3ITIA

Structure of bovine trypsin with the mad triangle b3c
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title How to get the magic triangle and the MAD triangle into your protein crystal.
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords Cationic trypsin
total genus 54
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2009-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3itiA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3itiA02
3GY7A 1YPHC 1XUIA 3LH3A 1AZ8A 1ANEA 1GJBB 2V3HH 5FAHA 3U8OH 5EXMA 3UR9A 1EX3A 1GPZA 2F9NA 1X7AC 2TGPZ 4NSYA 1EJNA 2I6QA 1YPMH 1O3CA 4INHA 1S6HA 1THSH 1C2EA 4FUIA 2VJ1A 2ZIQH 2H9EH 3AW1A 5IDKA 1EPTB 3F6UH 3GCTG 2WYGA 3ZZ8A 1N1LA 4OGYA 2AEIH 4XSKU 3T2NA 2GCHF 2GVFA 1PFXC 1F0RA 1V2RT 4FUJA 3GY5A 1AGJA 5EPYA 1HLTH 3QGNB 2GZ8A 1E37B 1FDPA 6LPRA 4XBCA 2XBWA 5K0HA 5JPMH 3P17H 3SGBE 3A8BA 2R9PA 1BJUA 1RXPA 2JH5D 3BN9A 1N6YA 1A1RA 4K8BA 1LHEH 2ZDKA 1J16A 3LGUA 7GCHG 1F7ZA 2ZFQH 2A5AA 1TMUH 1GI4A 2ZFFH 3HKJB 3P8FA 4GSOA 3BG8A 1HXFH 1WQSA 4CRCA 1RD3B 4NA9H 1GI1A 1K1PA 3URCA 2A4QA 1G3DA 4GPGA 1RIWC 1TNLA 3SHAH 1A3BH 2ILNA 2ZGXH 4JYTA 1W12U 5HGGA 2ZZUH 1DUEA 3F9GA 1O2GH 2G51A 4TY6A 1MD7A 2ANMH 1TB6H 3VB5A 2AMPA 1LKBA 1ZSKA 4VGCB 4DJZB 6ESTA 2GZ7A 3P8NA 3ZV8A 4NGAH 3HGNA 1ZGVA 1RGQA 4THNH 1NN6A 1ANBA 1ORFA 3QGJA 1W8BH 6CHAC 1T31A 2CHAC 1S84A 2FI5E 4HGCA 1XUGA 1KLTA 5L6NH 3A7ZA 1C2FA 3VB3A 1P2NA 2BDGA 3STJA 4FU7A 3RP2A 1V2ST 4RKJB 1O31A 2OBQA 3KL6A 1P2OA 5EQQA 1O2IA 4SGBE 4A1XA 2F3CE 1QB6A 1WU1A 3GY3A 2Z3DA 3SU0A 2A7CA 3ZZDA 1D3TB 1AD8H 4AYYB 1Y5UT 4JYVH 2A4OA 1E35B 3PM3A 2FLBH 3IITA 2B8OH 4I8KA 2AMDA 3KQBA 2HNTE 4B1TA 3UWJH 4X1NU 1RFNA 3TNTA 3UPEA 3S7HB 1SGIB 1NRPH 3PMBB 1J14A 3EYDA 3RM0H 3VFEA 1YCPM 2VGCB 5C3NA 3I78A 3BTHE 2Z9IA 4B2BA 3RXHA 1C5SA 3O8CA 1CBWB 3SU6A 4X6NA 3OX7U 1BMNH 5EU8A 6CHAB 3ELAH 2ALPA 1FY4A 4ZROA 1SGEE 1Z6JH 1GGDC 1OKXA 3SV2H 1XKAC 2O8MA 1HJAB 3FP7E 3RDZA 1OX1A 4ISIH 1B0EA 3BV9B 1QBOA 1UTOA 1BRUP 3NXPA 1CBWC 3IWMA 3QTVH 4AFUA 1TPAE 2BD8A 1UTLM 1XUFA 1XXDA 1C1QA 2ZPSA 1C1UH 2EEKA 1UTMA 2Y5FA 3TJNA 2B0FA 2GGVB 4K3JA 4ZXXH 3VPKA 1BTZA 3SGAE 5LH8A 2BB4A 3A84A 1G9IE 4NG9H 5EG4A 5B6OA 3BG4C 1HIAB 3RXEA 4YM9A 1P09A 1C4Y2 1FN6A 1ZGIA 1O37A 2FOMB 1A46H 1WYKA 1THRH 4MLFB 3K65B 2Y5HA 2FOCA 4GHQA 1BHXF 3RXUA 1IHTH 3UUZA 4ABGA 1EPTA 2HGTH 2TGAA 2KAIA 1WBGB 1C4U2 3SI3H 3LGWA 1LPZB 4D7GA 2STBE 1A2CH 3D23A 1UCYK 3M36A 2NU0E 1L4DA 4MVNA 5C2ZA 1GHAF 1S81A 3BSQA 3MO3A 3RXVA 5FCKA 1HAZB 3W94A 2VVUA 4VGCC 2P3FH 1MAYA 3SU4A 3TJVA 2GT8A 2K1QA 4ZKRU 1EAXA 1K21H 4JCNA 3FZDA 3D49H 1C2KA 1F0UA 3MH6A 1IQKA 4Y7BA 2WPLS 5A09A 1PPBH 2ZP0H 1H9LB 3MU8A 3M7UA 3RXOA 4X1SU 1HAYB 2CXVA 1A5IA 1BIOA 2A7JA 1KXCA 1AWHB 1GBKA 2BQWB 4FXGH 3JZ2B 3LU9B 6GCHF 3RXRA 3QK1A 4OGXA 2ZWLH 3ATIA 1Y3XA 3TK5A 1YLCA 1KY9A 1GJ4H 1O2VA 4Y71A 3U1JB 4RKOB 1TGBA 1AE5A 1NFXA 4WMFA 5AFYH 4X8SH 1C2IA 1UVSH 1YC0A 2ZU3A 2C4FH 1IQIA 1D6WA 1YBWA 2FS9A 4X6MA 8KME2 2P8OB 1KXDA 2XCFA 1DSUA 1O2OA 1AKSB 1CVWH 2QN5T 2VVVA 1HAVB 2UWOA 1LVBA 5DO4H 2BZAA 2UUFB 1GI5A 1NFWA 2EC9H 2PGBB 1FNIA 2BD5A 1GMDG 2PWXA 3LH1A 1YPGH 1PPCE 1Z1IA 1GGDB 2NU1E 1AUTC 1AVXA 1GBJA 1P0SH 8LPRA 1ZR0A 1H9HE 1TX7A 1C5NH 3TGKE 1EUFA 1PPFE 5GIBA 1QBVH 1BTWA 2AS9A 2G55A 4OS6A 4K5ZA 3BF6H 1O2RA 2IOTA 4MNYA 1O5EH 1CGIE 1RTKA 4A6LA 4K1SA 1BUIA 4BAQB 1B5GH 1W2KH 3MU1A 2FI4E 5L2YH 1O32A 5EQRA 1EZXC 4IN2A 3RXIA 1K2I1 2UWLA 4YOGA 1OWKA 2GMTC 2FESH 4XBBA 1CT0E 5FPSA 4CBNA 1G36A 3MNSA 1W7XH 2OINA 4B2CA 1AVWA 2BQ7B 1ZLRA 5ABWA 2OC1A 5T3HA 3D65E 1SFIA 5EW2H 1AMHA 1TNIA 4YT7H 1TMTH 2WYJA 3RMNH 2EI6A 5A0AE 2OQ5A 2D8WA 1QJ7B 4D76A 2J38A 1SGCA 4JYUH 3T62A 1GBHA 1BMMH 1QR3E 1GL1A 1Z1JA 1D3QB 1LQDB 3GCTF 1KXBA 2BVRH 4NFEA 2A2QH 2FS8A 3UWIA 2CJIA 1DE7H 1MBQA 2Q1JA 4BXWA 1ZHPA 1O2TA 1L0ZA 5E8EH 3AVZA 4R8TB 1BQYA 3ATKA 3MTYA 1AWFH 3M5LA 1MTWA 4KTSA 4Y10E 1BZXE 5FPTA 1QJ1B 4JZEH 1GMCF 1HFDA 4WF8A 5C5NA 1O3EA 3Q00A 1O2PA 2P16A 1KTTB 2TPIZ 4CRBA 4WY3A 4FUBA 1V2NT 1CGHA 1WOFA 2BD3A 2YNBA 4E7RG 1AIXH 1ARCA 1U6QA 1P3CA 2QYIA 1IOEA 3CS7A 1F0SA 3SU5A 1CSOE 5J4SA 3TH3H 4AB9A 5C5OA 1PQ7A 4AN7A 4GLYA 1CHGA 3OY5U 3ZZ9A 3ZVCA 1DX5M 2ZGJA 2ULLA 2WUBA 3PMHB 4X1PU 1SMFE 3T27A 2THFB 2UWPA 3PTNA 1O2HA 5HMAA 5C20A 1QRZA 3VB4A 2QF0A 4YOIA 3F68H 2ZC9H 4J2YB 1SC8U 1GJ7B 3LJOA 5DGJA 4AGJA 3RXDA 1QHRB 1WUNH 3SNEA 2QV1A 1LCYA 2ZDVH 3KCGH 1EQ9A 3ZVAA 1AN1E 1HAOH 3PWCA 1W0YH 1MCVA 1DM4B 1AHTH 1GBIA 1S83A 1BOQA 1C1WH 1XVOA 3M7QA 2RDLA 1KXFA 1L1NA 2BOKA 3TVJB 1UO6A 1N6XA 4WH8A 1NFUA 1KXAA 2F91A 1O33A 5F03A 2CHAB 1G3EA 1XX9A 1NTPA 2F9VA 4KGAA 3S7KB 1ARBA 2FOBA 3JZ1B 1QA0A 4E7NA 3E91A 4BTUB 1ELCA 5A8YA 1VGCC 1C5ZB 1HNEE 2QIQA 3P6ZB 3U8TH 1C5WB 2VGCC 3MO6A 4UFFH 3TITA 1AFQB 3SO3A 2QF3A 5GJ4B 1SL3A 1CA0B 1TGTA 1D3DB 4OS5A 2ZECA 1GBAA 1C1RA 1C2GA 1LMWB 1O3DA 5C1XA 2A4GA 2M5TA 1J15A 2AFQB 1O3PB 2BLVA 4BTTB 1UHBB 3A86A 1RTFB 1FY8E 3RC4A 5DP8A 3T29A 1NZQH 1VJ9U 3RXMA 3T28A 1GI0A 3AASA 2OC0A 4B71A 1W10U 4LOYH 1SG8B 2Y6TA 3QX5H 4NFFA 5EXNA 5A8XA 1C2LA 4JZ1A 1O0DH 3LPRA 1Y5BT 4AORA 3KEEA 1A0HB 2GP9B 3GY2A 2HPPH 2ZPQA 2ZTZA 2JH6D 3QWCH 4X8TH 1ACBE 5TJXA 4D8NA 2AERH 1YP9A 4OS1A 1TA2A 2C8WB 1DITH 4XOJA 3QLPH 1TE0A 2GKVE 3ZZ5A 2OC8A 1SGTA 3GCNA 3PROA 1P2MA 3V0XA 3LGVA 1LO6A 1DXWA 4Y76A 2Z7FE 3QO6A 1ESBA 4X2YA 3UQVA 1OOKB 5JYIA 1SQAA 3FVFB 3P92A 1FMGA 3RLWH 2WV4A 3MHWU 4X8VH 3SUEA 1GHAG 5C1YA 1IQJA 2FPZA 1LVOA 3ODDA 2Y5GA 1M9UA 4Y8YA 2BXTH 5LPFA 3FZZA 1V2QT 3OTJE 2FTLE 4ISOA 4TPIZ 3V12A 5EW1H 4HI3A 1MKWH 2NU2E 2PV9B 3BEFB 1JWTA 4O3UA 1KLIH 1C9TA 4H6SB 1C2DA 2JKHA 1TABE 1SLXB 1KYNA 3M5MA 3PMAB 5E2PA 1K1LA 1O3GA 1ABIH 1F5KU 1GCTC 1CO7E 1ZTKA 3KQDA 1EZSC 1QBNA 1JMOH 1O3FA 2NU4E 1P12E 5AHGH 5GWZA 4BAMB 2BQ6B 4NIWA 1DANH 1O3AA 1HGTH 3E1XB 4LXBH 1CA0C 1O3BA 1GMHG 1FY1A 1ZSJA 1E0FD 1T4VH 4DURA 4K8YA 1H1BA 1ZZZA 5C1UA 4HTCH 1O2UA 2ZHWH 1GBFA 2JETB 3BEIB 3ESTA 1DOJA 1FN8A 4GCHG 3U8RH 5I46H 2FODA 4O97A 5F8TA 1UTJA 3P95A 4IBLH 2GV7A 3F9EA 3TIUA 2XC4A 5E0GA 1NRNH 1BTYA 4B73A 2UUKB 4KELA 3V7TA 5CE1A 2GX4A 3BIVH 4Y79A 1BBRE 1OYQA 3ZZ3A 3A8CA 1P11E 3M35A 1LVYA 2PW8H 1E34B 1SGNE 4X6OA 4JZFH 1C5TA 1W0ZU 1Y59T 2XW9A 1D9IA 3LOXA 3SJ9A 1GHXH 1V2JT 1UK3A 2BDYA 3RXQA 2CV3A 3E6PH 5DG6A 3GOVB 3NUMA 1F0TA 1HAXB 4IN1A 2H5DA 4WXVA 1SHHB 3MI4A 4BAOB 5JB9S 3SU3A 1CGJE 2ZCHP 1FIZA 4OS4A 4CR9A 1PQ8A 3SJOA 4BXSA 1S0QA 2OUAA 1WSSH 5A2MH 3SJIA 2ALVA 2F83A 2Q6DA 1L4ZA 4YLUA 5DP7A 2ZKSA 1PPEE 3DFJA 1S5SA 3F1SB 1NC6A 1UCYE 2HWLB 2Y81A 1IQLA 2ZFPH 2UUJB 2XXLA 2XWBI 1C5XB 1BTXA 1NRSH 3FP8E 1TRYA 1EAIA 1AVGH 2TIOA 1C5VA 2VWLA 1ZRBA 3BTTE 2C93B 5ESTE 2RA0A 1SVPA 4IC6A 3RXTA 1O2MA 2AGEX 1TALA 5DJ7A 1VITF 1AO5A 1QTFA 4I8GA 3DD2H 2ZHQH 1TAWA 2PR3A 2C8ZB 3LC5A 1QB1A 3A82A 1P05A 7GCHF 2CF8H 4SGAE 3RMMH 4ZKNU 2GDDA 3GCHB 1C4V2 3MH4A 3Q3YA 5TCCA 2J95A 1BTHH 4ZHMU 2ZI2H 3UOUA 1AI8H 3MWIU 3B9FH 3URDA 1GJAB 2I6SA 3OYPA 1O2SA 3UQOA 1S85A 3DHKH 4CREA 5GCHG 1WAYB 2KAIB 1L1GA 1T32A 1ETSH 1PPZA 2ZDAH 4UFEH 2Q6FA 2D2DA 3Q77A 2P59A 1NM6A 3PWBA 4Y8XA 1Y8TA 1Y3VA 1V2UT 1H9IE 1D6RA 1EAWA 3S9CA 1C1NA 2BY9X 4X2VA 2ZTXA 3SJ8A 5DKMA 1D3PB 4I31A 1TNKA 2FX6A 3NZIA 3LGIA 3TLOA 1TMBH 2FZZA 4ABAA 3HKIB 1O2XA 2F9UA 3V3MA 3SZNA 1P57B 1GHBF 1UCYH 1MKXH 5DP5A 1K1IA 7LPRA 1QFKH 2AIQA 2XC5A 1O3OA 5EODA 3RC5A 2G4UA 1MKXK 3MH7A 1EKBB 1A0JA 2AH4X 1UK2A 3E16B 1GI6A 2IN2A 3TK6A 4TWYA 1A7SA 4RSPA 4UONA 2V3OH 1SLWB 4ZAEA 1LHDH 3RLYH 5ESBA 1CT2E 2AYWA 1JRTA 2HPQH 3L3TA 4H42U 4ZKSU 3AAUA 3AW0A 2W26A 3F9HA 5HM9A 1IQGA 1GHWH 4ABFA 3VEQB 1TYNA 3A8DA 1PPHE 1MTNB 2Y7ZA 2O8UA 1HB0B 4XE4A 1O5CB 4BANB 1GCDA 4K60A 4NWLA 1W14U 1HAVA 4A1TA 3ITIA 2ANKH 2XTTB 2P93A 2G5VA 3KN2A 1SB1H 1O3NA 2ODQA 5G4BA 2A31A 1G30B 1LPGB 2ZG0H 5I25A 4U30A 3S0NA 1TPOA 1XUKA 1TBRH 1C1MA 1ZJDA 1EPTC 1SHYA 3GCHC 5PTPA 4ABHA 1MTSA 1DWBH 1SFQB 2PLXA 1EP5A 3N7OA 3RXSA 1RJXB 1DFPA 1O2WA 4ZXYH 4I8JA 1O3LA 1MTUA 1SGYE 1ZRKA 1CHOF 1K28D 2J94A 3FANA 3A87A 3EGKH 3RMLH 1OP2A 3S9AA 4AG1A 5HYOA 4I7YH 2ZGCA 4ZHLU 1IQMA 2ZGBH 1O5GH 3K6YA 2B5TB 1UVTH 3SI4H 1ELVA 1B0FA 3MNBA 4O03A 4ABJA 1EJAA 1GBLA 1GJCB 3S9BA 3UOPA 1TQ0B 3SORA 1DY8A 1O2JA 1FAXA 1IQFA 1ZTJA 5F6MA 3LGTA 1T8NA 1GI9B 8GCHF 4PROA 2Z94A 3H5CB 2BX3A 2BDIA 4AGKA 1OP0A 1J9CH 2Z3EA 1FIWA 2ZNKH 3GY4A 1ZYOA 1HIAA 2FWWA 1AB9B 1DXPA 1LPKB 2HRVA 1LTOA 1YM0A 2QXJA 1PYTD 1HUTH 2PUQH 1T8MA 1ELEE 3L33A 2GMTB 4FVDA 5DP3A 3SUDA 1CU1A 1O3HA 4YZUA 2ZFSA 4DY7B 2PTCE 1ANCA 1H8IH 2A4RA 1ZHMA 4Q2KA 3LJJA 3U69H 2BD2A 3RXPA 1Z71A 1TGSZ 5BRRE 1GBEA 1QGFA 4YT6H 4TWWA 3ZVFA 4WVPE 1YPEH 1W13U 1TGNA 3GISB 1NO9H 1OWJA 2P95A 2F9BH 1S0RA 2QGRA 1Y3WA 3SBKA 1UVUH 1Q2WA 2VB0A 1TX8A 1OS8A 1N8OB 1RTLA 4Y6DA 4D7FA 3TNSA 4H6TA 4DG4A 4FUGA 1MZDA 1AUJA 1XVMA 2HLCA 4WH6A 1TLDA 1GBMA 5EQSA 3O8DA 4ABIA 1FXYA 2QCYA 2H2ZA 3GDUA 3RXBA 1F5RA 1LHFH 4O9VA 1GDQA 5LGOA 2W7SA 1FONA 1O3KA 1Y3UA 1GG6B 3A89A 4X1QU 1AZZA 2BLQA 4GAWA 1OWIA 4X2WA 1P2IA 4FU8A 1JBUH 4Q7XA 3M7TA 3SN8A 4AYVB 3P70B 3EE0B 2PKSB 2CF9H 2FP7B 2FX4A 4UDWH 4WXIA 1EOJA 2XRCA 1RRKA 1YPJH 3GDVA 4CRGA 2OD3B 4INKA 1XMNB 4JK5A 3E0PB 1ELBA 3SJKA 1FQ3A 1YCPH 1AQ7A 1KSNA 2ODYB 1PPGE 1V6DA 3TGJE 3MNXA 1C5YB 4KTUA 3TH4H 1YLDA 3K9XB 5L2ZH 1LKAA 3T26A 2YNAA 4CHAC 4IS5A 4CH2B 1ZHRA 5EOKA 1P3EA 4XBDA 1LHCH 2BLWA 3C27B 3GYLB 1FJSA 1NESE 2OQUA 1VZQH 4FUDA 4ZKOU 2GD4B 1EZQA 1EASA 1VJAU 1W7GH 3RM2H 4CBOA 2VNTA 3MO9A 1LDTT 7KMEH 1K1NA 4BOHA 1O3JA 4Y0YE 1WTGH 1TONA 1V2OT 1C2HA 4AFZA 2BX4A 1Z6EA 4NSVA 1MQ6A 2GCTB 1O39A 1GJ9B 1C2JA 4X0WU 1ESAA 9ESTA 1NFYA 3KGPA 2ZFRH 1P8VC 1NROH 2C90B 3A85A 1BHXB 3ZVGA 1SR5C 2FO9A 1QURH 1ZOMA 2ZHEH 5K7RA 2BXUH 1DSTA 1YPKH 2A5KA 3UNRA 4KTCA 2GCTC 1J17T 2GTBA 4UE7H 2P3UB 3B8JA 2R0KA 3ATMA 2Z3CA 2PGQB 1GVZA 1OWEA 4GVUA 4ISLA 2PKAA 1BBRH 1TGCA 4CHAB 1C2MA 1MU8B 1MZAA 5GDSH 3VGCC 1ABJH 3LT3A 1A3EH 3A7XA 5FBEA 2SGQE 2G52A 1VCQA 5DP6A 2J2UA 1C1VH 2V35A 1UHBA 1V2LT 1OPHB 2Z9LA 3SV9A 2SGPE 2Z9JA 4Y8ZA 1VCPA 4OS7A 2P8OC 2ZDMA 5GCHF 4JK6A 5A0BA 2AGGX 1OWDA 1OYTH 4NA7A 2FOFA 2SGDE 3C1KA 2FTMA 2C8XB 3ENSB 1PYTC 2BHGA 2VH6A 3T25A 1C1TA 1ZMNA 2ZQ2A 1MTNC 4ZMAH 1KIGH 1FI8A 1G3CA 3RUOA 3CS0A 1G32B 1GHZA 1E38B 2XC0A 3WY8A 4A7IB 1XUHA 4I32A 1NS3A 2C8YB 1HBTH 3PO1B 4DW2U 1HAPH 4X2XA 1YKTA 2EI7A 2G81E 1V2PT 3EDXB 3MH5A 2HALA 4Q7YA 1TWXB 4I8LA 3FP6E 1HAIH 8ESTE 2A7HA 4AOQA 2Z6BD 2R2WU 1QL9A 1Z8RA 2XNIA 3RXLA 2VWMA 4D9QA 1C5MD 2D26C 3EA9A 2VWOA 1MKWK 1ZSLA 1BA8B 2AGIX 1A5GH 2A1DB 1V3XA 4K1EA 1P06A 4A1VA 1O2LA 1O30A 1SGQE 2J34A 1QY6A 1NY22 2RCEA 1HAHH 1SGRE 5E0JA 1GHVH 1V2KT 1ZPCA 2BY7X 2DUCA 3MMGA 5FPYA 1QB9A 2FDAA 3KQEA 1EP6A 1QQUA 1O2NA 1QL7A 2XYAA 1DICA 4DT7B 4AFSA 3ZVEA 3ATLA 4WJG2 1GWAA 4K1TA 4FUHA 1P2JA 3SUGA 5FXLA 3RU4T 2VWNA 4MPUA 2JETC 3ZV9A 1ZMLA 4U2WA 3TJOA 4B76A 2XBVA 2RA3A 1SI5H 2ZQ1A 1SQTA 3TK9A 1TFXA 2ZF0H 4UFDH 1GL0E 3SNCA 3IG6B 1GBBA 2WPJS 2A5IA 2QC2A 1YCPK 4HFPB 1PQ5A 1DWCH 4YTAA 1BTUA 3EA8A 1V2WT 1TNGA 1GBCA 1TQ7B 1BBRK 2VINA 4CRFA 2BYAX 1CQQA 4DGJA 2FXRA 1AU8A 1JXPA 2BLOA 4MDSA 2AMQA 1MD8A 3ATWA 2FI3E 3NWUA 1G37A 3B23B 2GV6A 1DY9A 4UEHH 4GHTA 4WWYA 3SUFA 1BITA 2J9NA 2H1UA 2QXHA 3BTGE 1TBQH 4K69A 3GY8A 2FYRA 5E2OA 4IC5A 1UTPA 1SOZA 5JBBS 3ZYEA 1BRBE 3SV7A 2O9QA 1ZPZA 2BD9A 1W11U 2VIQA 1ELGA 2WV5A 3UREA 5DP9A 1O3MA 1AFEH 2FEQH 1Q31A 3QTOH 1SPJA 2BOHB 3QUMP 1EATA 1FUJA 3A88A 2ZU1A 2Z9GA 1MUEB 4CH8B 1MH0A 2FM2A 1ETTH 1J8AA 3A80A 2ANYA 3Q3KA 2A32A 2ZU2A 4M7GA 2PHBA 3GY6A 3SNDA 1C5LH 3MNCA 1O36A 1GJDB 1C1SA 1O34A 2YOLA 1O5FH 3O8RA 2XWAA 4AFQA 3UY9A 3HK3B 3UTUH 1MAXA 2ZHFH 1GI8B 5HM2A 1YF4A 4J1YA 5FX6A 1C5QA 2QXIA 3ZVBA 2WINI 1P10A 2SNWA 1BMLA 3LC3A 3ODFA 1UVOA 4MPWA 2ASUB 2PKSC 1GBTA 5FHTA 2ZTYA 5HXFA 2Y80A 4DOQA 5GPIB 2R2MB 1MU6B 2QA9E 1K1JA 3ZYDA 1ZTLA 3VB6A 3P8OA 1SQOA 1P2KA 3MU5A 4MNVA 1OP8A 2VIDA 1C9PA 1HRTH 3PLKA 1TPSA 4GCHF 2H5CA 2GZ9A 1UVPA 1FLEE 4FUFA 4X6PA 2BD4A 3EQ0H 3LONA 5IYTA 3HPTB 2ZCKP 1P9SA 4DCDA 1TNHA 2RG3A 3H7OA 1ELFA 3VXFH 3Q76A 1QRWA 1V2VT 3OSYA 1NU9A 2TBSA 2R3UA 3P8GA 4LZ1H 1SGFG 1Z8GA 3E8LA 1O2QA 2P94A 2CGAA 3D62A 4WMDA 4ISNA 4ABDA 1O3IA 1Z8IB 1QCPA 5LPEA 1THPB 1GMHF 4ABBA 2UUYA 2ZDLA 2VIPA 2ZEBA 4ZH8A 2W3KA 6GCHG 1BRAA 3BIUH 1MQ5A 1CT4E 5CMXH 1GVKB 5JB8S 1TPPA 3NCLA 4MG3A 1HXEH 3SHCH 1FPCH 1KDQB 2ODPA 3PTBA 1A5HA 1BMAA 3I77A 5EXLA 1NRRH 2VIWA 2ZGHA 1G3BA 1GI3A 2R0LA 3M3VA 3UNSA 3W95A 2OCVB 4RN6A 2OTVA 5EGMA 1WV7H 1FY3A 2W5EA 3A7TA 4AX9H 1PJPA 4ZUHA 1KDQA 3NK8A 4H4FA 3SNAA 1AY6H 4MPXA 4U01A 3T5FH 4B75A 1GDUA 1FZZA 3RXAA 1KXEA 2ZA5A 4BNRA 4Q80A 3ZZ6A 3L6PA 3UNQA 3BG4B 2NWNA 2ZU4A 1D4PB 4IMQA 4LZ4B 1YPLH 7ESTE 4ZHAA 5AF9H 2VH0A 1KTSB 1EXFA 2HVXA 1GMDF 4CRDA 3KQCA 1FV9A 2FOGA 2V6NA 3SNBA 1F5LA 4U32A 2H9TH 5T6FA 4HZHA 5JBCS 1T8OA 2JH0D 1GJ6A 5A0CA 2HOBA 1GDNA 1L1JA 5E0HA 1DUAA 4DIIH 4IW4E 3BEUA 1C1PA 2OC7A 4YLQH 1HJAC 2BVXH 5FCRA 2ANWA 2QY0B 2ESTE 3HK6B 3E90B 1K22H 3PB1E 1AE8H 2O8WA 2IPHA 3GICB 4Z6AH 2OP9A 1O2ZA 3LIWA 2D1JA 3M5OA 1ZMJA 2GCHG 5TCAA 2H6MA 1NT1A 3UIRA 1FAKH 3G01A 5L30H 2H9HA 3PMJA 3K2UA 1BTPA 3BTDE 2VU8E 3PO1C 2WUCA 4F49A 3BTWE 5DK1A 1T4UH 5FX5A 1HAGE 3DUXH 1DVAH 2BTCE 3EA7A 4XDEA 1O5BB 3STIA 1TRMA 2XBXA 2FYQA 4ESTE 1HYLA 3VXEH 3U9AH 3BTFE 4LK4A 2AIPA 1A0LA 3TJUA 1ESTA 2IJOB 2HNTF 1DWDH 2WPIS 1ID5H 1JIRA 1Q3XA 5JDUB 3SU2A 1HCGA 1BT7A 4Z0KA 1P04A 1GHBG 1XUJA 3F9FA 4MNXA 3BTKE 3S69A 1EOLA 1JRSA 4X1RU 1Y5AT 1HJ8A 4YESB 4A5TS 3MFJA 3M61U 1LQEA 4XFQA 1GI7B 2ZFTA 2DE9A 4JZDH 3M3SA 2NU3E 3ZZBA 1GVLA 4Y7AA 3M37A 2SGAA 4FU9A 1OXGA 1BDAA 4WMEA 2B7DH 2B9LA 3A7WA 1G2LA 1DS2E 1QRXA 3RMOH 3SQEE 1IQHA 2Y82A 3A8AA 4KKDA 1QJ6B 1F92A 3LDXH 2PUXB 2BDAA 1ZJKA 1EZUC 4A92A 2C3SA 5AFZH 4MQAA 4Y0ZE 3RXFA 1UTQA 1P02A 3GYMA 2ZCLP 5GXPA 3PV4A 1TNJA 3U1IB 1K1OA 1N8OC 3R3GB 5F8XA 1VR1H 3EAJA 2XBYA 1QL8A 4GUXA 1UTKA 1XXFA 1ELDE 3AAVA 1O38A 1O5DH 5A8ZA 1ELTA 4NZQA 4BAHB 1LVMA 4UD9H 1BB0B 3ZZ4A 5BPEA 1QA7A 3HATH 3BTQE 2F9OA 1UJ1A 2GDEH 5AVDA 1VITG 3BTME 1SLUB 1MCTA 3FFGA 3UR6A 1YGCH 2BVSH 3E0NB 3MOCA 1OSSA 1ELAA 2EI8A 3K6ZA 5JBAS 2A2XH 3A83A 4NA8A 1H8DH 3SU1A 2PSYA 2OBOA 3O8BA 1AKSA 3OU0A 4K2YA 1HV7A 1SBWA 1IHSH 2BD7A 1TOCB 1JIMA 1P01A 3RXJA 2SFAA 2DE8A 1C5RA 4NIXA 1GMCG 4ASHA 5LPRA 4ISHH 1S82A 2LPRA 3MYWA 1CHOG 1P2QA 1XKBC 1QNJA 1XM1A 5T6GA 2ZDNA 1EB2A 1AFQC 3SW2B 3NKKA 1C5OH 1V2TT 2GT7A 4YOJA 4OS2A 5J4QA 2ZO3H 3KHVA 4NZLA 3NPSA 3U98H 1B7XB 2ZHDA 1T8LA 2BMGB 3TPIZ 1TBZH 2FIRH 2G5NA 4MNWA 4TYDA 2CMYA 1F2SE 1C1OA 1OWHA 1Z7KA 4Y11E 2VIOA 1E36B 3SOSA 1P03A 4E05H 1KLJH 4BAKB 1SOTA 1MMJN 9LPRA 4FUCA 4TPYA 4E06H 4JMYA 4KP0A 3RXCA 1FPHH 3OY6U 3QZQA 3I29A 3M3TA 4FUEA 1HPGA 3PLBA 2FOEA 2PSXA 4DVAU 1HDTH 2BDBA 3QN7A 1LHGH 2OXSA 2BY6X 1T7CA 1O2KA 4YO9A 1VITH 4DIHH 1DT2A 2W3IA 5SGAE 1WQVH 2SGFE 2ZU5A 5CHAB 5F8ZA 4NIYA 1YPHE 3RXKA 1DWEH 2CN0H 3TGIE 1TX6A 4INLA 1GHYH 1VCWA 1IQNA 3VGCB 3MU0A 4NIVA 2Q6GA 1K9OE 4B2AA 4D9RA 1AB9C 2PKAB 1O35A 3LKWA 2Y7XA 4ABEA 5JBTA 2A0QB 3QZRA 2BM2A 1WTHD 5DPAA 3PLPA 1C5PA 4X8UH 1UK4A 4NCYA 3RU4E 3RC6A 1A61H 1W3CA 3DT0H 4BTIB 1TIOA 2WPMS 1CA8B 1NPMA 4MPVA 1GJ5H 1BCUH 1S6FA 1O5AB 1JOUB 3A81A 4NWKA 3PYHA 4UFGH 2J4IA 1HJ9A 2WPHS 2SNVA 1GCTB 1K1MA 1SLVB 3ZZCA 1GI2A 2FLRH 1O2YA 1DLKB 1MTVA 5T6DA 5C67A 3V13A 1UMAH 1GBDA 2F9PA 2P3TB 1EJMA 4IGDA 2G00A 3ZZ7A 3LGYA 1YYY1 2QXGA 1VGCB 1ZPBA 1MBMA 3RU4D 4F4OC 3BTEE 1C5UA 2LNCA 1IQEA 3H7TA 2FOAA 3DA9B 5H4IB 1L2EA 3GDSA 8GCHG 1TOMH 1QQ4A 1G2MA 3KF2A 2SGEE 4CR5A 1GJ8B 2W7UA 2TRMA 3A7VA 3MU4A 1SGFA 2J92A 4I33A 4AB8A 1TA6A 5FBIA 1WCZA 4MTBA 2FOHA 1GG6C 2O8LA 2FMJA 4FVBA 2BZ6H 2BDCA 3FAOA 2EA3A 1SGDE 3CP7A 3SV8A 2TGDA 2O8TA 3DFLA 1SGPE 1NRQH 1Z8JB 1PQAA 3SV6A 1ETRH 5CHAC 3TH2H 3KIDU 5EPNA 3ZZAA 3HGPA 4B74A 3GCOA 3TU7H 2VIVA 2VVCA 1DLEA 2ZPRA 3VB7A 3SQHE 4TY7A 2STAE 4I8HA 1TRNA 1RIWB 2V0BA 1V2MT 2BY5X 4IMZA 2XCNA 3KNXA 4QT8C 3R0FA 3Q3XA 4R0IA 2TGTA 1BRCE 4JZIA 1BJVA 3E3TA 4O3TA 2QAAA 1IAUA 1H4WA 1A4WH 1EB1H 2A45B 4AG2A 2PTNA 2OLGA 2BY8X 1CE5A 2G4TA 3QDZB 1RS0A 2WPKS 2R3YA 2HNTC 5ETXA 3ZVDA 1QIXB 1EAUA 1INCA 1Y3YA 1SSXA 2BDHA 4CRAA 3CENA 4AZ2B 1FY5A 3M5NA 4Q7ZA 1NU7B 5DP4A 2G8TA 3UFAA 2Z9KA 1ANDA 3RXGA 1DPOA 1UTNA 1P9UA 3SGQE 2PFEA 3A7YA 1DDJA
chains in the Genus database with same CATH superfamily
3GY7A 1YPHC 1XUIA 3LH3A 1AZ8A 1ANEA 1GJBB 2V3HH 5FAHA 3U8OH 5EXMA 5KEDA 3UR9A 1EX3A 1GPZA 2F9NA 1X7AC 2TGPZ 4NSYA 1EJNA 2I6QA 1YPMH 1O3CA 4INHA 1S6HA 1THSH 1C2EA 4FUIA 2VJ1A 2ZIQH 2H9EH 3AW1A 5IDKA 1EPTB 3F6UH 3GCTG 2WYGA 3ZZ8A 1N1LA 4OGYA 2AEIH 4XSKU 3T2NA 2GCHF 2GVFA 1PFXC 1F0RA 1V2RT 4ZCNA 4FUJA 3GY5A 1AGJA 5EPYA 1HLTH 3QGNB 2GZ8A 1E37B 1FDPA 2YMSB 5EJZA 6LPRA 4XBCA 2XBWA 5K0HA 5JPMH 3P17H 3SGBE 3A8BA 1W0KD 2R9PA 5DSFA 1BJUA 3WWFA 1RXPA 2JH5D 3BN9A 1N6YA 1A1RA 4K8BA 1LHEH 2ZDKA 1J16A 3LGUA 7GCHG 1F7ZA 2ZFQH 2A5AA 1TMUH 1GI4A 2ZFFH 3HKJB 3P8FA 4GSOA 3BG8A 1HXFH 1WQSA 4CRCA 1RD3B 4NA9H 1GI1A 1K1PA 3URCA 2A4QA 1G3DA 4GPGA 1RIWC 1TNLA 3SHAH 3DSOA 1A3BH 2ILNA 2ZGXH 4JYTA 1W12U 5HGGA 2ZZUH 1DUEA 3F9GA 1O2GH 2G51A 4TY6A 1MD7A 2ANMH 3OE7D 1TB6H 3VB5A 2AMPA 3W1EA 1LKBA 1ZSKA 2K0QA 4VGCB 4DJZB 6ESTA 2GZ7A 3P8NA 3ZV8A 4NGAH 3HGNA 1ZGVA 2PP6A 1RGQA 4THNH 1NN6A 1ANBA 1ORFA 3QGJA 1W8BH 6CHAC 1T31A 2CHAC 1S84A 2FI5E 4HGCA 1XUGA 1KLTA 5L6NH 3A7ZA 4B6EA 1C2FA 3VB3A 1P2NA 4XRNA 2BDGA 3STJA 4FU7A 3RP2A 1V2ST 4RKJB 1O31A 2OBQA 3KL6A 1P2OA 5EQQA 1O2IA 4SGBE 4ACAA 4A1XA 2F3CE 1QB6A 2WZQA 1WU1A 3GY3A 2Z3DA 3SU0A 2A7CA 3ZZDA 1D3TB 1AD8H 4AYYB 1Y5UT 4JYVH 2A4OA 1E35B 3PM3A 2FLBH 3IITA 2B8OH 4I8KA 2AMDA 3KQBA 2HNTE 4B1TA 3UWJH 4X1NU 1RFNA 3TNTA 3UPEA 3S7HB 1SGIB 1NRPH 3PMBB 1J14A 3EYDA 3RM0H 3VFEA 5C0UA 1YCPM 2VGCB 5C3NA 3I78A 5KECA 3BTHE 2Z9IA 4B2BA 3RXHA 1C5SA 3O8CA 1CBWB 2EY4C 3SU6A 4X6NA 3OX7U 1BMNH 5EU8A 6CHAB 3ELAH 2ALPA 1FY4A 4ZROA 1SGEE 1Z6JH 1GGDC 1OKXA 3SV2H 1XKAC 2O8MA 1HJAB 3FP7E 3RDZA 3PRBA 1OX1A 4ISIH 1B0EA 3BV9B 1QBOA 1UTOA 1BRUP 3NXPA 1CBWC 3IWMA 3QTVH 4AFUA 1TPAE 2BD8A 1UTLM 1XUFA 1XXDA 1C1QA 2ZPSA 1C1UH 2EEKA 1UTMA 2Y5FA 3TJNA 2B0FA 2GGVB 4K3JA 4ZXXH 3VPKA 1BTZA 3SGAE 5LH8A 5IK2D 2J5UA 2BB4A 3A84A 1G9IE 4NG9H 5EG4A 5B6OA 3BG4C 1HIAB 3RXEA 4YM9A 1P09A 1C4Y2 1FN6A 1ZGIA 1O37A 2FOMB 1A46H 1WYKA 1THRH 4MLFB 3K65B 2Y5HA 2FOCA 4GHQA 1BHXF 3RXUA 1IHTH 3UUZA 4ABGA 1EPTA 2HGTH 2TGAA 2KAIA 1WBGB 1C4U2 2YMSD 3LGWA 1LPZB 3SI3H 4D7GA 2STBE 1A2CH 3D23A 1UCYK 3M36A 2NU0E 1L4DA 4MVNA 5C2ZA 3OAAD 1GHAF 1S81A 2WSSD 3BSQA 3U28C 3MO3A 3RXVA 5FCKA 1HAZB 3W94A 2VVUA 4VGCC 2P3FH 1MAYA 3SU4A 3TJVA 2GT8A 2K1QA 4ZKRU 1EAXA 1K21H 4JCNA 1FX0B 3FZDA 3D49H 1C2KA 1BMFD 1F0UA 3MH6A 1IQKA 4Y7BA 2WPLS 5A09A 1PPBH 2ZP0H 1H9LB 3MU8A 2AHME 3M7UA 3RXOA 4X1SU 1HAYB 2CXVA 1A5IA 1BIOA 2A7JA 1KXCA 1AWHB 1GBKA 2BQWB 3OEED 3JZ2B 4FXGH 3LU9B 6GCHF 3RXRA 3QK1A 4OGXA 2ZWLH 3ATIA 1Y3XA 3TK5A 1YLCA 1KY9A 1GJ4H 1O2VA 4Y71A 3U1JB 4RKOB 1TGBA 1AE5A 1NFXA 4WMFA 5AFYH 4X8SH 1C2IA 1UVSH 1YC0A 2ZU3A 2C4FH 1IQIA 1D6WA 1YBWA 2FS9A 4X6MA 8KME2 2P8OB 1KXDA 2XCFA 1DSUA 1O2OA 3F2FA 1AKSB 1CVWH 2QN5T 2VVVA 1HAVB 2UWOA 1LVBA 4RI0A 5DO4H 2BZAA 2UUFB 1GI5A 1NFWA 2EC9H 2IJD1 2PGBB 1FNIA 2BD5A 5EIYA 1GMDG 2PWXA 3LH1A 1YPGH 1PPCE 1Z1IA 1GGDB 2NU1E 1AUTC 1AVXA 1GBJA 1P0SH 8LPRA 1ZR0A 1H9HE 1TX7A 1C5NH 3N7DA 3TGKE 1EUFA 1PPFE 5GIBA 1QBVH 1BTWA 2AS9A 2G55A 4OS6A 4K5ZA 3BF6H 1O2RA 2IOTA 4MNYA 1O5EH 1CGIE 1RTKA 4A6LA 4K1SA 1BUIA 4BAQB 1B5GH 1W2KH 3AK5A 3MU1A 2FI4E 5L2YH 1O32A 5EQRA 1EZXC 4IN2A 3RXIA 1K2I1 2UWLA 5HIZA 4YOGA 1OWKA 2GMTC 2FESH 4XBBA 1CT0E 5FPSA 2L6OA 4CBNA 1G36A 3MNSA 1W7XH 2OINA 4B2CA 1AVWA 2BQ7B 1ZLRA 5ABWA 2OC1A 5T3HA 3D65E 1SFIA 5EW2H 1AMHA 3WWBA 1TNIA 4YT7H 1TMTH 2WYJA 3RMNH 2EI6A 5A0AE 2OQ5A 2D8WA 1QJ7B 4D76A 2J38A 1SGCA 4JYUH 3T62A 1GBHA 1BMMH 1QR3E 1GL1A 1Z1JA 1D3QB 1LQDB 3GCTF 1KXBA 4FETA 2BVRH 4NFEA 2A2QH 2FS8A 3UWIA 2CJIA 1DE7H 1MBQA 2Q1JA 4BXWA 1ZHPA 1O2TA 1L0ZA 2KCPA 5E8EH 3AVZA 4R8TB 1BQYA 3ATKA 3MTYA 1AWFH 3M5LA 1MTWA 4KTSA 4Y10E 1BZXE 5FPTA 1QJ1B 4JZEH 1GMCF 1HFDA 4WF8A 5C5NA 1O3EA 3Q00A 1O2PA 2P16A 1KTTB 2TPIZ 4CRBA 4WY3A 4FUBA 1V2NT 1CGHA 1WOFA 2BD3A 3F2GA 2YNBA 4E7RG 1AIXH 1ARCA 1U6QA 1P3CA 2QYIA 1IOEA 3CS7A 1F0SA 3SU5A 1CSOE 5J4SA 3TH3H 4AB9A 5C5OA 1PQ7A 4AN7A 4GLYA 1CHGA 3OY5U 3ZZ9A 3ZVCA 1DX5M 2ZGJA 2ULLA 2WUBA 3PMHB 4X1PU 1SMFE 3T27A 2THFB 2UWPA 3PTNA 1O2HA 5HMAA 5C20A 1QRZA 3VB4A 2QF0A 4YOIA 3F68H 2ZC9H 4J2YB 1SC8U 1GJ7B 3LJOA 4RT1A 5DGJA 3RXDA 4AGJA 3KYGA 1QHRB 1WUNH 3SNEA 2QV1A 1LCYA 2ZDVH 3KCGH 1EQ9A 3ZVAA 1AN1E 1HAOH 3PWCA 1W0YH 1MCVA 1DM4B 1AHTH 1GBIA 1S83A 1BOQA 1C1WH 1XVOA 3M7QA 4RT0A 2RDLA 1KXFA 1L1NA 2BOKA 3TVJB 5C94A 1UO6A 1N6XA 4WH8A 1NFUA 1KXAA 2F91A 1O33A 5F03A 2CHAB 3KQ5A 2J98B 1G3EA 1XX9A 1NTPA 2F9VA 4KGAA 3S7KB 1ARBA 2FOBA 2L74A 3JZ1B 1QA0A 4E7NA 3E91A 4BTUB 1ELCA 5A8YA 1VGCC 1C5ZB 1HNEE 2QIQA 5EJLA 3P6ZB 3U8TH 4F48B 1C5WB 2VGCC 3MO6A 4UFFH 3TITA 1AFQB 3SO3A 2QF3A 5GJ4B 1SL3A 1CA0B 1TGTA 1D3DB 4OS5A 2ZECA 1GBAA 1C1RA 1C2GA 1LMWB 1O3DA 5C1XA 2A4GA 2M5TA 1J15A 2AFQB 1O3PB 2BLVA 4BTTB 1UHBB 3A86A 1RTFB 1FY8E 3RC4A 5DP8A 3T29A 1NZQH 3SYJA 1VJ9U 3RXMA 3T28A 1GI0A 3AASA 3FO8D 2OC0A 2JDID 4B71A 1W10U 4LOYH 4P00A 1SG8B 2Y6TA 3QX5H 4NFFA 5EXNA 5A8XA 1C2LA 4JZ1A 1O0DH 3LPRA 1Y5BT 4AORA 3KEEA 1A0HB 2GP9B 3GY2A 2HPPH 2ZPQA 2ZTZA 2JH6D 3QWCH 4X8TH 1ACBE 5TJXA 4D8NA 2AERH 1YP9A 4OS1A 1TA2A 2C8WB 1DITH 4XOJA 3QLPH 1TE0A 2GKVE 2HLDD 3ZZ5A 2OC8A 1SGTA 3GCNA 3PROA 1P2MA 3V0XA 3LGVA 1LO6A 1DXWA 4Y76A 2Z7FE 3QO6A 4TT3D 1ESBA 4X2YA 3UQVA 1OOKB 5JYIA 1VKYA 1SQAA 3FVFB 3P92A 1FMGA 3RLWH 2WV4A 3MHWU 4X8VH 3SUEA 1GHAG 5C1YA 3H09A 1IQJA 2FPZA 1LVOA 3ODDA 2Y5GA 1M9UA 4Y8YA 2BXTH 5LPFA 3FZZA 1V2QT 3OTJE 2FTLE 4ISOA 4TPIZ 3V12A 5EW1H 4HI3A 1MKWH 2NU2E 2PV9B 3BEFB 1JWTA 4O3UA 1KLIH 1C9TA 2J97A 4H6SB 1C2DA 2JKHA 1TABE 1SLXB 1KYNA 3M5MA 3PMAB 5E2PA 1K1LA 1O3GA 1ABIH 1F5KU 1COWD 1GCTC 1CO7E 1ZTKA 3KQDA 1EZSC 1QBNA 1JMOH 1O3FA 2NU4E 1P12E 5AHGH 5GWZA 4BAMB 2BQ6B 4NIWA 1DANH 1O3AA 1HGTH 3E1XB 4LXBH 1CA0C 1O3BA 1GMHG 1FY1A 1ZSJA 1E0FD 1T4VH 4DURA 4K8YA 1H1BA 1ZZZA 5C1UA 4HTCH 1O2UA 2ZHWH 1GBFA 2JETB 3BEIB 3ESTA 1DOJA 1FN8A 4GCHG 3U8RH 5I46H 2FODA 4O97A 5F8TA 1UTJA 2KR7A 3P95A 4IBLH 2GV7A 3F9EA 3TIUA 2LP6A 2XC4A 5E0GA 1NRNH 5HIYA 1BTYA 4B73A 2UUKB 3GS9A 4KELA 3V7TA 5CE1A 2GX4A 3BIVH 4Y79A 1BBRE 1OYQA 3ZZ3A 3A8CA 1P11E 3M35A 1LVYA 2PW8H 1E34B 1SGNE 4X6OA 4JZFH 1C5TA 1W0ZU 1Y59T 2XW9A 1D9IA 3LOXA 3SJ9A 5KGOA 1GHXH 1V2JT 1UK3A 2BDYA 3RXQA 2CV3A 3DCLA 3E6PH 5DG6A 3GOVB 3NUMA 1F0TA 1HAXB 4IN1A 2H5DA 4WXVA 2J98A 1SHHB 3MI4A 4BAOB 5JB9S 3SU3A 1CGJE 2ZCHP 1FIZA 4OS4A 4CR9A 1PQ8A 3SJOA 4BXSA 2OUAA 1S0QA 1UW7A 1WSSH 5A2MH 3SJIA 2ALVA 2F83A 2Q6DA 2GJGA 1L4ZA 4YLUA 5DP7A 2ZKSA 1PPEE 3DFJA 1S5SA 3F1SB 1NC6A 1UCYE 2HWLB 2Y81A 1IQLA 2ZFPH 2UUJB 2XXLA 1E1RD 1C5XB 2XWBI 1BTXA 1NRSH 3FP8E 1TRYA 1EAIA 1AVGH 2TIOA 1C5VA 1YLNA 1ZRBA 2VWLA 3BTTE 2C93B 5ESTE 2RA0A 1SVPA 4IC6A 3RXTA 1O2MA 2CK3D 2AGEX 1TALA 5DJ7A 1VITF 1AO5A 1QTFA 4I8GA 3DD2H 2ZHQH 1TAWA 2PR3A 2C8ZB 3LC5A 1QB1A 3A82A 1P05A 7GCHF 2CF8H 4SGAE 3RMMH 4ZKNU 2GDDA 3GCHB 1C4V2 3MH4A 3Q3YA 5TCCA 2J95A 1BTHH 4ZHMU 2ZI2H 3UOUA 1AI8H 3MWIU 3B9FH 3URDA 1GJAB 2I6SA 3OYPA 1O2SA 3UQOA 1S85A 3DHKH 4CREA 5GCHG 1WAYB 2KAIB 1L1GA 1T32A 1ETSH 1PPZA 2ZDAH 4UFEH 2Q6FA 2D2DA 3Q77A 2P59A 1NM6A 3PWBA 4Y8XA 1Y8TA 1Y3VA 1V2UT 1H9IE 2KCAA 1D6RA 1EAWA 3S9CA 1C1NA 2BY9X 4X2VA 2ZTXA 3SJ8A 5DKMA 1D3PB 4I31A 1TNKA 2FX6A 3NZIA 3LGIA 3TLOA 1TMBH 2FZZA 4ABAA 3HKIB 1O2XA 2F9UA 3V3MA 3SZNA 1P57B 1GHBF 1UCYH 3N99A 1MKXH 5DP5A 1K1IA 7LPRA 1QFKH 2AIQA 2XC5A 1O3OA 5EODA 3RC5A 2G4UA 1MKXK 3MH7A 1EKBB 1A0JA 2AH4X 1UK2A 3E16B 1GI6A 2IN2A 3TK6A 4TWYA 1A7SA 4RSPA 4UONA 2V3OH 1SLWB 4ZAEA 1LHDH 3RLYH 5ESBA 1CT2E 2AYWA 1JRTA 2HPQH 3L3TA 4H42U 4ZKSU 3AAUA 3AW0A 2W26A 3F9HA 5HM9A 1IQGA 1GHWH 4ABFA 5HKKD 3VEQB 1TYNA 3A8DA 1PPHE 1MTNB 2Y7ZA 2O8UA 1HB0B 4XE4A 1O5CB 4BANB 1GCDA 4K60A 4NWLA 1W14U 1HAVA 4A1TA 3ITIA 2ANKH 2XTTB 2P93A 2G5VA 3KN2A 1OHHD 1SB1H 1O3NA 2F4LA 2ODQA 5G4BA 2A31A 1G30B 1LPGB 2ZG0H 5I25A 4U30A 3S0NA 1TPOA 1XUKA 1H8HD 1TBRH 1K0HA 1C1MA 3ZIAD 1ZJDA 1EPTC 1SHYA 3GCHC 5PTPA 4ABHA 1MTSA 1DWBH 1SFQB 2PLXA 1EP5A 3N7OA 3RXSA 1RJXB 1DFPA 1O2WA 4ZXYH 4I8JA 1O3LA 1MTUA 1SGYE 1ZRKA 3CNRA 1CHOF 1QZ8A 1K28D 2J94A 3FANA 3A87A 3EGKH 3RMLH 1OP2A 3S9AA 4AG1A 5HYOA 4I7YH 2ZGCA 4ZHLU 1IQMA 2ZGBH 1O5GH 3K6YA 2B5TB 1NBME 1UVTH 3SI4H 1ELVA 1B0FA 3MNBA 4O03A 4ABJA 1EJAA 1GBLA 1GJCB 3S9BA 3UOPA 1TQ0B 3SORA 1DY8A 1O2JA 1FAXA 1IQFA 1ZTJA 4TSFD 5F6MA 3LGTA 1T8NA 1GI9B 8GCHF 4PROA 2Z94A 3H5CB 2BX3A 2BDIA 4AGKA 3FOAA 1OP0A 1J9CH 2Z3EA 1FIWA 2ZNKH 3GY4A 1ZYOA 1HIAA 2FWWA 1AB9B 1DXPA 1LPKB 2HRVA 1LTOA 1YM0A 2QXJA 1PYTD 1HUTH 2PUQH 1T8MA 3KYFA 1ELEE 3L33A 2GMTB 4FVDA 5DP3A 3SUDA 1CU1A 1O3HA 4Q63A 4YZUA 2ZFSA 4DY7B 2PTCE 1ANCA 1H8IH 2A4RA 1ZHMA 4Q2KA 3LJJA 3U69H 2BD2A 3RXPA 1Z71A 1TGSZ 5BRRE 1GBEA 1QGFA 4YT6H 4TWWA 3ZVFA 3EE7A 4WVPE 1YPEH 1W13U 1TGNA 3GISB 1NO9H 1OWJA 5EJ1A 2P95A 2F9BH 1S0RA 2QGRA 1Y3WA 3SBKA 1UVUH 1Q2WA 2VB0A 1TX8A 1E1QD 1OS8A 1N8OB 1RTLA 4Y6DA 4D7FA 3TNSA 4H6TA 4DG4A 4FUGA 1MZDA 1AUJA 1XVMA 2HLCA 4WH6A 1TLDA 1GBMA 5EQSA 3O8DA 4ABIA 1FXYA 2QCYA 2H2ZA 3GDUA 3RXBA 1F5RA 1LHFH 4O9VA 1GDQA 5LGOA 2W7SA 1FONA 1O3KA 1Y3UA 1GG6B 3A89A 4X1QU 1AZZA 2BLQA 4GAWA 1OWIA 4X2WA 1P2IA 4FU8A 1JBUH 4Q7XA 3M7TA 3SN8A 4AYVB 3P70B 3EE0B 2PKSB 2CF9H 2FP7B 2FX4A 4UDWH 4WXIA 1EOJA 2XRCA 1RRKA 1YPJH 3GDVA 1SQRA 4CRGA 2OD3B 4INKA 1XMNB 4JK5A 3E0PB 1ELBA 4P02A 3SJKA 1FQ3A 1YCPH 1AQ7A 1KSNA 2ODYB 4OM9A 1PPGE 1V6DA 3TGJE 3MNXA 1C5YB 4KTUA 3TH4H 1YLDA 3K9XB 5L2ZH 1LKAA 1KMHB 3T26A 4Z1MD 2YNAA 4CHAC 4IS5A 4CH2B 1ZHRA 5EOKA 1P3EA 4XBDA 1LHCH 2BLWA 3C27B 3GYLB 1FJSA 1NESE 2OQUA 1VZQH 4FUDA 4ZKOU 2GD4B 1EZQA 1EASA 1VJAU 1W7GH 3RM2H 4CBOA 2VNTA 3MO9A 1LDTT 7KMEH 1K1NA 4BOHA 1O3JA 4Y0YE 2W6ID 1WTGH 1TONA 1V2OT 1C2HA 4AFZA 2BX4A 2RDEA 1Z6EA 4NSVA 1MQ6A 2GCTB 1O39A 1GJ9B 1C2JA 4X0WU 1ESAA 2KCYA 3UB0A 9ESTA 1NFYA 3KGPA 2ZFRH 1P8VC 1NROH 2C90B 3A85A 1BHXB 3ZVGA 1SR5C 2FO9A 1QURH 1ZOMA 2ZHEH 5K7RA 2BXUH 1DSTA 1YPKH 2A5KA 3UNRA 4KTCA 2GCTC 1MABB 1J17T 2GTBA 4UE7H 2P3UB 2JJ2D 3B8JA 2R0KA 3ATMA 2Z3CA 2PGQB 1NBMD 1GVZA 1OWEA 4GVUA 2QE7D 4ISLA 2PKAA 1BBRH 1TGCA 4CHAB 1C2MA 1MU8B 1MZAA 5GDSH 3VGCC 1ABJH 3LT3A 1A3EH 3A7XA 5FBEA 2SGQE 3MQKC 1WDIA 2G52A 1VCQA 5DP6A 2J2UA 1C1VH 2V35A 1UHBA 1V2LT 3VG8A 1OPHB 2Z9LA 3SV9A 2SGPE 2Z9JA 4Y8ZA 1VCPA 4OS7A 2P8OC 2ZDMA 5GCHF 4JK6A 5A0BA 2AGGX 1YY3A 1OWDA 1OYTH 2XOKD 4NA7A 2FOFA 2SGDE 3C1KA 2QF5A 2FTMA 2C8XB 3ENSB 1PYTC 2BHGA 4B6FA 2VH6A 4DT4A 3T25A 1C1TA 1ZMNA 2ZQ2A 1MTNC 4ZMAH 1KIGH 1FI8A 1G3CA 3RUOA 3CS0A 1G32B 1GHZA 1E38B 2XC0A 3WY8A 4A7IB 1XUHA 4I32A 1NS3A 2C8YB 1HBTH 3PO1B 4DW2U 1HAPH 4X2XA 1YKTA 2EI7A 2G81E 1V2PT 3EDXB 3MH5A 2HALA 4Q7YA 1TWXB 4I8LA 3FP6E 1HAIH 8ESTE 2A7HA 4M9FA 4AOQA 2Z6BD 2R2WU 2WV9A 1QL9A 1Z8RA 2XNIA 3RXLA 2VWMA 4D9QA 1C5MD 2D26C 3EA9A 2VWOA 1MKWK 1ZSLA 1BA8B 2AGIX 1A5GH 2A1DB 1V3XA 4K1EA 1P06A 4A1VA 1O2LA 1O30A 1SGQE 2J34A 5CHBA 1QY6A 4ASUD 1NY22 2RCEA 1HAHH 1SGRE 5E0JA 3F0PA 1GHVH 1V2KT 1ZPCA 2BY7X 2DUCA 3MMGA 2W6JD 5FPYA 1QB9A 2FDAA 3KQEA 1EP6A 1QQUA 1O2NA 1QL7A 2LELA 2XYAA 1SKYE 1DICA 4DT7B 4AFSA 3ZVEA 3ATLA 4WJG2 1GWAA 4K1TA 4FUHA 1P2JA 3SUGA 5FXLA 3RU4T 2VWNA 4MPUA 2JETC 3ZV9A 1ZMLA 4U2WA 2EQNA 3TJOA 4B76A 2XBVA 2RA3A 1SI5H 3UAIC 2ZQ1A 3NRLA 1SQTA 3TK9A 1TFXA 2ZF0H 4UFDH 1GL0E 3SNCA 3IG6B 1GBBA 2WPJS 2A5IA 2QC2A 1YCPK 4HFPB 1PQ5A 1DWCH 4YTAA 1BTUA 3EA8A 1V2WT 1TNGA 1GBCA 1TQ7B 1BBRK 2VINA 4CRFA 2BYAX 3F0OA 1CQQA 4DGJA 2FXRA 1AU8A 1JXPA 2BLOA 4MDSA 2AMQA 1MD8A 3ATWA 2FI3E 3NWUA 1G37A 3B23B 2GV6A 1DY9A 4UEHH 4GHTA 4WWYA 3SUFA 1BITA 2J9NA 2H1UA 2QXHA 3BTGE 4XD7D 1TBQH 4K69A 3GY8A 2FYRA 5E2OA 4IC5A 1UTPA 1SOZA 5JBBS 3ZYEA 1BRBE 3SV7A 2O9QA 1ZPZA 2BD9A 1W11U 1WXRA 2VIQA 1ELGA 2WV5A 3UREA 5DP9A 1O3MA 1AFEH 2FEQH 1Q31A 3QTOH 1SPJA 2BOHB 3QUMP 1EATA 1FUJA 3A88A 2ZU1A 2KM0A 2Z9GA 1MUEB 4CH8B 1MH0A 2FM2A 1ETTH 1J8AA 5F53A 3A80A 2KFWA 2ANYA 3Q3KA 2A32A 2ZU2A 4M7GA 2PHBA 3GY6A 3SNDA 1C5LH 3MNCA 1O36A 1GJDB 1C1SA 1O34A 2YOLA 1O5FH 4F55A 2XWAA 3O8RA 4AFQA 5T1VA 3UY9A 3HK3B 3UTUH 1MAXA 2ZHFH 1GI8B 5HM2A 1YF4A 4J1YA 5FX6A 4AC9A 1C5QA 2QXIA 3ZVBA 2WINI 1P10A 2SNWA 3N7EA 1BMLA 3LC3A 3ODFA 1UVOA 4MPWA 2ASUB 3WW7A 2WPDD 2PKSC 1GBTA 5FHTA 2ZTYA 5HXFA 2Y80A 4DOQA 5GPIB 2R2MB 1MU6B 2QA9E 1K1JA 3ZYDA 1ZTLA 3VB6A 3P8OA 1SQOA 1P2KA 3MU5A 4MNVA 1OP8A 2VIDA 1C9PA 1HRTH 3PLKA 1TPSA 4GCHF 2H5CA 2GZ9A 1UVPA 1FLEE 4FUFA 4X6PA 2BD4A 3EQ0H 3LONA 5IYTA 3HPTB 2ZCKP 1P9SA 4DCDA 1TNHA 2RG3A 2JIZD 1ELFA 3H7OA 3VXFH 3Q76A 1QRWA 1V2VT 3OSYA 1NU9A 2TBSA 2R3UA 3P8GA 4LZ1H 1SGFG 1Z8GA 3E8LA 1O2QA 1S6LA 2P94A 2CGAA 3D62A 4WMDA 4ISNA 3SZEA 1O3IA 1Z8IB 4ABDA 2K8IA 1QCPA 1YWUA 5LPEA 1THPB 1GMHF 4ABBA 2UUYA 2ZDLA 2VIPA 2ZEBA 4ZH8A 2W3KA 6GCHG 1BRAA 3BIUH 1MQ5A 1CT4E 5CMXH 1GVKB 5JB8S 1TPPA 3NCLA 4MG3A 1HXEH 3SHCH 1FPCH 1KDQB 2ODPA 3PTBA 1A5HA 1BMAA 3I77A 5EXLA 1NRRH 2VIWA 2ZGHA 1G3BA 1GI3A 2R0LA 3M3VA 3UNSA 3W95A 2OCVB 4RN6A 2OTVA 5EGMA 1WV7H 1FY3A 2W5EA 3A7TA 4AX9H 1PJPA 4ZUHA 1KDQA 3NK8A 4H4FA 4I86A 2KZ4A 3SNAA 1AY6H 4MPXA 4U01A 3T5FH 4B75A 1GDUA 1FZZA 3RXAA 1KXEA 2ZA5A 4BNRA 4Q80A 3ZZ6A 3L6PA 3UNQA 3BG4B 2NWNA 2ZU4A 1D4PB 4IMQA 4LZ4B 1YPLH 7ESTE 4ZHAA 5AF9H 2VH0A 1KTSB 1EXFA 2HVXA 1GMDF 4CRDA 3KQCA 1FV9A 2FOGA 2V6NA 3SNBA 1F5LA 4U32A 2H9TH 5T6FA 4HZHA 5JBCS 1T8OA 2JH0D 1GJ6A 5A0CA 2HOBA 1GDNA 1L1JA 5E0HA 1DUAA 4DIIH 4IW4E 3BEUA 1C1PA 5B6LA 2OC7A 4YLQH 1HJAC 2BVXH 5FCRA 2ANWA 2QY0B 2ESTE 3HK6B 3E90B 1K22H 3PB1E 1AE8H 2O8WA 5CDFE 2IPHA 3GICB 4Z6AH 2OP9A 1O2ZA 3LIWA 2D1JA 3M5OA 1ZMJA 2GCHG 5TCAA 2H6MA 3PRDA 1NT1A 3UIRA 1FAKH 3G01A 5L30H 2H9HA 3PMJA 3K2UA 1BTPA 3BTDE 2VU8E 3PO1C 2WUCA 4F49A 3BTWE 5DK1A 1T4UH 5FX5A 1HAGE 3DUXH 1DVAH 2BTCE 3EA7A 4XDEA 1O5BB 3STIA 1TRMA 2XBXA 2FYQA 4ESTE 1HYLA 3VXEH 3U9AH 3BTFE 4LK4A 2AIPA 1A0LA 3TJUA 1ESTA 2IJOB 2HNTF 1DWDH 2WPIS 1ID5H 1JIRA 1Q3XA 5JDUB 3SU2A 1HCGA 2HVYB 1BT7A 4Z0KA 1P04A 1GHBG 1XUJA 3F9FA 4MNXA 3BTKE 5FL7D 1EOLA 3S69A 3FN8A 1JRSA 4X1RU 1Y5AT 1HJ8A 4YESB 2F43B 4A5TS 2WHXA 3MFJA 3M61U 1LQEA 4XFQA 1GI7B 2ZFTA 2DE9A 4FOUC 4JZDH 3M3SA 2NU3E 3ZZBA 1GVLA 4Y7AA 3M37A 2SGAA 4FU9A 1OXGA 1BDAA 4WMEA 2B7DH 2B9LA 3A7WA 1G2LA 1DS2E 1QRXA 3RMOH 3SQEE 5C0TA 1IQHA 2Y82A 3A8AA 4KKDA 1QJ6B 1F92A 3LDXH 2PUXB 2BDAA 1ZJKA 1EZUC 4A92A 2C3SA 3OEHD 5AFZH 4MQAA 4Y0ZE 3RXFA 1UTQA 4HG6A 1P02A 3GYMA 2ZCLP 5GXPA 3PV4A 1TNJA 3U1IB 1K1OA 1N8OC 3R3GB 5F8XA 1VR1H 3EAJA 2XBYA 1QL8A 4GUXA 1UTKA 1XXFA 1ELDE 3AAVA 2IPQX 1O38A 1O5DH 5A8ZA 1ELTA 4NZQA 4BAHB 1LVMA 4UD9H 1BB0B 3ZZ4A 3PV5A 1QA7A 5BPEA 3HATH 3BTQE 2F9OA 1UJ1A 2GDEH 5AVDA 1VITG 3BTME 1SLUB 1MCTA 3FFGA 3UR6A 1YGCH 2BVSH 3E0NB 3MOCA 1OSSA 1ELAA 2EI8A 3K6ZA 5JBAS 1H8ED 2A2XH 3A83A 4NA8A 1H8DH 3SU1A 2PSYA 2OBOA 3O8BA 1AKSA 3OU0A 4K2YA 1HV7A 1SBWA 1IHSH 2BD7A 1TOCB 1JIMA 1P01A 3RXJA 2SFAA 2DE8A 1C5RA 4NIXA 1GMCG 4ASHA 5LPRA 4ISHH 1EFRD 1S82A 2LPRA 3MYWA 1CHOG 1P2QA 1XKBC 1QNJA 1XM1A 5T6GA 2ZDNA 1EB2A 1AFQC 3SW2B 3NKKA 1C5OH 1V2TT 2GT7A 4YOJA 4OS2A 5J4QA 2ZO3H 3KHVA 4NZLA 3NPSA 3U98H 1B7XB 2ZHDA 1T8LA 2BMGB 3TPIZ 1TBZH 2FIRH 2G5NA 4MNWA 4TYDA 2CMYA 1F2SE 1C1OA 5DN6D 1OWHA 1Z7KA 4Y11E 4ACBA 2VIOA 1E36B 3SOSA 1P03A 4E05H 1KLJH 4BAKB 2M2AA 1SOTA 1MMJN 9LPRA 3F3BA 4FUCA 4TPYA 4E06H 1W0JD 4JMYA 4KP0A 3RXCA 1FPHH 5C17A 3OY6U 3QZQA 3I29A 3M3TA 4FUEA 1HPGA 3PLBA 2FOEA 2PSXA 4DVAU 1HDTH 2BDBA 3QN7A 1LHGH 2OXSA 2BY6X 1T7CA 1O2KA 4YO9A 1VITH 4DIHH 2KX4A 1DT2A 2VBCA 2W3IA 5SGAE 1WQVH 2SGFE 2ZU5A 5CHAB 5F8ZA 4NIYA 1YPHE 3RXKA 1DWEH 2CN0H 3TGIE 1TX6A 4INLA 1GHYH 1VCWA 1IQNA 3VGCB 3MU0A 4NIVA 2Q6GA 1K9OE 4B2AA 4D9RA 1AB9C 2PKAB 1O35A 3LKWA 2Y7XA 4ABEA 5JBTA 2A0QB 3QZRA 2BM2A 1WTHD 5DPAA 2OK5A 3PLPA 1C5PA 4X8UH 1UK4A 3OFND 4NCYA 3RU4E 2QF4A 3RC6A 1A61H 3DSGA 1W3CA 3DT0H 4BTIB 1TIOA 2WPMS 1CA8B 1NPMA 4MPVA 1GJ5H 1BCUH 3PV2A 2V3MA 1S6FA 1O5AB 1JOUB 3A81A 4NWKA 3PYHA 4UFGH 2J4IA 1HJ9A 2WPHS 2SNVA 3F2HA 1GCTB 1K1MA 1SLVB 3ZZCA 1GI2A 2FLRH 1O2YA 1DLKB 1MTVA 5T6DA 5C67A 3V13A 1UMAH 1GBDA 2F9PA 2P3TB 1EJMA 4IGDA 2G00A 3ZZ7A 3LGYA 1YYY1 2QXGA 1VGCB 1ZPBA 1MBMA 3RU4D 4F4OC 3BTEE 1C5UA 4YXWD 2LNCA 1IQEA 3H7TA 2FOAA 3DA9B 5H4IB 1L2EA 3GDSA 8GCHG 1E79D 1TOMH 1QQ4A 1G2MA 3KF2A 2SGEE 4CR5A 1GJ8B 2W7UA 2TRMA 3A7VA 3MU4A 1SGFA 2J92A 4I33A 4AB8A 1TA6A 5FBIA 1WCZA 4MTBA 2FOHA 3OTPA 1GG6C 2O8LA 2FMJA 4FVBA 2BZ6H 2BDCA 3FAOA 2EA3A 5GNDA 1SGDE 3CP7A 3SV8A 2TGDA 2O8TA 3DFLA 4Q4LA 1SGPE 1NRQH 1Z8JB 1PQAA 3SV6A 1ETRH 5CHAC 2KCOA 3TH2H 3KIDU 5EPNA 3ZZAA 3HGPA 4B74A 3GCOA 3TU7H 2VIVA 2VVCA 1DLEA 2ZPRA 3VB7A 3SQHE 4TY7A 2STAE 4I8HA 1TRNA 1RIWB 2V0BA 1V2MT 2BY5X 4IMZA 2XCNA 3KNXA 4QT8C 3DSPA 3R0FA 3Q3XA 4R0IA 2TGTA 1BRCE 4JZIA 1BJVA 3E3TA 2JJ1D 4O3TA 2QAAA 2XNDD 1IAUA 1H4WA 2YMSC 1A4WH 1EB1H 2A45B 4AG2A 2PTNA 2OLGA 2BY8X 1CE5A 2G4TA 3QDZB 1RS0A 2WPKS 2R3YA 2HNTC 5ETXA 3ZVDA 1QIXB 1EAUA 1INCA 1Y3YA 3FKSD 1SSXA 2BDHA 4CRAA 3CENA 4AZ2B 2RFKC 1FY5A 3M5NA 4Q7ZA 1NU7B 5DP4A 2G8TA 3UFAA 2Z9KA 1ANDA 3RXGA 1DPOA 1UTNA 1P9UA 3SGQE 2PFEA 2V7QD 3A7YA 1DDJA
chains in the Genus database with same CATH topology
3GY7A 1YPHC 1XUIA 3LH3A 1AZ8A 1ANEA 1GJBB 2V3HH 5FAHA 3U8OH 5EXMA 3UR9A 1EX3A 1GPZA 2F9NA 1X7AC 2TGPZ 4NSYA 1EJNA 2I6QA 1YPMH 1O3CA 4INHA 1S6HA 1THSH 1C2EA 4FUIA 2VJ1A 2ZIQH 2H9EH 3AW1A 5IDKA 1EPTB 3F6UH 3GCTG 2WYGA 3ZZ8A 1N1LA 4OGYA 2AEIH 4XSKU 3T2NA 2GCHF 2GVFA 1PFXC 1F0RA 1V2RT 4FUJA 3GY5A 1AGJA 5EPYA 1HLTH 3QGNB 2GZ8A 1E37B 1FDPA 6LPRA 4XBCA 2XBWA 5K0HA 5JPMH 3P17H 3SGBE 3A8BA 2R9PA 1BJUA 1RXPA 2JH5D 3BN9A 1N6YA 1A1RA 4K8BA 1LHEH 2ZDKA 1J16A 3LGUA 7GCHG 1F7ZA 2ZFQH 2A5AA 1TMUH 1GI4A 2ZFFH 3HKJB 3P8FA 4GSOA 3BG8A 1HXFH 1WQSA 4CRCA 1RD3B 4NA9H 1GI1A 1K1PA 3URCA 2A4QA 1G3DA 4GPGA 1RIWC 1TNLA 3SHAH 1A3BH 2ILNA 2ZGXH 4JYTA 1W12U 5HGGA 2ZZUH 1DUEA 3F9GA 1O2GH 2G51A 4TY6A 1MD7A 2ANMH 1TB6H 3VB5A 2AMPA 1LKBA 1ZSKA 4VGCB 4DJZB 6ESTA 2GZ7A 3P8NA 3ZV8A 4NGAH 3HGNA 1ZGVA 1RGQA 4THNH 1NN6A 1ANBA 1ORFA 3QGJA 1W8BH 6CHAC 1T31A 2CHAC 1S84A 2FI5E 4HGCA 1XUGA 1KLTA 5L6NH 3A7ZA 1C2FA 3VB3A 1P2NA 2BDGA 3STJA 4FU7A 3RP2A 1V2ST 4RKJB 1O31A 2OBQA 3KL6A 1P2OA 5EQQA 1O2IA 4SGBE 4A1XA 2F3CE 1QB6A 1WU1A 3GY3A 2Z3DA 3SU0A 2A7CA 3ZZDA 1D3TB 1AD8H 4AYYB 1Y5UT 4JYVH 2A4OA 1E35B 3PM3A 2FLBH 3IITA 2B8OH 4I8KA 2AMDA 3KQBA 2HNTE 4B1TA 3UWJH 4X1NU 1RFNA 3TNTA 3UPEA 3S7HB 1SGIB 1NRPH 3PMBB 1J14A 3EYDA 3RM0H 3VFEA 1YCPM 2VGCB 5C3NA 3I78A 3BTHE 2Z9IA 4B2BA 3RXHA 1C5SA 3O8CA 1CBWB 3SU6A 4X6NA 3OX7U 1BMNH 5EU8A 6CHAB 3ELAH 2ALPA 1FY4A 4ZROA 1SGEE 1Z6JH 1GGDC 1OKXA 3SV2H 1XKAC 2O8MA 1HJAB 3FP7E 3RDZA 1OX1A 4ISIH 1B0EA 3BV9B 1QBOA 1UTOA 1BRUP 3NXPA 1CBWC 3IWMA 3QTVH 4AFUA 1TPAE 2BD8A 1UTLM 1XUFA 1XXDA 1C1QA 2ZPSA 1C1UH 2EEKA 1UTMA 2Y5FA 3TJNA 2B0FA 2GGVB 4K3JA 4ZXXH 3VPKA 1BTZA 3SGAE 5LH8A 2BB4A 3A84A 1G9IE 4NG9H 5EG4A 5B6OA 3BG4C 1HIAB 3RXEA 4YM9A 1P09A 1C4Y2 1FN6A 1ZGIA 1O37A 2FOMB 1A46H 1WYKA 1THRH 4MLFB 3K65B 2Y5HA 2FOCA 4GHQA 1BHXF 3RXUA 1IHTH 3UUZA 4ABGA 1EPTA 2HGTH 2TGAA 2KAIA 1WBGB 1C4U2 3SI3H 3LGWA 1LPZB 4D7GA 2STBE 1A2CH 3D23A 1UCYK 3M36A 2NU0E 1L4DA 4MVNA 5C2ZA 1GHAF 1S81A 3BSQA 3MO3A 3RXVA 5FCKA 1HAZB 3W94A 2VVUA 4VGCC 2P3FH 1MAYA 3SU4A 3TJVA 2GT8A 2K1QA 4ZKRU 1EAXA 1K21H 4JCNA 3FZDA 3D49H 1C2KA 1F0UA 3MH6A 1IQKA 4Y7BA 2WPLS 5A09A 1PPBH 2ZP0H 1H9LB 3MU8A 3M7UA 3RXOA 4X1SU 1HAYB 2CXVA 1A5IA 1BIOA 2A7JA 1KXCA 1AWHB 1GBKA 2BQWB 4FXGH 3JZ2B 3LU9B 6GCHF 3RXRA 3QK1A 4OGXA 2ZWLH 3ATIA 1Y3XA 3TK5A 1YLCA 1KY9A 1GJ4H 1O2VA 4Y71A 3U1JB 4RKOB 1TGBA 1AE5A 1NFXA 4WMFA 5AFYH 4X8SH 1C2IA 1UVSH 1YC0A 2ZU3A 2C4FH 1IQIA 1D6WA 1YBWA 2FS9A 4X6MA 8KME2 2P8OB 1KXDA 2XCFA 1DSUA 1O2OA 1AKSB 1CVWH 2QN5T 2VVVA 1HAVB 2UWOA 1LVBA 5DO4H 2BZAA 2UUFB 1GI5A 1NFWA 2EC9H 2PGBB 1FNIA 2BD5A 1GMDG 2PWXA 3LH1A 1YPGH 1PPCE 1Z1IA 1GGDB 2NU1E 1AUTC 1AVXA 1GBJA 1P0SH 8LPRA 1ZR0A 1H9HE 1TX7A 1C5NH 3TGKE 1EUFA 1PPFE 5GIBA 1QBVH 1BTWA 2AS9A 2G55A 4OS6A 4K5ZA 3BF6H 1O2RA 2IOTA 4MNYA 1O5EH 1CGIE 1RTKA 4A6LA 4K1SA 1BUIA 4BAQB 1B5GH 1W2KH 3MU1A 2FI4E 5L2YH 1O32A 5EQRA 1EZXC 4IN2A 3RXIA 1K2I1 2UWLA 4YOGA 1OWKA 2GMTC 2FESH 4XBBA 1CT0E 5FPSA 4CBNA 1G36A 3MNSA 1W7XH 2OINA 4B2CA 1AVWA 2BQ7B 1ZLRA 5ABWA 2OC1A 5T3HA 3D65E 1SFIA 5EW2H 1AMHA 1TNIA 4YT7H 1TMTH 2WYJA 3RMNH 2EI6A 5A0AE 2OQ5A 2D8WA 1QJ7B 4D76A 2J38A 1SGCA 4JYUH 3T62A 1GBHA 1BMMH 1QR3E 1GL1A 1Z1JA 1D3QB 1LQDB 3GCTF 1KXBA 2BVRH 4NFEA 2A2QH 2FS8A 3UWIA 2CJIA 1DE7H 1MBQA 2Q1JA 4BXWA 1ZHPA 1O2TA 1L0ZA 5E8EH 3AVZA 4R8TB 1BQYA 3ATKA 3MTYA 1AWFH 3M5LA 1MTWA 4KTSA 4Y10E 1BZXE 5FPTA 1QJ1B 4JZEH 1GMCF 1HFDA 4WF8A 5C5NA 1O3EA 3Q00A 1O2PA 2P16A 1KTTB 2TPIZ 4CRBA 4WY3A 4FUBA 1V2NT 1CGHA 1WOFA 2BD3A 2YNBA 4E7RG 1AIXH 1ARCA 1U6QA 1P3CA 2QYIA 1IOEA 3CS7A 1F0SA 3SU5A 1CSOE 5J4SA 3TH3H 4AB9A 5C5OA 1PQ7A 4AN7A 4GLYA 1CHGA 3OY5U 3ZZ9A 3ZVCA 1DX5M 2ZGJA 2ULLA 2WUBA 3PMHB 4X1PU 1SMFE 3T27A 2THFB 2UWPA 3PTNA 1O2HA 5HMAA 5C20A 1QRZA 3VB4A 2QF0A 4YOIA 3F68H 2ZC9H 4J2YB 1SC8U 1GJ7B 3LJOA 5DGJA 4AGJA 3RXDA 1QHRB 1WUNH 3SNEA 2QV1A 1LCYA 2ZDVH 3KCGH 1EQ9A 3ZVAA 1AN1E 1HAOH 3PWCA 1W0YH 1MCVA 1DM4B 1AHTH 1GBIA 1S83A 1BOQA 1C1WH 1XVOA 3M7QA 2RDLA 1KXFA 1L1NA 2BOKA 3TVJB 1UO6A 1N6XA 4WH8A 1NFUA 1KXAA 2F91A 1O33A 5F03A 2CHAB 1G3EA 1XX9A 1NTPA 2F9VA 4KGAA 3S7KB 1ARBA 2FOBA 3JZ1B 1QA0A 4E7NA 3E91A 4BTUB 1ELCA 5A8YA 1VGCC 1C5ZB 1HNEE 2QIQA 3P6ZB 3U8TH 1C5WB 2VGCC 3MO6A 4UFFH 3TITA 1AFQB 3SO3A 2QF3A 5GJ4B 1SL3A 1CA0B 1TGTA 1D3DB 4OS5A 2ZECA 1GBAA 1C1RA 1C2GA 1LMWB 1O3DA 5C1XA 2A4GA 2M5TA 1J15A 2AFQB 1O3PB 2BLVA 4BTTB 1UHBB 3A86A 1RTFB 1FY8E 3RC4A 5DP8A 3T29A 1NZQH 1VJ9U 3RXMA 3T28A 1GI0A 3AASA 2OC0A 4B71A 1W10U 4LOYH 1SG8B 2Y6TA 3QX5H 4NFFA 5EXNA 5A8XA 1C2LA 4JZ1A 1O0DH 3LPRA 1Y5BT 4AORA 3KEEA 1A0HB 2GP9B 3GY2A 2HPPH 2ZPQA 2ZTZA 2JH6D 3QWCH 4X8TH 1ACBE 5TJXA 4D8NA 2AERH 1YP9A 4OS1A 1TA2A 2C8WB 1DITH 4XOJA 3QLPH 1TE0A 2GKVE 3ZZ5A 2OC8A 1SGTA 3GCNA 3PROA 1P2MA 3V0XA 3LGVA 1LO6A 1DXWA 4Y76A 2Z7FE 3QO6A 1ESBA 4X2YA 3UQVA 1OOKB 5JYIA 1SQAA 3FVFB 3P92A 1FMGA 3RLWH 2WV4A 3MHWU 4X8VH 3SUEA 1GHAG 5C1YA 1IQJA 2FPZA 1LVOA 3ODDA 2Y5GA 1M9UA 4Y8YA 2BXTH 5LPFA 3FZZA 1V2QT 3OTJE 2FTLE 4ISOA 4TPIZ 3V12A 5EW1H 4HI3A 1MKWH 2NU2E 2PV9B 3BEFB 1JWTA 4O3UA 1KLIH 1C9TA 4H6SB 1C2DA 2JKHA 1TABE 1SLXB 1KYNA 3M5MA 3PMAB 5E2PA 1K1LA 1O3GA 1ABIH 1F5KU 1GCTC 1CO7E 1ZTKA 3KQDA 1EZSC 1QBNA 1JMOH 1O3FA 2NU4E 1P12E 5AHGH 5GWZA 4BAMB 2BQ6B 4NIWA 1DANH 1O3AA 1HGTH 3E1XB 4LXBH 1CA0C 1O3BA 1GMHG 1FY1A 1ZSJA 1E0FD 1T4VH 4DURA 4K8YA 1H1BA 1ZZZA 5C1UA 4HTCH 1O2UA 2ZHWH 1GBFA 2JETB 3BEIB 3ESTA 1DOJA 1FN8A 4GCHG 3U8RH 5I46H 2FODA 4O97A 5F8TA 1UTJA 3P95A 4IBLH 2GV7A 3F9EA 3TIUA 2XC4A 5E0GA 1NRNH 1BTYA 4B73A 2UUKB 4KELA 3V7TA 5CE1A 2GX4A 3BIVH 4Y79A 1BBRE 1OYQA 3ZZ3A 3A8CA 1P11E 3M35A 1LVYA 2PW8H 1E34B 1SGNE 4X6OA 4JZFH 1C5TA 1W0ZU 1Y59T 2XW9A 1D9IA 3LOXA 3SJ9A 1GHXH 1V2JT 1UK3A 2BDYA 3RXQA 2CV3A 3E6PH 5DG6A 3GOVB 3NUMA 1F0TA 1HAXB 4IN1A 2H5DA 4WXVA 1SHHB 3MI4A 4BAOB 5JB9S 3SU3A 1CGJE 2ZCHP 1FIZA 4OS4A 4CR9A 1PQ8A 3SJOA 4BXSA 1S0QA 2OUAA 1WSSH 5A2MH 3SJIA 2ALVA 2F83A 2Q6DA 1L4ZA 4YLUA 5DP7A 2ZKSA 1PPEE 3DFJA 1S5SA 3F1SB 1NC6A 1UCYE 2HWLB 2Y81A 1IQLA 2ZFPH 2UUJB 2XXLA 2XWBI 1C5XB 1BTXA 1NRSH 3FP8E 1TRYA 1EAIA 1AVGH 2TIOA 1C5VA 2VWLA 1ZRBA 3BTTE 2C93B 5ESTE 2RA0A 1SVPA 4IC6A 3RXTA 1O2MA 2AGEX 1TALA 5DJ7A 1VITF 1AO5A 1QTFA 4I8GA 3DD2H 2ZHQH 1TAWA 2PR3A 2C8ZB 3LC5A 1QB1A 3A82A 1P05A 7GCHF 2CF8H 4SGAE 3RMMH 4ZKNU 2GDDA 3GCHB 1C4V2 3MH4A 3Q3YA 5TCCA 2J95A 1BTHH 4ZHMU 2ZI2H 3UOUA 1AI8H 3MWIU 3B9FH 3URDA 1GJAB 2I6SA 3OYPA 1O2SA 3UQOA 1S85A 3DHKH 4CREA 5GCHG 1WAYB 2KAIB 1L1GA 1T32A 1ETSH 1PPZA 2ZDAH 4UFEH 2Q6FA 2D2DA 3Q77A 2P59A 1NM6A 3PWBA 4Y8XA 1Y8TA 1Y3VA 1V2UT 1H9IE 1D6RA 1EAWA 3S9CA 1C1NA 2BY9X 4X2VA 2ZTXA 3SJ8A 5DKMA 1D3PB 4I31A 1TNKA 2FX6A 3NZIA 3LGIA 3TLOA 1TMBH 2FZZA 4ABAA 3HKIB 1O2XA 2F9UA 3V3MA 3SZNA 1P57B 1GHBF 1UCYH 1MKXH 5DP5A 1K1IA 7LPRA 1QFKH 2AIQA 2XC5A 1O3OA 5EODA 3RC5A 2G4UA 1MKXK 3MH7A 1EKBB 1A0JA 2AH4X 1UK2A 3E16B 1GI6A 2IN2A 3TK6A 4TWYA 1A7SA 4RSPA 4UONA 2V3OH 1SLWB 4ZAEA 1LHDH 3RLYH 5ESBA 1CT2E 2AYWA 1JRTA 2HPQH 3L3TA 4H42U 4ZKSU 3AAUA 3AW0A 2W26A 3F9HA 5HM9A 1IQGA 1GHWH 4ABFA 3VEQB 1TYNA 3A8DA 1PPHE 1MTNB 2Y7ZA 2O8UA 1HB0B 4XE4A 1O5CB 4BANB 1GCDA 4K60A 4NWLA 1W14U 1HAVA 4A1TA 3ITIA 2ANKH 2XTTB 2P93A 2G5VA 3KN2A 1SB1H 1O3NA 2ODQA 5G4BA 2A31A 1G30B 1LPGB 2ZG0H 5I25A 4U30A 3S0NA 1TPOA 1XUKA 1TBRH 1C1MA 1ZJDA 1EPTC 1SHYA 3GCHC 5PTPA 4ABHA 1MTSA 1DWBH 1SFQB 2PLXA 1EP5A 3N7OA 3RXSA 1RJXB 1DFPA 1O2WA 4ZXYH 4I8JA 1O3LA 1MTUA 1SGYE 1ZRKA 1CHOF 1K28D 2J94A 3FANA 3A87A 3EGKH 3RMLH 1OP2A 3S9AA 4AG1A 5HYOA 4I7YH 2ZGCA 4ZHLU 1IQMA 2ZGBH 1O5GH 3K6YA 2B5TB 1UVTH 3SI4H 1ELVA 1B0FA 3MNBA 4O03A 4ABJA 1EJAA 1GBLA 1GJCB 3S9BA 3UOPA 1TQ0B 3SORA 1DY8A 1O2JA 1FAXA 1IQFA 1ZTJA 5F6MA 3LGTA 1T8NA 1GI9B 8GCHF 4PROA 2Z94A 3H5CB 2BX3A 2BDIA 4AGKA 1OP0A 1J9CH 2Z3EA 1FIWA 2ZNKH 3GY4A 1ZYOA 1HIAA 2FWWA 1AB9B 1DXPA 1LPKB 2HRVA 1LTOA 1YM0A 2QXJA 1PYTD 1HUTH 2PUQH 1T8MA 1ELEE 3L33A 2GMTB 4FVDA 5DP3A 3SUDA 1CU1A 1O3HA 4YZUA 2ZFSA 4DY7B 2PTCE 1ANCA 1H8IH 2A4RA 1ZHMA 4Q2KA 3LJJA 3U69H 2BD2A 3RXP