3ITIA

Structure of bovine trypsin with the mad triangle b3c
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cationic trypsin
publication title How to get the magic triangle and the MAD triangle into your protein crystal.
pubmed doi rcsb
molecule tags Hydrolase
total genus 54
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2009-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3itiA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3itiA02
1P01A 1TQ0B 1CBWC 4KP0A 1ELAA 3OX7U 1B7XB 1HAIH 2GD4B 5C67A 1CBWB 1RD3B 1BRBE 2ULLA 3Q3KA 1IQMA 1HAHH 2J34A 1JOUB 4A1XA 3RXPA 1G3DA 4OS4A 3ZZ4A 1QBVH 2OUAA 1Y5UT 1C5SA 1D3PB 1UK2A 3CS7A 3E3TA 1YLDA 1W14U 3KQEA 3PLBA 1VZQH 3M61U 2QY0B 2F9UA 4FUIA 4LXBH 1QJ6B 2ZQ2A 1QFKH 2LPRA 1C5QA 5FX5A 2ILNA 3UOUA 1FV9A 3MO3A 3W95A 1GDQA 4Q80A 1CQQA 5AF9H 3M7QA 1N8OC 4ZKOU 5JB8S 3BTEE 5B6OA 1V2UT 5ESTE 2YNAA 4ABDA 2ZWLH 1XUHA 1O31A 3UOPA 1T31A 2Z7FE 1BRUP 3A85A 4JK6A 2GZ7A 1DFPA 1INCA 3CS0A 2PV9B 2ZQ1A 3MU4A 3RXBA 3VB6A 1K1IA 4XBCA 4WF8A 3ENSB 1IQHA 2CXVA 5AFZH 1HJ8A 2J2UA 3BF6H 2F9NA 4ISHH 2BY5X 2NWNA 3FANA 2F83A 1FXYA 4XFQA 1GHVH 1TGCA 5T6GA 3PV4A 1O3JA 1OOKB 2BXUH 1V2QT 1P3CA 2A4GA 1ZGIA 4F49A 4O03A 1L1GA 3ZVAA 5FPSA 1SQAA 3RXSA 3MWIU 1L0ZA 1Z6EA 1BTUA 3LC3A 1E36B 1AIXH 4TYDA 3UWIA 1GI9B 2ODPA 2XCFA 1FMGA 4TY6A 3NXPA 1O2SA 4UFGH 1SR5C 1T8LA 5EODA 1G32B 1A2CH 2GCHG 3LU9B 5JBBS 1LVBA 2Y81A 3RMLH 1EJAA 2A5IA 2G81E 3P8NA 2I6QA 5FXLA 1P2JA 2FXRA 4MVNA 1MCTA 1SHYA 1O2JA 3B23B 2CHAC 1JRSA 2H5DA 5J4SA 2BQ7B 4CR5A 3RM2H 1CHGA 4J2YB 2ZI2H 1TGBA 1NU7B 2D2DA 4OGYA 2ZPSA 1IQEA 2BX3A 3B8JA 1G36A 2ZFFH 2PTNA 3SJKA 1B5GH 4ABJA 4GUXA 4CH2B 3KQCA 2WINI 3SI4H 1C5VA 1TBZH 1Z8RA 1O2PA 4B71A 2ALPA 1CSOE 2O8MA 1YKTA 1OWHA 2V3HH 1ZTLA 1T32A 2PWXA 2ZFTA 1C9PA 4NIVA 1BRAA 1K1NA 4FUHA 1W12U 1WTHD 1CT4E 8KME2 1OPHB 1OWIA 1A61H 1P8VC 1S83A 5DP5A 3PO1C 1MD8A 1SLUB 1BDAA 3LH1A 4MNWA 2A4OA 3PO1B 4KELA 4A7IB 1BQYA 5DP4A 3M7UA 1OWJA 2ZHDA 1PPZA 4PROA 1UJ1A 3V0XA 4Z6AH 1SGDE 1ZRKA 5JBAS 4INKA 2Y82A 2PHBA 3BG8A 4Q2KA 5K0HA 2QF0A 1SSXA 2PTCE 2GT8A 4THNH 1GBHA 2R9PA 1O3GA 2BVSH 1C5OH 4FUBA 4MTBA 2A1DB 4BXSA 1Y59T 4NG9H 1O5CB 1A0LA 1EJMA 5GPIB 4A6LA 3SU1A 2FX6A 1DS2E 2ZIQH 1ELTA 3TNSA 4X8TH 1GPZA 3SGBE 1D3QB 3MMGA 1ESBA 1H9HE 1O2XA 5A09A 5LPRA 3UNSA 1OP8A 3B9FH 3A81A 5JYIA 4NZLA 4Z0KA 1DWBH 2G8TA 3UTUH 2J38A 1ZPCA 1GBEA 1CA0C 2ZU3A 5TCCA 4LZ4B 2BY8X 2BDYA 1T7CA 2BTCE 3O8RA 1LMWB 1XVMA 1VCQA 4OS2A 1W2KH 1Z1IA 1BB0B 3AAUA 2HWLB 1C1MA 3M36A 4B73A 2XW9A 2GDDA 4ZHAA 1FLEE 1KLJH 2BOHB 1VJ9U 3TU7H 1C5RA 1IHTH 1GHBF 3NWUA 1O5EH 1TGNA 1FPCH 2DE8A 5LH8A 1K21H 1OS8A 3FZZA 1K1JA 2V35A 1K1MA 1K9OE 1W3CA 1LVOA 1Q31A 3BSQA 1HXFH 1O2ZA 1O2RA 2QA9E 3AAVA 4I8KA 5GCHG 1TNJA 3A86A 1C1PA 1P2OA 1BZXE 1GI5A 5C1UA 5K7RA 1MZAA 3KF2A 3D23A 4BAQB 3HGNA 1HDTH 2BZ6H 3SUGA 4GAWA 3SHAH 4UONA 1DUAA 1P04A 3DD2H 1MKWK 1V2WT 2FOEA 2W5EA 2BOKA 2OCVB 1MTNC 1LPZB 4GHQA 1RTKA 5E0GA 2ZDMA 3UPEA 3TJUA 5HGGA 4K60A 3ZZ7A 2VWMA 3AASA 3V3MA 1XXFA 5L6NH 1DVAH 3EGKH 4K1SA 1BHXF 1C2JA 4B2CA 1V2TT 2OINA 3PLKA 5HM9A 4UFDH 3L33A 4ZKNU 2TBSA 3SU0A 1ACBE 2TIOA 3SUFA 2ZPQA 3OY5U 5HXFA 3KGPA 1E35B 3A7TA 1W13U 2AGGX 3UREA 5IYTA 1Y3WA 2B9LA 3BTGE 1XUKA 1O3HA 4AB8A 1AB9C 3ZVGA 2ZG0H 2ODQA 3RM0H 1P11E 2XRCA 2Z9GA 3SJ8A 4A92A 1G3EA 1RRKA 3H5CB 1HAYB 1HAXB 4WVPE 3RU4D 1P06A 1UVOA 1GMDG 2A0QB 1UVSH 1PQ8A 1PPFE 1FAXA 3DFLA 1GI6A 1E37B 4WWYA 4YT6H 4BAKB 1P02A 1AVGH 1L4ZA 1O3LA 1GBBA 2ZU2A 2QCYA 1KXFA 1AZ8A 4JYUH 3ZZCA 2A31A 3PMJA 4SGAE 2O8LA 1HJAC 5C2ZA 3CENA 2BY9X 3U1IB 4K8BA 2BYAX 1LPGB 2G5NA 1O2IA 5EPYA 1QRXA 2Y7ZA 2ANWA 1SGQE 1LPKB 1A7SA 1ZR0A 1PPEE 4NIYA 5FCRA 4MPVA 4AYYB 1L4DA 3BV9B 2JETB 3EA7A 1NESE 1F2SE 3A84A 1MAYA 4K3JA 1NFXA 1TLDA 4B2BA 1IHSH 1VR1H 2EEKA 3F6UH 5E0HA 5GXPA 2PKAB 1O3BA 4HFPB 1G2MA 3AVZA 2J4IA 2FESH 3MH6A 1UTKA 5JB9S 1C5TA 5L2ZH 1O3FA 1DITH 2ZGXH 3BIUH 1BHXB 4INHA 3LJJA 3FZDA 4MG3A 1C2LA 4U32A 1EP6A 1PPBH 1FONA 3NK8A 1K1PA 1LQDB 3PMAB 2OP9A 1ZMJA 3TGKE 2ASUB 3ZVBA 2PKAA 4CR9A 1HPGA 1AVWA 1AGJA 1YPMH 1O0DH 3SGAE 5E2PA 1FY3A 2GGVB 6ESTA 2VGCC 2VVCA 3ATWA 2VGCB 3T5FH 2TGPZ 3RC4A 4X1PU 3U8OH 2EI6A 1T4UH 3BTKE 1KXEA 5I46H 1DE7H 4IMQA 1TQ7B 1H9IE 1BMAA 1MUEB 1V3XA 1MU8B 2A32A 2VIOA 4IC5A 1P10A 1YBWA 2A2QH 1CHOF 2FOCA 3A7XA 5TCAA 3T25A 5C3NA 4FVBA 4X2YA 1TFXA 2UWPA 3ZZ5A 2TGDA 1AUJA 2P3FH 4RN6A 1GMCF 2V0BA 3RXHA 5DKMA 2ZCKP 1C1OA 1VGCC 3SV8A 2AS9A 3QTOH 4UDWH 1NFYA 1SGCA 2QXHA 4M7GA 1N1LA 3LH3A 4AG2A 5IDKA 2BQ6B 3O8BA 4ZH8A 1TPPA 2ZTZA 2VNTA 1TAWA 1ABJH 1CGHA 1G37A 1Z1JA 1FJSA 2NU3E 1AWHB 1F5RA 1TNLA 1H8IH 1LVYA 4WH8A 1GBLA 2YOLA 3SNCA 1O3PB 3RUOA 1HJ9A 4B76A 2NU2E 3MNSA 8GCHF 1GBIA 2FTLE 3HK6B 3KNXA 1YPHC 4AFZA 1ELVA 3ODDA 3MU1A 5T3HA 4ABBA 1S81A 1EKBB 1MBQA 2OD3B 2SGFE 3MNCA 1Z71A 1O3OA 1GHBG 1QQUA 2AYWA 2AERH 2GCTB 4JMYA 3VB7A 1LHCH 5G4BA 3E16B 2FM2A 3TH3H 4BTIB 1O37A 3C27B 1C5UA 1ZGVA 2D8WA 4GPGA 2TPIZ 3A80A 3N7OA 2C3SA 1VCWA 1SGFG 4WY3A 1RXPA 4ASHA 4CRFA 5BRRE 9ESTA 1ZPZA 1PJPA 1EZUC 1MTSA 2JH0D 2FS9A 1HRTH 3A83A 5C20A 2AMPA 1PPCE 1F7ZA 3F9FA 1G3CA 1C5XB 1V2RT 3P6ZB 1TNHA 3SU3A 1DY9A 1O5DH 4QT8C 1C4U2 3QGJA 2P3TB 1QB1A 1ETTH 3MH7A 2W3IA 4NCYA 3ATMA 1OWEA 1MH0A 1NC6A 1C1WH 1IAUA 3SU6A 2ALVA 3SJOA 1GI3A 3BTTE 5GCHF 5A8YA 4DCDA 3RXDA 2PW8H 1Q3XA 4Y7BA 2G55A 1KIGH 2H1UA 4CHAB 2HRVA 2VB0A 4VGCC 2VIWA 1O2KA 3LJOA 1ZSKA 3ZZDA 4X6NA 1LVMA 2VWOA 1ZHPA 5DP7A 1JWTA 6LPRA 3MO9A 1O3MA 1AMHA 3PM3A 4AFQA 2QGRA 3DT0H 3EDXB 1ESAA 1C2MA 1UO6A 1FPHH 1V2VT 1BTZA 4X2VA 3ELAH 4YLQH 1H4WA 3S9AA 1P2MA 2Z3DA 5DP9A 1WTGH 3FP6E 2XC0A 1A3BH 1THRH 1XKAC 4AGKA 1ANDA 1UTPA 1Z8IB 3Q76A 3M5OA 3RMNH 2STBE 1DWCH 4JCNA 3SORA 1NROH 3NPSA 2QAAA 4K5ZA 1ZJDA 3DFJA 1QURH 5DP3A 2HNTC 2HPQH 3VFEA 3VEQB 1N8OB 1PPHE 1Y8TA 4FUGA 4B74A 1GL0E 2P3UB 4H4FA 2A45B 1FY5A 5BPEA 1Y3UA 2J92A 1N6XA 3A7ZA 4YOGA 1P2QA 4X2XA 1DSTA 2K1QA 2GKVE 1DLKB 1ETSH 2W3KA 2BD5A 3PB1E 3MH5A 1GMDF 2ZCLP 2PGBB 3HK3B 1SQTA 1F0UA 4TWYA 3NUMA 3ITIA 2F91A 3I77A 3SO3A 3NZIA 3Q00A 4AN7A 3OU0A 1YM0A 2WYGA 2H2ZA 4X6PA 5HM2A 2XBXA 1BA8B 4FUDA 4UFEH 2F3CE 4DGJA 1L1NA 1A3EH 2H6MA 1GMHG 3HKIB 3OY6U 3GCOA 1QHRB 1JIMA 2Y5GA 2EA3A 2FZZA 2SGEE 3A89A 4GVUA 1NU9A 3QLPH 4NGAH 2XYAA 4INLA 1VCPA 2RA0A 2VVUA 3LOXA 4DVAU 1TB6H 3RXGA 4BAMB 3LGUA 4NA7A 1XM1A 4TPYA 1SGIB 2SNVA 2FOAA 3EE0B 2G00A 1O2YA 3RXRA 1T8OA 1HV7A 3R0FA 1AD8H 2ZGHA 4DY7B 2CHAB 3ZZ6A 4DIHH 1D9IA 3BTFE 4Y71A 2O8UA 2IOTA 1ZMNA 5F8TA 4AYVB 2P8OC 4NA9H 3STJA 1TRMA 2P8OB 1QL8A 1UTOA 2WPHS 3RXQA 1TWXB 3NKKA 2VIPA 4Y7AA 1UVTH 3PWBA 1SFQB 2JH6D 3EAJA 1O5BB 1ARCA 3ZVCA 5CHAC 1ELGA 2P93A 5C1YA 2Q6GA 2C8ZB 3PYHA 1O2NA 2GP9B 1TGSZ 5CHAB 3UFAA 1FY1A 1WQSA 5ESBA 1BMLA 1ANBA 1Z8JB 2FIRH 2OQ5A 1C5MD 3JZ1B 3Q3XA 3LIWA 2QC2A 1CHOG 1DWEH 3MU8A 4BNRA 2BDCA 1Y3XA 1YLCA 1OX1A 1SOZA 1EOJA 2GX4A 3RLWH 4A5TS 4XE4A 1JXPA 3ZVFA 1GMCG 4X8VH 1V2NT 4H6SB 1EAUA 2LNCA 2A7HA 1WAYB 1C1SA 1WBGB 1NRSH 3QO6A 4HTCH 1Y5AT 1KYNA 1ELEE 3NCLA 1GJBB 1C2KA 2A5KA 5DG6A 1BCUH 3H7TA 4TWWA 1IQNA 3PTBA 1O2MA 1XUFA 2AGEX 1V2ST 1IQIA 4ZKSU 2QXIA 2WPIS 1WYKA 3RXIA 2GTBA 1NM6A 4GHTA 3DUXH 4MNVA 4YO9A 3QTVH 2Z9JA 1HXEH 5T6FA 3UQOA 1AO5A 1XUIA 1EPTC 1O5GH 2A7JA 1GBCA 3TK9A 4DT7B 2FOGA 1UTQA 1EJNA 2C8YB 4K2YA 5PTPA 4RKJB 3IWMA 8GCHG 4CRAA 4BAHB 3QZQA 3GISB 1EUFA 1QL7A 1DM4B 5HYOA 4J1YA 4JZDH 1KXBA 3ZZ3A 2UUFB 3L6PA 4K69A 1O2WA 3LGVA 2G52A 1LHFH 2BD9A 1CA0B 1THPB 4FU9A 1L2EA 3GY6A 1S6FA 4CRCA 2UWOA 4ABAA 2WPJS 4Y76A 1D6WA 1C5PA 2B5TB 1C9TA 4X1QU 4ZUHA 3TK6A 3BG4C 3C1KA 1CU1A 1GVKB 2Y7XA 1KY9A 1YPLH 2BZAA 3TGJE 4AFSA 4ZROA 3VB3A 4O3TA 1BJVA 3Q3YA 6GCHF 1XVOA 3EQ0H 3HKJB 1XMNB 2ZDAH 2CF9H 1DT2A 2WPKS 2FLBH 1P05A 1HLTH 5DP8A 1BUIA 3QUMP 2VIVA 1NT1A 1MCVA 3KHVA 1TGTA 2C93B 5GDSH 1MU6B 4ABHA 3SGQE 1WOFA 4ZKRU 1NPMA 1JBUH 2OQUA 3GDVA 1K2I1 2Z9LA 2ZU5A 3QZRA 2R2WU 5FCKA 3RXEA 1O30A 1IQLA 2UUJB 2OC7A 4BXWA 8LPRA 3BTQE 1DWDH 1P9SA 3RXLA 4D8NA 2QXGA 1W10U 3URDA 1NFUA 5EOKA 1ETRH 2VWLA 1TIOA 1MTNB 1TRYA 1CGJE 4IN2A 1DLEA 3ESTA 4ZHLU 1O5FH 1BIOA 4E05H 4FUEA 1GCTC 1GBMA 2H9EH 4ZXXH 1VITH 5EW2H 1GCTB 2PFEA 1ZYOA 3UUZA 2P16A 3HATH 1RFNA 5FPTA 1C2IA 2CF8H 4MPXA 1G9IE 1O2TA 1BITA 3RU4E 4X8UH 2FS8A 1J17T 1ZSLA 1BMMH 1VJAU 3GY2A 2BY7X 2B0FA 1W0YH 3P92A 4JYTA 1GHZA 4D7GA 2FYRA 2ANYA 2ZFRH 1J8AA 4GSOA 1TNKA 1EB2A 1AB9B 1P03A 3V12A 1GI8B 1UTMA 1B0EA 1KDQB 5H4IB 2C4FH 3S9CA 1GJ4H 1MTWA 1YP9A 4XDEA 2FO9A 1EXFA 4JYVH 5GWZA 4K8YA 3TVJB 2BLVA 1RIWC 4O97A 3T62A 2TGTA 4YTAA 4IN1A 2JKHA 1C4V2 2SGDE 3A8CA 1W8BH 2BM2A 2FOMB 2AH4X 1LHDH 4DOQA 1JMOH 2XXLA 2ZKSA 1C2GA 1HJAB 1RJXB 1AKSB 4Y0ZE 4AX9H 3LT3A 5FAHA 3GYMA 4KTCA 4YLUA 1AFQC 1KDQA 5DK1A 4YZUA 2PUQH 1BTWA 1IQJA 1AFQB 4X0WU 3SUDA 1HFDA 3P70B 2H5CA 1CE5A 1OYQA 3ZV8A 2CGAA 1QGFA 1AWFH 1TPAE 2FTMA 3VXFH 2OLGA 1MBMA 7GCHG 1BRCE 1ABIH 1KLIH 1K1OA 1O3AA 1AKSA 2WPLS 1TOCB 1NRQH 1SGPE 1UTJA 2ZP0H 1F5KU 2BX4A 2HGTH 1SGFA 2Y80A 1LHEH 2RA3A 3U69H 1DOJA 1GMHF 3K65B 3LGYA 4BTUB 2ZDNA 2BD7A 3RC5A 2D1JA 1KTTB 2BVXH 3FP7E 1MKWH 1NN6A 4AG1A 4AGJA 1EZXC 4FXGH 2FEQH 1O2QA 1EATA 2Y5HA 3RLYH 1YPJH 4GCHF 1S0QA 4XOJA 1GHAG 1P12E 4I7YH 4IGDA 3A7VA 1ZSJA 1QBNA 3LGTA 4I8HA 1KSNA 1V2KT 3MH4A 7ESTE 4AOQA 1GBJA 2XBYA 4BAOB 3A8DA 4ZMAH 2FOBA 3SU2A 1BMNH 2BDGA 1GI7B 1GBAA 1SGTA 2ZPRA 2VH0A 2WPMS 1TPSA 2PR3A 3LDXH 3MU0A 4TPIZ 2D26C 2J9NA 4Y79A 3ZZ8A 3D49H 3W94A 2VVVA 3GCNA 1O2UA 1SHHB 1NRNH 1SL3A 4HZHA 3U8RH 1OWDA 2ZFPH 1UHBB 1BOQA 3SV9A 3M37A 3FVFB 5A8XA 3GOVB 3SU5A 1C1RA 5FBIA 5I25A 3ATKA 1YCPM 1GCDA 2UUYA 5JBTA 1ZLRA 1ZJKA 1GGDC 3EYDA 1AE8H 1AQ7A 1GGDB 2ZTXA 2V3OH 3RDZA 4NFEA 2BD4A 1X7AC 1ARBA 1VGCB 5EU8A 1ELBA 3E90B 1SVPA 3HPTB 2XC5A 1UHBA 1O2GH 1AVXA 2GV7A 1MQ6A 4E06H 2QYIA 1YF4A 4LK4A 2HVXA 2EI7A 4CBOA 1J9CH 1ZTJA 3RXMA 1SGEE 1YYY1 2Q6FA 3FFGA 4A1TA 1HNEE 3LGWA 4DG4A 3P17H 1UVPA 1FDPA 1MTVA 1O3DA 1DICA 2F9PA 2ZU1A 3EA9A 1WCZA 1YC0A 2KAIB 1G30B 1SB1H 3P8FA 5F8ZA 2ZDKA 1SGNE 4NA8A 3L3TA 3BN9A 1BTPA 2VIQA 4CH8B 5EGMA 1P09A 1CT0E 1AI8H 3UR6A 3IG6B 1EZQA 2ZU4A 1D3DB 2HNTF 2ZEBA 1XUGA 1P0SH 1K28D 1IOEA 2ZHFH 2PKSC 1QBOA 3GDSA 3GY7A 2SFAA 4ABFA 2Z3CA 2ZDLA 2A7CA 4FU8A 3ZVDA 1SQOA 5A0CA 4Y8ZA 2O8TA 3RXOA 6GCHG 2KAIA 1D6RA 4HGCA 4I8LA 1UK4A 3BTME 4UE7H 3SI3H 4Y6DA 5F8XA 3TGIE 2VH6A 1FUJA 1HAVB 3E8LA 2XWAA 1W0ZU 3ZYEA 1OXGA 1W11U 3UY9A 2CV3A 5LPFA 2THFB 1K22H 3GYLB 2H9HA 4E7NA 1GHYH 4MQAA 3KQBA 1C2EA 4AFUA 4XBBA 4ABIA 2IJOB 5EQSA 3SNDA 4WMDA 2FP7B 2W26A 1T8MA 3F1SB 1O2OA 3U8TH 1OKXA 5LPEA 3ZVEA 4MPWA 4IC6A 1O33A 3VPKA 3SV6A 1AUTC 1C5ZB 5JPMH 2BDBA 2VU8E 5L2YH 1GI4A 1ZHRA 1TONA 4I32A 4B75A 1HAVA 3PTNA 1O3EA 3GY8A 2GMTC 2FI5E 4H6TA 2PSYA 4NIXA 1OP0A 1F0TA 4KTSA 2PLXA 1GBDA 2ZGCA 4E7RG 9LPRA 2ANKH 4VGCB 1XUJA 3K9XB 3RMOH 1ZOMA 1FIZA 3T27A 3D62A 1NO9H 2A4QA 1SLXB 5GJ4B 2OBOA 1H9LB 1O5AB 1PYTC 4X1SU 4K1TA 1V2MT 1GJ6A 3SJ9A 1TMTH 1BTYA 1EX3A 1L1JA 4KTUA 1O3CA 2WV5A 3RXVA 3TJVA 5C1XA 1V2OT 3SBKA 4WXVA 3RXTA 1MZDA 4NWLA 3ZZBA 2CN0H 1EAWA 2Z9IA 2A2XH 1SFIA 4DIIH 3E1XB 2FDAA 1ID5H 5FX6A 2B8OH 3TITA 8ESTE 1QNJA 4MNYA 3S69A 3ZYDA 2FPZA 2ZZUH 2HOBA 1QJ7B 2PGQB 1MKXK 1O3NA 4NZQA 1TX8A 1CGIE 1A1RA 4WMFA 3M3TA 1S5SA 1ZTKA 1TNIA 3SV7A 1Z6JH 1A5GH 1FAKH 5FBEA 5T6DA 1NRRH 2ZC9H 1A4WH 2XCNA 1VITF 4UEHH 3F68H 2RDLA 2AIPA 4LZ1H 1O34A 3RP2A 2BDAA 1TA2A 1EQ9A 1UMAH 1TMUH 3UQVA 2GDEH 3GY4A 1C5NH 1NZQH 4I33A 4ZAEA 3O8CA 4D76A 4JZFH 1P2IA 1EAIA 3SNEA 2CJIA 1YPGH 2GZ9A 3PLPA 3PROA 1DXWA 2TRMA 1S82A 4U2WA 4U01A 1O36A 1W7GH 2AFQB 5A0AE 1GJ7B 1DDJA 4BANB 2W7SA 2OC8A 1TOMH 4B2AA 4XBDA 2WUCA 1OYTH 1DPOA 1A0HB 3UIRA 1SI5H 1TPOA 7GCHF 1O2LA 1P9UA 2C8WB 1QJ1B 1UVUH 4Y8YA 1GHXH 3VXEH 4GCHG 3MTYA 4O9VA 1TRNA 2BY6X 4I31A 1JRTA 2F9VA 2F9BH 2ODYB 4IMZA 2NU0E 3V13A 1Y3VA 1QCPA 3ZZAA 4BOHA 1QB9A 5C5NA 1K1LA 1YGCH 3FP8E 1EZSC 1P2NA 3RXCA 3QWCH 1F5LA 1A0JA 4R0IA 4FU7A 2AMQA 3QK1A 3S7KB 5CMXH 4WMEA 2ZFSA 1UTLM 3RMMH 1GI0A 3OTJE 2F9OA 2XWBI 1Y5BT 1BTXA 1GHAF 4YM9A 2R3UA 1LQEA 3K2UA 4D7FA 2OC1A 5SGAE 1ZZZA 1GJAB 1H8DH 3R3GB 1CT2E 3SNBA 1YPKH 4ESTE 3SN8A 4ISLA 3S7HB 1F92A 1M9UA 2P59A 1V2PT 3BTWE 2YNBA 4FVDA 2HPPH 1T8NA 1O35A 1EOLA 3O8DA 1C2FA 3E0NB 1TABE 1KXAA 1O3IA 1JIRA 1GWAA 2AIQA 1XXDA 3SW2B 2HLCA 1BBRE 3CP7A 3KL6A 1Z8GA 5EPNA 5ABWA 1MKXH 1E34B 2ZA5A 3QDZB 4OGXA 3ATLA 3MHWU 3F9HA 3GY3A 3QGNB 1PQAA 4FUFA 4IS5A 5A8ZA 1EAXA 1WUNH 1UTNA 2XBWA 1SBWA 3GCHC 4MLFB 3I29A 4OS6A 3TIUA 2GZ8A 1GDNA 3GCHB 1S84A 3BIVH 2R3YA 1N6YA 2ESTE 4X2WA 1SG8B 1TE0A 3URCA 5DGJA 2WYJA 2PSXA 5EQRA 4Y8XA 3A7YA 2O9QA 2OC0A 2QV1A 3MNBA 3P95A 2R0KA 1EPTB 4ABGA 4AZ2B 2Z6BD 3MI4A 3TPIZ 3RC6A 1ESTA 3GDUA 2BD2A 1AN1E 1HAPH 3A8BA 3RXFA 2R0LA 3BEUA 1W7XH 1DSUA 3M3VA 1PFXC 2AGIX 2GV6A 3RXKA 2AEIH 1AE5A 4NSVA 1ELCA 1ORFA 3PMBB 5E0JA 3SOSA 4UD9H 4D9QA 3MYWA 1B0FA 1HB0B 1SC8U 3IITA 1HAOH 1OP2A 2OTVA 2ZHEH 1KTSB 4LOYH 2ZGJA 1EPTA 2SNWA 4OS7A 4CBNA 1LO6A 1TBQH 1LTOA 2Y6TA 2ZCHP 1HCGA 1UCYE 3LKWA 1KXDA 1GI2A 3STIA 5A0BA 3LPRA 1ANCA 1GBFA 3KN2A 1GJ9B 1QL9A 1J14A 1V2JT 3BG4B 4MNXA 4XSKU 1A46H 1S6HA 1HIAB 4X8SH 2ZTYA 1D4PB 3A8AA 3LONA 5F03A 5ETXA 2GT7A 1S85A 1QA7A 3DA9B 1SLWB 1D3TB 2BLQA 3ZV9A 1GDUA 1QA0A 2NU4E 1A5IA 1MMJN 1C1VH 1RTFB 2G51A 3JZ2B 3K6YA 3MO6A 1ZMLA 4Y0YE 2FLRH 3HGPA 1SLVB 1GJCB 1C5YB 4X1RU 3SUEA 2VIDA 1EP5A 2BMGB 1FN8A 3TJOA 3MFJA 1GJDB 1KLTA 2BD8A 3T28A 4ABEA 4IBLH 4NIWA 1HAGE 4Y11E 2Q1JA 1C1QA 1HIAA 5LGOA 1GBTA 5DJ7A 4MDSA 2BLOA 2PUXB 4JZ1A 1SGYE 5DP6A 3MNXA 1DX5M 1WQVH 4R8TB 1LHGH 1Q2WA 2ZNKH 3SQHE 1ELDE 3GICB 1PPGE 3A82A 3GCTF 1QIXB 1Y3YA 1C5LH 5AHGH 2BB4A 2G4UA 1TNGA 1HAZB 2Z3EA 4WJG2 1E38B 1OWKA 2SGQE 3SHCH 3P8OA 4F4OC 4KKDA 4FUCA 2B7DH 4K1EA 2ANMH 4HI3A 3BEFB 4AORA 4WXIA 2FI3E 3I78A 3U1JB 4RSPA 3RXJA 4JZIA 3SU4A 3D65E 2QF3A 4JZEH 3UNRA 1Z7KA 1YPHE 4SGBE 1ZRBA 4BTTB 3KQDA 5E8EH 2DE9A 1XKBC 5F6MA 1AY6H 4GLYA 1GG6C 3M5MA 3S9BA 1GHWH 2IPHA 4OS5A 1BJUA 1GG6B 1WU1A 2STAE 2C90B 1MQ5A 1VITG 3OYPA 1SPJA 1FQ3A 3A88A 4O3UA 3VB4A 2OXSA 2FWWA 5EXNA 1RIWB 5CE1A 3BEIB 1YPEH 3WY8A 4YESB 4AB9A 2Y5FA 3SNAA 1QR3E 3VGCC 1RGQA 1WV7H 3VGCB 1G3BA 2VWNA 1C1TA 1CA8B 1G2LA 4OS1A 1LKAA 1CO7E 4X1NU 1XX9A 5C5OA 2VINA 3TJNA 3K6ZA 1QY6A 4IW4E 3SZNA 4ISIH 1NRPH 3U98H 1LKBA 2P94A 3KCGH 4X6OA 2XBVA 3ODFA 2XNIA 1FNIA 1S0RA 3UWJH 1TX6A 1IQFA 2ZFQH 4I8GA 4CRGA 2H9TH 2ZO3H 1BBRK 1KXCA 1A5HA 1GJ5H 1NY22 2JETC 1C1UH 1BT7A 5AFYH 1FY8E 2IN2A 5EW1H 2P95A 3A87A 1P57B 2EC9H 1NS3A 1GJ8B 1QRZA 3M7TA 3UNQA 3Q77A 3QX5H 1V2LT 2BD3A 2ZHWH 2A4RA 4Q7ZA 1H1BA 1AZZA 1GVZA 1HYLA 1GVLA 3T2NA 2TGAA 2GCHF 2QXJA 4CRBA 1O38A 2V6NA 1T4VH 1TYNA 5J4QA 4TY7A 1DY8A 6CHAC 2ZECA 3LGIA 1MAXA 4CRDA 1BTHH 5EXLA 5EXMA 1UK3A 6CHAB 3TNTA 4Q7YA 4DJZB 1PYTD 1TBRH 1O32A 3U9AH 4RKOB 1C4Y2 2HNTE 1RTLA 1GL1A 1TMBH 2SGPE 2CMYA 3M5NA 5E2OA 1YCPK 4D9RA 2DUCA 4ISOA 4H42U 4MPUA 4FUJA 2Q6DA 4ISNA 2WUBA 3T29A 1LCYA 2I6SA 3TH2H 2XTTB 3ATIA 1C5WB 1ZPBA 1AFEH 3VB5A 3E0PB 5JBCS 3RXUA 5FPYA 1UCYK 2OBQA 3AW0A 2BVRH 3S0NA 1IQGA 2FODA 1QRWA 1HGTH 3G01A 4NWKA 4ZXYH 4ZHMU 2G4TA 1U6QA 4U30A 1SMFE 1DANH 2O8WA 2ZDVH 1V6DA 1WSSH 1TALA 4KGAA 1AHTH 1ELFA 1OSSA 1PQ7A 1P3EA 1QTFA 4UFFH 2FI4E 1ANEA 1P2KA 2EI8A 1NTPA 2VJ1A 2BXTH 2J94A 4Q7XA 1C1NA 7KMEH 4NSYA 2C8XB 1EASA 2Z94A 3E6PH 3DHKH 3V7TA 1O3KA 3MU5A 3H7OA 2BLWA 1MTUA 2QN5T 4DURA 3SV2H 3LC5A 1O39A 3TLOA 7LPRA 4NFFA 1C2DA 1C2HA 3SQEE 1BBRH 2XC4A 1CVWH 2JH5D 2SGAA 1J15A 3RU4T 1SGRE 1FY4A 2J95A 1O2VA 4JK5A 5HMAA 3MOCA 2ZF0H 4YOJA 2G5VA 1F0RA 3AW1A 2BDIA 1FI8A 1DXPA 3M3SA 1THSH 1FZZA 2PKSB 2FMJA 1TX7A 5GIBA 5JDUB 5AVDA 1MD7A 2FYQA 2UWLA 1IQKA 3E91A 3FAOA 3A7WA 5TJXA 2GCTC 4A1VA 3EA8A 1TA6A 4YOIA 5A2MH 2FOFA 1F0SA 2ZGBH 2Z9KA 3M5LA 2RG3A 2M5TA 3TK5A 2HALA 1GI1A 1ZHMA 3RXAA 3BTDE 3TH4H 1EB1H 1QQ4A 1HBTH 1SOTA 5L30H 1FIWA 3F9EA 4DW2U 2W7UA 2RCEA 1NFWA 1J16A 1QB6A 2R2MB 2UUKB 4CREA 1E0FD 1YCPH 2GVFA 5FHTA 3SJIA 1PQ5A 3QN7A 3F9GA 3GCTG 1LDTT 3PWCA 3UR9A 1AU8A 2BHGA 2QIQA 3BTHE 2GMTB 5DO4H 4WH6A 1O2HA 2BDHA 3PMHB 2A5AA 2ZHQH 1RS0A 5DPAA 1HUTH 3OSYA 1FN6A 3T26A 1UCYH 4X6MA 1GBKA 2WV4A 4Y10E 4I8JA 4B1TA 5EQQA 2FOHA 2FX4A 2NU1E 3ZZ9A 3P8GA 4CHAC 3GY5A 3KIDU 1DUEA 3M35A 3KEEA 2AMDA 5EG4A 4YT7H 2BQWB
chains in the Genus database with same CATH superfamily
1P01A 1TQ0B 1CBWC 4KP0A 1ELAA 3OX7U 1B7XB 1HAIH 2GD4B 5C67A 1CBWB 1RD3B 1BRBE 2ULLA 3Q3KA 1IQMA 1HAHH 2J34A 1JOUB 4A1XA 3RXPA 1G3DA 4OS4A 3ZZ4A 1QBVH 2OUAA 1Y5UT 1C5SA 1D3PB 1UK2A 3CS7A 2RFKC 3E3TA 1YLDA 1W14U 3KQEA 3PLBA 2KR7A 1VZQH 3M61U 2QY0B 2F9UA 4FUIA 4LXBH 1QJ6B 5C94A 2ZQ2A 1QFKH 2LPRA 1C5QA 5FX5A 2ILNA 3UOUA 1FV9A 3MO3A 3W95A 1GDQA 4B6FA 4Q80A 1CQQA 5AF9H 1S6LA 3M7QA 3PV2A 1N8OC 4ZKOU 5JB8S 3BTEE 5B6OA 1V2UT 5ESTE 2YNAA 4ABDA 2ZWLH 1XUHA 1O31A 3UOPA 1T31A 2Z7FE 1BRUP 3A85A 4JK6A 2GZ7A 1DFPA 1INCA 3CS0A 2PV9B 2ZQ1A 3MU4A 3RXBA 3VB6A 1K1IA 4XBCA 4WF8A 3ENSB 1IQHA 2CXVA 5AFZH 1HJ8A 2J2UA 3BF6H 2F9NA 4ISHH 2BY5X 2NWNA 3FANA 2F83A 1FXYA 4XFQA 1GHVH 1TGCA 2WZQA 5T6GA 3PV4A 1O3JA 1OOKB 2BXUH 1V2QT 1P3CA 2A4GA 1ZGIA 4F49A 4O03A 1L1GA 3ZVAA 3WWFA 5FPSA 4Q63A 1SQAA 3RXSA 3MWIU 1L0ZA 1Z6EA 1BTUA 3LC3A 1E36B 1AIXH 4TYDA 3UWIA 1GI9B 2ODPA 2XCFA 1FMGA 4TY6A 3NXPA 1O2SA 4UFGH 1SR5C 1T8LA 5EODA 1G32B 1A2CH 2GCHG 3LU9B 5JBBS 1LVBA 2Y81A 3RMLH 1QZ8A 1EJAA 2A5IA 2G81E 3P8NA 2I6QA 5FXLA 1P2JA 2FXRA 4MVNA 1MCTA 1SHYA 1O2JA 3B23B 2CHAC 1JRSA 2H5DA 2VBCA 2BQ7B 5J4SA 4CR5A 3RM2H 1CHGA 2WHXA 4J2YB 2ZI2H 1TGBA 1NU7B 2D2DA 4OGYA 2ZPSA 4OM9A 2QE7D 1IQEA 2BX3A 3B8JA 1G36A 2ZFFH 2PTNA 3SJKA 1B5GH 4ABJA 4GUXA 4CH2B 3KQCA 2WINI 3SI4H 1C5VA 1TBZH 1Z8RA 1O2PA 4B6EA 4B71A 2ALPA 1CSOE 2O8MA 1YKTA 1OWHA 2V3HH 1ZTLA 1T32A 2PWXA 2ZFTA 1C9PA 4NIVA 1BRAA 2HLDD 1K1NA 4FUHA 1W12U 1WTHD 1CT4E 8KME2 4ASUD 1OPHB 1OWIA 1A61H 1P8VC 1S83A 5DP5A 3PO1C 1MD8A 1SLUB 1BDAA 3LH1A 4MNWA 2A4OA 3PO1B 4KELA 4A7IB 1WXRA 1BQYA 5DP4A 3M7UA 1OWJA 2ZHDA 1PPZA 3FO8D 4PROA 1UJ1A 3V0XA 4Z6AH 3NRLA 2M2AA 1YY3A 1SGDE 1ZRKA 5JBAS 4INKA 2Y82A 2PHBA 3BG8A 4Q2KA 5K0HA 2QF0A 1SSXA 2PTCE 2GT8A 4THNH 5C0UA 1GBHA 2R9PA 3OEHD 1O3GA 5B6LA 2BVSH 2KFWA 1C5OH 4FUBA 4MTBA 2A1DB 4BXSA 1Y59T 4NG9H 1O5CB 1A0LA 1EJMA 5GPIB 4A6LA 3SU1A 2FX6A 1DS2E 3WWBA 2ZIQH 1ELTA 3TNSA 4X8TH 1GPZA 3SGBE 1D3QB 3MMGA 1ESBA 1H9HE 1O2XA 5A09A 5LPRA 3UNSA 1OP8A 3B9FH 3A81A 5JYIA 4NZLA 4Z0KA 1DWBH 2G8TA 3UTUH 2J38A 2LP6A 1ZPCA 1GBEA 1CA0C 2ZU3A 5TCCA 4LZ4B 2BY8X 2BDYA 1T7CA 2BTCE 3O8RA 1LMWB 2W6JD 1XVMA 1VCQA 4OS2A 1W2KH 1Z1IA 1BB0B 3AAUA 2HWLB 1C1MA 3M36A 4B73A 2XW9A 2GDDA 4ZHAA 1FLEE 1KLJH 2BOHB 1VJ9U 3TU7H 1C5RA 1IHTH 1GHBF 3NWUA 1O5EH 1TGNA 1FPCH 2DE8A 5LH8A 5T1VA 1K21H 1OS8A 3FZZA 1K1JA 2V35A 1K1MA 1K9OE 1W3CA 1LVOA 1KMHB 1Q31A 3BSQA 1HXFH 1O2ZA 1O2RA 1K0HA 2QA9E 3AAVA 4I8KA 5GCHG 1TNJA 3A86A 1C1PA 1P2OA 1BZXE 2XOKD 1GI5A 5C1UA 5K7RA 1MZAA 3KF2A 3D23A 4BAQB 3HGNA 1HDTH 2BZ6H 3SUGA 1W0KD 4I86A 4GAWA 3SHAH 4UONA 1DUAA 1P04A 3DD2H 1MKWK 1V2WT 2FOEA 2W5EA 2BOKA 2OCVB 1MTNC 1LPZB 4GHQA 1RTKA 5E0GA 2ZDMA 3UPEA 3TJUA 5HGGA 4K60A 3ZZ7A 2VWMA 3AASA 3V3MA 1XXFA 5L6NH 1DVAH 3EGKH 4K1SA 1BHXF 1C2JA 4B2CA 1V2TT 2OINA 3PLKA 2V3MA 5HM9A 5DN6D 4UFDH 3L33A 4ZKNU 2TBSA 3SU0A 1ACBE 2TIOA 3SUFA 2ZPQA 3F2FA 3OY5U 5HXFA 3KGPA 1E35B 3A7TA 1W13U 2AGGX 3UREA 5IYTA 1Y3WA 2B9LA 4F48B 3BTGE 1XUKA 4P02A 1O3HA 4AB8A 1AB9C 3ZVGA 2ZG0H 2ODQA 3RM0H 1P11E 2XRCA 2Z9GA 3SJ8A 4A92A 1G3EA 1RRKA 3H5CB 1HAYB 1HAXB 4WVPE 3RU4D 1P06A 3FOAA 1UVOA 1GMDG 2A0QB 3W1EA 1UVSH 1PQ8A 1PPFE 1FAXA 3DFLA 1GI6A 1E37B 4WWYA 4YT6H 4BAKB 1P02A 1AVGH 1L4ZA 1O3LA 1GBBA 2ZU2A 2QCYA 1KXFA 1AZ8A 4JYUH 3ZZCA 2A31A 3PMJA 4SGAE 2O8LA 1HJAC 5C2ZA 3CENA 2BY9X 3U1IB 4K8BA 2BYAX 1LPGB 2G5NA 1O2IA 5EPYA 1QRXA 2Y7ZA 2ANWA 1SGQE 2EQNA 1LPKB 1A7SA 1ZR0A 1PPEE 4NIYA 5FCRA 4MPVA 4AYYB 1L4DA 1UW7A 3BV9B 2JETB 3EA7A 1NESE 1F2SE 5HIYA 3A84A 1MAYA 4K3JA 1NFXA 1TLDA 4B2BA 1IHSH 1VR1H 2EEKA 3F6UH 5E0HA 5GXPA 4F55A 2PKAB 1O3BA 4HFPB 1G2MA 3AVZA 2J4IA 2FESH 3MH6A 1UTKA 5JB9S 1C5TA 5L2ZH 1O3FA 1DITH 2ZGXH 3BIUH 1BHXB 4INHA 3LJJA 3FZDA 4MG3A 1C2LA 2K8IA 4U32A 1EP6A 1PPBH 1FONA 3NK8A 1K1PA 1LQDB 3PMAB 2OP9A 1ZMJA 3TGKE 2ASUB 3ZVBA 2PKAA 4CR9A 1HPGA 1AVWA 1AGJA 1YPMH 1O0DH 3SGAE 5E2PA 1FY3A 2GGVB 6ESTA 2VGCC 2VVCA 3ATWA 3N7EA 2VGCB 4FETA 3T5FH 2TGPZ 3RC4A 2J97A 4X1PU 3F0PA 3U8OH 2EI6A 1T4UH 3BTKE 1KXEA 5I46H 1DE7H 4IMQA 1TQ7B 1H9IE 1BMAA 1MUEB 1V3XA 1MU8B 2A32A 2VIOA 4IC5A 1P10A 1YBWA 2A2QH 1CHOF 2FOCA 3A7XA 5TCAA 3T25A 5C3NA 4FVBA 4X2YA 1TFXA 2UWPA 3ZZ5A 2TGDA 1AUJA 2P3FH 4RN6A 1GMCF 2V0BA 3RXHA 2OK5A 5DKMA 2ZCKP 1C1OA 1VGCC 3SV8A 2AS9A 3QTOH 4UDWH 1NFYA 1SGCA 2QXHA 4M7GA 1N1LA 3LH3A 4AG2A 5IDKA 2BQ6B 4RI0A 2F4LA 3O8BA 4ZH8A 1TPPA 2ZTZA 2VNTA 4DT4A 1TAWA 1ABJH 1CGHA 1G37A 1Z1JA 1FJSA 2NU3E 1AWHB 1F5RA 1TNLA 1H8IH 1LVYA 4WH8A 1GBLA 2YOLA 3SNCA 1O3PB 3RUOA 1HJ9A 4B76A 2NU2E 3MNSA 8GCHF 1GBIA 2FTLE 3HK6B 3KNXA 1YPHC 4AFZA 1ELVA 3ODDA 1MABB 3MU1A 5T3HA 4ABBA 1S81A 1EKBB 1MBQA 2OD3B 2SGFE 3MNCA 1Z71A 1O3OA 1GHBG 1QQUA 2AYWA 2AERH 2GCTB 4JMYA 3VB7A 1LHCH 5G4BA 3E16B 2FM2A 3TH3H 4BTIB 1H8HD 1O37A 3C27B 1C5UA 1ZGVA 2D8WA 5KEDA 4GPGA 2TPIZ 3A80A 3N7OA 2C3SA 1VCWA 1SGFG 4WY3A 1RXPA 4ASHA 4CRFA 5BRRE 9ESTA 1ZPZA 1PJPA 1EZUC 1MTSA 2JH0D 2FS9A 1HRTH 3A83A 5C20A 2AMPA 1PPCE 1F7ZA 3F9FA 1G3CA 1C5XB 1V2RT 3P6ZB 1TNHA 3SU3A 1DY9A 1O5DH 4QT8C 1C4U2 3QGJA 2P3TB 1QB1A 1ETTH 3MH7A 2W3IA 4NCYA 3ATMA 1OWEA 1MH0A 1NC6A 1C1WH 1IAUA 3SU6A 2ALVA 3SJOA 1GI3A 3BTTE 5GCHF 5A8YA 4DCDA 3RXDA 2PW8H 1Q3XA 4Y7BA 2G55A 1KIGH 2H1UA 4CHAB 2HRVA 2VB0A 4VGCC 2VIWA 1O2KA 3LJOA 1ZSKA 3ZZDA 4X6NA 1LVMA 2VWOA 1ZHPA 5DP7A 1JWTA 6LPRA 3MO9A 1O3MA 1AMHA 3PM3A 4AFQA 2QGRA 3DT0H 3EDXB 1ESAA 1C2MA 1UO6A 1FPHH 1V2VT 1BTZA 4X2VA 3ELAH 4YLQH 1H4WA 3S9AA 1P2MA 2Z3DA 5DP9A 1WTGH 3FP6E 2XC0A 1A3BH 1THRH 1XKAC 4AGKA 1ANDA 1UTPA 1Z8IB 3Q76A 3M5OA 3RMNH 2STBE 1DWCH 4JCNA 3SORA 1NROH 3NPSA 2QAAA 4K5ZA 5IK2D 1ZJDA 3DFJA 1QURH 5DP3A 2HNTC 2HPQH 3VFEA 3VEQB 1N8OB 1PPHE 1Y8TA 4FUGA 4B74A 1GL0E 2P3UB 4H4FA 2A45B 1FY5A 5BPEA 1Y3UA 2J92A 4YXWD 1N6XA 3A7ZA 4YOGA 1P2QA 4X2XA 1DSTA 2K1QA 2GKVE 1DLKB 1ETSH 2W3KA 2BD5A 4ACAA 3PB1E 3MH5A 1GMDF 2ZCLP 2PGBB 3HK3B 1SQTA 1F0UA 4TWYA 3NUMA 3ITIA 2F91A 3I77A 3SO3A 3NZIA 3Q00A 4AN7A 3OU0A 1YM0A 3KQ5A 2WYGA 2H2ZA 4X6PA 5HM2A 2XBXA 1BA8B 4FUDA 4UFEH 2F3CE 4DGJA 1L1NA 1A3EH 2H6MA 1GMHG 3HKIB 3OY6U 3GCOA 1QHRB 1JIMA 2Y5GA 2EA3A 1NBMD 2FZZA 2SGEE 3A89A 1NU9A 4GVUA 4NGAH 2XYAA 4INLA 3QLPH 1VCPA 2RA0A 2VVUA 3LOXA 4DVAU 1TB6H 3RXGA 4BAMB 3LGUA 4NA7A 1XM1A 4TPYA 1SGIB 2SNVA 2FOAA 3EE0B 2G00A 2JDID 1O2YA 3RXRA 1T8OA 1HV7A 3R0FA 1AD8H 2ZGHA 4DY7B 2CHAB 3ZZ6A 4DIHH 4FOUC 1D9IA 3BTFE 4Y71A 2O8UA 2IOTA 3N7DA 1ZMNA 4Z1MD 5F8TA 4AYVB 2P8OC 4NA9H 3STJA 1TRMA 2P8OB 1QL8A 1UTOA 2WPHS 3RXQA 1TWXB 3VG8A 3NKKA 2VIPA 4Y7AA 1UVTH 3PWBA 1SFQB 2JH6D 3EAJA 1O5BB 1ARCA 3ZVCA 5CHAC 1ELGA 2P93A 5C1YA 2Q6GA 2C8ZB 3PYHA 1O2NA 2GP9B 1TGSZ 5CHAB 3UFAA 1FY1A 1WQSA 4TSFD 5ESBA 1BMLA 1ANBA 1Z8JB 2FIRH 2OQ5A 1C5MD 3JZ1B 3Q3XA 3LIWA 2QC2A 1CHOG 1DWEH 3EE7A 3MU8A 4BNRA 2BDCA 1Y3XA 1YLCA 1OX1A 1SOZA 1EOJA 2GX4A 3RLWH 4A5TS 2WPDD 4XE4A 1JXPA 3ZVFA 1GMCG 4X8VH 1V2NT 4H6SB 1EAUA 2LNCA 2A7HA 1WAYB 1C1SA 1WBGB 1NRSH 3QO6A 4HTCH 1Y5AT 1KYNA 1ELEE 3NCLA 1GJBB 1C2KA 2A5KA 5DG6A 1BCUH 3H7TA 4TWWA 1IQNA 3PTBA 1O2MA 1XUFA 2AGEX 1V2ST 3KYFA 1IQIA 4ZKSU 2QXIA 2WPIS 1WYKA 3RXIA 2GTBA 1NM6A 4GHTA 3DUXH 4MNVA 4YO9A 3QTVH 2Z9JA 1HXEH 5T6FA 3UQOA 1AO5A 1XUIA 1EPTC 1O5GH 2A7JA 1GBCA 3TK9A 2L74A 4DT7B 2FOGA 1UTQA 1EJNA 2C8YB 4K2YA 5PTPA 4RKJB 3IWMA 8GCHG 4CRAA 4BAHB 3QZQA 3GISB 1EUFA 1QL7A 1DM4B 5HYOA 4J1YA 4JZDH 1KXBA 3ZZ3A 2UUFB 3L6PA 4K69A 1O2WA 3LGVA 2G52A 1LHFH 3PRDA 2BD9A 1CA0B 1THPB 4FU9A 1L2EA 3GY6A 1S6FA 4CRCA 2UWOA 4ABAA 2WPJS 4Y76A 1D6WA 1C5PA 2B5TB 1C9TA 4X1QU 4ZUHA 3TK6A 3BG4C 4M9FA 3C1KA 1CU1A 1GVKB 2Y7XA 1KY9A 1YPLH 2BZAA 3TGJE 4AFSA 4ZROA 3VB3A 4O3TA 1BJVA 3Q3YA 6GCHF 1XVOA 3EQ0H 3HKJB 1XMNB 3PRBA 2ZDAH 2CF9H 1DT2A 2WPKS 2FLBH 1P05A 5HKKD 1HLTH 5DP8A 1BUIA 3QUMP 2VIVA 1NT1A 1MCVA 3KHVA 1TGTA 2C93B 5GDSH 1MU6B 4ABHA 3SGQE 1WOFA 4ZKRU 2JIZD 1NPMA 1JBUH 2OQUA 3GDVA 1K2I1 2Z9LA 2ZU5A 3QZRA 2R2WU 5FCKA 3RXEA 1O30A 1IQLA 2UUJB 2OC7A 4BXWA 8LPRA 3BTQE 1DWDH 1P9SA 3RXLA 4D8NA 2QXGA 1W10U 3URDA 1NFUA 5EOKA 1ETRH 2VWLA 1TIOA 1MTNB 1TRYA 1CGJE 4IN2A 1DLEA 3ESTA 4ZHLU 1O5FH 1BIOA 4E05H 4FUEA 1GCTC 1GBMA 2H9EH 4ZXXH 1VITH 5EW2H 1GCTB 2PFEA 1ZYOA 2PP6A 3UUZA 2P16A 3HATH 1RFNA 5FPTA 1C2IA 2CF8H 4MPXA 1G9IE 1O2TA 1BITA 3RU4E 4X8UH 2FS8A 1J17T 2KM0A 1ZSLA 1BMMH 1VJAU 3GY2A 2BY7X 2B0FA 1W0YH 3P92A 4JYTA 1GHZA 4D7GA 2FYRA 2ANYA 2ZFRH 1J8AA 4GSOA 1TNKA 1EB2A 1AB9B 1P03A 3V12A 2LELA 1GI8B 1UTMA 1B0EA 1KDQB 2WV9A 5H4IB 2C4FH 3S9CA 1GJ4H 1MTWA 1YP9A 4XDEA 2FO9A 1EXFA 4JYVH 5GWZA 4K8YA 2KCAA 2EY4C 3TVJB 1YWUA 2BLVA 1RIWC 4O97A 3T62A 2TGTA 4YTAA 4IN1A 2JKHA 1C4V2 2SGDE 3A8CA 1W8BH 2BM2A 2FOMB 2AH4X 1LHDH 4DOQA 1JMOH 2XXLA 2ZKSA 1C2GA 1HJAB 1RJXB 1AKSB 4Y0ZE 4AX9H 5EIYA 3LT3A 5FAHA 3GYMA 1OHHD 4KTCA 4YLUA 1AFQC 1KDQA 5DK1A 4YZUA 2PUQH 1VKYA 1BTWA 1IQJA 1AFQB 4X0WU 3SUDA 3MQKC 1HFDA 3P70B 2H5CA 1CE5A 1OYQA 3ZV8A 2CGAA 1QGFA 1AWFH 5KECA 1TPAE 2FTMA 3VXFH 2OLGA 1MBMA 7GCHG 1BRCE 1ABIH 1KLIH 1K1OA 1O3AA 1AKSA 2WPLS 1TOCB 1NRQH 1SGPE 1UTJA 2ZP0H 1F5KU 2BX4A 2HGTH 1SGFA 2Y80A 1LHEH 3DSOA 2RA3A 3U69H 4XD7D 1DOJA 2JJ1D 1GMHF 3K65B 3LGYA 4BTUB 2ZDNA 2BD7A 3RC5A 2D1JA 1KTTB 2BVXH 3FP7E 3PV5A 1MKWH 3FKSD 1NN6A 4AG1A 2YMSC 4AGJA 1EZXC 4FXGH 2FEQH 4XRNA 1O2QA 1EATA 2Y5HA 3RLYH 1YPJH 4GCHF 1S0QA 4XOJA 1GHAG 1P12E 4I7YH 4IGDA 3A7VA 1ZSJA 1QBNA 3LGTA 4I8HA 3F2HA 1KSNA 1V2KT 2QF4A 3MH4A 7ESTE 3UB0A 4AOQA 1GBJA 2XBYA 4BAOB 3A8DA 4ZMAH 2FOBA 3SU2A 1BMNH 2BDGA 1GI7B 1GBAA 1SGTA 2ZPRA 2VH0A 2WPMS 1TPSA 2PR3A 3LDXH 3MU0A 4TPIZ 2D26C 2J9NA 4Y79A 3ZZ8A 3D49H 3W94A 2VVVA 3GCNA 1O2UA 1SHHB 1NRNH 1BMFD 1SL3A 4HZHA 3U8RH 1OWDA 2ZFPH 1COWD 1UHBB 2AHME 1BOQA 3SV9A 3M37A 3FVFB 5A8XA 3GOVB 3SU5A 1C1RA 5FBIA 5I25A 3ATKA 1YCPM 4HG6A 1GCDA 2UUYA 5JBTA 5FL7D 1ZLRA 1ZJKA 1GGDC 3EYDA 1AE8H 1AQ7A 1GGDB 2ZTXA 2V3OH 3RDZA 4NFEA 2BD4A 1X7AC 1ARBA 1VGCB 2IPQX 5EU8A 1ELBA 3E90B 1SVPA 3HPTB 2XC5A 1UHBA 1O2GH 1AVXA 2GV7A 1MQ6A 4E06H 2QYIA 1YF4A 4LK4A 2HVXA 2EI7A 4CBOA 1J9CH 1ZTJA 3RXMA 1SGEE 1YYY1 2Q6FA 3FFGA 4A1TA 1HNEE 3LGWA 4DG4A 3P17H 1UVPA 1FDPA 2WSSD 1MTVA 1O3DA 1DICA 2F9PA 2ZU1A 3EA9A 1WCZA 1YC0A 2KAIB 1G30B 1SB1H 3P8FA 2KZ4A 2ZDKA 5F8ZA 1SGNE 4NA8A 3L3TA 3BN9A 1BTPA 2VIQA 1W0JD 4CH8B 5EGMA 1P09A 1CT0E 1AI8H 3UR6A 3IG6B 1EZQA 2ZU4A 1D3DB 2HNTF 2ZEBA 1XUGA 1P0SH 1K28D 1IOEA 2ZHFH 2PKSC 1QBOA 3GDSA 3GY7A 2SFAA 4ABFA 2XNDD 2Z3CA 2ZDLA 2A7CA 4FU8A 3ZVDA 1SQOA 5A0CA 4Y8ZA 2O8TA 3RXOA 6GCHG 2KAIA 1D6RA 4HGCA 2L6OA 4I8LA 1UK4A 3BTME 3OEED 4UE7H 4Y6DA 5F8XA 3SI3H 3TGIE 2VH6A 1FUJA 1HAVB 3E8LA 2XWAA 3F3BA 1W0ZU 3ZYEA 1OXGA 1W11U 3UY9A 2CV3A 5LPFA 2THFB 1K22H 3GYLB 2H9HA 4E7NA 1GHYH 4MQAA 3KQBA 1C2EA 4AFUA 4XBBA 4ABIA 2IJOB 5EQSA 3SNDA 4WMDA 2FP7B 2W26A 1T8MA 3F1SB 1O2OA 4TT3D 3U8TH 1OKXA 5LPEA 3ZVEA 4MPWA 4IC6A 1O33A 3VPKA 3SV6A 1AUTC 1C5ZB 5JPMH 2BDBA 2VU8E 5L2YH 1GI4A 1ZHRA 5KGOA 1TONA 4I32A 4B75A 1HAVA 3PTNA 1O3EA 3GY8A 3GS9A 2J5UA 2GMTC 2FI5E 4H6TA 2PSYA 4NIXA 1OP0A 1F0TA 4KTSA 2PLXA 1GBDA 2ZGCA 4E7RG 9LPRA 2ANKH 2W6ID 4VGCB 1XUJA 3K9XB 3RMOH 1ZOMA 1FIZA 3T27A 3D62A 1NO9H 2KCYA 3ZIAD 2A4QA 4P00A 1SLXB 5GJ4B 2OBOA 1H9LB 1O5AB 1PYTC 4X1SU 4K1TA 1V2MT 1GJ6A 3SJ9A 1TMTH 1BTYA 1EX3A 1L1JA 4KTUA 1O3CA 2WV5A 3RXVA 3TJVA 5C1XA 1V2OT 3SBKA 2IJD1 4WXVA 3RXTA 5EJZA 1MZDA 4NWLA 3ZZBA 2CN0H 1EAWA 2Z9IA 2A2XH 1SFIA 2GJGA 4DIIH 3E1XB 2FDAA 1ID5H 5FX6A 5F53A 2B8OH 3TITA 8ESTE 1QNJA 1SQRA 4MNYA 3S69A 3ZYDA 2FPZA 2ZZUH 2HOBA 1QJ7B 2PGQB 4RT1A 1MKXK 1WDIA 1O3NA 4NZQA 1TX8A 1CGIE 1A1RA 4WMFA 3M3TA 1S5SA 3SYJA 1ZTKA 1TNIA 3SV7A 1Z6JH 1A5GH 3DSPA 1FAKH 3F2GA 5FBEA 5T6DA 1NRRH 2ZC9H 1A4WH 2XCNA 1VITF 4UEHH 3F68H 2RDLA 2AIPA 4LZ1H 1O34A 2CK3D 3RP2A 2BDAA 1TA2A 1EQ9A 1UMAH 1TMUH 1NBME 3UQVA 1H8ED 2GDEH 3GY4A 1C5NH 1NZQH 4I33A 4ZAEA 3O8CA 4D76A 4JZFH 1P2IA 1EAIA 3SNEA 2CJIA 5CDFE 1YPGH 2GZ9A 3PLPA 3PROA 1DXWA 5DSFA 2TRMA 1S82A 4U2WA 4U01A 1O36A 1W7GH 2AFQB 5A0AE 1GJ7B 1DDJA 2JJ2D 4BANB 2W7SA 2OC8A 1TOMH 4B2AA 4XBDA 2WUCA 1OYTH 1DPOA 1A0HB 3UIRA 1SI5H 1TPOA 7GCHF 1O2LA 1P9UA 2C8WB 1QJ1B 1UVUH 4Y8YA 1GHXH 3VXEH 4GCHG 3MTYA 4O9VA 1TRNA 2BY6X 4I31A 1JRTA 2F9VA 3N99A 1E1RD 3OFND 2F9BH 2ODYB 4IMZA 2NU0E 3V13A 1Y3VA 1QCPA 3ZZAA 4BOHA 1QB9A 5C5NA 1K1LA 1YGCH 3FP8E 1EZSC 1P2NA 3RXCA 3QWCH 1F5LA 1A0JA 4R0IA 4FU7A 2AMQA 3QK1A 3S7KB 5CMXH 4WMEA 2ZFSA 1UTLM 3RMMH 1GI0A 1E79D 3OTJE 2F9OA 2XWBI 1Y5BT 1BTXA 1GHAF 4YM9A 2R3UA 1LQEA 3K2UA 4D7FA 2OC1A 5SGAE 1ZZZA 1GJAB 1H8DH 3R3GB 1CT2E 3SNBA 1YPKH 4ESTE 3SN8A 4ISLA 3S7HB 1F92A 1M9UA 2P59A 1V2PT 3BTWE 2YNBA 4FVDA 2HPPH 1T8NA 1O35A 1EOLA 3O8DA 1C2FA 3E0NB 1TABE 1KXAA 1O3IA 1JIRA 1GWAA 2AIQA 1XXDA 3SW2B 2HLCA 1BBRE 3CP7A 3KL6A 1Z8GA 5EPNA 5ABWA 1MKXH 1E34B 2ZA5A 3QDZB 4OGXA 3ATLA 3CNRA 3MHWU 3F9HA 3GY3A 3QGNB 1PQAA 1EFRD 4FUFA 4IS5A 5A8ZA 2QF5A 1EAXA 1WUNH 1UTNA 2XBWA 1SBWA 3GCHC 3OTPA 3I29A 4MLFB 4OS6A 3TIUA 2GZ8A 1GDNA 3GCHB 2KX4A 1S84A 3BIVH 2R3YA 1N6YA 2ESTE 4X2WA 1SG8B 1TE0A 3URCA 5DGJA 2WYJA 2PSXA 5EQRA 4Y8XA 3A7YA 2O9QA 2OC0A 2QV1A 3MNBA 3P95A 2R0KA 1EPTB 4ABGA 4AZ2B 2Z6BD 3MI4A 3TPIZ 3RC6A 1ESTA 3GDUA 2BD2A 1AN1E 1HAPH 3A8BA 3RXFA 2R0LA 3BEUA 1W7XH 1DSUA 3M3VA 1PFXC 2AGIX 2GV6A 3RXKA 2AEIH 1AE5A 4NSVA 1ELCA 1ORFA 3PMBB 5E0JA 5GNDA 3SOSA 4UD9H 4D9QA 3MYWA 1B0FA 1HB0B 1SC8U 3IITA 1HAOH 1OP2A 2OTVA 2ZHEH 1KTSB 4LOYH 2ZGJA 1EPTA 2SNWA 4OS7A 4CBNA 1LO6A 1TBQH 3DCLA 1LTOA 2Y6TA 2ZCHP 1HCGA 1UCYE 3LKWA 1KXDA 1GI2A 3STIA 5A0BA 3LPRA 1ANCA 1GBFA 3KN2A 1GJ9B 1QL9A 1J14A 1V2JT 2YMSD 3BG4B 4MNXA 4XSKU 1A46H 1S6HA 4RT0A 3AK5A 1HIAB 1SKYE 4X8SH 2ZTYA 1D4PB 3A8AA 3LONA 5F03A 5ETXA 2GT7A 1S85A 1QA7A 3DA9B 1SLWB 1D3TB 2BLQA 3ZV9A 1GDUA 1QA0A 2NU4E 3DSGA 1A5IA 1MMJN 1C1VH 1RTFB 2G51A 3JZ2B 3K6YA 3MO6A 1ZMLA 4Y0YE 2FLRH 3HGPA 1SLVB 1GJCB 1C5YB 4X1RU 5EJ1A 3SUEA 2VIDA 1EP5A 2BMGB 1FN8A 3TJOA 3MFJA 1GJDB 1KLTA 2BD8A 3T28A 1E1QD 4ABEA 3UAIC 4IBLH 4NIWA 1HAGE 4Y11E 2Q1JA 1C1QA 1HIAA 5LGOA 1GBTA 5DJ7A 4MDSA 2BLOA 2PUXB 4JZ1A 1SGYE 5DP6A 3MNXA 1DX5M 1WQVH 4R8TB 1LHGH 1Q2WA 2ZNKH 3SQHE 1ELDE 3GICB 1PPGE 3A82A 3GCTF 1QIXB 1Y3YA 1C5LH 5HIZA 5AHGH 2BB4A 2G4UA 1TNGA 1HAZB 2Z3EA 4WJG2 1E38B 1OWKA 2SGQE 3SHCH 3P8OA 4F4OC 4KKDA 4FUCA 2B7DH 4K1EA 3U28C 2ANMH 4HI3A 3BEFB 4AORA 4WXIA 2FI3E 3I78A 3U1JB 4RSPA 3RXJA 4JZIA 3SU4A 3D65E 2QF3A 4JZEH 3UNRA 1Z7KA 1YPHE 4SGBE 1ZRBA 4BTTB 3KQDA 5E8EH 2DE9A 1XKBC 5F6MA 1AY6H 4GLYA 1GG6C 3FN8A 3M5MA 3S9BA 1GHWH 2IPHA 4OS5A 1BJUA 1GG6B 3F0OA 1WU1A 2STAE 2C90B 1MQ5A 1VITG 3OYPA 1SPJA 1FQ3A 3A88A 4O3UA 3VB4A 4Q4LA 2OXSA 2FWWA 5EXNA 1RIWB 5CE1A 3BEIB 1YPEH 3WY8A 4YESB 4AB9A 2Y5FA 3SNAA 1QR3E 3VGCC 1RGQA 1WV7H 3VGCB 1FX0B 1G3BA 2VWNA 1C1TA 1CA8B 2J98B 1G2LA 4OS1A 1LKAA 1CO7E 4X1NU 1XX9A 5C5OA 5C0TA 2VINA 3TJNA 3K6ZA 2F43B 1QY6A 4IW4E 3SZNA 4ISIH 1NRPH 3U98H 1LKBA 2P94A 3KCGH 4X6OA 2XBVA 3ODFA 2XNIA 1FNIA 1S0RA 3UWJH 1TX6A 1IQFA 2ZFQH 4I8GA 2HVYB 4CRGA 2H9TH 2J98A 2ZO3H 1BBRK 1KXCA 1A5HA 1GJ5H 2KCPA 1NY22 2JETC 1C1UH 1BT7A 5AFYH 1FY8E 2IN2A 5EW1H 2P95A 3A87A 1P57B 2EC9H 1NS3A 1GJ8B 1QRZA 3M7TA 3UNQA 2V7QD 3Q77A 3KYGA 3WW7A 2YMSB 3QX5H 1V2LT 2BD3A 2ZHWH 2A4RA 4Q7ZA 1H1BA 1AZZA 1GVZA 1HYLA 1GVLA 3T2NA 2TGAA 2GCHF 2QXJA 4CRBA 1O38A 4AC9A 2V6NA 1T4VH 1TYNA 5J4QA 4TY7A 1DY8A 6CHAC 2ZECA 3LGIA 1MAXA 4CRDA 1BTHH 5EXLA 5EXMA 1UK3A 6CHAB 3TNTA 4Q7YA 4DJZB 1PYTD 1TBRH 1O32A 3U9AH 4RKOB 1C4Y2 2HNTE 1RTLA 1GL1A 1TMBH 2SGPE 2CMYA 3M5NA 5E2OA 1YCPK 4D9RA 2KCOA 2DUCA 4ISOA 4H42U 4MPUA 4FUJA 2Q6DA 4ISNA 2WUBA 3T29A 1LCYA 2I6SA 5CHBA 3TH2H 2XTTB 3ATIA 1C5WB 1ZPBA 1AFEH 3VB5A 3E0PB 5JBCS 3RXUA 5FPYA 1UCYK 2OBQA 3AW0A 2BVRH 3S0NA 1IQGA 2FODA 1QRWA 1HGTH 3G01A 4NWKA 4ZXYH 4ZHMU 2RDEA 2G4TA 1U6QA 4U30A 1SMFE 1DANH 2O8WA 2ZDVH 1V6DA 1WSSH 1TALA 1YLNA 4KGAA 1AHTH 1ELFA 1OSSA 1PQ7A 1P3EA 1QTFA 4UFFH 3SZEA 2FI4E 1ANEA 4ZCNA 1P2KA 2EI8A 1NTPA 2VJ1A 2BXTH 2J94A 4Q7XA 1C1NA 7KMEH 4NSYA 5EJLA 2C8XB 1EASA 2Z94A 3E6PH 3DHKH 3V7TA 1O3KA 3MU5A 3H7OA 2BLWA 1MTUA 2QN5T 4DURA 3SV2H 3LC5A 1O39A 3TLOA 7LPRA 4NFFA 1C2DA 1C2HA 3SQEE 1BBRH 2XC4A 1CVWH 2JH5D 2SGAA 1J15A 3RU4T 1SGRE 4ACBA 1FY4A 2J95A 1O2VA 4JK5A 5HMAA 3MOCA 2ZF0H 4YOJA 2G5VA 1F0RA 3AW1A 2BDIA 1FI8A 1DXPA 3M3SA 1THSH 1FZZA 2PKSB 2FMJA 1TX7A 5GIBA 5JDUB 5AVDA 1MD7A 2FYQA 2UWLA 1IQKA 3E91A 3FAOA 3A7WA 5TJXA 2K0QA 2GCTC 4A1VA 3EA8A 1TA6A 4YOIA 5A2MH 2FOFA 1F0SA 2ZGBH 2Z9KA 3M5LA 2RG3A 2M5TA 3TK5A 2HALA 1GI1A 1ZHMA 3RXAA 3BTDE 3TH4H 1EB1H 1QQ4A 1HBTH 1SOTA 5L30H 1FIWA 3F9EA 4DW2U 2W7UA 2RCEA 1NFWA 1J16A 1QB6A 2R2MB 2UUKB 4CREA 1E0FD 1YCPH 2GVFA 5FHTA 3SJIA 1PQ5A 3QN7A 3F9GA 3GCTG 1LDTT 3PWCA 3UR9A 1AU8A 2BHGA 2QIQA 3BTHE 3OAAD 2GMTB 3H09A 5DO4H 4WH6A 1O2HA 2BDHA 3PMHB 2A5AA 2ZHQH 1RS0A 5DPAA 1HUTH 3OSYA 1FN6A 3T26A 1UCYH 3OE7D 4X6MA 1GBKA 2WV4A 4Y10E 5C17A 4I8JA 4B1TA 5EQQA 2FOHA 2FX4A 2NU1E 3ZZ9A 3P8GA 4CHAC 3GY5A 3KIDU 1DUEA 3M35A 3KEEA 2AMDA 5EG4A 4YT7H 2BQWB
chains in the Genus database with same CATH topology
1P01A 1TQ0B 1CBWC 4KP0A 1ELAA 3OX7U 1B7XB 1HAIH 2GD4B 5C67A 1CBWB 1RD3B 1BRBE 2ULLA 3Q3KA 1IQMA 1HAHH 2J34A 1JOUB 4A1XA 3RXPA 1G3DA 4OS4A 3ZZ4A 1QBVH 2OUAA 1Y5UT 1C5SA 1D3PB 1UK2A 3CS7A 3E3TA 1YLDA 1W14U 3KQEA 3PLBA 1VZQH 3M61U 2QY0B 2F9UA 4FUIA 4LXBH 1QJ6B 2ZQ2A 1QFKH 2LPRA 1C5QA 5FX5A 2ILNA 3UOUA 1FV9A 3MO3A 3W95A 1GDQA 4Q80A 1CQQA 5AF9H 3M7QA 1N8OC 4ZKOU 5JB8S 3BTEE 5B6OA 1V2UT 5ESTE 2YNAA 4ABDA 2ZWLH 1XUHA 1O31A 3UOPA 1T31A 2Z7FE 1BRUP 3A85A 4JK6A 2GZ7A 1DFPA 1INCA 3CS0A 2PV9B 2ZQ1A 3MU4A 3RXBA 3VB6A 1K1IA 4XBCA 4WF8A 3ENSB 1IQHA 2CXVA 5AFZH 1HJ8A 2J2UA 3BF6H 2F9NA 4ISHH 2BY5X 2NWNA 3FANA 2F83A 1FXYA 4XFQA 1GHVH 1TGCA 5T6GA 3PV4A 1O3JA 1OOKB 2BXUH 1V2QT 1P3CA 2A4GA 1ZGIA 4F49A 4O03A 1L1GA 3ZVAA 5FPSA 1SQAA 3RXSA 3MWIU 1L0ZA 1Z6EA 1BTUA 3LC3A 1E36B 1AIXH 4TYDA 3UWIA 1GI9B 2ODPA 2XCFA 1FMGA 4TY6A 3NXPA 1O2SA 4UFGH 1SR5C 1T8LA 5EODA 1G32B 1A2CH 2GCHG 3LU9B 5JBBS 1LVBA 2Y81A 3RMLH 1EJAA 2A5IA 2G81E 3P8NA 2I6QA 5FXLA 1P2JA 2FXRA 4MVNA 1MCTA 1SHYA 1O2JA 3B23B 2CHAC 1JRSA 2H5DA 5J4SA 2BQ7B 4CR5A 3RM2H 1CHGA 4J2YB 2ZI2H 1TGBA 1NU7B 2D2DA 4OGYA 2ZPSA 1IQEA 2BX3A 3B8JA 1G36A 2ZFFH 2PTNA 3SJKA 1B5GH 4ABJA 4GUXA 4CH2B 3KQCA 2WINI 3SI4H 1C5VA 1TBZH 1Z8RA 1O2PA 4B71A 2ALPA 1CSOE 2O8MA 1YKTA 1OWHA 2V3HH 1ZTLA 1T32A 2PWXA 2ZFTA 1C9PA 4NIVA 1BRAA 1K1NA 4FUHA 1W12U 1WTHD 1CT4E 8KME2 1OPHB 1OWIA 1A61H 1P8VC 1S83A 5DP5A 3PO1C 1MD8A 1SLUB 1BDAA 3LH1A 4MNWA 2A4OA 3PO1B 4KELA 4A7IB 1BQYA 5DP4A 3M7UA 1OWJA 2ZHDA 1PPZA 4PROA 1UJ1A 3V0XA 4Z6AH 1SGDE 1ZRKA 5JBAS 4INKA 2Y82A 2PHBA 3BG8A 4Q2KA 5K0HA 2QF0A 1SSXA 2PTCE 2GT8A 4THNH 1GBHA 2R9PA 1O3GA 2BVSH 1C5OH 4FUBA 4MTBA 2A1DB 4BXSA 1Y59T 4NG9H 1O5CB 1A0LA 1EJMA 5GPIB 4A6LA 3SU1A 2FX6A 1DS2E 2ZIQH 1ELTA 3TNSA 4X8TH 1GPZA 3SGBE 1D3QB 3MMGA 1ESBA 1H9HE 1O2XA 5A09A 5LPRA 3UNSA 1OP8A 3B9FH 3A81A 5JYIA 4NZLA 4Z0KA 1DWBH 2G8TA 3UTUH 2J38A 1ZPCA 1GBEA 1CA0C 2ZU3A 5TCCA 4LZ4B 2BY8X 2BDYA 1T7CA 2BTCE 3O8RA 1LMWB 1XVMA 1VCQA 4OS2A 1W2KH 1Z1IA 1BB0B 3AAUA 2HWLB 1C1MA 3M36A 4B73A 2XW9A 2GDDA 4ZHAA 1FLEE 1KLJH 2BOHB 1VJ9U 3TU7H 1C5RA 1IHTH 1GHBF 3NWUA 1O5EH 1TGNA 1FPCH 2DE8A 5LH8A 1K21H 1OS8A 3FZZA 1K1JA 2V35A 1K1MA 1K9OE 1W3CA 1LVOA 1Q31A 3BSQA 1HXFH 1O2ZA 1O2RA 2QA9E 3AAVA 4I8KA 5GCHG 1TNJA 3A86A 1C1PA 1P2OA 1BZXE 1GI5A 5C1UA 5K7RA 1MZAA 3KF2A 3D23A 4BAQB 3HGNA 1HDTH 2BZ6H 3SUGA 4GAWA 3SHAH 4UONA 1DUAA 1P04A 3DD2H 1MKWK 1V2WT 2FOEA 2W5EA 2BOKA 2OCVB 1MTNC 1LPZB 4GHQA 1RTKA 5E0GA 2ZDMA 3UPEA 3TJUA 5HGGA 4K60A 3ZZ7A 2VWMA 3AASA 3V3MA 1XXFA 5L6NH 1DVAH 3EGKH 4K1SA 1BHXF 1C2JA 4B2CA 1V2TT 2OINA 3PLKA 5HM9A 4UFDH 3L33A 4ZKNU 2TBSA 3SU0A 1ACBE 2TIOA 3SUFA 2ZPQA 3OY5U 5HXFA 3KGPA 1E35B 3A7TA 1W13U 2AGGX 3UREA 5IYTA 1Y3WA 2B9LA 3BTGE 1XUKA 1O3HA 4AB8A 1AB9C 3ZVGA 2ZG0H 2ODQA 3RM0H 1P11E 2XRCA 2Z9GA 3SJ8A 4A92A 1G3EA 1RRKA 3H5CB 1HAYB 1HAXB 4WVPE 3RU4D 1P06A 1UVOA 1GMDG 2A0QB 1UVSH 1PQ8A 1PPFE 1FAXA 3DFLA 1GI6A 1E37B 4WWYA 4YT6H 4BAKB 1P02A 1AVGH 1L4ZA 1O3LA 1GBBA 2ZU2A 2QCYA 1KXFA 1AZ8A 4JYUH 3ZZCA 2A31A 3PMJA 4SGAE 2O8LA 1HJAC 5C2ZA 3CENA 2BY9X 3U1IB 4K8BA 2BYAX 1LPGB 2G5NA 1O2IA 5EPYA 1QRXA 2Y7ZA 2ANWA 1SGQE 1LPKB 1A7SA 1ZR0A 1PPEE 4NIYA 5FCRA 4MPVA 4AYYB 1L4DA 3BV9B 2JETB 3EA7A 1NESE 1F2SE 3A84A 1MAYA 4K3JA 1NFXA 1TLDA 4B2BA 1IHSH 1VR1H 2EEKA 3F6UH 5E0HA 5GXPA 2PKAB 1O3BA 4HFPB 1G2MA 3AVZA 2J4IA 2FESH 3MH6A 1UTKA 5JB9S 1C5TA 5L2ZH 1O3FA 1DITH 2ZGXH 3BIUH 1BHXB 4INHA 3LJJA 3FZDA 4MG3A 1C2LA 4U32A 1EP6A 1PPBH 1FONA 3NK8A 1K1PA 1LQDB 3PMAB 2OP9A 1ZMJA 3TGKE 2ASUB 3ZVBA 2PKAA 4CR9A 1HPGA 1AVWA 1AGJA 1YPMH 1O0DH 3SGAE 5E2PA 1FY3A 2GGVB 6ESTA 2VGCC 2VVCA 3ATWA 2VGCB 3T5FH 2TGPZ 3RC4A 4X1PU 3U8OH 2EI6A 1T4UH 3BTKE 1KXEA 5I46H 1DE7H 4IMQA 1TQ7B 1H9IE 1BMAA 1MUEB 1V3XA 1MU8B 2A32A 2VIOA 4IC5A 1P10A 1YBWA 2A2QH 1CHOF 2FOCA 3A7XA 5TCAA 3T25A 5C3NA 4FVBA 4X2YA 1TFXA 2UWPA 3ZZ5A 2TGDA 1AUJA 2P3FH 4RN6A 1GMCF 2V0BA 3RXHA 5DKMA 2ZCKP 1C1OA 1VGCC 3SV8A 2AS9A 3QTOH 4UDWH 1NFYA 1SGCA 2QXHA 4M7GA 1N1LA 3LH3A 4AG2A 5IDKA 2BQ6B 3O8BA 4ZH8A 1TPPA 2ZTZA 2VNTA 1TAWA 1ABJH 1CGHA 1G37A 1Z1JA 1FJSA 2NU3E 1AWHB 1F5RA 1TNLA 1H8IH 1LVYA 4WH8A 1GBLA 2YOLA 3SNCA 1O3PB 3RUOA 1HJ9A 4B76A 2NU2E 3MNSA 8GCHF 1GBIA 2FTLE 3HK6B 3KNXA 1YPHC 4AFZA 1ELVA 3ODDA 3MU1A 5T3HA 4ABBA 1S81A 1EKBB 1MBQA 2OD3B 2SGFE 3MNCA 1Z71A 1O3OA 1GHBG 1QQUA 2AYWA 2AERH 2GCTB 4JMYA 3VB7A 1LHCH 5G4BA 3E16B 2FM2A 3TH3H 4BTIB 1O37A 3C27B 1C5UA 1ZGVA 2D8WA 4GPGA 2TPIZ 3A80A 3N7OA 2C3SA 1VCWA 1SGFG 4WY3A 1RXPA 4ASHA 4CRFA 5BRRE 9ESTA 1ZPZA 1PJPA 1EZUC 1MTSA 2JH0D 2FS9A 1HRTH 3A83A 5C20A 2AMPA 1PPCE 1F7ZA 3F9FA 1G3CA 1C5XB 1V2RT 3P6ZB 1TNHA 3SU3A 1DY9A 1O5DH 4QT8C 1C4U2 3QGJA 2P3TB 1QB1A 1ETTH 3MH7A 2W3IA 4NCYA 3ATMA 1OWEA 1MH0A 1NC6A 1C1WH 1IAUA 3SU6A 2ALVA 3SJOA 1GI3A 3BTTE 5GCHF 5A8YA 4DCDA 3RXDA 2PW8H 1Q3XA 4Y7BA 2G55A 1KIGH 2H1UA 4CHAB 2HRVA 2VB0A 4VGCC 2VIWA 1O2KA 3LJOA 1ZSKA 3ZZDA 4X6NA 1LVMA 2VWOA 1ZHPA 5DP7A 1JWTA 6LPRA 3MO9A 1O3MA 1AMHA 3PM3A 4AFQA 2QGRA 3DT0H 3EDXB 1ESAA 1C2MA 1UO6A 1FPHH 1V2VT 1BTZA 4X2VA 3ELAH 4YLQH 1H4WA 3S9AA 1P2MA 2Z3DA 5DP9A 1WTGH 3FP6E 2XC0A 1A3BH 1THRH 1XKAC 4AGKA 1ANDA 1UTPA 1Z8IB 3Q76A 3M5OA 3RMNH 2STBE 1DWCH 4JCNA 3SORA 1NROH 3NPSA 2QAAA 4K5ZA 1ZJDA 3DFJA 1QURH 5DP3A 2HNTC 2HPQH 3VFEA 3VEQB 1N8OB 1PPHE 1Y8TA 4FUGA 4B74A 1GL0E 2P3UB 4H4FA 2A45B 1FY5A 5BPEA 1Y3UA 2J92A 1N6XA 3A7ZA 4YOGA 1P2QA 4X2XA 1DSTA 2K1QA 2GKVE 1DLKB 1ETSH 2W3KA 2BD5A 3PB1E 3MH5A 1GMDF 2ZCLP 2PGBB 3HK3B 1SQTA 1F0UA 4TWYA 3NUMA 3ITIA 2F91A 3I77A 3SO3A 3NZIA 3Q00A 4AN7A 3OU0A 1YM0A 2WYGA 2H2ZA 4X6PA 5HM2A 2XBXA 1BA8B 4FUDA 4UFEH 2F3CE 4DGJA 1L1NA 1A3EH 2H6MA 1GMHG 3HKIB 3OY6U 3GCOA 1QHRB 1JIMA 2Y5GA 2EA3A 2FZZA 2SGEE 3A89A 4GVUA 1NU9A 3QLPH 4NGAH 2XYAA 4INLA 1VCPA 2RA0A 2VVUA 3LOXA 4DVAU 1TB6H 3RXGA 4BAMB 3LGUA 4NA7A 1XM1A 4TPYA 1SGIB 2SNVA 2FOAA 3EE0B 2G00A 1O2YA 3RXRA 1T8OA 1HV7A 3R0FA 1AD8H 2ZGHA 4DY7B 2CHAB 3ZZ6A 4DIHH 1D9IA 3BTFE 4Y71A 2O8UA 2IOTA 1ZMNA 5F8TA 4AYVB 2P8OC 4NA9H 3STJA 1TRMA 2P8OB 1QL8A 1UTOA 2WPHS 3RXQA 1TWXB 3NKKA 2VIPA 4Y7AA 1UVTH 3PWBA 1SFQB 2JH6D 3EAJA 1O5BB 1ARCA 3ZVCA 5CHAC 1ELGA 2P93A 5C1YA 2Q6GA 2C8ZB 3PYHA 1O2NA 2GP9B 1TGSZ 5CHAB 3UFAA 1FY1A 1WQSA 5ESBA 1BMLA 1ANBA 1Z8JB 2FIRH 2OQ5A 1C5MD 3JZ1B 3Q3XA 3LIWA 2QC2A 1CHOG 1DWEH 3MU8A 4BNRA 2BDCA 1Y3XA 1YLCA 1OX1A 1SOZA 1EOJA 2GX4A 3RLWH 4A5TS 4XE4A 1JXPA 3ZVFA 1GMCG 4X8VH 1V2NT 4H6SB 1EAUA 2LNCA 2A7HA 1WAYB 1C1SA 1WBGB 1NRSH 3QO6A 4HTCH 1Y5AT 1KYNA 1ELEE 3NCLA 1GJBB 1C2KA 2A5KA 5DG6A 1BCUH 3H7TA 4TWWA 1IQNA 3PTBA 1O2MA 1XUFA 2AGEX 1V2ST 1IQIA 4ZKSU 2QXIA 2WPIS 1WYKA 3RXIA 2GTBA 1NM6A 4GHTA 3DUXH 4MNVA 4YO9A 3QTVH 2Z9JA 1HXEH 5T6FA 3UQOA 1AO5A 1XUIA 1EPTC 1O5GH 2A7JA 1GBCA 3TK9A 4DT7B 2FOGA 1UTQA 1EJNA 2C8YB 4K2YA 5PTPA 4RKJB 3IWMA 8GCHG 4CRAA 4BAHB 3QZQA 3GISB 1EUFA 1QL7A 1DM4B 5HYOA 4J1YA 4JZDH 1KXBA 3ZZ3A 2UUFB 3L6PA 4K69A 1O2WA 3LGVA 2G52A 1LHFH 2BD9A 1CA0B 1THPB 4FU9A 1L2EA 3GY6A 1S6FA 4CRCA 2UWOA 4ABAA 2WPJS 4Y76A 1D6WA 1C5PA 2B5TB 1C9TA 4X1QU 4ZUHA 3TK6A 3BG4C 3C1KA 1CU1A 1GVKB 2Y7XA 1KY9A 1YPLH 2BZAA 3TGJE 4AFSA 4ZROA 3VB3A 4O3TA 1BJVA 3Q3YA 6GCHF 1XVOA 3EQ0H 3HKJB 1XMNB 2ZDAH 2CF9H 1DT2A 2WPKS 2FLBH 1P05A 1HLTH 5DP8A 1BUIA 3QUMP 2VIVA 1NT1A 1MCVA 3KHVA 1TGTA 2C93B 5GDSH 1MU6B 4ABHA 3SGQE 1WOFA 4ZKRU 1NPMA 1JBUH 2OQUA 3GDVA 1K2I1 2Z9LA 2ZU5A 3QZRA 2R2WU 5FCKA 3RXEA 1O30A 1IQLA 2UUJB 2OC7A 4BXWA 8LPRA 3BTQE 1DWDH 1P9SA 3RXLA 4D8NA 2QXGA 1W10U 3URDA 1NFUA 5EOKA 1ETRH 2VWLA 1TIOA 1MTNB 1TRYA 1CGJE 4IN2A 1DLEA 3ESTA 4ZHLU 1O5FH 1BIOA 4E05H 4FUEA 1GCTC 1GBMA 2H9EH 4ZXXH 1VITH 5EW2H 1GCTB 2PFEA 1ZYOA 3UUZA 2P16A 3HATH 1RFNA 5FPTA 1C2IA 2CF8H 4MPXA 1G9IE 1O2TA 1BITA 3RU4E 4X8UH 2FS8A 1J17T 1ZSLA 1BMMH 1VJAU 3GY2A 2BY7X 2B0FA 1W0YH 3P92A 4JYTA 1GHZA 4D7GA 2FYRA 2ANYA 2ZFRH 1J8AA 4GSOA 1TNKA 1EB2A 1AB9B 1P03A 3V12A 1GI8B 1UTMA 1B0EA 1KDQB 5H4IB 2C4FH 3S9CA 1GJ4H 1MTWA 1YP9A 4XDEA 2FO9A 1EXFA 4JYVH 5GWZA 4K8YA 3TVJB 2BLVA 1RIWC 4O97A 3T62A 2TGTA