4SGAE

Structures of product and inhibitor complexes of streptomyces griseus protease a at 1.8 angstroms resolution. a model for serine protease catalysis
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
181
structure length
181
Chain Sequence
IAGGEAITTGGSRCSLGFNVSVNGVAHALTAGHCTNISASWSIGTRTGTSFPNNDYGIIRHSNPAAADGRVYLYNGSYQDITTAGNAFVGQAVQRSGSTTGLRSGSVTGLNATVNYGSSGIVYGMIQTNVCAQPGDSGGSLFAGSTALGLTSGGSGNCRTGGTTFYQPVTEALSAYGATVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords PROTEINASE A (SGPA)
publication title Structures of product and inhibitor complexes of Streptomyces griseus protease A at 1.8 A resolution. A model for serine protease catalysis.
pubmed doi rcsb
source organism Streptomyces griseus
total genus 55
structure length 181
sequence length 181
ec nomenclature ec 3.4.21.80: Streptogrisin A.
pdb deposition date 1990-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4sgaE02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4sgaE01
2WYJA 4Y8ZA 5C3NA 1UTQA 3H7OA 1MZAA 2YNAA 1FY5A 2GT8A 7KMEH 5E0JA 1Z7KA 1GBIA 1AY6H 3K9XB 4ABDA 4AGKA 1NFYA 2BQWB 3SHAH 2BTCE 1F0RA 4X2WA 1PFXC 5EW2H 3C27B 5GIBA 8GCHG 1LPGB 3V12A 1MZDA 4MDSA 2ZU2A 4XFQA 1ANDA 1O5CB 3PWBA 2Y7XA 1C2GA 3RC6A 5FPTA 4ZHMU 5GPIB 4X6OA 3UPEA 3GICB 4JYTA 1KLJH 1YLDA 5C20A 1F2SE 1A4WH 1FQ3A 1AGJA 5EQRA 4D8NA 3DFJA 1W7XH 1LKAA 1XXDA 2QXGA 1O3MA 3NCLA 1O0DH 2FPZA 3LU9B 5GCHG 2CXVA 4TY7A 1YPHC 1VJ9U 3LGVA 1NTPA 3L3TA 2EC9H 4ABBA 1T31A 2FOHA 3LGUA 1YF4A 1DE7H 1G3CA 3P95A 1GMDF 4CRGA 2BDIA 5L30H 2Q6FA 2C8XB 4CRDA 1NFWA 1YCPM 1ELAA 3V0XA 1HAZB 3RU4D 2J2UA 1F5KU 1V6DA 4XBBA 1O2LA 3A7WA 4YZUA 3SU2A 1GHXH 1K1PA 5L2YH 1W2KH 3A81A 3SOSA 1NRSH 3ZYEA 3A87A 1Y8TA 1EB2A 1Z8IB 1IQLA 4LK4A 4ZUHA 1WQVH 2P95A 1GMHG 1OWJA 1UVTH 3F9EA 4MLFB 4ISLA 1GHAF 1T4VH 1KXFA 1P09A 2BVXH 3MI4A 3F1SB 4NIXA 1ZPBA 4CBNA 1TBRH 4B2BA 1QFKH 3NKKA 2STAE 3A88A 1MCVA 1VCPA 1VITH 4GVUA 3SUDA 4HGCA 1X7AC 2B8OH 4IMZA 3E91A 4OS6A 1K1IA 1GPZA 2BLWA 1WOFA 3GDUA 1TNHA 2FX6A 3HK6B 4RN6A 1C1TA 1O5FH 2ZFFH 1O2NA 2BXUH 2Y5HA 1ZZZA 4E7NA 1UTJA 3E8LA 4TPIZ 1C5YB 1J14A 2ZHQH 3FZDA 3MU4A 3S7HB 1GGDC 1BTWA 2FZZA 3MH5A 4D7FA 1ZHPA 2YNBA 1ESBA 2ZCLP 2R0LA 2B5TB 3BEIB 1GMCG 2VINA 3ZZ5A 4RKOB 3F68H 1PYTD 1J8AA 1INCA 3TK6A 1ORFA 1KLIH 2A31A 2ANMH 1FONA 4K5ZA 3VEQB 5JPMH 1CA8B 3VB3A 2STBE 1GGDB 5HYOA 3H7TA 2OQ5A 1EOLA 3BTKE 1HJ9A 5BPEA 1LTOA 4KKDA 2BLQA 3ZZAA 1P8VC 1JIRA 3SN8A 4UE7H 3RXIA 3M7TA 3MHWU 3QTOH 1O3JA 3RU4T 1P2IA 1GDNA 2AIQA 2WPKS 1DVAH 1SHYA 1V2WT 1NN6A 2FOBA 4Q7YA 2R3UA 3RXFA 2BYAX 2OTVA 2XBVA 3SO3A 1V2UT 5DG6A 3DD2H 2Z6BD 2FM2A 1RTLA 1EPTA 5E8EH 2OD3B 2RA3A 2CMYA 3KIDU 4Q2KA 1YPLH 4ISIH 2J9NA 2XYAA 4Y10E 2BD3A 3M35A 2ZCKP 1A5IA 4ZKOU 4MNXA 5LGOA 1GJCB 3ATKA 2F9OA 1JXPA 2V0BA 2Z9KA 4ZKNU 1UHBB 2IN2A 1S85A 3GCOA 1CVWH 2BD5A 2UUFB 1MUEB 4A6LA 2FEQH 3BTTE 4AG1A 2SGAA 4O03A 5LH8A 3MU5A 3P92A 1ZTLA 2BMGB 2R3YA 4MPUA 2H6MA 1OS8A 1QNJA 1VGCC 1HGTH 2J92A 4FUHA 2BB4A 1BTZA 2Y80A 1LMWB 4X6MA 2TPIZ 2XTTB 3RXAA 2DE9A 3SHCH 1K2I1 2CF9H 1K9OE 3EA8A 4NCYA 4AYYB 1EP6A 3DHKH 3O8RA 1KXCA 1TRNA 1MKXH 2V6NA 4LOYH 3LIWA 1V2JT 1VGCB 3DT0H 1J16A 4NIVA 1XUHA 4NFFA 1P2MA 4I31A 5FXLA 2NU4E 1GI1A 3P17H 3O8DA 1XM1A 2M5TA 2TRMA 3KHVA 1GI5A 5DP6A 5LPRA 1C5TA 1KDQB 1MD8A 1ZSJA 3E90B 4RSPA 1GJDB 3QN7A 5TJXA 3S69A 2XBWA 2RDLA 2FTLE 3D65E 1Q3XA 4FUJA 2HPPH 1QL9A 2LNCA 1CT2E 5CE1A 1BITA 2PKSC 3HGPA 2ZKSA 1MBMA 1RD3B 1W12U 2Q1JA 3QGJA 1TRMA 1Z8GA 4KTUA 2PGQB 4WMFA 1IQEA 2LPRA 2A45B 1W10U 4I33A 3R3GB 2FOFA 4A1TA 1BRAA 1Y59T 2VH6A 2AMPA 1QR3E 1E37B 2JH0D 2PKSB 4Y0YE 1AB9C 1DT2A 1AU8A 1C4Y2 1UVOA 3RDZA 4Y7AA 4IW4E 2SNVA 3LOXA 2BVRH 1QRZA 1ZMLA 2QXIA 3RLWH 1BHXB 1TGTA 1GL0E 1FY1A 1EJAA 2XWBI 4FU7A 5C1UA 4FVBA 2H5CA 3RXCA 2VWNA 1C5QA 1NFXA 1AB9B 3T26A 1XMNB 3V13A 2ALPA 1ZMJA 2NU2E 1O3LA 3E16B 4O9VA 1L1GA 3KQCA 2J95A 2JH6D 2PUQH 1C4U2 1RGQA 2OLGA 5T6FA 1BTXA 2VNTA 2ZDNA 4BTTB 1GHWH 5L6NH 1JWTA 4E06H 4I7YH 2PUXB 5DO4H 3ZZ7A 1FY8E 1BZXE 4IS5A 3U1IB 1P2KA 1NO9H 4ZROA 3U8OH 1WUNH 3ATIA 3STIA 1EZXC 1CGIE 1L1NA 1HUTH 3KCGH 2ZFQH 1H8IH 1HJAC 4X1QU 3ATLA 2PTNA 3LPRA 1SLWB 5HM9A 1ZTKA 1L4DA 2ASUB 3MO9A 3TH2H 5A8YA 2G4TA 3N7OA 1QBOA 2XXLA 2RG3A 2HOBA 4AOQA 1HJAB 1RIWC 1GI4A 3B8JA 5JB9S 4HZHA 1GHZA 1GVZA 1DDJA 1Z8JB 2G4UA 4CHAC 1ZYOA 4AZ2B 3MH6A 1BTYA 1V2VT 3U98H 2BY9X 4YT7H 1ZSKA 3RMMH 3AVZA 1XUIA 1ZJDA 1SLVB 1GJ7B 1YPKH 1S0QA 1O3CA 3BIVH 3AASA 3VB7A 4X8TH 4XOJA 2WV4A 3W95A 2ZDMA 4IC6A 1FPCH 5DJ7A 2XC0A 4CHAB 3RUOA 1O36A 1C5VA 1F0UA 2BXTH 1EQ9A 2CF8H 2FMJA 4ISNA 3TK5A 2ZGJA 2PFEA 3LT3A 1D6WA 4HFPB 1ZRBA 4GHTA 4OGYA 2ZPQA 1HAYB 3BTQE 1TNIA 3SNAA 3T27A 3RXGA 4YTAA 4XE4A 2AGIX 4Y11E 3FP8E 7LPRA 5GWZA 1C2FA 5EQQA 2AERH 1QL8A 1N8OC 1BOQA 4A5TS 4FUDA 5ESBA 4B71A 2SFAA 4DOQA 2ZNKH 1O31A 1DSTA 3QZRA 1V3XA 1SLXB 2PR3A 5EOKA 1C1VH 1C2LA 1SGFA 1P12E 2A7HA 2ZDKA 3GDSA 4KELA 4SGAE 3S9CA 4NGAH 2BVSH 1GBDA 4FU9A 4BAMB 1AFEH 1D3TB 1N8OB 3T2NA 1UVSH 1QB6A 3QWCH 4YO9A 1LPKB 2QA9E 3SJ9A 3RXSA 3TJNA 5DPAA 4YESB 1LHEH 1O3DA 1RS0A 1ESAA 2G00A 2UWLA 3AW0A 2J94A 1HAVB 2QCYA 1EUFA 9ESTA 4X1SU 2ZPSA 1GI3A 3A8CA 4GSOA 4D7GA 2XC4A 1P3CA 1Z6JH 2QAAA 4NWLA 2FOMB 1P9UA 1XKAC 1V2MT 1L4ZA 4FUCA 2OQUA 4NG9H 2GZ8A 4B2AA 5FX6A 3ZZ8A 2NU3E 1T8OA 1C1MA 1TNLA 1QBVH 4AB9A 2A5AA 1XUFA 2R2MB 3MH4A 4MQAA 2OXSA 1LVMA 2G5NA 1NROH 2AGGX 3CS0A 2FI4E 1O2JA 1TQ0B 1C1UH 5FCKA 4AFUA 1AZ8A 4H42U 3RXJA 3ZVDA 3LONA 1GBEA 1SGIB 1TFXA 4WXVA 5J4QA 1KXAA 2GMTC 2G55A 2ZHEH 1C5OH 1O5DH 2HRVA 3B9FH 4DY7B 4ASHA 1QA0A 3SI3H 2ZZUH 3IITA 1DS2E 1K1JA 1GVLA 3PLPA 1UCYE 1UCYK 4GAWA 2FOEA 3GYLB 5F8ZA 1BDAA 2YOLA 1TNJA 2NU1E 1MTSA 3I77A 5JBAS 3MTYA 3SZNA 2GMTB 3MWIU 3SU6A 4AX9H 1BTPA 1ELDE 2XC5A 3M36A 3RC5A 1C2KA 3GOVB 2BDBA 1WAYB 3BIUH 1MTWA 8ESTE 1OSSA 3TGIE 1PQ7A 1QB9A 3F9FA 3Q3KA 2PHBA 1VCWA 1O2TA 1FZZA 2A2QH 3A7XA 3I29A 1AKSB 3QDZB 4SGBE 4A7IB 1RTKA 1G3BA 1QHRB 1TOMH 4FUIA 1GBAA 5C5NA 5A09A 1PPBH 3MU1A 1SGYE 2K1QA 1H4WA 2F9BH 2ZFTA 4U30A 1KYNA 1GBKA 3NWUA 1DY8A 3UR6A 3SGAE 2FESH 1ELCA 1Z1IA 8KME2 1A1RA 1WV7H 2F3CE 1S81A 4X1RU 1V2TT 4B73A 1BQYA 1PPZA 3E1XB 1ZRKA 1MU8B 4DGJA 1OX1A 1BA8B 1KSNA 2FOCA 1HBTH 1SGTA 2R9PA 4ZMAH 2ZWLH 2ZGBH 3SUEA 5JBCS 4NFEA 5DK1A 1ID5H 1IHSH 2GKVE 1AWFH 1TGCA 2QXJA 1FIWA 3U69H 3UUZA 3UQOA 2TIOA 1LDTT 1CHGA 5DP8A 1ZR0A 4X1PU 4X6NA 4INKA 2FS9A 1FXYA 1BRUP 2W3IA 1C2MA 5JDUB 2GD4B 4X2XA 1EJMA 1K21H 1ABJH 4MNYA 7GCHG 1ZPZA 4CBOA 3GCTF 3NPSA 1S5SA 4MPXA 1BHXF 4AFQA 1IQKA 3FFGA 4K3JA 4X6PA 4Y6DA 1EP5A 3A89A 3B23B 1HRTH 3C1KA 2PSXA 2ZHFH 4JYVH 1NM6A 3GY8A 2ZDVH 2VIPA 3I78A 3FP6E 3TH3H 4WH6A 1BB0B 5T6DA 1V2KT 3JZ2B 1HAPH 2TBSA 1AN1E 1LCYA 1LO6A 2QIQA 4IN1A 2BLOA 4BXWA 2F83A 1H9LB 1DX5M 1SMFE 1TGSZ 3SJIA 5ABWA 4B1TA 1G32B 3S9BA 1GL1A 1W14U 4B2CA 2ZPRA 3SV6A 1P3EA 1TYNA 1IAUA 2DUCA 3SJ8A 1ETRH 1O30A 1VR1H 1ETTH 4NSYA 1TBQH 3RMOH 1W8BH 4ZAEA 2OBQA 8GCHF 1V2LT 2ZF0H 4UFDH 5J4SA 3SV9A 1TPAE 1C2EA 1YCPH 2BQ6B 5HMAA 1BMLA 2AMQA 1O2QA 1W13U 2GV6A 4FUFA 4Q7XA 1Z6EA 1C5PA 1KTTB 2EEKA 1ELGA 3RXTA 1NU9A 5F6MA 1C1WH 3SGQE 1O2UA 3ZVFA 4Q7ZA 1CGJE 1ZMNA 3GY2A 2A4RA 5GCHF 2W5EA 1IQNA 4ABAA 3FVFB 5A0CA 1V2RT 1TNKA 1YPGH 2H1UA 1O3EA 3GY3A 4MPVA 4NZQA 1JBUH 2ZDAH 1MH0A 1L0ZA 5DP4A 2O8MA 2A4QA 3IG6B 1ZPCA 4TWWA 1EAUA 1YC0A 2ULLA 2OINA 2A5KA 1BRCE 1E35B 1CE5A 2VGCC 1HPGA 2F9UA 1IQJA 4XDEA 1YM0A 3GISB 2WPJS 2JKHA 3SV7A 5EPYA 3SBKA 5CMXH 1TX8A 1IQIA 1F7ZA 3SUGA 3DA9B 1TE0A 1C5NH 1A61H 5EW1H 1P11E 2CV3A 2BD8A 1GMHF 3UNRA 3PMJA 3HKJB 2VGCB 4JK6A 4UDWH 3RU4E 1XUKA 3NZIA 7ESTE 1UVUH 4NWKA 1WTHD 3P8NA 3LJJA 1UTOA 3OSYA 3SUFA 4BXSA 4B76A 2QY0B 1B0FA 1Z1JA 3A7YA 3EDXB 1SB1H 2ZFRH 1S84A 1SQTA 2B0FA 1GBHA 1ELVA 1LPZB 2C3SA 4I8KA 1V2QT 2J38A 1O2WA 3QK1A 2WUBA 3LH1A 1C5WB 2FLRH 2ZO3H 3PLBA 3P8OA 1A0HB 1O3KA 2W7SA 3RXPA 4DG4A 1UCYH 2W26A 3QTVH 1O3GA 2ALVA 2A4GA 2GCHG 4WWYA 2UWPA 1THPB 1P06A 1GMCF 4DURA 2OCVB 2OC8A 3GCNA 4AORA 1C1PA 2AS9A 2A2XH 3OY5U 1DOJA 1WBGB 1EAWA 1NC6A 2AFQB 1J15A 1P2NA 2ZI2H 2GDEH 4XSKU 2BY7X 1SSXA 2D8WA 3F6UH 1GJ8B 1F0TA 2TGAA 4Y7BA 2ZIQH 1SGEE 1O3HA 4K1TA 4ZHLU 1OPHB 1C1QA 2BY8X 3TIUA 1SGRE 4I8LA 6LPRA 4Y76A 1XX9A 3LKWA 5DKMA 4B74A 5C1YA 1SQOA 1HB0B 2VJ1A 1ETSH 2A7JA 4H4FA 4WJG2 1D3QB 2H9HA 2P93A 1ELEE 1O5GH 3GY5A 1N6XA 4OS1A 4FUEA 1TX7A 2VIDA 5EPNA 3VXEH 5EXNA 1RXPA 1A3BH 2NU0E 2CJIA 3ZZ9A 4WH8A 1O3OA 2BD9A 2ZC9H 1YPEH 2IOTA 5EG4A 4GPGA 3KQEA 5FBIA 3UWIA 1P0SH 1EX3A 1C5LH 4JCNA 3STJA 1YPMH 2ZGHA 5E2OA 1Z8RA 3SU5A 1RFNA 1QBNA 2FP7B 3M37A 1HAGE 1XKBC 1HFDA 1GBTA 4THNH 1BMMH 3UWJH 1O32A 1AVGH 1DUAA 1CU1A 3TNSA 1UK4A 2KAIB 3K6ZA 2QXHA 4VGCC 1F5LA 3PTBA 3A8DA 2JETC 2EA3A 3BG8A 1ZGIA 5DP5A 3RXBA 2GGVB 1KY9A 1NS3A 3BTHE 1SGPE 3MOCA 1IQGA 3A86A 4BOHA 1Y5AT 2Y82A 5AFZH 1NRPH 1TX6A 4BANB 1AE5A 2BOKA 1EZUC 1P10A 1ZTJA 4JK5A 4VGCB 4I8GA 4IMQA 2JETB 3T5FH 3M3VA 4IC5A 3HK3B 1S83A 1C1OA 3ZVGA 1DWEH 1O2OA 2RCEA 1J17T 1SFQB 2HALA 5FX5A 1V2ST 3SJOA 5A8XA 3SU1A 2I6QA 3U8TH 3ESTA 3U9AH 2Z3CA 5JYIA 4GLYA 2FS8A 3ZVCA 4DIHH 3LJOA 3TPIZ 2H9TH 2Z9IA 5TCCA 2C4FH 4CREA 2GX4A 2QF0A 2ZU4A 3MYWA 2GP9B 3LC3A 2BQ7B 1HIAB 2EI7A 4Z6AH 2G5VA 1SGFG 4UONA 1TWXB 3V7TA 3HATH 2BDCA 5C2ZA 4GHQA 3BTGE 2SGFE 3PMBB 1G9IE 1H9HE 3ZV8A 1EAIA 1U6QA 3BSQA 1L2EA 4ZKSU 1P01A 3AAVA 1WSSH 3PO1C 2IJOB 3VB4A 2GCTC 1SQAA 2QV1A 3MU8A 3V3MA 2BDHA 5T3HA 4MPWA 1YP9A 2CGAA 2O9QA 4IN2A 5DGJA 3BTME 2ANWA 1EAXA 1OXGA 5GXPA 1O2PA 3RXMA 1T8MA 1Y3XA 3PO1B 2ODYB 4UEHH 2GCTB 1BRBE 2Z9JA 4O3TA 4DVAU 2A7CA 1AKSA 4WMDA 2XNIA 1DWDH 1S82A 4Z0KA 2BD7A 3MFJA 3UIRA 2ZU5A 1ZOMA 1A46H 4JZFH 3UQVA 1DWBH 1NRNH 2GT7A 3HGNA 3Q77A 4O3UA 4NA9H 1Y5UT 2EI6A 2HLCA 3SW2B 2FOAA 3EE0B 3U8RH 5K7RA 1VJAU 1QTFA 2UUYA 1TNGA 1SR5C 3MNXA 5F8TA 1SGDE 1AWHB 1OWDA 2P59A 2QF3A 1AZZA 1W7GH 4NIWA 2Z9GA 4BAKB 3A7TA 1CA0B 1TA2A 1PQAA 4HI3A 2WPLS 2BLVA 1MMJN 4X0WU 3TU7H 3ENSB 4OS7A 2BY5X 1GCDA 3SNBA 1AUTC 5I46H 1TGNA 2GZ9A 4NIYA 1O3NA 1OWHA 1C1SA 3ELAH 4YT6H 1O2VA 2FXRA 3SJKA 4X2YA 4K8YA 1O37A 2ZG0H 2B9LA 4U2WA 3KEEA 1Y3VA 3RXKA 2C8ZB 4E05H 1M9UA 1NU7B 1N6YA 1AQ7A 1G3DA 1GDUA 4YOGA 3SNDA 3E0PB 1SGCA 5G4BA 4JZ1A 2OC0A 5EGMA 3LGIA 4K60A 1GI7B 2HPQH 1YLCA 2A5IA 5JBTA 2C8WB 1K1LA 3HKIB 3PB1E 5A8ZA 3M5LA 1QCPA 2ILNA 3TVJB 3LC5A 1LVOA 1PJPA 2RA0A 2WPIS 4KTCA 3L33A 3A85A 5A2MH 1GHBG 5ESTE 2PWXA 1AUJA 2G51A 2WPMS 4BAQB 1TPPA 1J9CH 1FIZA 1VCQA 1D4PB 3GY4A 1VZQH 2SGDE 5L2ZH 1QURH 1C5ZB 1BT7A 6ESTA 4MTBA 1QJ7B 3UREA 1V2NT 4YLQH 1O2IA 4AG2A 1ELTA 2G81E 2Y6TA 1GJAB 1ELBA 4GCHG 4FXGH 3M3TA 3W94A 1AD8H 4I8HA 1XUJA 2OBOA 3QO6A 2ZU1A 3S9AA 1VITG 1S6FA 3CP7A 4INLA 3SV2H 3T62A 5EXLA 1NFUA 1C2HA 1E36B 5F03A 1EOJA 2FI3E 1JRSA 1HJ8A 1YBWA 3SGBE 2ZTYA 3FZZA 1UK2A 2BOHB 1EJNA 1BTHH 1HNEE 1O3AA 3GY7A 2WUCA 1C5RA 1A5HA 3MO6A 4A92A 1A7SA 4XBCA 2ZDLA 1GG6C 1C2DA 3DUXH 1MBQA 3D62A 3ZVEA 1SGQE 5FPYA 1AVXA 1WCZA 1HAOH 1C1RA 3K2UA 1BMNH 1PYTC 2J34A 2VIVA 5E0HA 5SGAE 4GCHF 1E34B 1F0SA 4K69A 1W0YH 1GBJA 2ZQ2A 3EYDA 2AMDA 1GG6B 2B7DH 1G37A 3GDVA 2BZ6H 2ZFPH 1GI2A 1G2MA 1UTKA 1C2IA 3E0NB 4DT7B 2XCFA 1THSH 5HXFA 1UO6A 4TY6A 1FN8A 1HDTH 1TMUH 2G8TA 3M7QA 4AB8A 1QRXA 3M5OA 3ZZBA 3KNXA 2JH5D 1GI9B 4Y79A 1C5UA 3UOPA 1WTGH 1NPMA 1MTNB 3ZZDA 3BF6H 6GCHG 4YLUA 1OWIA 3QGNB 3URCA 2BX3A 1QIXB 2VB0A 4Y8YA 4OGXA 2AIPA 3Q76A 1GCTC 2A4OA 5CHAC 4NZLA 1V2PT 2ZGCA 2Q6GA 1C9TA 3M61U 2A1DB 2A32A 3TNTA 3ZZ4A 1RRKA 1MAXA 3S0NA 3RXHA 1UTNA 1QY6A 1OP8A 2ZA5A 4X1NU 5C1XA 3RXEA 1CSOE 2VU8E 1HCGA 1SBWA 1P05A 1GCTB 1SOZA 2P3FH 5CHAB 3FAOA 1P2JA 3VB5A 4XBDA 1SOTA 1SI5H 1OP0A 1MQ5A 4Q80A 4ABHA 3BEUA 3Q3XA 1GI0A 1UHBA 2VIQA 4ABEA 5JB8S 1IQMA 2ZECA 1JOUB 2FIRH 3A8BA 2GZ7A 2J4IA 3EA7A 1DUEA 2D2DA 4AN7A 1SVPA 1CQQA 1QL7A 1AE8H 4KP0A 3KF2A 3P70B 3ATWA 1G3EA 1T8LA 1GJ5H 1EB1H 1MD7A 1UMAH 5EQSA 2FX4A 4KGAA 4K8BA 1CHOG 4TYDA 1GJ6A 1TAWA 3CS7A 4F4OC 1BBRE 1BBRK 1GMDG 1H1BA 3TGKE 1B7XB 4X8SH 5EODA 1SPJA 4X2VA 3SU3A 4YOJA 1TONA 3BTDE 1P9SA 1ELFA 7GCHF 5FPSA 2BZAA 1YGCH 4ABGA 1C5XB 2FODA 1N1LA 1ANEA 1KXEA 3PMAB 3TGJE 3ZV9A 1O3PB 1GJ4H 4R0IA 3BEFB 3UNQA 1O5EH 1O2YA 1EZQA 1KDQA 3OY6U 4H6SB 5K0HA 2P3TB 2VWOA 3PM3A 2Z3DA 1GHAG 2KAIA 5HGGA 4ESTE 1O2SA 4JZEH 4ISOA 1HAXB 3E3TA 2TGDA 3FANA 3VGCC 1CHOF 1GHYH 4BTUB 1O39A 1C1NA 2CHAC 3ZZ6A 1NT1A 1XVMA 3D49H 2Z3EA 1O2MA 3ZZCA 1LHCH 1TGBA 4BAOB 3MMGA 3A82A 4MNVA 1FNIA 4FUGA 3T29A 4R8TB 3G01A 1FI8A 3VGCB 1A3EH 2CHAB 1O2RA 4CR5A 4A1XA 1V2OT 3RXQA 1Z71A 1TALA 1TA6A 1NRQH 1O5BB 3A7ZA 3BTWE 3RC4A 4CH8B 2SGEE 1PQ5A 8LPRA 2QC2A 1B5GH 3M5NA 1SG8B 2O8TA 3IWMA 4QT8C 1HIAA 1YYY1 2ODPA 2GVFA 2ZFSA 4KTSA 5JBBS 2HVXA 1D3PB 5EU8A 3KGPA 2GDDA 4UD9H 3LH3A 4D9RA 3RMNH 2FYQA 4CRCA 2UWOA 4UFGH 2BDYA 1OYQA 1CT4E 1DY9A 2F9VA 2OUAA 2WYGA 5GDSH 2O8UA 1P03A 1Q2WA 4O97A 1O3BA 3RXUA 1DLEA 2QYIA 1HAHH 4OS5A 1EKBB 1PPCE 5A0BA 3SQEE 2ANKH 1NRRH 2H2ZA 1JMOH 1ZSLA 3A83A 1TPOA 3M5MA 5HM2A 1FAKH 3FP7E 4K1SA 3VXFH 2NWNA 2VVUA 1BJUA 1AI8H 5LPEA 4ZH8A 3F9GA 5FHTA 1A0LA 3AW1A 3BTFE 1ZLRA 2OC1A 1LHFH 2PKAB 4M7GA 2VWLA 1XUGA 1KTSB 1ESTA 5I25A 4JYUH 4LZ4B 1LVBA 1BMAA 1OWEA 2P8OC 2Y5GA 1PPFE 5EXMA 1UTMA 4AGJA 4BAHB 2AEIH 3ZYDA 2R2WU 1ARCA 3ZZ3A 3JZ1B 1O38A 1TABE 3MH7A 1BJVA 4ZKRU 3OU0A 2AGEX 2VH0A 1O3IA 3P8FA 6CHAC 2FDAA 1O5AB 2HNTE 2H5DA 4A1VA 3DFLA 1HLTH 2P8OB 2ZGXH 3MNCA 4HTCH 1KXDA 3RP2A 2WPHS 1SGNE 1QQ4A 3O8BA 2GCHF 1GBLA 1LHGH 2ZTZA 3EGKH 2FOGA 1WYKA 1LKBA 3BG4C 3ITIA 6CHAB 4WY3A 4CRBA 1UJ1A 1W11U 3Q00A 1MTVA 2FWWA 4Y0ZE 1O2GH 2ZTXA 3AAUA 1OKXA 1E0FD 2XBXA 3TJVA 1SHHB 2Z94A 2VIWA 1ZHRA 1XXFA 2W3KA 1DPOA 1E38B 1CGHA 3BG4B 4WVPE 2ZHWH 1TPSA 4FUBA 1DFPA 4CRAA 1GBBA 5A0AE 1PPHE 1LHDH 3BN9A 4U01A 4WMEA 2ZEBA 1HAIH 1ANCA 4YOIA 3LGWA 4ZHAA 1H8DH 3UFAA 1O2KA 4TPYA 1F92A 3LGYA 4NA7A 5C67A 5DP3A 1AIXH 2PLXA 2HWLB 4BNRA 4JMYA 1BCUH 3UY9A 4ISHH 5T6GA 1TB6H 2HNTF 2OP9A 1AO5A 1HAVA 1WQSA 1YKTA 3CENA 4Y8XA 1P2QA 3A8AA 2THFB 1IQHA 3UTUH 1DXPA 1K1NA 1BBRH 1P02A 3RLYH 1O33A 1RTFB 1PPGE 4I8JA 3QZQA 1K1MA 5AVDA 3PWCA 4CRFA 2XRCA 2WV5A 3TITA 2P3UB 3GYMA 5C5OA 1TRYA 5ETXA 3TH4H 2V3OH 3WY8A 2CN0H 1D6RA 5B6OA 1THRH 2HGTH 1G2LA 1HYLA 3VPKA 2PGBB 2TGTA 2F91A 2F9PA 3U1JB 3ODDA 2D1JA 1HXEH 1FMGA 1Y3YA 3TJOA 4ABIA 4AFSA 1H9IE 1S0RA 3RXVA 1GDQA 3A80A 1KXBA 2C93B 1O2ZA 1DWCH 4AYVB 3GY6A 5FAHA 1MKWK 4RKJB 2ESTE 1P04A 1YPHE 2I6SA 1D9IA 2UUJB 4F49A 3R0FA 4NSVA 4K1EA 4LZ1H 2QGRA 4ABFA 1UVPA 1FUJA 1PPEE 1S6HA 2V35A 1DICA 1FV9A 2ZP0H 3MNSA 4DIIH 1FAXA 1ANBA 1DLKB 1TMTH 2VVVA 1SL3A 1UTLM 3KL6A 3RMLH 1ZGVA 3K6YA 5DP7A 4TWYA 1ARBA 3SNCA 2VIOA 2P16A 2WINI 4MG3A 2OC7A 2XW9A 3MO3A 1EPTC 3LDXH 1AVWA 1GBMA 1QQUA 5GJ4B 1K1OA 1FPHH 4DW2U 1EATA 3S7KB 1OOKB 4UFFH 1A5GH 1CA0C 1MTUA 3BV9B 2GTBA 1GVKB 4E7RG 1Y5BT 2ANYA 3SU0A 3RXLA 1MQ6A 5PTPA 1OP2A 1L1JA 1EPTB 4Y71A 3QUMP 3PV4A 1GI6A 3PTNA 3PROA 5F8XA 1KIGH 1SLUB 1FY4A 3SNEA 1C9PA 1C5MD 2BD2A 3NK8A 1P57B 4ABJA 2UUKB 2VVCA 2O8WA 2PV9B 2PTCE 1RJXB 1RIWB 4MNWA 1EXFA 1GJBB 1QB1A 5AF9H 1C5SA 3EQ0H 1LQEA 1ZJKA 3SU4A 2XCNA 4FVDA 5LPFA 1TIOA 1DXWA 3PYHA 2BDAA 4U32A 9LPRA 2AH4X 1IHTH 2IPHA 5FCRA 1C4V2 1FN6A 2A0QB 3UOUA 2AYWA 2Y7ZA 4DJZB 1GI8B 3TJUA 3LGTA 3MU0A 1YCPK 1W0ZU 1JRTA 1IQFA 4D76A 3RM0H 1AMHA 1O2XA 2PSYA 3OX7U 1C2JA 2BHGA 4I32A 1EASA 1NESE 1NY22 2BY6X 1LQDB 5AHGH 4B75A 1TBZH 4NA8A 3D23A 1O34A 3MNBA 1T7CA 1HXFH 3A7VA 1O35A 1KLTA 3A84A 3SQHE 2SGQE 1T32A 3EAJA 1BTUA 1FLEE 4YM9A 1MCTA 1JIMA 3P6ZB 5DP9A 4LXBH 1Y3WA 1QGFA 1ACBE 3UR9A 3T28A 4X8UH 1G36A 1BIOA 1O3FA 5FBEA 1XVOA 1SFIA 2GV7A 4OS4A 2ZHDA 3RM2H 1G30B 3HPTB 2ZCHP 5IYTA 1TMBH 1FDPA 1ABIH 4IBLH 3VB6A 2TGPZ 2P94A 5H4IB 1MAYA 3RXDA 1ZHMA 3TLOA 3KQBA 1CO7E 5IDKA 1EZSC 2Q6DA 4X8VH 1GHBF 2O8LA 1TOCB 2FI5E 1W3CA 4ZXYH 1QJ6B 3NXPA 3PMHB 3RXOA 5BRRE 1OWKA 2VWMA 2BDGA 1HV7A 2SNWA 3H5CB 3TK9A 3URDA 2FO9A 3ODFA 3EA9A 4WF8A 4JZIA 1GJ9B 1T4UH 2C8YB 2D26C 1AFQC 4BTIB 3F9HA 1BUIA 1DSUA 1YPJH 4OS2A 1GBFA 3ATMA 2R0KA 2Z9LA 2F9NA 2W7UA 3UNSA 1A0JA 2PW8H 1CBWC 2HNTC 3QLPH 3QX5H 3ZVBA 3ZVAA 2C90B 1O2HA 2FTMA 4IGDA 2BD4A 4AFZA 1VITF 2BM2A 3KN2A 1AFQB 1F5RA 2ZQ1A 2DE8A 1QJ1B 3M3SA 1LVYA 1MTNC 1T8NA 3O8CA 4CR9A 2QN5T 1Q31A 2BX4A 2XWAA 1MU6B 2SGPE 2Z7FE 3KQDA 1CBWB 1P2OA 1K28D 1Y3UA 2Y81A 1CT0E 2FLBH 4J2YB 1DANH 4PROA 5E0GA 2G52A 1GWAA 1TQ7B 2V3HH 1OYTH 1GHVH 4FU8A 3NUMA 2EI8A 1NZQH 4D9QA 3OYPA 1QRWA 3E6PH 3T25A 1QA7A 1FJSA 1UTPA 3Q3YA 1B0EA 3PLKA 1MKWH 1DM4B 3P8GA 3RXRA 1IOEA 1D3DB 3GCTG 2ODQA 3K65B 1DITH 1GBCA 4MVNA 2PKAA 3L6PA 1SC8U 4CH2B 3GCHC 1TLDA 1WU1A 2FYRA 4J1YA 3SORA 3VFEA 4WXIA 1FY3A 5TCAA 2H9EH 2ZU3A 4ZXXH 3OTJE 4JZDH 4GUXA 4UFEH 1PQ8A 4DCDA 1AHTH 3M7UA 3BTEE 2Y5FA 3SV8A 3GCHB 1A2CH 4INHA 1MKXK 5AFYH 5E2PA 6GCHF 1K22H 3SI4H 4H6TA 4K2YA 1UK3A 2XBYA
chains in the Genus database with same CATH superfamily
2WYJA 4Y8ZA 5C3NA 1UTQA 3H7OA 1MZAA 2YNAA 1FY5A 2GT8A 7KMEH 5EJZA 5E0JA 1Z7KA 1GBIA 1AY6H 3K9XB 4ABDA 4AGKA 1NFYA 2BQWB 3SHAH 2BTCE 1F0RA 4X2WA 1PFXC 5EW2H 3MQKC 3C27B 5GIBA 8GCHG 1LPGB 3V12A 1MZDA 4MDSA 2ZU2A 4XFQA 1ANDA 1O5CB 4OM9A 3PWBA 2Y7XA 1C2GA 3RC6A 5FPTA 4ZHMU 5GPIB 4X6OA 3UPEA 3GICB 4JYTA 1KLJH 1YLDA 5C20A 5HKKD 1F2SE 1A4WH 1FQ3A 1AGJA 5EQRA 4D8NA 3DFJA 1W7XH 1LKAA 1XXDA 2QXGA 1O3MA 3NCLA 1O0DH 2FPZA 3LU9B 5GCHG 2CXVA 4TY7A 1YPHC 1VJ9U 3LGVA 1NTPA 3L3TA 2EC9H 4ABBA 1T31A 2FOHA 3LGUA 1YF4A 2PP6A 2KZ4A 1DE7H 4P00A 1G3CA 3P95A 1GMDF 4CRGA 2BDIA 1VKYA 5L30H 2Q6FA 1S6LA 2C8XB 4CRDA 1NFWA 1YCPM 1ELAA 3V0XA 1HAZB 3RU4D 2J2UA 1F5KU 1V6DA 4XBBA 1O2LA 3A7WA 2RDEA 4YZUA 3SU2A 1GHXH 1K1PA 5L2YH 1W2KH 3A81A 3SOSA 1NRSH 3ZYEA 3A87A 1Y8TA 1EB2A 1Z8IB 1IQLA 4LK4A 4ZUHA 2AHME 1WQVH 2P95A 1GMHG 1OWJA 1UVTH 3F9EA 4MLFB 4ISLA 1GHAF 1T4VH 1KXFA 1P09A 2BVXH 3OTPA 3MI4A 3F1SB 4NIXA 1ZPBA 4CBNA 1TBRH 4B2BA 1QFKH 3NKKA 2STAE 3A88A 3H09A 1MCVA 1VCPA 1VITH 4GVUA 3SUDA 4HGCA 1X7AC 5DSFA 2B8OH 4IMZA 3E91A 4OS6A 1K1IA 1GPZA 2BLWA 1WOFA 3GDUA 1TNHA 2FX6A 3HK6B 4RN6A 1C1TA 2KX4A 1O5FH 2ZFFH 5C0TA 1O2NA 2BXUH 2Y5HA 1ZZZA 2HVYB 4E7NA 1UTJA 3E8LA 4TPIZ 1C5YB 1J14A 2ZHQH 3FZDA 3MU4A 3S7HB 1GGDC 1BTWA 2FZZA 3MH5A 4D7FA 1E79D 1ZHPA 2YNBA 1ESBA 4Q63A 2ZCLP 2R0LA 2B5TB 3BEIB 1GMCG 2VINA 3ZZ5A 4RKOB 3F68H 1PYTD 1J8AA 1INCA 3TK6A 5C0UA 1ORFA 1KLIH 2A31A 2ANMH 1FONA 4K5ZA 3VEQB 5JPMH 1CA8B 2QF4A 3VB3A 2STBE 1GGDB 5HYOA 3H7TA 2OQ5A 1EOLA 3BTKE 1HJ9A 5BPEA 1LTOA 4KKDA 2BLQA 3ZZAA 1P8VC 1JIRA 3SN8A 4UE7H 3RXIA 3M7TA 3MHWU 3QTOH 1O3JA 3RU4T 1P2IA 1GDNA 2AIQA 2WPKS 1DVAH 1SHYA 1V2WT 1NN6A 2FOBA 4Q7YA 2R3UA 3RXFA 3VG8A 2BYAX 2OTVA 2XBVA 3SO3A 1V2UT 2KR7A 5DG6A 3DD2H 2Z6BD 2FM2A 1RTLA 1EPTA 5E8EH 2OD3B 2RA3A 2CMYA 3KIDU 4Q2KA 1YPLH 4ISIH 2J9NA 2XYAA 4Y10E 2BD3A 3M35A 2ZCKP 1A5IA 4ZKOU 4MNXA 5LGOA 1GJCB 3ATKA 2F9OA 1JXPA 2V0BA 2Z9KA 4ZKNU 1UHBB 2IN2A 1S85A 3GCOA 1CVWH 2BD5A 2UUFB 1MUEB 4A6LA 2FEQH 3BTTE 4AG1A 2SGAA 4O03A 5LH8A 3MU5A 3P92A 1ZTLA 2BMGB 2R3YA 4MPUA 2H6MA 1OS8A 1QNJA 1VGCC 1HGTH 2J92A 4FUHA 4RT0A 2BB4A 1BTZA 2Y80A 1LMWB 4X6MA 4F55A 2TPIZ 2XTTB 3RXAA 2DE9A 3SHCH 1K2I1 2CF9H 1K9OE 3EA8A 4NCYA 4AYYB 1EP6A 3DHKH 3O8RA 1KXCA 1TRNA 1MKXH 2V6NA 4LOYH 3W1EA 3LIWA 1V2JT 2QE7D 1VGCB 3DT0H 1J16A 4NIVA 1XUHA 4NFFA 1P2MA 4I31A 5FXLA 2NU4E 1GI1A 3P17H 3O8DA 1XM1A 2M5TA 2TRMA 3KHVA 1GI5A 5DP6A 5LPRA 1C5TA 1KDQB 1MD8A 1ZSJA 3E90B 4RSPA 1GJDB 3QN7A 5TJXA 3S69A 4XRNA 2XBWA 2RDLA 2FTLE 3D65E 1Q3XA 4FUJA 2HPPH 1QL9A 2LNCA 1CT2E 5CE1A 1BITA 2PKSC 3HGPA 2ZKSA 1MBMA 1RD3B 1W12U 2Q1JA 3QGJA 1TRMA 2XNDD 1Z8GA 4KTUA 2PGQB 4WMFA 1IQEA 2LPRA 2A45B 1W10U 4I33A 3R3GB 2FOFA 4A1TA 1BRAA 1Y59T 2VH6A 2AMPA 1QR3E 1E37B 2JH0D 2PKSB 4Y0YE 1AB9C 1DT2A 1AU8A 1C4Y2 1UVOA 3RDZA 3OAAD 4Y7AA 4IW4E 2SNVA 3LOXA 2BVRH 1QRZA 1ZMLA 2QXIA 3RLWH 1BHXB 1TGTA 2V7QD 1GL0E 1FY1A 1EJAA 2XWBI 4FU7A 5C1UA 4FVBA 2H5CA 3RXCA 2VWNA 1C5QA 1NFXA 1AB9B 3T26A 1XMNB 3V13A 2ALPA 1ZMJA 2NU2E 1O3LA 3E16B 4O9VA 1L1GA 3KQCA 2J95A 2JH6D 2KCOA 2PUQH 1C4U2 1RGQA 2OLGA 5T6FA 1BTXA 2VNTA 2ZDNA 4BTTB 1H8ED 1GHWH 5L6NH 1JWTA 4E06H 4I7YH 2PUXB 5DO4H 3ZZ7A 1FY8E 1BZXE 4IS5A 3U1IB 1P2KA 1NO9H 4ZROA 3U8OH 1WUNH 3ATIA 3STIA 1EZXC 1CGIE 1L1NA 1HUTH 3KCGH 2ZFQH 1H8IH 1HJAC 2GJGA 4X1QU 3ATLA 2WV9A 2PTNA 3LPRA 5HIZA 1SLWB 5HM9A 3ZIAD 4DT4A 1ZTKA 5FL7D 1L4DA 2ASUB 3MO9A 5F53A 3TH2H 5A8YA 2G4TA 3N7OA 1QBOA 2XXLA 2RG3A 2HOBA 4AOQA 1HJAB 1RIWC 1GI4A 3B8JA 5JB9S 4HZHA 1GHZA 1GVZA 1DDJA 1Z8JB 2G4UA 4CHAC 1ZYOA 4AZ2B 3MH6A 1BTYA 1V2VT 2HLDD 3U98H 2J98A 2BY9X 4YT7H 1ZSKA 3RMMH 3AVZA 1XUIA 1ZJDA 1SLVB 1GJ7B 1YPKH 1S0QA 1O3CA 3BIVH 3AASA 3VB7A 2M2AA 4X8TH 4XOJA 2YMSD 2WV4A 3W95A 2ZDMA 4IC6A 1FPCH 5DJ7A 2XC0A 4CHAB 3RUOA 1O36A 1C5VA 1F0UA 2BXTH 1EQ9A 2CF8H 2FMJA 4ISNA 3TK5A 2ZGJA 2PFEA 3LT3A 1D6WA 4HFPB 1ZRBA 4GHTA 4OGYA 2ZPQA 1HAYB 1BMFD 1TNIA 3BTQE 3SNAA 3T27A 3RXGA 3U28C 4YTAA 4XE4A 2AGIX 4Y11E 3FP8E 7LPRA 5GWZA 1C2FA 5EQQA 2AERH 1QL8A 1N8OC 1BOQA 4A5TS 4FUDA 5ESBA 4B71A 2SFAA 4DOQA 2ZNKH 1O31A 1DSTA 3QZRA 4YXWD 1V3XA 1SLXB 2PR3A 5EOKA 1C1VH 1C2LA 1SGFA 1P12E 2A7HA 2ZDKA 3GDSA 4KELA 4SGAE 2OK5A 4NGAH 3S9CA 2BVSH 2EY4C 1GBDA 4FU9A 4BAMB 1AFEH 1D3TB 1N8OB 3T2NA 1UVSH 1QB6A 3QWCH 4YO9A 1LPKB 2QA9E 3SJ9A 3RXSA 3TJNA 5DPAA 2IPQX 4YESB 1LHEH 1O3DA 1RS0A 1ESAA 2G00A 2UWLA 3AW0A 2J94A 1HAVB 2QCYA 1EUFA 9ESTA 4X1SU 2QF5A 2ZPSA 1GI3A 3A8CA 4GSOA 4D7GA 2XC4A 1P3CA 1Z6JH 2QAAA 4NWLA 2FOMB 1P9UA 1XKAC 1V2MT 2VBCA 1L4ZA 4FUCA 2OQUA 4NG9H 2GZ8A 4B2AA 5FX6A 3ZZ8A 2NU3E 1T8OA 1C1MA 1TNLA 1QBVH 2WPDD 4AB9A 2A5AA 1XUFA 2R2MB 3MH4A 4MQAA 2OXSA 1LVMA 2G5NA 1NROH 2AGGX 3CS0A 2FI4E 1O2JA 3EE7A 1TQ0B 1C1UH 5FCKA 4AFUA 1AZ8A 4H42U 3RXJA 3ZVDA 3LONA 1GBEA 1SGIB 1TFXA 3F0OA 4WXVA 1KXAA 2GMTC 2G55A 2ZHEH 5J4QA 1C5OH 1O5DH 2HRVA 3B9FH 4DY7B 4ASHA 1QA0A 3SI3H 2ZZUH 3IITA 1DS2E 1K1JA 4FETA 1GVLA 3PLPA 1UCYE 1UCYK 4GAWA 2FOEA 3GYLB 5F8ZA 1BDAA 2YOLA 1TNJA 2NU1E 1MTSA 3I77A 5JBAS 3MTYA 3SZNA 2GMTB 3MWIU 3SU6A 4AX9H 1BTPA 1ELDE 2XC5A 3M36A 3RC5A 1C2KA 3GOVB 2BDBA 1WAYB 3BIUH 1MTWA 8ESTE 1OSSA 3TGIE 1PQ7A 1QB9A 3F9FA 3Q3KA 2PHBA 1VCWA 1O2TA 1FZZA 2A2QH 3A7XA 3I29A 1AKSB 3QDZB 4SGBE 2KM0A 4A7IB 1RTKA 1G3BA 1QHRB 1TOMH 4FUIA 1GBAA 5C5NA 5CDFE 5A09A 1PPBH 3MU1A 1SGYE 2K1QA 1H4WA 2F9BH 2KCPA 2ZFTA 4U30A 3WW7A 1KYNA 1GBKA 3NWUA 1DY8A 3UR6A 3SGAE 2FESH 1ELCA 1Z1IA 8KME2 1A1RA 5B6LA 1WV7H 2F3CE 1S81A 4X1RU 1V2TT 4B73A 1BQYA 3WWFA 1PPZA 3E1XB 1ZRKA 1MU8B 4DGJA 1OX1A 1BA8B 1KSNA 2FOCA 1HBTH 1SGTA 5C94A 2R9PA 4ZMAH 2ZWLH 1SKYE 1KMHB 2ZGBH 3PV2A 3SUEA 5JBCS 4NFEA 5DK1A 1E1RD 1ID5H 1IHSH 2GKVE 1AWFH 1TGCA 2QXJA 1FIWA 3U69H 3UUZA 3UQOA 2TIOA 1LDTT 1CHGA 5DP8A 1ZR0A 4X1PU 4X6NA 4INKA 2FS9A 1FXYA 1BRUP 2W3IA 1C2MA 5JDUB 2GD4B 4X2XA 1EJMA 2J5UA 1K21H 1ABJH 4MNYA 7GCHG 1ZPZA 2WSSD 4CBOA 3GCTF 3NPSA 1S5SA 4MPXA 1BHXF 4AFQA 1OHHD 1IQKA 3FFGA 4K3JA 1E1QD 4X6PA 3DSGA 4Y6DA 1EP5A 3A89A 3B23B 1HRTH 3C1KA 2PSXA 2ZHFH 4JYVH 1NM6A 3GY8A 2ZDVH 2VIPA 3I78A 2CK3D 3FP6E 3TH3H 4WH6A 1BB0B 5T6DA 1V2KT 3JZ2B 1HAPH 2TBSA 1AN1E 1LCYA 1LO6A 2QIQA 4IN1A 2BLOA 4BXWA 2F83A 1H9LB 1DX5M 1SMFE 1TGSZ 3SJIA 5ABWA 4B1TA 1G32B 3S9BA 1YWUA 1GL1A 1W14U 4B2CA 2ZPRA 3SV6A 1P3EA 1TYNA 1IAUA 2DUCA 3SJ8A 1ETRH 1O30A 1VR1H 1ETTH 4NSYA 1TBQH 3RMOH 1W8BH 4ZAEA 2OBQA 8GCHF 1V2LT 2ZF0H 4UFDH 5J4SA 3SV9A 1TPAE 2KFWA 1C2EA 1YCPH 2BQ6B 5HMAA 1BMLA 2AMQA 1O2QA 1W13U 2GV6A 4FUFA 4Q7XA 2KCAA 1Z6EA 1C5PA 1KTTB 2EEKA 3PV5A 1ELGA 3RXTA 1NU9A 5F6MA 3OFND 1C1WH 3SGQE 1O2UA 3ZVFA 4Q7ZA 1CGJE 1ZMNA 3GY2A 1EFRD 2A4RA 3F0PA 5GCHF 2W5EA 1IQNA 4ABAA 3FVFB 3UAIC 5A0CA 3NRLA 1V2RT 1TNKA 1YPGH 2H1UA 1O3EA 3GY3A 4MPVA 4NZQA 1JBUH 2ZDAH 1MH0A 1L0ZA 5DP4A 3WWBA 2O8MA 3F2GA 2A4QA 3IG6B 1ZPCA 4TWWA 1EAUA 1YC0A 2ULLA 2OINA 2A5KA 1BRCE 1E35B 1CE5A 2VGCC 1HPGA 2F9UA 1IQJA 4XDEA 1YM0A 3GISB 2WPJS 2JKHA 1QZ8A 3SV7A 5EPYA 3SBKA 3DSOA 4ACBA 5CMXH 1TX8A 1IQIA 1F7ZA 3SUGA 3DA9B 1TE0A 1C5NH 1A61H 5EW1H 1P11E 2CV3A 3F2HA 2BD8A 1GMHF 3UNRA 3PMJA 3HKJB 2VGCB 4JK6A 4UDWH 3RU4E 1XUKA 3NZIA 7ESTE 1UVUH 4NWKA 1WTHD 3P8NA 3LJJA 1UTOA 3OSYA 3SUFA 4HG6A 4BXSA 4B76A 2QY0B 1B0FA 1Z1JA 3A7YA 3EDXB 1SB1H 2ZFRH 1S84A 1SQTA 2B0FA 1GBHA 2WZQA 1ELVA 1LPZB 2C3SA 4I8KA 1V2QT 2J38A 1O2WA 4RI0A 3QK1A 2WUBA 3LH1A 1C5WB 2FLRH 2ZO3H 3PLBA 3DSPA 3P8OA 1A0HB 1O3KA 2W7SA 3RXPA 4DG4A 1UCYH 2W26A 3QTVH 1O3GA 2ALVA 2A4GA 2GCHG 4WWYA 1COWD 2UWPA 1THPB 1P06A 1GMCF 2KCYA 2OCVB 4DURA 2OC8A 3GCNA 4AORA 1C1PA 2AS9A 2JIZD 2A2XH 3OY5U 1DOJA 1WBGB 1EAWA 1NC6A 2AFQB 1J15A 1P2NA 2LELA 2ZI2H 2GDEH 4XSKU 2BY7X 1SSXA 2D8WA 3F6UH 1GJ8B 1F0TA 2TGAA 4Y7BA 2ZIQH 1SGEE 1O3HA 3FOAA 4K1TA 4ZHLU 1OPHB 1C1QA 2BY8X 3TIUA 1SGRE 4I8LA 6LPRA 4Y76A 1XX9A 3LKWA 5DKMA 4B74A 5C1YA 1SQOA 1HB0B 2VJ1A 1ETSH 2A7JA 4H4FA 4WJG2 1D3QB 2H9HA 2JJ1D 2P93A 1ELEE 1O5GH 3GY5A 1N6XA 4OS1A 4FUEA 1TX7A 2VIDA 5EPNA 3VXEH 5EXNA 1RXPA 1A3BH 2NU0E 2CJIA 3ZZ9A 4WH8A 1O3OA 2BD9A 2ZC9H 1WDIA 1YPEH 2IOTA 5EG4A 4GPGA 3KQEA 5FBIA 3UWIA 1P0SH 1EX3A 1K0HA 1C5LH 4JCNA 3STJA 1YPMH 2ZGHA 5E2OA 1Z8RA 3SU5A 1RFNA 1QBNA 2FP7B 3M37A 1HAGE 1XKBC 1HFDA 1GBTA 4THNH 1BMMH 3UWJH 1O32A 4B6FA 1AVGH 1DUAA 1CU1A 3TNSA 1UK4A 2KAIB 3K6ZA 2QXHA 4VGCC 1F5LA 3PTBA 3A8DA 2JETC 2EA3A 3BG8A 1ZGIA 5DP5A 3RXBA 2GGVB 1KY9A 1NS3A 3BTHE 1SGPE 3MOCA 1IQGA 3A86A 4BOHA 1Y5AT 2K8IA 4P02A 2Y82A 5AFZH 1NRPH 1TX6A 4BANB 1AE5A 2BOKA 1EZUC 1P10A 1ZTJA 4JK5A 4VGCB 4I8GA 4IMQA 2JETB 3T5FH 3M3VA 4IC5A 3KQ5A 3HK3B 1S83A 1C1OA 3ZVGA 1DWEH 1O2OA 2RCEA 1J17T 1SFQB 2HALA 5FX5A 1V2ST 3SJOA 5A8XA 3SU1A 2I6QA 3U8TH 3ESTA 3U9AH 2Z3CA 5JYIA 4GLYA 2FS8A 3ZVCA 4DIHH 1W0JD 3LJOA 3TPIZ 2H9TH 4XD7D 2Z9IA 5TCCA 2C4FH 4CREA 2GX4A 4TT3D 2QF0A 2ZU4A 3MYWA 2GP9B 3LC3A 2BQ7B 1HIAB 2EI7A 4Z6AH 2G5VA 1SGFG 4UONA 1TWXB 3V7TA 3HATH 2BDCA 5C2ZA 4GHQA 1NBMD 3BTGE 2SGFE 3PMBB 1G9IE 1H9HE 3ZV8A 1EAIA 1U6QA 3BSQA 1L2EA 4ZKSU 1P01A 3AAVA 1WSSH 3PO1C 2IJOB 3VB4A 2GCTC 1SQAA 2QV1A 3MU8A 3V3MA 3DCLA 2BDHA 5T3HA 4MPWA 1SQRA 1YP9A 2CGAA 2O9QA 4IN2A 5DGJA 3BTME 5EIYA 2ANWA 1EAXA 1OXGA 5GXPA 1O2PA 3RXMA 1T8MA 1Y3XA 3PO1B 2ODYB 4UEHH 2GCTB 1BRBE 2Z9JA 4O3TA 4DVAU 2A7CA 1AKSA 4WMDA 2XNIA 1DWDH 1S82A 4Z0KA 2BD7A 3MFJA 3UIRA 2ZU5A 1ZOMA 1H8HD 1A46H 4JZFH 3UQVA 1DWBH 1NRNH 2GT7A 3HGNA 3Q77A 4O3UA 4NA9H 1Y5UT 2EI6A 3FO8D 2HLCA 2F4LA 3SW2B 2FOAA 3EE0B 3U8RH 3FKSD 5K7RA 1VJAU 3N99A 1QTFA 2UUYA 1TNGA 1SR5C 3MNXA 5F8TA 1SGDE 1AWHB 1OWDA 2P59A 2QF3A 1AZZA 1W7GH 4NIWA 2Z9GA 4BAKB 3OEHD 3A7TA 1CA0B 4F48B 1TA2A 1PQAA 3N7EA 4HI3A 2WPLS 2BLVA 1MMJN 4X0WU 3TU7H 3ENSB 4OS7A 2BY5X 1GCDA 3SNBA 1AUTC 5I46H 1TGNA 2GZ9A 4NIYA 1O3NA 1OWHA 1C1SA 3ELAH 4YT6H 2EQNA 1O2VA 2FXRA 3SJKA 4ACAA 5DN6D 4X2YA 4K8YA 1O37A 2ZG0H 2B9LA 4U2WA 3KEEA 1Y3VA 3RXKA 2C8ZB 4E05H 1M9UA 1NU7B 1N6YA 1AQ7A 1G3DA 1GDUA 4YOGA 3SNDA 3E0PB 1SGCA 5G4BA 4JZ1A 2OC0A 5EGMA 3LGIA 4K60A 1GI7B 2HPQH 2V3MA 1YLCA 2A5IA 5JBTA 2C8WB 1K1LA 3HKIB 3PB1E 5A8ZA 3AK5A 3M5LA 1QCPA 2ILNA 3TVJB 3LC5A 1LVOA 1PJPA 2RA0A 2WPIS 4KTCA 3L33A 3A85A 5A2MH 1GHBG 5ESTE 2PWXA 1AUJA 2G51A 2WPMS 4BAQB 1TPPA 5GNDA 1J9CH 1FIZA 1VCQA 1D4PB 3GY4A 3SYJA 1VZQH 2SGDE 5L2ZH 1QURH 1C5ZB 1BT7A 6ESTA 4MTBA 1QJ7B 2F43B 3UREA 1V2NT 4YLQH 1O2IA 4AG2A 1ELTA 2G81E 2Y6TA 1GJAB 1ELBA 4GCHG 4FXGH 3M3TA 3W94A 1AD8H 4I8HA 1XUJA 2OBOA 3QO6A 2ZU1A 3S9AA 1VITG 1S6FA 3CP7A 4INLA 3SV2H 3T62A 5EXLA 1NFUA 3UB0A 1C2HA 1E36B 5F03A 1EOJA 2FI3E 1JRSA 1HJ8A 1YBWA 3SGBE 2ZTYA 3FZZA 1UK2A 2BOHB 1EJNA 1BTHH 1HNEE 1O3AA 3GY7A 3SZEA 2WUCA 1C5RA 1A5HA 3MO6A 4A92A 1A7SA 4XBCA 4AC9A 2ZDLA 1GG6C 1C2DA 3DUXH 1MBQA 3D62A 3ZVEA 1SGQE 5FPYA 1AVXA 1WCZA 3CNRA 1HAOH 1C1RA 3K2UA 1BMNH 1PYTC 2J34A 2VIVA 2W6JD 5E0HA 5SGAE 4GCHF 1E34B 1F0SA 4K69A 1W0YH 1GBJA 2ZQ2A 3EYDA 2AMDA 3FN8A 1GG6B 2B7DH 1G37A 3GDVA 2BZ6H 2ZFPH 1GI2A 1G2MA 1UTKA 1C2IA 3E0NB 4DT7B 2XCFA 1THSH 5HXFA 5CHBA 1UO6A 4TY6A 1FN8A 1HDTH 1TMUH 2G8TA 3M7QA 4AB8A 1QRXA 3M5OA 3ZZBA 3KNXA 2JH5D 1GI9B 4Y79A 1C5UA 3UOPA 1WTGH 1NPMA 1MTNB 3ZZDA 3BF6H 6GCHG 4YLUA 1OWIA 3QGNB 3URCA 3F2FA 2BX3A 1QIXB 2VB0A 4Y8YA 4OGXA 2AIPA 3Q76A 1GCTC 2A4OA 5CHAC 4NZLA 1V2PT 2ZGCA 2Q6GA 1C9TA 3M61U 2A1DB 2A32A 3TNTA 3ZZ4A 1RRKA 1MAXA 2J98B 3S0NA 3RXHA 1UTNA 1QY6A 1OP8A 2ZA5A 4X1NU 5C1XA 3RXEA 1CSOE 2VU8E 1HCGA 1SBWA 1P05A 1GCTB 1SOZA 2P3FH 5CHAB 3FAOA 1P2JA 3VB5A 4XBDA 1SOTA 1SI5H 1OP0A 1MQ5A 4Q80A 4ABHA 3BEUA 1YLNA 3Q3XA 1GI0A 1UHBA 2VIQA 4ABEA 5JB8S 1IQMA 2ZECA 1JOUB 2FIRH 2K0QA 3A8BA 2GZ7A 2J4IA 3EA7A 1DUEA 2D2DA 4AN7A 1SVPA 1CQQA 1QL7A 1AE8H 4KP0A 2RFKC 3KF2A 3P70B 3ATWA 1G3EA 1T8LA 1GJ5H 1EB1H 1MD7A 1UMAH 5EQSA 2FX4A 4KGAA 4K8BA 1CHOG 2JDID 4TYDA 1GJ6A 1TAWA 3CS7A 4F4OC 1BBRE 1BBRK 1GMDG 1H1BA 3TGKE 4Z1MD 1B7XB 4X8SH 5EODA 1SPJA 4X2VA 3SU3A 4YOJA 1TONA 3BTDE 1P9SA 1ELFA 3KYGA 7GCHF 5FPSA 2BZAA 1YGCH 4ABGA 1C5XB 2FODA 1N1LA 1ANEA 1KXEA 3PMAB 3TGJE 3ZV9A 1O3PB 1GJ4H 2LP6A 3BEFB 4R0IA 3UNQA 1O5EH 1O2YA 5EJLA 1EZQA 1KDQA 3OY6U 4H6SB 5K0HA 2P3TB 2VWOA 3PM3A 2Z3DA 1GHAG 2KAIA 5HGGA 4ESTE 1O2SA 4JZEH 4ISOA 1HAXB 3E3TA 2TGDA 3FANA 3VGCC 1CHOF 1GHYH 4BTUB 1O39A 1C1NA 2CHAC 3ZZ6A 1NT1A 1XVMA 3D49H 2Z3EA 1O2MA 3ZZCA 1LHCH 1TGBA 4BAOB 3MMGA 3A82A 4MNVA 1FNIA 4FUGA 3T29A 4R8TB 3G01A 1FI8A 3VGCB 1A3EH 5IK2D 2CHAB 1O2RA 4CR5A 1WXRA 4A1XA 1V2OT 3RXQA 1Z71A 1TALA 1TA6A 1NRQH 1O5BB 3A7ZA 3BTWE 3RC4A 4CH8B 2SGEE 1PQ5A 8LPRA 2QC2A 1B5GH 3M5NA 1SG8B 2O8TA 3IWMA 1FX0B 4QT8C 1HIAA 1YYY1 2ODPA 2GVFA 2ZFSA 4KTSA 5JBBS 2HVXA 1D3PB 5EU8A 3KGPA 2GDDA 4UD9H 3LH3A 4D9RA 3RMNH 2FYQA 3F3BA 4CRCA 2UWOA 4UFGH 3OEED 2BDYA 1OYQA 1CT4E 1DY9A 2F9VA 2OUAA 2WYGA 5GDSH 2O8UA 1P03A 1Q2WA 4O97A 1O3BA 3RXUA 1DLEA 2QYIA 1HAHH 4ASUD 4OS5A 1EKBB 1PPCE 5A0BA 3SQEE 2ANKH 4M9FA 1NRRH 2H2ZA 1JMOH 1ZSLA 3A83A 1TPOA 3M5MA 5HM2A 1FAKH 3FP7E 4K1SA 3VXFH 2NWNA 2VVUA 1BJUA 1AI8H 5LPEA 4ZH8A 3F9GA 5FHTA 1A0LA 1UW7A 3AW1A 3BTFE 1ZLRA 2OC1A 1LHFH 2PKAB 4M7GA 2VWLA 1XUGA 1KTSB 1ESTA 5I25A 4JYUH 4LZ4B 1LVBA 1BMAA 1OWEA 2P8OC 2Y5GA 1PPFE 2YMSC 5EXMA 1UTMA 5KGOA 4AGJA 4BAHB 2AEIH 3ZYDA 2R2WU 1ARCA 3ZZ3A 4I86A 3JZ1B 1O38A 1TABE 3MH7A 1BJVA 4ZKRU 3OU0A 4FOUC 2AGEX 2VH0A 1O3IA 3P8FA 6CHAC 2FDAA 1O5AB 2HNTE 2H5DA 4A1VA 3DFLA 1HLTH 2P8OB 2ZGXH 3MNCA 4HTCH 1KXDA 3RP2A 2WPHS 1SGNE 1QQ4A 2YMSB 2JJ2D 3O8BA 2GCHF 1GBLA 1LHGH 2ZTZA 3EGKH 2FOGA 4RT1A 1WYKA 1LKBA 3BG4C 3ITIA 6CHAB 4WY3A 4CRBA 1UJ1A 1W11U 3Q00A 1MTVA 2FWWA 4Y0ZE 1O2GH 2ZTXA 3AAUA 1OKXA 1E0FD 2XBXA 3TJVA 1SHHB 5T1VA 2Z94A 2VIWA 1ZHRA 1XXFA 2W3KA 1DPOA 1E38B 1CGHA 3BG4B 4WVPE 2ZHWH 1TPSA 4FUBA 1DFPA 4CRAA 1GBBA 5A0AE 1PPHE 1LHDH 3BN9A 4U01A 4WMEA 2ZEBA 1HAIH 1ANCA 4YOIA 3LGWA 4ZHAA 1H8DH 3UFAA 1O2KA 4TPYA 1F92A 3LGYA 4NA7A 5C67A 5DP3A 1AIXH 2PLXA 2HWLB 4BNRA 5HIYA 4JMYA 1BCUH 3UY9A 4ISHH 5T6GA 1TB6H 2HNTF 3PRDA 2OP9A 1AO5A 1HAVA 1W0KD 1WQSA 1YKTA 3PRBA 3CENA 4Y8XA 1P2QA 3A8AA 2THFB 1IQHA 3UTUH 1DXPA 1K1NA 1BBRH 1P02A 3RLYH 1O33A 1RTFB 1PPGE 4I8JA 3QZQA 1K1MA 5AVDA 3PWCA 4CRFA 2XRCA 2WV5A 3TITA 2P3UB 3GYMA 5C5OA 1TRYA 5ETXA 3TH4H 2V3OH 3WY8A 2CN0H 1D6RA 5B6OA 1THRH 2HGTH 1G2LA 1HYLA 3VPKA 2PGBB 2TGTA 2F91A 4B6EA 2F9PA 3U1JB 3ODDA 2D1JA 1HXEH 1FMGA 1Y3YA 5C17A 3TJOA 4ABIA 4AFSA 1H9IE 1S0RA 3RXVA 5EJ1A 1GDQA 3A80A 1KXBA 4ZCNA 2C93B 1O2ZA 1DWCH 4AYVB 3GY6A 5FAHA 1MKWK 4RKJB 2ESTE 1P04A 1YPHE 2I6SA 1D9IA 2UUJB 4F49A 3R0FA 4NSVA 4K1EA 4LZ1H 2QGRA 1MABB 4ABFA 1UVPA 1FUJA 1PPEE 1S6HA 2V35A 1DICA 1FV9A 2ZP0H 3MNSA 4DIIH 1FAXA 1ANBA 1DLKB 1TMTH 2VVVA 1SL3A 1UTLM 3KL6A 3RMLH 1ZGVA 3K6YA 3KYFA 5DP7A 1YY3A 4TWYA 1ARBA 3SNCA 2VIOA 2P16A 2WINI 4MG3A 2OC7A 2XW9A 3MO3A 1EPTC 3LDXH 1AVWA 1GBMA 1QQUA 5GJ4B 1K1OA 1FPHH 4DW2U 1EATA 3S7KB 1OOKB 4UFFH 1A5GH 1CA0C 1MTUA 3BV9B 2GTBA 1GVKB 4E7RG 1NBME 1Y5BT 2ANYA 3SU0A 3RXLA 1MQ6A 5PTPA 1OP2A 1L1JA 1EPTB 4Y71A 3QUMP 3PV4A 1GI6A 3PTNA 3PROA 5F8XA 1KIGH 1SLUB 1FY4A 3SNEA 1C9PA 1C5MD 2BD2A 3NK8A 1P57B 4ABJA 2UUKB 2VVCA 2O8WA 2PV9B 2PTCE 1RJXB 1RIWB 4MNWA 1EXFA 1GJBB 1QB1A 5AF9H 1C5SA 3EQ0H 1LQEA 1ZJKA 3SU4A 2XCNA 4FVDA 5LPFA 1TIOA 1DXWA 3PYHA 2BDAA 4U32A 9LPRA 2AH4X 1IHTH 2IPHA 5FCRA 1C4V2 1FN6A 2A0QB 3UOUA 3N7DA 2AYWA 2Y7ZA 4DJZB 1GI8B 3OE7D 3TJUA 3LGTA 3MU0A 1YCPK 1W0ZU 1JRTA 1IQFA 2J97A 4D76A 3RM0H 2IJD1 1AMHA 1O2XA 2PSYA 3OX7U 1C2JA 2L74A 2BHGA 2XOKD 4I32A 1EASA 1NESE 1NY22 2BY6X 1LQDB 5AHGH 4B75A 1TBZH 4NA8A 3D23A 1O34A 3MNBA 1T7CA 1HXFH 3A7VA 1O35A 1KLTA 3A84A 3SQHE 2SGQE 1T32A 3EAJA 1BTUA 1FLEE 4YM9A 1MCTA 1JIMA 3P6ZB 5DP9A 4LXBH 1Y3WA 1QGFA 1ACBE 5KEDA 3UR9A 3T28A 4X8UH 1G36A 1BIOA 1O3FA 5FBEA 1XVOA 1SFIA 2GV7A 4Q4LA 4OS4A 2ZHDA 3RM2H 1G30B 3HPTB 2ZCHP 5IYTA 1TMBH 1FDPA 1ABIH 4IBLH 3VB6A 2TGPZ 2P94A 5H4IB 1MAYA 3RXDA 1ZHMA 3TLOA 3KQBA 1CO7E 5IDKA 1EZSC 2Q6DA 4X8VH 1GHBF 2O8LA 1TOCB 2FI5E 1W3CA 4ZXYH 1QJ6B 3NXPA 3PMHB 3RXOA 5BRRE 1OWKA 2VWMA 2BDGA 1HV7A 2SNWA 3H5CB 3TK9A 3URDA 2FO9A 3ODFA 3EA9A 4WF8A 2W6ID 1GJ9B 1T4UH 4JZIA 2C8YB 2D26C 1AFQC 4BTIB 3F9HA 1BUIA 1DSUA 1YPJH 4OS2A 1GBFA 3ATMA 2R0KA 2Z9LA 2F9NA 2W7UA 3UNSA 1A0JA 2PW8H 1CBWC 2HNTC 3QLPH 3QX5H 3ZVBA 3ZVAA 2C90B 1O2HA 2FTMA 4IGDA 2BD4A 4AFZA 1VITF 2BM2A 3KN2A 1AFQB 1F5RA 2ZQ1A 2DE8A 1QJ1B 3M3SA 1LVYA 1MTNC 1T8NA 3O8CA 4CR9A 2QN5T 1Q31A 2BX4A 2XWAA 1MU6B 2SGPE 2Z7FE 3KQDA 1CBWB 1P2OA 1K28D 1Y3UA 2Y81A 1CT0E 2FLBH 4J2YB 1DANH 4PROA 5E0GA 2G52A 1GWAA 1TQ7B 2V3HH 1OYTH 1GHVH 4FU8A 3NUMA 2EI8A 1NZQH 4D9QA 3OYPA 2L6OA 1QRWA 3E6PH 3T25A 1QA7A 1FJSA 1UTPA 3Q3YA 1B0EA 3PLKA 1MKWH 1DM4B 3P8GA 3RXRA 1IOEA 1D3DB 3GCTG 2ODQA 3K65B 4TSFD 1DITH 1GBCA 4MVNA 2PKAA 3L6PA 1SC8U 4CH2B 3GCHC 1TLDA 1WU1A 2FYRA 4J1YA 3SORA 3VFEA 4WXIA 1FY3A 5TCAA 2H9EH 2WHXA 2ZU3A 4ZXXH 3OTJE 4JZDH 5KECA 4GUXA 4UFEH 1PQ8A 4DCDA 1AHTH 3M7UA 3BTEE 2Y5FA 3SV8A 3GCHB 1A2CH 3GS9A 4INHA 1MKXK 5AFYH 5E2PA 6GCHF 1K22H 3SI4H 4H6TA 4K2YA 1UK3A 2XBYA
chains in the Genus database with same CATH topology
2WYJA 4Y8ZA 5C3NA 1UTQA 3H7OA 1MZAA 2YNAA 1FY5A 2GT8A 7KMEH 5E0JA 1Z7KA 1GBIA 1AY6H 3K9XB 4ABDA 4AGKA 1NFYA 2BQWB 3SHAH 2BTCE 1F0RA 4X2WA 1PFXC 5EW2H 3C27B 5GIBA 8GCHG 1LPGB 3V12A 1MZDA 4MDSA 2ZU2A 4XFQA 1ANDA 1O5CB 3PWBA 2Y7XA 1C2GA 3RC6A 5FPTA 4ZHMU 5GPIB 4X6OA 3UPEA 3GICB 4JYTA 1KLJH 1YLDA 5C20A 1F2SE 1A4WH 1FQ3A 1AGJA 5EQRA 4D8NA 3DFJA 1W7XH 1LKAA 1XXDA 2QXGA 1O3MA 3NCLA 1O0DH 2FPZA 3LU9B 5GCHG 2CXVA 4TY7A 1YPHC 1VJ9U 3LGVA 1NTPA 3L3TA 2EC9H 4ABBA 1T31A 2FOHA 3LGUA 1YF4A 1DE7H 1G3CA 3P95A 1GMDF 4CRGA 2BDIA 5L30H 2Q6FA 2C8XB 4CRDA 1NFWA 1YCPM 1ELAA 3V0XA 1HAZB 3RU4D 2J2UA 1F5KU 1V6DA 4XBBA 1O2LA 3A7WA 4YZUA 3SU2A 1GHXH 1K1PA 5L2YH 1W2KH 3A81A 3SOSA 1NRSH 3ZYEA 3A87A 1Y8TA 1EB2A 1Z8IB 1IQLA 4LK4A 4ZUHA 1WQVH 2P95A 1GMHG 1OWJA 1UVTH 3F9EA 4MLFB 4ISLA 1GHAF 1T4VH 1KXFA 1P09A 2BVXH 3MI4A 3F1SB 4NIXA 1ZPBA 4CBNA 1TBRH 4B2BA 1QFKH 3NKKA 2STAE 3A88A 1MCVA 1VCPA 1VITH 4GVUA 3SUDA 4HGCA 1X7AC 2B8OH 4IMZA 3E91A 4OS6A 1K1IA 1GPZA 2BLWA 1WOFA 3GDUA 1TNHA 2FX6A 3HK6B 4RN6A 1C1TA 1O5FH 2ZFFH 1O2NA 2BXUH 2Y5HA 1ZZZA 4E7NA 1UTJA 3E8LA 4TPIZ 1C5YB 1J14A 2ZHQH 3FZDA 3MU4A 3S7HB 1GGDC 1BTWA 2FZZA 3MH5A 4D7FA 1ZHPA 2YNBA 1ESBA 2ZCLP 2R0LA 2B5TB 3BEIB 1GMCG 2VINA 3ZZ5A 4RKOB 3F68H 1PYTD 1J8AA 1INCA 3TK6A 1ORFA 1KLIH 2A31A 2ANMH 1FONA 4K5ZA 3VEQB 5JPMH 1CA8B 3VB3A 2STBE 1GGDB 5HYOA 3H7TA 2OQ5A 1EOLA 3BTKE 1HJ9A 5BPEA 1LTOA 4KKDA 2BLQA 3ZZAA 1P8VC 1JIRA 3SN8A 4UE7H 3RXIA 3M7TA 3MHWU 3QTOH 1O3JA 3RU4T 1P2IA 1GDNA 2AIQA 2WPKS 1DVAH 1SHYA 1V2WT 1NN6A 2FOBA 4Q7YA 2R3UA 3RXFA 2BYAX 2OTVA 2XBVA 3SO3A 1V2UT 5DG6A 3DD2H 2Z6BD 2FM2A 1RTLA 1EPTA 5E8EH 2OD3B 2RA3A 2CMYA 3KIDU 4Q2KA 1YPLH 4ISIH 2J9NA 2XYAA 4Y10E 2BD3A 3M35A 2ZCKP 1A5IA 4ZKOU 4MNXA 5LGOA 1GJCB 3ATKA 2F9OA 1JXPA 2V0BA 2Z9KA 4ZKNU 1UHBB 2IN2A 1S85A 3GCOA 1CVWH 2BD5A 2UUFB 1MUEB 4A6LA 2FEQH 3BTTE 4AG1A 2SGAA 4O03A 5LH8A 3MU5A 3P92A 1ZTLA 2BMGB 2R3YA 4MPUA 2H6MA 1OS8A 1QNJA 1VGCC 1HGTH 2J92A 4FUHA 2BB4A 1BTZA 2Y80A 1LMWB 4X6MA 2TPIZ 2XTTB 3RXAA 2DE9A 3SHCH 1K2I1 2CF9H 1K9OE 3EA8A 4NCYA 4AYYB 1EP6A 3DHKH 3O8RA 1KXCA 1TRNA 1MKXH 2V6NA 4LOYH 3LIWA 1V2JT 1VGCB 3DT0H 1J16A 4NIVA 1XUHA 4NFFA 1P2MA 4I31A 5FXLA 2NU4E 1GI1A 3P17H 3O8DA 1XM1A 2M5TA 2TRMA 3KHVA 1GI5A 5DP6A 5LPRA 1C5TA 1KDQB 1MD8A 1ZSJA 3E90B 4RSPA 1GJDB 3QN7A 5TJXA 3S69A 2XBWA 2RDLA 2FTLE 3D65E 1Q3XA 4FUJA 2HPPH 1QL9A 2LNCA 1CT2E 5CE1A 1BITA 2PKSC 3HGPA 2ZKSA 1MBMA 1RD3B 1W12U 2Q1JA 3QGJA 1TRMA 1Z8GA 4KTUA 2PGQB 4WMFA 1IQEA 2LPRA 2A45B 1W10U 4I33A 3R3GB 2FOFA 4A1TA 1BRAA 1Y59T 2VH6A 2AMPA 1QR3E 1E37B 2JH0D 2PKSB 4Y0YE 1AB9C 1DT2A 1AU8A 1C4Y2 1UVOA 3RDZA 4Y7AA 4IW4E 2SNVA 3LOXA 2BVRH 1QRZA 1ZMLA 2QXIA 3RLWH 1BHXB 1TGTA 1GL0E 1FY1A 1EJAA 2XWBI 4FU7A 5C1UA 4FVBA 2H5CA 3RXCA 2VWNA 1C5QA 1NFXA 1AB9B 3T26A 1XMNB 3V13A 2ALPA 1ZMJA 2NU2E 1O3LA 3E16B 4O9VA 1L1GA 3KQCA 2J95A 2JH6D 2PUQH 1C4U2 1RGQA 2OLGA 5T6FA 1BTXA 2VNTA 2ZDNA 4BTTB 1GHWH 5L6NH 1JWTA 4E06H 4I7YH 2PUXB 5DO4H 3ZZ7A 1FY8E 1BZXE 4IS5A 3U1IB 1P2KA 1NO9H 4ZROA 3U8OH 1WUNH 3ATIA 3STIA 1EZXC 1CGIE 1L1NA 1HUTH 3KCGH 2ZFQH 1H8IH 1HJAC 4X1QU 3ATLA 2PTNA 3LPRA 1SLWB 5HM9A 1ZTKA 1L4DA 2ASUB 3MO9A 3TH2H 5A8YA 2G4TA 3N7OA 1QBOA 2XXLA 2RG3A 2HOBA 4AOQA 1HJAB 1RIWC 1GI4A 3B8JA 5JB9S 4HZHA 1GHZA 1GVZA 1DDJA 1Z8JB 2G4UA 4CHAC 1ZYOA 4AZ2B 3MH6A 1BTYA 1V2VT 3U98H 2BY9X 4YT7H 1ZSKA 3RMMH 3AVZA 1XUIA 1ZJDA 1SLVB 1GJ7B 1YPKH 1S0QA 1O3CA 3BIVH 3AASA 3VB7A 4X8TH 4XOJA 2WV4A 3W95A 2ZDMA 4IC6A 1FPCH 5DJ7A 2XC0A 4CHAB 3RUOA 1O36A 1C5VA 1F0UA 2BXTH 1EQ9A 2CF8H 2FMJA 4ISNA 3TK5A 2ZGJA 2PFEA 3LT3A 1D6WA 4HFPB 1ZRBA 4GHTA 4OGYA 2ZPQA 1HAYB 3BTQE 1TNIA 3SNAA 3T27A 3RXGA 4YTAA 4XE4A 2AGIX 4Y11E 3FP8E 7LPRA 5GWZA 1C2FA 5EQQA 2AERH 1QL8A 1N8OC 1BOQA 4A5TS 4FUDA 5ESBA 4B71A 2SFAA 4DOQA 2ZNKH 1O31A 1DSTA 3QZRA 1V3XA 1SLXB 2PR3A 5EOKA 1C1VH 1C2LA 1SGFA 1P12E 2A7HA 2ZDKA 3GDSA 4KELA 4SGAE 3S9CA 4NGAH 2BVSH 1GBDA 4FU9A 4BAMB 1AFEH 1D3TB 1N8OB 3T2NA 1UVSH 1QB6A 3QWCH 4YO9A 1LPKB 2QA9E 3SJ9A 3RXSA 3TJNA 5DPAA 4YESB 1LHEH 1O3DA 1RS0A 1ESAA 2G00A 2UWLA 3AW0A 2J94A 1HAVB 2QCYA 1EUFA 9ESTA 4X1SU 2ZPSA 1GI3A 3A8CA 4GSOA 4D7GA 2XC4A 1P3CA 1Z6JH 2QAAA 4NWLA 2FOMB 1P9UA 1XKAC 1V2MT 1L4ZA 4FUCA 2OQUA 4NG9H 2GZ8A 4B2AA 5FX6A 3ZZ8A 2NU3E 1T8OA 1C1MA 1TNLA 1QBVH 4AB9A 2A5AA 1XUFA 2R2MB 3MH4A 4MQAA 2OXSA 1LVMA 2G5NA 1NROH 2AGGX 3CS0A 2FI4E 1O2JA 1TQ0B 1C1UH 5FCKA 4AFUA 1AZ8A 4H42U 3RXJA 3ZVDA 3LONA 1GBEA 1SGIB 1TFXA 4WXVA 5J4QA 1KXAA 2GMTC 2G55A 2ZHEH 1C5OH 1O5DH 2HRVA 3B9FH 4DY7B 4ASHA 1QA0A 3SI3H 2ZZUH 3IITA 1DS2E 1K1JA 1GVLA 3PLPA 1UCYE 1UCYK 4GAWA 2FOEA 3GYLB 5F8ZA 1BDAA 2YOLA 1TNJA 2NU1E 1MTSA 3I77A 5JBAS 3MTYA 3SZNA 2GMTB 3MWIU 3SU6A 4AX9H 1BTPA 1ELDE 2XC5A 3M36A 3RC5A 1C2KA 3GOVB 2BDBA 1WAYB 3BIUH 1MTWA 8ESTE 1OSSA 3TGIE 1PQ7A 1QB9A 3F9FA 3Q3KA 2PHBA 1VCWA 1O2TA 1FZZA 2A2QH 3A7XA 3I29A 1AKSB 3QDZB 4SGBE 4A7IB 1RTKA 1G3BA 1QHRB 1TOMH 4FUIA 1GBAA 5C5NA 5A09A 1PPBH 3MU1A 1SGYE 2K1QA 1H4WA 2F9BH 2ZFTA 4U30A 1KYNA 1GBKA 3NWUA 1DY8A 3UR6A 3SGAE 2FESH 1ELCA 1Z1IA 8KME2 1A1RA 1WV7H 2F3CE 1S81A 4X1RU 1V2TT 4B73A 1BQYA 1PPZA 3E1XB 1ZRKA 1MU8B 4DGJA 1OX1A 1BA8B 1KSNA 2FOCA 1HBTH 1SGTA 2R9PA 4ZMAH 2ZWLH 2ZGBH 3SUEA 5JBCS 4NFEA 5DK1A 1ID5H 1IHSH 2GKVE 1AWFH 1TGCA 2QXJA 1FIWA 3U69H 3UUZA 3UQOA 2TIOA 1LDTT 1CHGA 5DP8A 1ZR0A 4X1PU 4X6NA 4INKA 2FS9A 1FXYA 1BRUP 2W3IA 1C2MA 5JDUB 2GD4B 4X2XA 1EJMA 1K21H 1ABJH 4MNYA 7GCHG 1ZPZA 4CBOA 3GCTF 3NPSA 1S5SA 4MPXA 1BHXF 4AFQA 1IQKA 3FFGA 4K3JA 4X6PA 4Y6DA 1EP5A 3A89A 3B23B 1HRTH 3C1KA 2PSXA 2ZHFH 4JYVH 1NM6A 3GY8A 2ZDVH 2VIPA 3I78A 3FP6E 3TH3H 4WH6A 1BB0B 5T6DA 1V2KT 3JZ2B 1HAPH 2TBSA 1AN1E 1LCYA 1LO6A 2QIQA 4IN1A 2BLOA 4BXWA 2F83A 1H9LB 1DX5M 1SMFE 1TGSZ 3SJIA 5ABWA 4B1TA 1G32B 3S9BA 1GL1A 1W14U 4B2CA 2ZPRA 3SV6A 1P3EA 1TYNA 1IAUA 2DUCA 3SJ8A 1ETRH 1O30A 1VR1H 1ETTH 4NSYA 1TBQH 3RMOH 1W8BH 4ZAEA 2OBQA 8GCHF 1V2LT 2ZF0H 4UFDH 5J4SA 3SV9A 1TPAE 1C2EA 1YCPH 2BQ6B 5HMAA 1BMLA 2AMQA 1O2QA 1W13U 2GV6A 4FUFA 4Q7XA 1Z6EA 1C5PA 1KTTB 2EEKA 1ELGA 3RXTA 1NU9A 5F6MA 1C1WH 3SGQE 1O2UA 3ZVFA 4Q7ZA 1CGJE 1ZMNA 3GY2A 2A4RA 5GCHF 2W5EA 1IQNA 4ABAA 3FVFB 5A0CA 1V2RT 1TNKA 1YPGH 2H1UA 1O3EA 3GY3A 4MPVA 4NZQA 1JBUH 2ZDAH 1MH0A 1L0ZA 5DP4A 2O8MA 2A4QA 3IG6B 1ZPCA 4TWWA 1EAUA 1YC0A 2ULLA 2OINA 2A5KA 1BRCE 1E35B 1CE5A 2VGCC 1HPGA 2F9UA 1IQJA 4XDEA 1YM0A 3GISB 2WPJS 2JKHA 3SV7A 5EPYA 3SBKA 5CMXH 1TX8A 1IQIA 1F7ZA 3SUGA 3DA9B 1TE0A 1C5NH 1A61H 5EW1H 1P11E 2CV3A 2BD8A 1GMHF 3UNRA 3PMJA 3HKJB 2VGCB 4JK6A 4UDWH 3RU4E 1XUKA 3NZIA 7ESTE 1UVUH 4NWKA 1WTHD 3P8NA 3LJJA 1UTOA 3OSYA 3SUFA 4BXSA 4B76A 2QY0B 1B0FA 1Z1JA 3A7YA 3EDXB 1SB1H 2ZFRH 1S84A 1SQTA 2B0FA 1GBHA 1ELVA 1LPZB 2C3SA 4I8KA 1V2QT 2J38A 1O2WA 3QK1A 2WUBA 3LH1A 1C5WB 2FLRH 2ZO3H 3PLBA 3P8OA 1A0HB 1O3KA 2W7SA 3RXPA 4DG4A 1UCYH 2W26A 3QTVH 1O3GA 2ALVA 2A4GA 2GCHG 4WWYA 2UWPA 1THPB 1P06A 1GMCF 4DURA 2OCVB 2OC8A 3GCNA 4AORA 1C1PA 2AS9A 2A2XH 3OY5U 1DOJA 1WBGB 1EAWA 1NC6A 2AFQB 1J15A 1P2NA 2ZI2H 2GDEH 4XSKU 2BY7X 1SSXA 2D8WA 3F6UH 1GJ8B 1F0TA 2TGAA 4Y7BA 2ZIQH 1SGEE 1O3HA 4K1TA 4ZHLU 1OPHB 1C1QA 2BY8X 3TIUA 1SGRE 4I8LA 6LPRA 4Y76A 1XX9A 3LKWA 5DKMA 4B74A 5C1YA 1SQOA 1HB0B 2VJ1A 1ETSH 2A7JA 4H4FA 4WJG2 1D3QB 2H9HA 2P93A 1ELEE 1O5GH 3GY5A 1N6XA 4OS1A 4FUEA 1TX7A 2VIDA 5EPNA 3VXEH 5EXNA 1RXPA 1A3BH 2NU0E 2CJIA 3ZZ9A 4WH8A 1O3OA 2BD9A 2ZC9H 1YPEH 2IOTA 5EG4A 4GPGA 3KQEA 5FBIA 3UWIA 1P0SH 1EX3A 1C5LH 4JCNA 3STJA 1YPMH 2ZGHA 5E2OA 1Z8RA 3SU5A 1RFNA 1QBNA 2FP7B 3M37A 1HAGE 1XKBC 1HFDA 1GBTA 4THNH 1BMMH 3UWJH 1O32A 1AVGH 1DUAA 1CU1A 3TNSA 1UK4A 2KAIB 3K6ZA 2QXHA 4VGCC 1F5LA 3PTBA 3A8DA 2JETC 2EA3A 3BG8A 1ZGIA 5DP5A 3RXBA 2GGVB 1KY9A 1NS3A 3BTHE 1SGPE 3MOCA 1IQGA 3A86A 4BOHA 1Y5AT 2Y82A 5AFZH 1NRPH 1TX6A 4BANB 1AE5A 2BOKA 1EZUC 1P10A 1ZTJA 4JK5A 4VGCB 4I8GA 4IMQA 2JETB 3T5FH 3M3VA 4IC5A 3HK3B 1S83A 1C1OA 3ZVGA 1DWEH 1O2OA 2RCEA 1J17T 1SFQB 2HALA 5FX5A 1V2ST 3SJOA 5A8XA 3SU1A 2I6QA 3U8TH 3ESTA 3U9AH 2Z3CA 5JYIA