTTE 3T27A 3ZYEA 3W94A 2FTMA 1W0ZU 2GZ7A 4AFZA 1E34B 2QV1A 1Q31A 2GKVE 2QC2A 1C5OH 2ZHFH 1XKAC 1GBFA 1NRPH 2HALA 1A0JA 1LDTT 3DFLA 1XVMA 1G3BA 5A0CA 1XUJA 3MU0A 1QBVH 1N1LA 1F0UA 1HAZB 4Y0YE 3ATMA 1O2MA 2ZGXH 4NFFA 1OP8A 1HV7A 2ZFTA 1V2KT 1LKBA 1AU8A 3E3TA 3KQDA 3A7TA 3S7KB 1P0SH 1GHAG 1O2JA 1UO6A 3OYPA 3B23B 1S84A 3TK6A 1P3EA 3PTNA 2HNTC 1VJAU 3M7TA 1ZR0A 2F83A 3FAOA 1PQ5A 5EODA 1F7ZA 1SGFG 2O8MA 2ZO3H 3NPSA 3ZZ5A 4AG1A 3M3SA 4BXSA 2G5NA 1O5CB 2ZFQH 1P04A 2VIOA 1TYNA 2O8LA 1UTPA 2XNIA 3ATIA 1HLTH 3Q3XA 2VIWA 2JETC 4JCNA 5F8XA 1AGJA 1W11U 1TQ0B 2PKAA 5FBEA 4OGXA 2ZHDA 1C5PA 1P3CA 3QN7A 3SNBA 1O2PA 5DK1A 1Y59T 3QK1A 3SGAE 1MTNC 2F9NA 2AMPA 1ZJDA 3EGKH 3B9FH 1C9PA 4BOHA 3LC5A 2BVXH 2P16A 4A92A 1RTFB 4AYYB 5EQSA 4BNRA 3SOSA 3LH3A 1AVGH 2PHBA 1ZJKA 2BD3A 2BVRH 2OUAA 1C1VH 1F5LA 3AASA 1AN1E 1SQAA 2A5KA 1MZAA 2QAAA 4I8KA 3EAJA 2GDEH 2ULLA 5EXLA 1ZGVA 3P6ZB 2ZU1A 1NS3A 3URDA 7GCHG 1IHSH 3ZZ9A 4UD9H 3UOUA 1YPHE 2H9EH 1OP2A 4MPWA 3VXEH 4GVUA 1WYKA 3M3TA 3QX5H 3VB6A 3SJ9A 1O2OA 1CHOF 3T5FH 4D9RA 1C1NA 1DUEA 2ODYB 5DGJA 1PPEE 5T6FA 3TK9A 1IHTH 1TE0A 8KME2 2ALVA 1ELEE 3BG4C 1C1UH 1V2QT 2SGPE 1EAIA 1EATA 1C2DA 2FOFA 5FAHA 1NU7B 5HYOA 1V2WT 1P11E 2AGIX 3ENSB 4MNVA 1NFXA 1GI6A 1UTKA 4ZH8A 1YGCH 4Y6DA 3FZDA 1EXFA 1T31A 3CP7A 2ZGHA 3NUMA 4CR9A 1O2HA 2Q6FA 3CS7A 2VWNA 4BTTB 2JETB 1PPHE 2FO9A 2BLOA 3ZZDA 2XBYA 1C5WB 3SGBE 4CBNA 3NZIA 3RXEA 3TNSA