1JXPA

Bk strain hepatitis c virus (hcv) ns3-ns4a
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
177
structure length
177
Chain Sequence
ITAYSQQTRGLLGCIITSLTGRDKNQVEGEVQVVSTATQSFLATCVNGVCWTVYHGAGSKTLAGPKGPITQMYTNVDQDLVGWQAPPGARSLTPCTCGSSDLYLVTRHADVIPVRRRGDSRGSLLSPRPVSYLKGSSGGPLLCPSGHAVGIFRAAVCTRGVAKAVDFVPVESMETTM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NS3 SERINE PROTEASE
publication title Complex of NS3 protease and NS4A peptide of BK strain hepatitis C virus: a 2.2 A resolution structure in a hexagonal crystal form.
pubmed rcsb
source organism Hepatitis c virus (isolate bk)
molecule tags Viral protein complex
total genus 37
structure length 177
sequence length 177
chains with identical sequence B
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1997-08-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02907 Peptidase_S29 Hepatitis C virus NS3 protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1jxpA02
2.40.10.120 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 1jxpA01
1MTUA 4JZIA 4JCNA 4I7YH 1TE0A 1UTPA 4Y0ZE 2SNVA 1QBOA 3VFEA 1MU6B 1GHAG 3NCLA 2ZFPH 2BM2A 1Z8RA 4JMYA 3T29A 1GHBF 4BAQB 5SGAE 1ZZZA 4NSVA 1SC8U 3ZV9A 1C1QA 1KXDA 2SNWA 4NIYA 3K9XB 3MFJA 5F8TA 1K1MA 1LHGH 2BZ6H 3RP2A 2FLRH 3KQDA 1HDTH 2GMTC 3BG4C 1OWJA 2IOTA 1CHGA 1N6YA 1PPBH 1HFDA 2ZU4A 3MU1A 4ZH8A 5JPMH 1ID5H 3M5OA 2O8TA 1PPCE 2GGVB 1KTSB 4X1QU 3MHWU 4INHA 3MH6A 4FUDA 2J9NA 5EXMA 2CJIA 1GBDA 1AUTC 5EPYA 1W2KH 2ULLA 5GDSH 2ASUB 5GCHG 3LGWA 5K0HA 2WHXA 3VB5A 1T8NA 4WXVA 3A7ZA 3U98H 1WCZA 2P59A 1UVOA 1PQ5A 4MNVA 4A1VA 3A8BA 1SLUB 1SGIB 1O2JA 3SORA 1P9SA 1QFKH 1ZR0A 4CRBA 1T31A 3ELAH 2R2WU 1SOZA 2ZF0H 4FU9A 5FBEA 1NROH 1FN6A 1GI9B 1AHTH 1UK3A 3GY3A 1WTHD 1FAKH 3RMLH 1HIAB 3QZRA 2QA9E 1GBEA 1EZUC 1MQ6A 1UTQA 3U8OH 4AYVB 1MMJN 2F3CE 3M5LA 2A1DB 4B71A 1AN1E 3UQOA 2BOHB 1ANDA 1UVSH 1HAPH 2Q6FA 1Q3XA 2ZDAH 3WY8A 1DICA 1GDNA 2BY5X 5LH8A 4O3TA 1SGFA 2FOEA 4MTBA 1O5CB 3NUMA 3A83A 3F9HA 5DGJA 4AX9H 1GI8B 4TY7A 1HJ9A 1TNLA 1O3MA 1LVYA 5T6DA 3ZZ9A 1GMDF 5A0AE 1ZRKA 1E35B 4IMZA 3ZZ4A 3MNSA 3BTKE 2BLVA 2A4OA 6GCHF 1O3BA 5JBCS 1D3DB 1Z6JH 1NZQH 1XUIA 5AHGH 4DGJA 3ITIA 1LPGB 1EATA 3V7TA 5LGOA 3SNBA 1SGTA 4Z0KA 2Y80A 4KELA 1GBCA 1GHZA 2BD9A 3SI3H 1C2LA 4XBDA 2BD2A 4K1EA 1V3XA 2ILNA 2J38A 2ZGXH 4NIVA 1GDQA 4ASHA 3TLOA 4E05H 1D6RA 3UWIA 2GZ8A 1XKBC 3MNXA 3K2UA 2FX6A 1AD8H 1IQGA 3QN7A 3TGKE 2Z3CA 1EPTA 2CF8H 5FX5A 3RXQA 1O34A 2ZC9H 1LPZB 4B1TA 2PV9B 4DJZB 2WV4A 1ZHMA 1O2HA 2WYGA 1TGBA 1TNKA 1MZAA 3TK9A 2A45B 1AUJA 3R3GB 1TRMA 1V2MT 4Q7ZA 1N6XA 1Y3YA 2WPLS 4BAHB 2P8OB 1ELDE 1O3GA 3SO3A 2WPIS 5FCKA 1YPJH 2ZPRA 3QGJA 2EEKA 3OTJE 4FVBA 3A87A 2BB4A 2OC7A 2BD4A 1O32A 1KDQA 1RTLA 1A3EH 4DOQA 1SOTA 2ZFSA 1OS8A 3RLYH 3MMGA 5T3HA 5K7RA 1O0DH 5EXNA 1O37A 1CU1A 3STIA 1QTFA 7LPRA 1NFYA 1GDUA 3PM3A 2FOFA 4ISNA 3A88A 3FANA 1CBWB 4K69A 3RMNH 3ZVBA 1FNIA 2VWLA 1P57B 2BQWB 3ENSB 1MH0A 5DKMA 3S7HB 1C1OA 1MTNC 1KY9A 2FWWA 2R3UA 2ANMH 2OTVA 4CR5A 4SGAE 1WOFA 2G00A 1K28D 1HRTH 1GI0A 5GNDA 4WWYA 4AGJA 1FMGA 1HAOH 5DP3A 1TQ7B 8GCHG 1LCYA 1L1NA 3H7TA 1IQHA 1J14A 1ZTLA 3BG8A 5FPTA 1Q2WA 1VITG 2VIQA 2ZU3A 1QJ7B 3SHAH 4I32A 1D3TB 2QIQA 3Q3YA 2ZQ1A 3SNDA 3V12A 4K2YA 4Y0YE 3OU0A 3M3VA 2FI3E 4YT6H 1O2LA 1A5IA 1TIOA 3GDUA 1W13U 3M61U 4CRDA 1QB1A 3O8CA 1WYKA 2CXVA 3NZIA 6CHAB 1O3CA 4B6EA 3RXKA 3GDSA 5HGGA 1P03A 3SV7A 1OYQA 7ESTE 5L30H 1ZRBA 3QTVH 1KXAA 4MG3A 4E7NA 2ZHQH 1HJAB 3QTOH 2F9VA 1O3EA 3A82A 4FUCA 2BLOA 1EZXC 2A5AA 1C1MA 1OWKA 2TIOA 2P3FH 4NWLA 2WV5A 3GYMA 1Y3VA 1NRPH 1C2HA 1G3BA 3SGQE 1O3JA 2V3OH 1MCVA 2Z3DA 2NU1E 4NWKA 5EXLA 4D76A 3KL6A 1O2QA 3HKIB 3JZ1B 1IAUA 2VGCB 2NU0E 1G2LA 5TCCA 1J8AA 4AOQA 5HM9A 4Y79A 4BAOB 2R0LA 2XW9A 4UONA 1GBMA 1EB2A 2P8OC 1H8IH 2OK5A 2RCEA 1EP5A 3SU0A 3FZZA 4IBLH 2AMDA 4JZEH 1DOJA 1F0SA 1TPOA 3GY7A 3MH4A 1LPKB 1UHBA 1ZYOA 2ESTE 1VJAU 4D7GA 3BTWE 3MOCA 1C1PA 1CHOG 1NPMA 4GLYA 2PKAA 2H5CA 3LKWA 3U9AH 2OC0A 1NN6A 1CBWC 1TBZH 3AAVA 1D4PB 2I6SA 2OD3B 4CRFA 1H4WA 3RU4T 4DIIH 1Z8GA 2Z9GA 2VVCA 4Q7XA 2O8MA 2G8TA 1D3PB 4Q80A 3VEQB 5GJ4B 2FOBA 1ARBA 1LHDH 4NIXA 1O2OA 1G36A 4NA8A 1C5RA 2QXGA 1NO9H 1RJXB 3NXPA 3QUMP 1T4UH 5L2YH 1Y3UA 1SQOA 2C93B 2K1QA 2GVFA 1ORFA 1GWAA 2KAIB 3TNTA 4CH8B 3UREA 5HYOA 1AKSA 1K22H 1XVOA 1DY8A 1BTHH 2LPRA 1EAIA 1GVZA 2PKSB 1P2NA 3MU5A 3MNCA 3U69H 5EOKA 3RXCA 1FIZA 2HPPH 3KEEA 1AMHA 3H7OA 1SR5C 1Y59T 4ABAA 3OSYA 6CHAC 1CGJE 1BRCE 1ZMNA 2VIWA 4TWYA 1HJAC 1TMUH 2STBE 5GPIB 2P16A 1FY4A 3TJOA 3Q3KA 2FX4A 1P2JA 4F49A 1XUKA 1K1LA 1CT2E 1GHBG 1ZGVA 3TU7H 1YGCH 1J16A 3LGTA 1XUFA 3U1IB 4X8UH 1KLJH 3RMMH 4NG9H 3SZEA 1HAZB 4WMFA 5JB9S 4CRCA 1VCWA 2OLGA 1P06A 1A4WH 1PPZA 4YLQH 3TGIE 1O5FH 1BRBE 4A5TS 1C5XB 2FYQA 2QGRA 2ZKSA 5F8XA 2VGCC 2HLCA 3S9BA 2ZHEH 2BDBA 3MI4A 3PLKA 1QBNA 4XBBA 3AAUA 2DUCA 2GP9B 2GT7A 3GCNA 5DJ7A 1F5LA 1V2QT 1S6HA 1BOQA 1TALA 2BY7X 1H8DH 4Y8YA 3RXIA 3AW0A 2GKVE 1IQEA 2A4GA 2EI7A 4CRGA 3HK3B 1JIRA 1F0UA 3VGCB 1HPGA 2G5NA 4NA9H 4TWWA 2I6QA 1ANCA 1W10U 1V2WT 4I8HA 4BTIB 1HAVA 2TGTA 1CSOE 1RGQA 1G30B 3RXRA 4MPWA 2ZFQH 3W94A 2Y7ZA 1TB6H 3BTME 2BD8A 3M7UA 1S0RA 1KXBA 2G4UA 2VWMA 2XBYA 2HGTH 3RC4A 3RLWH 3RXOA 1MZDA 3SV9A 1G2MA 4E7RG 3C1KA 3URCA 3N7OA 1GG6B 1G32B 1C4U2 1RS0A 3K6YA 2C8WB 5T6GA 3NKKA 3SBKA 1SG8B 1C1RA 4Y8XA 1H9IE 1AFEH 1E38B 2RDLA 4BAKB 1V2PT 1DFPA 2FS9A 2G52A 2HPQH 2AFQB 3DD2H 3E16B 2GT8A 1L1GA 2DE9A 3B8JA 1O33A 1C5SA 2XWBI 2Y81A 1V6DA 1BTXA 3FVFB 2BHGA 2DE8A 3PYHA 1V2UT 4H6TA 4YESB 4MPVA 2ZI2H 1SGDE 4O97A 1T32A 4MVNA 3CS7A 1C5NH 3F9GA 4HZHA 1P2IA 2R0KA 1CQQA 2ALVA 3GY4A 4AG1A 2FOAA 3DUXH 3ZZCA 5FHTA 1YLCA 4KP0A 1O3FA 3BF6H 2UUKB 3QK1A 3PO1B 2F83A 1P11E 4BNRA 4TPYA 1P01A 3SV2H 1O3LA 3RXSA 3BTDE 1C5YB 2PSYA 1ANEA 1PQAA 5AFZH 3M5MA 1TX7A 4UFEH 2O9QA 3ZZBA 1S5SA 5DG6A 4YOJA 1PPHE 1GJ5H 2ZNKH 2FXRA 1DS2E 3ZVDA 3P8FA 1BHXF 2EI8A 4PROA 1JXPA 1PYTC 1S82A 4ABGA 1IQNA 4JZDH 5C3NA 3M5NA 1IHSH 3A7TA 1TGNA 3VPKA 4FUEA 4A6LA 2JH0D 4I8LA 2F9BH 1E0FD 1YPKH 3PV4A 1S83A 1TPPA 2XBXA 3LPRA 1C5VA 2FTLE 4U32A 3VGCC 2GZ7A 4O9VA 4MPUA 5A0BA 1YC0A 1C5PA 2HRVA 2IPHA 3RUOA 1MKWK 1PYTD 4M7GA 5TCAA 3P95A 1DUEA 1SLXB 1T8LA 1QHRB 1C4V2 1IQFA 3MTYA 3QWCH 4FXGH 4I8KA 2J92A 2TBSA 3BN9A 4FU7A 5IYTA 3T26A 1DLKB 5JBTA 1KXEA 5E2OA 3UFAA 3P6ZB 1NFXA 5B6OA 2V3HH 3A7VA 1L4ZA 1OWEA 1GG6C 1O3KA 2BZAA 3TGJE 8KME2 1M9UA 1QB9A 4X1SU 3A86A 2RG3A 1P2KA 1GI7B 2H9TH 2PW8H 3S69A 1BTUA 3TK5A 4X2VA 1THRH 1WUNH 4YOIA 1O2ZA 1MD7A 3ESTA 2VIOA 4NGAH 5JYIA 1YCPK 9ESTA 3H09A 3I78A 1DLEA 1O3AA 3SU5A 2SGQE 1MD8A 1N8OB 1VZQH 1ZMJA 4WH6A 4B75A 4ABBA 5JBBS 1MCTA 1K9OE 3KF2A 1AU8A 4Z6AH 2XYAA 3IWMA 3PV5A 5EW2H 1OSSA 1QIXB 3BEFB 2A7JA 4ABIA 2W7SA 1Z6EA 3SI4H 3ZZ6A 3PO1C 1THSH 1RTKA 1YPHE 4TPIZ 2Z6BD 1AVXA 1AB9B 2FIRH 3P70B 4LZ4B 4ZKNU 1QA7A 4RI0A 3FP6E 4BANB 1TA6A 3Q77A 4D7FA 1ELEE 4UFGH 2A32A 1C5MD 2VWOA 1MKWH 4JYVH 1AZ8A 2HALA 5A2MH 5ABWA 1V2NT 4OGXA 1AE8H 2ZFRH 3KGPA 1SMFE 3KN2A 1SBWA 4Y10E 2C8ZB 4BXWA 1GCTB 3ZZ8A 1GMHF 2BY9X 2YOLA 2WUCA 3F9EA 4A1TA 2BLQA 2FI5E 1C9TA 3M7QA 1TQ0B 3ODFA 4IS5A 1DANH 4KTUA 1O2VA 2F9NA 3UQVA 3E91A 4RKJB 4U2WA 3D23A 4NCYA 4LOYH 3LGVA 3FFGA 1LHFH 1BTYA 2ZHWH 4GVUA 3SUDA 3SU1A 2AMQA 1CVWH 1TMTH 1EASA 5DP6A 3A8AA 1YF4A 1K21H 1YCPH 4I8GA 2WZQA 2ZHDA 2ZCHP 3F9FA 4Y11E 1GI2A 1EJMA 2PR3A 2ZHFH 3TK6A 2F91A 1CO7E 3RDZA 2ANWA 2P94A 1DWBH 4UD9H 1ETSH 1P3EA 2ZECA 4K1SA 3A7WA 4CBOA 2ANKH 4B6FA 4FUBA 1JRSA 2CN0H 2FEQH 2NU3E 4DT7B 1DSUA 2A5KA 2BQ7B 1TFXA 1GBAA 2V35A 3G01A 2Z3EA 1GBFA 4X2YA 1ELAA 2M5TA 1QQ4A 5LPRA 1YLDA 1FPCH 1OWDA 3EYDA 1C1VH 7GCHF 5EQRA 1N8OC 5AVDA 4WMEA 5FBIA 3LT3A 3ZYEA 5GWZA 1AO5A 1TGTA 1SI5H 4MNWA 1A2CH 2J94A 3H5CB 3M7TA 2B0FA 4FUGA 4JYTA 3ATWA 1AB9C 1FUJA 1O2GH 1P10A 2GCHG 3F6UH 1YCPM 1TNIA 2VU8E 4K5ZA 3S9AA 4LZ1H 1OPHB 1NFWA 1BB0B 1D3QB 3PMAB 5I46H 1IQLA 1O2XA 4ESTE 1PJPA 1WXRA 1LHEH 2VH6A 1HAHH 1YPHC 1N1LA 2C4FH 2H9HA 4LXBH 4WY3A 1KXFA 3BEIB 4FU8A 3T28A 3SYJA 4KTCA 4KGAA 1CT0E 3CENA 1GCTC 3B23B 2CF9H 4XFQA 5A8ZA 1O5DH 1KLIH 4YO9A 1B0FA 2BX3A 2Y6TA 1F92A 3LJOA 1TX8A 2QYIA 1O2MA 4R0IA 1LQDB 3OYPA 1Z8JB 1ELGA 1DSTA 1EXFA 1JOUB 2ZGHA 4B74A 1ZSJA 3LONA 4B73A 1IQJA 3F68H 1MTVA 3BEUA 2F4LA 4UFFH 1MAYA 1P05A 3E90B 1ZPBA 1SGNE 2HVXA 4RN6A 5H4IB 3MU0A 3NPSA 4RKOB 4B2CA 5A0CA 1GMCF 1XKAC 4JK5A 2QN5T 4ZMAH 2BDGA 1TABE 2D8WA 2C3SA 3V3MA 1O30A 5E8EH 2Z9LA 2AGGX 1GJ9B 1BUIA 1JIMA 3PV2A 1GHAF 3UOUA 1MU8B 3VXFH 3UNSA 1G37A 4WMDA 4D9QA 2OQ5A 1CA8B 2VIPA 1O2SA 3MO9A 1AY6H 1G3CA 2ZDVH 4JK6A 3RM2H 1TWXB 3QGNB 5EODA 1WSSH 2QXIA 1TMBH 1BIOA 4A92A 4OS2A 1CGIE 5TJXA 1FI8A 5LPFA 1TAWA 5C1YA 1ZTKA 2EC9H 3HK6B 1UTMA 4GCHF 1L1JA 5CMXH 2SGPE 1EZQA 1O36A 2O8LA 2AGIX 1ABJH 4AFUA 2D2DA 1A61H 4FUHA 4E06H 1SGRE 4MLFB 1VR1H 2BVXH 1WQVH 3DHKH 1HB0B 1K1NA 4X0WU 3Q3XA 2PFEA 4MDSA 3M3SA 4A7IB 1VCQA 5HMAA 2G51A 3MNBA 3QDZB 3SUFA 1FY3A 2A4QA 4UEHH 1KDQB 3A7YA 1W8BH 2V6NA 4VGCB 3E3TA 1NESE 2O8WA 1QRXA 2VNTA 3TJNA 1S6FA 2CHAB 2D1JA 5F6MA 2H6MA 1UTOA 2STAE 1ZJKA 2XWAA 2BD7A 1HV7A 2PUQH 3CP7A 3HGNA 1EAXA 4JZFH 1F5KU 1OP2A 4WJG2 2FODA 2OXSA 5FPYA 1C5TA 2H1UA 4AB8A 1UO6A 1BHXB 1BTWA 1XXFA 1P12E 1ELTA 3E1XB 3A81A 2IJD1 4OS7A 1QB6A 3RXTA 3RXMA 3D49H 3L33A 2TGDA 5FX6A 1GJ4H 4F4OC 1V2ST 3KQCA 2VVUA 1BCUH 2HOBA 2GCTB 3UOPA 3QX5H 1ELFA 1QL9A 3DFLA 3ZZ7A 1SQTA 3VB6A 3GISB 2R2MB 1O2TA 5DP4A 2TRMA 1T4VH 2OUAA 1NRQH 1GI1A 1ZGIA 1HXEH 3URDA 2P3UB 3ZZDA 1OP8A 3GY6A 1HNEE 1QCPA 2GX4A 1AIXH 1C5ZB 1HGTH 3QLPH 1SLWB 1HLTH 3RXDA 1EAUA 1OWIA 2A4RA 5J4QA 3P8NA 2Z7FE 2HWLB 3TPIZ 3B9FH 3T5FH 1C9PA 3EGKH 4ZXXH 1JWTA 3EAJA 4Q7YA 2SGEE 4Y8ZA 4XBCA 1C2DA 1F0RA 1F0TA 4X8TH 1O5AB 5AFYH 1V2OT 3O8RA 1FPHH 2HNTF 2TGAA 1QGFA 4AORA 5T6FA 2ZP0H 3LJJA 1FY1A 1O2NA 3GCTF 3QO6A 4BOHA 1ZHPA 2ZDMA 4IMQA 2Y5FA 1AE5A 1Y5AT 5LPEA 1QQUA 4NSYA 3LOXA 4R8TB 1F2SE 1GI6A 4DY7B 1O39A 3BTEE 4AFQA 2Q6DA 4INLA 2G4TA 1NRRH 1CT4E 1O5BB 1P2QA 2OP9A 5C67A 5DP8A 1ACBE 1AI8H 2WPHS 4X6MA 1UHBB 2BY8X 1UTNA 1Y3WA 2Y5HA 3ZZ3A 1EUFA 1FJSA 1LKAA 2CHAC 2YNAA 1QL7A 2ZCLP 3LC3A 1EJNA 4GHQA 4O3UA 1O2UA 1DWDH 2PKAB 3FAOA 2V0BA 1T7CA 2LNCA 2WINI 5L2ZH 3A85A 1KTTB 3AK5A 1ABIH 3EDXB 5EQSA 4UFDH 1TX6A 2XRCA 3MO6A 3SU4A 1LVOA 1GVKB 1PQ8A 1LO6A 3SUGA 1GJDB 1V2LT 1GMHG 2AEIH 2A7HA 3RXVA 4BTTB 2VVVA 2XC5A 4CHAB 3SNEA 2BDYA 2R9PA 1ELBA 2THFB 3FP7E 1UJ1A 1WV7H 3MH7A 2ZDKA 3LGIA 2ZU5A 1U6QA 1GHWH 2ODYB 1L2EA 1EKBB 2SFAA 2GCTC 1GI3A 1H1BA 5E0HA 2BMGB 3T25A 1IQIA 3ZVCA 1VITF 1C5WB 5ETXA 1AKSB 3RXAA 1O5GH 1GBHA 3I77A 4Y76A 3UR6A 2PKSC 1EZSC 3LDXH 1XMNB 4X8SH 2A7CA 2F9PA 2PTNA 1C1NA 3SV8A 2NWNA 1ETRH 5C5NA 1FN8A 1QR3E 4AGKA 2TGPZ 1GMDG 2VJ1A 2A2XH 1F5RA 3O8DA 6GCHG 1BMMH 2JETB 2GV7A 1AGJA 3ODDA 2BDAA 2BDHA 2FDAA 1BMLA 1QL8A 3BIVH 1ELVA 4UDWH 1QJ1B 1C2JA 1UVPA 1ZMLA 3AVZA 1YPMH 2ZDNA 1ETTH 2FTMA 2UUFB 1YPGH 4J1YA 4ZHAA 3Q76A 1D6WA 3A84A 3ATLA 2ZFFH 5EG4A 1W11U 4YOGA 3E8LA 3DFJA 3TH2H 3AASA 1UTLM 2PUXB 1TLDA 2WV9A 1GJBB 2CV3A 1EJAA 1Z1JA 2BXUH 4ZKSU 3M36A 2H9EH 4CRAA 5C2ZA 3VXEH 1SB1H 1ANBA 1O3OA 4M9FA 3TVJB 2AS9A 1BRAA 3HKJB 2GD4B 2EI6A 2PTCE 1Y8TA 3E0NB 2JH5D 1CGHA 3HPTB 1IHTH 4ZUHA 1TOMH 4MPXA 1GHVH 1AVWA 1GI5A 1FLEE 1PPFE 2GDDA 1W14U 1FY5A 2SGDE 1GJ8B 1SGYE 1K1JA 3KQBA 5EPNA 4NZLA 1BBRK 4FVDA 1O3HA 2OBOA 4FUIA 5G4BA 1HAVB 3RXGA 3OTPA 3GYLB 2AYWA 3ZZAA 5C5OA 1SHYA 3BV9B 3MWIU 3SJOA 1XUGA 3EQ0H 4CHAC 3ZYDA 2QF0A 2A0QB 1HIAA 4TYDA 2W3KA 2AGEX 2QAAA 1INCA 1KXCA 3GY8A 3UPEA 2ZA5A 2FP7B 1LTOA 1UTJA 4MQAA 4K8YA 1YPEH 2C90B 3NK8A 2P93A 3RXHA 1C1UH 1ZSKA 1UTKA 4NIWA 1OKXA 2RA0A 3A89A 4BTUB 1PPGE 4X6NA 1DDJA 5EU8A 4RSPA 4INKA 5FCRA 1GJ6A 4GAWA 3SNAA 4X8VH 1GL1A 2OBQA 3HATH 1FXYA 4ISIH 1GL0E 1B7XB 2Y5GA 3T62A 2GV6A 2JETC 3P17H 1J17T 1HAYB 3O8BA 4Q2KA 3PLPA 1HAGE 2B7DH 2OCVB 4JZ1A 2NU4E 2ALPA 1A5GH 3MU4A 1P0SH 4Y71A 2PGQB 1SGQE 3ATKA 4NZQA 3LC5A 2FESH 5GXPA 3S9CA 1UCYE 1Z7KA 2H2ZA 1PFXC 1PQ7A 4MNYA 2YNBA 5E2PA 3U8RH 4YZUA 2XC0A 3K6ZA 1BBRH 4GCHG 4X1NU 2XXLA 1QURH 2Z9IA 1P3CA 1GGDB 1P2OA 1DVAH 3SV6A 3QZQA 1FQ3A 2BYAX 3A8CA 1A3BH 4OGYA 2XTTB 5F8ZA 1BITA 4OS4A 1BTZA 2UUYA 3GCHB 2BDCA 8LPRA 1KIGH 1MBQA 2UWLA 1MUEB 2A31A 3PTBA 1O2PA 3LGYA 3EA9A 3FZDA 1YP9A 1V2KT 4ABEA 4K60A 2A5IA 3HGPA 3SQHE 1GBIA 2FLBH 1ARCA 2B9LA 1TGSZ 5C1UA 3SOSA 3ZVFA 3SW2B 1SQAA 3SU3A 2BTCE 1O3DA 4BXSA 3S0NA 1GPZA 1QNJA 2P95A 2W26A 4NA7A 3IITA 2ODPA 3MO3A 4KTSA 1FV9A 4THNH 1XM1A 3TNSA 4OS5A 2BOKA 1MTNB 4DCDA 4OS6A 3UWJH 2FI4E 3AW1A 1FDPA 2ZDLA 5A8YA 4H42U 1KLTA 5B6LA 3BTQE 4X2XA 1TOCB 2RA3A 2WPJS 1HYLA 1TNJA 3MYWA 2AERH 3ZV8A 1BRUP 1RXPA 4IGDA 1EQ9A 4DG4A 1YM0A 3L3TA 1SHHB 4ZHLU 3RU4D 1OXGA 1K2I1 1MKXK 1SGPE 1VCPA 2A2QH 2GTBA 1A0LA 3IG6B 4K8BA 4WVPE 3RXLA 4CH2B 3P8OA 1GI4A 1TRYA 2FOMB 3ZVEA 1UMAH 3ATIA 3F1SB 1UVTH 3A80A 5DK1A 1L0ZA 2Z94A 2HNTE 4ABDA 3BTTE 2C8YB 2B5TB 5EW1H 2ZZUH 3UTUH 2QXHA 2UUJB 3SJ9A 2ZU1A 3SJKA 4I8JA 4ZXYH 2BQ6B 3SU6A 3PMHB 2QCYA 4ISLA 4DIHH 3OY5U 1TNGA 1SGEE 2D26C 1TPAE 1GGDC 4IN1A 1QRZA 3GCTG 3RXFA 1LMWB 4GUXA 2SGAA 4B2BA 3RMOH 3GCHC 2F9UA 1OOKB 2BD5A 5HXFA 3GCOA 1O2WA 3EE0B 4AFSA 1OX1A 3KCGH 3KHVA 4X6PA 2ANYA 1OP0A 4A1XA 3SNCA 4FUJA 1L4DA 1O3NA 2TPIZ 3LIWA 1G3EA 2P3TB 1BZXE 5FXLA 1JMOH 1LQEA 1AQ7A 1CA0B 1ESTA 2BVSH 6LPRA 1RIWB 2QXJA 2PWXA 1SGCA 1SGFG 1BMAA 3Q00A 4XE4A 4B76A 2PSXA 5BPEA 4ABJA 3TJUA 5L6NH 1Z71A 3UR9A 1SL3A 4XDEA 4AYYB 1WAYB 4I33A 1V2VT 1MKXH 2ZPSA 4YT7H 3A7XA 1ZLRA 2BDIA 3UNRA 3BIUH 4OM9A 1C4Y2 4YM9A 3RXEA 2ZTXA 5JB8S 1A0HB 2AH4X 1QRWA 2ZPQA 3UY9A 1EB1H 1Y5UT 2WPKS 1OYTH 1Q31A 5T1VA 4NFEA 4AG2A 1NRNH 5HM2A 2PLXA 1LVBA 5DPAA 2WYJA 4HFPB 1QJ6B 1GJCB 1W3CA 1NTPA 3PWBA 2KAIA 4KKDA 3SGAE 2F9OA 1GCDA 4UE7H 1HAIH 1DITH 1ZTJA 3D65E 2AIPA 3DT0H 1BQYA 4YLUA 2ZCKP 2ZGCA 5DP5A 8ESTE 1QBVH 2Q6GA 1NS3A 2VBCA 1EPTB 1PPEE 1TA2A 1ZPCA 2BLWA 3RC5A 1BT7A 3ZZ5A 1GBLA 1P9UA 1UCYK 3UIRA 5DO4H 3W95A 1RTFB 5CE1A 3LH3A 1NM6A 1J9CH 1EOLA 1UVUH 1Z8IB 1TRNA 5A09A 1Y3XA 2PHBA 2G5VA 4O03A 4U30A 2QC2A 1G9IE 1YKTA 3VB4A 2QY0B 2FS8A 1H9HE 1C2IA 1YPLH 2XNIA 1NC6A 5EGMA 1OWHA 4WH8A 6ESTA 3P8GA 3PROA 5GCHF 2IN2A 1TNHA 2HNTC 1GJ7B 1XVMA 1DE7H 1KSNA 3ZVGA 1O2YA 5DP9A 1EX3A 5IDKA 1GJAB 1XXDA 2VINA 3TITA 1EP6A 1O3IA 1TBQH 4SGBE 5JDUB 1S81A 3E6PH 2ODQA 1C2KA 1V2TT 3JZ2B 4BAMB 1P09A 1E37B 1NFUA 1MQ5A 4D9RA 1UK4A 2BY6X 2FOHA 1IQKA 1BBRE 2OQUA 4GSOA 2FYRA 1K1OA 1CA0C 3D62A 1LHCH 1RIWC 4HGCA 1ZPZA 1G3DA 1C5QA 2NU2E 2ZG0H 2QF3A 2UWOA 2XC4A 3FP8E 3L6PA 1EAWA 2J34A 2W7UA 1IQMA 1WQSA 1LDTT 1K1PA 2J2UA 1H9LB 1XX9A 1UK2A 2B8OH 3PB1E 1AFQB 1VJ9U 3TH4H 2CMYA 5E0JA 1TGCA 2CGAA 4H6SB 3K65B 1AVGH 1T8OA 3KIDU 3MH5A 1J15A 5FPSA 4ABHA 4ZKRU 1C5UA 1E34B 1VGCB 2VB0A 4X2WA 4AFZA 3PMBB 4DURA 5A8XA 3VB7A 1DXPA 1MTSA 1MBMA 1BJUA 5CHAB 3RM0H 1FZZA 1UCYH 3MU8A 4Y7BA 4ZAEA 1IOEA 3GDVA 5J4SA 2W5EA 4ABFA 2XBVA 3VB3A 2ZTZA 4IC5A 4QT8C 1DT2A 4DW2U 1B5GH 4K1TA 3LGUA 1TYNA 4X6OA 2ZFTA 2H5DA 5GIBA 2XBWA 1P2MA 4J2YB 3T2NA 1C5OH 3E0PB 3LU9B 2OC8A 1Y5BT 1DX5M 1C5LH 1EPTC 4I31A 2AIQA 5C20A 4GHTA 5FAHA 1HJ8A 3PMJA 1DUAA 1O31A 1BDAA 4Y6DA 4YTAA 1MTWA 1DY9A 1FY8E 2GCHF 3A8DA 1DWCH 3GY5A 1F7ZA 1Z1IA 4LK4A 2O8UA 1S84A 2ZO3H 2ZEBA 1FIWA 2VIVA 1C1TA 3M35A 2AMPA 1BA8B 1ESBA 4VGCC 1LVMA 1KYNA 1GVLA 2WPMS 1O2IA 5E0GA 1DM4B 1SSXA 1NU9A 1A7SA 1NU7B 2VH0A 1C2MA 4IC6A 3GICB 3RXUA 2BX4A 2FOCA 4MNXA 2FM2A 3EA8A 3PLBA 5I25A 1AWFH 3BTGE 4X1PU 3SJIA 2G81E 5BRRE 4AN7A 5EQQA 1XUJA 3RXJA 3KNXA 5F03A 4WXIA 1TPSA 1W7GH 3GY2A 3NWUA 1C2GA 1THPB 2JKHA 1SFQB 1A5HA 2QV1A 4ISOA 1ZOMA 4AZ2B 3BTFE 1HAXB 1CE5A 3SU2A 3ZVAA 3SJ8A 1WBGB 1T8MA 3V0XA 1DXWA 3SZNA 1AFQC 3PTNA 4ZROA 1S0QA 2ZGJA 8GCHF 4U01A 3U8TH 4H4FA 2XCNA 3ATMA 3T27A 2W3IA 1RRKA 1P02A 1O38A 1NY22 3C27B 1EOJA 4CR9A 1VGCC 4NFFA 1P04A 5AF9H 1X7AC 5CHAC 1XUHA 2WUBA 3I29A 1W0ZU 1TONA 2ZGBH 3OX7U 9LPRA 5DP7A 3PWCA 1AZZA 2VIDA 3RXBA 1K1IA 3EA7A 4B2AA 1ZHRA 2Z9JA 1GHYH 3SUEA 1C2FA 1SLVB 3BSQA 2Q1JA 2Y7XA 2EA3A 5ESTE 1TBRH 1GBKA 3R0FA 3TJVA 2BXTH 1SVPA 2J95A 2XCFA 3SN8A 2BVRH 4K3JA 1FONA 3GOVB 3SHCH 1HXFH 4GPGA 2R3YA 7GCHG 4HTCH 1O35A 1ZSLA 3UNQA 1QY6A 3RC6A 4AB9A 2GZ9A 1B0EA 1FAXA 4ZKOU 2GMTB 2G55A 3BG4B 5C1XA 5JBAS 2ZU2A 1YBWA 4WF8A 1MAXA 2ZTYA 4TY6A 2FOGA 1QA0A 1JRTA 1GBBA 1C2EA 2FMJA 1SFIA 2C8XB 4JYUH 1SPJA 3P92A 4XSKU 1A46H 1ZJDA 1BMNH 2OINA 1GHXH 3V13A 1HUTH 3TIUA 3M37A 1AWHB 1DPOA 3OY6U 1VITH 1CHOF 3M3TA 2ZQ2A 1LKBA 1W7XH 2IJOB 2OC1A 1A1RA 1RD3B 3RU4E 4HI3A 4FUFA 2BD3A 1O2RA 1O3PB 4IN2A 2ZWLH 1ESAA 7KMEH 1WTGH 2VWNA 1WU1A 2FO9A 4XOJA 1GBTA 3S7KB 3SQEE 4ZHMU 1W0YH 1V2JT 1BJVA 1RFNA 1C1SA 2FPZA 4CREA 1S85A 2PGBB 1P8VC 3LH1A 4X1RU 3RXPA 1BTPA 4DVAU 2GDEH 3SGBE 2Y82A 5ESBA 1O5EH 5PTPA 3DA9B 3CS0A 2Z9KA 2SGFE 1C1WH 1V2RT 3U1JB 4IW4E 2JH6D 1HBTH 1GBJA 4ISHH 1W12U 3BTHE 1DWEH 3TH3H 2ZIQH 1ELCA 4D8NA 1NRSH 1A0JA 1E36B 4Y7AA 3STJA 2FZZA 1HCGA 1O2KA 1D9IA 2J4IA 3KQEA 3UUZA 1JBUH 4CBNA 1GMCG 4OS1A 1NT1A 1YYY1 2UWPA
chains in the Genus database with same CATH superfamily
1MTUA 4JZIA 4JCNA 4I7YH 4RT0A 1TE0A 1UTPA 4Y0ZE 1KMHB 2SNVA 1QBOA 3VFEA 1MU6B 1GHAG 3NCLA 2ZFPH 2BM2A 1Z8RA 4JMYA 3T29A 1GHBF 5CHBA 4BAQB 5SGAE 1ZZZA 4NSVA 1SC8U 3ZV9A 1C1QA 1KXDA 2SNWA 4NIYA 3K9XB 3MFJA 5F8TA 1K1MA 1LHGH 2BZ6H 3RP2A 2FLRH 3KQDA 1HDTH 2GMTC 3BG4C 3W1EA 1OWJA 4TT3D 2IOTA 1CHGA 1N6YA 1PPBH 1HFDA 2ZU4A 3MU1A 4ZH8A 5JPMH 1ID5H 3M5OA 2O8TA 1PPCE 2GGVB 1E79D 1KTSB 4X1QU 3MHWU 4INHA 3MH6A 4FUDA 2J9NA 5EXMA 2CJIA 1GBDA 1AUTC 5EPYA 3DSPA 1W2KH 2ULLA 5GDSH 2ASUB 5GCHG 2WHXA 3LGWA 5K0HA 3VB5A 1T8NA 3FO8D 4WXVA 3A7ZA 3U98H 2KCYA 1WCZA 2P59A 1UVOA 1PQ5A 4MNVA 4A1VA 3A8BA 1SLUB 1SGIB 1O2JA 3SORA 1P9SA 1QFKH 1ZR0A 4CRBA 1T31A 3ELAH 2R2WU 1SOZA 2ZF0H 4FU9A 5FBEA 1NROH 1FN6A 1GI9B 1AHTH 2YMSD 1UK3A 3GY3A 3OAAD 1WTHD 1FAKH 3RMLH 1HIAB 3QZRA 2QA9E 1GBEA 1EZUC 1MQ6A 1UTQA 3U8OH 4AYVB 1MMJN 2F3CE 3M5LA 2A1DB 4B71A 1AN1E 3UQOA 2BOHB 1ANDA 1UVSH 1HAPH 2Q6FA 1Q3XA 1EFRD 2ZDAH 3WY8A 1DICA 1GDNA 2BY5X 5LH8A 4O3TA 1SGFA 2FOEA 4MTBA 1O5CB 3F0PA 3NUMA 3A83A 3F9HA 5DGJA 4AX9H 1GI8B 4TY7A 1HJ9A 1TNLA 1O3MA 1LVYA 5T6DA 3ZZ9A 1GMDF 5A0AE 1ZRKA 1E35B 4IMZA 3ZZ4A 3MNSA 3BTKE 2BLVA 2A4OA 6GCHF 1O3BA 5JBCS 1D3DB 1Z6JH 1NZQH 1XUIA 5AHGH 4DGJA 3ITIA 1LPGB 1EATA 3V7TA 5LGOA 3SNBA 2LELA 1SGTA 4Z0KA 2Y80A 4KELA 1GBCA 1GHZA 2BD9A 3SI3H 1C2LA 4XBDA 2BD2A 4K1EA 1V3XA 2ILNA 4Z1MD 2J38A 2ZGXH 4NIVA 1GDQA 4ASHA 3TLOA 4E05H 1D6RA 2XOKD 3UWIA 2GZ8A 1XKBC 3MNXA 3K2UA 2FX6A 1AD8H 1IQGA 3QN7A 3TGKE 4FOUC 2Z3CA 1EPTA 2CF8H 5FX5A 5HIZA 3RXQA 1O34A 2ZC9H 1LPZB 4B1TA 2PV9B 3F3BA 4DJZB 2WV4A 1ZHMA 1O2HA 2WYGA 1TGBA 1TNKA 1MZAA 3TK9A 2A45B 1AUJA 3R3GB 1TRMA 1V2MT 4Q7ZA 1N6XA 1Y3YA 2WPLS 4BAHB 2P8OB 1ELDE 1O3GA 3SO3A 2WPIS 5FCKA 1YPJH 2ZPRA 3QGJA 2EEKA 3OTJE 4FVBA 3A87A 2BB4A 2OC7A 2BD4A 1O32A 1KDQA 1RTLA 1A3EH 4DOQA 1SOTA 2ZFSA 1OS8A 3RLYH 3MMGA 5T3HA 5K7RA 1O0DH 5EXNA 1O37A 1CU1A 2KFWA 3STIA 1QTFA 7LPRA 1NFYA 1GDUA 3PM3A 2FOFA 4ISNA 3A88A 3FANA 1CBWB 4K69A 3RMNH 3ZVBA 1FNIA 2VWLA 1P57B 2BQWB 3ENSB 1H8ED 1MH0A 5DKMA 3S7HB 1C1OA 1MTNC 1KY9A 2FWWA 2R3UA 2ANMH 2OTVA 4CR5A 4SGAE 1WOFA 2G00A 1K28D 1HRTH 1GI0A 5GNDA 4WWYA 4AGJA 1FMGA 1HAOH 5DP3A 1TQ7B 5CDFE 8GCHG 1LCYA 1L1NA 3H7TA 1IQHA 1J14A 1ZTLA 3BG8A 5FPTA 1Q2WA 1VITG 2VIQA 2ZU3A 1QJ7B 3SHAH 4I32A 1D3TB 2QIQA 3PRDA 3Q3YA 2ZQ1A 3SNDA 3V12A 4K2YA 4Y0YE 3OU0A 3M3VA 2FI3E 4YT6H 1O2LA 1A5IA 1TIOA 3GDUA 1W13U 3M61U 4CRDA 1QB1A 3O8CA 1WYKA 2CXVA 3NZIA 6CHAB 1O3CA 4B6EA 3RXKA 3GDSA 5HIYA 5HGGA 1P03A 3SV7A 1OYQA 7ESTE 5L30H 1ZRBA 3QTVH 1KXAA 4MG3A 4E7NA 2ZHQH 1HJAB 3QTOH 3CNRA 2F9VA 1O3EA 3A82A 4FUCA 2BLOA 1EZXC 2A5AA 1C1MA 1OWKA 2TIOA 2P3FH 4NWLA 2WV5A 3GYMA 1Y3VA 1NRPH 1C2HA 1G3BA 3SGQE 1O3JA 2V3OH 1MCVA 2Z3DA 2NU1E 4NWKA 5EXLA 4D76A 2WPDD 3KL6A 1O2QA 3HKIB 3JZ1B 1IAUA 2VGCB 2NU0E 1G2LA 5TCCA 1J8AA 4AOQA 5HM9A 4Y79A 4BAOB 2R0LA 2XW9A 3OEED 4UONA 1GBMA 1EB2A 2P8OC 1H8IH 2OK5A 2RCEA 1EP5A 3SU0A 3FZZA 4IBLH 2AMDA 4JZEH 3DSOA 1DOJA 1F0SA 1TPOA 3GY7A 3MH4A 1LPKB 1UHBA 1ZYOA 2ESTE 1VJAU 4D7GA 3BTWE 3MOCA 1C1PA 1CHOG 1NPMA 4GLYA 2PKAA 2H5CA 3LKWA 3U9AH 2OC0A 1NN6A 1CBWC 1TBZH 3AAVA 1D4PB 2I6SA 2OD3B 4CRFA 1H4WA 3RU4T 4DIIH 1Z8GA 2Z9GA 2VVCA 4Q7XA 2O8MA 2G8TA 1D3PB 3N7EA 4Q80A 3VEQB 5GJ4B 2FOBA 1ARBA 2J98B 1LHDH 4NIXA 1O2OA 1G36A 4NA8A 1C5RA 2QXGA 4I86A 1NO9H 1RJXB 3NXPA 3QUMP 1T4UH 5L2YH 1Y3UA 1SQOA 2C93B 2K1QA 2GVFA 1ORFA 1GWAA 2KAIB 3TNTA 4CH8B 3UREA 5HYOA 1AKSA 1K22H 1XVOA 1DY8A 1BTHH 2LPRA 1EAIA 1GVZA 2PKSB 1P2NA 3MU5A 3MNCA 3U69H 5EOKA 3RXCA 1FIZA 2HPPH 3KEEA 1AMHA 3H7OA 1SR5C 1Y59T 4ABAA 3OSYA 6CHAC 1CGJE 1BRCE 1ZMNA 2VIWA 4TWYA 1HJAC 1TMUH 2STBE 5GPIB 2P16A 1FY4A 3TJOA 3Q3KA 2FX4A 1P2JA 4F49A 1XUKA 1K1LA 1CT2E 1GHBG 1ZGVA 3TU7H 1YGCH 1J16A 3LGTA 1XUFA 3U1IB 4X8UH 1KLJH 3RMMH 4NG9H 3SZEA 1HAZB 4WMFA 5JB9S 4CRCA 1VCWA 2OLGA 1P06A 1A4WH 1PPZA 4YLQH 3TGIE 1O5FH 1BRBE 4A5TS 1C5XB 2FYQA 2QGRA 2ZKSA 5F8XA 2VGCC 2HLCA 3S9BA 2ZHEH 2BDBA 3MI4A 3PLKA 1QBNA 4XBBA 1H8HD 3AAUA 2DUCA 2GP9B 2GT7A 3GCNA 5DJ7A 1F5LA 1V2QT 1S6HA 1BOQA 1TALA 2BY7X 1H8DH 4Y8YA 3RXIA 3AW0A 2GKVE 1IQEA 2A4GA 2EI7A 4CRGA 2LP6A 3HK3B 1JIRA 1F0UA 3VGCB 1HPGA 2G5NA 4NA9H 4TWWA 2I6QA 1ANCA 1W10U 1V2WT 4I8HA 4BTIB 1HAVA 2TGTA 1CSOE 1RGQA 1G30B 3RXRA 5EJZA 4MPWA 2ZFQH 3W94A 2Y7ZA 1TB6H 1SQRA 3BTME 2BD8A 3M7UA 1S0RA 1KXBA 2G4UA 2VWMA 2XBYA 2HGTH 3RC4A 4TSFD 3RLWH 3RXOA 1MZDA 3SV9A 1G2MA 4E7RG 3C1KA 3URCA 3N7OA 1GG6B 1G32B 1C4U2 1RS0A 3K6YA 2C8WB 5T6GA 3NKKA 3SBKA 1SG8B 1C1RA 4Y8XA 1H9IE 1AFEH 1E38B 2RDLA 4BAKB 1V2PT 1DFPA 2FS9A 2G52A 2HPQH 2AFQB 3DD2H 3E16B 2GT8A 1L1GA 2DE9A 3B8JA 1OHHD 1O33A 1C5SA 2XWBI 2Y81A 1V6DA 1BTXA 3FVFB 2BHGA 2DE8A 3PYHA 1V2UT 4H6TA 4YESB 4MPVA 1COWD 2ZI2H 1SGDE 4O97A 1T32A 4MVNA 3CS7A 1C5NH 3F9GA 4HZHA 1E1RD 1P2IA 2R0KA 1CQQA 2ALVA 3GY4A 4AG1A 2FOAA 3DUXH 3ZZCA 5FHTA 1YLCA 4KP0A 1O3FA 3BF6H 3FN8A 2UUKB 3QK1A 3PO1B 2F83A 1P11E 4BNRA 4TPYA 1P01A 3SV2H 1O3LA 3RXSA 3BTDE 1C5YB 2PSYA 1ANEA 1PQAA 5AFZH 3M5MA 2YMSB 1TX7A 4UFEH 2O9QA 4P00A 3ZZBA 1S5SA 5DG6A 4YOJA 1PPHE 1GJ5H 2ZNKH 3WW7A 2FXRA 1DS2E 3ZVDA 3P8FA 3GS9A 1BHXF 2EI8A 4PROA 1JXPA 1PYTC 1S82A 4ABGA 1IQNA 4JZDH 5C3NA 3M5NA 1IHSH 3A7TA 1TGNA 3VPKA 4FUEA 4A6LA 2JH0D 4I8LA 2F9BH 1E0FD 1YPKH 3PV4A 1S83A 1TPPA 2XBXA 2J97A 3LPRA 1C5VA 2FTLE 4U32A 3VGCC 2GZ7A 4O9VA 4MPUA 5A0BA 1YC0A 1C5PA 2HRVA 2IPHA 3RUOA 1MKWK 1PYTD 4M7GA 5TCAA 3P95A 1DUEA 3KQ5A 1SLXB 1T8LA 1W0KD 1QHRB 1C4V2 1IQFA 3MTYA 3QWCH 4FXGH 4I8KA 2J92A 2TBSA 3BN9A 4FU7A 5IYTA 4HG6A 3T26A 1DLKB 5JBTA 1KXEA 5E2OA 3UFAA 3P6ZB 1NFXA 5B6OA 2V3HH 3A7VA 1L4ZA 1OWEA 1GG6C 1O3KA 2BZAA 3TGJE 8KME2 1M9UA 1QB9A 4X1SU 2M2AA 5C0TA 3A86A 2RG3A 1P2KA 1GI7B 2H9TH 2PW8H 3S69A 1BTUA 3TK5A 4X2VA 1THRH 1WUNH 4YOIA 1O2ZA 1MD7A 3ESTA 2VIOA 4NGAH 5JYIA 1YCPK 9ESTA 3H09A 3I78A 1DLEA 1O3AA 3SU5A 2SGQE 1MD8A 1N8OB 1VZQH 1ZMJA 4WH6A 4B75A 4ABBA 5JBBS 1MCTA 1K9OE 3KF2A 1AU8A 4Z6AH 2XYAA 3IWMA 3PV5A 5EW2H 1OSSA 1QIXB 3BEFB 2A7JA 4ABIA 2W7SA 1Z6EA 3SI4H 3ZZ6A 3PO1C 1THSH 1RTKA 1YPHE 4TPIZ 2Z6BD 1AVXA 1AB9B 2FIRH 3P70B 4LZ4B 4RI0A 1QA7A 4ZKNU 3FP6E 5DN6D 4BANB 2YMSC 1TA6A 3Q77A 4D7FA 1ELEE 4UFGH 2A32A 1C5MD 2VWOA 1MKWH 4JYVH 1AZ8A 1NBME 2HALA 2JJ2D 5A2MH 5ABWA 1V2NT 4OGXA 1AE8H 2ZFRH 3KGPA 1SMFE 3KN2A 1SBWA 4Y10E 2C8ZB 4BXWA 1GCTB 3ZZ8A 1GMHF 2BY9X 2YOLA 2WUCA 3F9EA 4A1TA 2BLQA 2FI5E 1C9TA 3M7QA 1TQ0B 3ODFA 4IS5A 1DANH 4KTUA 1O2VA 2F9NA 3UQVA 3E91A 4RKJB 3N7DA 4U2WA 3D23A 4NCYA 4LOYH 3LGVA 3FFGA 1LHFH 1BTYA 2ZHWH 4GVUA 4F55A 3SUDA 3SU1A 2AMQA 1CVWH 1TMTH 1EASA 3F2GA 5DP6A 3A8AA 1YF4A 1K21H 1YCPH 4I8GA 2WZQA 2ZHDA 2ZCHP 3F9FA 4Y11E 1GI2A 1EJMA 2PR3A 2ZHFH 3TK6A 2F91A 1CO7E 3RDZA 2ANWA 2P94A 1DWBH 3KYGA 4UD9H 1ETSH 1P3EA 2ZECA 4K1SA 3A7WA 4CBOA 2ANKH 4B6FA 4FUBA 1JRSA 2CN0H 2FEQH 4F48B 2NU3E 4DT7B 1DSUA 2A5KA 2BQ7B 1TFXA 1GBAA 2V35A 3G01A 2Z3EA 5KGOA 1GBFA 4X2YA 1ELAA 2M5TA 1QQ4A 5LPRA 1YLDA 1FPCH 1OWDA 3EYDA 1C1VH 7GCHF 3UAIC 5EQRA 1N8OC 5AVDA 4WMEA 5FBIA 3LT3A 3ZYEA 5GWZA 1AO5A 1TGTA 2KM0A 1SI5H 4MNWA 1A2CH 2J94A 1YWUA 3H5CB 3M7TA 2B0FA 4FUGA 4JYTA 3ATWA 1AB9C 1FUJA 1O2GH 1P10A 2GCHG 3F6UH 1YCPM 2JIZD 1TNIA 2VU8E 4K5ZA 3S9AA 4LZ1H 1OPHB 1NFWA 1BB0B 1D3QB 3PMAB 5I46H 1IQLA 1O2XA 2CK3D 4ESTE 1PJPA 1WXRA 1LHEH 2VH6A 1HAHH 1YPHC 1N1LA 2C4FH 2H9HA 4LXBH 4WY3A 1KXFA 3BEIB 4FU8A 3T28A 3SYJA 4KTCA 4KGAA 1CT0E 3CENA 1GCTC 3B23B 2CF9H 4XFQA 5A8ZA 1O5DH 1KLIH 4YO9A 1B0FA 2BX3A 2Y6TA 1F92A 3LJOA 1TX8A 2QYIA 1O2MA 2K0QA 4R0IA 1LQDB 3OYPA 1Z8JB 1ELGA 1DSTA 1EXFA 1JOUB 2ZGHA 3F0OA 4B74A 1ZSJA 3LONA 4B73A 1UW7A 1IQJA 2F4LA 1MTVA 3BEUA 3F68H 5F53A 4UFFH 1MAYA 1SKYE 1P05A 3E90B 1ZPBA 1SGNE 2HVXA 4RN6A 1NBMD 3WWFA 5H4IB 3MU0A 3NPSA 4RKOB 4B2CA 5A0CA 1GMCF 1XKAC 4JK5A 2QN5T 1YY3A 4ZMAH 2BDGA 1TABE 2D8WA 2C3SA 3V3MA 1O30A 5E8EH 2Z9LA 2AGGX 1GJ9B 1BUIA 1JIMA 3PV2A 1GHAF 3UOUA 1MU8B 3VXFH 3UNSA 1G37A 2KX4A 4WMDA 4D9QA 2OQ5A 2V3MA 1CA8B 2VIPA 1O2SA 3MO9A 1AY6H 1G3CA 2ZDVH 4JK6A 3RM2H 1TWXB 5HKKD 3QGNB 5EODA 1WSSH 2QXIA 1TMBH 1BIOA 4A92A 4OS2A 1CGIE 5TJXA 1FI8A 5LPFA 1TAWA 5C1YA 1ZTKA 2EC9H 3HK6B 1UTMA 4GCHF 2QF4A 1L1JA 5CMXH 2SGPE 1EZQA 1O36A 2O8LA 2AGIX 1ABJH 4AFUA 1VKYA 2D2DA 1A61H 4FUHA 4E06H 1SGRE 4MLFB 1VR1H 2BVXH 2KCPA 1WQVH 3DHKH 1HB0B 1K1NA 4X0WU 3Q3XA 2PFEA 4MDSA 3M3SA 4A7IB 1VCQA 5HMAA 2G51A 3MNBA 3QDZB 3SUFA 1FY3A 2A4QA 4UEHH 1KDQB 3A7YA 1W8BH 2V6NA 4VGCB 3E3TA 1NESE 2O8WA 1QRXA 2VNTA 3TJNA 1S6FA 2CHAB 2D1JA 5F6MA 2H6MA 1UTOA 2STAE 1ZJKA 2XWAA 2BD7A 1HV7A 2PUQH 3CP7A 3HGNA 1EAXA 4JZFH 1F5KU 1OP2A 4WJG2 3UB0A 2FODA 2OXSA 2XNDD 5FPYA 1C5TA 2H1UA 4AB8A 1UO6A 1BHXB 1BTWA 1XXFA 1P12E 2EQNA 1ELTA 2RFKC 2IJD1 3A81A 3E1XB 4OS7A 1QB6A 3RXTA 3RXMA 3OFND 4YXWD 3D49H 3L33A 2TGDA 5FX6A 1GJ4H 4F4OC 1V2ST 3KQCA 2VVUA 1BCUH 2HOBA 2GCTB 3UOPA 3QX5H 1ELFA 2F43B 1QL9A 3DFLA 3ZZ7A 1SQTA 3VB6A 3GISB 2R2MB 1O2TA 5DP4A 2TRMA 1T4VH 2OUAA 1NRQH 1GI1A 1ZGIA 1HXEH 3URDA 2P3UB 3ZZDA 1OP8A 3GY6A 3F2FA 1HNEE 1QCPA 2GX4A 1AIXH 1C5ZB 1HGTH 5EIYA 3QLPH 1SLWB 1HLTH 3RXDA 1EAUA 1OWIA 2A4RA 5J4QA 3P8NA 3VG8A 2Z7FE 2HWLB 3TPIZ 3B9FH 3T5FH 1C9PA 3EGKH 4ZXXH 1JWTA 3EAJA 4Q7YA 2SGEE 2EY4C 4Y8ZA 4XBCA 1C2DA 1F0RA 1F0TA 4X8TH 1O5AB 5AFYH 1V2OT 3O8RA 1FPHH 2HNTF 2TGAA 1QGFA 4AORA 5T6FA 2ZP0H 3LJJA 1FY1A 1O2NA 3GCTF 3QO6A 4BOHA 2HVYB 1ZHPA 2ZDMA 4IMQA 2Y5FA 1AE5A 1Y5AT 5LPEA 1QQUA 4NSYA 3LOXA 4R8TB 1F2SE 1GI6A 4DY7B 1O39A 3BTEE 4AFQA 2Q6DA 4INLA 2G4TA 1NRRH 2L6OA 1CT4E 1O5BB 1P2QA 2OP9A 5C67A 5DP8A 1ACBE 1AI8H 2WPHS 4X6MA 1UHBB 2BY8X 1UTNA 1Y3WA 5IK2D 2Y5HA 3ZZ3A 1EUFA 1FJSA 1LKAA 2CHAC 2YNAA 1QL7A 2ZCLP 3LC3A 1EJNA 4GHQA 4O3UA 1O2UA 1DWDH 2PKAB 3FAOA 2V0BA 1T7CA 2LNCA 2WINI 5L2ZH 3A85A 1KTTB 3AK5A 1ABIH 3EDXB 5EQSA 3DCLA 4UFDH 1TX6A 2XRCA 3MO6A 1QZ8A 3SU4A 1LVOA 1GVKB 1PQ8A 1LO6A 3SUGA 1GJDB 1V2LT 1GMHG 2AEIH 2A7HA 5C0UA 3RXVA 4BTTB 2VVVA 2XC5A 4CHAB 3SNEA 2BDYA 2R9PA 1ELBA 2THFB 3FP7E 1UJ1A 1WV7H 3MH7A 2ZDKA 3LGIA 2ZU5A 1U6QA 1GHWH 2ODYB 1L2EA 1EKBB 2SFAA 2GCTC 1GI3A 1H1BA 5E0HA 2BMGB 3T25A 1IQIA 3ZVCA 1VITF 1C5WB 5ETXA 1AKSB 3RXAA 1O5GH 2J5UA 1GBHA 3I77A 4Y76A 3UR6A 2PKSC 1EZSC 3LDXH 1XMNB 4X8SH 2A7CA 2F9PA 2PTNA 1C1NA 3SV8A 2NWNA 1ETRH 5C5NA 1FN8A 1QR3E 4AGKA 1S6LA 2TGPZ 1GMDG 2VJ1A 2W6JD 3OE7D 2A2XH 1F5RA 3O8DA 6GCHG 1BMMH 2JETB 2GV7A 1AGJA 3ODDA 2BDAA 2BDHA 2FDAA 1BMLA 1QL8A 3BIVH 1ELVA 4UDWH 1QJ1B 1C2JA 1UVPA 3FKSD 1ZMLA 3AVZA 1YPMH 2ZDNA 1ETTH 2FTMA 2UUFB 1YPGH 4J1YA 4ZHAA 3Q76A 1D6WA 3A84A 3ATLA 2ZFFH 5EG4A 1W11U 4YOGA 3E8LA 3DFJA 3TH2H 3AASA 1UTLM 2PUXB 1TLDA 2WV9A 1GJBB 2CV3A 1EJAA 1Z1JA 2BXUH 4ZKSU 3M36A 2H9EH 4CRAA 5C2ZA 3VXEH 1SB1H 1ANBA 4Q63A 1O3OA 4M9FA 3TVJB 2AS9A 1BRAA 3HKJB 2GD4B 2EI6A 2KCOA 2PTCE 1Y8TA 3E0NB 2JH5D 1CGHA 3HPTB 1IHTH 4ZUHA 1TOMH 4MPXA 1GHVH 1AVWA 1GI5A 1FLEE 1PPFE 2GDDA 1W14U 1FY5A 2SGDE 1GJ8B 1SGYE 1K1JA 3KQBA 3MQKC 5EPNA 4NZLA 1BBRK 4FVDA 1O3HA 2OBOA 4FUIA 5G4BA 1HAVB 3RXGA 3OTPA 3GYLB 2AYWA 3ZZAA 5C5OA 1SHYA 3BV9B 3MWIU 3SJOA 1XUGA 1E1QD 3EQ0H 4CHAC 3ZYDA 2QF0A 2A0QB 1HIAA 4TYDA 2W3KA 2AGEX 2PP6A 2QAAA 1INCA 1KXCA 3GY8A 3UPEA 2ZA5A 2FP7B 1LTOA 4ACAA 1UTJA 2KR7A 4MQAA 4K8YA 1YPEH 2C90B 3NK8A 2P93A 3RXHA 1C1UH 1ZSKA 1UTKA 4NIWA 1OKXA 2RA0A 3A89A 4BTUB 1PPGE 4X6NA 4AC9A 1DDJA 5EU8A 4RSPA 4INKA 5FCRA 1GJ6A 4GAWA 3SNAA 4X8VH 1GL1A 2OBQA 3HATH 1FXYA 4ISIH 1GL0E 1B7XB 2Y5GA 3T62A 2GV6A 2JETC 3P17H 1J17T 1HAYB 3O8BA 4Q2KA 3PLPA 1HAGE 2B7DH 2OCVB 4JZ1A 2NU4E 2ALPA 1A5GH 3MU4A 1P0SH 4Y71A 2PGQB 1SGQE 3ATKA 4NZQA 3LC5A 2FESH 5GXPA 3S9CA 1WDIA 1UCYE 1Z7KA 2H2ZA 1PFXC 1PQ7A 4MNYA 2YNBA 5E2PA 3U8RH 4YZUA 2XC0A 3K6ZA 1BBRH 4GCHG 4X1NU 2XXLA 1QURH 2Z9IA 1P3CA 1GGDB 1P2OA 1DVAH 3SV6A 3QZQA 1FQ3A 2BYAX 3A8CA 1A3BH 4OGYA 2XTTB 5F8ZA 1BITA 4OS4A 1BTZA 2UUYA 3GCHB 2BDCA 4P02A 8LPRA 1KIGH 1MBQA 2UWLA 1MUEB 2A31A 3PTBA 1O2PA 3LGYA 3EA9A 4XD7D 3FZDA 1YP9A 1V2KT 4ABEA 4K60A 2A5IA 3HGPA 3SQHE 1GBIA 2FLBH 1ARCA 2B9LA 1TGSZ 5C1UA 2KZ4A 3SOSA 3ZVFA 3SW2B 1SQAA 3SU3A 2BTCE 1O3DA 4BXSA 3S0NA 4ACBA 1GPZA 1QNJA 2P95A 2W26A 4NA7A 3IITA 2ODPA 3MO3A 4KTSA 1FV9A 4THNH 1XM1A 3TNSA 4OS5A 2BOKA 1MTNB 4DCDA 4OS6A 3UWJH 3NRLA 2FI4E 3AW1A 1FDPA 2ZDLA 5A8YA 4H42U 1KLTA 5B6LA 3BTQE 4X2XA 2JDID 1TOCB 2RA3A 2WPJS 1HYLA 1TNJA 3MYWA 2AERH 3ZV8A 4ASUD 1BRUP 1RXPA 4IGDA 1EQ9A 4DG4A 1YM0A 3L3TA 1SHHB 4ZHLU 3RU4D 1OXGA 1K2I1 1MKXK 1SGPE 1VCPA 2A2QH 2GTBA 1A0LA 3IG6B 4K8BA 4WVPE 3RXLA 4CH2B 3P8OA 1GI4A 1TRYA 2FOMB 3ZVEA 1UMAH 3ATIA 3F1SB 2HLDD 1UVTH 3A80A 5DK1A 1L0ZA 2Z94A 2HNTE 4ABDA 3BTTE 5FL7D 2C8YB 2B5TB 5EW1H 2ZZUH 3UTUH 2QXHA 2UUJB 3SJ9A 2ZU1A 3SJKA 4I8JA 4ZXYH 2BQ6B 3SU6A 3PMHB 2QCYA 4ISLA 4DIHH 3OY5U 1TNGA 1SGEE 3N99A 2D26C 1TPAE 1GGDC 4IN1A 1QRZA 3GCTG 3RXFA 1LMWB 2AHME 4GUXA 2SGAA 4B2BA 3RMOH 3GCHC 2F9UA 1OOKB 4Q4LA 2BD5A 5KEDA 5HXFA 3GCOA 1O2WA 3EE0B 4AFSA 1OX1A 3KCGH 3KHVA 4X6PA 2ANYA 1OP0A 4A1XA 3SNCA 4FUJA 1L4DA 1O3NA 2TPIZ 3LIWA 1G3EA 2P3TB 1BZXE 5FXLA 1JMOH 1LQEA 1AQ7A 1CA0B 1ESTA 2BVSH 6LPRA 1RIWB 2QXJA 2PWXA 1SGCA 1SGFG 1BMAA 2GJGA 3Q00A 4XE4A 4B76A 2PSXA 5BPEA 4ABJA 3TJUA 5L6NH 1Z71A 3UR9A 1SL3A 4XDEA 4AYYB 1WAYB 4I33A 1V2VT 1MKXH 2ZPSA 4YT7H 3A7XA 1ZLRA 2BDIA 3UNRA 3BIUH 4OM9A 1C4Y2 3WWBA 4YM9A 3RXEA 2ZTXA 5JB8S 1A0HB 2AH4X 1QRWA 2J98A 2ZPQA 3UY9A 1EB1H 1Y5UT 2WPKS 1OYTH 1Q31A 5T1VA 4NFEA 4AG2A 1NRNH 5HM2A 2PLXA 1LVBA 5DPAA 2WYJA 1YLNA 4HFPB 1QJ6B 1GJCB 1W3CA 1NTPA 3PWBA 2KAIA 4KKDA 3U28C 3SGAE 2QF5A 3FOAA 2F9OA 2JJ1D 1GCDA 4UE7H 1HAIH 1DITH 1ZTJA 3D65E 2AIPA 3DT0H 1BQYA 3KYFA 2ZCKP 4YLUA 2ZGCA 5DP5A 8ESTE 1QBVH 2Q6GA 1NS3A 2VBCA 1EPTB 1PPEE 1TA2A 1ZPCA 2BLWA 3RC5A 1BT7A 3ZZ5A 2KCAA 1GBLA 1P9UA 1UCYK 3UIRA 5C94A 5DO4H 3W95A 1RTFB 1W0JD 3LH3A 5CE1A 1NM6A 1J9CH 1EOLA 1UVUH 1Z8IB 1TRNA 5A09A 1Y3XA 2PHBA 2G5VA 4O03A 4U30A 2QC2A 1G9IE 1YKTA 3VB4A 2QY0B 2FS8A 1H9HE 1C2IA 1YPLH 2XNIA 1NC6A 5EGMA 1OWHA 4WH8A 2V7QD 6ESTA 3P8GA 3PROA 5GCHF 2IN2A 1TNHA 4XRNA 2HNTC 1GJ7B 1XVMA 1DE7H 1KSNA 3ZVGA 3EE7A 1O2YA 5DP9A 1EX3A 5IDKA 1GJAB 1XXDA 2VINA 4RT1A 3TITA 1EP6A 1O3IA 1TBQH 4SGBE 5JDUB 1S81A 3E6PH 2ODQA 1C2KA 1V2TT 3JZ2B 4BAMB 1P09A 5C17A 1E37B 1NFUA 1MQ5A 4D9RA 3OEHD 1UK4A 2BY6X 2FOHA 1IQKA 1BBRE 2OQUA 4GSOA 2FYRA 1K1OA 1CA0C 3D62A 1LHCH 1RIWC 4HGCA 1ZPZA 1G3DA 1C5QA 2NU2E 2ZG0H 2QF3A 2UWOA 2XC4A 3FP8E 3L6PA 1EAWA 2J34A 2W7UA 5DSFA 1IQMA 1WQSA 1LDTT 1K1PA 2J2UA 1H9LB 1XX9A 1UK2A 2B8OH 3PB1E 1AFQB 1VJ9U 5KECA 3TH4H 2CMYA 5E0JA 1TGCA 2CGAA 4H6SB 3K65B 1AVGH 1T8OA 3KIDU 3MH5A 1J15A 5FPSA 4ABHA 4ZKRU 1C5UA 1E34B 1VGCB 2VB0A 4X2WA 4AFZA 3PMBB 4DURA 5A8XA 3VB7A 1DXPA 1MTSA 1MBMA 1BJUA 5CHAB 3RM0H 1FZZA 1UCYH 3MU8A 4Y7BA 4ZAEA 1IOEA 1BMFD 3GDVA 2W5EA 5J4SA 2K8IA 4ABFA 2XBVA 3VB3A 2ZTZA 4IC5A 4QT8C 1DT2A 4DW2U 1B5GH 4K1TA 3LGUA 1TYNA 4X6OA 2ZFTA 2QE7D 2H5DA 5GIBA 2XBWA 1P2MA 4J2YB 3T2NA 1C5OH 3E0PB 3LU9B 2OC8A 1Y5BT 1DX5M 1C5LH 1EPTC 4I31A 2AIQA 5C20A 4GHTA 5FAHA 1HJ8A 3PMJA 1DUAA 1O31A 3DSGA 1BDAA 4Y6DA 4YTAA 1MTWA 1DY9A 1FY8E 2GCHF 3A8DA 1DWCH 3GY5A 1F7ZA 1Z1IA 4LK4A 2O8UA 1S84A 2ZO3H 2ZEBA 1FIWA 2VIVA 1C1TA 3M35A 2AMPA 1BA8B 1ESBA 4VGCC 1LVMA 1KYNA 1GVLA 2WPMS 1O2IA 5E0GA 1DM4B 1SSXA 1NU9A 1A7SA 1NU7B 2VH0A 1C2MA 4IC6A 3GICB 3RXUA 2BX4A 5EJ1A 2FOCA 4MNXA 2FM2A 3EA8A 1FX0B 3PLBA 5I25A 1AWFH 3BTGE 4X1PU 3SJIA 2G81E 5BRRE 4AN7A 1MABB 5EQQA 1XUJA 3RXJA 3KNXA 5F03A 4WXIA 1TPSA 1W7GH 3GY2A 3NWUA 1C2GA 1THPB 2JKHA 1SFQB 1A5HA 2QV1A 4ISOA 1ZOMA 4AZ2B 3BTFE 1HAXB 1CE5A 3SU2A 3ZVAA 3SJ8A 1WBGB 1T8MA 5EJLA 3V0XA 1DXWA 3SZNA 4DT4A 1AFQC 3PTNA 4ZROA 1S0QA 2ZGJA 8GCHF 4U01A 3U8TH 4H4FA 2W6ID 2XCNA 3ATMA 3T27A 2W3IA 1RRKA 1P02A 1O38A 1NY22 3C27B 1EOJA 4CR9A 1VGCC 4NFFA 1P04A 5AF9H 1X7AC 5CHAC 1XUHA 2WUBA 3I29A 1W0ZU 1TONA 2ZGBH 3OX7U 9LPRA 5DP7A 3PWCA 1AZZA 2VIDA 3RXBA 1K1IA 3EA7A 4B2AA 1ZHRA 2Z9JA 1GHYH 3SUEA 1C2FA 4FETA 1SLVB 3BSQA 3ZIAD 2IPQX 2Q1JA 2Y7XA 2EA3A 5ESTE 1TBRH 1GBKA 3R0FA 3TJVA 2BXTH 1SVPA 2J95A 2XCFA 3SN8A 2BVRH 4K3JA 1FONA 3GOVB 3SHCH 1HXFH 4GPGA 2R3YA 7GCHG 4HTCH 1O35A 1ZSLA 3UNQA 1QY6A 3RC6A 4AB9A 2GZ9A 1B0EA 1FAXA 4ZKOU 2GMTB 2G55A 3BG4B 5C1XA 5JBAS 2ZU2A 1YBWA 4WF8A 1MAXA 2ZTYA 4TY6A 2FOGA 1QA0A 1JRTA 1GBBA 1C2EA 2WSSD 2FMJA 1SFIA 2C8XB 4JYUH 1SPJA 3P92A 4XSKU 1A46H 1ZJDA 1BMNH 2OINA 1GHXH 3V13A 1HUTH 3TIUA 3F2HA 3PRBA 3M37A 1AWHB 1DPOA 3OY6U 1VITH 1CHOF 3M3TA 2ZQ2A 1LKBA 1W7XH 2IJOB 2OC1A 1A1RA 1RD3B 3RU4E 4HI3A 4FUFA 2BD3A 1O2RA 1O3PB 4IN2A 2ZWLH 1ESAA 7KMEH 1WTGH 2VWNA 1WU1A 2FO9A 4XOJA 1GBTA 3S7KB 3SQEE 4ZHMU 1W0YH 1V2JT 4ZCNA 1BJVA 1RFNA 1C1SA 2FPZA 4CREA 1S85A 2PGBB 1P8VC 3LH1A 4X1RU 3RXPA 1BTPA 4DVAU 2GDEH 3SGBE 2Y82A 2RDEA 5ESBA 1O5EH 5PTPA 3DA9B 3CS0A 2Z9KA 2SGFE 1C1WH 1V2RT 3U1JB 4IW4E 2JH6D 1HBTH 1GBJA 4ISHH 1W12U 3BTHE 1DWEH 3TH3H 2ZIQH 1ELCA 4D8NA 1NRSH 1A0JA 1E36B 2L74A 4Y7AA 3STJA 2FZZA 1HCGA 1O2KA 1D9IA 2J4IA 3KQEA 3UUZA 1JBUH 4CBNA 1GMCG 4OS1A 1K0HA 1NT1A 1YYY1 2UWPA
chains in the Genus database with same CATH topology
1MTUA 4JZIA 4JCNA 4I7YH 1TE0A 1UTPA 4Y0ZE 1KMHB 2SNVA 1QBOA 3VFEA 1MU6B 1GHAG 3NCLA 2ZFPH 2BM2A 1Z8RA 4JMYA 3T29A 1GHBF 5CHBA 4BAQB 5SGAE 1ZZZA 4NSVA 1SC8U 3ZV9A 1C1QA 1KXDA 2SNWA 4NIYA 3K9XB 3MFJA 5F8TA 1K1MA 1LHGH 2BZ6H 3RP2A 2FLRH 3KQDA 1HDTH 2GMTC 3BG4C 3W1EA 1OWJA 4TT3D 2IOTA 1CHGA 1N6YA 1PPBH 1HFDA 2ZU4A 3MU1A 4ZH8A 5JPMH 1ID5H 3M5OA 2O8TA 1PPCE 2GGVB 1E79D 1KTSB 4X1QU 3MHWU 4INHA 3MH6A 4FUDA 2J9NA 5EXMA 2CJIA 1GBDA 1AUTC 5EPYA 3DSPA 1W2KH 2ULLA 5GDSH 2ASUB 5GCHG 3LGWA 5K0HA 2WHXA 3VB5A 1T8NA 3FO8D 4WXVA 3A7ZA 3U98H 2KCYA 1WCZA 2P59A 1UVOA 1PQ5A 4MNVA 4A1VA 3A8BA 1SLUB 1SGIB 1O2JA 3SORA 1P9SA 1QFKH 1ZR0A 4CRBA 1T31A 3ELAH 2R2WU 1SOZA 2ZF0H 4FU9A 5FBEA 1NROH 1FN6A 1GI9B 1AHTH 2YMSD 1UK3A 3GY3A 3OAAD 1WTHD 1FAKH 3RMLH 1HIAB 3QZRA 2QA9E 1GBEA 1EZUC 1MQ6A 1UTQA 3U8OH 4AYVB 1MMJN 2F3CE 3M5LA 2A1DB 4B71A 1AN1E 3UQOA 2BOHB 1ANDA 1UVSH 1HAPH 2Q6FA 1Q3XA 1EFRD 2ZDAH 3WY8A 1DICA 1GDNA 2BY5X 5LH8A 4O3TA 1SGFA 2FOEA 4MTBA 1O5CB 3F0PA 3NUMA 3A83A 3F9HA 5DGJA 4AX9H 1GI8B 4TY7A 1HJ9A 1TNLA 1O3MA 1LVYA 5T6DA 3ZZ9A 1GMDF 5A0AE 1ZRKA 1E35B 4IMZA 3ZZ4A 3MNSA 3BTKE 2BLVA 2A4OA 6GCHF 1O3BA 5JBCS 1D3DB 1Z6JH 1NZQH 1XUIA 5AHGH 4DGJA 3ITIA 1LPGB 1EATA 3V7TA 5LGOA 3SNBA 2LELA 1SGTA 4Z0KA 2Y80A 4KELA 1GBCA 1GHZA 2BD9A 3SI3H 1C2LA 4XBDA 2BD2A 4K1EA 1V3XA 2ILNA 4Z1MD 2J38A 2ZGXH 4NIVA 1GDQA 4ASHA 3TLOA 4E05H 1D6RA 3UWIA 2XOKD 2GZ8A 1XKBC 3MNXA 3K2UA 2FX6A 1AD8H 1IQGA 3QN7A 3TGKE 2Z3CA 1EPTA 2CF8H 5FX5A 3RXQA 1O34A 2ZC9H 1LPZB 4B1TA 2PV9B 3F3BA 4DJZB 2WV4A 1ZHMA 1O2HA 2WYGA 1TGBA 1TNKA 1MZAA 3TK9A 2A45B 1AUJA 3R3GB 1TRMA 1V2MT 4Q7ZA 1N6XA 1Y3YA 2WPLS 4BAHB 2P8OB 1ELDE 1O3GA 3SO3A 2WPIS 5FCKA 1YPJH 2ZPRA 3QGJA 2EEKA 3OTJE 4FVBA 3A87A 2BB4A 2OC7A 2BD4A 1O32A 1KDQA 1RTLA 1A3EH 4DOQA 1SOTA 2ZFSA 1OS8A 3RLYH 3MMGA 5T3HA 5K7RA 1O0DH 5EXNA 1O37A 1CU1A 2KFWA 3STIA 1QTFA 7LPRA 1NFYA 1GDUA 3PM3A 2FOFA 4ISNA 3A88A 3FANA 1CBWB 4K69A 3RMNH 3ZVBA 1FNIA 2VWLA 1P57B 2BQWB 3ENSB 1H8ED 1MH0A 5DKMA 3S7HB 1C1OA 1MTNC 1KY9A 2FWWA 2R3UA 2ANMH 2OTVA 4CR5A 4SGAE 1WOFA 2G00A 1K28D 1HRTH 1GI0A 5GNDA 4WWYA 4AGJA 1FMGA 1HAOH 5DP3A 1TQ7B 5CDFE 8GCHG 1LCYA 1L1NA 3H7TA 1IQHA 1J14A 1ZTLA 3BG8A 5FPTA 1Q2WA 1VITG 2VIQA 2ZU3A 1QJ7B 3SHAH 4I32A 1D3TB 2QIQA 3PRDA 3Q3YA 2ZQ1A 3SNDA 3V12A 4K2YA 4Y0YE 3OU0A 3M3VA 2FI3E 4YT6H 1O2LA 1A5IA 1TIOA 3GDUA 1W13U 3M61U 4CRDA 1QB1A 3O8CA 1WYKA 2CXVA 3NZIA 6CHAB 1O3CA 4B6EA 3RXKA 3GDSA 5HGGA 1P03A 3SV7A 1OYQA 7ESTE 5L30H 1ZRBA 3QTVH 1KXAA 4MG3A 4E7NA 2ZHQH 1HJAB 3QTOH 2F9VA 1O3EA 3A82A 4FUCA 2BLOA 1EZXC 2A5AA 1C1MA 1OWKA 2TIOA 2P3FH 4NWLA 2WV5A 3GYMA 1Y3VA 1NRPH 1C2HA 1G3BA 3SGQE 1O3JA 2V3OH 1MCVA 2Z3DA 2NU1E 4NWKA 5EXLA 4D76A 2WPDD 3KL6A 1O2QA 3HKIB 3JZ1B 1IAUA 2VGCB 2NU0E 1G2LA 5TCCA 1J8AA 4AOQA 5HM9A 4Y79A 4BAOB 2R0LA 2XW9A 3OEED 4UONA 1GBMA 1EB2A 2P8OC 1H8IH 2OK5A 2RCEA 1EP5A 3SU0A 3FZZA 4IBLH 2AMDA 4JZEH 3DSOA 1DOJA 1F0SA 1TPOA 3GY7A 3MH4A 1LPKB 1UHBA 1ZYOA 2ESTE 1VJAU 4D7GA 3BTWE 3MOCA 1C1PA 1CHOG 1NPMA 4GLYA 2PKAA 2H5CA 3LKWA 3U9AH 2OC0A 1NN6A 1CBWC 1TBZH 3AAVA 1D4PB 2I6SA 2OD3B 4CRFA 1H4WA 3RU4T 4DIIH 1Z8GA 2Z9GA 2VVCA 4Q7XA 2O8MA 2G8TA 1D3PB 4Q80A 3N7EA 3VEQB 5GJ4B 2FOBA 1ARBA 1LHDH 4NIXA 1O2OA 1G36A 4NA8A 1C5RA 2QXGA 1NO9H 1RJXB 3NXPA 3QUMP 1T4UH 5L2YH 1Y3UA 1SQOA 2C93B 2K1QA 2GVFA 1ORFA 1GWAA 2KAIB 3TNTA 4CH8B 3UREA 5HYOA 1AKSA 1K22H 1XVOA 1DY8A 1BTHH 2LPRA 1EAIA 1GVZA 2PKSB 1P2NA 3MU5A 3MNCA 3U69H 5EOKA 3RXCA 1FIZA 2HPPH 3KEEA 1AMHA 3H7OA 1SR5C 1Y59T 4ABAA 3OSYA 6CHAC 1CGJE 1BRCE 1ZMNA 2VIWA 4TWYA 1HJAC 1TMUH 2STBE 5GPIB 2P16A 1FY4A 3TJOA 3Q3KA 2FX4A 1P2JA 4F49A 1XUKA 1K1LA 1CT2E 1GHBG 1ZGVA 3TU7H 1YGCH 1J16A 3LGTA 1XUFA 3U1IB 4X8UH 1KLJH 3RMMH 4NG9H 3SZEA 1HAZB 4WMFA 5JB9S 4CRCA 1VCWA 2OLGA 1P06A 1A4WH 1PPZA 4YLQH 3TGIE 1O5FH 1BRBE 4A5TS 1C5XB 2FYQA 2QGRA 2ZKSA 5F8XA 2VGCC 2HLCA 3S9BA 2ZHEH 2BDBA 3MI4A 3PLKA 1QBNA 4XBBA 1H8HD 3AAUA 2DUCA 2GP9B 2GT7A 3GCNA 5DJ7A 1F5LA 1V2QT 1S6HA 1BOQA 1TALA 2BY7X 1H8DH 4Y8YA 3RXIA 3AW0A 2GKVE 1IQEA 2A4GA 2EI7A 4CRGA 3HK3B 1JIRA 1F0UA 3VGCB 1HPGA 2G5NA 4NA9H 4TWWA 2I6QA 1ANCA 1W10U 1V2WT 4I8HA 4BTIB 1HAVA 2TGTA 1CSOE 1RGQA 1G30B 3RXRA 4MPWA 2ZFQH 3W94A 2Y7ZA 1TB6H 3BTME 2BD8A 3M7UA 1S0RA 1KXBA 2G4UA 2VWMA 2XBYA 2HGTH 3RC4A 4TSFD 3RLWH 3RXOA 1MZDA 3SV9A 1G2MA 4E7RG 3C1KA 3URCA 3N7OA 1GG6B 1G32B 1C4U2 1RS0A 3K6YA 2C8WB 5T6GA 3NKKA 3SBKA 1SG8B 1C1RA 4Y8XA 1H9IE 1AFEH 1E38B 2RDLA 4BAKB 1V2PT 1DFPA 2FS9A 2G52A 2HPQH 2AFQB 3DD2H 3E16B 2GT8A 1L1GA 2DE9A 3B8JA 1OHHD 1O33A 1C5SA 2XWBI 2Y81A 1V6DA 1BTXA 3FVFB 2BHGA 2DE8A 3PYHA 1V2UT 4H6TA 4YESB 4MPVA 1COWD 2ZI2H 1SGDE 4O97A 1T32A 4MVNA 3CS7A 1C5NH 3F9GA 4HZHA 1E1RD 1P2IA 2R0KA 1CQQA 2ALVA 3GY4A 4AG1A 2FOAA 3DUXH 3ZZCA 5FHTA 1YLCA 4KP0A 1O3FA 3BF6H 3FN8A 2UUKB 3QK1A 3PO1B 2F83A 1P11E 4BNRA 4TPYA 1P01A 3SV2H 1O3LA 3RXSA 3BTDE 1C5YB 2PSYA 1ANEA 1PQAA 5AFZH 3M5MA 2YMSB 1TX7A 4UFEH 2O9QA 3ZZBA 1S5SA 5DG6A 4YOJA 1PPHE 1GJ5H 2ZNKH 3WW7A 2FXRA 1DS2E 3ZVDA 3P8FA 3GS9A 1BHXF 2EI8A 4PROA 1JXPA 1PYTC 1S82A 4ABGA 1IQNA 4JZDH 5C3NA 3M5NA 1IHSH 3A7TA 1TGNA 3VPKA 4FUEA 4A6LA 2JH0D 4I8LA 2F9BH 1E0FD 1YPKH 3PV4A 1S83A 1TPPA 2XBXA 3LPRA 1C5VA 2FTLE 4U32A 3VGCC 2GZ7A 4O9VA 4MPUA 5A0BA 1YC0A 1C5PA 2HRVA 2IPHA 3RUOA 1MKWK 1PYTD 4M7GA 5TCAA 3P95A 1DUEA 1SLXB 1T8LA 1W0KD 1QHRB 1C4V2 1IQFA 3MTYA 3QWCH 4FXGH 4I8KA 2J92A 2TBSA 3BN9A 4FU7A 5IYTA 3T26A 1DLKB 5JBTA 1KXEA 5E2OA 3UFAA 3P6ZB 1NFXA 5B6OA 2V3HH 3A7VA 1L4ZA 1OWEA 1GG6C 1O3KA 2BZAA 3TGJE 8KME2 1M9UA 1QB9A 4X1SU 2M2AA 5C0TA 3A86A 2RG3A 1P2KA 1GI7B 2H9TH 2PW8H 3S69A 1BTUA 3TK5A 4X2VA 1THRH 1WUNH 4YOIA 1O2ZA 1MD7A 3ESTA 2VIOA 4NGAH 5JYIA 1YCPK 9ESTA 3H09A 3I78A 1DLEA 1O3AA 3SU5A 2SGQE 1MD8A 1N8OB 1VZQH 1ZMJA 4WH6A 4B75A 4ABBA 5JBBS 1MCTA 1K9OE 3KF2A 1AU8A 4Z6AH 2XYAA 3IWMA 3PV5A 5EW2H 1OSSA 1QIXB 3BEFB 2A7JA 4ABIA 2W7SA 1Z6EA 3SI4H 3ZZ6A 3PO1C 1THSH 1RTKA 1YPHE 4TPIZ 2Z6BD 1AVXA 1AB9B 2FIRH 3P70B 4LZ4B 4ZKNU 1QA7A 4RI0A 3FP6E 5DN6D 4BANB 2YMSC 1TA6A 3Q77A 4D7FA 1ELEE 4UFGH 2A32A 1C5MD 2VWOA 1MKWH 4JYVH 1AZ8A 2HALA 1NBME 2JJ2D 5A2MH 5ABWA 1V2NT 4OGXA 1AE8H 2ZFRH 3KGPA 1SMFE 3KN2A 1SBWA 4Y10E 2C8ZB 4BXWA 1GCTB 3ZZ8A 1GMHF 2BY9X 2YOLA 2WUCA 3F9EA 4A1TA 2BLQA 2FI5E 1C9TA 3M7QA 1TQ0B 3ODFA 4IS5A 1DANH 4KTUA 1O2VA 2F9NA 3UQVA 3E91A 4RKJB 3N7DA 4U2WA 3D23A 4NCYA 4LOYH 3LGVA 3FFGA 1LHFH 1BTYA 2ZHWH 4GVUA 4F55A 3SUDA 3SU1A 2AMQA 1CVWH 1TMTH 1EASA 3F2GA 5DP6A 3A8AA 1YF4A 1K21H 1YCPH 4I8GA 2WZQA 2ZHDA 2ZCHP 3F9FA 4Y11E 1GI2A 1EJMA 2PR3A 2ZHFH 3TK6A 2F91A 1CO7E 3RDZA 2ANWA 2P94A 1DWBH 4UD9H 1ETSH 1P3EA 2ZECA 4K1SA 3A7WA 4CBOA 2ANKH 4B6FA 4FUBA 1JRSA 2CN0H 2FEQH 2NU3E 4DT7B 1DSUA 2A5KA 2BQ7B 1TFXA 1GBAA 2V35A 3G01A 2Z3EA 1GBFA 4X2YA 1ELAA 2M5TA 1QQ4A 5LPRA 1YLDA 1FPCH 1OWDA 3EYDA 1C1VH 7GCHF 5EQRA 1N8OC 5AVDA 4WMEA 5FBIA 3LT3A 3ZYEA 5GWZA 1AO5A 1TGTA 2KM0A 1SI5H 4MNWA 1A2CH 2J94A 3H5CB 3M7TA 2B0FA 4FUGA 4JYTA 3ATWA 1AB9C 1FUJA 1O2GH 1P10A 2GCHG 3F6UH 1YCPM 2JIZD 1TNIA 2VU8E 4K5ZA 3S9AA 4LZ1H 1OPHB 1NFWA 1BB0B 1D3QB 3PMAB 5I46H 1IQLA 1O2XA 2CK3D 4ESTE 1PJPA 1WXRA 1LHEH 2VH6A 1HAHH 1YPHC 1N1LA 2C4FH 2H9HA 4LXBH 4WY3A 1KXFA 3BEIB 4FU8A 3T28A 3SYJA 4KTCA 4KGAA 1CT0E 3CENA 1GCTC 3B23B 2CF9H 4XFQA 5A8ZA 1O5DH 1KLIH 4YO9A 1B0FA 2BX3A 2Y6TA 1F92A 3LJOA 1TX8A 2QYIA 1O2MA 2K0QA 4R0IA 1LQDB 3OYPA 1Z8JB 1ELGA 1DSTA 1EXFA 1JOUB 2ZGHA 4B74A 3F0OA 1ZSJA 3LONA 4B73A 1IQJA 3F68H 1MTVA 3BEUA 2F4LA 5F53A 4UFFH 1MAYA 1SKYE 1P05A 3E90B 1ZPBA 1SGNE 2HVXA 4RN6A 1NBMD 3WWFA 5H4IB 3MU0A 3NPSA 4RKOB 4B2CA 5A0CA 1GMCF 1XKAC 4JK5A 2QN5T 4ZMAH 2BDGA 1TABE 2D8WA 2C3SA 3V3MA 1O30A 5E8EH 2Z9LA 2AGGX 1GJ9B 1BUIA 1JIMA 3PV2A 1GHAF 3UOUA 1MU8B 3VXFH 3UNSA 1G37A 4WMDA 4D9QA 2OQ5A 1CA8B 2VIPA 1O2SA 3MO9A 1AY6H 1G3CA 2ZDVH 4JK6A 3RM2H 1TWXB 5HKKD 3QGNB 5EODA 1WSSH