1JXPA

Bk strain hepatitis c virus (hcv) ns3-ns4a
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
177
structure length
177
Chain Sequence
ITAYSQQTRGLLGCIITSLTGRDKNQVEGEVQVVSTATQSFLATCVNGVCWTVYHGAGSKTLAGPKGPITQMYTNVDQDLVGWQAPPGARSLTPCTCGSSDLYLVTRHADVIPVRRRGDSRGSLLSPRPVSYLKGSSGGPLLCPSGHAVGIFRAAVCTRGVAKAVDFVPVESMETTM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein complex
molecule keywords NS3 SERINE PROTEASE
publication title Complex of NS3 protease and NS4A peptide of BK strain hepatitis C virus: a 2.2 A resolution structure in a hexagonal crystal form.
pubmed rcsb
source organism Hepatitis c virus (isolate bk)
total genus 37
structure length 177
sequence length 177
chains with identical sequence B
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1997-08-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02907 Peptidase_S29 Hepatitis C virus NS3 protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1jxpA02
2.40.10.120 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 1jxpA01
4A1VA 1GI1A 2YNAA 1T32A 3VB7A 1FDPA 3Q76A 3ATKA 2BD2A 3EDXB 4AX9H 4DIHH 1H9HE 3E16B 3RXEA 5A8XA 1MCTA 3M7TA 1SB1H 4WXIA 4X2VA 2GGVB 1GBMA 2EC9H 1KXCA 4Y7AA 3NZIA 4B76A 5I46H 1GBFA 2FOGA 2XBVA 4GHTA 2GCTC 1W7XH 3RXBA 5JPMH 1A7SA 2GKVE 1SFIA 1Z1IA 1O36A 2ZU1A 2HLCA 2Q6DA 3ZVEA 3QDZB 5A0AE 1A5GH 3QTOH 3F9GA 5EU8A 1EOLA 1GJ9B 2ZTXA 2W3IA 2B0FA 2XW9A 1GJ4H 1FAKH 1MTUA 3O8DA 4AGJA 1O2IA 2CJIA 3TH3H 1GI9B 2FOMB 2CHAC 2FX6A 1IQFA 2GMTC 1GHYH 4D76A 2ANMH 2PV9B 1UTQA 1ELCA 4TWWA 3A8AA 2AFQB 3P8NA 2HWLB 4DT7B 3MNCA 1BTWA 3P95A 3HK3B 3CS0A 3DUXH 3A84A 4B6EA 3STJA 1V2KT 1GJCB 3C1KA 3SI4H 5E2OA 1YBWA 1NS3A 1SQTA 5EPYA 1F5LA 1LMWB 1O2WA 2TIOA 2BB4A 1BITA 1YPJH 1WCZA 1P3EA 1CT2E 1ZJKA 4H4FA 1MKWH 1OOKB 1GBJA 2OC7A 1IQNA 1EJMA 2GDDA 1P2OA 1UVTH 2CGAA 1CVWH 2FDAA 4ABDA 1HJAB 1KXBA 3A88A 1W10U 3SI3H 1QCPA 4B2AA 1GHZA 4OS6A 4D9RA 3A7WA 1H4WA 2EI7A 2SGFE 3BG4C 5GPIB 1O3KA 1FMGA 1RFNA 1PPEE 2FWWA 2IPHA 2WUBA 3RC6A 4AFSA 1ELFA 4OS5A 1V2MT 1SLVB 4A92A 1Y5BT 3GY5A 1V2JT 3LGTA 2O8WA 1GI8B 2AMQA 5FAHA 2NWNA 5FPTA 3H7OA 2V3HH 2A7CA 4FUFA 1WOFA 1JOUB 4HZHA 1OWIA 3MNSA 3R0FA 2QXIA 2ZQ2A 1PYTC 4OS4A 1B7XB 1XM1A 3RM0H 1HRTH 2R3YA 3AAUA 3TK5A 4B2CA 1MQ6A 1SLUB 2R0LA 1DSUA 4KTCA 1TALA 4E7NA 1FQ3A 5CHAB 3Q3XA 4M7GA 3SNEA 5FBIA 2SGQE 1BTHH 5A0BA 3W95A 1UTOA 1A5IA 3Q3YA 4Y8XA 1L4ZA 4X6NA 1Z8IB 4LZ1H 4HI3A 4ZMAH 2OQ5A 4Q80A 1W8BH 4U2WA 3HPTB 5AFZH 4Y10E 1AY6H 1HJ8A 3MOCA 3K9XB 3PM3A 4KKDA 1O2TA 1AO5A 5LPFA 2ZGHA 3NK8A 1ELBA 4BOHA 5EODA 1RIWB 3BEFB 4JYUH 1S81A 2IJD1 3E3TA 1P12E 2ESTE 2ZFSA 2B9LA 1YPGH 1KDQB 4Y0ZE 1KY9A 2Y5HA 1EJAA 1W7GH 1O5BB 3SOSA 2Q6GA 2BD8A 5DG6A 2AEIH 1C2IA 3ZZ5A 3U69H 2PSYA 3NWUA 5F8ZA 5GCHF 1BBRK 1V2TT 3AK5A 3U8RH 4IW4E 5LGOA 4ISNA 1Y3VA 1YM0A 2ZP0H 5DJ7A 2ZQ1A 1WQVH 3MU8A 4AFUA 3ATLA 1YC0A 1AVXA 2ODYB 3EA8A 3HKJB 4U32A 3LU9B 3E0PB 3PO1C 2Y7XA 2VVVA 2ANYA 1SC8U 3NUMA 1O33A 2JH6D 1SFQB 3BSQA 1Y5AT 1SGFA 4ZHAA 3LONA 2FI3E 2PWXA 1CA0B 3ZZ8A 1EKBB 1ZMNA 3KGPA 2G00A 1T31A 1SGQE 3U1JB 3PMBB 1C2HA 1EASA 2OC8A 2VIWA 2BYAX 2D2DA 5C67A 5FX5A 3B23B 3RXTA 1LDTT 1Y3UA 4JYVH 2UUYA 3H5CB 1HPGA 3HATH 1DUAA 1IQEA 4X8TH 1CHOG 4GCHG 2WPIS 3SV7A 1O2NA 3A85A 3FP7E 1PFXC 2GP9B 1O2SA 4INKA 2ZPQA 4JZEH 3SZNA 1HNEE 2O8TA 4MNWA 4Q7YA 1O2PA 4TWYA 5DP7A 3EA9A 3T26A 1TGCA 1VCPA 4CR5A 3LC3A 3UWJH 1GHBF 2Q6FA 1EOJA 3KCGH 3DD2H 4ISLA 1PPBH 2WPKS 4YM9A 1QJ7B 1EB2A 1NRPH 4FUEA 5JBAS 4DGJA 2GTBA 1C5NH 2ZGJA 1T4UH 2FZZA 1LVYA 1T8NA 4GPGA 2F9NA 1OP0A 5EOKA 3P8OA 3SJIA 1AD8H 1T8OA 4NIYA 1MUEB 4O9VA 2FI5E 1HFDA 3RMMH 2PSXA 4DIIH 1A0JA 8KME2 2ANWA 3ZVFA 1MD7A 1P03A 4X8VH 1A1RA 1DOJA 1KYNA 1ZR0A 2P59A 1O0DH 2BX4A 2WV5A 4MNXA 3F9FA 4DCDA 1ZPZA 1K9OE 1EZSC 4X1NU 1TOCB 2C90B 1GBTA 1NRNH 8LPRA 5C3NA 2FTLE 2JH5D 3BEUA 4A6LA 4Y79A 2AMPA 1XVMA 4CRAA 1GI3A 5DP3A 3SU0A 3M5NA 2A45B 4FUBA 4BAHB 1D6RA 3TK9A 4D7GA 2OCVB 2CV3A 4GAWA 2DE9A 3SNBA 3GCHB 1LHDH 1TOMH 3URDA 1MH0A 2KAIB 2BD9A 2ODQA 4Q7ZA 4B75A 1O2ZA 2ZFTA 1XUHA 1EP5A 4Q7XA 1C2KA 2STAE 1UHBB 4ABBA 1TBQH 2ANKH 5GWZA 3WY8A 1G3CA 3SQHE 4AYYB 4OS2A 5C5OA 5K7RA 2XYAA 1GI2A 3LKWA 5GJ4B 2FO9A 2HALA 1O39A 2XC4A 3A89A 1OSSA 3MO6A 3RU4D 1TX8A 5JB9S 4AG1A 3F1SB 3LH1A 3BTHE 1S6FA 5EXMA 2O8LA 2D1JA 5A09A 1O3IA 1C9TA 2OUAA 2WV9A 4BXWA 4AB8A 3D62A 1DWBH 1ZTJA 3UWIA 1TWXB 3UNRA 1QA7A 2TGTA 3MMGA 4NSYA 2UUKB 2BLQA 3KL6A 3QO6A 3MO3A 1HB0B 3PROA 3RXUA 5L2ZH 5DP4A 3VGCB 1JIMA 1HAYB 3MU1A 3PLKA 3RXRA 2Z9JA 4CRCA 4UFFH 1TNLA 1TMUH 2NU2E 1EB1H 3BTQE 1F5KU 5I25A 1GI7B 3RXIA 4M9FA 3AVZA 6CHAB 3RXVA 1LQEA 1Q3XA 2O8MA 5T6FA 4CBOA 2AH4X 5EXLA 1QNJA 3EAJA 4INHA 2GCHG 2BY7X 1XUIA 2PKAA 2G4TA 3RXMA 1AFQB 1P2IA 1TBZH 2SNVA 1V2RT 1YPLH 4DOQA 1Z7KA 1D4PB 5LH8A 1FXYA 3IG6B 1SSXA 3ZZ9A 1GVKB 1FIWA 2JKHA 2Y5FA 5A8YA 3RXPA 1FY3A 2JH0D 2A7HA 4Y0YE 3NKKA 3FP8E 1BJUA 2FYRA 4B74A 2VIOA 1HAIH 2EA3A 2WPHS 1WSSH 3TJUA 1TGSZ 3PWBA 2SNWA 2J2UA 2R2MB 1F0RA 4MVNA 1AVGH 1CO7E 2HVXA 1Y59T 2BLWA 4KP0A 3EGKH 2C8ZB 1MCVA 1YCPH 3ZV8A 2HNTF 2M5TA 3QLPH 1OX1A 3M3SA 2ZHEH 3T62A 1TABE 4FUIA 2A32A 1HJAC 1C4Y2 2F83A 2VGCB 1NFWA 2QF0A 1O5DH 3S69A 1HIAA 1O30A 2CMYA 2HPPH 1FUJA 1L1NA 4RSPA 2BDIA 1C5LH 1XMNB 3O8CA 1UMAH 4JZFH 1K22H 3RM2H 3VEQB 3LGUA 2VB0A 1BTZA 4CRGA 4YESB 3S9CA 1C5ZB 1MKXK 1LTOA 1AU8A 3UFAA 1O3LA 1ETRH 1KDQA 2GZ8A 2BHGA 4ZKOU 3ZVGA 3SV6A 1TPSA 4AORA 2F9OA 1ZGIA 1D3PB 4AB9A 1TPAE 4NIWA 3M7QA 5HGGA 1P02A 3GDSA 3DT0H 2RA0A 1TQ7B 5CHAC 5EQSA 3RXSA 3L3TA 1PPFE 2ZO3H 1HYLA 2XWAA 4MPVA 3ZYEA 1A3BH 2XBXA 1BDAA 1BRBE 3LC5A 1Y5UT 3MU0A 4K3JA 1CA8B 3HKIB 4ZAEA 1DT2A 2BD4A 2BMGB 2ZCKP 1TIOA 1QJ1B 4ESTE 2P3FH 1J15A 3GDUA 5E0JA 2GDEH 1SQOA 1RIWC 3BEIB 4OGYA 1OYQA 1C5VA 1W12U 2Z9IA 5LPRA 1ESAA 1F2SE 1O5FH 4CR9A 2FLRH 5EPNA 2P95A 4I8LA 1VITF 4WH6A 4I8GA 4OS7A 5FCRA 3SV9A 1XUFA 5A0CA 4CRDA 2OLGA 4MNYA 2GVFA 4I31A 2V3OH 1BA8B 4GVUA 1SGYE 1TA6A 3RDZA 1SGEE 4NA8A 3SO3A 4TPYA 2ZU2A 4H42U 2G5NA 1C5OH 5EXNA 4BTUB 5EW2H 2QXHA 1UTPA 3RXGA 2OINA 4YT7H 3GYMA 1DSTA 1EZUC 1MBQA 2BXUH 2VIDA 1QL9A 1BMAA 4X6OA 1G37A 1OWJA 1NT1A 2PTNA 2WV4A 3P6ZB 1C5QA 2J95A 2F9UA 3B9FH 1FAXA 1V6DA 2A4GA 3DFLA 3STIA 1KIGH 2DUCA 4IN2A 1GBLA 4FUGA 1WYKA 3RXFA 1SGTA 3GICB 4ZKSU 5IDKA 2BDHA 3R3GB 2OBOA 1SOTA 1KTTB 3UR9A 2AS9A 4ABAA 1ABIH 1AWFH 1EPTB 1UCYE 2G4UA 2SGEE 3T29A 4H6SB 2ZDLA 1MZDA 2QV1A 3TLOA 5ABWA 1T8MA 3AASA 1ZTLA 4YZUA 1RTFB 1INCA 1KXFA 3ZV9A 5GCHG 1XUGA 4TPIZ 3S7HB 4WMDA 5FBEA 4CRBA 2A1DB 3QK1A 3SU3A 4WY3A 3ZZ7A 1P05A 1O3JA 2FESH 3BTKE 1P06A 1V2QT 2P16A 1THRH 2BM2A 1TGTA 4UEHH 1L1GA 1A0LA 1PPCE 4YT6H 1KXEA 5HXFA 3RXKA 8GCHF 2C3SA 2GZ7A 2R2WU 5GXPA 2PGBB 1LHEH 3FFGA 2QCYA 5E2PA 1HAXB 1QTFA 2BY9X 4CH8B 1EATA 2PGQB 4JZIA 1THSH 2BVXH 2HPQH 2IJOB 3GY2A 2BDGA 3SJOA 1A4WH 4KELA 1BJVA 1CQQA 2PTCE 4LOYH 1O2UA 3KQDA 3SU2A 1C2EA 2ZPSA 4GHQA 2VVUA 2BD5A 3QGNB 3LJJA 1V2ST 2ZGBH 1LPKB 4YOGA 3V7TA 1JRTA 5DPAA 4E06H 2UWPA 1J17T 2VWNA 3U8OH 3S0NA 2W3KA 2P3TB 1T7CA 1YCPM 2ZGCA 4LXBH 3SQEE 1S82A 1XUKA 1QL8A 3E6PH 3CP7A 1TMTH 3QGJA 1DICA 3LPRA 4CBNA 1L1JA 3A7ZA 3S7KB 1Z6JH 2BZ6H 3OTJE 3M5LA 1S85A 2BX3A 4LK4A 1CU1A 5FXLA 3GCNA 2PW8H 1GHBG 1Z71A 4BANB 1OWHA 3GCHC 3MU4A 3UNSA 1ANBA 3UPEA 1QBVH 4Y76A 1GI6A 1VJAU 2ULLA 3A7XA 4XE4A 1W13U 1C1TA 2BQ6B 1ZPBA 2OC0A 4IMQA 2XTTB 1P2QA 1WBGB 4NIVA 1QB6A 1WTGH 1SGPE 1O37A 4ZKNU 1RXPA 3F68H 5JBBS 4X8UH 3P17H 2FOFA 1VCWA 1HXEH 2Z9GA 1CHGA 2AGGX 4ZROA 1A3EH 4FXGH 1EJNA 5F03A 4YTAA 1GJ8B 1C1NA 5T1VA 1OWKA 3ZZ6A 1C2DA 1ELTA 2Z94A 3DFJA 4CHAB 1GMDF 1YF4A 1EAXA 2ZHWH 4AOQA 2C8YB 1TNKA 3RXDA 3VGCC 2PUXB 1D6WA 1E37B 2F3CE 1F7ZA 2BZAA 3RXJA 3PLBA 1VJ9U 4JCNA 3PV2A 3SGQE 1WAYB 1FZZA 4NIXA 1QHRB 6CHAC 2WHXA 1UVSH 1SGDE 1GBKA 4E05H 4FVDA 1MTSA 4J2YB 1GVLA 1NROH 1ZJDA 1FY8E 1O2MA 4MNVA 4NFFA 1WV7H 4OS1A 4MG3A 4NA9H 3OX7U 3RMNH 1W3CA 1NTPA 2BDYA 1AFQC 1TLDA 2I6QA 1BTUA 1O35A 2XBWA 2Z6BD 2A5IA 5ESTE 3ODFA 3M5OA 4I7YH 3PTNA 4SGBE 1QB1A 1Z6EA 1DUEA 2BDAA 3KHVA 5C5NA 1BMNH 1GDQA 2I6SA 1GBCA 3QZRA 1C5PA 1IOEA 2RDLA 1UTLM 4MDSA 3QX5H 1O2RA 1E0FD 2A0QB 3E90B 3MYWA 5A8ZA 3SYJA 3BIVH 1AKSB 1ZPCA 5GDSH 2OP9A 2UUFB 1N8OB 1W0ZU 4BAKB 1DLKB 5L6NH 1P9UA 2WINI 3P8FA 2ZU4A 1J16A 3SV2H 2QXGA 3Q00A 1C1UH 2YOLA 4J1YA 3ZVDA 1UCYH 2Z3DA 1KTSB 2VWLA 2Y7ZA 1YPMH 1K1MA 1EX3A 2BD7A 2ZECA 4ASHA 2VGCC 4K69A 4I8JA 3MH7A 3SGBE 6GCHF 3SJ9A 1YPHE 3O8RA 2V35A 1ORFA 1GDUA 1F92A 2VH6A 1TX6A 1RRKA 3P92A 3SU5A 4I8KA 2R0KA 1GCTB 3ATWA 1GMHF 1P57B 2Y6TA 1AI8H 3M5MA 1DDJA 2ZCHP 1ZHRA 4X2YA 2J92A 1O3BA 1GL1A 2P94A 5TCCA 3EYDA 1BBRE 1M9UA 4GSOA 1YPHC 1ZTKA 4UFDH 5EW1H 1G3EA 1D3TB 2TGPZ 1AN1E 4ZKRU 1GBHA 3MFJA 5IYTA 2TBSA 1SLWB 1G2MA 1AZZA 2NU1E 1MZAA 4YO9A 1DWDH 2IN2A 1VGCB 4K1EA 4ZXYH 1IQJA 1PJPA 2BD3A 1P04A 4A5TS 3TJNA 4O03A 2FOEA 1ESTA 1X7AC 4X6PA 1AE5A 1UTKA 1DWCH 1LKBA 1O5GH 3BTME 4FU9A 3SW2B 3BTGE 2W5EA 1C1PA 1HDTH 2V0BA 3KN2A 3NCLA 2FP7B 4E7RG 4B2BA 1HAVA 3IWMA 4O3TA 4AFQA 3RXOA 1Y3XA 1OXGA 1SL3A 5JBTA 3GISB 3DHKH 3SHAH 7ESTE 2STBE 1Z8RA 1P3CA 1XX9A 1TNHA 3SNDA 4D9QA 1TB6H 1BOQA 1OKXA 1TQ0B 1O2QA 1D3DB 1DXPA 1OP2A 4BTIB 2RG3A 4UDWH 1P0SH 2FS9A 1C1SA 2QF3A 4NSVA 3M37A 2LNCA 4AGKA 3SUDA 1P2MA 3CS7A 2K1QA 1GG6B 2G51A 3T27A 1QBOA 1BTPA 1XXDA 2PUQH 1T8LA 4ZXXH 1S5SA 2ZPRA 2TPIZ 2JETB 1DANH 2FPZA 2ILNA 4YLUA 1AGJA 1QA0A 1N6YA 3RXQA 1OS8A 4HFPB 2B8OH 4TYDA 1IQIA 1C2JA 2ZFRH 1O3GA 4MPXA 1GHAF 1JMOH 1HV7A 3FZZA 1QL7A 5PTPA 5T3HA 2RA3A 1LHFH 4IC5A 4R0IA 2YNBA 1C5SA 3ZVAA 1SHYA 2UWLA 3M3TA 2W7UA 1EPTC 1JBUH 3SU4A 1OWEA 2ODPA 5C1YA 3RUOA 2THFB 1BHXB 1J8AA 1OYTH 1ELGA 3URCA 3H7TA 1VITG 2AGEX 3TITA 2OQUA 1VCQA 2PR3A 5CE1A 3P70B 1UTNA 3GCTF 5T6GA 1PPGE 3L33A 1G3DA 1AHTH 1GJ6A 1TX7A 4WVPE 2NU3E 4WJG2 1W0YH 3PLPA 3ZZCA 5GIBA 1YLCA 1O2LA 1ZOMA 3H09A 4I8HA 1S6HA 3RXCA 1LVMA 2OD3B 1K1OA 2FX4A 1L4DA 1BRUP 1C1MA 2TGDA 4RN6A 3A82A 1BB0B 2GV6A 1XUJA 1AWHB 4X2WA 1GMCF 3VXFH 1A2CH 5DO4H 1NPMA 1Z8GA 4Y8YA 1L2EA 3UOPA 4XBDA 1AUTC 4HTCH 2A4RA 3F6UH 3V0XA 2SFAA 3T2NA 2XXLA 3BTWE 1TYNA 3GYLB 1F5RA 1O3FA 1HCGA 1VZQH 1K1LA 1QQUA 3I29A 3RMLH 3LOXA 3QUMP 3QZQA 2VWOA 3M36A 1ARBA 1UK3A 3KQEA 1JWTA 3W94A 4K5ZA 4WWYA 2J9NA 9ESTA 1MBMA 4X6MA 5TCAA 1ZMLA 2FEQH 2ZTZA 4JYTA 2Q1JA 1ZRBA 3TJOA 1V2OT 1B5GH 1U6QA 5C1XA 4NWKA 3LH3A 1CHOF 1MKWK 1KLJH 4FUCA 2BXTH 2QAAA 1MMJN 3GCOA 1ANDA 1TNGA 2Z3EA 3ODDA 3VB5A 1O2KA 2H9TH 2A2QH 1ANEA 1V2LT 2ASUB 2GZ9A 8GCHG 1W11U 2ZC9H 2R3UA 1O2JA 4HGCA 5AHGH 4YOIA 1HUTH 1BBRH 1E35B 1JIRA 2H1UA 3D65E 1RTLA 2AYWA 1DE7H 3FVFB 3VB6A 4Z0KA 1O3MA 3TJVA 2CN0H 2ZIQH 1WUNH 3ENSB 1AIXH 1C9PA 1K2I1 4KTUA 1ELEE 2OTVA 1GJ7B 3RU4E 2WPJS 4MQAA 3AAVA 3GY4A 4FUDA 4XOJA 1TGNA 3IITA 2TGAA 1ELVA 4CHAC 1NC6A 4I33A 1ETTH 4OM9A 1VR1H 1XXFA 3K2UA 5ETXA 5AVDA 2CF8H 1E38B 2EI8A 5SGAE 2NU0E 2ZDMA 2AMDA 4AZ2B 4NCYA 4UE7H 2F9BH 3U9AH 1HLTH 2VJ1A 1XVOA 4THNH 3ELAH 4A1XA 2WZQA 2OK5A 2A5KA 1BQYA 4IBLH 4WH8A 1O3HA 4XSKU 2P93A 2GD4B 2Z9KA 3BF6H 3BV9B 2H5CA 5G4BA 4JZDH 3T5FH 5AFYH 4BAQB 2BOKA 1ZRKA 2FOAA 1ABJH 3MH4A 3I77A 3L6PA 1TAWA 3QTVH 3LGWA 1G30B 4FVBA 1GBDA 1N1LA 3SUFA 4AYVB 1O2GH 2J94A 3PMJA 1GWAA 1GI0A 5EQQA 1DITH 3BIUH 1C5YB 1C1WH 1O3EA 1MAYA 2BVRH 2C93B 2W7SA 2FOHA 1GL0E 1GMDG 1N8OC 2ZCLP 4X1RU 2BQ7B 1ZSLA 4IS5A 2Z9LA 3NXPA 1E36B 2PHBA 2FOCA 1O3PB 1PQ8A 2VVCA 7GCHF 2BLOA 1ARCA 2FMJA 1FPHH 1GGDB 2VNTA 1O3CA 1P01A 3TVJB 1CA0C 3ATMA 3MU5A 3BG8A 3TGKE 1NU9A 2ZFFH 1GJDB 1LPZB 1YP9A 1AB9B 1Y3YA 3S9BA 2SGDE 4NA7A 3TNTA 2HNTE 1GDNA 1O2VA 1GCTC 3F9HA 1THPB 1Y3WA 4WF8A 4O3UA 2A5AA 1P2NA 2ZFQH 1AMHA 1PQ7A 2XCNA 3B8JA 3V13A 3ZVCA 1GBEA 1HGTH 1GHVH 4Y11E 2F9PA 3AW1A 3RXAA 3MNBA 1PYTD 2EI6A 3VXEH 4B6FA 1SGNE 3HGNA 1BTXA 2HNTC 4X8SH 2HOBA 2GCHF 4O97A 1RJXB 1TA2A 1DM4B 1YGCH 4NZQA 3TGIE 2QIQA 2H9EH 3RLWH 1VGCC 4ISOA 2OC1A 1BMLA 3HGPA 3JZ2B 1H8IH 2ZGXH 2ZWLH 1IHSH 1MD8A 3VFEA 1SI5H 4Y6DA 1NRRH 1O3NA 2UWOA 1AE8H 2A4OA 3GY3A 1RGQA 6GCHG 1KSNA 2KAIA 4B1TA 1V2WT 3PV4A 3UOUA 3TIUA 3RXHA 1A46H 1UHBA 1P09A 2FLBH 3JZ1B 1EUFA 1GMHG 3SUEA 1TNIA 4VGCB 2G8TA 4CRFA 1C5RA 1SG8B 5C2ZA 1O38A 2GV7A 1H9LB 1QJ6B 2ZTYA 2BOHB 2J38A 1UVUH 4K60A 3ESTA 3U98H 1GG6C 1TFXA 1CE5A 3PWCA 5E0GA 1G2LA 2QYIA 1CSOE 1Y8TA 2BTCE 2VWMA 2PKSB 2JETC 1ACBE 1UVOA 1C1RA 1BZXE 5BRRE 1G36A 1QBNA 4F4OC 3MH5A 1NZQH 1FV9A 1SBWA 1WU1A 1TGBA 1SMFE 2VIPA 5BPEA 4X0WU 1G3BA 2QXJA 4FUJA 3A7VA 3A83A 1YPKH 1LO6A 4YOJA 1A61H 3LDXH 5GNDA 5CMXH 2ZFPH 3ZVBA 4K8YA 1C5UA 4JMYA 1TNJA 1LKAA 1QB9A 3S9AA 5ESBA 4ZUHA 2BDBA 1ELAA 2ZF0H 2ALVA 4WMEA 1LPGB 3SJKA 2O9QA 1V2NT 1CT0E 1IQHA 1C5MD 4FU8A 5DP8A 5JB8S 2XWBI 2PKAB 3VPKA 1ZHPA 1V2PT 3OU0A 1ZSKA 2UUJB 3TH4H 2TRMA 1S0RA 8ESTE 1HAZB 1O32A 2VIVA 1PPZA 1GHXH 2A2XH 3BN9A 1YYY1 2ZDVH 1TMBH 3FZDA 1C2MA 4D8NA 4BAOB 5K0HA 5DP5A 1BUIA 4F49A 3G01A 1EAUA 1J14A 1EZXC 1RD3B 1CBWB 1YLDA 1MKXH 1K1IA 1QY6A 5EG4A 1ZHMA 2GX4A 2PFEA 1DPOA 2FODA 2OXSA 1SGRE 2HGTH 1V3XA 3UY9A 3VB3A 1J9CH 1LHCH 1S84A 1DVAH 3PTBA 3ZZDA 1GHAG 1IQKA 1DFPA 2B5TB 1LVBA 3KQCA 1FN6A 3KF2A 1NY22 1O2HA 4YLQH 1UTJA 5J4SA 2C8WB 3T25A 4I32A 3OY6U 4WXVA 1IQGA 1GHWH 3OY5U 1NFUA 5DKMA 1HIAB 1ID5H 1ESBA 3A7YA 1O2YA 3RXLA 3RMOH 1FY5A 1D3QB 1XKBC 1F0TA 5E0HA 1BIOA 1BCUH 4ABHA 5HM2A 3TGJE 4XFQA 2QA9E 3FAOA 2ZU3A 3GCTG 1K21H 1FN8A 1TE0A 2V6NA 2P8OB 3O8BA 1DX5M 1KLTA 4FUHA 3RC4A 1TRMA 5DK1A 1QQ4A 4KTSA 1YCPK 3UQVA 1EAWA 4NG9H 1SGIB 1UVPA 4X2XA 2ZA5A 3TK6A 1HBTH 3A80A 4Y71A 1C2FA 2H5DA 4NGAH 4ZH8A 5E8EH 1E34B 3K6ZA 2SGAA 2OBQA 1DS2E 5FPYA 1AQ7A 1OWDA 4IC6A 5F8TA 3RC5A 1G32B 4K1TA 2ZG0H 1GMCG 2O8UA 3M61U 3D49H 1WTHD 1TPPA 1K28D 4H6TA 1MAXA 3Q77A 5TJXA 1SLXB 4OGXA 1Z8JB 1YPEH 3CENA 5AF9H 1GBAA 5EGMA 3ITIA 5L30H 2IOTA 2P3UB 1P11E 1ZYOA 2FIRH 1ZLRA 1MTNB 3FANA 2ZDAH 1AUJA 3BTFE 4D7FA 4IN1A 1QFKH 1EZQA 2ZHQH 2ZHDA 3A86A 5FHTA 5DP9A 3UR6A 4MPUA 1B0FA 1FONA 1BTYA 2BQWB 1FY4A 1C2LA 1NU7B 2FS8A 1LHGH 1TRYA 1HAGE 4SGAE 2LPRA 2ALPA 2Z3CA 4CH2B 3KIDU 1F0SA 1T4VH 5FCKA 7KMEH 2WPMS 1QRXA 4NWLA 4Z6AH 4INLA 1S0QA 2H2ZA 4K2YA 4AN7A 3ZZBA 5HM9A 2GCTB 1VITH 3D23A 1IHTH 1IQLA 5F8XA 1P2KA 1SQAA 4Q2KA 4U01A 3ZZ4A 2BVSH 3LGIA 4PROA 1EPTA 3OYPA 3NPSA 1UK4A 2WYJA 2BY8X 3Q3KA 1P9SA 4UFGH 2F91A 2XNIA 1FY1A 3EQ0H 4JZ1A 2G81E 1HAHH 3SV8A 1QIXB 2W26A 1RTKA 1Z1JA 2FM2A 1SHHB 3UNQA 2H9HA 2CHAB 3M35A 4MLFB 2GMTB 2ZHFH 3LT3A 1P2JA 1NN6A 4DY7B 3LGYA 4DG4A 1HJ9A 1GGDC 3OSYA 3RP2A 1C5WB 1DY9A 5JBCS 2QN5T 2QGRA 2RCEA 1GBIA 1CT4E 1NFXA 3UQOA 1NO9H 1K1NA 2WUCA 1GJ5H 2J34A 4MTBA 3SN8A 3TU7H 3GDVA 1L0ZA 1AB9C 3KNXA 4XDEA 1NRSH 1H8DH 4X1PU 2ZNKH 3UIRA 1EP6A 1O3AA 1UTMA 2VINA 1EXFA 3GOVB 1EQ9A 4UONA 1AZ8A 4ISIH 1IAUA 3KEEA 1SPJA 5T6DA 1N6XA 4ABEA 2Z7FE 4ZHMU 1GVZA 3SUGA 2FTMA 2GT7A 2F4LA 1ELDE 1MU8B 3U1IB 1ANCA 3A8BA 2NU4E 3PMAB 1QURH 3PMHB 1SR5C 5A2MH 1K1PA 3EE0B 1W2KH 2BDCA 5L2YH 3M3VA 1HAOH 3BG4B 5JYIA 1FLEE 3SGAE 1DWEH 2A31A 1NESE 1SGCA 1NFYA 4GUXA 3A7TA 2Y82A 2GT8A 5HMAA 1O31A 7GCHG 1DXWA 1DLEA 2ZI2H 3PV5A 3SZEA 3ZYDA 1GJBB 4UD9H 1P10A 2WYGA 2BY5X 1FJSA 2EEKA 1V2UT 2ZDKA 1TBRH 1LVOA 3MHWU 1BMMH 1BRCE 3EA7A 2C4FH 1O3OA 2ZZUH 2CXVA 5C20A 6ESTA 4GLYA 3A81A 1QGFA 1O2XA 1P8VC 1WQSA 1HAPH 2A7JA 3GY6A 2C8XB 4TY7A 4AFZA 3SHCH 3PYHA 3ZZAA 1UJ1A 4VGCC 2BY6X 1C5TA 4BNRA 1AFEH 2VH0A 1F0UA 1W14U 2Y81A 4BTTB 3MTYA 7LPRA 1QRZA 3N7OA 1PQAA 1AVWA 2FXRA 1LCYA 3I78A 1OP8A 1UK2A 4DJZB 2R9PA 1G9IE 4X1SU 5DP6A 1ZSJA 2FOBA 2Y80A 4JK5A 3K6YA 1YKTA 1HXFH 2AIQA 4TY6A 4MPWA 3SNCA 2PKSC 1D9IA 5B6OA 4GCHF 4ABIA 3BTDE 9LPRA 1GPZA 1QRWA 1XKAC 3SU6A 4K1SA 4IGDA 2BLVA 2G55A 2FYQA 1C1OA 1DY8A 3RLYH 5FPSA 1SVPA 1KLIH 1TPOA 4DW2U 3LGVA 2VBCA 1FIZA 2XCFA 4BAMB 2XRCA 4RKJB 4ABJA 1KXAA 1O5EH 2QY0B 3PO1B 1IQMA 5C1UA 3OTPA 1GJAB 4B71A 1FI8A 1ETSH 1KXDA 3RU4T 1GI4A 3HK6B 3SNAA 2F9VA 1O2OA 2J4IA 1MTVA 4RKOB 3MH6A 4CREA 5H4IB 4Y8ZA 4Y7BA 2ZU5A 1MQ5A 1GCDA 3A8DA 3TNSA 4XBCA 1K1JA 4X1QU 1O5CB 1S83A 2ZDNA 1BRAA 2FI4E 1PPHE 3QWCH 1AKSA 3MNXA 2CF9H 3M7UA 1CGIE 3SU1A 2VU8E 1ZMJA 1CBWC 1Q2WA 2G52A 2Y5GA 1MU6B 3A8CA 3GY7A 1JXPA 1JRSA 4NFEA 4A7IB 1MTWA 1FPCH 4JK6A 5F6MA 1A5HA 5JDUB 5B6LA 1H9IE 3UUZA 3LJOA 3P8GA 4DVAU 1O3DA 2AERH 2XBYA 1ZGVA 5HYOA 2G5VA 4R8TB 3E8LA 3FP6E 3SORA 5FX6A 4FU7A 3TPIZ 3E0NB 1NRQH 1C5XB 4KGAA 4RI0A 1TRNA 2HRVA 5J4QA 1SGFG 2DE8A 4QT8C 3UREA 4WMFA 1V2VT 1B0EA 1UO6A 1TONA 1O5AB 2A4QA 2P8OC 1Q31A 2AIPA 3QN7A 4ABFA 3SJ8A 1UCYK 3MI4A 4ZHLU 2D26C 3E91A 1A0HB 2D8WA 3V3MA 3AW0A 3PB1E 1BT7A 3A87A 3F9EA 6LPRA 4AG2A 3KQBA 1H1BA 3BTTE 2PLXA 3K65B 3LIWA 4LZ4B 4K8BA 4IMZA 1C4U2 4DURA 4ISHH 2B7DH 1BHXF 5LPEA 1C1QA 3DA9B 1SOZA 1ZZZA 3E1XB 2ZEBA 4ABGA 2SGPE 1FNIA 5DGJA 1C4V2 3ZZ3A 3TH2H 1OPHB 2AGIX 5EQRA 3T28A 1C2GA 3ATIA 3U8TH 1RS0A 1LQDB 1NM6A 3GY8A 3BTEE 1CGJE 1HAVB 1O34A 4UFEH 1CGHA 1GI5A 2ZKSA 2XC0A 1WXRA 1C1VH 3UTUH 4A1TA 1MTNC 3MO9A 4NZLA 1PQ5A 3VB4A 3MWIU 3V12A 2XC5A 4BXSA 1QR3E 2WPLS 2VIQA 1EAIA 4U30A 1GBBA 2QC2A 3SBKA 3C27B 4XBBA 2H6MA 4B73A
chains in the Genus database with same CATH superfamily
5FL7D 4A1VA 1GI1A 2YNAA 1T32A 3VB7A 1FDPA 3Q76A 3ATKA 2BD2A 3EDXB 4AX9H 4DIHH 1H9HE 3E16B 3RXEA 5A8XA 1MCTA 3M7TA 1SB1H 4WXIA 4X2VA 2GGVB 1GBMA 2EC9H 1KXCA 4Y7AA 3F2GA 3NZIA 4B76A 1NBME 5I46H 1GBFA 2FOGA 2XBVA 4GHTA 2GCTC 1W7XH 3RXBA 5JPMH 1A7SA 2GKVE 1SFIA 1Z1IA 1O36A 2ZU1A 2HLCA 2Q6DA 3ZVEA 3QDZB 5A0AE 1A5GH 3QTOH 3F9GA 5EU8A 1EOLA 1GJ9B 2ZTXA 2W3IA 2B0FA 2XW9A 1GJ4H 1FAKH 1MTUA 3O8DA 4AGJA 1O2IA 2CJIA 3WWBA 3TH3H 1GI9B 2FOMB 2CHAC 2FX6A 1IQFA 2GMTC 1GHYH 4D76A 2ANMH 2PV9B 5DSFA 1UTQA 1ELCA 4TWWA 3A8AA 2AFQB 3F2FA 3P8NA 2HWLB 4DT7B 3MNCA 1BTWA 3P95A 3HK3B 3CS0A 3DUXH 3A84A 3OE7D 4B6EA 3STJA 1V2KT 1GJCB 3C1KA 3SI4H 5E2OA 1YBWA 5HIZA 1NS3A 1SQTA 3F2HA 3GS9A 1F5LA 1LMWB 5EPYA 1O2WA 2TIOA 2BB4A 1BITA 1YPJH 1WCZA 1P3EA 1CT2E 1ZJKA 4H4FA 1MKWH 1OOKB 1GBJA 2OC7A 1IQNA 1EJMA 2GDDA 1P2OA 1UVTH 2CGAA 1CVWH 2FDAA 4FETA 4ABDA 1HJAB 1KXBA 3A88A 1W10U 3SI3H 1QCPA 4B2AA 1GHZA 4OS6A 4D9RA 3A7WA 1H4WA 2EI7A 2SGFE 3BG4C 3CNRA 5GPIB 1O3KA 1FMGA 1RFNA 1PPEE 2FWWA 2IPHA 2WUBA 3KYGA 3RC6A 4AFSA 1ELFA 4OS5A 1V2MT 1SLVB 4A92A 1Y5BT 3GY5A 1V2JT 3LGTA 2O8WA 1GI8B 2AMQA 3FOAA 5FAHA 2NWNA 5FPTA 2AHME 2KCYA 3H7OA 2V3HH 2A7CA 4FUFA 1WOFA 1JOUB 4HZHA 1OWIA 3MNSA 3R0FA 2QXIA 2ZQ2A 1PYTC 4OS4A 1B7XB 1XM1A 3RM0H 1HRTH 2R3YA 3AAUA 3TK5A 4B2CA 1MQ6A 1SLUB 2R0LA 1DSUA 4KTCA 1TALA 4E7NA 1FQ3A 5CHAB 3Q3XA 4M7GA 3SNEA 5FBIA 2SGQE 1BTHH 5A0BA 3W95A 1UTOA 1A5IA 3Q3YA 4Y8XA 1L4ZA 4X6NA 1Z8IB 4LZ1H 4HI3A 4ZMAH 2OQ5A 4Q80A 1W8BH 4U2WA 3HPTB 5AFZH 4Y10E 1AY6H 1HJ8A 3MOCA 3K9XB 3PM3A 4KKDA 1O2TA 1AO5A 4F48B 5LPFA 2ZGHA 3NK8A 1ELBA 4BOHA 5EODA 1RIWB 3BEFB 4JYUH 1S81A 2IJD1 3E3TA 1P12E 2ESTE 2ZFSA 2B9LA 1YPGH 1KDQB 4Y0ZE 1KY9A 2Y5HA 1EJAA 1W7GH 1O5BB 3SOSA 2Q6GA 2BD8A 5DG6A 2AEIH 1C2IA 3U28C 3ZZ5A 3U69H 2PSYA 3NWUA 5F8ZA 5GCHF 1BBRK 1V2TT 3AK5A 3U8RH 4IW4E 5LGOA 4ISNA 1Y3VA 1YM0A 2ZP0H 5DJ7A 2ZQ1A 1WQVH 3MU8A 4AFUA 3ATLA 3EE7A 1YC0A 1AVXA 2ODYB 3EA8A 3HKJB 4U32A 3LU9B 3E0PB 3PO1C 2Y7XA 2VVVA 2ANYA 1SC8U 3NUMA 1O33A 2JH6D 1SFQB 3BSQA 3F0PA 1Y5AT 1SGFA 4ZHAA 3LONA 2FI3E 2PWXA 1CA0B 3ZZ8A 1EKBB 1ZMNA 3KGPA 2G00A 1T31A 1SGQE 3U1JB 3PMBB 1C2HA 1EASA 2OC8A 2VIWA 2BYAX 2D2DA 5C67A 5FX5A 3B23B 3RXTA 1LDTT 1Y3UA 4JYVH 2UUYA 3H5CB 1HPGA 3HATH 1DUAA 1IQEA 4X8TH 1CHOG 4GCHG 2WPIS 3SV7A 1O2NA 3A85A 3FP7E 1PFXC 2GP9B 1O2SA 4INKA 2ZPQA 4JZEH 3SZNA 1HNEE 2O8TA 4MNWA 4Q7YA 1O2PA 4TWYA 5DP7A 3EA9A 3T26A 1TGCA 1VCPA 4CR5A 3LC3A 3UWJH 1GHBF 4RT1A 2Q6FA 4ACBA 1EOJA 3KCGH 3DD2H 4ISLA 1PPBH 2WPKS 4YM9A 1QJ7B 1EB2A 1NRPH 4FUEA 5JBAS 4DGJA 2GTBA 1C5NH 2ZGJA 1T4UH 2FZZA 2LP6A 1LVYA 1T8NA 4GPGA 2F9NA 1OP0A 5EOKA 3P8OA 3SJIA 1AD8H 1T8OA 5DN6D 4NIYA 1MUEB 4O9VA 2FI5E 1HFDA 3RMMH 2PSXA 4DIIH 1A0JA 8KME2 2ANWA 2XOKD 3ZVFA 1MD7A 1P03A 4X8VH 1A1RA 1DOJA 1KYNA 1ZR0A 2P59A 1O0DH 2BX4A 2WV5A 4MNXA 3F9FA 4DCDA 1ZPZA 1K9OE 1EZSC 4X1NU 1TOCB 2C90B 1GBTA 1NRNH 8LPRA 5C3NA 2FTLE 2JH5D 3BEUA 4A6LA 3OFND 4Y79A 2AMPA 2JJ2D 1XVMA 4CRAA 1GI3A 5DP3A 3SU0A 3M5NA 2A45B 4FUBA 4BAHB 1D6RA 3TK9A 4D7GA 2OCVB 2CV3A 4GAWA 2DE9A 3SNBA 3GCHB 1LHDH 1TOMH 3URDA 1MH0A 2KAIB 2BD9A 2ODQA 4Q7ZA 4B75A 1O2ZA 2ZFTA 1XUHA 1EP5A 4Q7XA 1C2KA 2STAE 1UHBB 4ABBA 1TBQH 2ANKH 5GWZA 3WY8A 1G3CA 3SQHE 4AYYB 4OS2A 5C5OA 5K7RA 2XYAA 1GI2A 3LKWA 5GJ4B 2FO9A 2HALA 1O39A 2XC4A 3A89A 1OSSA 3MO6A 3RU4D 1TX8A 5JB9S 4AG1A 3F1SB 3LH1A 3BTHE 1S6FA 5EXMA 5EJZA 2O8LA 2D1JA 5A09A 1O3IA 1C9TA 2OUAA 2WV9A 4BXWA 4AB8A 3D62A 1DWBH 1ZTJA 3UWIA 1TWXB 3UNRA 1QA7A 2TGTA 3MMGA 2J98A 4NSYA 2UUKB 2BLQA 3KL6A 3QO6A 3MO3A 1HB0B 3PROA 3RXUA 5L2ZH 5DP4A 3VGCB 1JIMA 1HAYB 3MU1A 3PLKA 3RXRA 2RDEA 2Z9JA 4CRCA 4UFFH 1TNLA 1W0JD 1TMUH 2NU2E 1EB1H 3BTQE 1F5KU 5I25A 1GI7B 3RXIA 4M9FA 3AVZA 6CHAB 3RXVA 1LQEA 1Q3XA 3DSGA 2O8MA 5T6FA 4CBOA 2AH4X 5EXLA 1QNJA 3EAJA 4INHA 2GCHG 3KYFA 2BY7X 1XUIA 2PKAA 2G4TA 3RXMA 1AFQB 1P2IA 1TBZH 2SNVA 1V2RT 1YPLH 4DOQA 1Z7KA 1D4PB 5LH8A 1FXYA 3IG6B 1SSXA 3ZZ9A 1UW7A 1GVKB 1FIWA 3FN8A 2JKHA 2Y5FA 2J5UA 5A8YA 3RXPA 1FY3A 2JH0D 2A7HA 4Y0YE 3NKKA 3FP8E 1BJUA 2FYRA 4B74A 2VIOA 1HAIH 2EA3A 2WPHS 1WSSH 2KR7A 3TJUA 1TGSZ 3PWBA 2SNWA 2J2UA 2R2MB 1F0RA 4MVNA 1AVGH 1CO7E 2HVXA 1Y59T 2BLWA 4KP0A 3EGKH 2C8ZB 1MCVA 1YCPH 2EY4C 3ZV8A 2HNTF 2M5TA 3QLPH 1OX1A 3M3SA 2ZHEH 3T62A 1TABE 4FUIA 2A32A 1HJAC 1C4Y2 2F83A 5EJLA 2VGCB 1NFWA 2QF0A 3DCLA 1O5DH 3S69A 1HIAA 1O30A 2CMYA 2HPPH 3UB0A 1FUJA 1L1NA 2M2AA 4RSPA 2BDIA 1C5LH 1XMNB 3O8CA 1UMAH 4JZFH 1K22H 3RM2H 3VEQB 3LGUA 2VB0A 1BTZA 4CRGA 4YESB 3S9CA 1C5ZB 1MKXK 1LTOA 1AU8A 3UFAA 1O3LA 1ETRH 1KDQA 2GZ8A 2BHGA 4ZKOU 3ZVGA 3SV6A 1TPSA 4AORA 2F9OA 1ZGIA 1D3PB 4AB9A 1QZ8A 1TPAE 4NIWA 3M7QA 5HGGA 1P02A 3GDSA 3DT0H 2RA0A 1TQ7B 5CHAC 5EQSA 3RXSA 3L3TA 1PPFE 2ZO3H 1HYLA 2XWAA 4MPVA 3ZYEA 1A3BH 2XBXA 2V3MA 1BDAA 1BRBE 3LC5A 3OEHD 1H8ED 1Y5UT 3MU0A 4K3JA 1CA8B 3HKIB 1YWUA 4ZAEA 1DT2A 2BD4A 2BMGB 2ZCKP 1TIOA 3PRBA 1QJ1B 3VG8A 2P3FH 4ESTE 1J15A 3GDUA 5E0JA 2GDEH 1SQOA 1RIWC 3BEIB 4OGYA 1OYQA 1C5VA 1W12U 2Z9IA 5LPRA 1ESAA 1F2SE 1O5FH 4CR9A 2FLRH 5EPNA 2P95A 4I8LA 1VITF 4WH6A 4I8GA 4OS7A 5FCRA 2W6ID 3SV9A 1XUFA 5A0CA 4CRDA 2OLGA 2W6JD 4MNYA 2GVFA 4I31A 2V3OH 1BA8B 4GVUA 1SGYE 1TA6A 3RDZA 1SGEE 4NA8A 3SO3A 4TPYA 2ZU2A 4H42U 2G5NA 1C5OH 5EXNA 4BTUB 5EW2H 5C0TA 2QXHA 3N7DA 1UTPA 3RXGA 2OINA 4YT7H 3GYMA 1DSTA 1EZUC 1MBQA 2BXUH 2VIDA 2YMSD 1QL9A 1BMAA 4X6OA 1G37A 1OWJA 1NT1A 2PTNA 2WV4A 3P6ZB 1C5QA 2J95A 2F9UA 2KCAA 3B9FH 1FAXA 1V6DA 2A4GA 3DFLA 3STIA 1KIGH 2DUCA 4IN2A 1GBLA 4FUGA 1WYKA 3RXFA 3ZIAD 1SGTA 3GICB 4ZKSU 5IDKA 2BDHA 3R3GB 2OBOA 1SOTA 1KTTB 3UR9A 2AS9A 4ABAA 1ABIH 1AWFH 1EPTB 1UCYE 2G4UA 2SGEE 3T29A 4H6SB 2ZDLA 4TSFD 2XNDD 1MZDA 2QV1A 3TLOA 5ABWA 1T8MA 3AASA 1ZTLA 4YZUA 1RTFB 1INCA 1KXFA 4FOUC 3ZV9A 5GCHG 1XUGA 4TPIZ 3S7HB 4WMDA 5FBEA 4CRBA 2A1DB 3QK1A 3SU3A 4WY3A 3ZZ7A 1P05A 1O3JA 2FESH 3BTKE 1P06A 1V2QT 2P16A 2KCOA 1THRH 2BM2A 1TGTA 4UEHH 1L1GA 1A0LA 1PPCE 4YT6H 1KXEA 5HXFA 3RXKA 8GCHF 2C3SA 2GZ7A 2R2WU 5GXPA 2PGBB 1LHEH 3FFGA 2QCYA 5E2PA 1HAXB 1QTFA 2BY9X 4CH8B 1EATA 2PGQB 4JZIA 1THSH 2BVXH 2HPQH 2IJOB 3GY2A 2BDGA 3SJOA 1A4WH 4KELA 1BJVA 1CQQA 1S6LA 2PTCE 4LOYH 1O2UA 3KQDA 3SU2A 1C2EA 2ZPSA 4GHQA 5IK2D 5HKKD 2VVUA 2BD5A 3QGNB 3LJJA 1V2ST 2ZGBH 1LPKB 4YOGA 3V7TA 1JRTA 5DPAA 4E06H 2UWPA 1J17T 2VWNA 3U8OH 3S0NA 2W3KA 2P3TB 1T7CA 1YCPM 2ZGCA 4LXBH 3SQEE 1S82A 1XUKA 1QL8A 3E6PH 3CP7A 1TMTH 3QGJA 1DICA 3LPRA 4CBNA 1L1JA 3A7ZA 3S7KB 1Z6JH 2BZ6H 3OTJE 3M5LA 1S85A 2BX3A 4LK4A 1CU1A 5FXLA 3GCNA 2PW8H 1GHBG 1Z71A 4BANB 1OWHA 3GCHC 3MU4A 3UNSA 1ANBA 3UPEA 1QBVH 3FKSD 4Y76A 1GI6A 1VJAU 2ULLA 3A7XA 4XE4A 1W13U 1C1TA 2BQ6B 1ZPBA 2OC0A 4IMQA 2XTTB 3F3BA 1P2QA 1WBGB 4NIVA 1QB6A 1WTGH 1SGPE 1O37A 4ZKNU 1RXPA 3F68H 5JBBS 4X8UH 3P17H 2FOFA 1VCWA 1HXEH 4TT3D 2Z9GA 4XD7D 1CHGA 2AGGX 4ZROA 1A3EH 4FXGH 1EJNA 5F03A 4YTAA 1GJ8B 1C1NA 5T1VA 1OWKA 3ZZ6A 1C2DA 1ELTA 2Z94A 3DFJA 4CHAB 1GMDF 1YF4A 1EAXA 2ZHWH 4AOQA 2C8YB 1TNKA 3RXDA 1E1RD 3VGCC 2PUXB 1D6WA 1E37B 1SKYE 2JJ1D 2F3CE 1F7ZA 2BZAA 1EFRD 3RXJA 3PLBA 1VJ9U 4JCNA 3PV2A 3SGQE 1WAYB 1FZZA 4NIXA 1QHRB 6CHAC 2WHXA 1UVSH 1SGDE 1GBKA 4E05H 4FVDA 1MTSA 4J2YB 4HG6A 1GVLA 1NROH 1ZJDA 1FY8E 1O2MA 4MNVA 4NFFA 1WV7H 4OS1A 4MG3A 4NA9H 3OX7U 3RMNH 1W3CA 1NTPA 2BDYA 1AFQC 1TLDA 2I6QA 1BTUA 1O35A 2XBWA 2Z6BD 2A5IA 5ESTE 3ODFA 3M5OA 4I7YH 3PTNA 4SGBE 1QB1A 4ZCNA 1Z6EA 1DUEA 2BDAA 3KHVA 5C5NA 1BMNH 1GDQA 2I6SA 1GBCA 3QZRA 1C5PA 1IOEA 2RDLA 1UTLM 3DSPA 4MDSA 3QX5H 1O2RA 1E0FD 2A0QB 2LELA 3E90B 3MYWA 3SYJA 3BIVH 5A8ZA 1AKSB 1ZPCA 5GDSH 2OP9A 2UUFB 1N8OB 1W0ZU 4BAKB 1DLKB 5L6NH 1P9UA 2WINI 3P8FA 2QF5A 2ZU4A 1J16A 3SV2H 2QXGA 3Q00A 1C1UH 2YOLA 4J1YA 3ZVDA 1UCYH 2Z3DA 1KTSB 2VWLA 2Y7ZA 1YPMH 1K1MA 1EX3A 1MABB 2BD7A 2ZECA 4ASHA 2VGCC 4P02A 4K69A 4I8JA 3MH7A 3SGBE 6GCHF 3SJ9A 1YPHE 3O8RA 2V35A 1YLNA 1ORFA 1GDUA 1F92A 2VH6A 1TX6A 1RRKA 3P92A 3SU5A 4I8KA 2R0KA 1GCTB 3ATWA 1GMHF 5KEDA 1P57B 2Y6TA 1AI8H 3M5MA 1DDJA 2ZCHP 1ZHRA 4X2YA 2J92A 1O3BA 1GL1A 2P94A 5TCCA 3W1EA 3EYDA 1BBRE 1M9UA 4GSOA 1YPHC 1ZTKA 4UFDH 5EW1H 1G3EA 1D3TB 2TGPZ 1AN1E 4ZKRU 1GBHA 3MFJA 5IYTA 2TBSA 1SLWB 1G2MA 1AZZA 2NU1E 1MZAA 4YO9A 1DWDH 2IN2A 1VGCB 4K1EA 4ZXYH 1IQJA 1PJPA 1K0HA 5C94A 2BD3A 1P04A 4A5TS 3TJNA 3DSOA 2FOEA 4O03A 1ESTA 1X7AC 4X6PA 1AE5A 1UTKA 1DWCH 1LKBA 1O5GH 3BTME 4FU9A 3SW2B 3BTGE 2W5EA 1C1PA 1HDTH 2V0BA 3KN2A 3NCLA 2FP7B 4E7RG 4B2BA 1HAVA 3IWMA 4O3TA 4AFQA 3RXOA 1Y3XA 1OXGA 1SL3A 5JBTA 3GISB 3DHKH 3SHAH 7ESTE 2STBE 1Z8RA 1P3CA 1XX9A 1TNHA 3SNDA 4D9QA 1TB6H 1BOQA 1OKXA 1TQ0B 1O2QA 1D3DB 1DXPA 1OP2A 4BTIB 2RG3A 4UDWH 1P0SH 2FS9A 1C1SA 2QF3A 4NSVA 3M37A 2LNCA 4AGKA 3SUDA 1P2MA 3CS7A 2K1QA 1GG6B 2G51A 3T27A 2L74A 1QBOA 1BTPA 1XXDA 2PUQH 5KECA 1T8LA 4ZXXH 1S5SA 2ZPRA 2TPIZ 2JETB 1DANH 2FPZA 2ILNA 4YLUA 1AGJA 1QA0A 1N6YA 3RXQA 1OS8A 4HFPB 2B8OH 4TYDA 1IQIA 1C2JA 2ZFRH 1O3GA 4MPXA 1GHAF 1JMOH 1HV7A 3FZZA 1QL7A 5PTPA 5T3HA 2RA3A 1LHFH 3UAIC 4IC5A 4R0IA 2YNBA 1C5SA 3ZVAA 1SHYA 2UWLA 3M3TA 2W7UA 1EPTC 1JBUH 3SU4A 1OWEA 2ODPA 5C1YA 3RUOA 2THFB 1BHXB 1J8AA 1OYTH 1ELGA 2YMSB 3URCA 3H7TA 1VITG 2AGEX 3TITA 2OQUA 1VCQA 2PR3A 5CHBA 5CE1A 3P70B 1UTNA 3GCTF 5T6GA 1SQRA 1PPGE 3L33A 1G3DA 1AHTH 1GJ6A 1TX7A 4WVPE 2NU3E 3KQ5A 4WJG2 4ACAA 1W0YH 3PLPA 3ZZCA 5GIBA 1YLCA 1O2LA 1ZOMA 3H09A 4I8HA 1S6HA 2F43B 3RXCA 1LVMA 2OD3B 1K1OA 2FX4A 1L4DA 1BRUP 1C1MA 1E1QD 2TGDA 4RN6A 3A82A 1BB0B 2GV6A 1XUJA 1AWHB 2L6OA 4X2WA 1GMCF 3VXFH 1A2CH 5DO4H 1NPMA 1Z8GA 4Y8YA 1L2EA 3UOPA 4XBDA 1AUTC 4HTCH 2A4RA 3F6UH 3V0XA 2SFAA 3T2NA 2XXLA 3BTWE 1TYNA 3GYLB 1F5RA 1O3FA 2QF4A 1HCGA 1VZQH 1K1LA 1QQUA 5C0UA 3I29A 3RMLH 3LOXA 2RFKC 3QUMP 3QZQA 2VWOA 3M36A 1ARBA 1UK3A 3KQEA 1JWTA 5F53A 3W94A 4K5ZA 4WWYA 2J9NA 9ESTA 1MBMA 4X6MA 5TCAA 1ZMLA 2FEQH 2ZTZA 4JYTA 2Q1JA 1ZRBA 3TJOA 1V2OT 1B5GH 1U6QA 5C1XA 4NWKA 3LH3A 1CHOF 1MKWK 1KLJH 4FUCA 2BXTH 2QAAA 1MMJN 3GCOA 1ANDA 1TNGA 2Z3EA 3ODDA 3VB5A 1O2KA 2H9TH 2A2QH 1ANEA 1V2LT 2ASUB 2GZ9A 5KGOA 8GCHG 1W11U 2ZC9H 2R3UA 1O2JA 4HGCA 5AHGH 4YOIA 1HUTH 1BBRH 1E35B 1JIRA 2H1UA 3D65E 1RTLA 2AYWA 1DE7H 3FVFB 3VB6A 4Z0KA 1O3MA 3TJVA 2CN0H 2ZIQH 2GJGA 1WUNH 3ENSB 1AIXH 1C9PA 1K2I1 4KTUA 1ELEE 2OTVA 1GJ7B 3RU4E 2WPJS 4MQAA 3AAVA 3GY4A 4FUDA 4XOJA 1TGNA 3IITA 2TGAA 1ELVA 4CHAC 1NC6A 4I33A 1ETTH 4OM9A 4RT0A 1VR1H 1XXFA 3K2UA 5ETXA 5AVDA 2CF8H 1E38B 2EI8A 5SGAE 2NU0E 2ZDMA 2AMDA 4AZ2B 4NCYA 4UE7H 2F9BH 3U9AH 1HLTH 2VJ1A 1XVOA 4THNH 3ELAH 2WZQA 2OK5A 4A1XA 2A5KA 1BQYA 4IBLH 4WH8A 1NBMD 1O3HA 4XSKU 2P93A 2GD4B 2Z9KA 3BF6H 3BV9B 2H5CA 5G4BA 4JZDH 3T5FH 5AFYH 4BAQB 2BOKA 1ZRKA 2FOAA 1ABJH 3MH4A 3I77A 3L6PA 1TAWA 3QTVH 3LGWA 1G30B 4FVBA 1GBDA 1N1LA 3SUFA 4AYVB 1O2GH 2J94A 3PMJA 1GWAA 2V7QD 4I86A 1GI0A 5EQQA 1DITH 3BIUH 1C5YB 1C1WH 1O3EA 1MAYA 4AC9A 2BVRH 2C93B 2W7SA 2FOHA 1GL0E 1GMDG 1N8OC 2ZCLP 4X1RU 2BQ7B 1ZSLA 4IS5A 2Z9LA 3NXPA 1E36B 2PHBA 2FOCA 1O3PB 1PQ8A 2VVCA 7GCHF 2BLOA 1ARCA 2FMJA 1FPHH 1GGDB 2VNTA 1O3CA 1P01A 3TVJB 1CA0C 3ATMA 3MU5A 3BG8A 3TGKE 1NU9A 2ZFFH 3NRLA 1GJDB 1LPZB 1YP9A 1AB9B 1Y3YA 3S9BA 2SGDE 4NA7A 3TNTA 2HNTE 1GDNA 1O2VA 1GCTC 3F9HA 1THPB 1Y3WA 4WF8A 4O3UA 2A5AA 1P2NA 2ZFQH 1AMHA 1PQ7A 2XCNA 3B8JA 3V13A 3ZVCA 1GBEA 1HGTH 1GHVH 4Y11E 2F9PA 3AW1A 3RXAA 3MNBA 1PYTD 2EI6A 3VXEH 4B6FA 1SGNE 3HGNA 1BTXA 2HNTC 4X8SH 2HOBA 2GCHF 4O97A 5EIYA 1RJXB 1TA2A 1DM4B 1YGCH 4NZQA 3TGIE 2QIQA 2H9EH 3RLWH 1VGCC 3N99A 4ISOA 2OC1A 1BMLA 3HGPA 3JZ2B 1H8IH 2ZGXH 2ZWLH 1IHSH 1MD8A 3VFEA 1SI5H 4Y6DA 1NRRH 1O3NA 2UWOA 1AE8H 2A4OA 3GY3A 1RGQA 6GCHG 1KSNA 2KAIA 4B1TA 1V2WT 3PV4A 3UOUA 3TIUA 3RXHA 1A46H 1UHBA 1P09A 2FLBH 3JZ1B 1EUFA 1GMHG 1H8HD 2K0QA 3SUEA 1TNIA 4VGCB 2G8TA 4CRFA 1C5RA 1SG8B 5C2ZA 1O38A 2GV7A 1H9LB 1QJ6B 2ZTYA 2BOHB 2J38A 1UVUH 4K60A 3ESTA 3U98H 1GG6C 1TFXA 1CE5A 2CK3D 3PWCA 5E0GA 1G2LA 2QYIA 1CSOE 1Y8TA 2BTCE 2VWMA 2PKSB 2JETC 1ACBE 1UVOA 1C1RA 1BZXE 5BRRE 1G36A 1QBNA 4F4OC 3MH5A 1NZQH 2J98B 1FV9A 1SBWA 1WU1A 1TGBA 1SMFE 2VIPA 5BPEA 4X0WU 1G3BA 2QXJA 4FUJA 3A7VA 3A83A 1YPKH 1LO6A 5GNDA 1A61H 3LDXH 4YOJA 2IPQX 2ZFPH 3ZVBA 5CMXH 4K8YA 1C5UA 4JMYA 1TNJA 1LKAA 1QB9A 2YMSC 2KZ4A 5ESBA 3S9AA 4ZUHA 2BDBA 1ELAA 5CDFE 2ZF0H 2ALVA 4WMEA 1LPGB 3SJKA 2O9QA 1V2NT 1CT0E 1IQHA 1C5MD 4FU8A 5DP8A 5JB8S 2XWBI 2PKAB 3VPKA 1ZHPA 1V2PT 3OU0A 1ZSKA 2UUJB 3TH4H 2TRMA 1S0RA 8ESTE 1HAZB 1O32A 2VIVA 1PPZA 1GHXH 2A2XH 3BN9A 1YYY1 2ZDVH 3OEED 1TMBH 3FZDA 1C2MA 4D8NA 4BAOB 5K0HA 5DP5A 1BUIA 4F49A 3G01A 1EAUA 1J14A 2K8IA 1EZXC 1RD3B 1CBWB 1YLDA 1MKXH 1K1IA 1QY6A 5EG4A 1ZHMA 2GX4A 2PFEA 1DPOA 2FODA 2OXSA 1SGRE 2HGTH 1V3XA 3UY9A 3VB3A 1J9CH 1LHCH 1S84A 1DVAH 3PTBA 3ZZDA 1GHAG 1IQKA 1DFPA 2B5TB 1LVBA 3KQCA 1FN6A 3KF2A 1NY22 1O2HA 4YLQH 1UTJA 4Z1MD 5J4SA 2C8WB 3T25A 4I32A 3OY6U 4WXVA 1IQGA 1GHWH 3OY5U 1NFUA 5DKMA 1HIAB 1ID5H 1ESBA 3A7YA 1O2YA 3RXLA 3RMOH 1FY5A 1BMFD 1D3QB 1F0TA 1XKBC 5E0HA 1BIOA 1BCUH 4ABHA 5HM2A 3TGJE 2JIZD 2J97A 4XFQA 2QA9E 3FAOA 2ZU3A 3GCTG 1K21H 1FN8A 1TE0A 2V6NA 2P8OB 3O8BA 1DX5M 1KLTA 4FUHA 3RC4A 1TRMA 5DK1A 1QQ4A 4KTSA 1YCPK 3UQVA 1EAWA 4NG9H 1SGIB 1UVPA 4X2XA 2ZA5A 3TK6A 1HBTH 3A80A 4Y71A 1C2FA 2H5DA 4NGAH 4ZH8A 5E8EH 1E34B 3K6ZA 1COWD 2SGAA 2OBQA 1DS2E 5FPYA 1AQ7A 1OWDA 4IC6A 5F8TA 3RC5A 1G32B 4K1TA 2ZG0H 1GMCG 2O8UA 3M61U 3D49H 1WTHD 1TPPA 2WPDD 1YY3A 4Q63A 1K28D 4H6TA 1MAXA 3Q77A 5TJXA 1SLXB 4OGXA 1Z8JB 1YPEH 3CENA 5AF9H 1GBAA 5EGMA 3ITIA 5L30H 2IOTA 2P3UB 1P11E 1ZYOA 2FIRH 1ZLRA 1MTNB 3FANA 2ZDAH 1AUJA 3BTFE 4D7FA 4IN1A 1QFKH 1EZQA 2ZHQH 2ZHDA 3A86A 5FHTA 5DP9A 3UR6A 4MPUA 1B0FA 1FONA 1BTYA 2BQWB 1FY4A 1C2LA 3PRDA 1NU7B 2FS8A 2QE7D 1LHGH 1TRYA 2HLDD 1HAGE 4SGAE 2LPRA 2ALPA 2Z3CA 4CH2B 3KIDU 1F0SA 1T4VH 5FCKA 7KMEH 2WPMS 1QRXA 4NWLA 4Z6AH 4INLA 1S0QA 2H2ZA 4K2YA 4AN7A 3ZZBA 5HM9A 2GCTB 1VITH 3D23A 1IHTH 1IQLA 5F8XA 4ASUD 1P2KA 1SQAA 2KM0A 4Q2KA 4U01A 2KCPA 3ZZ4A 2BVSH 3LGIA 3N7EA 4PROA 1EPTA 3OYPA 3NPSA 1UK4A 2WYJA 2BY8X 3Q3KA 1P9SA 4UFGH 2F91A 2XNIA 1FY1A 3EQ0H 4JZ1A 2G81E 1HAHH 2JDID 3SV8A 1QIXB 2W26A 1RTKA 1Z1JA 2FM2A 1SHHB 3UNQA 2H9HA 2CHAB 3M35A 4MLFB 2GMTB 2ZHFH 3LT3A 1P2JA 1NN6A 4DY7B 3LGYA 4DG4A 1HJ9A 1GGDC 3OSYA 3RP2A 1C5WB 1DY9A 5JBCS 2QN5T 2QGRA 2RCEA 1GBIA 1CT4E 1NFXA 3UQOA 1NO9H 1K1NA 2WUCA 3WWFA 1GJ5H 2J34A 4MTBA 3SN8A 3TU7H 3GDVA 1L0ZA 1AB9C 3KNXA 4XDEA 1NRSH 1H8DH 4X1PU 2ZNKH 3UIRA 1EP6A 1O3AA 1UTMA 3MQKC 2VINA 1EXFA 2KX4A 3GOVB 1EQ9A 4UONA 1AZ8A 4ISIH 1IAUA 3KEEA 1SPJA 5T6DA 1N6XA 4ABEA 2Z7FE 4ZHMU 1GVZA 3SUGA 2F4LA 2FTMA 2GT7A 1E79D 1ELDE 1MU8B 3U1IB 1ANCA 3A8BA 2NU4E 3PMAB 1QURH 3PMHB 1SR5C 3WW7A 5A2MH 1K1PA 3EE0B 1W2KH 2BDCA 5L2YH 3M3VA 1HAOH 3BG4B 5JYIA 1FLEE 3SGAE 1DWEH 2A31A 1NESE 1SGCA 1KMHB 1NFYA 4GUXA 3A7TA 1WDIA 2GT8A 2Y82A 5HMAA 1O31A 7GCHG 1DXWA 4Q4LA 1DLEA 2ZI2H 3PV5A 3SZEA 3ZYDA 1GJBB 4UD9H 1P10A 2WYGA 2BY5X 1FJSA 5HIYA 5C17A 2EEKA 1V2UT 2PP6A 1FX0B 2ZDKA 1TBRH 1LVOA 3MHWU 1BMMH 1BRCE 3EA7A 2C4FH 1O3OA 2ZZUH 4DT4A 2CXVA 5C20A 6ESTA 4GLYA 3A81A 1QGFA 4YXWD 1O2XA 1P8VC 1WQSA 1HAPH 2A7JA 3GY6A 2C8XB 4TY7A 4AFZA 3SHCH 3PYHA 3ZZAA 1UJ1A 4VGCC 2BY6X 1C5TA 4BNRA 1AFEH 2VH0A 1F0UA 1W14U 2Y81A 4BTTB 3MTYA 7LPRA 1QRZA 3N7OA 1PQAA 1AVWA 2FXRA 1LCYA 3I78A 1OP8A 1UK2A 4DJZB 2R9PA 1G9IE 4X1SU 5DP6A 1ZSJA 2FOBA 2Y80A 4JK5A 3K6YA 1YKTA 1HXFH 2AIQA 4TY6A 3F0OA 4MPWA 3SNCA 2PKSC 1D9IA 5B6OA 4GCHF 4ABIA 3BTDE 9LPRA 1GPZA 1QRWA 1XKAC 3SU6A 4K1SA 4IGDA 2BLVA 2G55A 2FYQA 1C1OA 1DY8A 3RLYH 5FPSA 1SVPA 1KLIH 1TPOA 4DW2U 3LGVA 2VBCA 1FIZA 2XCFA 4BAMB 2XRCA 4RKJB 4ABJA 1KXAA 1O5EH 2QY0B 3PO1B 1W0KD 1IQMA 5C1UA 4XRNA 3OTPA 1GJAB 4B71A 1FI8A 1ETSH 1KXDA 3RU4T 1GI4A 3HK6B 3SNAA 2F9VA 1O2OA 2J4IA 1MTVA 4RKOB 3MH6A 4P00A 4CREA 5H4IB 4Y8ZA 4Y7BA 2ZU5A 1MQ5A 1GCDA 3A8DA 3TNSA 4XBCA 4F55A 1K1JA 4X1QU 1O5CB 1S83A 2ZDNA 1BRAA 2FI4E 2EQNA 1PPHE 3QWCH 1AKSA 3MNXA 2CF9H 3M7UA 1CGIE 3SU1A 2VU8E 5EJ1A 1ZMJA 1CBWC 1Q2WA 2G52A 2Y5GA 1MU6B 3A8CA 3GY7A 1JXPA 1JRSA 2WSSD 4NFEA 4A7IB 1MTWA 1FPCH 4JK6A 5F6MA 1A5HA 5B6LA 5JDUB 1H9IE 3UUZA 3LJOA 3P8GA 4DVAU 1O3DA 2AERH 2XBYA 1ZGVA 5HYOA 2G5VA 4R8TB 3E8LA 3FP6E 3SORA 5FX6A 4FU7A 3TPIZ 3E0NB 1NRQH 1C5XB 4KGAA 4RI0A 1TRNA 2HRVA 5J4QA 1SGFG 2DE8A 4QT8C 3UREA 4WMFA 1V2VT 1B0EA 1UO6A 1TONA 1O5AB 2A4QA 2P8OC 1Q31A 2AIPA 2HVYB 3QN7A 4ABFA 3SJ8A 1UCYK 3MI4A 4ZHLU 2D26C 3E91A 1A0HB 2D8WA 3V3MA 3AW0A 3PB1E 1BT7A 3OAAD 3A87A 3F9EA 6LPRA 3FO8D 4AG2A 3KQBA 2KFWA 1H1BA 3BTTE 2PLXA 3K65B 3LIWA 4LZ4B 4K8BA 4IMZA 1C4U2 4DURA 4ISHH 2B7DH 1BHXF 5LPEA 1C1QA 3DA9B 1SOZA 1ZZZA 3E1XB 2ZEBA 4ABGA 2SGPE 1FNIA 5DGJA 1C4V2 3ZZ3A 3TH2H 1OPHB 1VKYA 2AGIX 5EQRA 3T28A 1C2GA 3ATIA 3U8TH 1RS0A 1LQDB 1NM6A 3GY8A 1OHHD 3BTEE 1CGJE 1HAVB 1O34A 4UFEH 1CGHA 1GI5A 2ZKSA 2XC0A 1WXRA 1C1VH 3UTUH 4A1TA 1MTNC 3MO9A 4NZLA 1PQ5A 3VB4A 3MWIU 3V12A 2XC5A 4BXSA 1QR3E 2WPLS 2VIQA 1EAIA 4U30A 1GBBA 2QC2A 3SBKA 3C27B 4XBBA 2H6MA 4B73A
chains in the Genus database with same CATH topology
5FL7D 4A1VA 1GI1A 2YNAA 1T32A 3VB7A 1FDPA 3Q76A 3ATKA 2BD2A 3EDXB 4AX9H 4DIHH 1H9HE 3E16B 3RXEA 5A8XA 1MCTA 3M7TA 1SB1H 4WXIA 4X2VA 2GGVB 1GBMA 2EC9H 1KXCA 4Y7AA 3F2GA 3NZIA 4B76A 1NBME 5I46H 1GBFA 2FOGA 2XBVA 4GHTA 2GCTC 1W7XH 3RXBA 5JPMH 1A7SA 2GKVE 1SFIA 1Z1IA 1O36A 2ZU1A 2HLCA 2Q6DA 3ZVEA 3QDZB 5A0AE 1A5GH 3QTOH 3F9GA 5EU8A 1EOLA 1GJ9B 2ZTXA 2W3IA 2B0FA 2XW9A 1GJ4H 1FAKH 1MTUA 3O8DA 4AGJA 1O2IA 2CJIA 3WWBA 3TH3H 1GI9B 2FOMB 2CHAC 2FX6A 1IQFA 2GMTC 1GHYH 4D76A 2ANMH 2PV9B 5DSFA 1UTQA 1ELCA 4TWWA 3A8AA 2AFQB 3F2FA 3P8NA 2HWLB 4DT7B 3MNCA 1BTWA 3P95A 3HK3B 3CS0A 3DUXH 3A84A 3OE7D 4B6EA 3STJA 1V2KT 1GJCB 3C1KA 3SI4H 5E2OA 1YBWA 1NS3A 1SQTA 5EPYA 3F2HA 1F5LA 1LMWB 3GS9A 1O2WA 2TIOA 2BB4A 1BITA 1YPJH 1WCZA 1P3EA 1CT2E 1ZJKA 4H4FA 1MKWH 1OOKB 1GBJA 2OC7A 1IQNA 1EJMA 2GDDA 1P2OA 1UVTH 2CGAA 1CVWH 2FDAA 4FETA 4ABDA 1HJAB 1KXBA 3A88A 1W10U 3SI3H 1QCPA 4B2AA 1GHZA 4OS6A 4D9RA 3A7WA 1H4WA 2EI7A 2SGFE 3BG4C 5GPIB 1O3KA 1FMGA 1RFNA 1PPEE 2FWWA 2IPHA 2WUBA 3RC6A 4AFSA 1ELFA 4OS5A 1V2MT 1SLVB 4A92A 1Y5BT 3GY5A 1V2JT 3LGTA 2O8WA 1GI8B 2AMQA 3FOAA 5FAHA 2NWNA 5FPTA 2AHME 2KCYA 3H7OA 2V3HH 2A7CA 4FUFA 1WOFA 1JOUB 4HZHA 1OWIA 3MNSA 3R0FA 2QXIA 2ZQ2A 1PYTC 4OS4A 1B7XB 1XM1A 3RM0H 1HRTH 2R3YA 3AAUA 3TK5A 4B2CA 1MQ6A 1SLUB 2R0LA 1DSUA 4KTCA 1TALA 4E7NA 1FQ3A 5CHAB 3Q3XA 4M7GA 3SNEA 5FBIA 2SGQE 1BTHH 5A0BA 3W95A 1UTOA 1A5IA 3Q3YA 4Y8XA 1L4ZA 4X6NA 1Z8IB 4LZ1H 4HI3A 4ZMAH 2OQ5A 4Q80A 1W8BH 4U2WA 3HPTB 5AFZH 4Y10E 1AY6H 1HJ8A 3MOCA 3K9XB 3PM3A 4KKDA 1O2TA 1AO5A 5LPFA 2ZGHA 3NK8A 1ELBA 4BOHA 5EODA 1RIWB 3BEFB 4JYUH 1S81A 2IJD1 3E3TA 1P12E 2ESTE 2ZFSA 2B9LA 1YPGH 1KDQB 4Y0ZE 1KY9A 2Y5HA 1EJAA 1W7GH 1O5BB 3SOSA 2Q6GA 2BD8A 5DG6A 2AEIH 1C2IA 3ZZ5A 3U69H 2PSYA 3NWUA 5F8ZA 5GCHF 1BBRK 1V2TT 3AK5A 3U8RH 4IW4E 5LGOA 4ISNA 1Y3VA 1YM0A 2ZP0H 5DJ7A 2ZQ1A 1WQVH 3MU8A 4AFUA 3ATLA 1YC0A 1AVXA 2ODYB 3EA8A 3HKJB 4U32A 3LU9B 3E0PB 3PO1C 2Y7XA 2VVVA 2ANYA 1SC8U 3NUMA 1O33A 2JH6D 1SFQB 3BSQA 3F0PA 1Y5AT 1SGFA 4ZHAA 3LONA 2FI3E 2PWXA 1CA0B 3ZZ8A 1EKBB 1ZMNA 3KGPA 2G00A 1T31A 1SGQE 3U1JB 3PMBB 1C2HA 1EASA 2OC8A 2VIWA 2BYAX 2D2DA 5C67A 5FX5A 3B23B 3RXTA 1LDTT 1Y3UA 4JYVH 2UUYA 3H5CB 1HPGA 3HATH 1DUAA 1IQEA 4X8TH 1CHOG 4GCHG 2WPIS 3SV7A 1O2NA 3A85A 3FP7E 1PFXC 2GP9B 1O2SA 4INKA 2ZPQA 4JZEH 3SZNA 1HNEE 2O8TA 4MNWA 4Q7YA 1O2PA 4TWYA 5DP7A 3EA9A 3T26A 1TGCA 1VCPA 4CR5A 3LC3A 3UWJH 1GHBF 2Q6FA 1EOJA 3KCGH 3DD2H 4ISLA 1PPBH 2WPKS 4YM9A 1QJ7B 1EB2A 1NRPH 4FUEA 5JBAS 4DGJA 2GTBA 1C5NH 2ZGJA 1T4UH 2FZZA 1LVYA 1T8NA 4GPGA 2F9NA 1OP0A 5EOKA 3P8OA 3SJIA 1AD8H 1T8OA 5DN6D 4NIYA 1MUEB 4O9VA 2FI5E 1HFDA 3RMMH 2PSXA 4DIIH 1A0JA 8KME2 2ANWA 2XOKD 3ZVFA 1MD7A 1P03A 4X8VH 1A1RA 1DOJA 1KYNA 1ZR0A 2P59A 1O0DH 2BX4A 2WV5A 4MNXA 3F9FA 4DCDA 1ZPZA 1K9OE 1EZSC 4X1NU 1TOCB 2C90B 1GBTA 1NRNH 8LPRA 5C3NA 2FTLE 2JH5D 3BEUA 4A6LA 3OFND 4Y79A 2AMPA 2JJ2D 1XVMA 4CRAA 1GI3A 5DP3A 3SU0A 3M5NA 2A45B 4FUBA 4BAHB 1D6RA 3TK9A 4D7GA 2OCVB 2CV3A 4GAWA 2DE9A 3SNBA 3GCHB 1LHDH 1TOMH 3URDA 1MH0A 2KAIB 2BD9A 2ODQA 4Q7ZA 4B75A 1O2ZA 2ZFTA 1XUHA 1EP5A 4Q7XA 1C2KA 2STAE 1UHBB 4ABBA 1TBQH 2ANKH 5GWZA 3WY8A 1G3CA 3SQHE 4AYYB 4OS2A 5C5OA 5K7RA 2XYAA 1GI2A 3LKWA 5GJ4B 2FO9A 2HALA 1O39A 2XC4A 3A89A 1OSSA 3MO6A 3RU4D 1TX8A 5JB9S 4AG1A 3F1SB 3LH1A 3BTHE 1S6FA 5EXMA 2O8LA 2D1JA 5A09A 1O3IA 1C9TA 2OUAA 2WV9A 4BXWA 4AB8A 3D62A 1DWBH 1ZTJA 3UWIA 1TWXB 3UNRA 1QA7A 2TGTA 3MMGA 4NSYA 2UUKB 2BLQA 3KL6A 3QO6A 3MO3A 1HB0B 3PROA 3RXUA 5L2ZH 5DP4A 3VGCB 1JIMA 1HAYB 3MU1A 3PLKA 3RXRA 2Z9JA 4CRCA 4UFFH 1TNLA 1W0JD 1TMUH 2NU2E 1EB1H 3BTQE 1F5KU 5I25A 1GI7B 3RXIA 4M9FA 3AVZA 6CHAB 3RXVA 1LQEA 1Q3XA 2O8MA 5T6FA 4CBOA 2AH4X 5EXLA 1QNJA 3EAJA 4INHA 2GCHG 2BY7X 1XUIA 2PKAA 2G4TA 3RXMA 1AFQB 1P2IA 1TBZH 2SNVA 1V2RT 1YPLH 4DOQA 1Z7KA 1D4PB 5LH8A 1FXYA 3IG6B 1SSXA 3ZZ9A 1GVKB 1FIWA 3FN8A 2JKHA 2Y5FA 2J5UA 5A8YA 3RXPA 1FY3A 2JH0D 2A7HA 4Y0YE 3NKKA 3FP8E 1BJUA 2FYRA 4B74A 2VIOA 1HAIH 2EA3A 2WPHS 1WSSH 2KR7A 3TJUA 1TGSZ 3PWBA 2SNWA 2J2UA 2R2MB 1F0RA 4MVNA 1AVGH 1CO7E 2HVXA 1Y59T 2BLWA 4KP0A 3EGKH 2C8ZB 1MCVA 1YCPH 3ZV8A 2HNTF 2M5TA 3QLPH 1OX1A 3M3SA 2ZHEH 3T62A 1TABE 4FUIA 2A32A 1HJAC 1C4Y2 2F83A 2VGCB 1NFWA 2QF0A 3DCLA 1O5DH 3S69A 1HIAA 1O30A 2CMYA 2HPPH 3UB0A 1FUJA 1L1NA 2M2AA 4RSPA 2BDIA 1C5LH 1XMNB 3O8CA 1UMAH 4JZFH 1K22H 3RM2H 3VEQB 3LGUA 2VB0A 1BTZA 4CRGA 4YESB 3S9CA 1C5ZB 1MKXK 1LTOA 1AU8A 3UFAA 1O3LA 1ETRH 1KDQA 2GZ8A 2BHGA 4ZKOU 3ZVGA 3SV6A 1TPSA 4AORA 2F9OA 1ZGIA 1D3PB 4AB9A 1TPAE 4NIWA 3M7QA 5HGGA 1P02A 3GDSA 3DT0H 2RA0A 1TQ7B 5CHAC 5EQSA 3RXSA 3L3TA 1PPFE 2ZO3H 1HYLA 2XWAA 4MPVA 3ZYEA 1A3BH 2XBXA 1BDAA 1BRBE 3LC5A 3OEHD 1H8ED 1Y5UT 3MU0A 4K3JA 1CA8B 3HKIB 4ZAEA 1DT2A 2BD4A 2BMGB 2ZCKP 1TIOA 3PRBA 1QJ1B 4ESTE 2P3FH 3VG8A 1J15A 3GDUA 5E0JA 2GDEH 1SQOA 1RIWC 3BEIB 4OGYA 1OYQA 1C5VA 1W12U 2Z9IA 5LPRA 1ESAA 1F2SE 1O5FH 4CR9A 2FLRH 5EPNA 2P95A 4I8LA 1VITF 4WH6A 4I8GA 4OS7A 5FCRA 3SV9A 2W6ID 1XUFA 5A0CA 4CRDA 2OLGA 4MNYA 2W6JD 2GVFA 4I31A 2V3OH 1BA8B 4GVUA 1SGYE 1TA6A 3RDZA 1SGEE 4NA8A 3SO3A 4TPYA 2ZU2A 4H42U 2G5NA 1C5OH 5EXNA 4BTUB 5EW2H 5C0TA 2QXHA 3N7DA 1UTPA 3RXGA 2OINA 4YT7H 3GYMA 1DSTA 1EZUC 1MBQA 2BXUH 2VIDA 2YMSD 1QL9A 1BMAA 4X6OA 1G37A 1OWJA 1NT1A 2PTNA 2WV4A 3P6ZB 1C5QA 2J95A 2F9UA 2KCAA 3B9FH 1FAXA 1V6DA 2A4GA 3DFLA 3STIA 1KIGH 2DUCA 4IN2A 1GBLA 4FUGA 1WYKA 3RXFA 3ZIAD 1SGTA 3GICB 4ZKSU 5IDKA 2BDHA 3R3GB 2OBOA 1SOTA 1KTTB 3UR9A 2AS9A 4ABAA 1ABIH 1AWFH 1EPTB 1UCYE 2G4UA 2SGEE 3T29A 4H6SB 2ZDLA 4TSFD 2XNDD 1MZDA 2QV1A 3TLOA 5ABWA 1T8MA 3AASA 1ZTLA 4YZUA 1RTFB 1INCA 1KXFA 3ZV9A 5GCHG 1XUGA 4TPIZ 3S7HB 4WMDA 5FBEA 4CRBA 2A1DB 3QK1A 3SU3A 4WY3A 3ZZ7A 1P05A 1O3JA 2FESH 3BTKE 1P06A 1V2QT 2P16A 2KCOA 1THRH 2BM2A 1TGTA 4UEHH 1L1GA 1A0LA 1PPCE 4YT6H 1KXEA 5HXFA 3RXKA 8GCHF 2C3SA 2GZ7A 2R2WU 5GXPA 2PGBB 1LHEH 3FFGA 2QCYA 5E2PA 1HAXB 1QTFA 2BY9X 4CH8B 1EATA 2PGQB 4JZIA 1THSH 2BVXH 2HPQH 2IJOB 3GY2A 2BDGA 3SJOA 1A4WH 4KELA 1BJVA 1CQQA 1S6LA 2PTCE 4LOYH 1O2UA 3KQDA 3SU2A 1C2EA 2ZPSA 4GHQA 5IK2D 5HKKD 2VVUA 2BD5A 3QGNB 3LJJA 1V2ST 2ZGBH 1LPKB 4YOGA 3V7TA 1JRTA 5DPAA 4E06H 2UWPA 1J17T 2VWNA 3U8OH 3S0NA 2W3KA 2P3TB 1T7CA 1YCPM 2ZGCA 4LXBH 3SQEE 1S82A 1XUKA 1QL8A 3E6PH 3CP7A 1TMTH 3QGJA 1DICA 3LPRA 4CBNA 1L1JA 3A7ZA 3S7KB 1Z6JH 2BZ6H 3OTJE 3M5LA 1S85A 2BX3A 4LK4A 1CU1A 5FXLA 3GCNA 2PW8H 1GHBG 1Z71A 4BANB 1OWHA 3GCHC 3MU4A 3UNSA 1ANBA 3UPEA 1QBVH 3FKSD 4Y76A 1GI6A 1VJAU 2ULLA 3A7XA 4XE4A 1W13U 1C1TA 2BQ6B 1ZPBA 2OC0A 4IMQA 2XTTB 3F3BA 1P2QA 1WBGB 4NIVA 1QB6A 1WTGH 1SGPE 1O37A 4ZKNU 1RXPA 3F68H 5JBBS 4X8UH 3P17H 2FOFA 1VCWA 1HXEH 4TT3D 2Z9GA 4XD7D 1CHGA 2AGGX 4ZROA 1A3EH 4FXGH 1EJNA 5F03A 4YTAA 1GJ8B 1C1NA 5T1VA 1OWKA 3ZZ6A 1C2DA 1ELTA 2Z94A 3DFJA 4CHAB 1GMDF 1YF4A 1EAXA 2ZHWH 4AOQA 2C8YB 1TNKA 3RXDA 1E1RD 3VGCC 2PUXB 1D6WA 1E37B 1SKYE 2JJ1D 2F3CE 1F7ZA 2BZAA 3RXJA 1EFRD 3PLBA 1VJ9U 4JCNA 3PV2A 3SGQE 1WAYB 1FZZA 4NIXA 1QHRB 6CHAC 2WHXA 1UVSH 1SGDE 1GBKA 4E05H 4FVDA 1MTSA 4J2YB 1GVLA 1NROH 1ZJDA 1FY8E 1O2MA 4MNVA 4NFFA 1WV7H 4OS1A 4MG3A 4NA9H 3OX7U 3RMNH 1W3CA 1NTPA 2BDYA 1AFQC 1TLDA 2I6QA 1BTUA 1O35A 2XBWA 2Z6BD 2A5IA 5ESTE 3ODFA 3M5OA 4I7YH 3PTNA 4SGBE 1QB1A 4ZCNA 1Z6EA 1DUEA 2BDAA 3KHVA 5C5NA 1BMNH 1GDQA 2I6SA 1GBCA 3QZRA 1C5PA 1IOEA 2RDLA 1UTLM 3DSPA 4MDSA 3QX5H 1O2RA 1E0FD 2A0QB 3E90B 3MYWA 5A8ZA 2LELA 3BIVH 3SYJA 1AKSB 1ZPCA 5GDSH 2OP9A 2UUFB 1N8OB 1W0ZU 4BAKB 1DLKB 5L6NH 1P9UA 2WINI 3P8FA 2ZU4A 2QF5A 1J16A 3SV2H 2QXGA 3Q00A 1C1UH 2YOLA 4J1YA 3ZVDA 1UCYH 2Z3DA 1KTSB 2VWLA 2Y7ZA 1YPMH 1K1MA 1EX3A 1MABB 2BD7A 2ZECA 4ASHA 2VGCC 4K69A 4I8JA 3MH7A 3SGBE 6GCHF 3SJ9A 1YPHE 3O8RA 2V35A 1ORFA 1GDUA 1F92A 2VH6A 1TX6A 1RRKA 3P92A 3SU5A 4I8KA 2R0KA 1GCTB 3ATWA 1GMHF 1P57B 2Y6TA 1AI8H 3M5MA 1DDJA 2ZCHP 1ZHRA 4X2YA 2J92A 1O3BA 1GL1A 2P94A