4ZHMU

The crystal structure of mupain-1--16-ig in complex with murinised human upa at ph7.4
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
247
structure length
247
Chain Sequence
IIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAYHNDIALLKIRSKEGRCAQPSRTIQTIALPSMYNDPQFGTSCEITGFGKEQSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHTKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords mupain-1-16-IG
publication title Selection of High-Affinity Peptidic Serine Protease Inhibitors with Increased Binding Entropy from a Back-Flip Library of Peptide-Protease Fusions.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase inhibitor/hydrolase
total genus 57
structure length 247
sequence length 247
ec nomenclature ec 3.4.21.73: U-plasminogen activator.
pdb deposition date 2015-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
U PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4zhmU02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4zhmU01
4FVDA 5J4QA 4I33A 1RRKA 3B23B 2EI8A 2C8WB 1O34A 2WPHS 4INLA 1DWEH 1DWDH 1Q2WA 1TWXB 3FP7E 2SGFE 2J92A 2GCHG 1WTGH 3I77A 1Y5UT 5CHAC 2I6SA 2DE9A 1HAZB 4H6TA 2Z3EA 4X2VA 1JBUH 1SBWA 1SQOA 4K69A 3V12A 1FV9A 3BEIB 4NZQA 3QDZB 1QJ1B 3RXSA 5F8XA 3SW2B 3TGIE 5DP8A 4BOHA 1CBWB 5JDUB 3BTDE 1YPMH 1P03A 2XC0A 3RM2H 1MTNC 5DGJA 3M5NA 1BCUH 2V0BA 4CBOA 1GBIA 2BDBA 2H1UA 3P8GA 1N6XA 4ABEA 1GBCA 3E90B 1WYKA 3ZVEA 1C5VA 3G01A 4FUJA 4HI3A 2WPMS 5DP4A 4AFQA 5FAHA 2WPIS 1OWIA 1GL0E 1TIOA 1BRUP 1AU8A 3SU5A 5EPYA 2C3SA 4AX9H 1QBVH 1VITG 3PTBA 1C5XB 1O2GH 3KCGH 3ELAH 5I25A 5LPRA 3T27A 2GDDA 2XCNA 1OWJA 1MKWH 2OUAA 2ANMH 4TWWA 2ODYB 4B71A 1GHAF 4YLUA 2Z9IA 5K0HA 4Y6DA 4Y79A 1X7AC 2QYIA 1P57B 5C67A 1W14U 2BHGA 1RTKA 4K1EA 4I8JA 2TRMA 5FCKA 1BHXF 1GJ7B 1EAIA 1O30A 4MNWA 1SG8B 1NM6A 3F9GA 4LXBH 2FDAA 3K6YA 1FN8A 2CMYA 2FIRH 2HPQH 3RXTA 3ZZ9A 1O31A 4NIVA 5C5OA 3A7VA 1JRSA 3OU0A 3QZRA 3EAJA 1PPHE 4XSKU 2O9QA 1XVMA 1BTYA 4I8HA 5JBAS 1C5WB 2TBSA 4THNH 2BVRH 4ZKSU 1AKSA 4NFEA 1F5RA 3OX7U 3BTKE 3SNAA 4UONA 3DFLA 2WYGA 2ALPA 1FIZA 1O3PB 2G81E 1UK4A 4AFZA 1O3MA 5AFYH 1D6RA 3BSQA 1D3DB 4ABFA 3MU0A 1W3CA 1GI2A 2WPKS 3N7OA 1HV7A 4JK5A 4AN7A 4O3UA 4NG9H 4AYVB 1UTNA 2ASUB 2J34A 3RDZA 4BAOB 4ZUHA 1XUFA 2TGTA 3V7TA 1AWFH 1YPHC 2GP9B 1ETRH 1BMNH 1ESTA 1V2TT 1L1NA 1HNEE 3RXKA 4LZ4B 4DJZB 2OBQA 3RMMH 1IQLA 1ZTJA 3A80A 1PPZA 3SU0A 3M36A 3UIRA 4JYVH 4GPGA 2A5IA 2A2XH 3EYDA 3GDUA 1PPCE 1LTOA 1O3JA 1DVAH 1YM0A 1OSSA 2BLQA 2EI6A 1UCYK 3BG4C 3RC4A 5DP7A 3SI3H 1ABJH 3K9XB 1AB9B 1LHCH 3B9FH 4D9RA 3MU4A 1OWEA 1CVWH 2VGCB 2I6QA 1EAUA 4MLFB 1Y3XA 2BDYA 2J95A 5T6DA 2AGEX 1LVMA 2XYAA 1C2KA 1BHXB 2ZECA 3U1JB 1DUAA 1A4WH 2G5NA 3GDVA 1HJ9A 3RXBA 1VCWA 3T26A 5DP5A 2AGIX 2BDCA 4FU9A 1BQYA 1D6WA 2ZA5A 1BTWA 1GHBF 1GMHF 4O03A 1PYTD 3KF2A 8GCHG 1SGFG 3RXAA 1O37A 2TGDA 3SU2A 1K1MA 2NWNA 2VWLA 2ZNKH 1JOUB 4FVBA 3JZ2B 1TMTH 2UUJB 1RIWB 3HKIB 1K1NA 1GJCB 1O3CA 2BY8X 1EAXA 1KXFA 5EQRA 3ZVBA 4Y8ZA 2BM2A 4CHAC 4A1VA 4WJG2 1ELEE 2RA3A 1C5QA 4ZAEA 6ESTA 1DPOA 2ZO3H 4IMZA 1BMAA 1RXPA 1OKXA 3FZDA 1FY5A 1OP2A 3QTOH 1A7SA 1TRYA 5C20A 1V2LT 1DSTA 1AUTC 6CHAB 3AW1A 5IYTA 1ACBE 1TABE 1S0QA 5HXFA 2AERH 4JZFH 2OP9A 3PO1C 3MHWU 4J2YB 1MTSA 5EQSA 2PHBA 3FP6E 5DP9A 2G4TA 3O8DA 4TY7A 1BTPA 1C5PA 2F9UA 1P02A 4DG4A 5JBTA 3O8CA 2NU2E 4DVAU 4R8TB 1EZXC 3BEFB 1PPGE 5ESBA 1TA6A 1FPHH 1UVTH 3A8AA 2HALA 2FI3E 3MOCA 2GZ8A 3SHAH 1FDPA 4GCHF 3ZZ7A 1F92A 1HUTH 2O8LA 1EPTB 1UO6A 2IN2A 2QXGA 1NRQH 2W3KA 4OS2A 1LHFH 1TGBA 1ZHMA 1BBRH 1E0FD 1UK2A 3CS0A 3MO9A 3RMLH 4ABBA 1TNIA 1W7GH 2HVXA 2D1JA 2ZTYA 1BTXA 1SGYE 4DGJA 1QBOA 2R3UA 3VB3A 3RLWH 3LDXH 3SJIA 3ATIA 3FANA 3Q77A 3ZVGA 4O9VA 1SLWB 4BANB 1C2HA 1O5AB 1J14A 2GMTB 1LCYA 1YLDA 2ZCHP 3GY7A 3TGJE 1BDAA 1G9IE 3QTVH 2Z94A 1W0YH 1EZQA 2UWPA 1O2TA 5FX6A 2BLVA 3SNDA 3ODDA 3LH3A 5A8XA 4A92A 3C1KA 2F91A 4WH6A 1H9HE 2A7HA 1KXEA 4O3TA 3LGTA 1FAXA 1Y59T 3GCNA 1LHDH 5CE1A 3URCA 1TX8A 2GTBA 1EZUC 5AF9H 3Q3KA 2PSXA 1BTHH 2AS9A 2W3IA 3KNXA 1V3XA 2GVFA 1HYLA 4ZXYH 5DP3A 2A5AA 3P8OA 3FFGA 1C9PA 3K65B 2BDAA 3BTHE 5L2ZH 2BD9A 1G3CA 1GL1A 3A82A 3UQVA 1T32A 3MU8A 4AZ2B 2CHAB 3A88A 1FN6A 1TOCB 3ZZAA 1TOMH 1FNIA 2KAIB 3AAUA 3IWMA 1UTJA 1HAOH 1XKAC 4AG1A 1Y5AT 2AMDA 3SJ8A 2CF9H 2B8OH 3C27B 1H9LB 5ESTE 3F6UH 2C93B 3PROA 4K3JA 2XNIA 1BIOA 4IN2A 4NWLA 1TNHA 5SGAE 2FTLE 3Q3YA 8KME2 1KIGH 3UTUH 3A7ZA 3DD2H 1DLEA 1GMHG 2BMGB 4UD9H 1AN1E 3SU4A 4INKA 3EQ0H 1DDJA 4JK6A 7KMEH 2QY0B 2VIPA 1QY6A 1FY4A 1DICA 5K7RA 2FZZA 4FU8A 1VITH 2FYRA 3PM3A 2QA9E 3RXHA 3B8JA 3KIDU 2FPZA 2OCVB 2ZHEH 4CH2B 1HFDA 4ISHH 4X6NA 2BQWB 4MPVA 2Z9JA 4JZ1A 8LPRA 1O5BB 1C5OH 4NGAH 1ZPCA 4E05H 1IQGA 1EP6A 2UUFB 1A5IA 1G32B 1BRBE 3M5LA 2QV1A 1NRNH 1Z6JH 1ZMNA 1QJ7B 1IQFA 3A8CA 2XXLA 4NA7A 1O3OA 1OP0A 1PPFE 4MVNA 1TBQH 2TPIZ 1AZ8A 1V2ST 3TVJB 4ABGA 4E06H 1C4Y2 1C5RA 3D62A 1TNKA 1V2OT 1ZHPA 2A45B 4DCDA 3HK6B 4K1TA 2UWOA 2XBVA 2PGQB 1DOJA 3TK5A 1YKTA 3A85A 4OS7A 1G3EA 3SU6A 4XE4A 1C1WH 1JIMA 1GBHA 1O2HA 3D23A 1AB9C 2RA0A 1MKXH 1O5EH 1A46H 1ELBA 1GDNA 4GCHG 1O32A 4OS5A 1O3EA 1EB1H 5JB8S 3DA9B 1GDUA 2WUCA 1QQUA 2ZU5A 2Y5HA 2ZZUH 2BD3A 1K2I1 3LC3A 1T8MA 1LVYA 4HTCH 2OLGA 3TITA 3A8DA 3BG8A 5DPAA 7GCHG 4TPIZ 2EC9H 4BTTB 1MMJN 4CRCA 1XX9A 2F9BH 2FEQH 1ANBA 1AHTH 1Z1IA 2FOHA 4B74A 3H7OA 2PKAA 4XBDA 1YCPH 2ZFTA 5F8TA 3MH6A 2ZTZA 1O2ZA 2BX4A 3BTTE 1YCPM 1AFQB 1GI5A 1H1BA 4Y7AA 3PWBA 1TGTA 5LPEA 4D7FA 4Y7BA 5A09A 1KXAA 2QXJA 1YPEH 3MMGA 1GMDG 1FY1A 3OTJE 1OOKB 2ULLA 3D65E 5A0CA 1ELGA 4KTUA 1K21H 3K6ZA 2Z9KA 3ENSB 4NIXA 1P04A 1YP9A 1HRTH 2Z9LA 2P95A 1P01A 5F6MA 2QAAA 3ZZ4A 6CHAC 1AQ7A 4NSVA 3LGUA 3GY6A 1NRPH 2FLRH 3ZZ3A 1QL9A 2PKAB 1FXYA 1THPB 1LO6A 3LGYA 1SGDE 3RC6A 2B9LA 3SNCA 2STBE 3TJUA 3F1SB 1PQAA 3HGNA 3BTME 3TH2H 2O8TA 5TCAA 4U32A 1C9TA 3RXMA 2C8XB 2QGRA 5DKMA 3UNQA 4NZLA 3NCLA 5IDKA 1CT0E 5AFZH 1FZZA 1XUHA 4BAHB 2PKSB 1TPSA 3RXPA 1P05A 5B6OA 3WY8A 3EGKH 2ZU1A 2F9NA 1GGDB 2ZGXH 1CGJE 1TNGA 2BD7A 5EOKA 2Z3CA 1HAGE 3SV9A 1XUGA 2GDEH 5E0GA 3LU9B 1EASA 3MH7A 3SI4H 3O8RA 1AVWA 5EW2H 4NCYA 3Q76A 1ZSJA 1O2WA 2Q6DA 3E0PB 1A0JA 1NT1A 4MPXA 1O3IA 2IJOB 1O2SA 1TQ7B 1GI6A 2GD4B 3HKJB 4MNXA 2ZDLA 2O8UA 1O2MA 1XM1A 1Z6EA 1CHGA 1BITA 4FUDA 2ZC9H 3TLOA 1T7CA 2DE8A 4X1SU 1EXFA 4Y71A 1WUNH 1QQ4A 3I78A 5FPYA 1C2MA 1S84A 4KKDA 4IC6A 2GX4A 1ELVA 1C2EA 3ZVAA 3ATLA 2ZWLH 4JCNA 4DW2U 1YPKH 1ELDE 1RD3B 1V2JT 1LHEH 1F0UA 1YLCA 1WV7H 2RCEA 1ZJDA 3QWCH 1AO5A 1VCPA 3RM0H 1QURH 1P8VC 4YO9A 5EPNA 3T28A 3TNSA 1UVUH 4JMYA 4VGCB 1C1OA 1KY9A 3SGAE 3QUMP 3W95A 3KQDA 2G4UA 5J4SA 5T6FA 4B1TA 4SGAE 1N8OC 2F3CE 1LPGB 1SFQB 1EJAA 3ZVFA 3GY4A 2Y5FA 3A89A 2OBOA 2Y80A 1GJDB 4WMFA 1P9SA 3SORA 3ZVDA 3TU7H 2HNTC 4X8UH 2FI5E 3ITIA 1TBZH 1CQQA 4I8GA 1ZLRA 1EQ9A 3MYWA 4AYYB 5T6GA 3M61U 1NY22 1V2NT 1GHVH 3OY6U 1C5ZB 2Y7XA 3PTNA 1W11U 1K1LA 1D9IA 1B7XB 1KLTA 3JZ1B 1EJMA 3LPRA 3M7QA 1GHYH 1Z8JB 3MNSA 2IPHA 1QRWA 1OYQA 1J17T 1V2MT 4Q2KA 1O5GH 1FY8E 3S9BA 1BB0B 2G52A 2FOMB 1C1RA 4TWYA 2AMQA 3RP2A 4YOIA 3M37A 1NFUA 1SLVB 1AGJA 1BRAA 3UPEA 1MCTA 1AI8H 3GISB 4KGAA 1ARCA 1V2QT 4FU7A 1HXEH 3KQEA 5HGGA 4K8BA 3HPTB 5BPEA 4Q80A 2FOEA 3BEUA 3ESTA 1GJ8B 3VB7A 1ZGIA 1XUIA 2PWXA 5FBEA 2FOGA 1YF4A 3T62A 5GCHF 2FXRA 3GCHB 4FUCA 4K60A 4Z0KA 4B2CA 1DM4B 1C2IA 3KQBA 5E0HA 1SGNE 1HCGA 5DJ7A 4O97A 3L33A 4IS5A 1AKSB 1KTSB 2GKVE 3M35A 2ZFPH 4U01A 1GBAA 3SOSA 1LKAA 1SGQE 2BXUH 1NFWA 4RKOB 2FMJA 4E7RG 4F49A 3PMJA 1YPGH 2BLWA 1MH0A 3RUOA 4GLYA 1MAYA 1VJ9U 4Y8YA 3PMHB 1H4WA 2JETC 1Y5BT 1N1LA 1MAXA 2VVCA 1LKBA 1O39A 2C4FH 3ZZBA 2QXIA 3SO3A 4H42U 2BY5X 1KYNA 4M7GA 4CH8B 3GY3A 3U8OH 1MKWK 3QZQA 2A7JA 1NZQH 1RGQA 4E7NA 4UDWH 1FQ3A 3U98H 2P3TB 2XTTB 3A87A 5FXLA 1RTLA 1LQDB 1C1QA 4DURA 1TMBH 1F5LA 4GVUA 1C1TA 3BTWE 1O3DA 1DT2A 1NC6A 2P8OB 3LH1A 1IOEA 4X8TH 3A81A 3MNXA 2FM2A 2FWWA 1G37A 4OS4A 2RDLA 2EI7A 4Y8XA 1GI8B 1C5NH 1A2CH 1G3BA 1CO7E 1OYTH 4Y10E 1V6DA 1V2RT 1PJPA 2B5TB 1C4U2 1ZSLA 1INCA 3L6PA 2ZGCA 4K5ZA 2RG3A 1AFQC 1K28D 4I8KA 1P0SH 1VGCC 3NKKA 3HATH 2BTCE 1QBNA 4JZIA 1TRMA 4ZHMU 2A4RA 3BIUH 1GVLA 1O2PA 4ZXXH 3RU4E 1A5GH 1J16A 4X6OA 4XFQA 3K2UA 2AIQA 4OS1A 1N6YA 1T8NA 1U6QA 3P8NA 1K9OE 4BAMB 4NIYA 2VIVA 2H5CA 1GHAG 3GDSA 2GZ9A 2ZQ2A 1TALA 3MO3A 1CGHA 4X8SH 2ZKSA 5L6NH 1VZQH 2A1DB 1ZR0A 5FPSA 1SB1H 5L2YH 2QCYA 2SGAA 4CR5A 4CRDA 1ZSKA 4WXVA 4I8LA 2FTMA 1C5MD 1P12E 2OC8A 2F9PA 3DUXH 4FUHA 2ZCLP 1OWHA 1O2IA 3Q00A 3RMNH 3P92A 5EW1H 1GHWH 5HMAA 1S6HA 1UCYE 4WVPE 1GBLA 1HIAA 3PLPA 3SV8A 1SGIB 3ZV9A 1IQKA 2GT8A 2JKHA 1HJ8A 3GCTF 5H4IB 1SPJA 1JMOH 1C4V2 1IQMA 1C5SA 1TX7A 3E6PH 2BLOA 2XBWA 2FP7B 2PKSC 5PTPA 3UY9A 3V0XA 4ZH8A 1SGTA 1GI1A 4B75A 1GCTB 1XKBC 5ABWA 3RXJA 1GGDC 1A5HA 1O3LA 1WBGB 1QB6A 4GHQA 1UTLM 1MTWA 1GI0A 2ANWA 3SNBA 1UTQA 1T8LA 1ZPZA 3TNTA 1GBEA 1BMLA 1WCZA 2ALVA 3TPIZ 2NU3E 5F8ZA 1DWBH 3AVZA 1O5FH 3TH3H 1CBWC 1GBFA 2IOTA 3UNRA 1GG6B 1EATA 3PWCA 1C2FA 2Y6TA 4AOQA 2BD8A 2P16A 4WWYA 4YOJA 5CHAB 1HBTH 1UJ1A 1CT2E 3ZV8A 1EZSC 1O0DH 1O5CB 3PMBB 1W8BH 2BY7X 2ZEBA 1SQTA 2XWBI 1L2EA 4HZHA 5C1UA 1XVOA 4XDEA 3VB6A 1P2QA 5C3NA 1K22H 3FVFB 2FOBA 1QIXB 4BTIB 2CGAA 5GPIB 1KXDA 1Q31A 3O8BA 4U2WA 1QFKH 1SHHB 4K2YA 1ZTLA 3SV2H 2OINA 3LONA 3SGBE 1KLJH 1P2KA 1FUJA 2XWAA 2VIOA 4NA9H 3KEEA 3V13A 4VGCC 1CSOE 1AWHB 1ZMJA 1C5TA 1Z7KA 5LPFA 1C1PA 2FESH 1L1JA 1MTVA 4IMQA 3ZZDA 4K1SA 1HB0B 2BY9X 4DOQA 1ESBA 1HPGA 1DUEA 1E35B 2FX4A 1HAPH 4WF8A 1TGCA 1NROH 1HLTH 1LPKB 1TYNA 1YGCH 1C1UH 3BF6H 3NUMA 4IGDA 1O2VA 2YNBA 1ZHRA 1OS8A 1QJ6B 3PB1E 1GHBG 1E37B 2J94A 2SGDE 2WPJS 1H9IE 4ZHLU 3A7WA 4BAQB 1P09A 5A8YA 2BX3A 3BTEE 4X1QU 2VIDA 1SL3A 3BTQE 4AORA 2K1QA 4D76A 3RXGA 1QRXA 1IAUA 2FLBH 1O2UA 1UTPA 5C1YA 1Z71A 1BBRK 3VXEH 5EXNA 2HLCA 1IQEA 1NRRH 1TNJA 2BDGA 4BXSA 2ZFQH 5EU8A 3TIUA 1O2XA 4Y11E 1CE5A 4CRGA 7LPRA 1Y3YA 1A0LA 2BVXH 3EE0B 1JXPA 1OPHB 1GBKA 6LPRA 4RSPA 1SC8U 2VWOA 3GCHC 1PQ8A 1NN6A 2C8YB 4B2AA 3W94A 3TGKE 2YOLA 9ESTA 1GJ5H 5GXPA 2BQ7B 1D3PB 1TLDA 4ISIH 5EG4A 1BOQA 1SI5H 2TGPZ 1O38A 3SU1A 4LZ1H 1GI4A 1C2DA 3PMAB 1UVPA 1EAWA 4KTCA 2PW8H 4Z6AH 5A8ZA 1M9UA 2TGAA 1GJ4H 2XC5A 4BNRA 3KL6A 1SR5C 4CRFA 2G8TA 2QF3A 1AFEH 1XUKA 3DT0H 2F9VA 2FYQA 2CN0H 2Z7FE 4ABAA 2HOBA 2VGCC 1QA0A 4BTUB 4D8NA 3M5OA 4TYDA 2ZHQH 5ETXA 2R0LA 1KDQA 1GBJA 2W7UA 2P8OC 1QA7A 3E8LA 1KLIH 5DP6A 1O2OA 3UR6A 5BRRE 3SZNA 2WINI 2ANYA 3QGNB 5E2OA 2A32A 3UUZA 2ZDMA 1SGPE 2G5VA 3UOUA 1AVGH 1TRNA 4RKJB 5HM2A 3DFJA 1YPHE 3VB5A 1BTUA 1K1IA 1TFXA 2Y81A 1NU9A 4A1TA 1G3DA 1SLUB 1DXPA 2PUXB 1GBDA 1MBMA 1DX5M 2P94A 1T4VH 1SQAA 3RXIA 1C1VH 1HAVA 1RIWC 1HDTH 3A7TA 1BJUA 3RXFA 4F4OC 2VJ1A 1ZMLA 4X2XA 1P2MA 3DHKH 2Z6BD 2Q6GA 2WV5A 1HAYB 4K8YA 1VR1H 1NPMA 1SGRE 3UQOA 4A7IB 2G00A 3A86A 1MCVA 1KDQB 4IN1A 1GMCF 3SJKA 4JZEH 2R0KA 2H6MA 1J9CH 4B73A 3FP8E 5JBCS 3NK8A 1Z8GA 1EUFA 1MTUA 1LHGH 3R3GB 3GOVB 2ZCKP 1KSNA 1UK3A 2ILNA 2ZP0H 1HXFH 3VFEA 4ASHA 1S81A 3M3TA 2GCTB 1LMWB 2V35A 1WTHD 4WMDA 4AGKA 1C5UA 3QN7A 5FBIA 3CP7A 1TA2A 4I32A 4MPUA 1SFIA 4ISNA 3EA7A 2VINA 3A83A 4B2BA 1F0RA 2A2QH 1XMNB 4NSYA 2Q1JA 1D3TB 3RXVA 3NXPA 4XBBA 1ETSH 1QR3E 1HAXB 1P11E 5JBBS 2FS8A 4AFUA 1ZZZA 1EPTC 3PO1B 5FCRA 4I31A 1EB2A 1GCTC 1MBQA 4X6MA 6GCHF 2M5TA 1G2LA 2GV6A 1A3EH 5AVDA 4MTBA 2D8WA 2CXVA 5EXLA 1Y3WA 2V3HH 1L4DA 1O3NA 5FHTA 1G2MA 1CU1A 4AB9A 2NU1E 1C1MA 2QN5T 2ZDVH 1UTMA 3GICB 1P9UA 2ZU3A 1GG6C 3RXDA 3P17H 3P70B 1ORFA 1A3BH 2GMTC 3EA9A 5A0BA 1LVBA 2AGGX 3U9AH 1KTTB 1C5YB 1GBTA 2BB4A 2JH6D 2OXSA 2HWLB 1K1JA 2AMPA 1O3AA 3MU1A 5HM9A 1TGNA 2BDHA 1K1PA 3VGCB 1YCPK 3U8RH 1B0FA 2LNCA 3RXLA 1L1GA 3ZZ5A 1PPBH 1SHYA 3MWIU 4IBLH 3V3MA 1PQ7A 3T25A 3URDA 1B0EA 1TE0A 2BOKA 4WY3A 9LPRA 4UFDH 1V2PT 8GCHF 4KP0A 1O3FA 2ZPRA 1H8IH 1C2LA 3LJJA 3ZZ6A 1OWDA 1AE5A 5AHGH 1H8DH 1C2GA 1MQ6A 3NPSA 1EOLA 2FOAA 4ZKRU 3RC5A 2CHAC 3MTYA 1TMUH 2ZFFH 3UREA 1P2NA 4ZKNU 5C2ZA 3S0NA 3VPKA 3A84A 1EOJA 4TPYA 5EODA 3GY8A 1UCYH 1MD8A 3GYLB 3RMOH 3F68H 1RJXB 5LGOA 2ZDKA 4AFSA 4CR9A 1NFXA 3ATMA 3FAOA 5FPTA 3SN8A 3LGIA 2VIQA 1SOZA 2QC2A 1SSXA 2CV3A 1PPEE 4IW4E 4Y0ZE 2BQ6B 1BJVA 4J1YA 1QRZA 4MPWA 1O35A 3RXCA 2HPPH 2SNWA 5TJXA 1GBMA 1S5SA 4X1RU 5C1XA 2R2WU 2Z9GA 2A5KA 1GHZA 1FAKH 4WMEA 2XBXA 3SQEE 5HYOA 4RN6A 1D3QB 1SGFA 5FX5A 4ZHAA 3SUGA 1CGIE 1UMAH 2VH0A 1AVXA 2ODQA 2BD2A 2Z3DA 4SGBE 3A8BA 1TPAE 3BIVH 3TJOA 4YLQH 1P06A 1OXGA 1ELAA 1GVZA 1SVPA 4YT6H 2ZQ1A 1YPJH 2VNTA 2PLXA 2PGBB 2WYJA 5E0JA 4X0WU 3RLYH 2ODPA 3U8TH 1GMCG 1WU1A 2FI4E 1T8OA 1Y8TA 1Z8IB 1NU7B 1BMMH 4FUIA 1GPZA 1TPOA 3SUFA 1S0RA 3IG6B 1CA8B 1FONA 2Y7ZA 4FUBA 5T3HA 3T29A 4H4FA 1YPLH 2FO9A 1GI9B 1UVSH 2ZGBH 3TK9A 3QX5H 1W7XH 4FXGH 2D26C 3LGVA 2FX6A 1O2RA 1P2IA 4X1PU 2ZDNA 1RFNA 4MNYA 1IHSH 1SGEE 3M7UA 2VVVA 3M3VA 1QL8A 1TONA 2OC1A 1KXCA 2J38A 2ZI2H 1TNLA 1AD8H 3QLPH 2QIQA 1GI3A 1UVOA 5DO4H 1JIRA 2AYWA 3UNSA 2A4GA 1GI7B 1UTOA 1BA8B 2VU8E 1GWAA 2AIPA 6GCHG 3EDXB 1CA0B 1ARBA 1G30B 3LIWA 3MNBA 1ANDA 3LGWA 1QCPA 4LOYH 2WUBA 1V2VT 1TB6H 1A0HB 1B5GH 1CHOF 3GY5A 4ISLA 4ABDA 3SNEA 2WPLS 1FIWA 2BXTH 1QNJA 1MQ5A 1P2OA 3MFJA 4CRBA 1PYTC 1F7ZA 2P3FH 4YZUA 2J4IA 3RXRA 1FI8A 2H9HA 4YTAA 4MNVA 1O3GA 1V2WT 1T31A 3L3TA 5LH8A 1YYY1 2DUCA 2XW9A 3BTFE 4I7YH 2Y5GA 4UE7H 2A31A 2W5EA 1MD7A 3SUEA 1ELTA 1NESE 3S69A 4ESTE 1EX3A 1O2KA 3PV4A 4D7GA 1KXBA 1GDQA 1O3KA 4DIIH 1ESAA 4UFEH 4JZDH 1ABIH 1S83A 5GJ4B 4OGXA 4UFFH 1VJAU 1YC0A 3GY2A 1GHXH 4FUEA 1FMGA 1BRCE 2BY6X 1Q3XA 2FODA 2BOHB 1HAHH 3SUDA 1NS3A 1K1OA 5CMXH 4B76A 1O36A 3STIA 3ZZCA 2QF0A 8ESTE 2OC0A 2BYAX 3AW0A 4CRAA 1MZDA 1DITH 4ZMAH 1NFYA 1FLEE 4ABHA 1GVKB 5EXMA 5A2MH 1RTFB 1W10U 4GHTA 2LPRA 2UWLA 5EGMA 3RXOA 4HFPB 4XOJA 2V3OH 1DY8A 3EA8A 3I29A 1F5KU 4Y76A 1EPTA 2GCTC 2VVUA 4Y0YE 2PUQH 2ZGHA 2O8MA 2PSYA 3ATKA 4NWKA 1NO9H 1FPCH 1HJAB 3KGPA 5DG6A 3RXEA 3VXFH 1TAWA 4AG2A 4GUXA 3SQHE 3RU4T 1ZJKA 4DT7B 2OQUA 2ZHDA 2A4OA 4X8VH 1TX6A 5L30H 3PLKA 2OTVA 2HNTF 4GSOA 1AZZA 1JWTA 1ZTKA 1ZYOA 1DLKB 1TBRH 1TPPA 1WQVH 1P10A 4WH8A 5F03A 1NRSH 5C5NA 2C8ZB 4OGYA 1DXWA 2NU4E 2VWNA 1BZXE 4IC5A 2EEKA 4ZROA 3U1IB 1EKBB 2BD4A 5JPMH 2NU0E 2WV4A 4AGJA 1ZGVA 1AUJA 1MUEB 2FOFA 1E36B 1MU6B 1O2JA 2JH0D 1LDTT 2XBYA 3UOPA 1O2LA 1SGCA 3VEQB 5GCHG 4WXIA 1HIAB 1RS0A 2BVSH 2PV9B 3MO6A 3MU5A 4ABIA 3VGCC 1YBWA 4ISOA 4BXWA 2P93A 3E16B 1VCQA 2ZF0H 2Y82A 2CF8H 7GCHF 2G55A 3F9HA 3AAVA 2KAIA 2UUKB 3SV7A 3NZIA 1MTNB 4JYUH 3KN2A 3S9AA 2D2DA 5E2PA 5I46H 2W7SA 1LQEA 5EQQA 3LC5A 2F9OA 3UFAA 2CJIA 4OS6A 2GT7A 2H5DA 4ZKOU 3PYHA 4NA8A 5E8EH 3F9EA 4YOGA 2R9PA 4PROA 1SOTA 2AFQB 1THRH 3ZZ8A 1O2QA 1Y3VA 4QT8C 2SNVA 3QGJA 1L0ZA 1QHRB 1GJAB 1GMDF 3AASA 4Q7ZA 2C90B 2BZ6H 1C2JA 1E38B 3LT3A 4Q7XA 1O2NA 1ELFA 1CHOG 1THSH 1GBBA 1UHBA 1W2KH 2W26A 3E3TA 2ESTE 4MG3A 1ZOMA 4JYTA 1AMHA 4TY6A 2ZPQA 3KHVA 1EP5A 1TGSZ 2VIWA 2FS9A 3HK3B 1WSSH 1J8AA 1IQHA 1AIXH 3MI4A 1N8OB 4CBNA 4UEHH 1F0TA 1P3CA 4YT7H 1ANCA 1QB9A 3SHCH 2PTNA 3TH4H 2HRVA 2VWMA 1GCDA 4INHA 3TK6A 1F2SE 2P59A 1ZRBA 1P2JA 2J2UA 3RXQA 1NTPA 5GWZA 3IITA 3QO6A 2ZFSA 1CT4E 1DS2E 5JYIA 3UWIA 3T2NA 3NWUA 3SJ9A 2Q6FA 4LK4A 1S85A 4A5TS 2ZDAH 1DWCH 3F9FA 2B0FA 3RXUA 2GCHF 3U69H 1SLXB 2BZAA 3P8FA 1QB1A 2TIOA 3S7HB 2A4QA 3TJNA 1S82A 1SMFE 2H9EH 1W12U 1WAYB 4YESB 1UHBB 3H7TA 1IQJA 3MNCA 1OX1A 1ZPBA 3A7YA 3CENA 1J15A 3BV9B 3BN9A 1MZAA 3P6ZB 3ZYEA 2HNTE 2G51A 4XBCA 2FOCA 3PLBA 2HGTH 3LJOA 4U30A 1O33A 1S6FA 4AB8A 5GIBA 4X2YA 2OD3B 5JB9S 3ATWA 4DIHH 1XUJA 3VB4A 1V2KT 2V6NA 1P3EA 1QGFA 2OQ5A 2ZFRH 4CREA 2ZIQH 4BAKB 1O3BA 3Q3XA 4FUFA 1O2YA 3STJA 3A7XA 2GV7A 5DK1A 1JRTA 1QTFA 3GCTG 3SU3A 1HGTH 3TJVA 4H6SB 3E0NB 3UR9A 3MH4A 2XC4A 4KELA 2ZG0H 1CA0C 1PQ5A 1VITF 4Q7YA 2P3UB 1WQSA 2R2MB 1DANH 4X1NU 2ZU2A 2SGPE 3SJOA 2JETB 3SBKA 1C1SA 1WOFA 3M5MA 3HGPA 3MH5A 4D9QA 1ZRKA 2ZU4A 3LKWA 3BG4B 1W13U 3UWJH 3ZVCA 2EA3A 2XRCA 4NFFA 2SGEE 2A0QB 3D49H 1DSUA 1D4PB 1FY3A 3T5FH 2AEIH 2ANKH 2VB0A 1BTZA 2XCFA 3BTGE 1ID5H 4FUGA 3R0FA 1AE8H 3QK1A 3E91A 1O3HA 4A6LA 5TCCA 2SGQE 2PR3A 3GCOA 4R0IA 5G4BA 3S7KB 1Z1JA 4UFGH 1E34B 1DFPA 1BBRE 1C5LH 3LOXA 2JH5D 3SGQE 1IQIA 1F0SA 3RU4D 1EJNA 1GJ9B 1GJ6A 2R3YA 4NIWA 3M3SA 4KTSA 5GDSH 4MQAA 3SV6A 2J9NA 2PFEA 1A61H 2VH6A 1QL7A 1LVOA 1ELCA 5A0AE 1T4UH 3P95A 4YM9A 4X2WA 1LPZB 7ESTE 1ETTH 4ABJA 3M7TA 2ZHWH 2QXHA 3KQCA 1HAIH 1VGCB 2YNAA 2F83A 2OC7A 1AY6H 2O8WA 2A7CA 2ZGJA 3OYPA 1BT7A 2H9TH 2SFAA 3ZYDA 2ZHFH 4HGCA 3S9CA 1C1NA 4MDSA 2GZ7A 2BD5A 4CHAB 1O5DH 4GAWA 1IQNA 1A1RA 3FZZA 2THFB 3OY5U 1DY9A 2ZTXA 2AH4X 1HJAC 4X6PA 1UTKA 1DE7H 1Y3UA 1HAVB 1FJSA 1L4ZA 1TQ0B 2PTCE 2STAE 1W0ZU 3GYMA 2ZPSA 1OP8A 2BDIA 1PFXC 1XXDA 1BUIA 1ANEA 3E1XB 2GGVB 4A1XA 2UUYA 3OSYA 1OWKA 3H5CB 3CS7A 1MKXK 1Z8RA 1G36A 1V2UT 2B7DH 4DY7B 1IHTH 1XXFA 3ODFA 2H2ZA 1MU8B 1GJBB
chains in the Genus database with same CATH superfamily
4FVDA 5J4QA 4I33A 1RRKA 3B23B 2EI8A 2C8WB 1O34A 2WPHS 4INLA 1DWEH 1DWDH 1Q2WA 1TWXB 3FP7E 2SGFE 2J92A 2GCHG 1WTGH 3I77A 1Y5UT 5CHAC 2I6SA 2DE9A 1HAZB 4H6TA 2Z3EA 4X2VA 1JBUH 1SBWA 5C0TA 1SQOA 4K69A 2CK3D 3V12A 1FV9A 3BEIB 4NZQA 3QDZB 1QJ1B 3RXSA 5F8XA 3SW2B 3TGIE 2HVYB 5DP8A 4BOHA 1CBWB 5JDUB 3BTDE 1YPMH 1P03A 2XC0A 3RM2H 1MTNC 5DGJA 3M5NA 1BCUH 2V0BA 4CBOA 1GBIA 2BDBA 2H1UA 3P8GA 1N6XA 4ABEA 1GBCA 3E90B 1WYKA 3ZVEA 1C5VA 3G01A 4FUJA 4HI3A 2WPMS 5DP4A 4AFQA 5FAHA 2WPIS 1OWIA 1GL0E 1TIOA 1BRUP 1FX0B 1AU8A 3SU5A 5EPYA 2C3SA 4AX9H 1QBVH 1VITG 3PTBA 1C5XB 1O2GH 3KCGH 3ELAH 5I25A 5LPRA 3T27A 2GDDA 2XCNA 1OWJA 1MKWH 2OUAA 2ANMH 4TWWA 2ODYB 4B71A 1GHAF 4YLUA 2Z9IA 5B6LA 5K0HA 4Y6DA 4Y79A 1X7AC 2QYIA 1P57B 5C67A 1W14U 3F0OA 2BHGA 1RTKA 4K1EA 4RT0A 4I8JA 2TRMA 4YXWD 5FCKA 1BHXF 1GJ7B 1EAIA 1O30A 4MNWA 1SG8B 1NM6A 3F9GA 4LXBH 2FDAA 3K6YA 1FN8A 2CMYA 2FIRH 2HPQH 3RXTA 3ZZ9A 1O31A 4NIVA 5C5OA 3A7VA 1JRSA 3OU0A 3QZRA 3EAJA 1PPHE 4XSKU 2O9QA 1XVMA 1BTYA 4I8HA 5JBAS 2QF5A 1C5WB 5GNDA 2TBSA 4THNH 2BVRH 4ZKSU 1AKSA 4NFEA 1F5RA 3OX7U 3BTKE 3SNAA 4UONA 3DFLA 2WYGA 2ALPA 1FIZA 1O3PB 2G81E 1UK4A 4AFZA 1O3MA 5AFYH 1D6RA 3BSQA 1D3DB 1NBMD 4ABFA 3MU0A 1W3CA 1GI2A 2WPKS 3N7OA 1HV7A 4JK5A 4AN7A 4O3UA 4NG9H 4B6FA 4AYVB 1UTNA 2XNDD 2ASUB 2J34A 4P00A 3RDZA 4BAOB 4ZUHA 1XUFA 2TGTA 3V7TA 1AWFH 2WSSD 1YPHC 2KCPA 2GP9B 1ETRH 1BMNH 1ESTA 1V2TT 1L1NA 1HNEE 3RXKA 4LZ4B 4DJZB 5HIZA 2OBQA 3RMMH 1IQLA 1ZTJA 3A80A 1PPZA 3SU0A 3M36A 3UIRA 4JYVH 3UAIC 4GPGA 2A5IA 2A2XH 3EYDA 3GDUA 1PPCE 1LTOA 1O3JA 1DVAH 1YM0A 3PRBA 1OSSA 2BLQA 2EI6A 1UCYK 3BG4C 3RC4A 5DP7A 3SI3H 1ABJH 3K9XB 1AB9B 1LHCH 3B9FH 4D9RA 3MU4A 1OWEA 1CVWH 2VGCB 2I6QA 1EAUA 4MLFB 1Y3XA 2BDYA 2J95A 5T6DA 2AGEX 1LVMA 3FKSD 2XYAA 1C2KA 1BHXB 3AK5A 2ZECA 3U1JB 1DUAA 1A4WH 2G5NA 3GDVA 1HJ9A 3RXBA 1VCWA 3T26A 5DP5A 2AGIX 2BDCA 4FU9A 1BQYA 3WWFA 1D6WA 2ZA5A 1BTWA 1GHBF 1GMHF 4O03A 1PYTD 2VBCA 3KF2A 8GCHG 1SGFG 3RXAA 1O37A 2TGDA 3SU2A 1K1MA 2RFKC 5EJ1A 2NWNA 2VWLA 2ZNKH 1JOUB 4FVBA 3JZ2B 1TMTH 2UUJB 1RIWB 1SKYE 3HKIB 1K1NA 1GJCB 1O3CA 2BY8X 1EAXA 3PRDA 1KXFA 5EQRA 3ZVBA 4Y8ZA 2BM2A 4CHAC 4A1VA 4WJG2 1ELEE 2RA3A 1C5QA 4ZAEA 6ESTA 4FETA 1DPOA 4M9FA 2ZO3H 4IMZA 1BMAA 1RXPA 1OKXA 3FZDA 1FY5A 1OP2A 3QTOH 1A7SA 1TRYA 5C20A 1V2LT 1DSTA 1AUTC 6CHAB 3AW1A 5IYTA 1ACBE 1TABE 1S0QA 5HXFA 2AERH 4JZFH 2OP9A 3PO1C 3MHWU 4J2YB 1MTSA 5EQSA 2PHBA 3FP6E 5DP9A 2G4TA 1H8ED 3O8DA 4TY7A 1BTPA 1C5PA 2F9UA 1P02A 4DG4A 5JBTA 3O8CA 2NU2E 4DVAU 4R8TB 1EZXC 3BEFB 1PPGE 5ESBA 1TA6A 1FPHH 1UVTH 3A8AA 2HALA 2FI3E 3MOCA 2GZ8A 3SHAH 1FDPA 4GCHF 3ZZ7A 1F92A 1YWUA 1HUTH 2O8LA 1EPTB 1UO6A 2IN2A 2QXGA 1NRQH 2W3KA 3KYGA 4OS2A 1LHFH 1TGBA 1ZHMA 1BBRH 1E0FD 1UK2A 3CS0A 3MO9A 2W6ID 3RMLH 4ABBA 1TNIA 1W7GH 2HVXA 2D1JA 2ZTYA 1BTXA 1SGYE 4DGJA 3OAAD 1QBOA 2R3UA 3VB3A 3RLWH 3LDXH 3SJIA 3ATIA 3FANA 3Q77A 3ZVGA 4O9VA 1SLWB 4BANB 1C2HA 1O5AB 1J14A 2GMTB 1LCYA 1YLDA 2ZCHP 3GY7A 3TGJE 1BDAA 1G9IE 2J5UA 3QTVH 2Z94A 1W0YH 1EZQA 2UWPA 1O2TA 5FX6A 2BLVA 3SNDA 3ODDA 3LH3A 5A8XA 4A92A 3C1KA 2F91A 4WH6A 1H9HE 2A7HA 1KXEA 5KEDA 4O3TA 3LGTA 1FAXA 1Y59T 3GCNA 1LHDH 5CE1A 3URCA 1TX8A 2GTBA 1EZUC 5AF9H 3Q3KA 2PSXA 1BTHH 2AS9A 2W3IA 3KNXA 1V3XA 2GVFA 1HYLA 4ZXYH 5DP3A 2A5AA 3P8OA 3FFGA 1C9PA 3K65B 2BDAA 3BTHE 5L2ZH 2BD9A 1G3CA 1GL1A 3GS9A 3A82A 3UQVA 1WXRA 1T32A 3MU8A 4AZ2B 2CHAB 3A88A 1FN6A 1TOCB 5IK2D 3ZZAA 1TOMH 1FNIA 2KAIB 3AAUA 3IWMA 1UTJA 1HAOH 1XKAC 4AG1A 1Y5AT 2AMDA 3SJ8A 2CF9H 2B8OH 3C27B 1H9LB 5ESTE 3F6UH 2C93B 3PROA 4K3JA 2XNIA 1BIOA 4IN2A 4NWLA 3ZIAD 1TNHA 3F2GA 5SGAE 2FTLE 3Q3YA 8KME2 1KIGH 3UTUH 3A7ZA 3DD2H 1DLEA 1GMHG 2BMGB 4UD9H 1AN1E 3SU4A 4INKA 3EQ0H 2V7QD 1DDJA 4JK6A 7KMEH 2QY0B 2VIPA 1QY6A 1FY4A 1DICA 5K7RA 2FZZA 4FU8A 1VITH 2FYRA 3PM3A 2QA9E 3RXHA 3B8JA 3KIDU 5F53A 2FPZA 2OCVB 2ZHEH 4CH2B 1HFDA 4ISHH 2AHME 4X6NA 2BQWB 1S6LA 4MPVA 2Z9JA 4JZ1A 8LPRA 2WV9A 1O5BB 1C5OH 4NGAH 1ZPCA 4E05H 1IQGA 1EP6A 2UUFB 2W6JD 2F4LA 1A5IA 1G32B 1BRBE 3M5LA 2QV1A 1NRNH 1Z6JH 1ZMNA 1QJ7B 1IQFA 3A8CA 2XXLA 4NA7A 1O3OA 1OP0A 1PPFE 4MVNA 1TBQH 2TPIZ 1AZ8A 1V2ST 3KQ5A 3TVJB 4ABGA 4E06H 1C4Y2 1C5RA 3D62A 1TNKA 1V2OT 1ZHPA 2A45B 4DCDA 3HK6B 4K1TA 2UWOA 2XBVA 2PGQB 1DOJA 3TK5A 1YKTA 3A85A 4OS7A 1G3EA 3SU6A 4XE4A 1C1WH 1JIMA 1GBHA 1O2HA 3D23A 1AB9C 2RA0A 1EFRD 1MKXH 1O5EH 1A46H 1ELBA 1GDNA 4GCHG 1O32A 4OS5A 1O3EA 1EB1H 5JB8S 3DA9B 1GDUA 2WUCA 1QQUA 2ZU5A 2Y5HA 2ZZUH 2BD3A 1K2I1 3LC3A 1T8MA 1LVYA 4HTCH 3VG8A 2OLGA 3TITA 3A8DA 3BG8A 5DPAA 7GCHG 4TPIZ 2EC9H 4BTTB 1MMJN 4CRCA 1XX9A 2F9BH 2FEQH 1ANBA 1AHTH 1Z1IA 2FOHA 4B74A 3H7OA 2PKAA 4XBDA 1YCPH 2ZFTA 5F8TA 3MH6A 2ZTZA 1O2ZA 2BX4A 3BTTE 1YCPM 2JJ1D 1AFQB 2L6OA 1GI5A 1H1BA 4Y7AA 3PWBA 1TGTA 5LPEA 4D7FA 2WPDD 4Y7BA 5A09A 1KXAA 2QXJA 1YPEH 3MMGA 1GMDG 1FY1A 3OTJE 1OOKB 2ULLA 3D65E 5A0CA 1ELGA 4KTUA 3SZEA 1K21H 4RT1A 1VKYA 3K6ZA 2Z9KA 3ENSB 4NIXA 1P04A 1YP9A 1HRTH 2Z9LA 2P95A 1P01A 5F6MA 2QAAA 3ZZ4A 6CHAC 1AQ7A 4NSVA 3LGUA 3GY6A 1NRPH 2FLRH 3ZZ3A 4F48B 1QL9A 2PKAB 1FXYA 1THPB 3OFND 1LO6A 2OK5A 3LGYA 1SGDE 3RC6A 2B9LA 3SNCA 2STBE 3TJUA 3F1SB 1PQAA 3HGNA 3BTME 3TH2H 2O8TA 5TCAA 4U32A 1C9TA 3RXMA 5EIYA 2C8XB 2QGRA 2YMSB 5DKMA 1K0HA 1E1QD 3UNQA 2LP6A 4NZLA 3NCLA 5IDKA 1CT0E 5AFZH 1FZZA 1XUHA 4BAHB 2PKSB 1TPSA 3RXPA 1P05A 5B6OA 3WY8A 3EGKH 2ZU1A 2F9NA 1GGDB 4Z1MD 2ZGXH 5KGOA 1CGJE 1TNGA 2BD7A 5EOKA 2Z3CA 1HAGE 3SV9A 1XUGA 2GDEH 5E0GA 3LU9B 1EASA 3MH7A 3SI4H 3O8RA 1AVWA 5EW2H 4NCYA 3Q76A 1ZSJA 1O2WA 2Q6DA 3E0PB 1A0JA 1NT1A 4MPXA 1O3IA 2IJOB 1O2SA 1TQ7B 1GI6A 2GD4B 3HKJB 4MNXA 2ZDLA 2O8UA 1O2MA 1XM1A 1Z6EA 1CHGA 1BITA 4FUDA 2ZC9H 3TLOA 1T7CA 2DE8A 4X1SU 1EXFA 4Y71A 1WUNH 1QQ4A 3I78A 5FPYA 1C2MA 1S84A 4KKDA 4IC6A 2GX4A 1ELVA 1C2EA 3ZVAA 3ATLA 2ZWLH 4JCNA 4DW2U 1YPKH 1ELDE 1RD3B 1V2JT 1LHEH 1F0UA 1KMHB 1YLCA 1WV7H 2RCEA 1ZJDA 3QWCH 1AO5A 1VCPA 3RM0H 1QURH 1P8VC 4YO9A 5EPNA 3T28A 3TNSA 1UVUH 4JMYA 4VGCB 1C1OA 1KY9A 3SGAE 3QUMP 3W95A 3KQDA 2G4UA 5J4SA 2IPQX 5T6FA 4B1TA 4DT4A 4SGAE 1N8OC 2F3CE 1LPGB 1SFQB 1EJAA 2GJGA 3ZVFA 3GY4A 2Y5FA 3A89A 2OBOA 2Y80A 1GJDB 4WMFA 1P9SA 3SORA 3ZVDA 3TU7H 2HNTC 4X8UH 2FI5E 3ITIA 1TBZH 1CQQA 4I8GA 1ZLRA 1EQ9A 3MYWA 4AYYB 5T6GA 3M61U 1NY22 1V2NT 1GHVH 3OY6U 1C5ZB 2Y7XA 3PTNA 1W11U 1K1LA 3KYFA 1D9IA 1B7XB 1KLTA 3JZ1B 1EJMA 3LPRA 3M7QA 1GHYH 1Z8JB 2QE7D 2IPHA 3MNSA 5T1VA 1QRWA 1OYQA 1J17T 1V2MT 4Q2KA 1O5GH 1FY8E 3S9BA 1BB0B 2G52A 2FOMB 1C1RA 4TWYA 2AMQA 3RP2A 5CHBA 4YOIA 3M37A 1NFUA 1SLVB 1AGJA 1BRAA 3UPEA 1MCTA 1AI8H 3GISB 4KGAA 1ARCA 1V2QT 4FU7A 1HXEH 3KQEA 5HGGA 4K8BA 3HPTB 5BPEA 4Q80A 2FOEA 3BEUA 3ESTA 3FN8A 1GJ8B 3VB7A 1ZGIA 1XUIA 2PWXA 5FBEA 2FOGA 1YF4A 3T62A 5GCHF 2FXRA 3GCHB 4FUCA 4K60A 4Z0KA 4B2CA 1DM4B 1C2IA 3KQBA 5E0HA 1SGNE 1HCGA 5DJ7A 4O97A 3L33A 4IS5A 1AKSB 1KTSB 2GKVE 3M35A 2ZFPH 4U01A 1GBAA 3SOSA 1LKAA 1SGQE 4Q63A 2BXUH 1NFWA 4RKOB 2FMJA 4E7RG 4F49A 3PMJA 1YPGH 2BLWA 1MH0A 3UB0A 2KX4A 3RUOA 4GLYA 1MAYA 1VJ9U 4Y8YA 3PMHB 1H4WA 2JETC 1Y5BT 1N1LA 1MAXA 2KFWA 2VVCA 1LKBA 1O39A 3OEED 2C4FH 3ZZBA 3U28C 2QXIA 3SO3A 4H42U 2BY5X 1KYNA 1H8HD 4M7GA 3GY3A 4Q4LA 1MKWK 3QZQA 3U8OH 4CH8B 2A7JA 1NZQH 2WZQA 1RGQA 4E7NA 4UDWH 1FQ3A 3U98H 2P3TB 2XTTB 5EJLA 3A87A 5FXLA 1RTLA 1LQDB 1C1QA 4DURA 1TMBH 1F5LA 4GVUA 1C1TA 3BTWE 3SYJA 1O3DA 1DT2A 1NC6A 2P8OB 3LH1A 1IOEA 4X8TH 3A81A 3N7EA 3MNXA 2FM2A 2FWWA 1G37A 4OS4A 2RDLA 2EI7A 4Y8XA 1GI8B 1C5NH 1MABB 3W1EA 1E1RD 1A2CH 1G3BA 4ACAA 1CO7E 1OYTH 4Y10E 1V6DA 1V2RT 1PJPA 2B5TB 3CNRA 1C4U2 1ZSLA 1INCA 3L6PA 2ZGCA 4K5ZA 2RG3A 1AFQC 1K28D 4I8KA 1P0SH 1VGCC 3NKKA 3HATH 2BTCE 1QBNA 4JZIA 1TRMA 4ZHMU 2A4RA 3BIUH 1GVLA 1O2PA 2V3MA 4ZXXH 3RU4E 1A5GH 1J16A 4X6OA 4XFQA 3K2UA 2AIQA 4OS1A 1N6YA 1T8NA 1U6QA 3P8NA 1K9OE 4BAMB 4NIYA 2VIVA 2J98A 2H5CA 1GHAG 3GDSA 2GZ9A 2ZQ2A 1TALA 3MO3A 1CGHA 4X8SH 2ZKSA 5L6NH 1VZQH 2A1DB 1ZR0A 5FPSA 1SB1H 5L2YH 2QCYA 2SGAA 4CR5A 4CRDA 1ZSKA 4WXVA 4I8LA 2FTMA 1C5MD 1P12E 2OC8A 2F9PA 3DUXH 4FUHA 2ZCLP 1OWHA 1O2IA 3Q00A 3RMNH 3P92A 5EW1H 1GHWH 5HMAA 1S6HA 1UCYE 4WVPE 1GBLA 1HIAA 3PLPA 3SV8A 1SGIB 3ZV9A 2GT8A 1IQKA 2JKHA 2YMSC 1HJ8A 3GCTF 5H4IB 1SPJA 1JMOH 1C4V2 1IQMA 1C5SA 1TX7A 3E6PH 2BLOA 2XBWA 2FP7B 2PKSC 3DSPA 5PTPA 3UY9A 3V0XA 4ZH8A 1SGTA 1GI1A 4B75A 1GCTB 1XKBC 5ABWA 3RXJA 1GGDC 1A5HA 1O3LA 1WBGB 1QB6A 4GHQA 3DSOA 1UTLM 1MTWA 1GI0A 2ANWA 3SNBA 1UTQA 1T8LA 1ZPZA 3TNTA 1GBEA 1BMLA 1WCZA 2ALVA 3TPIZ 2NU3E 5F8ZA 1DWBH 3AVZA 5C94A 1O5FH 3TH3H 1CBWC 1GBFA 2IOTA 3WW7A 3UNRA 1GG6B 1EATA 3PWCA 1C2FA 2Y6TA 4AOQA 2BD8A 2P16A 4WWYA 4YOJA 5CHAB 1HBTH 1UJ1A 1CT2E 3ZV8A 1EZSC 1O0DH 1O5CB 3PMBB 3DCLA 1W8BH 2BY7X 3N99A 2ZEBA 1SQTA 4AC9A 2XWBI 3N7DA 1L2EA 4HZHA 5C1UA 1XVOA 4XDEA 3VB6A 1P2QA 5C3NA 2KCAA 1K22H 3FVFB 2FOBA 1QIXB 4BTIB 2J97A 2CGAA 5GPIB 1KXDA 1Q31A 3O8BA 4U2WA 1QFKH 1SHHB 4K2YA 1ZTLA 3SV2H 2OINA 3LONA 3SGBE 1KLJH 1P2KA 1FUJA 2XWAA 2VIOA 4NA9H 3KEEA 3V13A 4VGCC 1CSOE 1AWHB 1ZMJA 1C5TA 1Z7KA 5LPFA 1C1PA 2FESH 1L1JA 1MTVA 4IMQA 3ZZDA 4K1SA 1HB0B 2BY9X 4DOQA 1ESBA 1HPGA 1DUEA 1E35B 2FX4A 1HAPH 4WF8A 1TGCA 1NROH 1HLTH 1LPKB 1TYNA 1YGCH 1C1UH 3BF6H 3NUMA 4IGDA 1O2VA 2YNBA 1ZHRA 1OS8A 1QJ6B 3PB1E 1GHBG 1E37B 2J94A 2SGDE 2WPJS 1H9IE 4ZHLU 3A7WA 4BAQB 1P09A 5A8YA 2BX3A 3BTEE 4X1QU 2VIDA 1SL3A 3BTQE 4AORA 2K1QA 4D76A 3RXGA 1QRXA 1IAUA 2FLBH 1O2UA 1UTPA 5C1YA 1Z71A 1BBRK 2LELA 3VXEH 5EXNA 2HLCA 1IQEA 1NRRH 1TNJA 2BDGA 4BXSA 2ZFQH 5EU8A 3TIUA 1O2XA 4Y11E 1CE5A 4CRGA 7LPRA 1Y3YA 1A0LA 2BVXH 3EE0B 1JXPA 1OPHB 1GBKA 6LPRA 4RSPA 1SC8U 2VWOA 3GCHC 1PQ8A 1NN6A 2C8YB 4B2AA 3W94A 3TGKE 2YOLA 9ESTA 1GJ5H 5GXPA 2BQ7B 4I86A 1D3PB 1NBME 1TLDA 4ISIH 5EG4A 1BOQA 1SI5H 2TGPZ 1O38A 3SU1A 4LZ1H 1GI4A 1C2DA 3PMAB 1UVPA 1EAWA 4KTCA 2PW8H 4Z6AH 5A8ZA 1M9UA 2TGAA 1GJ4H 2XC5A 4BNRA 3KL6A 1SR5C 4CRFA 2G8TA 2QF3A 1AFEH 1XUKA 3DT0H 2F9VA 2FYQA 2CN0H 2Z7FE 4ABAA 2HOBA 2VGCC 1QA0A 4BTUB 4D8NA 3M5OA 4TYDA 2ZHQH 5ETXA 2R0LA 1KDQA 1GBJA 2W7UA 2P8OC 1QA7A 3E8LA 1KLIH 5DP6A 1O2OA 3UR6A 5BRRE 3SZNA 2WINI 2ANYA 3QGNB 5E2OA 2A32A 3UUZA 2ZDMA 1SGPE 2G5VA 3UOUA 1AVGH 1TRNA 4RKJB 5HM2A 3DFJA 1YPHE 4RI0A 3VB5A 1BTUA 1K1IA 1TFXA 2Y81A 1NU9A 4A1TA 1G3DA 1SLUB 1DXPA 2PUXB 1GBDA 1MBMA 1DX5M 2P94A 1T4VH 1SQAA 3RXIA 1C1VH 1HAVA 1RIWC 1HDTH 3A7TA 1BJUA 3RXFA 4F4OC 1BMFD 2VJ1A 1ZMLA 4X2XA 1P2MA 3DHKH 2Z6BD 2Q6GA 2WV5A 1HAYB 3WWBA 4K8YA 1VR1H 1NPMA 1SGRE 3UQOA 4A7IB 2G00A 3A86A 1MCVA 1KDQB 4IN1A 1GMCF 3SJKA 4JZEH 2R0KA 2H6MA 1J9CH 4B73A 3FP8E 5JBCS 3NK8A 1Z8GA 1EUFA 1MTUA 1LHGH 3R3GB 3GOVB 2ZCKP 1KSNA 1UK3A 2ILNA 2ZP0H 1HXFH 3VFEA 4ASHA 1S81A 3M3TA 2GCTB 1LMWB 2V35A 1WTHD 4WMDA 4AGKA 1C5UA 3QN7A 5FBIA 3CP7A 1TA2A 4I32A 4MPUA 1SFIA 2KR7A 4ISNA 3EA7A 2VINA 3A83A 4B2BA 1F0RA 2A2QH 1XMNB 4NSYA 2Q1JA 1D3TB 3RXVA 3NXPA 4XBBA 1ETSH 1QR3E 1HAXB 1P11E 3F3BA 5JBBS 2FS8A 4AFUA 1ZZZA 1EPTC 3PO1B 2XOKD 5FCRA 4I31A 1EB2A 1GCTC 1MBQA 4X6MA 6GCHF 2M5TA 1G2LA 2JDID 2GV6A 1A3EH 5AVDA 4MTBA 2D8WA 2CXVA 5EXLA 1Y3WA 2V3HH 1L4DA 1O3NA 5FHTA 1G2MA 1CU1A 4AB9A 2NU1E 1C1MA 1W0KD 2QN5T 2ZDVH 1UTMA 3GICB 1P9UA 2ZU3A 1GG6C 3RXDA 3P17H 3P70B 1ORFA 1A3BH 2GMTC 2RDEA 3EA9A 5A0BA 1LVBA 2AGGX 3U9AH 1KTTB 1C5YB 1GBTA 2BB4A 2JH6D 2OXSA 2HWLB 1K1JA 3F2FA 2AMPA 1O3AA 2K0QA 3MU1A 5HM9A 1TGNA 2BDHA 1K1PA 3VGCB 1YCPK 3U8RH 3F0PA 3DSGA 1B0FA 2LNCA 3RXLA 1L1GA 3ZZ5A 1PPBH 1SHYA 3MWIU 4IBLH 3V3MA 1PQ7A 3T25A 3URDA 1B0EA 1TE0A 2BOKA 4WY3A 9LPRA 4UFDH 1V2PT 8GCHF 4KP0A 3FO8D 1O3FA 1UW7A 2ZPRA 1H8IH 1C2LA 3LJJA 3ZZ6A 1OWDA 1AE5A 5AHGH 1H8DH 1C2GA 1MQ6A 3NPSA 1EOLA 2FOAA 4ZKRU 3RC5A 2CHAC 3MTYA 1TMUH 2ZFFH 3UREA 1P2NA 4ZKNU 5C2ZA 3S0NA 3VPKA 3A84A 1EOJA 4TPYA 5EODA 3GY8A 1UCYH 1MD8A 3GYLB 3RMOH 3F68H 1RJXB 5LGOA 2ZDKA 4AFSA 4CR9A 1NFXA 2M2AA 3ATMA 3FAOA 5FPTA 3SN8A 3LGIA 2VIQA 1SOZA 2QC2A 4F55A 1SSXA 2CV3A 1PPEE 4IW4E 4Y0ZE 2BQ6B 1BJVA 4J1YA 1QRZA 4MPWA 1O35A 3RXCA 2HPPH 2SNWA 5TJXA 1GBMA 1S5SA 4X1RU 5C1XA 2R2WU 2Z9GA 2A5KA 1GHZA 1FAKH 4WMEA 5FL7D 2XBXA 3SQEE 5DSFA 5HYOA 1YLNA 4RN6A 1D3QB 1SGFA 5FX5A 4ZHAA 3SUGA 1CGIE 1UMAH 2VH0A 1AVXA 2ODQA 2BD2A 2Z3DA 4SGBE 3A8BA 1TPAE 3BIVH 3TJOA 4YLQH 1P06A 1OXGA 1ELAA 1GVZA 1SVPA 4YT6H 2ZQ1A 1YPJH 2VNTA 2PLXA 2PGBB 2WYJA 5E0JA 4X0WU 3RLYH 2ODPA 3U8TH 1GMCG 1WU1A 2FI4E 1T8OA 1Y8TA 1Z8IB 1NU7B 1BMMH 4FUIA 1GPZA 1TPOA 3SUFA 1S0RA 2EQNA 3IG6B 4ZCNA 1CA8B 1FONA 2Y7ZA 4FUBA 5T3HA 3T29A 4H4FA 1YPLH 2FO9A 1GI9B 1UVSH 2ZGBH 3TK9A 3QX5H 1W7XH 4FXGH 2D26C 3LGVA 1E79D 2FX6A 1O2RA 1P2IA 4X1PU 2ZDNA 1RFNA 4MNYA 1IHSH 1SGEE 3M7UA 2VVVA 3M3VA 1QL8A 1TONA 2OC1A 3EE7A 1KXCA 2J38A 2ZI2H 1TNLA 2IJD1 1AD8H 3OE7D 3QLPH 2QIQA 1GI3A 1UVOA 5DO4H 1JIRA 2AYWA 3UNSA 2A4GA 1GI7B 1UTOA 1BA8B 2VU8E 1GWAA 2AIPA 6GCHG 3EDXB 1CA0B 1ARBA 1G30B 3LIWA 3MNBA 1ANDA 3LGWA 1QCPA 4LOYH 2WUBA 3OEHD 1V2VT 1TB6H 1A0HB 1B5GH 1CHOF 3GY5A 4ISLA 4ABDA 3SNEA 2WPLS 1FIWA 2BXTH 1QNJA 1MQ5A 1P2OA 3MFJA 4CRBA 1PYTC 1F7ZA 1OHHD 2P3FH 4YZUA 2J4IA 3RXRA 1FI8A 2H9HA 2K8IA 4FOUC 4YTAA 4MNVA 1O3GA 1V2WT 1T31A 3L3TA 5LH8A 1YYY1 2DUCA 2XW9A 3BTFE 4I7YH 2Y5GA 4UE7H 2A31A 2W5EA 1MD7A 3SUEA 1ELTA 1NESE 3S69A 4ESTE 1EX3A 1O2KA 3PV4A 4D7GA 1KXBA 1GDQA 1W0JD 1O3KA 4DIIH 1ESAA 4UFEH 4JZDH 1ABIH 1S83A 5GJ4B 4OGXA 4UFFH 1VJAU 1YC0A 3GY2A 2KM0A 1GHXH 4FUEA 1FMGA 1BRCE 2BY6X 1Q3XA 2FODA 2BOHB 1HAHH 3SUDA 1NS3A 1K1OA 5CMXH 5C0UA 4B76A 1O36A 3STIA 3ZZCA 2QF0A 8ESTE 2OC0A 2BYAX 3AW0A 4XRNA 4CRAA 3PV2A 1MZDA 1DITH 4ZMAH 1NFYA 1FLEE 4ABHA 1GVKB 5EXMA 4P02A 5A2MH 1RTFB 2WHXA 1W10U 4GHTA 2LPRA 2UWLA 5EGMA 3RXOA 4HFPB 4XOJA 2V3OH 1DY8A 3EA8A 3I29A 1F5KU 4Y76A 1EPTA 2GCTC 5EJZA 4B6EA 2VVUA 4Y0YE 2PUQH 2ZGHA 2O8MA 2PSYA 3ATKA 4NWKA 1NO9H 1FPCH 1HJAB 3KGPA 5DG6A 3RXEA 3VXFH 1TAWA 4AG2A 4GUXA 3SQHE 3RU4T 1ZJKA 4DT7B 2OQUA 2ZHDA 2A4OA 4X8VH 1TX6A 5L30H 3PLKA 2OTVA 2HNTF 4GSOA 1AZZA 2J98B 1JWTA 1ZTKA 1ZYOA 1DLKB 1TBRH 1TPPA 1WQVH 1P10A 4WH8A 5F03A 1NRSH 5C5NA 2C8ZB 1SQRA 4OGYA 1DXWA 2NU4E 2VWNA 1BZXE 4IC5A 2EEKA 4ZROA 3U1IB 1EKBB 2BD4A 5JPMH 2NU0E 2WV4A 3OTPA 4AGJA 1ZGVA 1AUJA 2JJ2D 1MUEB 2FOFA 1E36B 1MU6B 2YMSD 1O2JA 2JH0D 1LDTT 2XBYA 3UOPA 1O2LA 1SGCA 3VEQB 5GCHG 4WXIA 1HIAB 1RS0A 2BVSH 2PV9B 3MO6A 3MU5A 4ABIA 2QF4A 3VGCC 1YBWA 4ISOA 4BXWA 2P93A 3E16B 1VCQA 2ZF0H 2Y82A 2CF8H 7GCHF 2G55A 3F9HA 3AAVA 2KAIA 2UUKB 3SV7A 3NZIA 1MTNB 2KCOA 4JYUH 3KN2A 3S9AA 2D2DA 5E2PA 5I46H 2W7SA 2L74A 1LQEA 5EQQA 3LC5A 2F9OA 3UFAA 2CJIA 4OS6A 2GT7A 2H5DA 4ZKOU 3PYHA 4NA8A 5E8EH 3F9EA 4YOGA 2R9PA 4PROA 1SOTA 2AFQB 1THRH 3ZZ8A 1O2QA 4HG6A 1Y3VA 4QT8C 2SNVA 3QGJA 1L0ZA 1QHRB 1GJAB 1GMDF 3AASA 4Q7ZA 2C90B 2BZ6H 1C2JA 1E38B 3LT3A 5CDFE 5C17A 1YY3A 4Q7XA 1O2NA 1ELFA 1CHOG 1THSH 1GBBA 1UHBA 1W2KH 2W26A 3E3TA 2ESTE 4MG3A 3PV5A 1ZOMA 3FOAA 4JYTA 1AMHA 4TY6A 2ZPQA 3KHVA 4TT3D 1EP5A 1TGSZ 2VIWA 2FS9A 3HK3B 1WSSH 1J8AA 1IQHA 1AIXH 3MI4A 1N8OB 4CBNA 4UEHH 4TSFD 1F0TA 1P3CA 4YT7H 1ANCA 1QB9A 2EY4C 3SHCH 5KECA 2PTNA 3TH4H 2HRVA 2VWMA 1GCDA 2PP6A 4INHA 3TK6A 1F2SE 2P59A 1ZRBA 5DN6D 1P2JA 2J2UA 3RXQA 1NTPA 5GWZA 3IITA 3QO6A 2ZFSA 1CT4E 1DS2E 5JYIA 3UWIA 3T2NA 3NWUA 3SJ9A 2Q6FA 4LK4A 1S85A 4A5TS 2ZDAH 1DWCH 3F9FA 2B0FA 3RXUA 2GCHF 3U69H 1SLXB 2BZAA 3P8FA 1QB1A 4XD7D 5HKKD 2TIOA 3S7HB 2A4QA 3TJNA 1S82A 1SMFE 2JIZD 2H9EH 1W12U 1WAYB 4YESB 1UHBB 3H7TA 1IQJA 3MNCA 1OX1A 1ZPBA 3A7YA 3CENA 1J15A 3BV9B 3BN9A 1MZAA 1QZ8A 3NRLA 3P6ZB 3ZYEA 2HNTE 2G51A 4XBCA 2FOCA 3PLBA 2HGTH 3LJOA 4U30A 1O33A 1S6FA 4AB8A 5GIBA 4X2YA 2OD3B 5JB9S 3ATWA 4DIHH 1XUJA 3VB4A 1V2KT 2V6NA 1P3EA 1QGFA 2OQ5A 2ZFRH 4CREA 4ACBA 2ZIQH 4BAKB 1O3BA 3Q3XA 4FUFA 1O2YA 3H09A 3STJA 3A7XA 2GV7A 5DK1A 1JRTA 1QTFA 3GCTG 3SU3A 1HGTH 3TJVA 4H6SB 3E0NB 3UR9A 3MH4A 2XC4A 4KELA 2KZ4A 1CA0C 2ZG0H 1PQ5A 1VITF 4Q7YA 2P3UB 1WQSA 2R2MB 1DANH 4X1NU 2ZU2A 2SGPE 3SJOA 2JETB 3SBKA 1C1SA 1WOFA 3M5MA 3HGPA 3MH5A 4D9QA 1ZRKA 3MQKC 2ZU4A 3LKWA 3BG4B 1W13U 3UWJH 3ZVCA 2EA3A 2XRCA 4NFFA 2KCYA 2SGEE 2A0QB 3D49H 1DSUA 1D4PB 1FY3A 3T5FH 2AEIH 2ANKH 2VB0A 1BTZA 2XCFA 3BTGE 1ID5H 4FUGA 3R0FA 1AE8H 3QK1A 3E91A 1O3HA 4A6LA 5TCCA 2SGQE 2HLDD 2PR3A 5HIYA 3GCOA 4R0IA 1WDIA 5G4BA 3S7KB 1Z1JA 4UFGH 1E34B 1DFPA 1BBRE 1C5LH 3LOXA 2JH5D 3SGQE 1IQIA 1F0SA 3RU4D 1EJNA 1GJ9B 1GJ6A 2R3YA 4NIWA 3M3SA 4KTSA 5GDSH 4MQAA 3SV6A 2J9NA 2PFEA 1A61H 2VH6A 1QL7A 1LVOA 1ELCA 5A0AE 1T4UH 3P95A 4YM9A 4X2WA 1LPZB 7ESTE 1ETTH 4ABJA 3M7TA 2ZHWH 3F2HA 2QXHA 3KQCA 4ASUD 1HAIH 1VGCB 2YNAA 2F83A 2OC7A 1AY6H 2O8WA 2A7CA 2ZGJA 3OYPA 1BT7A 2H9TH 2SFAA 3ZYDA 2ZHFH 4HGCA 4OM9A 1C1NA 4MDSA 3S9CA 2GZ7A 2BD5A 4CHAB 1O5DH 4GAWA 1IQNA 1A1RA 3FZZA 2THFB 1COWD 3OY5U 1DY9A 2ZTXA 2AH4X 1HJAC 4X6PA 1UTKA 1DE7H 1Y3UA 1HAVB 1FJSA 1L4ZA 1TQ0B 2PTCE 2STAE 1W0ZU 3GYMA 2ZPSA 1OP8A 2BDIA 1PFXC 1XXDA 1BUIA 1ANEA 3E1XB 2GGVB 4A1XA 2UUYA 3OSYA 1OWKA 3H5CB 3CS7A 1MKXK 1Z8RA 1G36A 1V2UT 2B7DH 4DY7B 2F43B 1IHTH 1XXFA 3ODFA 2H2ZA 1MU8B 1GJBB
chains in the Genus database with same CATH topology
4FVDA 5J4QA 4I33A 1RRKA 3B23B 2EI8A 2C8WB 1O34A 2WPHS 4INLA 1DWEH 1DWDH 1Q2WA 1TWXB 3FP7E 2SGFE 2J92A 2GCHG 1WTGH 3I77A 1Y5UT 5CHAC 2I6SA 2DE9A 1HAZB 4H6TA 2Z3EA 4X2VA 1JBUH 1SBWA 1SQOA 4K69A 3V12A 1FV9A 3BEIB 4NZQA 3QDZB 1QJ1B 3RXSA 5F8XA 3SW2B 3TGIE 5DP8A 4BOHA 1CBWB 5JDUB 3BTDE 1YPMH 1P03A 2XC0A 3RM2H 1MTNC 5DGJA 3M5NA 1BCUH 2V0BA 4CBOA 1GBIA 2BDBA 2H1UA 3P8GA 1N6XA 4ABEA 1GBCA 3E90B 1WYKA 3ZVEA 1C5VA 3G01A 4FUJA 4HI3A 2WPMS 5DP4A 4AFQA 5FAHA 2WPIS 1OWIA 1GL0E 1TIOA 1BRUP 1AU8A 3SU5A 5EPYA 2C3SA 4AX9H 1QBVH 1VITG 3PTBA 1C5XB 1O2GH 3KCGH 3ELAH 5I25A 5LPRA 3T27A 2GDDA 2XCNA 1OWJA 1MKWH 2OUAA 2ANMH 4TWWA 2ODYB 4B71A 1GHAF 4YLUA 2Z9IA 5K0HA 4Y6DA 4Y79A 1X7AC 2QYIA 1P57B 5C67A 1W14U 2BHGA 1RTKA 4K1EA 4I8JA 2TRMA 5FCKA 1BHXF 1GJ7B 1EAIA 1O30A 4MNWA 1SG8B 1NM6A 3F9GA 4LXBH 2FDAA 3K6YA 1FN8A 2CMYA 2FIRH 2HPQH 3RXTA 3ZZ9A 1O31A 4NIVA 5C5OA 3A7VA 1JRSA 3OU0A 3QZRA 3EAJA 1PPHE 4XSKU 2O9QA 1XVMA 1BTYA 4I8HA 5JBAS 1C5WB 2TBSA 4THNH 2BVRH 4ZKSU 1AKSA 4NFEA 1F5RA 3OX7U 3BTKE 3SNAA 4UONA 3DFLA 2WYGA 2ALPA 1FIZA 1O3PB 2G81E 1UK4A 4AFZA 1O3MA 5AFYH 1D6RA 3BSQA 1D3DB 4ABFA 3MU0A 1W3CA 1GI2A 2WPKS 3N7OA 1HV7A 4JK5A 4AN7A 4O3UA 4NG9H 4AYVB 1UTNA 2ASUB 2J34A 3RDZA 4BAOB 4ZUHA 1XUFA 2TGTA 3V7TA 1AWFH 1YPHC 2GP9B 1ETRH 1BMNH 1ESTA 1V2TT 1L1NA 1HNEE 3RXKA 4LZ4B 4DJZB 2OBQA 3RMMH 1IQLA 1ZTJA 3A80A 1PPZA 3SU0A 3M36A 3UIRA 4JYVH 4GPGA 2A5IA 2A2XH 3EYDA 3GDUA 1PPCE 1LTOA 1O3JA 1DVAH 1YM0A 1OSSA 2BLQA 2EI6A 1UCYK 3BG4C 3RC4A 5DP7A 3SI3H 1ABJH 3K9XB 1AB9B 1LHCH 3B9FH 4D9RA 3MU4A 1OWEA 1CVWH 2VGCB 2I6QA 1EAUA 4MLFB 1Y3XA 2BDYA 2J95A 5T6DA 2AGEX 1LVMA 2XYAA 1C2KA 1BHXB 2ZECA 3U1JB 1DUAA 1A4WH 2G5NA 3GDVA 1HJ9A 3RXBA 1VCWA 3T26A 5DP5A 2AGIX 2BDCA 4FU9A 1BQYA 1D6WA 2ZA5A 1BTWA 1GHBF 1GMHF 4O03A 1PYTD 3KF2A 8GCHG 1SGFG 3RXAA 1O37A 2TGDA 3SU2A 1K1MA 2NWNA 2VWLA 2ZNKH 1JOUB 4FVBA 3JZ2B 1TMTH 2UUJB 1RIWB 3HKIB 1K1NA 1GJCB 1O3CA 2BY8X 1EAXA 1KXFA 5EQRA 3ZVBA 4Y8ZA 2BM2A 4CHAC 4A1VA 4WJG2 1ELEE 2RA3A 1C5QA 4ZAEA 6ESTA 1DPOA 2ZO3H 4IMZA 1BMAA 1RXPA 1OKXA 3FZDA 1FY5A 1OP2A 3QTOH 1A7SA 1TRYA 5C20A 1V2LT 1DSTA 1AUTC 6CHAB 3AW1A 5IYTA 1ACBE 1TABE 1S0QA 5HXFA 2AERH 4JZFH 2OP9A 3PO1C 3MHWU 4J2YB 1MTSA 5EQSA 2PHBA 3FP6E 5DP9A 2G4TA 3O8DA 4TY7A 1BTPA 1C5PA 2F9UA 1P02A 4DG4A 5JBTA 3O8CA 2NU2E 4DVAU 4R8TB 1EZXC 3BEFB 1PPGE 5ESBA 1TA6A 1FPHH 1UVTH 3A8AA 2HALA 2FI3E 3MOCA 2GZ8A 3SHAH 1FDPA 4GCHF 3ZZ7A 1F92A 1HUTH 2O8LA 1EPTB 1UO6A 2IN2A 2QXGA 1NRQH 2W3KA 4OS2A 1LHFH 1TGBA 1ZHMA 1BBRH 1E0FD 1UK2A 3CS0A 3MO9A 3RMLH 4ABBA 1TNIA 1W7GH 2HVXA 2D1JA 2ZTYA 1BTXA 1SGYE 4DGJA 1QBOA 2R3UA 3VB3A 3RLWH 3LDXH 3SJIA 3ATIA 3FANA 3Q77A 3ZVGA 4O9VA 1SLWB 4BANB 1C2HA 1O5AB 1J14A 2GMTB 1LCYA 1YLDA 2ZCHP 3GY7A 3TGJE 1BDAA 1G9IE 3QTVH 2Z94A 1W0YH 1EZQA 2UWPA 1O2TA 5FX6A 2BLVA 3SNDA 3ODDA 3LH3A 5A8XA 4A92A 3C1KA 2F91A 4WH6A 1H9HE 2A7HA 1KXEA 4O3TA 3LGTA 1FAXA 1Y59T 3GCNA 1LHDH 5CE1A 3URCA 1TX8A 2GTBA 1EZUC 5AF9H 3Q3KA 2PSXA 1BTHH 2AS9A 2W3IA 3KNXA 1V3XA 2GVFA 1HYLA 4ZXYH 5DP3A 2A5AA 3P8OA 3FFGA 1C9PA 3K65B 2BDAA 3BTHE 5L2ZH 2BD9A 1G3CA 1GL1A 3A82A 3UQVA 1T32A 3MU8A 4AZ2B 2CHAB 3A88A 1FN6A 1TOCB 3ZZAA 1TOMH 1FNIA 2KAIB 3AAUA 3IWMA 1UTJA 1HAOH 1XKAC 4AG1A 1Y5AT 2AMDA 3SJ8A 2CF9H 2B8OH 3C27B 1H9LB 5ESTE 3F6UH 2C93B 3PROA 4K3JA 2XNIA 1BIOA 4IN2A 4NWLA 1TNHA 5SGAE 2FTLE 3Q3YA 8KME2 1KIGH 3UTUH 3A7ZA 3DD2H 1DLEA 1GMHG 2BMGB 4UD9H 1AN1E 3SU4A 4INKA 3EQ0H 1DDJA 4JK6A 7KMEH 2QY0B 2VIPA 1QY6A 1FY4A 1DICA 5K7RA 2FZZA 4FU8A 1VITH 2FYRA 3PM3A 2QA9E 3RXHA 3B8JA 3KIDU 2FPZA 2OCVB 2ZHEH 4CH2B 1HFDA 4ISHH 4X6NA 2BQWB 4MPVA 2Z9JA 4JZ1A 8LPRA 1O5BB 1C5OH 4NGAH 1ZPCA 4E05H 1IQGA 1EP6A 2UUFB 1A5IA 1G32B 1BRBE 3M5LA 2QV1A 1NRNH 1Z6JH 1ZMNA 1QJ7B 1IQFA 3A8CA 2XXLA 4NA7A 1O3OA 1OP0A 1PPFE 4MVNA 1TBQH 2TPIZ 1AZ8A 1V2ST 3TVJB 4ABGA 4E06H 1C4Y2 1C5RA 3D62A 1TNKA 1V2OT 1ZHPA 2A45B 4DCDA 3HK6B 4K1TA 2UWOA 2XBVA 2PGQB 1DOJA 3TK5A 1YKTA 3A85A 4OS7A 1G3EA 3SU6A 4XE4A 1C1WH 1JIMA 1GBHA 1O2HA 3D23A 1AB9C 2RA0A 1MKXH 1O5EH 1A46H 1ELBA 1GDNA 4GCHG 1O32A 4OS5A 1O3EA 1EB1H 5JB8S 3DA9B 1GDUA 2WUCA 1QQUA 2ZU5A 2Y5HA 2ZZUH 2BD3A 1K2I1 3LC3A 1T8MA 1LVYA 4HTCH 2OLGA 3TITA 3A8DA 3BG8A 5DPAA 7GCHG 4TPIZ 2EC9H 4BTTB 1MMJN 4CRCA 1XX9A 2F9BH 2FEQH 1ANBA 1AHTH 1Z1IA 2FOHA 4B74A 3H7OA 2PKAA 4XBDA 1YCPH 2ZFTA 5F8TA 3MH6A 2ZTZA 1O2ZA 2BX4A 3BTTE 1YCPM 1AFQB 1GI5A 1H1BA 4Y7AA 3PWBA 1TGTA 5LPEA 4D7FA 4Y7BA 5A09A 1KXAA 2QXJA 1YPEH 3MMGA 1GMDG 1FY1A 3OTJE 1OOKB 2ULLA 3D65E 5A0CA 1ELGA 4KTUA 1K21H 3K6ZA 2Z9KA 3ENSB 4NIXA 1P04A 1YP9A 1HRTH 2Z9LA 2P95A 1P01A 5F6MA 2QAAA 3ZZ4A 6CHAC 1AQ7A 4NSVA 3LGUA 3GY6A 1NRPH 2FLRH 3ZZ3A 1QL9A 2PKAB 1FXYA 1THPB 1LO6A 3LGYA 1SGDE 3RC6A 2B9LA 3SNCA 2STBE 3TJUA 3F1SB 1PQAA 3HGNA 3BTME 3TH2H 2O8TA 5TCAA 4U32A 1C9TA 3RXMA 2C8XB 2QGRA 5DKMA 3UNQA 4NZLA 3NCLA 5IDKA 1CT0E 5AFZH 1FZZA 1XUHA 4BAHB 2PKSB 1TPSA 3RXPA 1P05A 5B6OA 3WY8A 3EGKH 2ZU1A 2F9NA 1GGDB 2ZGXH 1CGJE 1TNGA 2BD7A 5EOKA 2Z3CA 1HAGE 3SV9A 1XUGA 2GDEH 5E0GA 3LU9B 1EASA 3MH7A 3SI4H 3O8RA 1AVWA 5EW2H 4NCYA 3Q76A 1ZSJA 1O2WA 2Q6DA 3E0PB 1A0JA 1NT1A 4MPXA 1O3IA 2IJOB 1O2SA 1TQ7B 1GI6A 2GD4B 3HKJB 4MNXA 2ZDLA 2O8UA 1O2MA 1XM1A 1Z6EA 1CHGA 1BITA 4FUDA 2ZC9H 3TLOA 1T7CA 2DE8A 4X1SU 1EXFA 4Y71A 1WUNH 1QQ4A 3I78A 5FPYA 1C2MA 1S84A 4KKDA 4IC6A 2GX4A 1ELVA 1C2EA 3ZVAA 3ATLA 2ZWLH 4JCNA 4DW2U 1YPKH 1ELDE 1RD3B 1V2JT 1LHEH 1F0UA 1YLCA 1WV7H 2RCEA 1ZJDA 3QWCH 1AO5A 1VCPA 3RM0H 1QURH 1P8VC 4YO9A 5EPNA 3T28A 3TNSA 1UVUH 4JMYA 4VGCB 1C1OA 1KY9A 3SGAE 3QUMP 3W95A 3KQDA 2G4UA 5J4SA 5T6FA 4B1TA 4SGAE 1N8OC 2F3CE 1LPGB 1SFQB 1EJAA 3ZVFA 3GY4A 2Y5FA 3A89A 2OBOA 2Y80A 1GJDB 4WMFA 1P9SA 3SORA 3ZVDA 3TU7H 2HNTC 4X8UH 2FI5E 3ITIA 1TBZH 1CQQA 4I8GA 1ZLRA 1EQ9A 3MYWA 4AYYB 5T6GA 3M61U 1NY22 1V2NT 1GHVH 3OY6U 1C5ZB 2Y7XA 3PTNA 1W11U 1K1LA 1D9IA 1B7XB 1KLTA 3JZ1B 1EJMA 3LPRA 3M7QA 1GHYH 1Z8JB 3MNSA 2IPHA 1QRWA 1OYQA 1J17T 1V2MT 4Q2KA 1O5GH 1FY8E 3S9BA 1BB0B 2G52A 2FOMB 1C1RA 4TWYA 2AMQA 3RP2A 4YOIA 3M37A 1NFUA 1SLVB 1AGJA 1BRAA 3UPEA 1MCTA 1AI8H 3GISB 4KGAA 1ARCA 1V2QT 4FU7A 1HXEH 3KQEA 5HGGA 4K8BA 3HPTB 5BPEA 4Q80A 2FOEA 3BEUA 3ESTA 1GJ8B 3VB7A 1ZGIA 1XUIA 2PWXA 5FBEA 2FOGA 1YF4A 3T62A 5GCHF 2FXRA 3GCHB 4FUCA 4K60A 4Z0KA 4B2CA 1DM4B 1C2IA 3KQBA 5E0HA 1SGNE 1HCGA 5DJ7A 4O97A 3L33A 4IS5A 1AKSB 1KTSB 2GKVE 3M35A 2ZFPH 4U01A 1GBAA 3SOSA 1LKAA 1SGQE 2BXUH 1NFWA 4RKOB 2FMJA 4E7RG 4F49A 3PMJA 1YPGH 2BLWA 1MH0A 3RUOA 4GLYA 1MAYA 1VJ9U 4Y8YA 3PMHB 1H4WA 2JETC 1Y5BT 1N1LA 1MAXA 2VVCA 1LKBA 1O39A 2C4FH 3ZZBA 2QXIA 3SO3A 4H42U 2BY5X 1KYNA 4M7GA 4CH8B 3GY3A 3U8OH 1MKWK 3QZQA 2A7JA 1NZQH 1RGQA 4E7NA 4UDWH 1FQ3A 3U98H 2P3TB 2XTTB 3A87A 5FXLA 1RTLA 1LQDB 1C1QA 4DURA 1TMBH 1F5LA 4GVUA 1C1TA 3BTWE 1O3DA 1DT2A 1NC6A 2P8OB 3LH1A 1IOEA 4X8TH 3A81A 3MNXA 2FM2A 2FWWA 1G37A 4OS4A 2RDLA 2EI7A 4Y8XA 1GI8B 1C5NH 1A2CH 1G3BA 1CO7E 1OYTH 4Y10E 1V6DA 1V2RT 1PJPA 2B5TB 1C4U2 1ZSLA 1INCA 3L6PA 2ZGCA 4K5ZA 2RG3A 1AFQC 1K28D 4I8KA 1P0SH 1VGCC 3NKKA 3HATH 2BTCE 1QBNA 4JZIA 1TRMA 4ZHMU 2A4RA 3BIUH 1GVLA 1O2PA 4ZXXH 3RU4E 1A5GH 1J16A 4X6OA 4XFQA 3K2UA 2AIQA 4OS1A 1N6YA 1T8NA 1U6QA 3P8NA 1K9OE 4BAMB 4NIYA 2VIVA 2H5CA 1GHAG 3GDSA 2GZ9A 2ZQ2A 1TALA 3MO3A 1CGHA 4X8SH 2ZKSA 5L6NH 1VZQH 2A1DB 1ZR0A 5FPSA 1SB1H 5L2YH 2QCYA 2SGAA 4CR5A 4CRDA 1ZSKA 4WXVA 4I8LA 2FTMA 1C5MD 1P12E 2OC8A 2F9PA 3DUXH 4FUHA 2ZCLP 1OWHA 1O2IA 3Q00A 3RMNH 3P92A 5EW1H 1GHWH 5HMAA 1S6HA 1UCYE 4WVPE 1GBLA 1HIAA 3PLPA 3SV8A 1SGIB 3ZV9A 1IQKA 2GT8A 2JKHA 1HJ8A 3GCTF 5H4IB 1SPJA 1JMOH 1C4V2 1IQMA 1C5SA 1TX7A 3E6PH 2BLOA 2XBWA 2FP7B 2PKSC 5PTPA 3UY9A 3V0XA 4ZH8A 1SGTA 1GI1A 4B75A 1GCTB 1XKBC 5ABWA 3RXJA 1GGDC 1A5HA 1O3LA 1WBGB 1QB6A 4GHQA 1UTLM 1MTWA 1GI0A 2ANWA 3SNBA 1UTQA 1T8LA 1ZPZA 3TNTA 1GBEA 1BMLA 1WCZA 2ALVA 3TPIZ 2NU3E 5F8ZA 1DWBH 3AVZA 1O5FH 3TH3H 1CBWC 1GBFA 2IOTA 3UNRA 1GG6B 1EATA 3PWCA 1C2FA 2Y6TA 4AOQA 2BD8A 2P16A 4WWYA 4YOJA 5CHAB 1HBTH 1UJ1A 1CT2E 3ZV8A 1EZSC 1O0DH 1O5CB 3PMBB