4SGAE

Structures of product and inhibitor complexes of streptomyces griseus protease a at 1.8 angstroms resolution. a model for serine protease catalysis
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
181
structure length
181
Chain Sequence
IAGGEAITTGGSRCSLGFNVSVNGVAHALTAGHCTNISASWSIGTRTGTSFPNNDYGIIRHSNPAAADGRVYLYNGSYQDITTAGNAFVGQAVQRSGSTTGLRSGSVTGLNATVNYGSSGIVYGMIQTNVCAQPGDSGGSLFAGSTALGLTSGGSGNCRTGGTTFYQPVTEALSAYGATVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of product and inhibitor complexes of Streptomyces griseus protease A at 1.8 A resolution. A model for serine protease catalysis.
pubmed doi rcsb
source organism Streptomyces griseus
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords PROTEINASE A (SGPA)
total genus 55
structure length 181
sequence length 181
ec nomenclature ec 3.4.21.80: Streptogrisin A.
pdb deposition date 1990-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4sgaE02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4sgaE01
1KLJH 1YCPH 4ISLA 4AGJA 1XXFA 1YGCH 2QY0B 1MU6B 1EPTA 3PLBA 2XBVA 1O3MA 1GG6B 2GGVB 1NRNH 5GXPA 3ZV9A 1L0ZA 4THNH 3SU0A 2V0BA 1O3AA 2AFQB 1V2LT 1OP0A 2BY9X 4ZUHA 4MPUA 4O97A 2W3KA 2W3IA 2A31A 3P8GA 2G5NA 1RD3B 1WQVH 1THSH 4YESB 2ZHQH 4DCDA 1C1VH 4BANB 1BQYA 2JH5D 1IQLA 4PROA 4AORA 1BBRE 4AGKA 1EAXA 1ZZZA 5TJXA 1Y3UA 1GBFA 2OLGA 5EQSA 1F5LA 1TONA 6LPRA 3RXFA 1H1BA 4Q7YA 2PHBA 5EW2H 1K1LA 2F9BH 1O39A 1RIWB 3URCA 3RC4A 3F9EA 1THRH 5T3HA 2XCNA 1KLIH 3F1SB 3NWUA 2PSYA 2AYWA 1MH0A 1GHBF 3B9FH 1AKSA 1O5CB 4BAMB 3L3TA 5K0HA 3D23A 1AWHB 3LC5A 1HXEH 5EU8A 1AIXH 1TPSA 1NTPA 4JZ1A 4MNYA 2FOBA 2OUAA 1GI5A 3QUMP 5SGAE 4E7RG 1EASA 2VVUA 1AE5A 4GCHG 1KTTB 4B74A 2VIDA 2W7SA 3SGQE 3BG4C 1XM1A 1Y59T 3GY7A 2OC8A 1C5LH 1MAXA 3V7TA 3IWMA 1C5QA 1A46H 5JB9S 3P8FA 5DP8A 1GCTC 3TNSA 1EJAA 3ZZ8A 4K1TA 3WY8A 3E90B 1V2TT 2FESH 2GCTB 1SVPA 1G30B 4K1SA 1UCYH 3UNSA 1DS2E 4JK5A 3RXDA 3T28A 5GPIB 4HGCA 2WYJA 1TPPA 3M35A 3MH6A 1QJ7B 1SOTA 5L2YH 1T31A 1O2SA 1B0FA 1XMNB 1GGDC 1O0DH 1TA2A 2PLXA 1BRBE 1V2VT 3T27A 2VIWA 2G51A 1O2QA 3KQEA 2QA9E 1A7SA 1IQFA 1NN6A 4U2WA 2A7HA 3G01A 1YPKH 2ZFSA 1VCQA 1LHFH 1GBTA 1NFYA 5ESTE 3M61U 2ZDLA 3ODFA 4NIXA 1LQDB 1TGCA 2CMYA 4U30A 5F8XA 1GL1A 1XVMA 2ZO3H 3IG6B 2CHAB 1JWTA 4JYVH 1E38B 3U69H 2BD8A 3UR9A 3GCTF 4Z0KA 3FZZA 4DG4A 4Y7AA 4AFZA 1K1JA 7GCHF 3RXUA 3AW1A 2YNAA 1TBZH 1O2ZA 3BV9B 1GBBA 1HBTH 2Z9KA 1AFEH 2BDAA 2WV4A 1O2VA 1KYNA 2VIPA 4MPWA 1XUKA 2BY5X 4AYYB 3MWIU 1OWEA 2P95A 2ZGCA 3PO1C 2ZQ1A 1ESBA 3L33A 3KQBA 3SUDA 3M7UA 1GBCA 3BTKE 4ABBA 1IQJA 2TBSA 2TIOA 2PKAA 3SV2H 4JCNA 3U9AH 1JRTA 1ELGA 1GBAA 2FWWA 3RXAA 2IOTA 2VGCB 4X1SU 1QB1A 5IYTA 5I46H 1ANBA 2HALA 1O5BB 1ZHPA 1GBLA 3RLWH 1S0RA 1FJSA 2V3HH 2FOMB 5DKMA 4NIWA 1C5UA 3ODDA 2VU8E 3BTQE 4I8LA 4SGAE 3T29A 1TNGA 2SGPE 3RLYH 4CHAC 3TH3H 1T32A 3TJNA 1O2LA 3PMJA 4JYTA 5K7RA 1QBVH 1H8IH 2Q6FA 2ZC9H 1AUTC 3U1IB 2H1UA 1ARCA 2RG3A 1QJ6B 1WOFA 7ESTE 3MI4A 3O8DA 1BRUP 1K28D 4UFEH 3RMOH 1A1RA 4B76A 4CRAA 3RXTA 2J38A 2C90B 2ZHDA 2KAIB 3PMBB 1PPHE 3A81A 3MTYA 1SGQE 2FTMA 1O2YA 1PPGE 4OS5A 5A0CA 3BIVH 2XBWA 3RXVA 2PSXA 2BMGB 1C5TA 5EPYA 1OYQA 1GJAB 3UNRA 4GHQA 4XFQA 1TMUH 5C1YA 1G32B 3HK6B 2VWLA 1P01A 3LJOA 4XSKU 5F8ZA 2HPPH 2ZCLP 3SI4H 1HAVA 2P93A 3UIRA 2GDDA 1E34B 2OC7A 1IHSH 3PV4A 5FCRA 4FXGH 2FODA 4HTCH 2NU3E 4OS1A 1WTGH 3H7TA 3ZZ3A 2F9OA 4NZQA 2FDAA 5E2PA 1F92A 1QIXB 2PGBB 4I31A 4E06H 4AFQA 1ABJH 2ZDKA 4TY7A 1F7ZA 4NA9H 3P8OA 1CA0B 1TRMA 1F0SA 3GCTG 2XTTB 3AASA 4Y79A 1C9PA 2ANYA 3Q3XA 3A7YA 1YPHC 3SUEA 1ETTH 4YLUA 1MCTA 3U98H 2R2WU 2JKHA 1A3EH 4CH8B 3NPSA 2AMDA 1FNIA 1O3EA 3SW2B 1LPKB 2GX4A 1OWIA 8GCHG 4X1NU 1OXGA 1FXYA 4D8NA 4B2AA 2QXIA 1C4V2 1G3BA 2FMJA 3ZVGA 1HIAA 4JMYA 3TJUA 2XRCA 3A87A 4TWYA 1GPZA 1VGCC 2SGQE 1DFPA 4CH2B 3A8DA 3ATWA 5E0JA 5FBEA 4OS7A 1TQ0B 2Y5FA 5J4SA 2ZNKH 1C5RA 2CHAC 1C1TA 3KQCA 1EB1H 2JH6D 2ZU5A 1TAWA 2C93B 4X8VH 4ZHLU 3M3VA 1QCPA 2P3TB 4RSPA 2D26C 3NXPA 4UD9H 5E8EH 1FDPA 1DOJA 2BDHA 1TPAE 3RXHA 1O2TA 2A5IA 1N8OB 1NRQH 1EQ9A 5A0AE 3U8OH 1P9UA 1HPGA 5GDSH 1GJ9B 3T2NA 3TJVA 1W7GH 2WPIS 1J15A 1EP5A 2FI4E 1Q3XA 3KCGH 4DVAU 1TNIA 1S6HA 1ZYOA 4XOJA 1BTWA 3VB3A 2OCVB 2BZ6H 2ZU4A 4FUBA 1E37B 1MCVA 1FPCH 1XUHA 1A2CH 4KELA 4JZEH 2BDYA 2FXRA 3MO9A 2OQ5A 2ZGJA 3H7OA 1LHCH 2UUYA 3RDZA 2NU2E 1HJAC 2BX3A 2UWOA 3LT3A 1MTVA 1C1NA 1XKAC 3UQOA 4KGAA 1Y3XA 1K22H 4IW4E 1L4DA 1V2UT 2FO9A 5FPSA 1UHBA 4B1TA 3RXOA 1D9IA 1EZSC 1TNLA 5DP6A 3RXLA 1SGPE 2HVXA 1DVAH 4Z6AH 1GI9B 2GZ9A 2EI6A 1TRYA 4A6LA 4X1RU 1HIAB 4B71A 2SNVA 3GY5A 1WUNH 2HNTE 5TCAA 5C1XA 1A3BH 1HAPH 1LPGB 2DE8A 1GBMA 4YM9A 1AY6H 2H5DA 4K5ZA 2IN2A 4I33A 1GGDB 2Y7XA 1FUJA 2A45B 1C1PA 1MMJN 2J9NA 3VB5A 2FOAA 2ZEBA 1O2JA 2OTVA 4M7GA 2G4TA 3GCHB 1CBWB 2FX4A 2PTNA 4UEHH 1BA8B 1OX1A 4ABEA 4GAWA 4OS4A 1RGQA 1K1OA 1DT2A 3SZNA 1KIGH 4TWWA 1J9CH 3VXEH 4CRGA 4A1VA 7GCHG 1TFXA 1V2MT 2BQ7B 1MBMA 1AVXA 1HAOH 3MO3A 4ISNA 1FY5A 2YOLA 1FV9A 1PQ7A 2HPQH 1B5GH 3U8RH 1DANH 1BTUA 3C1KA 2THFB 3BF6H 4AZ2B 4D9QA 1TNJA 4X1PU 3B23B 4D7GA 3CS0A 2PR3A 1GI4A 2F91A 2BDCA 4JZFH 2GCHF 3P8NA 1SQTA 3TGJE 1P3EA 1FZZA 1K1IA 1P05A 1ZOMA 1ZLRA 1BOQA 4ZH8A 4NA7A 3TGIE 1GI1A 1DUAA 2C8WB 2FLBH 1C5NH 1SGRE 1JBUH 1GI0A 3GDUA 1AVGH 2O8LA 3A83A 1HXFH 3A8CA 1ANEA 1ELCA 2BLQA 1VITH 3JZ2B 1YPGH 1GVLA 1SI5H 5HM9A 4I7YH 2GZ7A 2AEIH 1IHTH 4LZ4B 3ESTA 1EOLA 9ESTA 4ISOA 1YPEH 4D76A 5A2MH 2ZCKP 1HGTH 1AWFH 5J4QA 1H9LB 2ZWLH 2IPHA 1GDUA 3S9AA 1ELBA 3A7WA 1V2JT 5DG6A 2VB0A 2BB4A 2FP7B 4AN7A 8KME2 1ZTJA 1SBWA 2I6SA 1XVOA 1O2MA 1ZHMA 2GV6A 4CR5A 4Y76A 1IQEA 1YLCA 2PV9B 2BOHB 2Y5GA 2ZDMA 2R3YA 1G2LA 3QLPH 2VWNA 1P2IA 1QTFA 2GTBA 1C2FA 3QWCH 2O8WA 1TGBA 1CHOG 5A8ZA 2AIQA 1A5IA 1SLWB 1GHBG 1H9IE 1UVUH 3E6PH 3DFLA 2A4OA 1DY9A 3BG4B 1TNHA 3M7QA 1ZJKA 1NM6A 1LPZB 1ESAA 1CGJE 2GCTC 2WINI 4DGJA 3GYMA 4NIVA 1O5DH 1Z8IB 3EAJA 3PLKA 1RTFB 1NRPH 2BY6X 4INHA 4Y71A 2RA0A 5EQQA 3S9CA 1OS8A 2ZHFH 2VVCA 3BTTE 4UFGH 3SNEA 6GCHG 2H5CA 5C5NA 5JBTA 3TLOA 5JYIA 3A84A 1W13U 2AMPA 3TJOA 3RMMH 5C3NA 2QXGA 3SV6A 4FUCA 3SU2A 4GHTA 2OBOA 1IOEA 4IC5A 1SGYE 1O3LA 2BLOA 2ZDNA 5HYOA 1D6WA 1SSXA 1BT7A 3TU7H 5EG4A 2Z3EA 5FX6A 5GWZA 1O2RA 1QL8A 1AI8H 2H6MA 2PGQB 1NFXA 4TPIZ 1EZQA 2SFAA 3E3TA 3EA7A 4NG9H 1CGIE 2OP9A 1UTOA 1WBGB 2SGDE 1W12U 1KTSB 2SGFE 4NWLA 1O2UA 4Q7ZA 2G00A 1LCYA 2VWMA 1EJNA 3GCNA 3EYDA 5GCHG 3UFAA 1DXWA 3W94A 4B73A 5JBAS 1ELTA 2WV5A 5DK1A 4MPXA 2ZI2H 1C1OA 3HKJB 1BUIA 3MO6A 1EX3A 1PYTD 4X2YA 3P95A 3M5OA 1HDTH 4ZROA 8LPRA 1CT4E 4X8SH 2BDIA 1YPJH 1BZXE 1H4WA 1JIRA 3B8JA 3CENA 1P2QA 1O5EH 1YBWA 2FIRH 1GCDA 4XBCA 3VGCC 1C5PA 4O3TA 5CMXH 4GSOA 3GCHC 2A2XH 2FOEA 1GHXH 3OU0A 1QRXA 3TGKE 1TX6A 1EAIA 4TYDA 1Y8TA 3E0NB 4X0WU 5HGGA 1UTJA 1GVKB 1BTHH 3TITA 3MYWA 1DICA 1C9TA 1K21H 4FU8A 2BY8X 1BB0B 2BZAA 1BJVA 1ANDA 4K2YA 1YCPM 1C2MA 1O35A 1QL7A 1NRRH 2ZU1A 4FUFA 3PTBA 4AFUA 5I25A 1BIOA 3SQEE 1TA6A 1MKWK 1GJCB 1PQ8A 1ZPBA 2BHGA 1C5SA 2BD3A 2ZFFH 1D3PB 4BAQB 1CT2E 1KXCA 3SJKA 1PJPA 1AUJA 4MLFB 3A7XA 2XWAA 3M36A 5FPYA 1TABE 1ZPZA 1OP2A 2BVRH 1G36A 1GI8B 4IC6A 3FZDA 1MKXK 4CHAB 4ISHH 1BTZA 1Y5AT 3U8TH 2J34A 3MNBA 4KTCA 3F68H 2BD7A 2G4UA 2VIOA 2OQUA 1QRWA 1FAXA 1GBEA 1Z7KA 1P04A 1DWEH 1C5VA 4O3UA 3MU8A 1KXBA 1ELDE 1QQUA 3LIWA 3P92A 5L2ZH 1W2KH 5A8XA 3K65B 4ZMAH 3RC5A 1J16A 3ITIA 3HKIB 2AS9A 1LVMA 3E1XB 1T8OA 4RN6A 3DHKH 1RTKA 4TY6A 3TK9A 1KXDA 2RDLA 1G3DA 3ZVFA 4E05H 1CHGA 1ARBA 5JBBS 3I29A 3BTDE 2P3FH 3LGIA 1NROH 4Y0ZE 4IMZA 4XE4A 1EZXC 1OKXA 3HK3B 2DE9A 3CS7A 3FANA 2HLCA 1V2QT 3QGJA 2VWOA 1W10U 2O8UA 2LPRA 2NU4E 4K8YA 3SNCA 3NCLA 2SGAA 3DUXH 1O2PA 3FP8E 1SQOA 2GCHG 2KAIA 4X2WA 2PW8H 1V2RT 2CGAA 1F5KU 2JETC 1HB0B 2SGEE 1Z1IA 1QA0A 4WWYA 1KSNA 1NESE 1O32A 1C2KA 3RXEA 2ODQA 1Y3WA 2J94A 3EA9A 2PWXA 2GVFA 3RXMA 8ESTE 1ZSKA 4GVUA 4ABGA 1Z6JH 4OGYA 2ZFRH 1C5ZB 1HAXB 3RP2A 5BRRE 4ABFA 1GDNA 4R8TB 3MNCA 4XBBA 1P06A 4YOGA 4AYVB 1P3CA 2R0LA 4O9VA 3TH4H 4Y6DA 1TLDA 3SUGA 3GY4A 1C4U2 1ETRH 3GY8A 1UCYK 4ABDA 3PM3A 4AB9A 2EA3A 2FM2A 2Y7ZA 2A0QB 4BTIB 3V12A 3GICB 1YYY1 1GHYH 4HZHA 1J14A 3GYLB 2F83A 3UWJH 2VVVA 4SGBE 1CBWC 1ZSJA 2Y82A 1UK3A 5T6DA 2AGIX 3KEEA 1CVWH 1Q31A 1GWAA 4MNXA 4IMQA 3ZZBA 1INCA 5LPRA 3EE0B 1JRSA 3IITA 3KF2A 3K2UA 4BXWA 2WPHS 2STBE 1GCTB 3I77A 3LH1A 1XUFA 4ZAEA 1O33A 1UO6A 1TYNA 4UONA 3L6PA 1BCUH 1LTOA 1SG8B 6GCHF 1O2XA 2XC4A 1RJXB 5EXNA 1EXFA 1DITH 1DDJA 4IBLH 4NFFA 1K2I1 3M3TA 1RXPA 3KQDA 1LHEH 1MTUA 1V2ST 4OS6A 3BN9A 4X1QU 3SU4A 5FX5A 2J95A 4K1EA 1GBHA 5ETXA 3S7HB 1AKSB 1AN1E 1GI2A 1GBDA 3E8LA 1H9HE 2IJOB 1TX8A 3A88A 1KY9A 1LVYA 2ZGBH 3RXGA 1HAHH 2ALVA 1F0RA 3FP6E 1F0TA 5C1UA 2BM2A 3PYHA 3TNTA 2G52A 1C4Y2 4AG1A 1UK4A 3SOSA 4K60A 1SFIA 1MZAA 1SPJA 4GCHF 3UUZA 2P3UB 1FY8E 1ELVA 1HJAB 1DSTA 3MNXA 2TGAA 2G55A 1SOZA 3HATH 4OS2A 2ZG0H 1QURH 1GJDB 1LHGH 1ZRBA 3SHCH 1TBQH 2ZTYA 3V3MA 2B7DH 3I78A 1VCPA 1O3HA 3T25A 2H2ZA 1PPFE 1O37A 2Z9JA 2WYGA 1PFXC 4A1XA 1LVOA 3TPIZ 2BYAX 1YLDA 3VB4A 3ZVBA 2HWLB 1ABIH 1VITF 5DP5A 3UREA 2VNTA 4ABAA 1ZTKA 1HAZB 1O5AB 1AE8H 1ZTLA 1FIZA 4I8JA 2G8TA 4WXIA 3A85A 2BVXH 3RXKA 1ANCA 4A1TA 4NFEA 1O3GA 1P2OA 2Y6TA 1CGHA 4K69A 1BTPA 1TBRH 1EATA 2C8YB 1Y3YA 1KXFA 2BLWA 1AVWA 2BDBA 1GMDG 2FYQA 3EGKH 1GJ4H 3MU1A 5PTPA 1O3NA 2EEKA 2FS8A 3AAVA 3F9FA 1WTHD 2QC2A 1OWJA 1NRSH 3T26A 2XYAA 3RXQA 1PPCE 2VIVA 2BLVA 2PKAB 1V2WT 2J4IA 3Q76A 4KTSA 2ESTE 4A7IB 1QRZA 3UNQA 5A0BA 2G81E 4MDSA 4ZKOU 3MU4A 2NU1E 1GJ8B 1W11U 2XBYA 3RU4E 3SNAA 1P03A 3MOCA 1AGJA 1SQAA 1FAKH 4D9RA 1A0HB 4ASHA 2CV3A 1NY22 2H9TH 1FIWA 4YO9A 1LO6A 1B0EA 1LKAA 2BXTH 2P59A 3H5CB 2VJ1A 3F9HA 4JYUH 1FY1A 4I8KA 2B8OH 5CHAC 1H8DH 5BPEA 6ESTA 2QIQA 1BHXB 4U32A 1BBRK 2NU0E 3MNSA 3VPKA 4JZIA 1EOJA 3MH4A 1Z1JA 1UTQA 3ATIA 3ATMA 1SLVB 1LHDH 1NFUA 3OSYA 3D65E 4CRBA 4DOQA 3SHAH 4NSVA 2SNWA 4AB8A 1TPOA 1DUEA 1IQGA 5IDKA 1QBOA 1GG6C 4CR9A 1G3EA 1GJ6A 1HAGE 4LOYH 5GJ4B 1W3CA 2VGCC 1MKXH 1VCWA 1BBRH 2F9NA 2HRVA 3ZZ7A 1L1GA 2YNBA 4OGXA 4X8UH 3UR6A 4X6MA 5E2OA 5AVDA 1GHAF 2FYRA 3RMLH 1UVTH 1GMDF 1QQ4A 2QYIA 1MTNB 3LONA 2B0FA 1VITG 2VINA 5AHGH 1TGTA 1IQNA 1C2HA 3LDXH 1GHZA 3SI3H 3SU5A 2ZA5A 1M9UA 1SGNE 1UTNA 1RIWC 1GL0E 1BMLA 4CBOA 1ZR0A 3A80A 1QB9A 1XKBC 2B9LA 5CHAB 3S0NA 1S83A 1C1UH 1E35B 3RXJA 3VB7A 3EQ0H 2BD9A 3UY9A 3SO3A 1HFDA 1SFQB 1UK2A 3BG8A 4J1YA 1RTLA 2ZTXA 4DURA 3A82A 1NZQH 4DJZB 1TIOA 3FFGA 1CSOE 1AD8H 5FBIA 5E0GA 4WH8A 3P17H 2HNTF 3PB1E 5JBCS 1TB6H 1YPHE 4NWKA 3SQHE 2FPZA 4FUHA 4WH6A 1LQEA 4DW2U 1Y3VA 1L1JA 2M5TA 2TGTA 3GDVA 2W7UA 4NGAH 1QA7A 2P8OC 3BEUA 2W5EA 1T8MA 1P10A 2QXHA 1BTYA 1XUGA 1TRNA 5HXFA 2F9UA 4LXBH 3PLPA 1DLEA 1SMFE 2Q1JA 2XXLA 3FP7E 8GCHF 3VXFH 4X6NA 3F9GA 1J8AA 4MPVA 1L4ZA 1ELEE 3E0PB 3SJOA 3RXRA 2R9PA 2FX6A 3VEQB 2BQ6B 2VIQA 1JXPA 3KHVA 1C2IA 1SL3A 4DT7B 1MBQA 2WUBA 1S5SA 3QN7A 4CBNA 1NPMA 2UWPA 3BEFB 2LNCA 5LPEA 1U6QA 3PWCA 4E7NA 1JMOH 1Y5BT 1JIMA 3V13A 3AW0A 1AHTH 5HM2A 5ESBA 1TQ7B 1UTLM 4Y0YE 1WQSA 1XUIA 2K1QA 2WPJS 2ULLA 4I8HA 1CA8B 2NWNA 1O31A 3ELAH 2Y5HA 3C27B 1HAYB 1FY4A 3KL6A 1UVOA 2ZTZA 2XC5A 5FPTA 1MD8A 1P57B 1SLXB 3ATKA 6CHAB 2FLRH 1YP9A 3P6ZB 4BOHA 1CO7E 3OYPA 2A4RA 4GLYA 1N1LA 1PPEE 3JZ1B 2P16A 1P2KA 2Z9LA 1BHXF 4F4OC 2ZGXH 1G9IE 3R3GB 2FOCA 1C5YB 5DJ7A 1EUFA 3SJIA 1MTSA 3LH3A 1OWHA 1CA0C 2CJIA 1OP8A 2TGDA 2UUJB 3ZZ9A 4A92A 6CHAC 3GOVB 1QY6A 3URDA 4D7FA 1S0QA 4H6TA 3A8BA 1YM0A 3SU3A 4GUXA 4CRCA 2BD4A 1EAUA 1ELFA 4AOQA 2PTCE 2R2MB 1F2SE 3VGCB 1YCPK 1TGSZ 2Z9GA 4IN1A 3TK5A 1FN6A 1SLUB 1GJ5H 1S82A 4UE7H 4WVPE 1ZSLA 2O8TA 1P11E 2BX4A 7KMEH 1QBNA 1OSSA 1O2IA 5EPNA 1O2NA 1FONA 1K1MA 3QK1A 3RU4T 1F0UA 1SGIB 1UMAH 3Q77A 2ZCHP 2FZZA 3EDXB 4Y7BA 2AH4X 4IS5A 1K9OE 4FVDA 4H4FA 3ZZ5A 2ZFQH 2QN5T 3LGTA 1SGFA 1C1QA 3QGNB 1SHYA 3DT0H 1LDTT 2GZ8A 1G3CA 1MU8B 1GI3A 1GMHG 4ISIH 4QT8C 4NSYA 3Q3YA 2W26A 2CF8H 1SGFG 1GDQA 1HNEE 3K6ZA 1YPLH 2GT7A 3PWBA 4BTUB 1ZHRA 2QGRA 4YOIA 1LKBA 4ZHAA 4MNVA 3RXBA 1SGCA 3OY5U 3LGUA 2A4GA 4FU7A 1ETSH 1A5HA 3LGYA 1IQIA 1TMTH 2ZU3A 1BRCE 1RFNA 3M5MA 1EZUC 1KDQA 3STIA 1WAYB 2GP9B 3GDSA 5EW1H 3TK6A 1OOKB 4B2BA 4X6OA 1EAWA 1XUJA 2G5VA 4NCYA 4INKA 2TGPZ 1HCGA 1HRTH 3UQVA 3MMGA 1C1RA 2C4FH 1O3PB 4DY7B 1KXAA 4Q80A 2A2QH 1DM4B 1C2DA 2AGGX 2Y80A 1QNJA 2F3CE 3RXIA 2BTCE 1O2WA 1G2MA 2PUXB 5C67A 2ZFTA 4Y8ZA 3ZZ4A 2PKSC 4KKDA 2ODYB 4Y8YA 1EJMA 3EA8A 4WF8A 1AO5A 4FUEA 3S7KB 3ZV8A 1S81A 2FI3E 2ZFPH 4XBDA 3SU1A 1AB9B 1DXPA 5C2ZA 3ZYDA 1P12E 1SGEE 4BAOB 4HFPB 1ZMNA 1BMAA 3TH2H 1FY3A 5CE1A 3MU0A 3OY6U 4YOJA 1C2GA 2JH0D 2ZPSA 3QTOH 1O3KA 2ZF0H 2ZZUH 1SGDE 4X8TH 1KXEA 3O8RA 3A89A 3TIUA 4UFFH 4AG2A 1K1PA 1V2OT 1QB6A 4JZDH 3A86A 5TCCA 1IQHA 1SC8U 1TNKA 1VJ9U 1QFKH 4Y10E 3RXPA 3BTEE 1AZZA 1DPOA 5G4BA 1ZRKA 3BTWE 3KGPA 1UHBB 5GCHF 1A0JA 5DPAA 4X2VA 1OPHB 1A5GH 4ZXXH 4ZKSU 1WSSH 5C5OA 5F8TA 3BIUH 4Y11E 1O5GH 5JDUB 1AFQB 3ATLA 1T7CA 3VFEA 4BNRA 2A1DB 2A7CA 1HJ9A 1O38A 4H6SB 3A7ZA 4VGCB 2GDEH 1PPZA 2J92A 2ZDVH 4FU9A 1C5OH 3SJ9A 1Z8RA 4DIIH 3MFJA 3RM2H 3RUOA 4Q7XA 5FHTA 1P2MA 3DD2H 4B75A 3A7TA 4TPYA 2ILNA 1MD7A 2GT8A 1PPBH 1AZ8A 1MQ5A 2P8OB 1B7XB 3BTFE 4IGDA 3BEIB 4Y8XA 1FN8A 1GHVH 2BD2A 5GIBA 1YPMH 4YLQH 1O3OA 1DWCH 1KLTA 1UTKA 1OYTH 2ZPRA 3FAOA 2PUQH 1S85A 5HMAA 3W95A 2WPLS 4WY3A 4BTTB 1QHRB 4WMFA 2FEQH 2D8WA 1P0SH 3KN2A 3V0XA 3PTNA 5DP4A 5T6GA 2RA3A 2FOHA 4MG3A 2JETB 5EQRA 3OTJE 1QJ1B 3SV7A 1VJAU 1CHOF 1O3BA 2V3OH 1A61H 2C3SA 3OX7U 1MTNC 1MQ6A 5A09A 2BDGA 2QAAA 4ZKRU 5JPMH 1NU7B 4X6PA 3LC3A 1WCZA 1O5FH 2HOBA 5H4IB 1ZJDA 1HYLA 2C8XB 3LOXA 3UTUH 1TOMH 2GKVE 1CU1A 1TE0A 1DWDH 9LPRA 2V6NA 1ESTA 2ANWA 3SNBA 5EXLA 1K1NA 2Z9IA 5LH8A 3RU4D 1SGTA 1W8BH 3LKWA 1DSUA 1O3IA 2PFEA 1GBIA 4NZLA 1W0ZU 1E0FD 1GBJA 5FAHA 4FUIA 4FUGA 2XC0A 4FUJA 3S69A 1WYKA 2DUCA 5ABWA 1L2EA 2ZP0H 4ABJA 1T4VH 3KIDU 2Z7FE 1GMCG 4GPGA 3HGPA 1WV7H 1RRKA 4K8BA 2Z6BD 3QX5H 3F6UH 3ZZDA 5C20A 2OINA 1HAVB 1V2NT 3UWIA 1O3DA 1NS3A 3ZZAA 2EC9H 1W14U 4ABIA 1ACBE 3M7TA 4A5TS 1C1WH 3QDZB 1UTMA 2A4QA 3A7VA 2F9PA 7LPRA 4RKJB 2HNTC 1VGCB 3QZRA 2AERH 3SORA 1C1MA 5T6FA 3CP7A 2ZGHA 2PKSB 2V35A 2QF0A 1D4PB 1BMMH 1O30A 4WXVA 1KDQB 3RXCA 4LZ1H 1D3TB 4WMEA 3E91A 2Y81A 2Q6DA 4CREA 2OC0A 2XCFA 1AB9C 4R0IA 1NC6A 4WJG2 1Q2WA 1UVSH 3PROA 4FUDA 4MQAA 1F5RA 4BAKB 4CRDA 2J2UA 1L1NA 3ZVAA 1ID5H 3M3SA 1ZGVA 1S6FA 4MNWA 1THPB 4IN2A 1O36A 4O03A 1P2JA 2ZDAH 1C5XB 5DP7A 2AMQA 3M5LA 1V6DA 1UTPA 1Y5UT 3AAUA 4K3JA 5L30H 1BJUA 1GHWH 1Z6EA 4FVBA 3BTHE 1C5MD 3HGNA 3UPEA 2OXSA 1RS0A 1GBKA 2Z94A 4YTAA 3SJ8A 1UJ1A 2P94A 3UOPA 1LVBA 4YZUA 2TRMA 1AFQC 4LK4A 2HGTH 3QZQA 5LPFA 3SU6A 2QXJA 1CT0E 4I32A 4VGCC 1A4WH 1OWDA 4ESTE 2ANMH 1ELAA 3ZZ6A 2GMTB 4XDEA 1XXDA 3Q3KA 2BVSH 1O3JA 2OC1A 3SV8A 3RMNH 4Q2KA 4BXSA 2XNIA 1ORFA 2AGEX 4UDWH 3PO1B 1EB2A 1TX7A 4CRFA 3U1JB 1FLEE 2ALPA 3NKKA 4YT6H 2CF9H 5DGJA 3S9BA 2QF3A 1P8VC 3PMAB 1P02A 1MKWH 4HI3A 1SR5C 3A8AA 5JB8S 1P9SA 2D1JA 2OBQA 1HV7A 1SB1H 1N8OC 2EI7A 4MTBA 3BTME 5A8YA 4DIHH 4ZXYH 3Q00A 1MUEB 2FOFA 1P09A 3LGVA 1O2HA 1V2PT 1S84A 3HPTB 1GVZA 2BD5A 1ZMLA 3T5FH 1CE5A 4UFDH 1AQ7A 3GISB 1N6YA 2Z3CA 1PQAA 3NUMA 3ZYEA 1JOUB 2XWBI 1CQQA 3SGAE 4B2CA 3R0FA 1Z71A 2O9QA 3MH5A 2ODPA 2GD4B 1MAYA 3LGWA 2B5TB 1BTXA 1V3XA 2QCYA 3QTVH 2A32A 2RCEA 2Q6GA 2ZU2A 4WMDA 1G37A 1O2GH 2WUCA 3GCOA 2BOKA 1C2EA 2WPKS 1O2OA 4NA8A 1FQ3A 2WPMS 1NO9H 2GV7A 2BY7X 3K9XB 3BSQA 3M37A 1QR3E 1W0YH 1WU1A 3DFJA 1D3QB 1TALA 5LGOA 2ZPQA 1BITA 2ANKH 3RC6A 1Z8GA 2D2DA 1IQMA 1N6XA 4NIYA 1O3CA 1YC0A 4ABHA 1W7XH 2FS9A 3ZVCA 2UUFB 1EPTC 1DWBH 2A5AA 3MHWU 1O34A 3D49H 3QO6A 1BDAA 2CN0H 1ZGIA 3SUFA 3ENSB 5F6MA 5DP3A 1TWXB 3D62A 4X2XA 1T4UH 1TGNA 4ZKNU 2ZHEH 3ZVEA 2VH0A 2R0KA 4H42U 1C5WB 5EGMA 3PMHB 3K6YA 1EKBB 1GHAG 5EODA 1QL9A 2UWLA 4ZHMU 2TPIZ 4J2YB 2EI8A 4AX9H 1DE7H 2A5KA 2BXUH 2C8ZB 3ZZCA 2XW9A 2FOGA 1AU8A 1GMHF 5AFZH 5EOKA 2VH6A 3TVJB 3BTGE 4BAHB 4INLA 1NT1A 1VZQH 2CXVA 4KTUA 2R3UA 1GI7B 3LPRA 1EPTB 1J17T 4I8GA 3N7OA 5EXMA 4AFSA 4U01A 4F49A 1MTWA 2Z3DA 1HJ8A 1SHHB 3KNXA 3SNDA 1IAUA 1C2LA 3NZIA 3NK8A 1BMNH 4RKOB 1FMGA 3AVZA 3P70B 1UCYE 1VR1H 3MU5A 1GJBB 1NFWA 3SV9A 1TOCB 2ZHWH 2FTLE 2ZKSA 5AFYH 3O8CA 3LU9B 3RM0H 1PYTC 1IQKA 2A7JA 2AIPA 2F9VA 3SBKA 5F03A 1T8NA 2BQWB 1GI6A 2O8MA 1D6RA 1E36B 2ZIQH 1OWKA 2H9EH 3ZVDA 2UUKB 4YT7H 1DY8A 1P2NA 1O2KA 3FVFB 1D3DB 5FXLA 1HAIH 5DO4H 5L6NH 3T62A 1EP6A 2H9HA 3M5NA 2OD3B 1C2JA 1TMBH 1DLKB 1ZMJA 2ASUB 2STAE 1YKTA 3GY6A 3MH7A 1O3FA 3RXSA 2QV1A 5AF9H 4JK6A 5B6OA 1YF4A 3O8BA 1A0LA 4MVNA 2XBXA 1NU9A 3E16B 1HUTH 5DP9A 1GMCF 2ZECA 1PQ5A 3GY2A 3SN8A 3SGBE 2I6QA 1FPHH 1MZDA 3DA9B 3VB6A 5E0HA 5FCKA 1UVPA 2FI5E 1T8LA 1LMWB 3STJA 1HLTH 1QGFA 1XX9A 1DX5M 1C1SA 3UOUA 3GY3A 1Z8JB 2ZQ2A 3LJJA 1X7AC 4KP0A 2GMTC 1V2KT 1FI8A 1AMHA 1GJ7B 1ZPCA 1BRAA
chains in the Genus database with same CATH superfamily
1KLJH 1YCPH 4ISLA 4AGJA 1XXFA 4M9FA 1YGCH 2QY0B 1MU6B 1EPTA 3PLBA 2XBVA 1O3MA 1GG6B 2GGVB 1NRNH 5GXPA 3ZV9A 1L0ZA 4THNH 3SU0A 2V0BA 1O3AA 3KYFA 2AFQB 1V2LT 1OP0A 2BY9X 4ZUHA 4MPUA 4O97A 2EQNA 2W3KA 2W3IA 2A31A 3P8GA 2G5NA 1RD3B 1WQVH 1THSH 4YESB 2ZHQH 4DCDA 1C1VH 4BANB 1BQYA 2JH5D 1IQLA 2M2AA 4PROA 2JDID 1BBRE 4AORA 2WZQA 1EAXA 4AGKA 1ZZZA 5TJXA 1Y3UA 1GBFA 2OLGA 5EQSA 1F5LA 1TONA 6LPRA 3RXFA 1H1BA 4Q7YA 2PHBA 5EW2H 1K1LA 2F9BH 1O39A 1RIWB 3URCA 3RC4A 3F9EA 1THRH 5T3HA 2XCNA 1KLIH 3F1SB 3NWUA 2PSYA 2AYWA 1MH0A 1GHBF 3B9FH 1AKSA 1O5CB 4BAMB 3L3TA 5K0HA 3D23A 1W0KD 1AWHB 3LC5A 1HXEH 5EU8A 1AIXH 1TPSA 1NTPA 4JZ1A 4MNYA 2FOBA 2OUAA 1GI5A 3QUMP 5SGAE 4E7RG 1EASA 2VVUA 1AE5A 4GCHG 1KTTB 4B74A 2VIDA 2W7SA 1FX0B 4ASUD 3SGQE 3BG4C 1XM1A 1Y59T 3GY7A 2OC8A 1C5LH 1MAXA 3V7TA 3IWMA 1C5QA 1A46H 5DN6D 5JB9S 3P8FA 5DP8A 1GCTC 3TNSA 1EJAA 3ZZ8A 4K1TA 3WY8A 3E90B 1V2TT 2FESH 2GCTB 1SVPA 1G30B 4K1SA 1UCYH 3UNSA 1DS2E 4JK5A 3RXDA 3T28A 5GPIB 4HGCA 4RT1A 2WYJA 1TPPA 3M35A 3MH6A 1QJ7B 1SOTA 5L2YH 2KX4A 1T31A 1O2SA 1E79D 1B0FA 1XMNB 1GGDC 1O0DH 2KCAA 1TA2A 2PLXA 1BRBE 1V2VT 3T27A 2VIWA 2G51A 1O2QA 3KQEA 2QA9E 1A7SA 1IQFA 1NN6A 4U2WA 2A7HA 3G01A 1YPKH 2ZFSA 1VCQA 1LHFH 1GBTA 1NFYA 5ESTE 3M61U 2ZDLA 3ODFA 4NIXA 1LQDB 1TGCA 2CMYA 4U30A 5F8XA 1GL1A 1XVMA 2ZO3H 3IG6B 2CHAB 1JWTA 4JYVH 1E38B 2XOKD 3U69H 2BD8A 5C17A 3UR9A 3GCTF 4HG6A 4Z0KA 3FZZA 4DG4A 4Y7AA 4AFZA 1K1JA 7GCHF 3RXUA 2AHME 3AW1A 2YNAA 1TBZH 1O2ZA 3BV9B 1GBBA 1HBTH 2Z9KA 1AFEH 2BDAA 2WV4A 1O2VA 1KYNA 2VIPA 4MPWA 1XUKA 2BY5X 4AYYB 3MWIU 1OWEA 2P95A 2ZGCA 3PO1C 2ZQ1A 1ESBA 3L33A 3KQBA 3SUDA 3M7UA 1GBCA 3BTKE 4ABBA 1IQJA 2TBSA 2TIOA 2PKAA 3SV2H 4JCNA 3U9AH 1JRTA 1ELGA 4B6EA 1GBAA 2FWWA 2JIZD 3RXAA 2IOTA 2VGCB 4X1SU 3OE7D 1QB1A 5IYTA 5I46H 1ANBA 2HALA 1O5BB 1ZHPA 3DCLA 1GBLA 3RLWH 1S0RA 3N7DA 1FJSA 2V3HH 4Q63A 2FOMB 5DKMA 4NIWA 1C5UA 3ODDA 2VU8E 3BTQE 4I8LA 4SGAE 3T29A 1TNGA 2SGPE 3RLYH 4CHAC 3TH3H 1T32A 3TJNA 1O2LA 5GNDA 3WWFA 3PMJA 4JYTA 5K7RA 1QBVH 1H8IH 2Q6FA 2ZC9H 1AUTC 3U1IB 2H1UA 1ARCA 2RG3A 1QJ6B 1WOFA 7ESTE 3MI4A 3O8DA 1BRUP 1K28D 4UFEH 3RMOH 1A1RA 4B76A 4CRAA 3RXTA 2J38A 2C90B 2ZHDA 2KAIB 3PMBB 1PPHE 3A81A 1QZ8A 3MTYA 1SGQE 5FL7D 2FTMA 1O2YA 1PPGE 4OS5A 5A0CA 3BIVH 2XBWA 3RXVA 2PSXA 2BMGB 1C5TA 5EPYA 1OYQA 1GJAB 3UNRA 4GHQA 4XFQA 1TMUH 5C1YA 1G32B 3HK6B 2VWLA 1P01A 3LJOA 4XSKU 5F8ZA 2HPPH 2ZCLP 3SI4H 1HAVA 2P93A 3UIRA 2HVYB 2GDDA 1E34B 3FN8A 2OC7A 1IHSH 3PV4A 5FCRA 4FXGH 2FODA 4HTCH 2NU3E 4OS1A 1WTGH 3H7TA 2KM0A 3ZZ3A 2F9OA 5IK2D 4NZQA 2FDAA 5E2PA 1F92A 1QIXB 2PGBB 4I31A 4E06H 4AFQA 1ABJH 2ZDKA 4TY7A 1F7ZA 4NA9H 3P8OA 1CA0B 1TRMA 1F0SA 3GCTG 2VBCA 2XTTB 3AASA 4Y79A 1C9PA 2ANYA 3Q3XA 3A7YA 1YPHC 3SUEA 1ETTH 4YLUA 1MCTA 3U98H 2R2WU 2JKHA 1A3EH 4CH8B 3NPSA 2AMDA 1FNIA 1O3EA 3SW2B 1LPKB 2GX4A 1OWIA 8GCHG 4X1NU 1OXGA 1FXYA 4D8NA 4B2AA 4ZCNA 2QXIA 5EJLA 1C4V2 1G3BA 2FMJA 3ZVGA 1HIAA 4JMYA 3TJUA 2XRCA 3A87A 4TWYA 1GPZA 1VGCC 2SGQE 1DFPA 4CH2B 3A8DA 3ATWA 5E0JA 5FBEA 2QF4A 4OS7A 1TQ0B 2Y5FA 5J4SA 2ZNKH 1C5RA 2CHAC 1C1TA 3KQCA 1EB1H 2JH6D 2ZU5A 1TAWA 2C93B 4X8VH 4ZHLU 3M3VA 1QCPA 2P3TB 4RSPA 2D26C 3NXPA 4UD9H 5E8EH 1FDPA 1DOJA 2BDHA 1TPAE 3RXHA 1O2TA 3FKSD 2A5IA 1N8OB 1NRQH 1EQ9A 5A0AE 3U8OH 1P9UA 1HPGA 5GDSH 1GJ9B 3T2NA 3TJVA 1W7GH 2WPIS 5KEDA 1J15A 1EP5A 2FI4E 1Q3XA 3KCGH 4DVAU 1TNIA 1S6HA 1ZYOA 4XOJA 1BTWA 3VB3A 2OCVB 2BZ6H 2ZU4A 4FUBA 1E37B 1MCVA 1FPCH 1XUHA 1A2CH 4KELA 4JZEH 2BDYA 2FXRA 3MO9A 2OQ5A 2ZGJA 3H7OA 1LHCH 2UUYA 3RDZA 2NU2E 1HJAC 2BX3A 2UWOA 3LT3A 1MTVA 1C1NA 1XKAC 3UQOA 4KGAA 1Y3XA 1K22H 1UW7A 4IW4E 1L4DA 1V2UT 2FO9A 5FPSA 1UHBA 4B1TA 3RXOA 1D9IA 1EZSC 1TNLA 3OEHD 5DP6A 3RXLA 1SGPE 2HVXA 1DVAH 3H09A 4Z6AH 1GI9B 2GZ9A 2EI6A 1TRYA 4A6LA 4X1RU 1HIAB 4B71A 2SNVA 3GY5A 1WUNH 2HNTE 5TCAA 5C1XA 1A3BH 1HAPH 1LPGB 2DE8A 1GBMA 4YM9A 1AY6H 2H5DA 4K5ZA 2IN2A 4I33A 1GGDB 2Y7XA 1FUJA 2A45B 1C1PA 1MMJN 2J9NA 3VB5A 2FOAA 2ZEBA 1O2JA 2OTVA 4M7GA 2G4TA 3GCHB 4B6FA 1CBWB 2FX4A 2PTNA 4UEHH 1BA8B 1OX1A 5C0TA 4ABEA 4GAWA 4OS4A 1RGQA 1K1OA 3OTPA 1DT2A 3SZNA 1KIGH 4TWWA 1J9CH 3VXEH 4CRGA 4A1VA 7GCHG 1TFXA 1V2MT 2BQ7B 1MBMA 1AVXA 1HAOH 3MO3A 4ISNA 1FY5A 2YOLA 1FV9A 1PQ7A 2HPQH 1B5GH 3U8RH 1DANH 1BTUA 1KMHB 3C1KA 2THFB 3BF6H 4AZ2B 4D9QA 1TNJA 4X1PU 3PRBA 3B23B 4D7GA 3CS0A 2PR3A 1GI4A 2F91A 2BDCA 2RFKC 4JZFH 2GCHF 3P8NA 1SQTA 3TGJE 1P3EA 1FZZA 1K1IA 1P05A 1ZOMA 1ZLRA 1BOQA 4ZH8A 4NA7A 3TGIE 1GI1A 1DUAA 2C8WB 2FLBH 1C5NH 1SGRE 1JBUH 1GI0A 3GDUA 1AVGH 2O8LA 3A83A 1HXFH 3A8CA 1ANEA 1ELCA 2BLQA 1VITH 3JZ2B 1YPGH 1GVLA 1SI5H 5HM9A 4I7YH 2GZ7A 2AEIH 1IHTH 1COWD 4LZ4B 3ESTA 1EOLA 9ESTA 4ISOA 1YPEH 4D76A 5A2MH 2ZCKP 1HGTH 1AWFH 5J4QA 1H9LB 2ZWLH 2IPHA 1GDUA 3S9AA 1ELBA 3A7WA 1V2JT 5DG6A 2VB0A 2BB4A 2FP7B 4AN7A 8KME2 1ZTJA 1SBWA 2I6SA 1XVOA 1O2MA 2WHXA 1ZHMA 2GV6A 4CR5A 4Y76A 1IQEA 1YLCA 2PV9B 2BOHB 2Y5GA 2ZDMA 2R3YA 1G2LA 3QLPH 2VWNA 1P2IA 1QTFA 2GTBA 1W0JD 1C2FA 3QWCH 1E1QD 2O8WA 1TGBA 1CHOG 5A8ZA 3AK5A 2AIQA 1A5IA 1SLWB 1GHBG 1H9IE 1UVUH 3E6PH 2KCYA 3DFLA 2A4OA 1DY9A 3BG4B 1TNHA 3M7QA 1ZJKA 1NM6A 1LPZB 1ESAA 1CGJE 2GCTC 2WINI 4DGJA 3GYMA 4NIVA 1O5DH 1Z8IB 3EAJA 3PLKA 1RTFB 1NRPH 2BY6X 4INHA 4Y71A 2RA0A 5EQQA 3S9CA 1OS8A 2ZHFH 2VVCA 3BTTE 4UFGH 5HIYA 3SNEA 6GCHG 2H5CA 5C5NA 5JBTA 3TLOA 5JYIA 3A84A 1W13U 2AMPA 3TJOA 3RMMH 5C3NA 2QXGA 3SV6A 4FUCA 3SU2A 4GHTA 2OBOA 1IOEA 2J97A 4IC5A 1SGYE 1O3LA 2BLOA 2ZDNA 5HYOA 1D6WA 1SSXA 1BT7A 3TU7H 5EG4A 2Z3EA 5FX6A 5GWZA 1O2RA 1QL8A 1AI8H 2H6MA 2PGQB 1H8ED 1NFXA 4TPIZ 1EZQA 2SFAA 3E3TA 3EA7A 4NG9H 1CGIE 2OP9A 1UTOA 1WBGB 2RDEA 2SGDE 1W12U 1KTSB 2SGFE 4NWLA 1O2UA 4Q7ZA 2G00A 1LCYA 2VWMA 1EJNA 3GCNA 3EYDA 5GCHG 3UFAA 1DXWA 3W94A 4B73A 1S6LA 2KFWA 5JBAS 1ELTA 2WV5A 5DK1A 4MPXA 2ZI2H 1C1OA 3HKJB 1BUIA 3MO6A 1EX3A 1PYTD 4X2YA 3P95A 3M5OA 1HDTH 4ZROA 8LPRA 1CT4E 5C0UA 4X8SH 2BDIA 1YPJH 1BZXE 1H4WA 1JIRA 3B8JA 3CENA 1P2QA 1O5EH 1YBWA 2FIRH 2YMSB 1GCDA 4XBCA 3VGCC 1C5PA 4O3TA 5CMXH 4GSOA 3GCHC 2A2XH 2FOEA 1GHXH 3OU0A 1QRXA 3TGKE 1TX6A 1EAIA 4TYDA 1Y8TA 3E0NB 4X0WU 5HGGA 1UTJA 1GVKB 1BTHH 3TITA 3MYWA 1DICA 1C9TA 1K21H 4FU8A 2BY8X 1BB0B 2BZAA 1BJVA 1ANDA 4K2YA 1YCPM 1C2MA 1O35A 1QL7A 1NRRH 2ZU1A 4FUFA 3PTBA 4AFUA 5I25A 1BIOA 4RT0A 3SQEE 1TA6A 1MKWK 1GJCB 1PQ8A 1ZPBA 2BHGA 1C5SA 2BD3A 2ZFFH 1D3PB 4BAQB 1CT2E 1KXCA 3SJKA 1PJPA 3F3BA 1AUJA 4MLFB 3PRDA 3A7XA 2XWAA 3M36A 5FPYA 2YMSC 1TABE 1ZPZA 1OP2A 2BVRH 1G36A 1GI8B 4IC6A 3FZDA 1MKXK 4CHAB 4ISHH 1BTZA 1Y5AT 3U8TH 2J34A 3MNBA 4KTCA 3F68H 2BD7A 2G4UA 2VIOA 2OQUA 4XRNA 1QRWA 1FAXA 1GBEA 1Z7KA 1P04A 1DWEH 1C5VA 4O3UA 3MU8A 1KXBA 1ELDE 1QQUA 3LIWA 3P92A 2GJGA 5L2ZH 1W2KH 3F0OA 5A8XA 3K65B 4ZMAH 3RC5A 1J16A 3ITIA 3HKIB 2AS9A 1LVMA 3E1XB 1T8OA 4RN6A 3DHKH 4AC9A 1RTKA 4TY6A 3TK9A 1KXDA 3N7EA 2RDLA 1G3DA 3ZVFA 4E05H 1CHGA 1ARBA 5JBBS 3I29A 3BTDE 2P3FH 3LGIA 1NROH 4Y0ZE 4IMZA 4XE4A 1EZXC 1OKXA 3HK3B 2DE9A 3CS7A 3FANA 2YMSD 2HLCA 1V2QT 3QGJA 2VWOA 1W10U 2O8UA 1OHHD 2LPRA 2NU4E 4K8YA 3SNCA 2KZ4A 3NCLA 2SGAA 3DUXH 1O2PA 3FP8E 1SQOA 2GCHG 2KAIA 4X2WA 2PW8H 1V2RT 2CGAA 3SYJA 1F5KU 2JETC 1HB0B 2SGEE 1Z1IA 1QA0A 4WWYA 1KSNA 1NESE 1O32A 1C2KA 3F2FA 2ODQA 3RXEA 1Y3WA 2J94A 3EA9A 2PWXA 2GVFA 3RXMA 8ESTE 1ZSKA 4GVUA 4ABGA 1Z6JH 4OGYA 2ZFRH 1VKYA 1C5ZB 1HAXB 3RP2A 5BRRE 4ABFA 1GDNA 4R8TB 3MNCA 4XBBA 1P06A 4YOGA 4AYVB 1P3CA 2R0LA 4O9VA 3TH4H 4Y6DA 1TLDA 3SUGA 3GY4A 1C4U2 1ETRH 3GY8A 1UCYK 4ABDA 3PM3A 4AB9A 2EA3A 2FM2A 2Y7ZA 2A0QB 4BTIB 3V12A 3GICB 1YYY1 1GHYH 4HZHA 1J14A 1H8HD 3GYLB 2F83A 3UWJH 2VVVA 4SGBE 2WV9A 1CBWC 1ZSJA 2Y82A 1UK3A 5T6DA 2AGIX 3KEEA 1CVWH 1Q31A 1GWAA 4MNXA 4IMQA 3ZZBA 1INCA 5LPRA 3EE0B 1JRSA 3IITA 3KF2A 3K2UA 4BXWA 2WPHS 2STBE 1GCTB 3I77A 3LH1A 1XUFA 4ZAEA 1O33A 1UO6A 1TYNA 5CHBA 3L6PA 4UONA 1BCUH 1LTOA 3OAAD 1SG8B 6GCHF 1O2XA 2XC4A 1RJXB 5EXNA 1EXFA 1DITH 1DDJA 4IBLH 1SQRA 4NFFA 1K2I1 3M3TA 1RXPA 3KQDA 1LHEH 1MTUA 1V2ST 4OS6A 3BN9A 2V3MA 4X1QU 3SU4A 5HKKD 5FX5A 2J95A 4K1EA 1GBHA 3F0PA 5ETXA 3S7HB 1AKSB 3ZIAD 1AN1E 1GI2A 1GBDA 3E8LA 3KQ5A 1H9HE 2IJOB 1TX8A 3A88A 1KY9A 1LVYA 2ZGBH 3RXGA 1HAHH 2ALVA 1F0RA 3FP6E 1F0TA 5C1UA 2BM2A 3PYHA 3TNTA 2G52A 1C4Y2 4AG1A 1UK4A 3SOSA 4K60A 1SFIA 1MZAA 1SPJA 4GCHF 3UUZA 2P3UB 1FY8E 1NBME 1ELVA 1HJAB 1DSTA 3MNXA 2TGAA 2G55A 4F48B 1SOZA 3HATH 4OS2A 2ZG0H 1QURH 3DSOA 1GJDB 1LHGH 1ZRBA 3SHCH 1TBQH 2ZTYA 3V3MA 2B7DH 3I78A 1VCPA 1O3HA 3T25A 2H2ZA 1PPFE 2K8IA 1O37A 2Z9JA 2WYGA 5B6LA 1PFXC 4A1XA 1LVOA 3OEED 3GS9A 3TPIZ 2BYAX 1YLDA 3VB4A 3ZVBA 2HWLB 1ABIH 1VITF 5DP5A 3UREA 2VNTA 4ABAA 1ZTKA 1HAZB 1O5AB 1AE8H 1ZTLA 1FIZA 4I8JA 2G8TA 4WXIA 3A85A 2BVXH 3RXKA 1ANCA 4A1TA 3FOAA 4NFEA 1O3GA 1P2OA 2Y6TA 1CGHA 4K69A 1BTPA 1TBRH 1EATA 3EE7A 2C8YB 1Y3YA 1KXFA 2BLWA 1AVWA 2BDBA 1GMDG 2FYQA 3EGKH 1GJ4H 3MU1A 5PTPA 1O3NA 2EEKA 1YY3A 2FS8A 3AAVA 3F9FA 1WTHD 2QC2A 1OWJA 1NRSH 3T26A 2F43B 2XYAA 3RXQA 1PPCE 2VIVA 2BLVA 2PKAB 1V2WT 2J4IA 3Q76A 4KTSA 2ESTE 4A7IB 1QRZA 3UNQA 5A0BA 2G81E 4MDSA 4ZKOU 3MU4A 2NU1E 1GJ8B 1W11U 2XBYA 3RU4E 3SNAA 1P03A 1EFRD 1AGJA 3MOCA 1SQAA 1FAKH 4D9RA 1A0HB 4ASHA 2CV3A 4P00A 1NY22 2H9TH 1FIWA 4YO9A 1LO6A 1B0EA 1LKAA 2BXTH 2P59A 3H5CB 2VJ1A 3SZEA 3F9HA 4JYUH 1FY1A 4I8KA 2B8OH 5CHAC 1H8DH 5BPEA 6ESTA 2QIQA 1BHXB 4U32A 1BBRK 2NU0E 3MNSA 3VPKA 4JZIA 1EOJA 3MH4A 1Z1JA 2J5UA 1UTQA 3ATIA 3ATMA 1SLVB 1LHDH 1NFUA 3OSYA 3D65E 4CRBA 4DOQA 3SHAH 4NSVA 3UAIC 2SNWA 4AB8A 1TPOA 1DUEA 1IQGA 5IDKA 1QBOA 1GG6C 2KR7A 1G3EA 4CR9A 1GJ6A 1HAGE 4LOYH 5GJ4B 1W3CA 2VGCC 2CK3D 1MKXH 1VCWA 3OFND 1BBRH 2F9NA 2HRVA 3ZZ7A 1L1GA 2YNBA 4OGXA 4X8UH 3UR6A 4X6MA 2J98B 5E2OA 5AVDA 1GHAF 3MQKC 2FYRA 3RMLH 1UVTH 1GMDF 4ACAA 1QQ4A 2QYIA 1MTNB 3LONA 2B0FA 1VITG 2VINA 5AHGH 1TGTA 1IQNA 1C2HA 3LDXH 1GHZA 2EY4C 3SI3H 3SU5A 4OM9A 2ZA5A 1M9UA 1SGNE 1UTNA 1RIWC 1GL0E 1BMLA 4CBOA 1ZR0A 3A80A 1QB9A 1XKBC 2B9LA 5CHAB 3S0NA 1S83A 1C1UH 3PV5A 1E35B 3F2HA 3RXJA 3VB7A 3EQ0H 2BD9A 3NRLA 2J98A 3UY9A 3SO3A 1HFDA 1SFQB 1UK2A 3BG8A 1YWUA 4J1YA 3F2GA 1RTLA 2ZTXA 4DURA 3A82A 1NZQH 4DJZB 1TIOA 3FFGA 1CSOE 1AD8H 5FBIA 5E0GA 4WH8A 3P17H 2HNTF 3PB1E 5JBCS 1TB6H 4TSFD 1YPHE 4NWKA 3SQHE 2FPZA 4FUHA 4WH6A 1LQEA 4DW2U 1Y3VA 1L1JA 2M5TA 2TGTA 3GDVA 2W7UA 4NGAH 1QA7A 4TT3D 2P8OC 3BEUA 2W5EA 1T8MA 1P10A 3FO8D 2QXHA 1BTYA 1XUGA 1TRNA 5HXFA 2F9UA 4LXBH 3PLPA 1DLEA 1SMFE 2Q1JA 2XXLA 3FP7E 8GCHF 3VXFH 4X6NA 3F9GA 1J8AA 4MPVA 1L4ZA 1ELEE 3E0PB 3SJOA 3RXRA 2R9PA 2FX6A 3VEQB 2BQ6B 2VIQA 1JXPA 3KHVA 1C2IA 1SL3A 4DT7B 1MBQA 2V7QD 2WUBA 5HIZA 1S5SA 3QN7A 4CBNA 1NPMA 2UWPA 3BEFB 2LNCA 5LPEA 1U6QA 3PWCA 4E7NA 1JMOH 1Y5BT 1JIMA 3V13A 3AW0A 1AHTH 4ACBA 5HM2A 5ESBA 1TQ7B 1UTLM 4Y0YE 1WQSA 1XUIA 2K1QA 2WPJS 2ULLA 4I8HA 1CA8B 5T1VA 2NWNA 1O31A 2L6OA 2Y5HA 3C27B 3ELAH 1HAYB 1FY4A 3KL6A 1UVOA 2ZTZA 2XC5A 5FPTA 1MD8A 1P57B 1SLXB 3ATKA 6CHAB 2FLRH 1YP9A 3P6ZB 4BOHA 1CO7E 3OYPA 2A4RA 4GLYA 1N1LA 1PPEE 3JZ1B 2P16A 1P2KA 2Z9LA 1BHXF 4F4OC 2ZGXH 1G9IE 3R3GB 2FOCA 1C5YB 5DJ7A 1EUFA 3SJIA 1MTSA 3LH3A 1OWHA 1CA0C 2CJIA 1OP8A 2TGDA 2UUJB 3ZZ9A 4A92A 6CHAC 3GOVB 1QY6A 3URDA 5CDFE 4D7FA 1S0QA 4H6TA 3WWBA 3A8BA 1YM0A 3SU3A 4GUXA 4CRCA 2BD4A 1EAUA 1ELFA 4AOQA 2LP6A 2PTCE 2R2MB 1F2SE 3VGCB 1YCPK 1TGSZ 2Z9GA 4IN1A 3TK5A 1FN6A 1SLUB 1GJ5H 1S82A 4UE7H 4WVPE 1ZSLA 2O8TA 1P11E 2BX4A 7KMEH 2KCPA 1QBNA 1OSSA 1O2IA 5EPNA 1O2NA 1FONA 1K1MA 3QK1A 3RU4T 1F0UA 1SGIB 1UMAH 3Q77A 2ZCHP 2FZZA 3EDXB 4Y7BA 2AH4X 4IS5A 1K9OE 4FVDA 4H4FA 3ZZ5A 2ZFQH 2QN5T 3LGTA 1SGFA 1C1QA 4FETA 3QGNB 1SHYA 3DT0H 1LDTT 2GZ8A 1G3CA 1MU8B 1GI3A 1GMHG 4ISIH 4QT8C 4NSYA 3Q3YA 2W26A 2CF8H 1SGFG 1GDQA 1HNEE 3K6ZA 1YPLH 2GT7A 3PWBA 4BTUB 1ZHRA 2QGRA 4YOIA 1LKBA 4ZHAA 4MNVA 3RXBA 1SGCA 3OY5U 3LGUA 2A4GA 4FU7A 1ETSH 1A5HA 3LGYA 1IQIA 1TMTH 2ZU3A 1BRCE 1RFNA 3M5MA 1EZUC 1KDQA 3STIA 1WAYB 2GP9B 3GDSA 5EW1H 3TK6A 1OOKB 4B2BA 4X6OA 1EAWA 1XUJA 2G5VA 4NCYA 4INKA 2TGPZ 4Q4LA 1HCGA 1HRTH 3UQVA 3MMGA 1C1RA 2C4FH 1O3PB 5KECA 4DY7B 1KXAA 4Q80A 2A2QH 1DM4B 1C2DA 2AGGX 2Y80A 1QNJA 2F3CE 2OK5A 3RXIA 2BTCE 1O2WA 1G2MA 2PUXB 5C67A 2ZFTA 4Y8ZA 3ZZ4A 2PKSC 4KKDA 2ODYB 4Y8YA 1EJMA 3EA8A 4WF8A 1AO5A 4FUEA 3S7KB 3ZV8A 2IJD1 1S81A 2FI3E 2ZFPH 4XBDA 3SU1A 1AB9B 1DXPA 5C2ZA 3ZYDA 1P12E 1SGEE 4BAOB 4HFPB 1ZMNA 1BMAA 2W6ID 3TH2H 1FY3A 5CE1A 3MU0A 3OY6U 4YOJA 1C2GA 2JH0D 1MABB 2ZPSA 3QTOH 1O3KA 2ZF0H 2ZZUH 1SGDE 4X8TH 1KXEA 3O8RA 3A89A 3TIUA 4UFFH 4AG2A 1K1PA 1V2OT 1QB6A 4JZDH 3A86A 5TCCA 1IQHA 1SC8U 1TNKA 1VJ9U 1QFKH 4Y10E 3RXPA 3BTEE 1AZZA 1DPOA 5G4BA 1ZRKA 1NBMD 3BTWE 3KGPA 1UHBB 5GCHF 1A0JA 5DPAA 4X2VA 1OPHB 1A5GH 4ZXXH 4ZKSU 1WSSH 5C5OA 5F8TA 3BIUH 4Y11E 1O5GH 5JDUB 1AFQB 3ATLA 1T7CA 3VFEA 1YLNA 4BNRA 2A1DB 2A7CA 1HJ9A 1O38A 4H6SB 3A7ZA 4VGCB 2GDEH 1PPZA 2J92A 2ZDVH 4FU9A 1C5OH 3SJ9A 1Z8RA 4DIIH 3MFJA 3RM2H 3RUOA 4Q7XA 5FHTA 1P2MA 3DD2H 4B75A 3A7TA 4TPYA 2ILNA 1MD7A 2IPQX 2GT8A 1PPBH 1WXRA 1AZ8A 1MQ5A 2P8OB 1B7XB 3BTFE 4IGDA 3BEIB 4Y8XA 1FN8A 1GHVH 2BD2A 5GIBA 1YPMH 4DT4A 4YLQH 1O3OA 4F55A 2WPDD 1DWCH 1KLTA 5KGOA 1UTKA 1OYTH 2ZPRA 3FAOA 2PUQH 1S85A 5HMAA 3W95A 2WPLS 4WY3A 4BTTB 1QHRB 4WMFA 2FEQH 2D8WA 1P0SH 3KN2A 3V0XA 3PTNA 5DP4A 5T6GA 2RA3A 2FOHA 4MG3A 2JETB 5EQRA 3OTJE 1QJ1B 5EIYA 3SV7A 1VJAU 1CHOF 1O3BA 2V3OH 2C3SA 1A61H 3OX7U 1MTNC 1MQ6A 5A09A 2BDGA 2QAAA 4ZKRU 5JPMH 1NU7B 4X6PA 3LC3A 1WCZA 1O5FH 2HOBA 5H4IB 1ZJDA 1HYLA 2C8XB 3LOXA 3UTUH 1TOMH 2GKVE 1CU1A 1TE0A 1DWDH 9LPRA 4Z1MD 2V6NA 1ESTA 2ANWA 3SNBA 5EXLA 2HLDD 1K1NA 2Z9IA 5LH8A 3RU4D 1SGTA 1W8BH 3LKWA 1DSUA 1O3IA 2PFEA 1GBIA 4NZLA 1W0ZU 1E0FD 1GBJA 5FAHA 4FUIA 4FUGA 2XC0A 4FUJA 5F53A 3S69A 1WYKA 2DUCA 5ABWA 1L2EA 2ZP0H 4ABJA 1T4VH 3KIDU 2Z7FE 1GMCG 4GPGA 3HGPA 1WV7H 1RRKA 4K8BA 2Z6BD 3QX5H 3F6UH 3ZZDA 5C20A 2OINA 1HAVB 1V2NT 3UWIA 1O3DA 2PP6A 1NS3A 3ZZAA 2EC9H 1W14U 4ABIA 1ACBE 3M7TA 4A5TS 2L74A 1C1WH 2KCOA 3QDZB 1UTMA 2A4QA 3A7VA 2F9PA 7LPRA 4RKJB 4P02A 2HNTC 1VGCB 3QZRA 2AERH 3SORA 1C1MA 5T6FA 3CP7A 2ZGHA 2PKSB 2V35A 2QF0A 1D4PB 1BMMH 1O30A 4WXVA 1KDQB 3RXCA 4LZ1H 1D3TB 4WMEA 3E91A 2Y81A 2Q6DA 4CREA 2OC0A 2XCFA 1AB9C 4R0IA 1NC6A 4WJG2 1Q2WA 2XNDD 1UVSH 3PROA 4FUDA 4MQAA 4YXWD 1F5RA 4BAKB 4CRDA 2J2UA 1L1NA 3ZVAA 1ID5H 3M3SA 1ZGVA 1S6FA 4MNWA 1THPB 4IN2A 1O36A 4O03A 1P2JA 2ZDAH 1C5XB 5DP7A 2AMQA 3M5LA 1V6DA 1UTPA 1Y5UT 3AAUA 4K3JA 5L30H 1BJUA 1GHWH 1Z6EA 4FVBA 3BTHE 1C5MD 3HGNA 3UPEA 2OXSA 1RS0A 1GBKA 2Z94A 4YTAA 3SJ8A 1UJ1A 2P94A 3UOPA 1LVBA 3VG8A 4YZUA 2TRMA 1AFQC 4LK4A 2HGTH 3QZQA 5LPFA 3SU6A 2QXJA 1CT0E 4I32A 2QF5A 1A4WH 4VGCC 1OWDA 4ESTE 2JJ1D 2ANMH 1ELAA 3U28C 3ZZ6A 2GMTB 4XDEA 1XXDA 3Q3KA 2BVSH 1O3JA 2OC1A 3SV8A 3RMNH 4Q2KA 4BXSA 2XNIA 1ORFA 2AGEX 4UDWH 3PO1B 2W6JD 1EB2A 1TX7A 4CRFA 3U1JB 1FLEE 2ALPA 3NKKA 4YT6H 2CF9H 5DGJA 3S9BA 2QF3A 1P8VC 3PMAB 1P02A 1MKWH 4HI3A 3DSGA 1SR5C 3A8AA 5JB8S 1P9SA 2D1JA 2OBQA 1HV7A 1SB1H 1N8OC 2EI7A 4MTBA 3BTME 3W1EA 5A8YA 4ZXYH 4DIHH 3Q00A 1MUEB 2FOFA 3KYGA 1P09A 3LGVA 1O2HA 1V2PT 1S84A 3HPTB 1GVZA 5DSFA 2BD5A 1ZMLA 3T5FH 1CE5A 4UFDH 2F4LA 1AQ7A 3GISB 1N6YA 2Z3CA 1PQAA 3NUMA 3ZYEA 1JOUB 2XWBI 1CQQA 3SGAE 4B2CA 3R0FA 1Z71A 2O9QA 5C94A 3MH5A 2ODPA 2GD4B 1MAYA 3LGWA 2QE7D 2B5TB 1BTXA 1V3XA 2QCYA 2LELA 3QTVH 2A32A 2RCEA 2Q6GA 2ZU2A 4WMDA 1G37A 1O2GH 2WUCA 3GCOA 2BOKA 1C2EA 2WPKS 1O2OA 4NA8A 1FQ3A 2WPMS 1NO9H 2GV7A 2BY7X 3K9XB 3BSQA 1SKYE 3M37A 1QR3E 1W0YH 1WU1A 3DFJA 1D3QB 1TALA 5LGOA 2ZPQA 1BITA 2ANKH 3RC6A 1Z8GA 2D2DA 1IQMA 3PV2A 2WSSD 1N6XA 4NIYA 1O3CA 1YC0A 4ABHA 1W7XH 2FS9A 3ZVCA 2UUFB 1EPTC 1DWBH 2A5AA 3MHWU 1O34A 3D49H 3QO6A 1BDAA 2CN0H 1ZGIA 3SUFA 3ENSB 5F6MA 5DP3A 1TWXB 3D62A 4X2XA 1T4UH 1TGNA 4ZKNU 2ZHEH 3ZVEA 2VH0A 2R0KA 4H42U 1C5WB 5EGMA 3PMHB 3K6YA 1EKBB 1GHAG 5EODA 1QL9A 2UWLA 4ZHMU 2TPIZ 4J2YB 3UB0A 5EJZA 2EI8A 4AX9H 1DE7H 2A5KA 2BXUH 2C8ZB 3ZZCA 2XW9A 2FOGA 1AU8A 1GMHF 5AFZH 5EOKA 1WDIA 2VH6A 3TVJB 3BTGE 4BAHB 4INLA 1NT1A 1VZQH 2CXVA 4KTUA 2R3UA 1GI7B 3LPRA 1EPTB 1J17T 4I8GA 3N7OA 5EXMA 4AFSA 4U01A 4F49A 1BMFD 1MTWA 2Z3DA 1HJ8A 1SHHB 3KNXA 3SNDA 1IAUA 1C2LA 4FOUC 3NZIA 3WW7A 1K0HA 3NK8A 1BMNH 4RKOB 1FMGA 3AVZA 3P70B 1UCYE 1VR1H 3MU5A 1GJBB 1NFWA 3SV9A 1TOCB 2ZHWH 2FTLE 2ZKSA 5AFYH 3O8CA 3LU9B 3RM0H 1PYTC 1IQKA 2A7JA 2AIPA 2F9VA 3SBKA 5EJ1A 5F03A 1T8NA 2BQWB 1GI6A 2O8MA 1D6RA 1E36B 2ZIQH 1OWKA 2H9EH 3CNRA 3ZVDA 2UUKB 4YT7H 1DY8A 1E1RD 1P2NA 1O2KA 3FVFB 1D3DB 5FXLA 1HAIH 5DO4H 5L6NH 3T62A 1EP6A 2H9HA 3M5NA 2OD3B 1C2JA 2JJ2D 1TMBH 1DLKB 1ZMJA 2ASUB 2STAE 1YKTA 3GY6A 3MH7A 1O3FA 3RXSA 2QV1A 5AF9H 4JK6A 5B6OA 1YF4A 3O8BA 1A0LA 4MVNA 2XBXA 1NU9A 3E16B 1HUTH 5DP9A 1GMCF 4XD7D 2ZECA 1PQ5A 3GY2A 4RI0A 3SN8A 3SGBE 2I6QA 3DSPA 1FPHH 1MZDA 3DA9B 3VB6A 5E0HA 5FCKA 1UVPA 2FI5E 1T8LA 1LMWB 3N99A 3STJA 1HLTH 1QGFA 1XX9A 1DX5M 1C1SA 3UOUA 4I86A 3GY3A 1Z8JB 2ZQ2A 3LJJA 2K0QA 1X7AC 4KP0A 2GMTC 1V2KT 1FI8A 1AMHA 1GJ7B 1ZPCA 1BRAA
chains in the Genus database with same CATH topology
1KLJH 1YCPH 4ISLA 4AGJA 1XXFA 1YGCH 2QY0B 1MU6B 1EPTA 3PLBA 2XBVA 1O3MA 1GG6B 2GGVB 1NRNH 5GXPA 3ZV9A 1L0ZA 4THNH 3SU0A 2V0BA 1O3AA 2AFQB 1V2LT 1OP0A 2BY9X 4ZUHA 4MPUA 4O97A 2W3KA 2W3IA 2A31A 3P8GA 2G5NA 1RD3B 1WQVH 1THSH 4YESB 2ZHQH 4DCDA 1C1VH 4BANB 1BQYA 2JH5D 1IQLA 4PROA 4AORA 1BBRE 4AGKA 1EAXA 1ZZZA 5TJXA 1Y3UA 1GBFA 2OLGA 5EQSA 1F5LA 1TONA 6LPRA 3RXFA 1H1BA 4Q7YA 2PHBA 5EW2H 1K1LA 2F9BH 1O39A 1RIWB 3URCA 3RC4A 3F9EA 1THRH 5T3HA 2XCNA 1KLIH 3F1SB 3NWUA 2PSYA 2AYWA 1MH0A 1GHBF 3B9FH 1AKSA 1O5CB 4BAMB 3L3TA 5K0HA 3D23A 1AWHB 3LC5A 1HXEH 5EU8A 1AIXH 1TPSA 1NTPA 4JZ1A 4MNYA 2FOBA 2OUAA 1GI5A 3QUMP 5SGAE 4E7RG 1EASA 2VVUA 1AE5A 4GCHG 1KTTB 4B74A 2VIDA 2W7SA 3SGQE 3BG4C 1XM1A 1Y59T 3GY7A 2OC8A 1C5LH 1MAXA 3V7TA 3IWMA 1C5QA 1A46H 5JB9S 3P8FA 5DP8A 1GCTC 3TNSA 1EJAA 3ZZ8A 4K1TA 3WY8A 3E90B 1V2TT 2FESH 2GCTB 1SVPA 1G30B 4K1SA 1UCYH 3UNSA 1DS2E 4JK5A 3RXDA 3T28A 5GPIB 4HGCA 2WYJA 1TPPA 3M35A 3MH6A 1QJ7B 1SOTA 5L2YH 1T31A 1O2SA 1B0FA 1XMNB 1GGDC 1O0DH 1TA2A 2PLXA 1BRBE 1V2VT 3T27A 2VIWA 2G51A 1O2QA 3KQEA 2QA9E 1A7SA 1IQFA 1NN6A 4U2WA 2A7HA 3G01A 1YPKH 2ZFSA 1VCQA 1LHFH 1GBTA 1NFYA 5ESTE 3M61U 2ZDLA 3ODFA 4NIXA 1LQDB 1TGCA 2CMYA 4U30A 5F8XA 1GL1A 1XVMA 2ZO3H 3IG6B 2CHAB 1JWTA 4JYVH 1E38B 3U69H 2BD8A 3UR9A 3GCTF 4Z0KA 3FZZA 4DG4A 4Y7AA 4AFZA 1K1JA 7GCHF 3RXUA 3AW1A 2YNAA 1TBZH 1O2ZA 3BV9B 1GBBA 1HBTH 2Z9KA 1AFEH 2BDAA 2WV4A 1O2VA 1KYNA 2VIPA 4MPWA 1XUKA 2BY5X 4AYYB 3MWIU 1OWEA 2P95A 2ZGCA 3PO1C 2ZQ1A 1ESBA 3L33A 3KQBA 3SUDA 3M7UA 1GBCA 3BTKE 4ABBA 1IQJA 2TBSA 2TIOA 2PKAA 3SV2H 4JCNA 3U9AH 1JRTA 1ELGA 1GBAA 2FWWA 3RXAA 2IOTA 2VGCB 4X1SU 1QB1A 5IYTA 5I46H 1ANBA 2HALA 1O5BB 1ZHPA 1GBLA 3RLWH 1S0RA 1FJSA 2V3HH 2FOMB 5DKMA 4NIWA 1C5UA 3ODDA 2VU8E 3BTQE 4I8LA 4SGAE 3T29A 1TNGA 2SGPE 3RLYH 4CHAC 3TH3H 1T32A 3TJNA 1O2LA 3PMJA 4JYTA 5K7RA 1QBVH 1H8IH 2Q6FA 2ZC9H 1AUTC 3U1IB 2H1UA 1ARCA 2RG3A 1QJ6B 1WOFA 7ESTE 3MI4A 3O8DA 1BRUP 1K28D 4UFEH 3RMOH 1A1RA 4B76A 4CRAA 3RXTA 2J38A 2C90B 2ZHDA 2KAIB 3PMBB 1PPHE 3A81A 3MTYA 1SGQE 2FTMA 1O2YA 1PPGE 4OS5A 5A0CA 3BIVH 2XBWA 3RXVA 2PSXA 2BMGB 1C5TA 5EPYA 1OYQA 1GJAB 3UNRA 4GHQA 4XFQA 1TMUH 5C1YA 1G32B 3HK6B 2VWLA 1P01A 3LJOA 4XSKU 5F8ZA 2HPPH 2ZCLP 3SI4H 1HAVA 2P93A 3UIRA 2GDDA 1E34B 2OC7A 1IHSH 3PV4A 5FCRA 4FXGH 2FODA 4HTCH 2NU3E 4OS1A 1WTGH 3H7TA 3ZZ3A 2F9OA 4NZQA 2FDAA 5E2PA 1F92A 1QIXB 2PGBB 4I31A 4E06H 4AFQA 1ABJH 2ZDKA 4TY7A 1F7ZA 4NA9H 3P8OA 1CA0B 1TRMA 1F0SA 3GCTG 2XTTB 3AASA 4Y79A 1C9PA 2ANYA 3Q3XA 3A7YA 1YPHC 3SUEA 1ETTH 4YLUA 1MCTA 3U98H 2R2WU 2JKHA 1A3EH 4CH8B 3NPSA 2AMDA 1FNIA 1O3EA 3SW2B 1LPKB 2GX4A 1OWIA 8GCHG 4X1NU 1OXGA 1FXYA 4D8NA 4B2AA 2QXIA 1C4V2 1G3BA 2FMJA 3ZVGA 1HIAA 4JMYA 3TJUA 2XRCA 3A87A 4TWYA 1GPZA 1VGCC 2SGQE 1DFPA 4CH2B 3A8DA 3ATWA 5E0JA 5FBEA 4OS7A 1TQ0B 2Y5FA 5J4SA 2ZNKH 1C5RA 2CHAC 1C1TA 3KQCA 1EB1H 2JH6D 2ZU5A 1TAWA 2C93B 4X8VH 4ZHLU 3M3VA 1QCPA 2P3TB 4RSPA 2D26C 3NXPA 4UD9H 5E8EH 1FDPA 1DOJA 2BDHA 1TPAE 3RXHA 1O2TA 2A5IA 1N8OB 1NRQH 1EQ9A 5A0AE 3U8OH 1P9UA 1HPGA 5GDSH 1GJ9B 3T2NA 3TJVA 1W7GH 2WPIS 1J15A 1EP5A 2FI4E 1Q3XA 3KCGH 4DVAU 1TNIA 1S6HA 1ZYOA 4XOJA 1BTWA 3VB3A 2OCVB 2BZ6H 2ZU4A 4FUBA 1E37B 1MCVA 1FPCH 1XUHA 1A2CH 4KELA 4JZEH 2BDYA 2FXRA 3MO9A 2OQ5A 2ZGJA 3H7OA 1LHCH 2UUYA 3RDZA 2NU2E 1HJAC 2BX3A 2UWOA 3LT3A 1MTVA 1C1NA 1XKAC 3UQOA 4KGAA 1Y3XA 1K22H 4IW4E 1L4DA 1V2UT 2FO9A 5FPSA 1UHBA 4B1TA 3RXOA 1D9IA 1EZSC 1TNLA 5DP6A 3RXLA 1SGPE 2HVXA 1DVAH 4Z6AH 1GI9B 2GZ9A 2EI6A 1TRYA 4A6LA 4X1RU 1HIAB 4B71A 2SNVA 3GY5A 1WUNH 2HNTE 5TCAA 5C1XA 1A3BH 1HAPH 1LPGB 2DE8A 1GBMA 4YM9A 1AY6H 2H5DA 4K5ZA 2IN2A 4I33A 1GGDB 2Y7XA 1FUJA 2A45B 1C1PA 1MMJN 2J9NA 3VB5A 2FOAA 2ZEBA 1O2JA 2OTVA 4M7GA 2G4TA 3GCHB 1CBWB 2FX4A 2PTNA 4UEHH 1BA8B 1OX1A 4ABEA 4GAWA 4OS4A 1RGQA 1K1OA 1DT2A 3SZNA 1KIGH 4TWWA 1J9CH 3VXEH 4CRGA 4A1VA 7GCHG 1TFXA 1V2MT 2BQ7B 1MBMA 1AVXA 1HAOH 3MO3A 4ISNA 1FY5A 2YOLA 1FV9A 1PQ7A 2HPQH 1B5GH 3U8RH 1DANH 1BTUA 3C1KA 2THFB 3BF6H 4AZ2B 4D9QA 1TNJA 4X1PU 3B23B 4D7GA 3CS0A 2PR3A 1GI4A 2F91A 2BDCA 4JZFH 2GCHF 3P8NA 1SQTA 3TGJE 1P3EA 1FZZA 1K1IA 1P05A 1ZOMA 1ZLRA 1BOQA 4ZH8A 4NA7A 3TGIE 1GI1A 1DUAA 2C8WB 2FLBH 1C5NH 1SGRE 1JBUH 1GI0A 3GDUA 1AVGH 2O8LA 3A83A 1HXFH 3A8CA 1ANEA 1ELCA 2BLQA 1VITH 3JZ2B 1YPGH 1GVLA 1SI5H 5HM9A 4I7YH 2GZ7A 2AEIH 1IHTH 4LZ4B 3ESTA 1EOLA 9ESTA 4ISOA 1YPEH 4D76A 5A2MH 2ZCKP 1HGTH 1AWFH 5J4QA 1H9LB 2ZWLH 2IPHA 1GDUA 3S9AA 1ELBA 3A7WA 1V2JT 5DG6A 2VB0A 2BB4A 2FP7B 4AN7A 8KME2 1ZTJA 1SBWA 2I6SA 1XVOA 1O2MA 1ZHMA 2GV6A 4CR5A 4Y76A 1IQEA 1YLCA 2PV9B 2BOHB 2Y5GA 2ZDMA 2R3YA 1G2LA 3QLPH 2VWNA 1P2IA 1QTFA 2GTBA 1C2FA 3QWCH 2O8WA 1TGBA 1CHOG 5A8ZA 2AIQA 1A5IA 1SLWB 1GHBG 1H9IE 1UVUH 3E6PH 3DFLA 2A4OA 1DY9A 3BG4B 1TNHA 3M7QA 1ZJKA 1NM6A 1LPZB 1ESAA 1CGJE 2GCTC 2WINI 4DGJA 3GYMA 4NIVA 1O5DH 1Z8IB 3EAJA 3PLKA 1RTFB 1NRPH 2BY6X 4INHA 4Y71A 2RA0A 5EQQA 3S9CA 1OS8A 2ZHFH 2VVCA 3BTTE 4UFGH 3SNEA 6GCHG 2H5CA 5C5NA 5JBTA 3TLOA 5JYIA 3A84A 1W13U 2AMPA 3TJOA 3RMMH 5C3NA 2QXGA 3SV6A 4FUCA 3SU2A 4GHTA 2OBOA 1IOEA 4IC5A 1SGYE 1O3LA 2BLOA 2ZDNA 5HYOA 1D6WA 1SSXA 1BT7A 3TU7H 5EG4A 2Z3EA 5FX6A 5GWZA 1O2RA 1QL8A 1AI8H 2H6MA 2PGQB 1NFXA 4TPIZ 1EZQA 2SFAA 3E3TA 3EA7A 4NG9H 1CGIE 2OP9A 1UTOA 1WBGB 2SGDE 1W12U 1KTSB 2SGFE 4NWLA 1O2UA 4Q7ZA 2G00A 1LCYA 2VWMA 1EJNA 3GCNA 3EYDA 5GCHG 3UFAA 1DXWA 3W94A 4B73A 5JBAS 1ELTA 2WV5A 5DK1A 4MPXA 2ZI2H 1C1OA 3HKJB 1BUIA 3MO6A 1EX3A 1PYTD 4X2YA 3P95A 3M5OA 1HDTH 4ZROA 8LPRA 1CT4E 4X8SH 2BDIA 1YPJH 1BZXE 1H4WA 1JIRA 3B8JA 3CENA 1P2QA 1O5EH 1YBWA 2FIRH 1GCDA 4XBCA 3VGCC 1C5PA 4O3TA 5CMXH 4GSOA 3GCHC 2A2XH 2FOEA 1GHXH 3OU0A 1QRXA 3TGKE 1TX6A 1EAIA 4TYDA 1Y8TA 3E0NB 4X0WU 5HGGA 1UTJA 1GVKB 1BTHH 3TITA 3MYWA 1DICA 1C9TA 1K21H 4FU8A 2BY8X 1BB0B 2BZAA 1BJVA 1ANDA 4K2YA 1YCPM 1C2MA 1O35A 1QL7A 1NRRH 2ZU1A 4FUFA 3PTBA 4AFUA 5I25A 1BIOA 3SQEE 1TA6A 1MKWK 1GJCB 1PQ8A 1ZPBA 2BHGA 1C5SA 2BD3A 2ZFFH 1D3PB 4BAQB 1CT2E 1KXCA 3SJKA 1PJPA 1AUJA 4MLFB 3A7XA 2XWAA 3M36A 5FPYA 1TABE 1ZPZA 1OP2A 2BVRH 1G36A 1GI8B 4IC6A 3FZDA 1MKXK 4CHAB 4ISHH 1BTZA 1Y5AT 3U8TH 2J34A 3MNBA 4KTCA 3F68H 2BD7A 2G4UA 2VIOA 2OQUA 1QRWA 1FAXA 1GBEA 1Z7KA 1P04A 1DWEH 1C5VA 4O3UA 3MU8A 1KXBA 1ELDE 1QQUA 3LIWA 3P92A 5L2ZH 1W2KH 5A8XA 3K65B 4ZMAH 3RC5A 1J16A 3ITIA 3HKIB 2AS9A 1LVMA 3E1XB 1T8OA 4RN6A 3DHKH 1RTKA 4TY6A 3TK9A 1KXDA 2RDLA 1G3DA 3ZVFA 4E05H 1CHGA 1ARBA 5JBBS 3I29A 3BTDE 2P3FH 3LGIA 1NROH 4Y0ZE 4IMZA 4XE4A 1EZXC 1OKXA 3HK3B 2DE9A 3CS7A 3FANA 2HLCA 1V2QT 3QGJA 2VWOA 1W10U 2O8UA 2LPRA 2NU4E 4K8YA 3SNCA 3NCLA 2SGAA 3DUXH 1O2PA 3FP8E 1SQOA 2GCHG 2KAIA 4X2WA 2PW8H 1V2RT 2CGAA 1F5KU 2JETC 1HB0B 2SGEE 1Z1IA 1QA0A 4WWYA 1KSNA 1NESE 1O32A 1C2KA 3RXEA 2ODQA 1Y3WA 2J94A 3EA9A 2PWXA 2GVFA 3RXMA 8ESTE 1ZSKA 4GVUA 4ABGA 1Z6JH 4OGYA 2ZFRH 1C5ZB 1HAXB 3RP2A 5BRRE 4ABFA 1GDNA 4R8TB 3MNCA 4XBBA 1P06A 4YOGA 4AYVB 1P3CA 2R0LA 4O9VA 3TH4H 4Y6DA 1TLDA 3SUGA 3GY4A 1C4U2 1ETRH 3GY8A 1UCYK 4ABDA 3PM3A 4AB9A 2EA3A 2FM2A 2Y7ZA 2A0QB 4BTIB 3V12A 3GICB 1YYY1 1GHYH 4HZHA 1J14A 3GYLB 2F83A 3UWJH 2VVVA 4SGBE 1CBWC 1ZSJA 2Y82A 1UK3A 5T6DA 2AGIX 3KEEA 1CVWH 1Q31A 1GWAA 4MNXA 4IMQA 3ZZBA 1INCA 5LPRA 3EE0B 1JRSA 3IITA 3KF2A 3K2UA 4BXWA 2WPHS 2STBE 1GCTB 3I77A 3LH1A 1XUFA 4ZAEA 1O33A 1UO6A 1TYNA 4UONA 3L6PA 1BCUH 1LTOA 1SG8B 6GCHF 1O2XA 2XC4A 1RJXB 5EXNA 1EXFA 1DITH 1DDJA 4IBLH 4NFFA 1K2I1 3M3TA 1RXPA 3KQDA 1LHEH 1MTUA 1V2ST 4OS6A 3BN9A 4X1QU 3SU4A 5FX5A 2J95A 4K1EA 1GBHA 5ETXA 3S7HB 1AKSB 1AN1E 1GI2A 1GBDA 3E8LA 1H9HE 2IJOB 1TX8A 3A88A 1KY9A 1LVYA 2ZGBH 3RXGA 1HAHH 2ALVA 1F0RA 3FP6E 1F0TA 5C1UA 2BM2A 3PYHA 3TNTA 2G52A 1C4Y2 4AG1A 1UK4A 3SOSA 4K60A 1SFIA 1MZAA 1SPJA 4GCHF 3UUZA 2P3UB 1FY8E 1ELVA 1HJAB 1DSTA 3MNXA 2TGAA 2G55A 1SOZA 3HATH 4OS2A 2ZG0H 1QURH 1GJDB 1LHGH 1ZRBA 3SHCH 1TBQH 2ZTYA 3V3MA 2B7DH 3I78A 1VCPA 1O3HA 3T25A 2H2ZA 1PPFE 1O37A 2Z9JA 2WYGA 1PFXC 4A1XA 1LVOA 3TPIZ 2BYAX 1YLDA 3VB4A 3ZVBA 2HWLB 1ABIH 1VITF 5DP5A 3UREA 2VNTA 4ABAA