4ZHMU

The crystal structure of mupain-1--16-ig in complex with murinised human upa at ph7.4
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
247
structure length
247
Chain Sequence
IIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAYHNDIALLKIRSKEGRCAQPSRTIQTIALPSMYNDPQFGTSCEITGFGKEQSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHTKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase inhibitor/hydrolase
molecule keywords mupain-1-16-IG
publication title Selection of High-Affinity Peptidic Serine Protease Inhibitors with Increased Binding Entropy from a Back-Flip Library of Peptide-Protease Fusions.
pubmed doi rcsb
source organism Homo sapiens
total genus 57
structure length 247
sequence length 247
ec nomenclature ec 3.4.21.73: U-plasminogen activator.
pdb deposition date 2015-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
U PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4zhmU02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4zhmU01
2F9OA 4UFFH 3GY3A 1GJBB 1CO7E 1GWAA 1ZMLA 4H6SB 3BV9B 1BTYA 2W7UA 2BY7X 1SL3A 2A7HA 3HKIB 4X6PA 2TBSA 8KME2 3TH4H 4UFGH 1GBEA 1KXBA 1TPAE 1ZPCA 3TGKE 1FPCH 1SGFG 3TJUA 1C5WB 2QXIA 1O3PB 4GCHF 1MKXK 1OWDA 1DWEH 1GBTA 1TMBH 4FUIA 2GCHG 2ZGCA 3SW2B 1G9IE 2FMJA 1FN6A 5DGJA 4BAMB 1P10A 2ESTE 5E2OA 1NT1A 4RSPA 2WUBA 1N6XA 2CMYA 3FANA 1ZJKA 3A89A 1PJPA 2ZQ2A 1RXPA 1DFPA 2HPPH 2O8TA 2J2UA 3F6UH 2QAAA 3SUDA 1D3QB 3Q3XA 1L2EA 4K8BA 3VB4A 3P8OA 4F49A 1O3DA 1EZXC 3B23B 1HRTH 1TPPA 3E0PB 1W7XH 2BVSH 1C4Y2 6CHAB 1P04A 1KXAA 1MD8A 1HYLA 4D7GA 1FY1A 2VJ1A 3ZZ6A 3FVFB 1ABJH 3K6YA 1PPFE 2FDAA 4I33A 4HZHA 2P3FH 3HPTB 1C9TA 2OXSA 2ZTYA 1PQAA 2XWBI 3SHCH 1O2TA 1DXPA 1DITH 4BAOB 2XNIA 1T4UH 1C2JA 1P12E 3GCOA 1LHEH 5EPNA 3T26A 2BX3A 2PUQH 4X1PU 1GBLA 4X2WA 3E0NB 4K5ZA 1WCZA 1DWBH 1WUNH 1K21H 1XKBC 2VINA 1TNHA 1MAXA 5JBBS 3RC5A 1ELGA 1QIXB 2W3IA 3PTBA 5FPTA 1QA0A 5EODA 1A2CH 1RTFB 5GCHG 1GHAG 1SGEE 3K2UA 1KIGH 2AH4X 1GI3A 1YM0A 1D3PB 1ZYOA 1BTPA 4J1YA 1SFIA 3TPIZ 3LPRA 3NXPA 3SU3A 3MU0A 4MPXA 1MZDA 6ESTA 1HAOH 1V2QT 1C4U2 1V2UT 1YBWA 1FY5A 1K22H 1A61H 2GZ9A 3D65E 4OS2A 1GI8B 4RKJB 1A4WH 3PWBA 2C8YB 4XE4A 1NC6A 2OCVB 1ANBA 3RXOA 1SQOA 1QL8A 2A0QB 1H9IE 1CVWH 3OSYA 1BZXE 3KF2A 2ZGHA 4YT6H 4JZDH 1BOQA 1UTNA 1CU1A 1XUKA 1XM1A 2NU0E 1JRSA 2O8LA 1THPB 3RXDA 4CRBA 1NZQH 3QTOH 3SJ9A 1EJNA 1NY22 3UQVA 2VWNA 3P8NA 2C8XB 1AY6H 1ANCA 2WPJS 3QGNB 3NKKA 4CRDA 1W11U 3DD2H 5FCKA 1XUJA 4Y0YE 2NU4E 2OBOA 3O8CA 4O97A 4XBCA 4NFFA 4Y8XA 1O38A 4I8GA 3SU6A 5E8EH 1TMUH 3BG8A 2CXVA 5HYOA 5FPYA 4DY7B 1YCPK 2H1UA 1VITG 1QB6A 2CHAB 3ZZ5A 8ESTE 3SI4H 3OTJE 1O39A 3V7TA 1DOJA 1BBRK 2ZGXH 1BTXA 3PLKA 1H9LB 1QTFA 1THRH 3UUZA 1DS2E 1O3IA 3STJA 1A3EH 3TK6A 3TITA 3GOVB 3UR6A 3SUEA 3UTUH 2H9TH 3KEEA 2GGVB 1GHBG 5LPEA 2AGEX 3ATWA 1SLVB 1NFWA 4FUBA 1F7ZA 1ELFA 2ZGBH 2Y5HA 5HM2A 1Q3XA 1P2KA 1T32A 1Z8GA 3EE0B 2ALVA 4Z0KA 2BD7A 1EP5A 1UCYE 3DUXH 4ZKRU 3QK1A 4ABAA 1DPOA 5A8ZA 3ATLA 2W26A 3BTGE 3MI4A 1F5LA 7ESTE 3U9AH 1GI9B 1YYY1 2Y80A 2ZO3H 3TJVA 1TQ0B 3PV4A 4ZUHA 2ANMH 1NFXA 3KIDU 3A8AA 1RIWB 2UUJB 5JPMH 4DURA 3RXMA 1J14A 3ZYEA 1O2PA 5AF9H 2VIPA 4X0WU 2AEIH 1HAZB 2THFB 4Y71A 3F9FA 1GJ7B 1U6QA 5IDKA 1P2QA 3Q3YA 1BRBE 1C2MA 4ZROA 4B74A 1DUAA 1AKSA 1EAWA 2C8WB 2B8OH 4OGXA 1AZZA 3DHKH 4XDEA 4X1NU 4ISIH 3PMAB 1P8VC 3IG6B 3R0FA 2NU2E 1QB9A 1BUIA 1O2SA 4X2XA 1YF4A 2BD5A 1FIZA 1O2VA 4A92A 1RJXB 5TCCA 2WYJA 2AIPA 1TX8A 2PKSB 1TGCA 2P59A 3ZVFA 1FAXA 4O03A 2ZU1A 1AFQC 5JBCS 1C1VH 1H9HE 2BD2A 2HOBA 2JH0D 4CH8B 1DVAH 2R0LA 1YC0A 3U8RH 5EW1H 1EP6A 1L1GA 1HAGE 1T8MA 3U98H 2JH6D 5F8XA 1AHTH 2C4FH 1S81A 3UFAA 2AIQA 4I8LA 1IQHA 1UVOA 4UONA 3OX7U 1YLCA 3FFGA 4O3UA 1CHGA 1LVYA 1W0YH 4E7NA 1IQIA 3C1KA 1HPGA 1Y3VA 1ZHMA 1MZAA 1XXFA 2HNTC 1ZGVA 4U30A 3TIUA 1K2I1 1YP9A 3ZZBA 4MPVA 1O32A 4ABIA 1EPTB 1O5AB 1XUGA 3TNTA 1DX5M 5FXLA 1LVMA 2BVXH 1GI1A 1O2GH 3HK6B 3E16B 1P0SH 1SPJA 1VZQH 3URCA 2ANWA 1FMGA 2ZDMA 1WYKA 2GKVE 4B73A 1C2FA 4CHAC 1J17T 3TVJB 2ZI2H 2FYRA 3K9XB 5EXNA 3O8BA 3L6PA 4YOIA 3SU4A 4AG2A 1VITH 2BQ7B 1ZSLA 1G32B 1ZTKA 2VVVA 4KKDA 4MLFB 5FX6A 3MO3A 4X1QU 2RCEA 3PLBA 3ZVAA 1OWIA 3KQEA 1T4VH 4Q2KA 1KTTB 1HJ8A 3E90B 1GDQA 4X8SH 2ZU2A 1EATA 1O5GH 2A31A 1C2DA 2XRCA 3M36A 3MHWU 1C1WH 3I77A 3RM2H 2BY9X 1AUJA 3M3TA 1GCTB 2HALA 1ZMNA 4Y76A 4K3JA 1SGPE 1EZQA 5DK1A 1BRCE 5FX5A 3RXBA 1GHVH 1UVSH 1Z1IA 1HXFH 2Z9GA 1O3OA 2BDCA 3BN9A 1BJUA 3HK3B 1DY8A 2FZZA 3RXGA 5T6GA 4JZ1A 3A86A 1ZHRA 1TRNA 2SGEE 1C2EA 2C8ZB 2R0KA 2GCTC 3LC5A 2BLQA 3M61U 1SMFE 3L33A 1TBQH 4D9QA 1F92A 3RXPA 1S6FA 4A6LA 2P3TB 2FODA 4B2AA 2F91A 1GJ4H 2ZFSA 1YPMH 2JETC 2F9BH 3AASA 3QTVH 2IJOB 1EJAA 2D8WA 5JB8S 4WH8A 1DE7H 3I29A 3LGUA 3SJKA 1SSXA 1YCPH 3A84A 1ZHPA 1O3NA 2V3HH 2OBQA 3VB3A 4D8NA 1V3XA 4OS5A 5DP8A 3IWMA 1RRKA 5G4BA 2FOGA 3LU9B 5GIBA 3Q77A 5E2PA 1UHBB 4X6OA 5JBTA 2ZHDA 1BBRH 2G81E 3P8GA 1UVUH 1Y5AT 4PROA 5T3HA 5L2YH 1P3EA 2ODQA 2ZDLA 5LPRA 3GYLB 2OP9A 4GCHG 1BB0B 4MPWA 3LH1A 3M35A 5SGAE 3LDXH 4LK4A 2BY6X 2FYQA 1TB6H 4Y8YA 4DGJA 1SG8B 2PHBA 1L4ZA 7KMEH 5L2ZH 1UO6A 2SGDE 4RN6A 2XYAA 3A83A 5K7RA 2QXGA 1SR5C 3U69H 1ELBA 1SGFA 2C93B 3LH3A 3P8FA 1E38B 2FS8A 1TIOA 3UOPA 3TNSA 1CGJE 3AAUA 2VVUA 1EOJA 1ZTLA 4NA8A 4X2YA 1AE8H 1HIAB 1MU6B 1LPKB 1ZSJA 4U01A 3ODDA 1GCDA 5BPEA 4YTAA 3ZVGA 4OS4A 3ZZ8A 4KTCA 2D2DA 3BTHE 3AW1A 3MU5A 1EZUC 5TCAA 3SGQE 1TRYA 2XXLA 1GGDB 3TH2H 1HXEH 2FIRH 4JK6A 4AFSA 3MH6A 1XVOA 2FWWA 1SGCA 3GDVA 2G5NA 1PQ5A 2HPQH 4Q7XA 4CRAA 3E8LA 3N7OA 1O2RA 5EQQA 3HGNA 3QN7A 4ESTE 2ODPA 1NU7B 1HAHH 1G3DA 4MDSA 3ZV8A 1LCYA 3QX5H 3A87A 5GJ4B 1P09A 6LPRA 1HJAC 1GI5A 1UK3A 1XUHA 1Z7KA 3GICB 1LQDB 5PTPA 1E0FD 1UCYK 3SV2H 1JRTA 1W14U 2A45B 1GI2A 3BTKE 4YO9A 3SORA 2ASUB 3BIVH 1YGCH 2RA0A 4NCYA 5A2MH 1ARBA 3LONA 5E0HA 1DSUA 1ID5H 1MTWA 2A5AA 2O8MA 3GY4A 3DA9B 1BJVA 1EASA 1QRWA 4UFDH 2TRMA 3UR9A 4WMFA 1AVGH 3SNEA 3P95A 5CHAC 2Y5FA 2OC0A 3UPEA 2Z3CA 4AZ2B 1E36B 5C5OA 3H5CB 3V13A 1EUFA 3MH4A 3LJJA 2VIWA 1DDJA 1Z6EA 4JZFH 3GCNA 1D9IA 3QLPH 1TNIA 1T7CA 4Q7YA 2BLWA 2VGCC 1P2IA 1HAIH 5C67A 3T5FH 3U1JB 1O3LA 1IQLA 3MU8A 2ZHQH 3RXUA 4NZLA 1DLEA 2ZWLH 1MTNB 4ZH8A 4GAWA 5LPFA 1QQ4A 3BTME 2J94A 2QIQA 1G3BA 2BDAA 1O33A 3RMMH 4WMEA 1UVPA 1CSOE 4D76A 2BHGA 4YESB 3SNCA 1F5RA 1DM4B 1E35B 1O3EA 4ISNA 3B9FH 1O5CB 1P2JA 1N8OB 1WU1A 3SQEE 8GCHF 3KHVA 4F4OC 3C27B 1E37B 3BTEE 1ANEA 1V2WT 1UMAH 1GHZA 1TA2A 3ZZ7A 2FX6A 1BQYA 2GT8A 3LJOA 1O2LA 4ZXYH 4R0IA 2J92A 4QT8C 4DCDA 1JWTA 2O8UA 2OQUA 1W10U 4AN7A 1YPHC 4IW4E 2P93A 2ANYA 2O9QA 3P92A 2XTTB 2XBWA 1TOCB 2FLRH 4AOQA 1ZRKA 9ESTA 2YNBA 1OKXA 4I8HA 3GY5A 2VWOA 1OP2A 3ZZ3A 3A7ZA 4UE7H 1ORFA 1TLDA 1O3GA 1W0ZU 3BTTE 1XMNB 1ABIH 2FI5E 1GMCF 1A1RA 1SQAA 4ASHA 3BG4B 3A7YA 1PYTD 3ZVDA 1BTUA 1CHOF 3O8RA 3S9CA 3FP8E 1ELEE 4UEHH 2FOCA 5C20A 4CHAB 1C5PA 4CREA 2GMTC 4Q80A 4A7IB 4JYVH 1O2YA 5L30H 1P06A 3K65B 1K9OE 1AU8A 1MBMA 1YLDA 2STBE 1BT7A 1NTPA 2BQWB 3BTQE 4ISOA 1IAUA 2DE9A 1V2OT 1FN8A 2IN2A 1C5RA 2BZ6H 1GDNA 1UVTH 1VCWA 2PKAB 1IQKA 3RU4D 3MNSA 1QNJA 1SC8U 1YCPM 2HGTH 2Q6FA 5DG6A 7GCHF 4Y79A 1Y5UT 1BMAA 3S69A 2BLVA 1HAPH 5CE1A 3F1SB 1LKBA 3KL6A 1EB1H 2FP7B 2P8OB 4FUDA 1S84A 4M7GA 1FIWA 2J34A 2FOMB 2WINI 2CV3A 1ANDA 3GISB 1HCGA 2BYAX 2K1QA 5A0BA 2I6SA 3PYHA 1NPMA 1C5YB 1QRZA 3PO1B 4ZMAH 1NO9H 4K1TA 3FP7E 1V6DA 1GI0A 1YPEH 5FBEA 1T31A 1SGTA 1QJ7B 1NRPH 2FOFA 2QXJA 3HGPA 2SGQE 1MUEB 1C2HA 1PPGE 1J9CH 1FQ3A 4WXVA 3ZZDA 2P16A 5HM9A 1UTOA 1GL0E 3RU4T 1GVLA 1BITA 2FTMA 1DUEA 2GCTB 1W13U 4K2YA 1C5XB 1G3CA 2GZ8A 3KQCA 3UQOA 4MNWA 4H4FA 1K1MA 3BSQA 1A3BH 3RXCA 3E1XB 5EOKA 1ZLRA 2I6QA 2HNTE 1ELDE 1B7XB 1LHDH 1CA0B 2G52A 1ZOMA 4YOGA 1DXWA 4MNXA 3B8JA 5T6FA 2A32A 1WV7H 1GJ8B 1Q31A 1C2LA 2G4UA 4E7RG 1YPJH 4FUGA 3TGIE 3MNBA 5HGGA 1EQ9A 1O31A 2XBVA 2Z7FE 4KGAA 4Z6AH 4A1XA 1GI6A 1A7SA 2A5IA 3D23A 3GDSA 3L3TA 1D6WA 2GZ7A 2BDYA 1CBWB 2ZFTA 2H2ZA 5A0CA 1GHWH 2HWLB 3M7TA 4CRFA 3BEIB 1IQJA 4NIYA 4Y11E 1LKAA 4AORA 1LMWB 2FOAA 1NFYA 1OP0A 1ARCA 3PWCA 5F8ZA 4E05H 1AN1E 4FU8A 1FZZA 3NPSA 4Y7AA 1O2IA 1ESTA 1UHBA 1LQEA 1TPSA 3MU1A 5C1UA 3LGTA 3BIUH 5TJXA 1EAIA 2FXRA 2ZDAH 1AFEH 1NROH 1QA7A 1T8LA 1CGIE 1QRXA 1N6YA 1K28D 2BDGA 3VEQB 4B76A 4XBDA 1W3CA 4U32A 4YM9A 1MMJN 2O8WA 3ATMA 1ZGIA 2YNAA 1AB9C 2A2QH 2G5VA 2BD3A 2Z6BD 1C5MD 4Y8ZA 3M3SA 1H1BA 3RXKA 4BTIB 2V3OH 2ZTXA 4FUCA 5GWZA 1WTHD 2BD8A 2VIQA 2EEKA 2V35A 5FHTA 2R3UA 4B71A 1ACBE 2H9HA 3T62A 2A7JA 4VGCC 1VCQA 5EQRA 4I31A 1NRQH 1QFKH 1NESE 1EB2A 4ABHA 4CRGA 2A4GA 3BTFE 3SNDA 1PQ8A 3LGWA 1TPOA 1OP8A 3STIA 2DUCA 2EI7A 3TGJE 3UWJH 4INHA 2SFAA 4I7YH 1ZPZA 2GDEH 1MKWK 8LPRA 3AVZA 1MKXH 4XBBA 3FP6E 1EZSC 2PGQB 3MTYA 1AUTC 1GI4A 1W12U 1C2GA 1CT4E 2FX4A 2QV1A 1BTHH 3KNXA 1O3FA 1ETTH 1K1OA 1TALA 2KAIB 2XC0A 2ULLA 1O3AA 3R3GB 3UNRA 1FPHH 4LXBH 2G55A 2BDIA 1AQ7A 5T6DA 1DY9A 1L1JA 4DIHH 1LHGH 5AVDA 1V2RT 3SV7A 1GBJA 5EW2H 1P9SA 2BDHA 1G37A 1A0JA 2GD4B 3OY6U 2B7DH 3PM3A 3LIWA 3T29A 2ZZUH 2R3YA 4X8TH 1TAWA 1QJ1B 2R2WU 2XW9A 4FUEA 1KY9A 1S0RA 2BDBA 1C5LH 1THSH 3UOUA 1FI8A 4K1SA 2OLGA 1V2PT 3OY5U 1P2MA 4OGYA 2GTBA 2A2XH 1GMHF 3GDUA 4KELA 3LGVA 2OTVA 4GHTA 1C2IA 4X1SU 2ZGJA 5I25A 1SFQB 4E06H 1TNLA 2RDLA 3F9HA 1Q2WA 1V2ST 1A5IA 3S7KB 3WY8A 3ZZAA 6CHAC 1J8AA 2W3KA 3EDXB 1S0QA 4BOHA 4AGJA 4AYYB 1BMNH 1XX9A 2ZPRA 1LVOA 1TA6A 2PFEA 2F9UA 2F9NA 1WTGH 1SGRE 1BRUP 4ABJA 2PW8H 3T25A 1NFUA 2SNVA 2BX4A 3ENSB 3UY9A 4DT7B 1O5DH 1O3CA 1GHXH 1TONA 3RDZA 3MOCA 2QYIA 1AMHA 2AGIX 2ZDKA 3LKWA 3MU4A 2BD4A 3QUMP 1HAYB 2HRVA 1QHRB 2ZKSA 2TPIZ 2ZPSA 3EAJA 4UDWH 1C5VA 5F8TA 1O30A 1ESAA 1KLTA 1IQNA 2ZNKH 2JKHA 1IQFA 1EOLA 3CS0A 4YT7H 3ZVBA 1RTLA 3H7TA 1D6RA 1S82A 3MYWA 5FPSA 4XOJA 1C1UH 1V2LT 2FOEA 1C1SA 3W95A 2BY8X 2G8TA 3VXEH 1AWFH 1C4V2 1DICA 4IMQA 5GXPA 1XKAC 4TYDA 1SLXB 1P11E 1BA8B 3MFJA 1PYTC 4NSVA 4NIXA 2BOKA 1A46H 1RD3B 4X6NA 1IQMA 2H6MA 4ZHLU 1LHCH 3UNQA 5AFZH 3PMBB 3DFJA 2ZDVH 1TGBA 1HB0B 1Z8RA 1Z8IB 2Z9JA 2GMTB 2PGBB 1C9PA 1D3TB 1OOKB 4MPUA 3VFEA 2LPRA 3EA8A 1AO5A 1KXDA 1KXFA 3LOXA 2ODYB 1FNIA 4HGCA 3SV8A 2A1DB 8GCHG 4CBOA 2ILNA 1GBCA 1B0FA 3JZ1B 1JIMA 2FESH 3TU7H 3S7HB 1O2HA 1Y8TA 1OSSA 3GYMA 2R9PA 3CENA 1DLKB 1YKTA 3P17H 4NG9H 1C1NA 5DP5A 4UFEH 1ELVA 2WPMS 4KTSA 4BXWA 2R2MB 4K60A 4JMYA 1DWCH 3U8TH 1Y3YA 1FY4A 4CBNA 2CHAC 3SU5A 1M9UA 1QJ6B 2FTLE 3A7XA 2AMQA 2Q6DA 1O2MA 4ABDA 1ZR0A 2B5TB 2HVXA 2FO9A 2A7CA 2UWPA 4JYUH 3MNXA 2G51A 4WH6A 3SBKA 1CA8B 1O5EH 1KYNA 1TYNA 1HV7A 5BRRE 4K8YA 2NU1E 1W2KH 3ESTA 3MH5A 4MNVA 1CE5A 1PPEE 1FV9A 3RXJA 1CGHA 5B6OA 4WJG2 4SGBE 5LGOA 1CHOG 3S9BA 1YPHE 1AGJA 2IPHA 4WMDA 1SBWA 6GCHF 1ZMJA 1NRNH 1C1RA 1K1IA 2UUKB 4DOQA 1BBRE 3OU0A 3T28A 1TNKA 5DP6A 4GPGA 3GY7A 1EXFA 1B5GH 4IBLH 1IQGA 3GCTF 2QC2A 2CF9H 1O3BA 4FU9A 3VB6A 1GBFA 4ZAEA 1TGSZ 1PQ7A 3ZZCA 4KTUA 2OD3B 2Y82A 2OQ5A 2V6NA 3MMGA 1B0EA 1RIWC 2CGAA 1SHYA 1QBVH 1MKWH 1BCUH 3ZYDA 1WAYB 7GCHG 2TIOA 1G2MA 2EI6A 4O3TA 2A4RA 1C5SA 1O37A 4X2VA 1JIRA 4IS5A 1GJCB 3RLYH 2ZU3A 1FAKH 1ZRBA 1TRMA 1J16A 1XUFA 2Y7ZA 3ATIA 4YZUA 1HNEE 3EA7A 4NA9H 2AERH 5ESTE 5EXMA 1K1LA 3GY2A 1GG6C 2G4TA 3FZZA 2UWLA 1QB1A 4YLQH 4I32A 1AIXH 2WPLS 1AVWA 1A0HB 1GVZA 5A09A 1E34B 1SQTA 1TOMH 2V0BA 1TX7A 3VB5A 3SV6A 5DJ7A 3ZZ9A 4RKOB 3GCHC 3A82A 1O0DH 1EJMA 4H6TA 4JZIA 1MAYA 1OWJA 2EA3A 1G30B 1C5UA 1GDUA 4U2WA 1PPZA 5FBIA 5ETXA 1EPTC 2Q1JA 2NWNA 2ZECA 4INKA 1GJAB 3GY6A 1QGFA 1GI7B 1UTPA 1FDPA 2F9PA 1HGTH 1XXDA 1C1QA 1T8OA 1VCPA 2OINA 3LGYA 4TPYA 4VGCB 5EPYA 1IQEA 1VGCC 2TGDA 3BEUA 1O2QA 2BB4A 1JOUB 4DVAU 1HAVB 4ZKSU 2F83A 4HFPB 4BAKB 3W94A 2WPKS 3QZRA 3SJIA 4DIIH 3ELAH 3JZ2B 4DG4A 4R8TB 3EA9A 2H5DA 1GBIA 5F03A 1AFQB 4AFZA 2GT7A 3SQHE 1P05A 3U1IB 1TBZH 1ETRH 3M5LA 7LPRA 1TABE 4YLUA 2XBXA 1O5FH 3VPKA 5K0HA 3I78A 2UWOA 4MTBA 3BEFB 3SUGA 4ZHAA 5A8XA 3EGKH 2FS9A 3S0NA 1Y5BT 1IHTH 4TY6A 4ZKNU 3MO9A 1GBBA 2PUXB 5C3NA 2OC7A 2GP9B 3IITA 2UUYA 1C5QA 4HTCH 4BANB 4MNYA 1GJDB 1GCTC 3H7OA 3SN8A 2H5CA 1GVKB 1C1TA 2CF8H 4ISHH 2ZCLP 2ZP0H 3QWCH 2B9LA 1DSTA 2KAIA 1SOZA 2WYGA 3RC4A 4ABEA 2FEQH 1HUTH 2BOHB 1NRRH 1C1OA 1OXGA 5LH8A 5IYTA 4IC6A 3QGJA 2GDDA 4CR5A 5F6MA 1GPZA 1H8IH 1C1PA 2VWMA 3URDA 4BTUB 1GHYH 4B2BA 1EPTA 4X8UH 1O2OA 2ZTZA 2OUAA 1BRAA 5DO4H 2HLCA 3FAOA 2J4IA 2QF3A 4IN2A 3KQDA 1AWHB 2W7SA 4AFUA 1BMLA 2A5KA 3TH3H 1L4DA 1QBOA 5EGMA 2ZHWH 2VWLA 1ELTA 4LZ1H 1KDQB 2FOBA 2XBYA 2Y81A 1NRSH 2GV6A 4NIVA 5HMAA 4H42U 4ZXXH 1Y3XA 1GBDA 2LNCA 3SOSA 2P95A 1PPHE 2P94A 1GMDF 4GVUA 3RXAA 2WV5A 3E3TA 3E6PH 4IGDA 2FM2A 4KP0A 2FLBH 3U8OH 3EYDA 1GBHA 1MCTA 1N1LA 3PMJA 1LDTT 2D1JA 4Y7BA 4FUHA 2W5EA 3BF6H 3A7VA 1TNJA 3RP2A 4A5TS 1CT2E 2PV9B 3CP7A 3QZQA 2A4QA 1HDTH 2XC5A 3RXFA 2HNTF 2DE8A 1EKBB 1LVBA 4NIWA 1P02A 1P57B 4WVPE 1OWHA 2TGPZ 1QL9A 3HATH 4TY7A 3TK5A 1FY3A 4Y6DA 5I46H 1D3DB 1NS3A 3RXEA 2AMPA 1ETSH 1GMHG 1S83A 4SGAE 1OS8A 5FCRA 3CS7A 4CR9A 2TGAA 2ZDNA 1V2VT 2FOHA 1UK4A 2JETB 3KGPA 4HI3A 3K6ZA 1Z71A 3A81A 2P3UB 3SV9A 3M7UA 2ZQ1A 3RMLH 2OC1A 3SNBA 1GGDC 2FI3E 2B0FA 3KCGH 3DT0H 1O2NA 1SB1H 1OX1A 2ANKH 1Y3WA 1YPGH 1BMMH 1UCYH 4X6MA 5CMXH 1P01A 3A7WA 3DFLA 3MNCA 3RXIA 2VNTA 1H8DH 3OYPA 4ISLA 2VB0A 3SJ8A 4MVNA 1O2JA 5ABWA 3NWUA 2EI8A 1A0LA 4A1TA 4NWLA 3A85A 1SI5H 1LO6A 2QY0B 1DT2A 3AW0A 5C1XA 1FXYA 5AHGH 2VIDA 5ESBA 2ZU4A 1SGIB 3UNSA 1F0SA 4LZ4B 2QCYA 5HXFA 4K1EA 1BTZA 2J95A 2PR3A 2ZCKP 3D49H 1KSNA 4BAHB 2GCHF 2QA9E 3VGCC 3F68H 1Y3UA 5DP4A 1QR3E 1L0ZA 2PTCE 3V3MA 2PSYA 1WSSH 1GBKA 1GJ5H 1O2ZA 2QXHA 3A8BA 4ABFA 2ZPQA 3TJNA 1MBQA 1L1NA 4DJZB 4B2CA 1O5BB 4CRCA 4K69A 2SGAA 1HIAA 4NA7A 2AMDA 3Q00A 3TK9A 4BXSA 2BVRH 2NU3E 1O3JA 2EC9H 1TBRH 1UTQA 5L6NH 1MTNC 4TWWA 1G3EA 4D9RA 4AX9H 2PTNA 2BXTH 2ZHEH 3A8CA 5J4SA 2PLXA 2ZCHP 4WF8A 1TGNA 1G36A 1KXCA 1LTOA 4INLA 1HJAB 4OS1A 3V0XA 5DP3A 3SZNA 1W8BH 1SGYE 1A5HA 2BTCE 3SGAE 1N8OC 4D7FA 4FVDA 1SGNE 1TX6A 2VH0A 1HBTH 1OYQA 1NU9A 5GCHF 1RGQA 1T8NA 1GHAF 2IOTA 2SGPE 1MQ5A 1BTWA 2F3CE 1MD7A 4AB8A 3RU4E 4IMZA 1GG6B 5C5NA 5AFYH 3KQBA 3HKJB 1PFXC 1Z1JA 3NCLA 5CHAB 5JB9S 2VVCA 1TE0A 1INCA 2QN5T 4ABBA 3RXHA 3UIRA 1AVXA 1P9UA 4GSOA 5DKMA 4BNRA 2ALPA 1SLUB 5FAHA 2VGCB 5GDSH 3Q3KA 1VR1H 3GCHB 3ODFA 1O34A 2BM2A 4FVBA 2BY5X 4I8KA 4TWYA 6GCHG 1KLIH 4AFQA 5A0AE 3ZV9A 3LC3A 1QURH 2M5TA 4ABGA 4JYTA 4GLYA 1XUIA 1O3KA 2GVFA 1MH0A 3E91A 4O9VA 1RFNA 2D26C 3GCTG 3BG4C 1MTSA 5DPAA 1JXPA 3T2NA 4OS6A 2VU8E 2FPZA 1K1JA 1ELAA 1TQ7B 2ZHFH 3SI3H 1C1MA 1VGCB 3PMHB 2WPHS 1UTLM 3MWIU 3ZVCA 3SUFA 1OWKA 4THNH 3KN2A 3RXTA 3T27A 3RXSA 1FJSA 4WXIA 2AS9A 3ZZ4A 5J4QA 2Z94A 4MQAA 4AYVB 1RS0A 2AYWA 2A4OA 1D4PB 2RG3A 2Z9IA 2WPIS 1VITF 1P2OA 1S6HA 1CQQA 4DW2U 1EX3A 1KTSB 2YOLA 1BHXB 1HAVA 1V2MT 1Z8JB 5E0JA 3PLPA 1YPKH 2BLOA 4J2YB 1UTKA 3RXLA 1WQVH 4B1TA 1AZ8A 2P8OC 1FUJA 3LT3A 3RM0H 1O3HA 4JZEH 2PWXA 3RXVA 1FLEE 3RXQA 1FONA 1ZZZA 2STAE 3QO6A 1PPCE 3F9GA 1C5NH 1AI8H 1S5SA 1HAXB 1NN6A 3PO1C 1TGTA 2GX4A 3S9AA 5C1YA 4I8JA 1GHBF 1TWXB 5JBAS 4FUFA 1HJ9A 1HLTH 1PPBH 3MO6A 3SGBE 1EAUA 2VIVA 1W7GH 1QBNA 1SOTA 3M3VA 1H4WA 1O2KA 3SHAH 1SGQE 3NZIA 1SHHB 2BXUH 3A88A 2JH5D 3LGIA 1WOFA 1KLJH 1LPGB 3BTDE 2BMGB 1F2SE 2VH6A 3ITIA 1QL7A 2BD9A 4OS7A 1HFDA 3PB1E 3F9EA 1OYTH 4XFQA 1TMTH 1BIOA 1ZSKA 5EQSA 1O35A 1AD8H 1GJ9B 1QY6A 2Z9LA 1VJ9U 2ZU5A 1ZJDA 4LOYH 3NK8A 4YOJA 3UREA 5H4IB 1O3MA 1S85A 3SO3A 5EXLA 3FZDA 5GPIB 3P6ZB 1ZPBA 1MTUA 2WUCA 3SU0A 1AE5A 1CA0C 1SGDE 1YPLH 1Z6JH 1GL1A 2XWAA 1C5ZB 1ESBA 3SJOA 3RUOA 2Z3DA 1C2KA 1F0UA 1XVMA 4NGAH 1Y59T 1JMOH 3P70B 4JK5A 1V2TT 4BTTB 2PKAA 1P3CA 3M5MA 4TPIZ 4X8VH 2GV7A 4A1VA 1JBUH 1BHXF 2ZFFH 3GY8A 4GUXA 1KDQA 3BTWE 1GBMA 2BQ6B 1RTKA 4NWKA 3Q76A 1KXEA 1IOEA 1CBWC 1G2LA 3EQ0H 1WQSA 5JDUB 4GHQA 2OC8A 4NSYA 5DP9A 4IN1A 1BDAA 3SU1A 1F5KU 1SLWB 1P2NA 2ZFPH 1FY8E 1LPZB 1V2NT 1V2JT 1GMCG 2J38A 2QGRA 3NUMA 4Y0ZE 1J15A 3VB7A 2Z9KA 3MH7A 3D62A 2WV4A 2G00A 1F0TA 3A7TA 1DWDH 3TLOA 2ZC9H 2CN0H 3SNAA 1UK2A 1O2WA 4FUJA 2H9EH 1UTMA 1V2KT 4FXGH 2SNWA 3M5NA 1DANH 2F9VA 1MTVA 4AG1A 1EAXA 4Q7ZA 3G01A 1AKSB 4B75A 3ATKA 1GJ6A 1ELCA 1X7AC 3A8DA 5C2ZA 2J9NA 3M7QA 2ZIQH 1A5GH 1C5OH 2QF0A 2PSXA 3M5OA 1O2UA 3O8DA 2BZAA 4JCNA 4NFEA 1C5TA 1TNGA 1GMDG 1K1NA 2CJIA 5JYIA 3A80A 1F0RA 2Q6GA 1QQUA 1O2XA 1MQ6A 2SGFE 2XCNA 4UD9H 1O36A 4XSKU 1ZTJA 1MCVA 2PKSC 9LPRA 1SVPA 1NM6A 3PTNA 1K1PA 1LHFH 2C90B 4FU7A 3M37A 2VIOA 4BAQB 3V12A 2UUFB 1P03A 1GBAA 3SU2A 1OWEA 4Y10E 2Y6TA 2AFQB 4ZKOU 2ZFRH 1TFXA 3PROA 1IHSH 4WY3A 5EG4A 4ZHMU 5DP7A 2AGGX 3UWIA 3VGCB 3RLWH 5E0GA 1AB9B 2ZA5A 4WWYA 4MG3A 3RC6A 2FI4E 5A8YA 4IC5A 2ZEBA 3ZVEA 4NZQA 3RXRA 1VJAU 4CH2B 2C3SA 2TGTA 1WBGB 3TJOA 4X1RU 1UJ1A 5EU8A 3RMOH 2ZF0H 2Y5GA 3AAVA 1UTJA 2XC4A 4AB9A 1CT0E 1MU8B 1OPHB 4AGKA 2ZFQH 3RMNH 3VXFH 1QCPA 2Z3EA 3QDZB 2ZG0H 2RA3A 2Y7XA 2XCFA
chains in the Genus database with same CATH superfamily
1W0JD 2F9OA 2QF4A 4UFFH 3GY3A 5F53A 1GJBB 1CO7E 1GWAA 1ZMLA 3MQKC 4H6SB 3BV9B 1BTYA 2W7UA 2BY7X 1SL3A 2A7HA 3HKIB 4X6PA 2TBSA 8KME2 3TH4H 4UFGH 1GBEA 1KXBA 1TPAE 1ZPCA 3TGKE 1FPCH 1SGFG 2YMSB 3TJUA 1C5WB 2QXIA 1O3PB 4GCHF 1MKXK 1OWDA 1DWEH 1GBTA 1TMBH 4FUIA 2GCHG 1W0KD 2ZGCA 1G9IE 2FMJA 1FN6A 5DGJA 3SW2B 1P10A 4BAMB 2ESTE 5E2OA 1NT1A 4RSPA 2WUBA 1N6XA 2CMYA 3FANA 1ZJKA 3A89A 1PJPA 5EJ1A 2ZQ2A 1RXPA 1DFPA 2HPPH 2O8TA 2J2UA 3F6UH 2QAAA 3SUDA 4M9FA 1D3QB 3Q3XA 1L2EA 4K8BA 3VB4A 3P8OA 4F49A 1O3DA 2V3MA 1EZXC 3B23B 1HRTH 1TPPA 3E0PB 1W7XH 2BVSH 3H09A 1C4Y2 6CHAB 1P04A 1KXAA 1MD8A 1HYLA 4D7GA 1FY1A 2VJ1A 3ZZ6A 3FVFB 1ABJH 3K6YA 1PPFE 2FDAA 4I33A 4HZHA 2P3FH 3HPTB 1C9TA 2OXSA 2ZTYA 1PQAA 2XWBI 3SHCH 1O2TA 1DXPA 1DITH 4BAOB 2XNIA 1T4UH 1C2JA 1P12E 3GCOA 1LHEH 5EPNA 3T26A 2BX3A 2PUQH 4X1PU 1GBLA 4X2WA 3E0NB 4K5ZA 1WCZA 1DWBH 1WUNH 1K21H 1XKBC 2JIZD 2VINA 1TNHA 1MAXA 5JBBS 3RC5A 1ELGA 1QIXB 2W3IA 3PTBA 5FPTA 1QA0A 5EODA 1A2CH 1RTFB 5GCHG 1GHAG 1SGEE 3K2UA 1KIGH 2AH4X 1GI3A 1YM0A 1D3PB 1ZYOA 1BTPA 4J1YA 1SFIA 3TPIZ 3LPRA 3NXPA 3SU3A 3MU0A 4MPXA 1MZDA 6ESTA 1HAOH 1V2QT 1C4U2 1V2UT 1YBWA 1FY5A 1K22H 1A61H 2GZ9A 3D65E 4OS2A 1GI8B 4RKJB 1A4WH 3PWBA 2C8YB 4XE4A 1NC6A 2OCVB 1ANBA 3RXOA 1SQOA 1QL8A 2A0QB 1H9IE 1CVWH 3OSYA 1BZXE 3KF2A 2ZGHA 4YT6H 4JZDH 1BOQA 1UTNA 1CU1A 1XUKA 1XM1A 2NU0E 1JRSA 2O8LA 1THPB 3RXDA 4CRBA 1NZQH 3QTOH 3SJ9A 1EJNA 1NY22 3UQVA 2VWNA 3P8NA 2C8XB 1AY6H 1ANCA 2WPJS 3QGNB 3NKKA 4CRDA 1W11U 3DD2H 5FCKA 1XUJA 4Y0YE 2NU4E 2OBOA 3O8CA 4O97A 4XBCA 4NFFA 4Y8XA 1S6LA 1O38A 4RT0A 4I8GA 3SU6A 5C0UA 5E8EH 1TMUH 3BG8A 2CXVA 5HYOA 5FPYA 4DY7B 1YCPK 2H1UA 1VITG 1QB6A 2CHAB 3ZZ5A 8ESTE 3SI4H 3PRDA 3OTJE 1O39A 3SZEA 3V7TA 1DOJA 1BBRK 1H8HD 2ZGXH 1BTXA 3PLKA 1H9LB 1QTFA 1THRH 3UUZA 1DS2E 1O3IA 3STJA 1A3EH 3TK6A 3TITA 3GOVB 3UR6A 3SUEA 3UTUH 2H9TH 3KEEA 2GGVB 1GHBG 5LPEA 2AGEX 3ATWA 1SLVB 1NFWA 4FUBA 1F7ZA 1ELFA 2ZGBH 2Y5HA 5HM2A 1Q3XA 1P2KA 1T32A 1Z8GA 3EE0B 2ALVA 4Z0KA 2BD7A 1EP5A 1UCYE 3DUXH 4ZKRU 4B6EA 3QK1A 4ABAA 2VBCA 1DPOA 5A8ZA 3ATLA 2W26A 3BTGE 3MI4A 1F5LA 7ESTE 3U9AH 1GI9B 1YYY1 2Y80A 2ZO3H 3TJVA 1TQ0B 3PV4A 4ZUHA 2ANMH 1NFXA 3KIDU 3A8AA 1RIWB 2V7QD 2UUJB 5JPMH 4DURA 3RXMA 1J14A 3CNRA 3ZYEA 1O2PA 5AF9H 2VIPA 4X0WU 2AEIH 1HAZB 2AHME 2THFB 4Y71A 3F9FA 1GJ7B 1U6QA 5IDKA 1P2QA 3Q3YA 1BRBE 1C2MA 4ZROA 4B74A 1DUAA 1AKSA 1EAWA 2C8WB 2B8OH 3F0OA 4OGXA 1AZZA 1FX0B 3DHKH 4XDEA 4X1NU 3EE7A 4ISIH 3PMAB 1P8VC 3IG6B 3R0FA 1QB9A 1BUIA 1O2SA 2NU2E 4X2XA 1YF4A 2BD5A 1FIZA 1O2VA 4A92A 1RJXB 5TCCA 2WYJA 5CDFE 2AIPA 1TX8A 2PKSB 1TGCA 2P59A 3ZVFA 1FAXA 4O03A 2ZU1A 1AFQC 2KZ4A 5JBCS 1C1VH 1H9HE 1MABB 2BD2A 2HOBA 2JH0D 4CH8B 1DVAH 2R0LA 1YC0A 3U8RH 5EW1H 1EP6A 1L1GA 1HAGE 1T8MA 3U98H 2JH6D 5F8XA 1AHTH 2C4FH 1S81A 3UFAA 2AIQA 4I8LA 1IQHA 1UVOA 4UONA 3OX7U 1YLCA 3FFGA 4O3UA 1CHGA 1LVYA 1W0YH 4E7NA 1IQIA 3C1KA 1HPGA 1Y3VA 1ZHMA 3OTPA 1MZAA 1XXFA 2HNTC 1ZGVA 4U30A 3TIUA 1K2I1 1YP9A 3ZZBA 4MPVA 1O32A 4ABIA 1EPTB 1O5AB 1XUGA 3TNTA 1DX5M 5FXLA 1E79D 1LVMA 2BVXH 1GI1A 1O2GH 3HK6B 3E16B 1P0SH 1SPJA 1VZQH 3URCA 2ANWA 1FMGA 2ZDMA 1WYKA 2GKVE 4B73A 3PV5A 1C2FA 4CHAC 1J17T 3TVJB 2ZI2H 2FYRA 3K9XB 5EXNA 3O8BA 3L6PA 4YOIA 3SU4A 4AG2A 1VITH 2BQ7B 4XRNA 1ZSLA 3DSOA 1G32B 1ZTKA 2J5UA 2VVVA 4KKDA 4MLFB 5FX6A 3MO3A 4X1QU 2RCEA 3PLBA 3ZVAA 1OWIA 3KQEA 1T4VH 4Q2KA 1KTTB 1BMFD 1HJ8A 3E90B 1GDQA 4X8SH 2ZU2A 1EATA 1O5GH 2A31A 1C2DA 2XRCA 3M36A 3MHWU 1C1WH 3I77A 3RM2H 2BY9X 2KR7A 4HG6A 1AUJA 3M3TA 1GCTB 2HALA 1ZMNA 4Y76A 4K3JA 1SGPE 1EZQA 5DK1A 1BRCE 5FX5A 3RXBA 1GHVH 1UVSH 1Z1IA 1HXFH 2Z9GA 1O3OA 2BDCA 3BN9A 1BJUA 3HK3B 1DY8A 2FZZA 3RXGA 5T6GA 4Q63A 4JZ1A 3A86A 1ZHRA 1TRNA 2SGEE 1C2EA 2C8ZB 2R0KA 2GCTC 3LC5A 2BLQA 3M61U 1SMFE 3L33A 1TBQH 4D9QA 1F92A 3RXPA 1S6FA 4A6LA 2P3TB 2FODA 4B2AA 2F91A 1GJ4H 2ZFSA 1YPMH 2JETC 2F9BH 3AASA 3QTVH 2IJOB 1EJAA 2D8WA 5JB8S 4WH8A 1DE7H 3I29A 3LGUA 3SJKA 1SSXA 1YCPH 3A84A 1ZHPA 1O3NA 2V3HH 4AC9A 4ASUD 2OBQA 3VB3A 4D8NA 1V3XA 4OS5A 5DP8A 3IWMA 1RRKA 5G4BA 2HVYB 2FOGA 3LU9B 5GIBA 3Q77A 5E2PA 5DSFA 1UHBB 4X6OA 5JBTA 2ZHDA 1BBRH 2G81E 3P8GA 1UVUH 1Y5AT 4PROA 5T3HA 4B6FA 5L2YH 1P3EA 2ODQA 2ZDLA 5LPRA 2KCAA 1KMHB 2OP9A 3F2GA 3GYLB 4GCHG 1BB0B 4MPWA 3LH1A 3M35A 5SGAE 1UW7A 3LDXH 4LK4A 2BY6X 2FYQA 1TB6H 4Y8YA 2KCOA 4DGJA 3F0PA 1SG8B 2PHBA 1L4ZA 7KMEH 5L2ZH 2XOKD 1UO6A 2SGDE 4RN6A 2XYAA 3A83A 5K7RA 2QXGA 1SR5C 3U69H 1ELBA 1SGFA 2C93B 1H8ED 3LH3A 3P8FA 1E38B 2FS8A 1TIOA 3UOPA 3TNSA 1CGJE 3AAUA 2VVUA 1EOJA 1ZTLA 4NA8A 4X2YA 2F4LA 1AE8H 1HIAB 1MU6B 1LPKB 1ZSJA 4U01A 3ODDA 1GCDA 5BPEA 4YTAA 3ZVGA 4OS4A 3ZZ8A 4KTCA 2D2DA 3BTHE 4FOUC 3AW1A 3MU5A 1EZUC 5TCAA 3SGQE 1TRYA 2KFWA 2XXLA 1GGDB 3TH2H 1HXEH 2FIRH 4JK6A 2LP6A 4AFSA 3MH6A 1XVOA 2FWWA 1SGCA 3GDVA 2G5NA 3SYJA 1PQ5A 2HPQH 4Q7XA 4CRAA 3E8LA 3N7OA 1O2RA 5EQQA 3HGNA 3QN7A 4ESTE 2ODPA 1NU7B 1HAHH 1G3DA 4MDSA 3ZV8A 1LCYA 3QX5H 3A87A 5GJ4B 4F55A 1P09A 6LPRA 1HJAC 1GI5A 1UK3A 1XUHA 1Z7KA 3GICB 1LQDB 5PTPA 1E0FD 1UCYK 3SV2H 1JRTA 1W14U 2A45B 1GI2A 3BTKE 4YO9A 3SORA 2EY4C 2ASUB 3BIVH 1YGCH 2LELA 2RA0A 4NCYA 2K0QA 5A2MH 1ARBA 3LONA 5E0HA 1DSUA 1ID5H 1MTWA 2A5AA 2O8MA 3GY4A 3DA9B 1BJVA 1EASA 1QRWA 4UFDH 2TRMA 2L74A 1NBME 3UR9A 4WMFA 1AVGH 3SNEA 3P95A 5CHAC 2Y5FA 2OC0A 3UPEA 2Z3CA 4AZ2B 2EQNA 1E36B 5C5OA 3H5CB 3V13A 1EUFA 3MH4A 3LJJA 2VIWA 1DDJA 1Z6EA 4JZFH 3GCNA 1D9IA 3QLPH 1TNIA 1T7CA 4Q7YA 2BLWA 2VGCC 1P2IA 1HAIH 5C67A 3T5FH 4RI0A 3U1JB 1O3LA 1IQLA 3MU8A 4YXWD 2ZHQH 3RXUA 4NZLA 1DLEA 2ZWLH 1MTNB 4ZH8A 4GAWA 5LPFA 1QQ4A 3BTME 2J94A 2J97A 2QIQA 1G3BA 2BDAA 5HIYA 3DSPA 1O33A 3RMMH 4WMEA 1UVPA 1CSOE 4D76A 2BHGA 2KM0A 4YESB 3SNCA 1F5RA 1DM4B 1E35B 1O3EA 4ISNA 3B9FH 1O5CB 1P2JA 1N8OB 1WU1A 3SQEE 8GCHF 3KHVA 4F4OC 3C27B 1E37B 3BTEE 1ANEA 1V2WT 2M2AA 1UMAH 1GHZA 1TA2A 3ZZ7A 2FX6A 4Z1MD 1BQYA 2GT8A 3LJOA 1O2LA 3U28C 4ZXYH 4R0IA 2J92A 4QT8C 4DCDA 1JWTA 2JDID 2O8UA 2OQUA 1W10U 4AN7A 1YPHC 4IW4E 2P93A 2ANYA 2O9QA 3P92A 2XTTB 3ZIAD 2XBWA 1TOCB 2FLRH 4AOQA 1ZRKA 9ESTA 2YNBA 1OKXA 4I8HA 3GY5A 3WW7A 2VWOA 1OP2A 3ZZ3A 5GNDA 3A7ZA 4UE7H 1E1QD 4TT3D 1ORFA 1TLDA 1O3GA 1W0ZU 3BTTE 1XMNB 1ABIH 2FI5E 1GMCF 1A1RA 1EFRD 1SQAA 4ASHA 3BG4B 3A7YA 1PYTD 3ZVDA 1BTUA 1CHOF 3O8RA 3S9CA 3FP8E 1ELEE 4UEHH 2FOCA 5C20A 4CHAB 1C5PA 4CREA 2GMTC 4Q80A 4A7IB 4JYVH 1O2YA 5L30H 1P06A 3K65B 1K9OE 1AU8A 1MBMA 1YLDA 2STBE 1BT7A 1NTPA 2BQWB 3BTQE 4ISOA 1IAUA 2DE9A 1V2OT 1FN8A 3F2FA 2IN2A 1C5RA 2BZ6H 1GDNA 1UVTH 1VCWA 2PKAB 1IQKA 3RU4D 3MNSA 1QNJA 1SC8U 1YCPM 2HGTH 2Q6FA 5DG6A 7GCHF 4Y79A 1Y5UT 1BMAA 3S69A 2BLVA 1HAPH 5CE1A 3F1SB 1COWD 1LKBA 3KL6A 1EB1H 2FP7B 2P8OB 4FUDA 1S84A 4M7GA 1FIWA 5C94A 2J34A 2FOMB 2WINI 2CV3A 1ANDA 3GISB 1HCGA 2BYAX 2K1QA 5A0BA 2I6SA 3PYHA 1NPMA 1C5YB 1QRZA 3PO1B 4ZMAH 1NO9H 4K1TA 3FP7E 1V6DA 1GI0A 1YPEH 5FBEA 1T31A 3N99A 1SGTA 1QJ7B 1NRPH 2FOFA 5EJZA 2QXJA 3HGPA 2SGQE 1SKYE 1MUEB 1C2HA 1PPGE 1J9CH 3FN8A 1FQ3A 4WXVA 3ZZDA 2P16A 5HM9A 1UTOA 1GL0E 3RU4T 1GVLA 1BITA 2FTMA 1DUEA 2GCTB 1W13U 4K2YA 1C5XB 1G3CA 2GZ8A 3KQCA 1QZ8A 3UQOA 4MNWA 4H4FA 1K1MA 3BSQA 1A3BH 3RXCA 3E1XB 5EOKA 1ZLRA 2I6QA 2HNTE 1ELDE 1B7XB 1LHDH 1CA0B 2G52A 1ZOMA 4YOGA 4OM9A 1DXWA 4MNXA 3B8JA 5T6FA 2A32A 1WV7H 1GJ8B 1Q31A 1C2LA 2G4UA 5T1VA 3DCLA 3PV2A 4E7RG 1YPJH 4FUGA 3TGIE 3MNBA 5HGGA 1EQ9A 1O31A 2XBVA 4FETA 2Z7FE 4KGAA 4Z6AH 4A1XA 1GI6A 1A7SA 2A5IA 3D23A 3GDSA 3L3TA 1D6WA 2GZ7A 2BDYA 1CBWB 2ZFTA 2H2ZA 5A0CA 1GHWH 2HWLB 3M7TA 4CRFA 3BEIB 1IQJA 4NIYA 4Y11E 1LKAA 4AORA 1LMWB 2FOAA 1NFYA 1OP0A 1ARCA 3PWCA 5F8ZA 4E05H 1AN1E 4FU8A 1FZZA 3NPSA 4Y7AA 1O2IA 1ESTA 1UHBA 1LQEA 1TPSA 3OEHD 3MU1A 5C1UA 3LGTA 4P02A 3BIUH 5TJXA 1EAIA 2FXRA 2ZDAH 1AFEH 1NROH 1QA7A 1T8LA 1CGIE 1QRXA 1N6YA 1K28D 2BDGA 2CK3D 3VEQB 4B76A 4XBDA 1W3CA 3KQ5A 4U32A 4YM9A 1MMJN 2O8WA 3ATMA 1ZGIA 2YNAA 1AB9C 2A2QH 2G5VA 2BD3A 2Z6BD 1C5MD 4Y8ZA 3M3SA 1H1BA 3RXKA 4BTIB 2V3OH 2ZTXA 3OFND 4FUCA 5GWZA 1WTHD 2BD8A 2VIQA 2EEKA 2V35A 5FHTA 2R3UA 4B71A 1ACBE 2H9HA 3T62A 2A7JA 4VGCC 1VCQA 5EQRA 4I31A 1NRQH 2IPQX 1QFKH 1NESE 1EB2A 4ABHA 4CRGA 2A4GA 3BTFE 3SNDA 1PQ8A 3LGWA 1TPOA 1OP8A 3STIA 2DUCA 2EI7A 3TGJE 3UWJH 4INHA 2SFAA 4I7YH 1ZPZA 2GDEH 1MKWK 8LPRA 3AVZA 1MKXH 4XBBA 3FP6E 1EZSC 2PGQB 3MTYA 1AUTC 1GI4A 1W12U 1C2GA 1CT4E 2FX4A 2QV1A 1BTHH 3KNXA 1O3FA 1ETTH 1K1OA 1TALA 2KAIB 2XC0A 2ULLA 1O3AA 3R3GB 3UNRA 1FPHH 4LXBH 2G55A 2BDIA 1AQ7A 5T6DA 1DY9A 1L1JA 3FO8D 4DIHH 1LHGH 5AVDA 1V2RT 3SV7A 1GBJA 5EW2H 1P9SA 2BDHA 1G37A 1A0JA 2GD4B 3OY6U 2B7DH 3PM3A 3LIWA 3T29A 2ZZUH 2R3YA 4X8TH 1TAWA 1QJ1B 2R2WU 2XW9A 4FUEA 1KY9A 1S0RA 2BDBA 2KCPA 1C5LH 1THSH 3UOUA 1FI8A 4K1SA 2L6OA 2OLGA 1V2PT 3OY5U 1P2MA 4OGYA 2GTBA 2A2XH 1GMHF 3GDUA 4KELA 3LGVA 2OTVA 4GHTA 1C2IA 4X1SU 2ZGJA 5I25A 1SFQB 4E06H 1TNLA 2RDLA 3F9HA 1Q2WA 1V2ST 1A5IA 3S7KB 3WY8A 3ZZAA 6CHAC 1J8AA 2W3KA 3EDXB 5CHBA 1S0QA 4BOHA 4AGJA 4AYYB 1BMNH 1XX9A 2ZPRA 1LVOA 1TA6A 2PFEA 2F9UA 2F9NA 1WTGH 1SGRE 1BRUP 4ABJA 2PW8H 3T25A 1NFUA 2SNVA 2BX4A 3ENSB 3UY9A 4DT7B 1O5DH 1O3CA 1GHXH 1TONA 3RDZA 3MOCA 2QYIA 1AMHA 2AGIX 2ZDKA 5EJLA 3F3BA 3LKWA 3MU4A 2BD4A 3QUMP 1HAYB 2HRVA 1QHRB 2ZKSA 2WPDD 2TPIZ 2ZPSA 3EAJA 4I86A 4UDWH 1C5VA 5F8TA 1O30A 1ESAA 1KLTA 1IQNA 2ZNKH 2JKHA 1IQFA 1EOLA 3CS0A 4YT7H 3ZVBA 1RTLA 3H7TA 1D6RA 1S82A 3MYWA 5FPSA 4XOJA 1C1UH 1V2LT 2FOEA 1C1SA 3W95A 2BY8X 2G8TA 3VXEH 1AWFH 1C4V2 1DICA 4IMQA 5GXPA 1XKAC 4TYDA 1SLXB 1P11E 1BA8B 3MFJA 1PYTC 4NSVA 4NIXA 2BOKA 1A46H 1RD3B 4X6NA 1IQMA 2H6MA 4ZHLU 1LHCH 3UNQA 5AFZH 3PMBB 3DFJA 2ZDVH 1TGBA 1HB0B 1Z8RA 1Z8IB 2Z9JA 2GMTB 2PGBB 1C9PA 1D3TB 1OOKB 4MPUA 3VFEA 2LPRA 3EA8A 1AO5A 1KXDA 1KXFA 3LOXA 2ODYB 1FNIA 4HGCA 3SV8A 2A1DB 8GCHG 4CBOA 2ILNA 1GBCA 1B0FA 3JZ1B 1JIMA 2FESH 3TU7H 3S7HB 1O2HA 1Y8TA 1OSSA 3GYMA 2R9PA 3CENA 1DLKB 1YKTA 3P17H 4NG9H 1C1NA 5DP5A 4UFEH 1ELVA 2K8IA 2WPMS 4KTSA 4BXWA 2R2MB 4K60A 4JMYA 1DWCH 3U8TH 1Y3YA 1FY4A 4CBNA 2CHAC 3SU5A 1M9UA 1QJ6B 2FTLE 3A7XA 2AMQA 2Q6DA 1O2MA 4ABDA 1ZR0A 2B5TB 2HVXA 2FO9A 2A7CA 2UWPA 4JYUH 3MNXA 2G51A 4WH6A 3SBKA 1CA8B 2XNDD 1O5EH 1KYNA 1TYNA 1HV7A 5BRRE 4K8YA 2NU1E 1W2KH 3ESTA 3MH5A 4MNVA 1CE5A 1PPEE 3N7EA 1FV9A 3RXJA 1CGHA 5B6OA 4WJG2 4XD7D 4SGBE 5LGOA 1CHOG 3S9BA 1YPHE 1AGJA 2IPHA 4WMDA 1SBWA 6GCHF 1ZMJA 1NRNH 1C1RA 5HKKD 1K1IA 2UUKB 4DOQA 1BBRE 3OU0A 3T28A 4ZCNA 1TNKA 5KEDA 5DP6A 4GPGA 3GY7A 1EXFA 2RFKC 1B5GH 4IBLH 1IQGA 3GCTF 3OE7D 2QC2A 2CF9H 2W6JD 1O3BA 4FU9A 2KX4A 1WXRA 3VB6A 1GBFA 4ZAEA 1TGSZ 1PQ7A 3ZZCA 4KTUA 2OD3B 2Y82A 2OQ5A 2V6NA 3MMGA 1B0EA 1RIWC 2CGAA 1SHYA 1QBVH 1MKWH 1BCUH 3ZYDA 1WAYB 7GCHG 2TIOA 1G2MA 3OAAD 3KYGA 2EI6A 4O3TA 2A4RA 1C5SA 1O37A 4X2VA 1JIRA 4IS5A 1GJCB 3RLYH 2ZU3A 1FAKH 1ZRBA 1TRMA 5FL7D 1J16A 1XUFA 2Y7ZA 3ATIA 4TSFD 4YZUA 1HNEE 3EA7A 4NA9H 2AERH 5ESTE 5EXMA 1K1LA 3GY2A 2YMSD 1GG6C 2G4TA 3FZZA 2UWLA 1QB1A 4YLQH 4I32A 1AIXH 2WPLS 1AVWA 1A0HB 1GVZA 5A09A 1E34B 1SQTA 1TOMH 2V0BA 1TX7A 3VB5A 3SV6A 5DJ7A 4ACBA 3ZZ9A 4RKOB 3GCHC 3A82A 1O0DH 1EJMA 4H6TA 4JZIA 1MAYA 1OWJA 2EA3A 1G30B 1C5UA 1GDUA 4U2WA 1PPZA 5FBIA 5ETXA 1EPTC 2Q1JA 2NWNA 2ZECA 4INKA 1GJAB 3GY6A 1QGFA 1GI7B 1UTPA 1FDPA 2F9PA 5HIZA 1HGTH 1XXDA 1C1QA 1T8OA 1VCPA 2OINA 3LGYA 4TPYA 4VGCB 5EPYA 2QE7D 1IQEA 1VGCC 2TGDA 3BEUA 1O2QA 2BB4A 1JOUB 4DVAU 1HAVB 4ZKSU 2F83A 4HFPB 2IJD1 4BAKB 3W94A 2JJ1D 2WPKS 3QZRA 3SJIA 4DIIH 3ELAH 3JZ2B 4DG4A 4R8TB 3FKSD 3EA9A 2H5DA 1GBIA 5F03A 1AFQB 4AFZA 2GT7A 3SQHE 1P05A 3U1IB 1TBZH 1ETRH 3M5LA 7LPRA 1TABE 4YLUA 2XBXA 1O5FH 3VPKA 5K0HA 3I78A 2UWOA 4MTBA 3BEFB 3SUGA 4ZHAA 5A8XA 1YY3A 2FS9A 3EGKH 3S0NA 1Y5BT 1IHTH 4TY6A 4ZKNU 3MO9A 1GBBA 2PUXB 5C3NA 2OC7A 2GP9B 3IITA 2UUYA 1C5QA 4HTCH 4BANB 4MNYA 1GJDB 1GCTC 3H7OA 3SN8A 2H5CA 1GVKB 1C1TA 2CF8H 4ISHH 4P00A 2ZCLP 2ZP0H 3QWCH 2B9LA 1DSTA 2KAIA 1SOZA 2WYGA 3RC4A 4ABEA 2FEQH 1HUTH 2BOHB 1NRRH 1C1OA 1OXGA 5LH8A 5IYTA 4IC6A 3QGJA 2GDDA 4CR5A 5F6MA 1GPZA 1H8IH 1C1PA 2VWMA 3URDA 4BTUB 1GHYH 4B2BA 1EPTA 4X8UH 1O2OA 2ZTZA 2OUAA 1BRAA 5DO4H 2HLCA 3FAOA 2J4IA 2QF3A 4IN2A 3KQDA 1AWHB 2W7SA 4AFUA 1BMLA 2A5KA 3TH3H 1L4DA 1QBOA 5EGMA 2ZHWH 2VWLA 1ELTA 4LZ1H 1KDQB 2FOBA 2XBYA 2Y81A 1NRSH 2GV6A 4NIVA 2GJGA 5HMAA 4H42U 4ZXXH 3KYFA 1Y3XA 1GBDA 2LNCA 3SOSA 2P95A 1PPHE 2P94A 1GMDF 4GVUA 3RXAA 3UAIC 2WV5A 3E3TA 3E6PH 4IGDA 2FM2A 4KP0A 2FLBH 3U8OH 3EYDA 1GBHA 1MCTA 1N1LA 3PMJA 1LDTT 2D1JA 4Y7BA 4FUHA 2W5EA 3BF6H 3A7VA 1TNJA 3RP2A 4A5TS 1CT2E 2PV9B 3CP7A 3QZQA 2A4QA 5C17A 1HDTH 2XC5A 3RXFA 2HNTF 2DE8A 1EKBB 1LVBA 4NIWA 1P02A 1P57B 4WVPE 1OWHA 2TGPZ 1QL9A 3HATH 4TY7A 3WWBA 3TK5A 3AK5A 1FY3A 4Y6DA 2OK5A 5I46H 1D3DB 1NS3A 3RXEA 2AMPA 1ETSH 1GMHG 1S83A 4SGAE 1OS8A 5FCRA 3CS7A 4CR9A 2TGAA 2ZDNA 2HLDD 1V2VT 2FOHA 1UK4A 2JETB 3KGPA 4HI3A 3K6ZA 1Z71A 3A81A 2P3UB 3SV9A 3M7UA 2ZQ1A 3RMLH 2OC1A 3SNBA 4Q4LA 1GGDC 2FI3E 2B0FA 3NRLA 3KCGH 3DT0H 1O2NA 1SB1H 1OX1A 2ANKH 1Y3WA 1YPGH 1BMMH 1UCYH 4X6MA 5CMXH 1P01A 3A7WA 3DFLA 3MNCA 3RXIA 3DSGA 2VNTA 3W1EA 1H8DH 3OYPA 4ISLA 2VB0A 3SJ8A 4MVNA 1O2JA 5ABWA 3NWUA 2EI8A 1A0LA 4RT1A 4A1TA 1WDIA 4NWLA 3A85A 1SI5H 1LO6A 2QY0B 1DT2A 3AW0A 5C1XA 1FXYA 1YLNA 5AHGH 2VIDA 5ESBA 2ZU4A 1SGIB 3UNSA 1F0SA 4LZ4B 2QCYA 5HXFA 4K1EA 1BTZA 2J95A 2PR3A 2ZCKP 3D49H 1KSNA 3PRBA 4BAHB 2GCHF 3WWFA 2QA9E 3VGCC 3F68H 1Y3UA 5DP4A 1QR3E 4DT4A 1L0ZA 2PTCE 3V3MA 5IK2D 2PSYA 2W6ID 2WZQA 1WSSH 1GBKA 1GJ5H 1O2ZA 2QXHA 3A8BA 3N7DA 4ABFA 2ZPQA 3TJNA 2J98B 1MBQA 1L1NA 4DJZB 4B2CA 2WSSD 1O5BB 4CRCA 4K69A 2SGAA 1HIAA 4NA7A 2AMDA 3Q00A 3TK9A 4BXSA 5KGOA 2BVRH 2F43B 2NU3E 1O3JA 2EC9H 1TBRH 1UTQA 5L6NH 1MTNC 2KCYA 4TWWA 1G3EA 4D9RA 4AX9H 2PTNA 2BXTH 2ZHEH 3A8CA 5J4SA 2PLXA 2ZCHP 4WF8A 1TGNA 1G36A 1KXCA 1LTOA 3FOAA 4INLA 1HJAB 4OS1A 3V0XA 3F2HA 5DP3A 3SZNA 2WV9A 1W8BH 1SGYE 1A5HA 2BTCE 3SGAE 1N8OC 4D7FA 4FVDA 1SGNE 1TX6A 2VH0A 5B6LA 1HBTH 1OYQA 1NU9A 2WHXA 5GCHF 1RGQA 1T8NA 1GHAF 2IOTA 2SGPE 2YMSC 1MQ5A 1BTWA 2F3CE 1MD7A 4AB8A 3RU4E 4IMZA 1GG6B 5C5NA 5AFYH 3KQBA 3HKJB 1PFXC 1Z1JA 3NCLA 5CHAB 5JB9S 2VVCA 1TE0A 1INCA 2QN5T 4ABBA 3RXHA 3UIRA 1AVXA 1P9UA 2JJ2D 4GSOA 5DKMA 4BNRA 2ALPA 1SLUB 5FAHA 2VGCB 5GDSH 3Q3KA 1VR1H 3GCHB 3ODFA 1O34A 2BM2A 4FVBA 2BY5X 4I8KA 4TWYA 5C0TA 6GCHG 1KLIH 4AFQA 5A0AE 3ZV9A 3LC3A 1QURH 2M5TA 4ABGA 4JYTA 4GLYA 1XUIA 1O3KA 2GVFA 1MH0A 3E91A 4O9VA 1RFNA 2D26C 3GCTG 3BG4C 1MTSA 5DPAA 1JXPA 3T2NA 4OS6A 2VU8E 1OHHD 2FPZA 1K1JA 1ELAA 1TQ7B 2ZHFH 3SI3H 1C1MA 1VGCB 3PMHB 2WPHS 4F48B 1UTLM 3MWIU 3ZVCA 3SUFA 1OWKA 4THNH 3KN2A 3RXTA 3T27A 3RXSA 1FJSA 4WXIA 2AS9A 3UB0A 3ZZ4A 5J4QA 2Z94A 4MQAA 4AYVB 5DN6D 1RS0A 2AYWA 2A4OA 1D4PB 2RG3A 2Z9IA 2WPIS 1VITF 1P2OA 1S6HA 1CQQA 4DW2U 1EX3A 1KTSB 2YOLA 1BHXB 1NBMD 1HAVA 1V2MT 1Z8JB 5E0JA 3PLPA 1YPKH 1K0HA 2BLOA 4J2YB 1UTKA 3RXLA 1WQVH 4B1TA 1AZ8A 2P8OC 1FUJA 3LT3A 3RM0H 1O3HA 4JZEH 2PWXA 3RXVA 1FLEE 3RXQA 1FONA 1ZZZA 2STAE 3QO6A 1PPCE 3F9GA 1C5NH 1AI8H 1S5SA 1HAXB 1NN6A 3PO1C 1TGTA 2GX4A 3S9AA 5C1YA 4I8JA 1GHBF 1TWXB 5JBAS 4FUFA 1HJ9A 1HLTH 1PPBH 3MO6A 3SGBE 1EAUA 2VIVA 1W7GH 1QBNA 1SOTA 3M3VA 1H4WA 1O2KA 3SHAH 1SGQE 3NZIA 1SHHB 2BXUH 3A88A 2JH5D 3LGIA 1WOFA 1KLJH 1LPGB 3BTDE 2BMGB 1F2SE 2VH6A 3ITIA 1QL7A 2BD9A 4OS7A 1HFDA 3PB1E 3F9EA 1OYTH 4XFQA 1TMTH 1BIOA 1ZSKA 5EQSA 1O35A 1AD8H 1GJ9B 1QY6A 2Z9LA 1VJ9U 2ZU5A 1ZJDA 4LOYH 3NK8A 4YOJA 3UREA 5H4IB 1O3MA 1S85A 3VG8A 3SO3A 5EXLA 3FZDA 5GPIB 3P6ZB 1ZPBA 1SQRA 1MTUA 2WUCA 3SU0A 1AE5A 1CA0C 1SGDE 1YPLH 1Z6JH 1GL1A 2XWAA 1C5ZB 1ESBA 3SJOA 3RUOA 2Z3DA 5KECA 1C2KA 1F0UA 2PP6A 1XVMA 4NGAH 1Y59T 1JMOH 3P70B 4JK5A 1V2TT 4BTTB 2PKAA 1P3CA 3M5MA 4TPIZ 4X8VH 2GV7A 4A1VA 1JBUH 1BHXF 2ZFFH 3GY8A 4GUXA 1KDQA 3BTWE 1GBMA 2BQ6B 1RTKA 4NWKA 3Q76A 2QF5A 1KXEA 1IOEA 1CBWC 1G2LA 3EQ0H 1WQSA 5JDUB 4GHQA 2OC8A 4NSYA 5DP9A 4IN1A 1BDAA 3SU1A 1F5KU 1SLWB 1P2NA 2ZFPH 1FY8E 1LPZB 1V2NT 1V2JT 1GMCG 2J38A 2QGRA 3NUMA 4Y0ZE 1J15A 3VB7A 2Z9KA 3MH7A 3D62A 2WV4A 2G00A 1F0TA 3A7TA 1DWDH 3TLOA 4ACAA 2ZC9H 2CN0H 3SNAA 1UK2A 1O2WA 4FUJA 2H9EH 1UTMA 1V2KT 4FXGH 2SNWA 3M5NA 1DANH 2F9VA 1MTVA 4AG1A 1EAXA 4Q7ZA 3G01A 1AKSB 4B75A 3ATKA 1GJ6A 1ELCA 3OEED 1X7AC 3A8DA 5C2ZA 2J9NA 3M7QA 2ZIQH 1A5GH 1C5OH 2QF0A 2PSXA 3M5OA 1O2UA 3O8DA 2BZAA 4JCNA 4NFEA 1C5TA 1TNGA 1GMDG 1K1NA 2CJIA 5JYIA 3A80A 1F0RA 2Q6GA 1QQUA 1O2XA 1MQ6A 2SGFE 2XCNA 3GS9A 4UD9H 1O36A 4XSKU 1ZTJA 1MCVA 2PKSC 9LPRA 1SVPA 1NM6A 3PTNA 1K1PA 1LHFH 1E1RD 2C90B 4FU7A 3M37A 2VIOA 4BAQB 3V12A 2UUFB 1P03A 1GBAA 3SU2A 1OWEA 4Y10E 2Y6TA 2AFQB 4ZKOU 2ZFRH 1TFXA 3PROA 1IHSH 4WY3A 5EG4A 4ZHMU 5DP7A 2AGGX 3UWIA 3VGCB 3RLWH 5E0GA 1AB9B 2ZA5A 4WWYA 4MG3A 3RC6A 2FI4E 5A8YA 2RDEA 4IC5A 2ZEBA 3ZVEA 4NZQA 3RXRA 1VJAU 4CH2B 2C3SA 2TGTA 1WBGB 1VKYA 3TJOA 4X1RU 1UJ1A 5EU8A 3RMOH 2ZF0H 2Y5GA 3AAVA 1UTJA 2XC4A 4AB9A 1CT0E 1MU8B 1OPHB 4AGKA 2ZFQH 5EIYA 1YWUA 3RMNH 3VXFH 1QCPA 2Z3EA 3QDZB 2ZG0H 2RA3A 2Y7XA 2J98A 2XCFA
chains in the Genus database with same CATH topology
2F9OA 4UFFH 3GY3A 1GJBB 1CO7E 1GWAA 1ZMLA 4H6SB 3BV9B 1BTYA 2W7UA 2BY7X 1SL3A 2A7HA 3HKIB 4X6PA 2TBSA 8KME2 3TH4H 4UFGH 1GBEA 1KXBA 1TPAE 1ZPCA 3TGKE 1FPCH 1SGFG 3TJUA 1C5WB 2QXIA 1O3PB 4GCHF 1MKXK 1OWDA 1DWEH 1GBTA 1TMBH 4FUIA 2GCHG 2ZGCA 3SW2B 1G9IE 2FMJA 1FN6A 5DGJA 4BAMB 1P10A 2ESTE 5E2OA 1NT1A 4RSPA 2WUBA 1N6XA 2CMYA 3FANA 1ZJKA 3A89A 1PJPA 2ZQ2A 1RXPA 1DFPA 2HPPH 2O8TA 2J2UA 3F6UH 2QAAA 3SUDA 1D3QB 3Q3XA 1L2EA 4K8BA 3VB4A 3P8OA 4F49A 1O3DA 1EZXC 3B23B 1HRTH 1TPPA 3E0PB 1W7XH 2BVSH 1C4Y2 6CHAB 1P04A 1KXAA 1MD8A 1HYLA 4D7GA 1FY1A 2VJ1A 3ZZ6A 3FVFB 1ABJH 3K6YA 1PPFE 2FDAA 4I33A 4HZHA 2P3FH 3HPTB 1C9TA 2OXSA 2ZTYA 1PQAA 2XWBI 3SHCH 1O2TA 1DXPA 1DITH 4BAOB 2XNIA 1T4UH 1C2JA 1P12E 3GCOA 1LHEH 5EPNA 3T26A 2BX3A 2PUQH 4X1PU 1GBLA 4X2WA 3E0NB 4K5ZA 1WCZA 1DWBH 1WUNH 1K21H 1XKBC 2VINA 1TNHA 1MAXA 5JBBS 3RC5A 1ELGA 1QIXB 2W3IA 3PTBA 5FPTA 1QA0A 5EODA 1A2CH 1RTFB 5GCHG 1GHAG 1SGEE 3K2UA 1KIGH 2AH4X 1GI3A 1YM0A 1D3PB 1ZYOA 1BTPA 4J1YA 1SFIA 3TPIZ 3LPRA 3NXPA 3SU3A 3MU0A 4MPXA 1MZDA 6ESTA 1HAOH 1V2QT 1C4U2 1V2UT 1YBWA 1FY5A 1K22H 1A61H 2GZ9A 3D65E 4OS2A 1GI8B 4RKJB 1A4WH 3PWBA 2C8YB 4XE4A 1NC6A 2OCVB 1ANBA 3RXOA 1SQOA 1QL8A 2A0QB 1H9IE 1CVWH 3OSYA 1BZXE 3KF2A 2ZGHA 4YT6H 4JZDH 1BOQA 1UTNA 1CU1A 1XUKA 1XM1A 2NU0E 1JRSA 2O8LA 1THPB 3RXDA 4CRBA 1NZQH 3QTOH 3SJ9A 1EJNA 1NY22 3UQVA 2VWNA 3P8NA 2C8XB 1AY6H 1ANCA 2WPJS 3QGNB 3NKKA 4CRDA 1W11U 3DD2H 5FCKA 1XUJA 4Y0YE 2NU4E 2OBOA 3O8CA 4O97A 4XBCA 4NFFA 4Y8XA 1O38A 4I8GA 3SU6A 5E8EH 1TMUH 3BG8A 2CXVA 5HYOA 5FPYA 4DY7B 1YCPK 2H1UA 1VITG 1QB6A 2CHAB 3ZZ5A 8ESTE 3SI4H 3OTJE 1O39A 3V7TA 1DOJA 1BBRK 2ZGXH 1BTXA 3PLKA 1H9LB 1QTFA 1THRH 3UUZA 1DS2E 1O3IA 3STJA 1A3EH 3TK6A 3TITA 3GOVB 3UR6A 3SUEA 3UTUH 2H9TH 3KEEA 2GGVB 1GHBG 5LPEA 2AGEX 3ATWA 1SLVB 1NFWA 4FUBA 1F7ZA 1ELFA 2ZGBH 2Y5HA 5HM2A 1Q3XA 1P2KA 1T32A 1Z8GA 3EE0B 2ALVA 4Z0KA 2BD7A 1EP5A 1UCYE 3DUXH 4ZKRU 3QK1A 4ABAA 1DPOA 5A8ZA 3ATLA 2W26A 3BTGE 3MI4A 1F5LA 7ESTE 3U9AH 1GI9B 1YYY1 2Y80A 2ZO3H 3TJVA 1TQ0B 3PV4A 4ZUHA 2ANMH 1NFXA 3KIDU 3A8AA 1RIWB 2UUJB 5JPMH 4DURA 3RXMA 1J14A 3ZYEA 1O2PA 5AF9H 2VIPA 4X0WU 2AEIH 1HAZB 2THFB 4Y71A 3F9FA 1GJ7B 1U6QA 5IDKA 1P2QA 3Q3YA 1BRBE 1C2MA 4ZROA 4B74A 1DUAA 1AKSA 1EAWA 2C8WB 2B8OH 4OGXA 1AZZA 3DHKH 4XDEA 4X1NU 4ISIH 3PMAB 1P8VC 3IG6B 3R0FA 2NU2E 1QB9A 1BUIA 1O2SA 4X2XA 1YF4A 2BD5A 1FIZA 1O2VA 4A92A 1RJXB 5TCCA 2WYJA 2AIPA 1TX8A 2PKSB 1TGCA 2P59A 3ZVFA 1FAXA 4O03A 2ZU1A 1AFQC 5JBCS 1C1VH 1H9HE 2BD2A 2HOBA 2JH0D 4CH8B 1DVAH 2R0LA 1YC0A 3U8RH 5EW1H 1EP6A 1L1GA 1HAGE 1T8MA 3U98H 2JH6D 5F8XA 1AHTH 2C4FH 1S81A 3UFAA 2AIQA 4I8LA 1IQHA 1UVOA 4UONA 3OX7U 1YLCA 3FFGA 4O3UA 1CHGA 1LVYA 1W0YH 4E7NA 1IQIA 3C1KA 1HPGA 1Y3VA 1ZHMA 1MZAA 1XXFA 2HNTC 1ZGVA 4U30A 3TIUA 1K2I1 1YP9A 3ZZBA 4MPVA 1O32A 4ABIA 1EPTB 1O5AB 1XUGA 3TNTA 1DX5M 5FXLA 1LVMA 2BVXH 1GI1A 1O2GH 3HK6B 3E16B 1P0SH 1SPJA 1VZQH 3URCA 2ANWA 1FMGA 2ZDMA 1WYKA 2GKVE 4B73A 1C2FA 4CHAC 1J17T 3TVJB 2ZI2H 2FYRA 3K9XB 5EXNA 3O8BA 3L6PA 4YOIA 3SU4A 4AG2A 1VITH 2BQ7B 1ZSLA 1G32B 1ZTKA 2VVVA 4KKDA 4MLFB 5FX6A 3MO3A 4X1QU 2RCEA 3PLBA 3ZVAA 1OWIA 3KQEA 1T4VH 4Q2KA 1KTTB 1HJ8A 3E90B 1GDQA 4X8SH 2ZU2A 1EATA 1O5GH 2A31A 1C2DA 2XRCA 3M36A 3MHWU 1C1WH 3I77A 3RM2H 2BY9X 1AUJA 3M3TA 1GCTB 2HALA 1ZMNA 4Y76A 4K3JA 1SGPE 1EZQA 5DK1A 1BRCE 5FX5A 3RXBA 1GHVH 1UVSH 1Z1IA 1HXFH 2Z9GA 1O3OA 2BDCA 3BN9A 1BJUA 3HK3B 1DY8A 2FZZA 3RXGA 5T6GA 4JZ1A 3A86A 1ZHRA 1TRNA 2SGEE 1C2EA 2C8ZB 2R0KA 2GCTC 3LC5A 2BLQA 3M61U 1SMFE 3L33A 1TBQH 4D9QA 1F92A 3RXPA 1S6FA 4A6LA 2P3TB 2FODA 4B2AA 2F91A 1GJ4H 2ZFSA 1YPMH 2JETC 2F9BH 3AASA 3QTVH 2IJOB 1EJAA 2D8WA 5JB8S 4WH8A 1DE7H 3I29A 3LGUA 3SJKA 1SSXA 1YCPH 3A84A 1ZHPA 1O3NA 2V3HH 2OBQA 3VB3A 4D8NA 1V3XA 4OS5A 5DP8A 3IWMA 1RRKA 5G4BA 2FOGA 3LU9B 5GIBA 3Q77A 5E2PA 1UHBB 4X6OA 5JBTA 2ZHDA 1BBRH 2G81E 3P8GA 1UVUH 1Y5AT 4PROA 5T3HA 5L2YH 1P3EA 2ODQA 2ZDLA 5LPRA 3GYLB 2OP9A 4GCHG 1BB0B 4MPWA 3LH1A 3M35A 5SGAE 3LDXH 4LK4A 2BY6X 2FYQA 1TB6H 4Y8YA 4DGJA 1SG8B 2PHBA 1L4ZA 7KMEH 5L2ZH 1UO6A 2SGDE 4RN6A 2XYAA 3A83A 5K7RA 2QXGA 1SR5C 3U69H 1ELBA 1SGFA 2C93B 3LH3A 3P8FA 1E38B 2FS8A 1TIOA 3UOPA 3TNSA 1CGJE 3AAUA 2VVUA 1EOJA 1ZTLA 4NA8A 4X2YA 1AE8H 1HIAB 1MU6B 1LPKB 1ZSJA 4U01A 3ODDA 1GCDA 5BPEA 4YTAA 3ZVGA 4OS4A 3ZZ8A 4KTCA 2D2DA 3BTHE 3AW1A 3MU5A 1EZUC 5TCAA 3SGQE 1TRYA 2XXLA 1GGDB 3TH2H 1HXEH 2FIRH 4JK6A 4AFSA 3MH6A 1XVOA 2FWWA 1SGCA 3GDVA 2G5NA 1PQ5A 2HPQH 4Q7XA 4CRAA 3E8LA 3N7OA 1O2RA 5EQQA 3HGNA 3QN7A 4ESTE 2ODPA 1NU7B 1HAHH 1G3DA 4MDSA 3ZV8A 1LCYA 3QX5H 3A87A 5GJ4B 1P09A 6LPRA 1HJAC 1GI5A 1UK3A 1XUHA 1Z7KA 3GICB 1LQDB 5PTPA 1E0FD 1UCYK 3SV2H 1JRTA 1W14U 2A45B 1GI2A 3BTKE 4YO9A 3SORA 2ASUB 3BIVH 1YGCH 2RA0A 4NCYA 5A2MH 1ARBA 3LONA 5E0HA 1DSUA 1ID5H 1MTWA 2A5AA 2O8MA 3GY4A 3DA9B 1BJVA 1EASA 1QRWA 4UFDH 2TRMA 3UR9A 4WMFA 1AVGH 3SNEA 3P95A 5CHAC 2Y5FA 2OC0A 3UPEA 2Z3CA 4AZ2B 1E36B 5C5OA 3H5CB 3V13A 1EUFA 3MH4A 3LJJA 2VIWA 1DDJA 1Z6EA 4JZFH 3GCNA 1D9IA 3QLPH 1TNIA 1T7CA 4Q7YA 2BLWA 2VGCC 1P2IA 1HAIH 5C67A 3T5FH 3U1JB 1O3LA 1IQLA 3MU8A 2ZHQH 3RXUA 4NZLA 1DLEA 2ZWLH 1MTNB 4ZH8A 4GAWA 5LPFA 1QQ4A 3BTME 2J94A 2QIQA 1G3BA 2BDAA 1O33A 3RMMH 4WMEA 1UVPA 1CSOE 4D76A 2BHGA 4YESB 3SNCA 1F5RA 1DM4B 1E35B 1O3EA 4ISNA 3B9FH 1O5CB 1P2JA 1N8OB 1WU1A 3SQEE 8GCHF 3KHVA 4F4OC 3C27B 1E37B 3BTEE 1ANEA 1V2WT 1UMAH 1GHZA 1TA2A 3ZZ7A 2FX6A 1BQYA 2GT8A 3LJOA 1O2LA 4ZXYH 4R0IA 2J92A 4QT8C 4DCDA 1JWTA 2O8UA 2OQUA 1W10U 4AN7A 1YPHC 4IW4E 2P93A 2ANYA 2O9QA 3P92A 2XTTB 2XBWA 1TOCB 2FLRH 4AOQA 1ZRKA 9ESTA 2YNBA 1OKXA 4I8HA 3GY5A 2VWOA 1OP2A 3ZZ3A 3A7ZA 4UE7H 1ORFA 1TLDA 1O3GA 1W0ZU 3BTTE 1XMNB 1ABIH 2FI5E 1GMCF 1A1RA 1SQAA 4ASHA 3BG4B 3A7YA 1PYTD 3ZVDA 1BTUA 1CHOF 3O8RA 3S9CA 3FP8E 1ELEE 4UEHH 2FOCA 5C20A 4CHAB 1C5PA 4CREA 2GMTC 4Q80A 4A7IB 4JYVH 1O2YA 5L30H 1P06A 3K65B 1K9OE 1AU8A 1MBMA 1YLDA 2STBE 1BT7A 1NTPA 2BQWB 3BTQE 4ISOA 1IAUA 2DE9A 1V2OT 1FN8A 2IN2A 1C5RA 2BZ6H 1GDNA 1UVTH 1VCWA 2PKAB 1IQKA 3RU4D 3MNSA 1QNJA 1SC8U 1YCPM 2HGTH 2Q6FA 5DG6A 7GCHF 4Y79A 1Y5UT 1BMAA 3S69A 2BLVA 1HAPH 5CE1A 3F1SB 1LKBA 3KL6A 1EB1H 2FP7B 2P8OB 4FUDA 1S84A 4M7GA 1FIWA 2J34A 2FOMB 2WINI 2CV3A 1ANDA 3GISB 1HCGA 2BYAX 2K1QA 5A0BA 2I6SA 3PYHA 1NPMA 1C5YB 1QRZA 3PO1B 4ZMAH 1NO9H 4K1TA 3FP7E 1V6DA 1GI0A 1YPEH 5FBEA 1T31A 1SGTA 1QJ7B 1NRPH 2FOFA 2QXJA 3HGPA 2SGQE 1MUEB 1C2HA 1PPGE 1J9CH 1FQ3A 4WXVA 3ZZDA 2P16A 5HM9A 1UTOA 1GL0E 3RU4T 1GVLA 1BITA 2FTMA 1DUEA 2GCTB 1W13U 4K2YA 1C5XB 1G3CA 2GZ8A 3KQCA 3UQOA 4MNWA 4H4FA 1K1MA 3BSQA 1A3BH 3RXCA 3E1XB 5EOKA 1ZLRA 2I6QA 2HNTE 1ELDE 1B7XB 1LHDH 1CA0B 2G52A 1ZOMA 4YOGA 1DXWA 4MNXA 3B8JA 5T6FA 2A32A 1WV7H 1GJ8B 1Q31A 1C2LA 2G4UA 4E7RG 1YPJH 4FUGA 3TGIE 3MNBA 5HGGA 1EQ9A 1O31A 2XBVA 2Z7FE 4KGAA 4Z6AH 4A1XA 1GI6A 1A7SA 2A5IA 3D23A 3GDSA 3L3TA 1D6WA 2GZ7A 2BDYA 1CBWB 2ZFTA 2H2ZA 5A0CA 1GHWH 2HWLB 3M7TA 4CRFA 3BEIB 1IQJA 4NIYA 4Y11E 1LKAA 4AORA 1LMWB 2FOAA 1NFYA 1OP0A 1ARCA 3PWCA 5F8ZA 4E05H 1AN1E 4FU8A 1FZZA 3NPSA 4Y7AA 1O2IA 1ESTA 1UHBA 1LQEA 1TPSA 3MU1A 5C1UA 3LGTA 3BIUH 5TJXA 1EAIA 2FXRA 2ZDAH 1AFEH 1NROH 1QA7A 1T8LA 1CGIE 1QRXA 1N6YA 1K28D 2BDGA 3VEQB 4B76A 4XBDA 1W3CA 4U32A 4YM9A 1MMJN 2O8WA 3ATMA 1ZGIA 2YNAA 1AB9C 2A2QH 2G5VA 2BD3A 2Z6BD 1C5MD 4Y8ZA 3M3SA 1H1BA 3RXKA 4BTIB 2V3OH 2ZTXA 4FUCA 5GWZA 1WTHD 2BD8A 2VIQA 2EEKA 2V35A 5FHTA 2R3UA 4B71A 1ACBE 2H9HA 3T62A 2A7JA 4VGCC 1VCQA 5EQRA 4I31A 1NRQH 1QFKH 1NESE 1EB2A 4ABHA 4CRGA 2A4GA 3BTFE 3SNDA 1PQ8A 3LGWA 1TPOA 1OP8A 3STIA 2DUCA 2EI7A 3TGJE 3UWJH 4INHA 2SFAA 4I7YH 1ZPZA 2GDEH 1MKWK 8LPRA 3AVZA 1MKXH 4XBBA 3FP6E 1EZSC 2PGQB 3MTYA 1AUTC 1GI4A 1W12U 1C2GA 1CT4E 2FX4A 2QV1A 1BTHH 3KNXA 1O3FA 1ETTH 1K1OA 1TALA 2KAIB 2XC0A 2ULLA 1O3AA 3R3GB 3UNRA 1FPHH 4LXBH 2G55A 2BDIA 1AQ7A 5T6DA 1DY9A 1L1JA 4DIHH 1LHGH 5AVDA 1V2RT 3SV7A 1GBJA 5EW2H 1P9SA 2BDHA 1G37A 1A0JA 2GD4B 3OY6U 2B7DH 3PM3A 3LIWA 3T29A 2ZZUH 2R3YA 4X8TH 1TAWA 1QJ1B 2R2WU 2XW9A 4FUEA 1KY9A 1S0RA 2BDBA