3ITIA

Structure of bovine trypsin with the mad triangle b3c
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Cationic trypsin
publication title How to get the magic triangle and the MAD triangle into your protein crystal.
pubmed doi rcsb
total genus 54
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2009-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3itiA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3itiA02
8LPRA 1P06A 2H6MA 1BT7A 2G00A 1QHRB 6GCHF 3PYHA 1QQUA 3P95A 1LVMA 1W11U 1W7GH 1F92A 3TK5A 1C1MA 2FESH 3LC5A 4H6TA 3E16B 1PPGE 1PPEE 1MTNB 2PKAB 2VIDA 1TGSZ 2SFAA 4ZAEA 3TPIZ 1DXWA 1E35B 3KQEA 2QA9E 4JK6A 2YNAA 4UFDH 3ZVDA 4WY3A 3RXBA 1AB9B 2QCYA 1ZZZA 1EAIA 1GDNA 3SJOA 2SNVA 3LH3A 2FODA 1QJ6B 5FAHA 3SV2H 4SGBE 4Z0KA 3M5OA 4FUCA 1AFQB 2FTMA 1P8VC 3GDVA 2GZ8A 3MH7A 1OWHA 2B9LA 1LPZB 1O38A 4UD9H 1Y5UT 2C4FH 4Y7BA 1KXCA 2J95A 1L4DA 1B0FA 2QY0B 5HM2A 2HVXA 1Y3YA 3BIVH 1XM1A 4X2WA 1A0LA 2AGIX 1QA0A 4X8UH 2J2UA 2OD3B 4CBOA 3VB7A 1GHZA 3ENSB 5C2ZA 1O2RA 5A0BA 1P2OA 2I6QA 5I46H 3PTNA 4XE4A 3UR6A 2ZDKA 3K9XB 2Y5HA 2GDDA 2F9BH 4IC5A 4DGJA 3UIRA 2OC7A 1F0UA 1YCPH 2GMTB 1TX6A 1AWHB 1EKBB 1GI9B 3F9GA 4MDSA 3RMLH 3ATIA 1DY8A 1C2EA 1TPPA 1SMFE 1HRTH 2J9NA 4FU7A 4THNH 1QR3E 1GMHF 1SFIA 1G9IE 2NU2E 5GJ4B 1OS8A 3MMGA 2VJ1A 1RS0A 5DGJA 4BAHB 1IQMA 1FAKH 1TPOA 2ODQA 4X8SH 1VR1H 1W12U 3RXFA 3ZZCA 7LPRA 1UTJA 1AO5A 5DP5A 5E2PA 3U98H 1H4WA 1TBZH 1SHHB 1ZPCA 2AMQA 3SNBA 4BTTB 1TMBH 1PFXC 1EXFA 2ZWLH 1P12E 2BQ6B 3BEUA 1QA7A 3SGQE 4NA7A 5GPIB 1CT2E 1FIWA 4NIXA 3DA9B 2EEKA 3MO6A 3RXGA 1MAYA 2V35A 3RXUA 2P94A 2XYAA 2F9UA 2J92A 2ZDVH 1GCDA 1O33A 2A0QB 4Q2KA 1G32B 3ZZDA 1O2OA 3SBKA 1EJAA 3KNXA 4D8NA 1ZHMA 2XWAA 2A4RA 3O8DA 4WMDA 2BD5A 1QBNA 2BD7A 1C1WH 2Q6FA 1P0SH 5A2MH 1Y8TA 3Q3XA 4WWYA 2IOTA 5AFYH 3M5NA 1XUIA 1FN8A 1B5GH 1C2KA 1BOQA 4WXVA 1TX7A 1YPHE 1O2GH 1HBTH 2EI6A 3B9FH 3GY4A 3TH3H 5DO4H 4MPWA 3UNQA 3LDXH 1UK2A 2XBVA 3P6ZB 1JOUB 3LONA 1HJ9A 1N8OC 3S0NA 2RA3A 2ZDMA 2XWBI 1QQ4A 1LMWB 2AEIH 1O32A 2FOMB 2Y7ZA 1T8MA 2HLCA 3BF6H 1ELCA 2Y5GA 1OWDA 2QN5T 4I8GA 3GY2A 2FIRH 1ZRKA 2WPMS 2OBOA 4IC6A 1GBAA 2P59A 1WYKA 2P16A 2CHAC 1O31A 4TY6A 2Z9KA 1IHTH 1IQLA 1TMTH 3ELAH 4AYVB 3EA9A 1NFUA 1P2NA 1TFXA 5A8YA 1G2MA 1GDUA 3A87A 1EJNA 3RXSA 1CHOG 2F9PA 1BITA 2GVFA 5DP6A 5EQSA 4OS5A 1C9PA 4TY7A 2R2WU 1O3KA 1MD8A 4IGDA 3Q00A 4X6MA 1ESBA 2FTLE 1C5RA 1VZQH 5C3NA 1OX1A 2PUQH 4O03A 4Y79A 1IHSH 5C1XA 2WPLS 3UWIA 4FUHA 1TGTA 2A7HA 1A7SA 1A0JA 2BQ7B 1OOKB 3KQCA 1E34B 1F5RA 1YBWA 1YLDA 3MNXA 4HFPB 2D8WA 5J4QA 2ASUB 2OC8A 2IJOB 2G8TA 5DP3A 5LH8A 2BYAX 4MPVA 2ZHDA 1DS2E 3U69H 3URCA 2HRVA 5FPTA 5JB8S 1G36A 1GMCF 3A85A 2XC4A 1N1LA 3SUFA 3OYPA 3GCHC 5FCKA 5F8XA 3TJNA 3ZVFA 2QC2A 5K7RA 2FYQA 4GCHF 4GLYA 1MQ6A 4NFEA 1D6RA 2PLXA 3U1JB 3TJVA 1S6FA 4A1TA 1O2MA 2ODPA 2ZNKH 2VWLA 4MNXA 1Q3XA 3O8RA 1YCPM 1MH0A 1J8AA 2QAAA 3C27B 1TE0A 4JYTA 4YM9A 3MTYA 2H2ZA 5I25A 2K1QA 2Q1JA 5DP4A 4KTCA 2ZHWH 2Z9JA 1K28D 3GOVB 3FFGA 4OGXA 1TWXB 3GCNA 2F9NA 1UCYH 2O8LA 1ZYOA 3DD2H 4UFEH 1KTTB 2GP9B 2TRMA 4FUJA 5EXMA 1CO7E 1GI2A 4AFZA 1IQGA 4VGCC 1LCYA 2PW8H 3MNSA 3M3TA 3VEQB 2AGGX 1J16A 4B73A 2BXUH 1SG8B 3QO6A 2BVSH 2YOLA 3M37A 3MU8A 3VB5A 1GBMA 4YT7H 5CMXH 2TBSA 1A2CH 2BVRH 2FPZA 3DUXH 4I8KA 1THPB 5DKMA 3MU0A 1BBRK 2G5NA 4K1TA 4LOYH 5FX6A 1SGEE 2BDYA 4ISLA 1GI4A 1G3EA 2GCHG 1BHXB 1EP5A 5A0CA 1KXDA 2ZPRA 3GCHB 2FOHA 1THSH 2Z3DA 1LVBA 2QXIA 3ZZ5A 1P02A 1BJVA 2ESTE 3H5CB 3UTUH 2BM2A 1V2KT 1ZHPA 4NWLA 1P3EA 1O2WA 2WPJS 3V13A 1ETSH 3ZVGA 2FOAA 2OCVB 1TPAE 1PPFE 2SGFE 1QNJA 1TBRH 1GMDF 1AHTH 1V2VT 3M7QA 1BQYA 3P8OA 5H4IB 1AWFH 4BAOB 2C93B 5HYOA 1SOZA 3MNBA 1LHFH 2ANWA 1K22H 1OKXA 3OU0A 3KGPA 3ATKA 2OLGA 1QB6A 1L4ZA 2ZCLP 3SHAH 5SGAE 4A1XA 2PKAA 4X1PU 6ESTA 2O8MA 1WTHD 5FPYA 4BXWA 2FOEA 1P11E 1XUFA 1GBTA 2BDBA 3GDSA 3UNSA 1NZQH 3BTHE 3LGYA 3PO1C 1ANCA 3RXLA 3PV4A 2A2XH 2BLVA 1GJ4H 1NS3A 1TIOA 2ZFQH 2QF0A 4VGCB 4DIIH 3SOSA 1YYY1 4TPYA 1ZSJA 4I7YH 2ZI2H 1C5TA 1PPZA 1EASA 1TALA 3NK8A 3RLWH 2CN0H 4CRFA 1XUKA 4CH2B 1C5NH 2H9HA 8GCHG 2A7CA 1MTUA 4CHAB 1C9TA 1RIWC 4U2WA 2R3UA 4D9QA 3SQHE 2NU0E 4MPUA 2G4UA 4X0WU 3I77A 4H4FA 4XFQA 3RXRA 1YLCA 1F0TA 2ZHQH 1V3XA 1C5SA 4D7FA 1TNIA 3K6ZA 1T8NA 1C5UA 1ESTA 1GJCB 2ZCHP 1C2HA 2HALA 4R8TB 3LU9B 2OP9A 1SQAA 1HV7A 1W0YH 2TGDA 3EE0B 1T8LA 1E38B 5L2YH 2FZZA 1Y3XA 3NZIA 3O8CA 2TGPZ 7ESTE 1D4PB 2BY8X 1C1VH 1L1NA 2SNWA 1Y3VA 3ZZ8A 1EAXA 2H1UA 1N6YA 3F1SB 1SGFG 4Y71A 1XMNB 3S9CA 3EAJA 2ZHFH 2FI3E 4GSOA 3SV8A 3RXCA 2XRCA 3SGAE 1FY3A 4WXIA 5BPEA 3RXTA 1SLXB 1TQ0B 2BX4A 2VIOA 1C5VA 4UE7H 3SU0A 3A8CA 4XBBA 1ZTLA 1A5IA 3GY7A 1NESE 1VCQA 4CBNA 1SGRE 2P93A 3KIDU 4CREA 1O2XA 1GWAA 4DVAU 4TYDA 3U8TH 4X1QU 4X1NU 1LVOA 3ZZ9A 4NIYA 1QJ7B 3TGIE 1V2NT 1O3JA 4KP0A 2BDCA 5L6NH 4ZROA 2ZG0H 3EA8A 1FV9A 2ZO3H 2F9OA 1C5WB 1ORFA 2EI7A 4CRBA 2ALPA 3P92A 3PO1B 5HGGA 1OXGA 2XXLA 4ZKOU 5E2OA 3Q3KA 1GBFA 3SJIA 4BAMB 1V2RT 3TH2H 1MMJN 1ANDA 4ABFA 2W7UA 1CHOF 1RTFB 1MTSA 1AUTC 3RMNH 1WAYB 2PTCE 1EAUA 1E0FD 2F83A 3A8AA 5C5OA 3BG8A 4BTIB 1DICA 1GCTC 1A3BH 1H9LB 3A7WA 2SGEE 1TGBA 1OPHB 5ESBA 1H8IH 2R2MB 1O3NA 1YPMH 4DIHH 1FY8E 2VNTA 5FPSA 5JYIA 3BTKE 3G01A 1B0EA 3S7KB 5EQQA 3GCTG 2ZFPH 1SQTA 3ATLA 4X2XA 3UUZA 3NCLA 1WU1A 2Y7XA 2QF3A 2DE9A 1ELFA 2G55A 3LGTA 5JBAS 3U9AH 1IQFA 1C1UH 3DHKH 4NCYA 4F4OC 2W3KA 5A0AE 1SI5H 3UOPA 3T62A 1OWEA 3TGKE 1UK4A 2CV3A 3Q77A 3T2NA 1BTPA 5C1YA 1GBLA 1EZXC 4K69A 1L1JA 1O3PB 1SGQE 1F7ZA 1HUTH 2ZP0H 1L1GA 1HJAC 4WJG2 1MKWK 1W13U 1Z7KA 1D9IA 4NZQA 1DPOA 1VCWA 2BDGA 2GX4A 1C4Y2 1S84A 3H7OA 3BTQE 4IW4E 2VU8E 2JH0D 1EP6A 1V2WT 1ZLRA 2Z9IA 2WV4A 2ALVA 3LJJA 1MQ5A 1YPGH 5C5NA 4BNRA 3EGKH 3I78A 1C1RA 4K3JA 4XOJA 1UO6A 2A31A 1ELTA 3D49H 3AAUA 2FP7B 1P9SA 1C5OH 5E0JA 1ARCA 5DK1A 1W10U 1PYTC 2VWMA 1GBBA 3VGCB 1HIAB 1JMOH 2Z7FE 1UCYE 1A5HA 3MO3A 1W0ZU 2NU1E 3SU5A 4Y8YA 3DT0H 3L33A 3A83A 2TIOA 4DOQA 1C5XB 1HAIH 3WY8A 1CA0B 3A82A 1FXYA 2ZKSA 3S9BA 1QRXA 2PTNA 3GY5A 1J9CH 1UVUH 4IN1A 4TPIZ 4GHTA 1SGPE 3TITA 2BVXH 1GGDC 4ISIH 1OP0A 3RXKA 3VB6A 3A7TA 2A5AA 3F9HA 1DSTA 2FX4A 1V2OT 2C8ZB 1C1SA 4NSYA 1GJAB 1Z1JA 1WQVH 3SUDA 1P04A 1ELEE 3PB1E 2BD9A 1EATA 4DY7B 3U1IB 1AE5A 3LH1A 3EQ0H 3RP2A 1AN1E 2PSYA 3H7TA 2AMPA 1XUGA 1NU7B 1LO6A 1SGNE 1TNKA 2FYRA 1B7XB 2PKSB 4CRAA 1D3TB 1O3DA 3SUGA 3V3MA 1BHXF 2OC0A 1C5MD 1EPTC 3QTVH 1GI3A 2RDLA 1ZTJA 1O5GH 2D2DA 2H9EH 2V6NA 4KTSA 2V3HH 1VJAU 2AS9A 2PUXB 4B76A 4A1VA 2QIQA 2CJIA 3T29A 1C2LA 1ZJKA 1ZPBA 4U30A 1PPBH 1D3DB 1CSOE 2UWPA 2XNIA 8KME2 1GVKB 1K2I1 1FY4A 1PPCE 1A0HB 1GHBF 2THFB 1DANH 1Z6EA 5AFZH 4E06H 1KDQB 1G3CA 5JB9S 3BG4C 4OS2A 4Y6DA 3NWUA 2XCNA 2Z3EA 5DP7A 3D62A 3KN2A 1C1NA 1DDJA 2HPPH 3RLYH 2UUKB 4MNYA 2VIPA 3M61U 3PMAB 2ZGBH 2VIVA 2PSXA 2BLOA 1U6QA 4FUDA 4A92A 4FUEA 2P95A 4H6SB 1TOMH 1GBKA 5GCHF 2XC5A 3GY6A 4MLFB 1GGDB 2HNTF 2SGQE 4A7IB 4AG2A 4Y8ZA 3RMOH 2WPKS 3NXPA 1NROH 3SU4A 1RRKA 1GHYH 2SGDE 1BMLA 2OQUA 3M36A 1G30B 1FIZA 8GCHF 1K1NA 2PGQB 1MCTA 1WQSA 4K1SA 5DP9A 2AIPA 2ZU5A 1GHAG 3A8BA 4IMZA 4WVPE 1G3DA 1O3HA 4XBCA 1ZSLA 4NIVA 1Y59T 2CGAA 1EB2A 3PMBB 2GV6A 1EPTB 1AKSB 1RJXB 5EW2H 4O3TA 1ABIH 4ISHH 2YNBA 1LHGH 2BOHB 1P3CA 3PLBA 2ZU4A 5AVDA 1NFWA 1LKAA 1VGCC 3LPRA 1UTKA 3BTTE 3RXJA 1DSUA 3M3SA 2BB4A 3OX7U 4UFGH 2FI4E 5F8ZA 3CENA 4ZXXH 3W94A 2WV5A 6LPRA 3AW0A 1OWIA 2BD3A 1O3OA 2R0KA 1EX3A 2BD8A 3A7VA 1CHGA 2JKHA 4JZFH 2ZZUH 4NIWA 1XVOA 2W3IA 4Q7XA 1ZMNA 1O3LA 1C5ZB 1FPHH 1S5SA 2A32A 1MTWA 1HB0B 3BN9A 3FP6E 4AFQA 2G51A 3BG4B 1V2LT 3SJ8A 1NRNH 4ISNA 1LQEA 2O8TA 3TU7H 5C20A 3I29A 2JH5D 3RU4E 3U8RH 4K5ZA 2GZ9A 1DWEH 3A89A 2C8WB 1FPCH 2IPHA 1PQ5A 1GJ6A 1ZPZA 1MKXK 1YPLH 4HI3A 4ZKSU 3ZZ6A 2BY9X 2Z3CA 1FMGA 4ASHA 2V0BA 2AFQB 1SQOA 1ZJDA 3LKWA 3SV7A 1TA2A 4Y0ZE 1XXDA 2VVCA 3SU3A 3SU1A 5FBEA 1FUJA 1D3PB 1LHEH 1NRSH 5GDSH 2ZTYA 2O8WA 1GG6C 4ZUHA 3ZVCA 2HPQH 3LT3A 2WPHS 1YC0A 3B23B 4MG3A 4NA8A 3CP7A 1MD7A 4J1YA 1KLJH 1WOFA 4X8TH 3PWCA 3BEFB 1UHBA 2TPIZ 3BV9B 3GCTF 4JZIA 1H9HE 1TONA 5TJXA 5F8TA 3QDZB 1ETTH 1N6XA 3KF2A 3UNRA 1A3EH 3GYLB 3E0PB 4X6PA 2BQWB 3PTBA 2VH6A 4LZ1H 2B8OH 2GT7A 1JBUH 1ELVA 4FU8A 2OQ5A 1A46H 1DLKB 2EA3A 4X1RU 4A5TS 1BA8B 3GYMA 1VGCB 5EODA 1BDAA 1F0SA 3DFJA 3TJOA 1ZMJA 2W5EA 4AZ2B 1NN6A 4YZUA 1HAVB 3RXMA 3VFEA 7GCHF 3VB3A 3CS7A 1N8OB 4B2CA 1V2PT 2HOBA 2LNCA 3M7UA 2RA0A 1V2UT 4YO9A 2J38A 5C1UA 1D6WA 1SHYA 2WINI 3F6UH 3T25A 2TGAA 5ETXA 2GD4B 1GHVH 3SW2B 1GHWH 2CHAB 3RU4T 1EZSC 2LPRA 1FDPA 3FANA 1QBOA 1KYNA 1TGCA 2ZGJA 3K6YA 3ZZ7A 1LQDB 3UQOA 3FP8E 1ACBE 1O5AB 3MH5A 1ELBA 4ZHAA 1YPKH 2FS8A 4X2VA 1O2NA 1JIMA 5JPMH 4F49A 1GG6B 2UUYA 1GI7B 2FOGA 1P2QA 3LOXA 3W95A 3AAVA 1F5LA 2ANKH 1C5PA 6GCHG 4RKJB 1AFEH 1CGHA 1TBQH 7KMEH 1LPKB 4NA9H 5AHGH 4TWWA 1K1PA 5HMAA 3SI3H 2CMYA 3UREA 1BZXE 1S82A 3N7OA 3STJA 2A5IA 1P10A 3V0XA 4UONA 1LHCH 1C5LH 4ESTE 1WUNH 3BSQA 2ZPSA 3P70B 4B74A 1YPJH 4JZEH 4JYUH 4UFFH 1FLEE 2FDAA 1INCA 1NU9A 1THRH 5EW1H 2Z9LA 4K8YA 1PYTD 1W2KH 1HIAA 1NRQH 1S81A 3CS0A 4Y8XA 3SV9A 3TJUA 3P17H 1T7CA 1Q2WA 2GZ7A 4KKDA 1NT1A 1QL7A 1BTWA 4I31A 2AIQA 3KEEA 3LGVA 4U32A 2PGBB 2G81E 1BRCE 3LC3A 5K0HA 2Y5FA 1HAHH 3GDUA 2H5DA 9ESTA 4ZXYH 3S69A 1HAZB 4BANB 3LJOA 1UVTH 3A7ZA 3QK1A 1UMAH 1HPGA 4H42U 1ELDE 1NRRH 2WUCA 2F9VA 4FUFA 2C3SA 5ABWA 2XCFA 1QL8A 2BDHA 4BAQB 4LXBH 3ZVEA 1BRUP 1SGCA 1DM4B 2ZQ2A 4XBDA 3SO3A 1ID5H 1QGFA 5E8EH 3HK3B 5G4BA 5JBTA 3K2UA 3A7XA 1G3BA 2QXHA 1ZR0A 5T3HA 2BLWA 1AE8H 3M3VA 1GMHG 5BRRE 1AUJA 1GBJA 1RXPA 1ZTKA 2A4GA 1HLTH 2ILNA 1AGJA 1BBRH 2ZCKP 4OS7A 5J4SA 2EI8A 1AVWA 3QGJA 4SGAE 3RU4D 3TNSA 4Q80A 3SNEA 4ABIA 1O3GA 2NU3E 5GXPA 3A84A 3D23A 1AVXA 2O8UA 4ZKRU 1ANEA 1WBGB 1SGYE 2UUJB 3M35A 1M9UA 4MTBA 4O3UA 3UWJH 1KLIH 3GICB 4I8JA 1Z8RA 3AW1A 1XVMA 1EUFA 1QCPA 3ITIA 2FX6A 4A6LA 1AMHA 1GL1A 4FUGA 4Y7AA 4B2AA 4NFFA 3B8JA 1Z71A 1O2LA 1GVLA 4I32A 1O5FH 3E3TA 2BLQA 2ODYB 2VWNA 2VINA 2Z94A 4YOGA 4LK4A 4ABEA 2TGTA 2VH0A 3UFAA 1IQEA 1CBWC 1SLWB 3MH6A 2Q6GA 2BY5X 3PWBA 4D76A 5DPAA 1G37A 1KIGH 1T32A 1QRWA 1UTLM 4K60A 3PMHB 1VCPA 3UR9A 1C1QA 2FO9A 1W7XH 2B5TB 1FY5A 3A81A 2JETC 3ZZ4A 4AFSA 4YESB 3S9AA 5TCCA 1NC6A 3RDZA 3TIUA 3M7TA 4NSVA 4E7NA 1BB0B 4GUXA 2ZFRH 3HK6B 1X7AC 3E6PH 2BZAA 3FAOA 1EPTA 1RD3B 4I8HA 1H1BA 4GAWA 4JCNA 2R3YA 2ZEBA 1RIWB 3SU2A 1TNGA 1J15A 5HXFA 2Y6TA 3SU6A 1ZOMA 1AZ8A 5JBCS 1C1OA 1Z1IA 2GTBA 1IQHA 2A2QH 3UQVA 3QWCH 4B71A 4KGAA 4B75A 4INLA 1FAXA 1EQ9A 1L0ZA 1SC8U 4NWKA 1OP2A 3F68H 4ABBA 3T28A 1AB9C 1K1OA 2VVVA 5T6FA 2A5KA 4XDEA 3A8DA 1O3IA 2Y80A 1CVWH 1C4V2 1GMCG 4M7GA 1O2SA 1TAWA 4WH6A 3FZZA 3SNAA 6CHAC 1P05A 3SJ9A 1VITH 3PLPA 2PR3A 1IQNA 3QX5H 4JK5A 3SHCH 1G2LA 3PM3A 1ARBA 1CT4E 1TB6H 1O2JA 1SSXA 3RMMH 4BTUB 1ELGA 1C2DA 4O97A 3OY5U 1CBWB 3L6PA 1KXAA 5B6OA 2OBQA 2WUBA 1SGDE 1TNLA 2FOCA 1TRMA 1A1RA 3Q76A 1MZDA 4INHA 1ABJH 1O2QA 1TABE 3VB4A 2PV9B 2ZF0H 1EB1H 1FJSA 2HWLB 5E0GA 2BZ6H 1O2KA 2P8OC 1BRAA 1GI1A 3E0NB 1O39A 4HTCH 1QB9A 3SUEA 2BY7X 1FZZA 3TNTA 2GMTC 2XW9A 1HAYB 1W14U 1IAUA 2RG3A 2FMJA 1P01A 1ANBA 4RSPA 1YCPK 4IMQA 1PQAA 1DXPA 3SORA 1O2PA 2GGVB 1GCTB 1Z8GA 3V12A 3QLPH 1CU1A 4XSKU 3ODDA 3RC5A 1P2MA 2Y82A 4X2YA 4J2YB 1O5BB 2BXTH 4DURA 3BTWE 3KHVA 1DITH 4Y11E 1HDTH 2VVUA 1HAVA 2XBXA 5T6GA 4NG9H 4GPGA 2A4QA 4K1EA 1QFKH 1JIRA 1JRTA 5LGOA 2EC9H 3FZDA 1H8DH 1WSSH 1V2JT 3MI4A 1GJ8B 1A61H 2A7JA 2ZTZA 1MKWH 1GBCA 2AH4X 2GCHF 1S0QA 2SGAA 1YPHC 2FOFA 1IQKA 3A86A 2J94A 1HJAB 1BTHH 1SGIB 1SL3A 1C2GA 3R0FA 1QTFA 1XXFA 6CHAB 3SNCA 2WYJA 3MH4A 3PROA 1ZMLA 1WCZA 4FUBA 1BTYA 1CGJE 2W7SA 5A09A 2KAIB 1HAPH 1AY6H 3E91A 1HYLA 1BTZA 3RC4A 3SJKA 3QTOH 3RUOA 1O0DH 1GMDG 3IITA 1NFYA 3TK6A 1XKBC 4AN7A 3BTEE 1GI8B 1V2ST 1XUJA 1O3CA 2VGCC 1OWJA 1QY6A 1C1TA 2ZU3A 3AVZA 3IG6B 4Q7ZA 2M5TA 4ABJA 2VIWA 2ZIQH 1F5KU 1O2TA 1LKBA 2P8OB 5CHAC 5PTPA 5EXLA 1DOJA 3MYWA 3ZZ3A 3DFLA 1V2MT 3KCGH 1QB1A 3MU4A 2RCEA 1CA8B 2ANMH 4CRGA 1T4UH 2GT8A 3HGPA 1DLEA 1AVGH 4AX9H 2FOBA 3MO9A 5EOKA 1LDTT 4FU9A 1NY22 4DW2U 1TRYA 4OGYA 1HNEE 3OSYA 1YF4A 1BBRE 4FXGH 5F6MA 2ZPQA 1DUAA 2ULLA 1AU8A 3FP7E 4AGKA 1KTSB 3LGWA 1E37B 1SVPA 2XC0A 3SI4H 1O5DH 1RGQA 1A4WH 3ZZAA 4JYVH 1NPMA 4FVDA 3RM2H 1FNIA 2BD2A 1O30A 3RXPA 4LZ4B 5FBIA 4YLUA 2QGRA 3UPEA 4I8LA 2ZTXA 3SGBE 1K1JA 1FI8A 1K9OE 5FXLA 1GJ5H 4E05H 5HM9A 4BXSA 3MU5A 3E1XB 2BY6X 5LPEA 3RXAA 2ANYA 5EPYA 2B0FA 3Q3YA 1HXFH 4R0IA 3RXQA 3GCOA 4Y0YE 2ZU1A 1SGTA 1J14A 1C2JA 2FWWA 5EPNA 4AOQA 5EU8A 1MTVA 1K1LA 4DT7B 1A5GH 2ZC9H 1O37A 1UTQA 1C2MA 1SOTA 2PHBA 1DT2A 1HFDA 2VGCB 1KLTA 2STAE 1SPJA 1BTUA 3RXOA 1O2VA 1C5YB 4KTUA 4HGCA 2CF9H 2A45B 5L30H 5DP8A 4ZHMU 4I33A 1YKTA 5C67A 1P9UA 3MFJA 5AF9H 4INKA 1TMUH 1O2IA 5CHAB 1MBQA 1GBEA 4IBLH 1GJ9B 4YTAA 5L2ZH 1O36A 1ZSKA 1ETRH 4X1SU 1UCYK 4YOJA 4MQAA 1GJ7B 3P8NA 2GDEH 2G52A 1GI0A 4PROA 4AYYB 1JRSA 4BOHA 1EOLA 1O2HA 1SGFA 3BTGE 3AASA 1EZUC 1SR5C 2G4TA 3OTJE 1VITG 2FI5E 4AB9A 3ZV8A 1LTOA 1NO9H 2A4OA 1UVOA 1S85A 1NRPH 2BDIA 1SB1H 1PQ7A 1BMMH 1O2YA 1V2QT 1T4VH 2ZDNA 4X8VH 1C1PA 4JMYA 1HAXB 1DWDH 1MU6B 5EGMA 1IQIA 2P3FH 3HPTB 3C1KA 3A7YA 1K21H 1S6HA 4NZLA 1EOJA 1Z8IB 3KQDA 4B2BA 4DCDA 4CR9A 3SQEE 3ZVAA 1RTKA 3KQBA 3P8GA 2NU4E 1BTXA 1Y3WA 4QT8C 1GBHA 8ESTE 1GI6A 3QZQA 2VWOA 3D65E 2H5CA 3JZ2B 5LPRA 3HGNA 2VB0A 1GJDB 1JWTA 1K1MA 1QL9A 3TGJE 1Z8JB 2ZHEH 1SFQB 4X6OA 1ZRBA 1TQ7B 1UTPA 3TH4H 1MKXH 2XTTB 1ZGIA 2BD4A 1TNHA 1TA6A 1P2KA 1V2TT 4RKOB 1HAOH 4FUIA 1GL0E 3RC6A 1QBVH 5T6DA 4KELA 3M5LA 5JBBS 3P8FA 1XKAC 1S0RA 2PFEA 1BJUA 1ZGVA 2Q6DA 2ZQ1A 2F91A 1UVSH 2BHGA 4DJZB 3URDA 1F2SE 2FEQH 3UOUA 4WMFA 1GI5A 3ESTA 2ZGCA 1C2FA 3RXIA 3MU1A 1QURH 1Z6JH 4MVNA 2JH6D 3KL6A 1ELAA 1Q31A 1BRBE 4ABHA 1DWCH 2HNTC 4U01A 2J34A 3T5FH 2ZDAH 4ABAA 1TLDA 1FN6A 1TRNA 4CHAC 4YLQH 2ZFTA 4FVBA 3F9FA 2ZFSA 3PMJA 4ZH8A 1O3EA 2DE8A 1MUEB 2J4IA 2BTCE 1LVYA 2ZECA 1C2IA 1F0RA 3BTME 1VJ9U 3NPSA 3T27A 4D9RA 1L2EA 2CXVA 1AIXH 1AZZA 1YGCH 1JXPA 2C90B 4Y10E 3ZVBA 4MNWA 1OYTH 4O9VA 3SNDA 3A88A 2BMGB 3HKIB 1K1IA 5DJ7A 3MWIU 1Y3UA 3NUMA 2GV7A 2ZGHA 3QZRA 5JDUB 1KXBA 2DUCA 1OWKA 1RFNA 1DUEA 3ATMA 3UY9A 1IOEA 1FONA 2STBE 2Y81A 1O5EH 3JZ1B 4AB8A 1RTLA 2BDAA 1EJMA 4CH8B 1V6DA 5FCRA 2B7DH 3ZYDA 3BTDE 2UWOA 4CRCA 1UTMA 3GY3A 5GIBA 1KY9A 4ZMAH 4K2YA 1O35A 2H9TH 3VXFH 1SBWA 3ZYEA 2I6SA 2PWXA 1GDQA 4ABGA 4CR5A 1GHBG 1MAXA 1PJPA 4WH8A 2QV1A 1O2ZA 1J17T 1H9IE 5EG4A 1KXFA 3ZV9A 1HAGE 4OS6A 3VXEH 4IS5A 1HCGA 1DVAH 1O3BA 2QXJA 1GJBB 1Y5BT 3QGNB 2F3CE 1XX9A 4X6NA 1DX5M 5FHTA 3RXVA 3MHWU 1O3MA 1UTOA 3FVFB 4E7RG 1XUHA 1QIXB 4WMEA 3RM0H 2NWNA 3TVJB 3K65B 1EAWA 1O3AA 1CE5A 2UWLA 5TCAA 5GCHG 2P3UB 1QRZA 1UK3A 1W8BH 1P2IA 3VPKA 3EA7A 3EDXB 1P2JA 1AD8H 1D3QB 1BMNH 2ZU2A 4DG4A 4UDWH 4RN6A 1KDQA 2KAIA 1CGIE 3NKKA 3O8BA 4OS4A 1GHAF 1YM0A 2Z9GA 3BIUH 1BIOA 3T26A 3RXDA 4ABDA 5ESTE 4Q7YA 1QJ1B 1O34A 2R0LA 2XBWA 1YP9A 1W3CA 2P3TB 1O5CB 1C4U2 1AQ7A 1BMAA 2AMDA 1DFPA 1WV7H 2HNTE 2BX3A 3L3TA 1PPHE 3RXHA 3SV6A 4AGJA 4D7GA 1S83A 2FLBH 1EZQA 2OC1A 2G5VA 2O9QA 1LHDH 3U8OH 2IN2A 1WTGH 3R3GB 4ISOA 2VIQA 2ZA5A 3S7HB 1BCUH 2SGPE 3F9EA 3QN7A 4WF8A 2GKVE 1P09A 1NM6A 1P57B 1T8OA 3ATWA 2GCTC 3LIWA 4GVUA 3GISB 2A1DB 3TLOA 1TNJA 2AERH 3MOCA 1UHBB 4MPXA 1GBIA 1TOCB 5GWZA 1ESAA 3A80A 4TWYA 3STIA 3VGCC 2AYWA 3HKJB 2ZDLA 1HJ8A 3RXEA 2FLRH 3EYDA 4BAKB 5IYTA 1ZHRA 1AKSA 1MBMA 5EQRA 2QXGA 4MNVA 2D26C 2WYGA 1CA0C 2R9PA 5LPFA 1HGTH 3HATH 1SLVB 1OSSA 4YT6H 1CQQA 1SLUB 3OY6U 2QYIA 1MZAA 2CF8H 4AORA 1PQ8A 2UUFB 2AGEX 1TX8A 3E90B 2D1JA 1DWBH 1YPEH 2OUAA 1MTNC 4GHQA 1VITF 3LGIA 3ODFA 1E36B 3GY8A 1TPSA 3IWMA 4HZHA 2FXRA 2XBYA 3SZNA 5DG6A 1KXEA 5F03A 1TGNA 4YOIA 3BTFE 1T31A 2V3OH 5FX5A 1UJ1A 2OTVA 5E0HA 1NTPA 2HGTH 1BUIA 1AFQC 4K8BA 4B1TA 1Y5AT 2PKSC 4AG1A 1UTNA 4GCHG 4ZKNU 3PLKA 5A8ZA 1UVPA 2C8YB 1FY1A 1GBDA 3BEIB 2ZGXH 1GPZA 1OYQA 1LPGB 4AFUA 3V7TA 1FQ3A 3ZZBA 1KSNA 2FS9A 7GCHG 1P03A 2WPIS 5IDKA 4Y76A 2GCTB 2BOKA 1C5QA 1DY9A 5CE1A 4UEHH 2W26A 2C8XB 4JZ1A 5A8XA 1DE7H 1AI8H 4CRDA 3TK9A 2JETB 4JZDH 1HXEH 2FM2A 1GHXH 9LPRA 4IN2A 4OS1A 4Z6AH 4ZHLU 3M5MA 1O3FA 4NGAH 1TYNA 1OP8A 3LGUA 1MU8B 3QUMP 1O2UA 3MNCA 5EXNA 3SN8A 1NFXA 2Z6BD 2OINA 2ZFFH 1MCVA 1GVZA 1IQJA 2OXSA 3E8LA 1CT0E
chains in the Genus database with same CATH superfamily
8LPRA 1P06A 2H6MA 1BT7A 2G00A 1QHRB 6GCHF 3PYHA 1QQUA 3P95A 1LVMA 1W11U 1W7GH 1F92A 3TK5A 1C1MA 2FESH 3LC5A 4H6TA 3E16B 1PPGE 1PPEE 1MTNB 2PKAB 2VIDA 1TGSZ 2SFAA 4ZAEA 3TPIZ 1DXWA 1E35B 3KQEA 2QA9E 4JK6A 2YNAA 4UFDH 3ZVDA 4WY3A 2L74A 1AB9B 3RXBA 2QCYA 1ZZZA 5GNDA 1EAIA 1GDNA 3SJOA 2SNVA 3LH3A 2FODA 1QJ6B 5FAHA 3SV2H 4SGBE 2KM0A 4Z0KA 3M5OA 4FUCA 2W6ID 1AFQB 2FTMA 1P8VC 3GDVA 2GZ8A 3MH7A 1OWHA 2B9LA 4F55A 1LPZB 1O38A 1EFRD 4UD9H 3DSOA 1Y5UT 2C4FH 4Y7BA 1KXCA 2J95A 1L4DA 1B0FA 2QY0B 5HM2A 2HVXA 1Y3YA 3BIVH 1VKYA 1XM1A 4X2WA 1A0LA 2AGIX 1QA0A 4X8UH 2J2UA 2OD3B 4CBOA 3VB7A 1GHZA 3ENSB 5C2ZA 1O2RA 5A0BA 1P2OA 2I6QA 5I46H 3PTNA 4XE4A 3UR6A 2ZDKA 3K9XB 2Y5HA 2EQNA 2GDDA 2F9BH 4IC5A 4DGJA 3UIRA 2OC7A 1F0UA 1YCPH 1K0HA 2GMTB 1TX6A 1AWHB 1EKBB 1GI9B 3F9GA 4MDSA 3RMLH 3ATIA 1DY8A 1C2EA 1TPPA 1SMFE 1HRTH 2J9NA 4FU7A 4THNH 1QR3E 1GMHF 1SFIA 1G9IE 2NU2E 5GJ4B 1OS8A 3MMGA 2VJ1A 1RS0A 5DGJA 2KX4A 4BAHB 1IQMA 1FAKH 1TPOA 2ODQA 4X8SH 1VR1H 1W12U 3FOAA 3RXFA 3ZZCA 7LPRA 1UTJA 4RI0A 1AO5A 4RT1A 5DP5A 5E2PA 3U98H 1H4WA 1TBZH 1SHHB 1ZPCA 2AMQA 3SNBA 4BTTB 1TMBH 1PFXC 1EXFA 2ZWLH 1P12E 2BQ6B 3BEUA 1QA7A 3SGQE 4NA7A 5GPIB 1CT2E 1FIWA 4NIXA 3DA9B 2EEKA 3MO6A 3RXGA 1MAYA 2V35A 3RXUA 2P94A 2XYAA 2F9UA 2J92A 2ZDVH 1GCDA 1O33A 2A0QB 4Q2KA 1G32B 3ZZDA 1O2OA 3GS9A 3SBKA 1EJAA 3KNXA 4D8NA 1ZHMA 5DSFA 1UW7A 2XWAA 2A4RA 3O8DA 5C0TA 4WMDA 2BD5A 1QBNA 2BD7A 1C1WH 2Q6FA 1P0SH 5A2MH 1Y8TA 3Q3XA 4WWYA 2IOTA 5AFYH 3M5NA 1XUIA 1FN8A 1B5GH 1C2KA 1BOQA 4WXVA 1TX7A 1YPHE 2L6OA 1O2GH 1HBTH 2EI6A 3B9FH 3GY4A 3TH3H 5DO4H 4MPWA 3UNQA 3LDXH 1UK2A 2XBVA 3P6ZB 1JOUB 3LONA 1HJ9A 1N8OC 3S0NA 2RA3A 2ZDMA 2XWBI 1QQ4A 1LMWB 2AEIH 1O32A 2FOMB 2Y7ZA 1T8MA 2HLCA 3BF6H 1ELCA 2RDEA 2Y5GA 1OWDA 2QN5T 4I8GA 3GY2A 2FIRH 1ZRKA 2WPMS 2OBOA 4IC6A 1GBAA 2P59A 1WYKA 2CHAC 2P16A 1O31A 4TY6A 2Z9KA 1IHTH 1IQLA 1TMTH 3ELAH 4AYVB 3EA9A 1NFUA 1P2NA 1TFXA 4XD7D 5A8YA 1G2MA 1GDUA 3A87A 1EJNA 3RXSA 1CHOG 2F9PA 1BITA 2GVFA 5DP6A 5EQSA 4OS5A 1C9PA 4TY7A 2R2WU 1O3KA 1MD8A 4IGDA 3Q00A 4X6MA 1ESBA 2FTLE 1C5RA 1VZQH 5C3NA 1OX1A 2PUQH 4O03A 4Y79A 1IHSH 5C1XA 2WPLS 3UWIA 4FUHA 1TGTA 2A7HA 1A7SA 1A0JA 2BQ7B 1OOKB 3KQCA 1E34B 1F5RA 1YBWA 1YLDA 4ASUD 3MNXA 2V3MA 4HFPB 2D8WA 5J4QA 2ASUB 2IJOB 2G8TA 2OC8A 5DP3A 5LH8A 2BYAX 4MPVA 2ZHDA 1DS2E 3U69H 3URCA 2HRVA 5FPTA 5JB8S 1G36A 1GMCF 3A85A 2XC4A 1N1LA 3SUFA 3OYPA 3GCHC 5FCKA 5F8XA 3TJNA 3ZVFA 2QC2A 5K7RA 2FYQA 4GCHF 4GLYA 1MQ6A 4NFEA 1D6RA 2PLXA 4P00A 3U1JB 3TJVA 1S6FA 1WDIA 4A1TA 1O2MA 2ODPA 2ZNKH 2VWLA 4MNXA 1Q3XA 3O8RA 1YCPM 1MH0A 1J8AA 2QAAA 3C27B 1TE0A 4JYTA 4YM9A 3MTYA 2H2ZA 5I25A 2K1QA 2Q1JA 5DP4A 4KTCA 2ZHWH 2Z9JA 1K28D 3GOVB 3FFGA 4OGXA 1TWXB 3GCNA 2F9NA 1UCYH 2O8LA 1ZYOA 3DD2H 4UFEH 1KTTB 2GP9B 2TRMA 4FUJA 5EXMA 1CO7E 1GI2A 4AFZA 1IQGA 4VGCC 1LCYA 1MABB 2PW8H 3MNSA 3M3TA 3VEQB 2AGGX 1J16A 4B73A 2BXUH 1SG8B 3QO6A 2BVSH 2YOLA 3M37A 3MU8A 3VB5A 1GBMA 4YT7H 5CMXH 1YWUA 2TBSA 1A2CH 2BVRH 2FPZA 3DUXH 4I8KA 1THPB 2J98A 4YXWD 5DKMA 3MU0A 2AHME 1BBRK 2G5NA 4K1TA 4LOYH 5FX6A 1SGEE 2IJD1 2BDYA 4ISLA 1GI4A 1G3EA 2GCHG 1BHXB 2CK3D 1EP5A 5A0CA 1KXDA 2ZPRA 3GCHB 2FOHA 1THSH 2Z3DA 1LVBA 2QXIA 3ZZ5A 1H8HD 1P02A 5DN6D 1BJVA 2ESTE 3H5CB 3UTUH 2BM2A 1V2KT 1ZHPA 4NWLA 1P3EA 1O2WA 2WPJS 3V13A 1ETSH 3ZVGA 1YLNA 2FOAA 2OCVB 1TPAE 1PPFE 2SGFE 1QNJA 1TBRH 4I86A 1GMDF 1AHTH 1V2VT 3M7QA 1BQYA 3P8OA 5H4IB 1AWFH 4BAOB 2C93B 5HYOA 1SOZA 3MNBA 1LHFH 2ANWA 2PP6A 1K22H 1OKXA 3OU0A 3KGPA 3ATKA 2OLGA 1QB6A 1L4ZA 2ZCLP 3SHAH 5SGAE 4A1XA 1H8ED 2PKAA 4X1PU 6ESTA 2O8MA 3OAAD 1WTHD 5FPYA 4BXWA 2FOEA 1P11E 2JJ2D 1XUFA 1GBTA 2BDBA 3GDSA 3UNSA 1NZQH 3BTHE 3LGYA 3PO1C 1ANCA 3RXLA 3PV4A 2A2XH 2BLVA 1GJ4H 1NS3A 1TIOA 2ZFQH 2QF0A 4VGCB 4DIIH 2KFWA 3SOSA 1YYY1 4TPYA 1ZSJA 4I7YH 2ZI2H 1C5TA 1PPZA 1EASA 1TALA 3NK8A 3RLWH 2CN0H 4CRFA 2RFKC 1XUKA 4CH2B 1C5NH 3SZEA 2H9HA 8GCHG 2A7CA 1MTUA 4CHAB 1C9TA 1RIWC 4U2WA 3KQ5A 2R3UA 4D9QA 3SQHE 2NU0E 4MPUA 2G4UA 4X0WU 3I77A 4H4FA 4XFQA 3RXRA 3FN8A 1YLCA 3WW7A 1F0TA 2ZHQH 1V3XA 1C5SA 4D7FA 1TNIA 3K6ZA 2K0QA 1T8NA 1C5UA 1ESTA 1GJCB 2ZCHP 1C2HA 2HALA 1WXRA 4R8TB 3LU9B 2OP9A 1SQAA 1HV7A 1W0YH 2TGDA 3EE0B 1T8LA 1E38B 5L2YH 2FZZA 1Y3XA 3NZIA 3O8CA 2TGPZ 7ESTE 1D4PB 2BY8X 1C1VH 1L1NA 2SNWA 1Y3VA 3ZZ8A 1EAXA 2H1UA 1N6YA 3F1SB 1SGFG 4Y71A 1XMNB 3S9CA 3EAJA 2ZHFH 2FI3E 4GSOA 3SV8A 3RXCA 2XRCA 3SGAE 1FY3A 4WXIA 5BPEA 3RXTA 1SLXB 1TQ0B 2K8IA 2BX4A 2VIOA 5CHBA 1C5VA 4UE7H 3H09A 3SU0A 3A8CA 4XBBA 1ZTLA 1A5IA 3GY7A 1NESE 1VCQA 4CBNA 1SGRE 2P93A 3KIDU 4CREA 1O2XA 1GWAA 4DVAU 4TYDA 3U8TH 4X1QU 4X1NU 1LVOA 3ZZ9A 4NIYA 1QJ7B 3TGIE 1V2NT 1O3JA 4KP0A 2BDCA 5L6NH 4ZROA 2ZG0H 4M9FA 3EA8A 1FV9A 2ZO3H 2F9OA 4B6EA 1C5WB 1ORFA 2EI7A 4CRBA 2ALPA 3P92A 3PO1B 5HGGA 1OXGA 2XXLA 4ZKOU 5E2OA 1KMHB 3Q3KA 1GBFA 3SJIA 4BAMB 1V2RT 3TH2H 1MMJN 1ANDA 4ABFA 2W7UA 1CHOF 1RTFB 1MTSA 1AUTC 3RMNH 1WAYB 2PTCE 1EAUA 1E0FD 2F83A 3A8AA 5C5OA 3BG8A 4BTIB 1DICA 1GCTC 1A3BH 1H9LB 3A7WA 2SGEE 1TGBA 1OPHB 5ESBA 1H8IH 2R2MB 1O3NA 1YPMH 4DIHH 1FY8E 1S6LA 2VNTA 5FPSA 5JYIA 3BTKE 3G01A 1B0EA 3S7KB 5EQQA 3GCTG 2ZFPH 1SQTA 3ATLA 4X2XA 3UUZA 3NCLA 1WU1A 2Y7XA 2QF3A 2DE9A 1ELFA 2G55A 3LGTA 5JBAS 3U9AH 1IQFA 1C1UH 3DHKH 4NCYA 4F4OC 2W3KA 5A0AE 1SI5H 3UOPA 3T62A 1OWEA 3TGKE 1UK4A 2CV3A 3Q77A 3T2NA 1BTPA 5HKKD 5C1YA 1GBLA 1EZXC 4K69A 1L1JA 1O3PB 1SGQE 1F7ZA 1HUTH 2ZP0H 1L1GA 1HJAC 4WJG2 1MKWK 1W13U 1Z7KA 1D9IA 4NZQA 1DPOA 1VCWA 2BDGA 2GX4A 1C4Y2 2OK5A 1S84A 3H7OA 3BTQE 4DT4A 2KZ4A 4IW4E 2VU8E 2JH0D 1EP6A 1V2WT 1ZLRA 2Z9IA 2WV4A 2ALVA 3LJJA 1MQ5A 1YPGH 5C5NA 4BNRA 3EGKH 3I78A 1C1RA 4K3JA 4XOJA 1UO6A 2A31A 1ELTA 3D49H 3AAUA 2FP7B 1P9SA 1C5OH 5E0JA 1ARCA 4ZCNA 5DK1A 4P02A 1W10U 1PYTC 2VWMA 1GBBA 3VGCB 1HIAB 1JMOH 2Z7FE 1UCYE 1A5HA 3MO3A 1W0ZU 2NU1E 3SU5A 4Y8YA 3DT0H 3L33A 3A83A 2TIOA 4DOQA 1C5XB 1HAIH 3WY8A 1CA0B 3A82A 1FXYA 2ZKSA 3S9BA 1QRXA 2PTNA 3GY5A 1J9CH 4HG6A 1UVUH 4IN1A 4TPIZ 4GHTA 1SGPE 3TITA 2BVXH 1GGDC 4ISIH 1OP0A 3RXKA 3VB6A 3A7TA 2A5AA 3F9HA 1DSTA 2FX4A 1V2OT 2C8ZB 1C1SA 4NSYA 1GJAB 1Z1JA 1WQVH 3SUDA 1P04A 1ELEE 3PB1E 2BD9A 1EATA 3KYGA 4DY7B 3U1IB 1AE5A 3LH1A 3EQ0H 3RP2A 1AN1E 2PSYA 3H7TA 2AMPA 1XUGA 1NU7B 1LO6A 1SGNE 1TNKA 2FYRA 1B7XB 2LP6A 2PKSB 4CRAA 1D3TB 1O3DA 3SUGA 3V3MA 1BHXF 2OC0A 1C5MD 1EPTC 3QTVH 1GI3A 2RDLA 1ZTJA 1O5GH 2D2DA 2H9EH 2V6NA 4KTSA 2V3HH 1VJAU 2AS9A 2PUXB 4B76A 4A1VA 2QIQA 2CJIA 3T29A 1C2LA 1ZJKA 1ZPBA 4AC9A 4U30A 1PPBH 1D3DB 1CSOE 2UWPA 2XNIA 8KME2 1GVKB 1K2I1 2J97A 5C94A 1FY4A 1PPCE 1A0HB 1GHBF 2THFB 1DANH 1Z6EA 5AFZH 4E06H 1KDQB 4FOUC 1G3CA 5JB9S 3BG4C 4OS2A 4Y6DA 3F3BA 3NWUA 2XCNA 2Z3EA 5DP7A 3D62A 3KN2A 1C1NA 1DDJA 2HPPH 2WPDD 3RLYH 2UUKB 4MNYA 2VIPA 3M61U 2KCYA 3PMAB 2ZGBH 2VIVA 2PSXA 2BLOA 1U6QA 4FUDA 4A92A 4FUEA 2P95A 4H6SB 1TOMH 1GBKA 5GCHF 2XC5A 3GY6A 4MLFB 1GGDB 2HNTF 2SGQE 4A7IB 4AG2A 1FX0B 4Y8ZA 3RMOH 2WPKS 3NXPA 1NROH 2HLDD 3SU4A 1RRKA 1GHYH 2SGDE 1BMLA 4RT0A 2OQUA 3M36A 1G30B 1FIZA 8GCHF 1K1NA 2PGQB 1MCTA 1WQSA 4K1SA 5DP9A 2AIPA 2ZU5A 1GHAG 3SYJA 3A8BA 4IMZA 4WVPE 1G3DA 1O3HA 4XBCA 1ZSLA 4NIVA 1Y59T 2CGAA 1EB2A 3PMBB 3U28C 3W1EA 2GV6A 1EPTB 1AKSB 1RJXB 5EW2H 4O3TA 1ABIH 4ISHH 2YNBA 1LHGH 2BOHB 1P3CA 3PLBA 2ZU4A 5AVDA 1NFWA 1LKAA 1VGCC 3LPRA 5C0UA 1UTKA 3BTTE 3RXJA 1DSUA 3M3SA 2BB4A 3OX7U 4UFGH 2FI4E 5F8ZA 3CENA 4ZXXH 3W94A 3WWFA 2WV5A 6LPRA 1SKYE 3AW0A 1OWIA 2BD3A 1O3OA 2R0KA 1EX3A 2BD8A 3A7VA 1CHGA 2JKHA 4JZFH 2ZZUH 4NIWA 1XVOA 2W3IA 4Q7XA 1ZMNA 1O3LA 1C5ZB 1FPHH 1S5SA 2A32A 1MTWA 1HB0B 3BN9A 3FP6E 4AFQA 2G51A 3BG4B 1V2LT 3SJ8A 1NRNH 4ISNA 1LQEA 2O8TA 3TU7H 4Q63A 5C20A 3I29A 2JH5D 3RU4E 3U8RH 4K5ZA 5EIYA 2GZ9A 1DWEH 3A89A 2C8WB 1FPCH 2IPHA 1PQ5A 1GJ6A 1ZPZA 1MKXK 1YPLH 4HI3A 4ZKSU 3ZZ6A 2BY9X 2Z3CA 1FMGA 4ASHA 2V0BA 2AFQB 1SQOA 2WV9A 1ZJDA 2JIZD 3LKWA 1TA2A 3SV7A 4Y0ZE 1XXDA 2VVCA 5KEDA 3PV5A 3SU1A 5FBEA 3SU3A 1FUJA 1D3PB 1LHEH 2YMSC 1NRSH 5GDSH 2ZTYA 2O8WA 1GG6C 4ZUHA 3ZVCA 2HPQH 3LT3A 2WPHS 1YC0A 3B23B 4MG3A 4NA8A 3CP7A 1E79D 1MD7A 4J1YA 1KLJH 1WOFA 4X8TH 3PWCA 3BEFB 1UHBA 2TPIZ 3BV9B 3GCTF 4JZIA 1H9HE 1TONA 5TJXA 5F8TA 3QDZB 1ETTH 1N6XA 2QF4A 3KF2A 3UNRA 1A3EH 3GYLB 3E0PB 4X6PA 2BQWB 3PTBA 2VH6A 4LZ1H 2B8OH 5T1VA 3FO8D 2GT7A 1JBUH 1ELVA 4FU8A 2OQ5A 1A46H 1DLKB 2EA3A 4Z1MD 4X1RU 4A5TS 1BA8B 3GYMA 1VGCB 5EODA 1BDAA 1F0SA 3DFJA 3TJOA 1ZMJA 2W5EA 4AZ2B 1NN6A 4YZUA 1HAVB 3RXMA 3VFEA 7GCHF 3VB3A 3CS7A 1N8OB 4B2CA 1V2PT 2HOBA 2LNCA 3M7UA 2RA0A 1V2UT 4YO9A 2J38A 5C1UA 1D6WA 1SHYA 2WINI 3F6UH 3T25A 2TGAA 5ETXA 2GD4B 1GHVH 2W6JD 1GHWH 3SW2B 2CHAB 3RU4T 1EZSC 2LPRA 1FDPA 3UB0A 3FANA 1QBOA 1KYNA 1TGCA 2ZGJA 3K6YA 3ZZ7A 1LQDB 3UQOA 3FP8E 5EJ1A 1ACBE 1O5AB 3MH5A 1ELBA 4ZHAA 1YPKH 2FS8A 4X2VA 1O2NA 1JIMA 5JPMH 4F49A 1GG6B 2UUYA 1GI7B 2FOGA 1P2QA 3LOXA 4Q4LA 2IPQX 1F5LA 3AAVA 2ANKH 3W95A 1C5PA 6GCHG 4RKJB 1AFEH 1CGHA 1TBQH 7KMEH 1LPKB 4NA9H 5AHGH 4TWWA 1K1PA 5HMAA 3SI3H 2CMYA 3UREA 1BZXE 1S82A 3N7OA 3STJA 2A5IA 1P10A 3V0XA 4UONA 1LHCH 1C5LH 4ESTE 1WUNH 3BSQA 2ZPSA 3P70B 4B74A 1YPJH 4JZEH 4JYUH 3N7DA 1FLEE 2FDAA 4UFFH 1INCA 1NU9A 1THRH 5EW1H 2Z9LA 4K8YA 1PYTD 1W2KH 1HIAA 1NRQH 1S81A 3CS0A 4Y8XA 3SV9A 3TJUA 3P17H 1NBME 1T7CA 1Q2WA 2GZ7A 4KKDA 1NT1A 1QL7A 1BTWA 4I31A 2AIQA 3KEEA 3LGVA 4U32A 2PGBB 1W0KD 2G81E 1BRCE 3LC3A 5K0HA 2Y5FA 1HAHH 3GDUA 2H5DA 9ESTA 4ZXYH 1YY3A 3S69A 1HAZB 4BANB 3LJOA 1UVTH 3A7ZA 3QK1A 1UMAH 1HPGA 4H42U 1ELDE 1NRRH 2WUCA 2F9VA 4FUFA 2C3SA 5ABWA 2XCFA 1QL8A 2BDHA 4BAQB 4LXBH 3ZVEA 1BRUP 1SGCA 1DM4B 2ZQ2A 4XBDA 3SO3A 1ID5H 1QGFA 3KYFA 5E8EH 3HK3B 5G4BA 5JBTA 3K2UA 3A7XA 1G3BA 2QXHA 1ZR0A 5T3HA 2BLWA 1AE8H 3M3VA 1GMHG 5BRRE 1AUJA 1GBJA 1RXPA 1ZTKA 2WZQA 2A4GA 1HLTH 2ILNA 1AGJA 1BBRH 2ZCKP 4OS7A 1E1RD 2EI8A 5J4SA 1AVWA 3QGJA 4SGAE 3RU4D 3TNSA 4Q80A 3SNEA 4ABIA 1O3GA 2NU3E 5GXPA 3A84A 2J5UA 3D23A 1AVXA 2O8UA 4ZKRU 1ANEA 1WBGB 1SGYE 2UUJB 3M35A 1M9UA 4MTBA 4O3UA 3UWJH 1KLIH 3GICB 4I8JA 1Z8RA 3AW1A 1XVMA 5HIZA 1EUFA 1QCPA 3ITIA 2FX6A 4A6LA 1AMHA 1GL1A 4FUGA 4Y7AA 4B2AA 4NFFA 3B8JA 1Z71A 1O2LA 1GVLA 3DSGA 4I32A 1O5FH 3E3TA 2BLQA 2ODYB 2VWNA 2VINA 2Z94A 4YOGA 4LK4A 4ABEA 2TGTA 2VH0A 3UFAA 1IQEA 1CBWC 1SLWB 3MH6A 2Q6GA 2BY5X 3PWBA 4D76A 5DPAA 1G37A 1KIGH 1T32A 1QRWA 1UTLM 4K60A 3PMHB 1VCPA 3UR9A 1C1QA 2FO9A 1W7XH 2B5TB 2QF5A 1FY5A 3A81A 2JETC 3ZZ4A 4AFSA 4YESB 3S9AA 5TCCA 1NC6A 3RDZA 3TIUA 3M7TA 4NSVA 4E7NA 1BB0B 4GUXA 2ZFRH 3VG8A 3HK6B 1X7AC 2WHXA 3E6PH 2BZAA 3FAOA 1EPTA 1RD3B 4I8HA 1H1BA 4GAWA 4JCNA 2R3YA 2ZEBA 1RIWB 5EJZA 3SU2A 1TNGA 1J15A 5HXFA 3F2GA 2Y6TA 3SU6A 1ZOMA 1AZ8A 3ZIAD 5JBCS 1C1OA 1Z1IA 2GTBA 1IQHA 2A2QH 3UQVA 3QWCH 4B71A 4KGAA 4B75A 4INLA 1FAXA 1EQ9A 1L0ZA 1SC8U 2LELA 1OP2A 3F68H 4NWKA 4ABBA 3T28A 1AB9C 1K1OA 2VVVA 5T6FA 2A5KA 4XDEA 3A8DA 1O3IA 2Y80A 1CVWH 1C4V2 1GMCG 4M7GA 1O2SA 1TAWA 4WH6A 3FZZA 3SNAA 6CHAC 1P05A 3SJ9A 1VITH 3PLPA 2PR3A 1IQNA 3QX5H 4JK5A 3SHCH 1G2LA 3PM3A 1ARBA 1CT4E 1TB6H 1O2JA 1SSXA 3RMMH 4BTUB 5HIYA 1E1QD 1ELGA 1C2DA 4O97A 3OY5U 1CBWB 3L6PA 1KXAA 5B6OA 2OBQA 2WUBA 1SGDE 2J98B 1TNLA 2FOCA 1TRMA 1A1RA 3Q76A 1MZDA 4INHA 1ABJH 1O2QA 1TABE 3VB4A 4TT3D 2PV9B 2ZF0H 1EB1H 1FJSA 2HWLB 5E0GA 2BZ6H 1O2KA 2P8OC 1BRAA 1GI1A 1W0JD 1O39A 3E0NB 1QB9A 4HTCH 2BY7X 3SUEA 1FZZA 3TNTA 2GMTC 2XW9A 1HAYB 1W14U 1IAUA 2RG3A 4F48B 2FMJA 1P01A 1ANBA 4RSPA 1YCPK 4IMQA 1PQAA 1DXPA 3SORA 1O2PA 2GGVB 1GCTB 1Z8GA 3V12A 3QLPH 1CU1A 4XSKU 3ODDA 3RC5A 1P2MA 2WSSD 2Y82A 3N99A 4X2YA 3WWBA 2F43B 4J2YB 1O5BB 2BXTH 4DURA 4ACAA 3BTWE 3KHVA 1DITH 4Y11E 1HDTH 2VVUA 1HAVA 2XBXA 5T6GA 4NG9H 4GPGA 3N7EA 2A4QA 4K1EA 1QFKH 3PRDA 1JIRA 1JRTA 5LGOA 2EC9H 3FZDA 1H8DH 1WSSH 1V2JT 3MI4A 1GJ8B 1A61H 2A7JA 2ZTZA 1MKWH 1GBCA 2AH4X 2GCHF 1S0QA 2SGAA 1YPHC 2FOFA 1IQKA 3A86A 3UAIC 2J94A 1HJAB 1BTHH 1SGIB 1SL3A 1C2GA 3R0FA 1QTFA 1XXFA 6CHAB 3SNCA 2WYJA 3MH4A 3PROA 1ZMLA 1WCZA 4FUBA 1BTYA 1CGJE 2W7SA 5A09A 2KAIB 1HAPH 1AY6H 3E91A 1HYLA 1BTZA 2KCPA 3F2HA 3RC4A 3SJKA 3QTOH 3RUOA 1O0DH 1GMDG 3IITA 1NFYA 3TK6A 1XKBC 4AN7A 3BTEE 1GI8B 1V2ST 1XUJA 1O3CA 2F4LA 2VGCC 1OWJA 1QY6A 3DCLA 1C1TA 2VBCA 2ZU3A 3AVZA 3IG6B 4Q7ZA 4TSFD 2M5TA 4ABJA 2VIWA 2ZIQH 1F5KU 1O2TA 1LKBA 2P8OB 5CHAC 5PTPA 5EXLA 1DOJA 3MYWA 3ZZ3A 3DFLA 1V2MT 3KCGH 1QB1A 3MU4A 2RCEA 1CA8B 2ANMH 4CRGA 1T4UH 2GT8A 3HGPA 1DLEA 1AVGH 4AX9H 2FOBA 3MO9A 5EOKA 1LDTT 4FU9A 1NY22 4DW2U 1TRYA 4OGYA 1HNEE 3OSYA 1YF4A 1BBRE 4FXGH 5C17A 5F6MA 2ZPQA 1DUAA 2ULLA 5KGOA 1AU8A 3FP7E 4AGKA 1KTSB 3LGWA 1E37B 1SVPA 2XC0A 3SI4H 1O5DH 1RGQA 1A4WH 3ZZAA 4JYVH 1NPMA 4FVDA 3RM2H 1FNIA 2BD2A 1O30A 3RXPA 4LZ4B 5FBIA 1OHHD 4YLUA 2QGRA 3UPEA 3F2FA 4I8LA 2ZTXA 2KCAA 1K1JA 3SGBE 1FI8A 1BMFD 1K9OE 5FXLA 1GJ5H 4E05H 5HM9A 4BXSA 3MU5A 3E1XB 2BY6X 5LPEA 3RXAA 2ANYA 5EPYA 2B0FA 3Q3YA 1HXFH 4R0IA 3RXQA 3GCOA 4Y0YE 2ZU1A 1SGTA 1J14A 1C2JA 2FWWA 5EPNA 4AOQA 5EU8A 1MTVA 1K1LA 4ACBA 4DT7B 1A5GH 2ZC9H 1O37A 1UTQA 1C2MA 1SOTA 2PHBA 1DT2A 1HFDA 2VGCB 1KLTA 4XRNA 2STAE 1SPJA 1BTUA 3RXOA 1O2VA 1C5YB 4KTUA 4HGCA 2CF9H 2A45B 5L30H 5DP8A 4ZHMU 3EE7A 4I33A 1YKTA 5C67A 1P9UA 3MFJA 5F53A 5AF9H 4INKA 1TMUH 3F0OA 1O2IA 5CHAB 1MBQA 1GBEA 4IBLH 1GJ9B 4YTAA 5L2ZH 1O36A 3FKSD 1ZSKA 1ETRH 4X1SU 1UCYK 4YOJA 4MQAA 1GJ7B 3P8NA 2GDEH 2G52A 1GI0A 4PROA 4AYYB 1JRSA 3PV2A 4BOHA 1EOLA 1O2HA 1SGFA 3BTGE 3AASA 1EZUC 1SR5C 2G4TA 3OTJE 1VITG 2FI5E 4AB9A 3ZV8A 1LTOA 1NO9H 2A4OA 1UVOA 1S85A 1NRPH 1SQRA 2BDIA 1SB1H 1PQ7A 1BMMH 1O2YA 1V2QT 1T4VH 2ZDNA 4X8VH 1C1PA 4JMYA 1HAXB 1DWDH 1MU6B 5EGMA 1IQIA 2P3FH 3HPTB 3C1KA 3A7YA 1K21H 1S6HA 4NZLA 1EOJA 1Z8IB 3KQDA 4B2BA 4DCDA 4CR9A 3SQEE 3ZVAA 1RTKA 3KQBA 3CNRA 3P8GA 2NU4E 1BTXA 1Y3WA 4QT8C 1GBHA 8ESTE 1GI6A 3OEED 3QZQA 2VWOA 3D65E 2H5CA 3JZ2B 5LPRA 3HGNA 2VB0A 1GJDB 1JWTA 1K1MA 1QL9A 3TGJE 1Z8JB 2ZHEH 1SFQB 4X6OA 1ZRBA 1TQ7B 1QZ8A 1UTPA 3TH4H 1MKXH 2XTTB 1ZGIA 2BD4A 1TNHA 1TA6A 2XOKD 1P2KA 1V2TT 4RKOB 1HAOH 4FUIA 1GL0E 4OM9A 3RC6A 1QBVH 5T6DA 4KELA 3M5LA 2GJGA 5JBBS 3P8FA 1XKAC 1S0RA 2PFEA 1BJUA 1ZGVA 2YMSB 2Q6DA 2ZQ1A 2F91A 1UVSH 3OFND 2BHGA 4DJZB 3URDA 1F2SE 2FEQH 3UOUA 4WMFA 1GI5A 3ESTA 2ZGCA 1C2FA 3RXIA 3MU1A 1QURH 1Z6JH 4MVNA 2JH6D 3KL6A 1ELAA 1Q31A 1BRBE 4ABHA 1DWCH 2HNTC 4U01A 2J34A 3T5FH 2ZDAH 4ABAA 1TLDA 1FN6A 1TRNA 4CHAC 4YLQH 2ZFTA 4FVBA 3F9FA 2ZFSA 3PMJA 4ZH8A 1O3EA 2DE8A 1MUEB 2J4IA 2BTCE 1LVYA 2ZECA 1C2IA 1F0RA 3BTME 1VJ9U 3NPSA 3T27A 4D9RA 1L2EA 2CXVA 1AIXH 1AZZA 1YGCH 1JXPA 2C90B 4Y10E 3ZVBA 4MNWA 1OYTH 4O9VA 3SNDA 3A88A 2BMGB 3OE7D 3HKIB 1K1IA 5DJ7A 3MWIU 1Y3UA 3NUMA 2GV7A 2ZGHA 3QZRA 5JDUB 1KXBA 2DUCA 1OWKA 1RFNA 1DUEA 3ATMA 3UY9A 1IOEA 1FONA 3PRBA 2STBE 2Y81A 1O5EH 3JZ1B 4AB8A 1RTLA 2BDAA 1EJMA 4CH8B 3OTPA 1V6DA 5FCRA 2B7DH 3ZYDA 3BTDE 2UWOA 4CRCA 1UTMA 3GY3A 5GIBA 1KY9A 4ZMAH 4K2YA 1O35A 2H9TH 3VXFH 3MQKC 1SBWA 3ZYEA 2I6SA 2PWXA 1GDQA 4ABGA 4CR5A 1GHBG 1MAXA 1PJPA 4WH8A 2QV1A 1O2ZA 2HVYB 1J17T 1H9IE 5EG4A 1KXFA 3ZV9A 1HAGE 4OS6A 3VXEH 4IS5A 1HCGA 1DVAH 1O3BA 2QXJA 1GJBB 1Y5BT 3QGNB 2F3CE 1XX9A 4X6NA 1DX5M 5FHTA 3RXVA 3MHWU 1O3MA 1UTOA 3FVFB 4E7RG 1XUHA 1QIXB 4WMEA 3RM0H 2NWNA 3TVJB 3K65B 1EAWA 2QE7D 1O3AA 1CE5A 2UWLA 5TCAA 5GCHG 2P3UB 1QRZA 1UK3A 1W8BH 1P2IA 3VPKA 3EA7A 3EDXB 5B6LA 1P2JA 1AD8H 1D3QB 1BMNH 2ZU2A 4DG4A 4UDWH 4RN6A 1KDQA 2KAIA 1CGIE 3NKKA 3O8BA 4OS4A 1GHAF 1YM0A 2Z9GA 3BIUH 1BIOA 3T26A 3RXDA 2V7QD 4ABDA 5ESTE 4Q7YA 1QJ1B 1O34A 2R0LA 2XBWA 1YP9A 1W3CA 2P3TB 1O5CB 1C4U2 1AQ7A 1BMAA 2AMDA 1DFPA 1WV7H 2HNTE 2BX3A 3L3TA 1PPHE 3RXHA 3SV6A 4AGJA 4D7GA 3OEHD 1S83A 2FLBH 1EZQA 2OC1A 2G5VA 2O9QA 1LHDH 3U8OH 2IN2A 1WTGH 3R3GB 4ISOA 2VIQA 2ZA5A 3S7HB 1BCUH 2SGPE 2EY4C 3F9EA 3QN7A 4WF8A 2GKVE 1P09A 1NM6A 1P57B 1T8OA 3ATWA 2GCTC 3LIWA 2JDID 4GVUA 3GISB 2A1DB 3TLOA 1TNJA 5KECA 2AERH 3MOCA 1UHBB 4MPXA 1GBIA 1TOCB 5GWZA 1ESAA 3DSPA 3A80A 4TWYA 3STIA 3VGCC 2AYWA 4FETA 3HKJB 2ZDLA 1HJ8A 3RXEA 2KCOA 2FLRH 5CDFE 3EYDA 4BAKB 5IYTA 1ZHRA 1AKSA 1MBMA 5EQRA 2QXGA 4MNVA 2D26C 2WYGA 1CA0C 2R9PA 5LPFA 1HGTH 3HATH 1SLVB 1OSSA 4YT6H 2M2AA 3AK5A 1CQQA 2XNDD 1SLUB 3OY6U 2QYIA 1MZAA 2CF8H 4AORA 1PQ8A 2UUFB 2AGEX 1TX8A 3E90B 2D1JA 1DWBH 1YPEH 2OUAA 1MTNC 4GHQA 1VITF 3LGIA 3ODFA 1E36B 3GY8A 1TPSA 5IK2D 5FL7D 5EJLA 3IWMA 4HZHA 2FXRA 2XBYA 3SZNA 5DG6A 1KXEA 5F03A 1TGNA 4YOIA 3BTFE 1T31A 2V3OH 5FX5A 1UJ1A 2OTVA 5E0HA 1NTPA 2HGTH 1BUIA 1AFQC 4K8BA 4B1TA 1Y5AT 2JJ1D 2PKSC 4AG1A 1UTNA 2KR7A 4GCHG 4ZKNU 3PLKA 5A8ZA 3F0PA 1UVPA 2C8YB 1FY1A 1GBDA 3BEIB 4B6FA 2ZGXH 1GPZA 1OYQA 1LPGB 2YMSD 4AFUA 3V7TA 1FQ3A 3ZZBA 1KSNA 2FS9A 1COWD 1P03A 7GCHG 2WPIS 5IDKA 4Y76A 3NRLA 2GCTB 2BOKA 1C5QA 1DY9A 5CE1A 1NBMD 4UEHH 2W26A 2C8XB 4JZ1A 5A8XA 1DE7H 1AI8H 4CRDA 3TK9A 2JETB 4JZDH 1HXEH 2FM2A 1GHXH 9LPRA 4IN2A 4OS1A 4Z6AH 4ZHLU 3M5MA 1O3FA 4NGAH 1TYNA 1OP8A 3LGUA 1MU8B 3QUMP 1O2UA 3MNCA 5EXNA 3SN8A 1NFXA 2Z6BD 2OINA 2ZFFH 1MCVA 1GVZA 1IQJA 2OXSA 3E8LA 1CT0E
chains in the Genus database with same CATH topology
8LPRA 1P06A 2H6MA 1BT7A 2G00A 1QHRB 6GCHF 3PYHA 1QQUA 3P95A 1LVMA 1W11U 1W7GH 1F92A 3TK5A 1C1MA 2FESH 3LC5A 4H6TA 3E16B 1PPGE 1PPEE 1MTNB 2PKAB 2VIDA 1TGSZ 2SFAA 4ZAEA 3TPIZ 1DXWA 1E35B 3KQEA 2QA9E 4JK6A 2YNAA 4UFDH 3ZVDA 4WY3A 3RXBA 1AB9B 2QCYA 1ZZZA 1EAIA 1GDNA 3SJOA 2SNVA 3LH3A 2FODA 1QJ6B 5FAHA 3SV2H 4SGBE 4Z0KA 3M5OA 4FUCA 1AFQB 2FTMA 1P8VC 3GDVA 2GZ8A 3MH7A 1OWHA 2B9LA 1LPZB 1O38A 4UD9H 1Y5UT 2C4FH 4Y7BA 1KXCA 2J95A 1L4DA 1B0FA 2QY0B 5HM2A 2HVXA 1Y3YA 3BIVH 1XM1A 4X2WA 1A0LA 2AGIX 1QA0A 4X8UH 2J2UA 2OD3B 4CBOA 3VB7A 1GHZA 3ENSB 5C2ZA 1O2RA 5A0BA 1P2OA 2I6QA 5I46H 3PTNA 4XE4A 3UR6A 2ZDKA 3K9XB 2Y5HA 2GDDA 2F9BH 4IC5A 4DGJA 3UIRA 2OC7A 1F0UA 1YCPH 2GMTB 1TX6A 1AWHB 1EKBB 1GI9B 3F9GA 4MDSA 3RMLH 3ATIA 1DY8A 1C2EA 1TPPA 1SMFE 1HRTH 2J9NA 4FU7A 4THNH 1QR3E 1GMHF 1SFIA 1G9IE 2NU2E 5GJ4B 1OS8A 3MMGA 2VJ1A 1RS0A 5DGJA 4BAHB 1IQMA 1FAKH 1TPOA 2ODQA 4X8SH 1VR1H 1W12U 3RXFA 3ZZCA 7LPRA 1UTJA 1AO5A 5DP5A 5E2PA 3U98H 1H4WA 1TBZH 1SHHB 1ZPCA 2AMQA 3SNBA 4BTTB 1TMBH 1PFXC 1EXFA 2ZWLH 1P12E 2BQ6B 3BEUA 1QA7A 3SGQE 4NA7A 5GPIB 1CT2E 1FIWA 4NIXA 3DA9B 2EEKA 3MO6A 3RXGA 1MAYA 2V35A 3RXUA 2P94A 2XYAA 2F9UA 2J92A 2ZDVH 1GCDA 1O33A 2A0QB 4Q2KA 1G32B 3ZZDA 1O2OA 3SBKA 1EJAA 3KNXA 4D8NA 1ZHMA 2XWAA 2A4RA 3O8DA 4WMDA 2BD5A 1QBNA 2BD7A 1C1WH 2Q6FA 1P0SH 5A2MH 1Y8TA 3Q3XA 4WWYA 2IOTA 5AFYH 3M5NA 1XUIA 1FN8A 1B5GH 1C2KA 1BOQA 4WXVA 1TX7A 1YPHE 1O2GH 1HBTH 2EI6A 3B9FH 3GY4A 3TH3H 5DO4H 4MPWA 3UNQA 3LDXH 1UK2A 2XBVA 3P6ZB 1JOUB 3LONA 1HJ9A 1N8OC 3S0NA 2RA3A 2ZDMA 2XWBI 1QQ4A 1LMWB 2AEIH 1O32A 2FOMB 2Y7ZA 1T8MA 2HLCA 3BF6H 1ELCA 2Y5GA 1OWDA 2QN5T 4I8GA 3GY2A 2FIRH 1ZRKA 2WPMS 2OBOA 4IC6A 1GBAA 2P59A 1WYKA 2P16A 2CHAC 1O31A 4TY6A 2Z9KA 1IHTH 1IQLA 1TMTH 3ELAH 4AYVB 3EA9A 1NFUA 1P2NA 1TFXA 5A8YA 1G2MA 1GDUA 3A87A 1EJNA 3RXSA 1CHOG 2F9PA 1BITA 2GVFA 5DP6A 5EQSA 4OS5A 1C9PA 4TY7A 2R2WU 1O3KA 1MD8A 4IGDA 3Q00A 4X6MA 1ESBA 2FTLE 1C5RA 1VZQH 5C3NA 1OX1A 2PUQH 4O03A 4Y79A 1IHSH 5C1XA 2WPLS 3UWIA 4FUHA 1TGTA 2A7HA 1A7SA 1A0JA 2BQ7B 1OOKB 3KQCA 1E34B 1F5RA 1YBWA 1YLDA 3MNXA 4HFPB 2D8WA 5J4QA 2ASUB 2OC8A 2IJOB 2G8TA 5DP3A 5LH8A 2BYAX 4MPVA 2ZHDA 1DS2E 3U69H 3URCA 2HRVA 5FPTA 5JB8S 1G36A 1GMCF 3A85A 2XC4A 1N1LA 3SUFA 3OYPA 3GCHC 5FCKA 5F8XA 3TJNA 3ZVFA 2QC2A 5K7RA 2FYQA 4GCHF 4GLYA 1MQ6A 4NFEA 1D6RA 2PLXA 3U1JB 3TJVA 1S6FA 4A1TA 1O2MA 2ODPA 2ZNKH 2VWLA 4MNXA 1Q3XA 3O8RA 1YCPM 1MH0A 1J8AA 2QAAA 3C27B 1TE0A 4JYTA 4YM9A 3MTYA 2H2ZA 5I25A 2K1QA 2Q1JA 5DP4A 4KTCA 2ZHWH 2Z9JA 1K28D 3GOVB 3FFGA 4OGXA 1TWXB 3GCNA 2F9NA 1UCYH 2O8LA 1ZYOA 3DD2H 4UFEH 1KTTB 2GP9B 2TRMA 4FUJA 5EXMA 1CO7E 1GI2A 4AFZA 1IQGA 4VGCC 1LCYA 2PW8H 3MNSA 3M3TA 3VEQB 2AGGX 1J16A 4B73A 2BXUH 1SG8B 3QO6A 2BVSH 2YOLA 3M37A 3MU8A 3VB5A 1GBMA 4YT7H 5CMXH 2TBSA 1A2CH 2BVRH 2FPZA 3DUXH 4I8KA 1THPB 5DKMA 3MU0A 1BBRK 2G5NA 4K1TA 4LOYH 5FX6A 1SGEE 2BDYA 4ISLA 1GI4A 1G3EA 2GCHG 1BHXB 1EP5A 5A0CA 1KXDA 2ZPRA 3GCHB 2FOHA 1THSH 2Z3DA 1LVBA 2QXIA 3ZZ5A 1P02A 1BJVA 2ESTE 3H5CB 3UTUH 2BM2A 1V2KT 1ZHPA 4NWLA 1P3EA 1O2WA 2WPJS 3V13A 1ETSH 3ZVGA 2FOAA 2OCVB 1TPAE 1PPFE 2SGFE 1QNJA 1TBRH 1GMDF 1AHTH 1V2VT 3M7QA 1BQYA 3P8OA 5H4IB 1AWFH 4BAOB 2C93B 5HYOA 1SOZA 3MNBA 1LHFH 2ANWA 1K22H 1OKXA 3OU0A 3KGPA 3ATKA 2OLGA 1QB6A 1L4ZA 2ZCLP 3SHAH 5SGAE 4A1XA 2PKAA 4X1PU 6ESTA 2O8MA 1WTHD 5FPYA 4BXWA 2FOEA 1P11E 1XUFA 1GBTA 2BDBA 3GDSA 3UNSA 1NZQH 3BTHE 3LGYA 3PO1C 1ANCA 3RXLA 3PV4A 2A2XH 2BLVA 1GJ4H 1NS3A 1TIOA 2ZFQH 2QF0A 4VGCB 4DIIH 3SOSA 1YYY1 4TPYA 1ZSJA 4I7YH 2ZI2H 1C5TA 1PPZA 1EASA 1TALA 3NK8A 3RLWH 2CN0H 4CRFA 1XUKA 4CH2B 1C5NH 2H9HA 8GCHG 2A7CA 1MTUA 4CHAB 1C9TA 1RIWC 4U2WA 2R3UA 4D9QA 3SQHE 2NU0E 4MPUA 2G4UA 4X0WU 3I77A 4H4FA 4XFQA 3RXRA 1YLCA 1F0TA 2ZHQH 1V3XA 1C5SA 4D7FA 1TNIA 3K6ZA 1T8NA 1C5UA 1ESTA 1GJCB 2ZCHP 1C2HA 2HALA 4R8TB 3LU9B 2OP9A 1SQAA 1HV7A 1W0YH 2TGDA 3EE0B 1T8LA 1E38B 5L2YH 2FZZA 1Y3XA 3NZIA 3O8CA 2TGPZ 7ESTE 1D4PB 2BY8X 1C1VH 1L1NA 2SNWA 1Y3VA 3ZZ8A 1EAXA 2H1UA 1N6YA 3F1SB 1SGFG 4Y71A 1XMNB 3S9CA 3EAJA 2ZHFH 2FI3E 4GSOA 3SV8A 3RXCA 2XRCA 3SGAE 1FY3A 4WXIA 5BPEA 3RXTA 1SLXB 1TQ0B 2BX4A 2VIOA 1C5VA 4UE7H 3SU0A 3A8CA 4XBBA 1ZTLA 1A5IA 3GY7A 1NESE 1VCQA 4CBNA 1SGRE 2P93A 3KIDU 4CREA 1O2XA 1GWAA 4DVAU 4TYDA 3U8TH 4X1QU 4X1NU 1LVOA 3ZZ9A 4NIYA 1QJ7B 3TGIE 1V2NT 1O3JA 4KP0A 2BDCA 5L6NH 4ZROA 2ZG0H 3EA8A 1FV9A 2ZO3H 2F9OA 1C5WB 1ORFA 2EI7A 4CRBA 2ALPA 3P92A 3PO1B 5HGGA 1OXGA 2XXLA 4ZKOU 5E2OA 3Q3KA 1GBFA 3SJIA 4BAMB 1V2RT 3TH2H 1MMJN 1ANDA 4ABFA 2W7UA 1CHOF 1RTFB 1MTSA 1AUTC 3RMNH 1WAYB 2PTCE 1EAUA 1E0FD 2F83A 3A8AA 5C5OA 3BG8A 4BTIB 1DICA 1GCTC 1A3BH 1H9LB 3A7WA 2SGEE 1TGBA 1OPHB 5ESBA 1H8IH 2R2MB 1O3NA 1YPMH 4DIHH 1FY8E 2VNTA 5FPSA 5JYIA 3BTKE 3G01A 1B0EA 3S7KB 5EQQA 3GCTG 2ZFPH 1SQTA 3ATLA 4X2XA 3UUZA 3NCLA 1WU1A 2Y7XA 2QF3A 2DE9A 1ELFA 2G55A 3LGTA 5JBAS 3U9AH 1IQFA 1C1UH 3DHKH 4NCYA 4F4OC 2W3KA 5A0AE 1SI5H 3UOPA 3T62A 1OWEA 3TGKE 1UK4A 2CV3A 3Q77A 3T2NA 1BTPA 5C1YA 1GBLA 1EZXC 4K69A 1L1JA 1O3PB 1SGQE 1F7ZA 1HUTH 2ZP0H 1L1GA 1HJAC 4WJG2 1MKWK 1W13U 1Z7KA 1D9IA 4NZQA 1DPOA 1VCWA 2BDGA 2GX4A 1C4Y2 1S84A 3H7OA 3BTQE 4IW4E 2VU8E 2JH0D 1EP6A 1V2WT 1ZLRA 2Z9IA 2WV4A 2ALVA 3LJJA 1MQ5A 1YPGH 5C5NA 4BNRA 3EGKH 3I78A 1C1RA 4K3JA 4XOJA 1UO6A 2A31A 1ELTA 3D49H 3AAUA 2FP7B 1P9SA 1C5OH 5E0JA 1ARCA 5DK1A 1W10U 1PYTC 2VWMA 1GBBA 3VGCB 1HIAB 1JMOH 2Z7FE 1UCYE 1A5HA 3MO3A 1W0ZU 2NU1E 3SU5A 4Y8YA 3DT0H 3L33A 3A83A 2TIOA 4DOQA 1C5XB 1HAIH 3WY8A 1CA0B 3A82A 1FXYA 2ZKSA 3S9BA 1QRXA 2PTNA 3GY5A 1J9CH 1UVUH 4IN1A 4TPIZ 4GHTA 1SGPE 3TITA 2BVXH 1GGDC 4ISIH 1OP0A 3RXKA 3VB6A 3A7TA 2A5AA 3F9HA 1DSTA 2FX4A 1V2OT 2C8ZB 1C1SA 4NSYA 1GJAB 1Z1JA 1WQVH 3SUDA 1P04A 1ELEE 3PB1E 2BD9A 1EATA 4DY7B 3U1IB 1AE5A 3LH1A 3EQ0H 3RP2A 1AN1E 2PSYA 3H7TA 2AMPA 1XUGA 1NU7B 1LO6A 1SGNE 1TNKA 2FYRA 1B7XB 2PKSB 4CRAA 1D3TB 1O3DA 3SUGA 3V3MA 1BHXF 2OC0A 1C5MD 1EPTC 3QTVH 1GI3A 2RDLA 1ZTJA 1O5GH 2D2DA 2H9EH 2V6NA 4KTSA 2V3HH 1VJAU 2AS9A 2PUXB 4B76A 4A1VA 2QIQA 2CJIA 3T29A 1C2LA 1ZJKA 1ZPBA 4U30A 1PPBH 1D3DB 1CSOE 2UWPA 2XNIA 8KME2 1GVKB 1K2I1 1FY4A 1PPCE 1A0HB 1GHBF 2THFB 1DANH 1Z6EA 5AFZH 4E06H 1KDQB 1G3CA 5JB9S 3BG4C 4OS2A 4Y6DA 3NWUA 2XCNA 2Z3EA 5DP7A 3D62A 3KN2A 1C1NA 1DDJA 2HPPH 3RLYH 2UUKB 4MNYA 2VIPA 3M61U 3PMAB 2ZGBH 2VIVA 2PSXA 2BLOA 1U6QA 4FUDA 4A92A 4FUEA 2P95A 4H6SB 1TOMH 1GBKA 5GCHF 2XC5A 3GY6A 4MLFB 1GGDB 2HNTF 2SGQE 4A7IB 4AG2A 4Y8ZA 3RMOH 2WPKS 3NXPA 1NROH 3SU4A 1RRKA 1GHYH 2SGDE 1BMLA 2OQUA 3M36A 1G30B 1FIZA 8GCHF 1K1NA 2PGQB 1MCTA 1WQSA 4K1SA 5DP9A 2AIPA 2ZU5A 1GHAG 3A8BA 4IMZA 4WVPE 1G3DA 1O3HA 4XBCA 1ZSLA 4NIVA 1Y59T 2CGAA 1EB2A 3PMBB 2GV6A 1EPTB 1AKSB 1RJXB 5EW2H 4O3TA 1ABIH 4ISHH 2YNBA 1LHGH 2BOHB 1P3CA 3PLBA 2ZU4A 5AVDA 1NFWA 1LKAA 1VGCC 3LPRA 1UTKA 3BTTE 3RXJA 1DSUA 3M3SA 2BB4A 3OX7U 4UFGH 2FI4E 5F8ZA 3CENA 4ZXXH 3W94A 2WV5A 6LPRA 3AW0A 1OWIA 2BD3A 1O3OA 2R0KA 1EX3A 2BD8A 3A7VA 1CHGA 2JKHA 4JZFH 2ZZUH 4NIWA 1XVOA 2W3IA 4Q7XA 1ZMNA 1O3LA 1C5ZB 1FPHH 1S5SA 2A32A 1MTWA 1HB0B 3BN9A 3FP6E 4AFQA 2G51A 3BG4B 1V2LT 3SJ8A 1NRNH 4ISNA 1LQEA 2O8TA 3TU7H 5C20A 3I29A 2JH5D 3RU4E 3U8RH 4K5ZA 2GZ9A 1DWEH 3A89A 2C8WB 1FPCH 2IPHA 1PQ5A 1GJ6A 1ZPZA 1MKXK 1YPLH 4HI3A 4ZKSU 3ZZ6A 2BY9X 2Z3CA 1FMGA 4ASHA 2V0BA 2AFQB 1SQOA 1ZJDA 3LKWA 3SV7A 1TA2A 4Y0ZE 1XXDA 2VVCA 3SU3A 3SU1A 5FBEA 1FUJA 1D3PB 1LHEH 1NRSH 5GDSH 2ZTYA 2O8WA 1GG6C 4ZUHA 3ZVCA 2HPQH 3LT3A 2WPHS 1YC0A 3B23B 4MG3A 4NA8A 3CP7A 1MD7A 4J1YA 1KLJH 1WOFA 4X8TH 3PWCA 3BEFB 1UHBA 2TPIZ 3BV9B 3GCTF 4JZIA 1H9HE 1TONA 5TJXA 5F8TA 3QDZB 1ETTH 1N6XA 3KF2A 3UNRA 1A3EH 3GYLB 3E0PB 4X6PA 2BQWB 3PTBA 2VH6A 4LZ1H 2B8OH 2GT7A 1JBUH 1ELVA 4FU8A 2OQ5A 1A46H 1DLKB 2EA3A 4X1RU 4A5TS 1BA8B 3GYMA 1VGCB 5EODA 1BDAA 1F0SA 3DFJA 3TJOA 1ZMJA 2W5EA 4AZ2B 1NN6A 4YZUA 1HAVB 3RXMA 3VFEA 7GCHF 3VB3A 3CS7A 1N8OB 4B2CA 1V2PT 2HOBA 2LNCA 3M7UA 2RA0A 1V2UT 4YO9A 2J38A 5C1UA 1D6WA 1SHYA 2WINI 3F6UH 3T25A 2TGAA 5ETXA 2GD4B 1GHVH 3SW2B 1GHWH 2CHAB 3RU4T 1EZSC 2LPRA 1FDPA 3FANA