3ATWA

Structure-based design, synthesis, evaluation of peptide-mimetic sars 3cl protease inhibitors
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
300
structure length
300
Chain Sequence
SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRKSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKFYGPFVDIQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords 3C-Like Proteinase
publication title Structure-Based Design, Synthesis, and Evaluation of Peptide-Mimetic SARS 3CL Protease Inhibitors.
pubmed doi rcsb
source organism Sars coronavirus
total genus 85
structure length 300
sequence length 300
chains with identical sequence B
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2011-01-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1840.10 Mainly Alpha Orthogonal Bundle main proteinase (3clpro) structure, domain 3 main proteinase (3clpro) structure, domain 3 3atwA03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3atwA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3atwA02
1LQDB 1FAXA 1T8NA 2HNTF 2PSXA 5H4IB 1GJ6A 1YPLH 1BDAA 3LH1A 4UD9H 1HAVB 2AGEX 1HRTH 1NFUA 1V6DA 1Z8JB 5E0JA 3T27A 1K1JA 1EATA 1JXPA 1Z1JA 3P92A 1MBQA 3OX7U 3T25A 1YF4A 2D26C 1C2DA 3RXTA 3OY6U 1KXEA 4CH8B 4FXGH 2FOBA 4UFEH 3GY4A 1DITH 1O3KA 4INHA 4IS5A 1HDTH 2ZHEH 1LVOA 1XUKA 1LPZB 3KGPA 4UONA 1C1NA 1MTVA 4X2VA 4BTIB 1KY9A 2CHAC 4X8SH 2BY6X 3UY9A 2FZZA 1O2SA 1CHGA 4I33A 4X1RU 3CENA 1K1IA 1FMGA 1LKBA 3TJUA 3SNAA 1OP2A 1Z8RA 3FANA 3GCTF 3RXJA 4PROA 5E0HA 1QFKH 1A3BH 5F6MA 2CGAA 2SGPE 2EC9H 4E7NA 2IOTA 1Y8TA 3H7OA 3O8RA 3RXQA 1MAYA 1O2IA 5LPEA 5F03A 4ZUHA 4DY7B 1C5SA 5GPIB 2XXLA 1QBVH 1ANBA 2Y82A 1GVKB 1V3XA 5CE1A 1AE5A 1SGYE 2ZCLP 4AOQA 3RUOA 2B8OH 2WV4A 3E0NB 6GCHF 4CHAB 4X6PA 2NU4E 2FOAA 4B74A 5TCCA 3VGCB 1CU1A 1O2MA 4Y8ZA 2FODA 4CBOA 3M5MA 3ATLA 3SU3A 1AMHA 1JIMA 4OS7A 3KNXA 1TA2A 2UUJB 1C1PA 1F5KU 3MOCA 2ZZUH 4X8UH 1YPHC 2P93A 2BZAA 3A8CA 2ZPRA 5FPSA 1F0RA 1G9IE 1T31A 1F7ZA 2G00A 3RMMH 1N1LA 4XSKU 2PWXA 5FCKA 3S9BA 2NU3E 2FTMA 2UWPA 3E0PB 3ZVGA 1PQ8A 2VGCC 3NZIA 2VIWA 1C5TA 2QXIA 5C5OA 1AB9B 1SGCA 4BTTB 3CP7A 2VU8E 3AVZA 1EAXA 4KTSA 5FX6A 5K7RA 2Y5FA 2BD9A 3BF6H 1S83A 4FVBA 3KHVA 1V2TT 1OX1A 2H9TH 1BRAA 5K0HA 1MBMA 1LPGB 6LPRA 1WOFA 4X2WA 4B76A 2VINA 1MKWK 2ZC9H 1C5MD 1W2KH 1WV7H 1ZMLA 2A2QH 4X0WU 1YLDA 3MH4A 4H6SB 2J38A 1EJMA 2RDLA 4FUBA 4INLA 4ZXXH 5A2MH 3MU5A 1QNJA 2ZU5A 4YO9A 4RKOB 4AZ2B 2VNTA 1GBFA 3PV4A 4SGBE 1V2PT 6CHAB 1CHOG 3AAUA 3EQ0H 5E0GA 4E06H 1O2PA 1K1NA 1XVMA 1SOTA 2OC8A 2B5TB 2P8OC 1AUTC 4AG1A 1GWAA 2A4OA 2A32A 2A2XH 1AI8H 3T29A 4I7YH 4FUCA 1SGQE 2XC0A 1BBRE 2PR3A 5DKMA 1ELFA 1O2VA 1C1QA 1BBRH 3SHAH 3V12A 4KELA 3MH6A 1SGTA 4MG3A 1FY8E 3K2UA 1G2LA 2WV5A 2XWAA 2C8YB 1YCPH 4NZLA 2BXTH 4AG2A 1EOJA 2Z9JA 2F83A 2BB4A 1AFEH 4DIIH 1NM6A 4RN6A 4AFUA 2ZFFH 1GGDB 3A83A 1BJUA 3R0FA 1J17T 3TH2H 1WTHD 1OP8A 4DIHH 1DWBH 1UVUH 3PLPA 4Y8YA 2W26A 1O5CB 1C5PA 1WYKA 4NIVA 2J94A 3ZVCA 1PQAA 2AEIH 2Z94A 3GY3A 1TE0A 1RXPA 4FU7A 2OBOA 1BRUP 1CVWH 1E36B 4OS6A 4FUHA 2PW8H 1WAYB 2AMDA 1HAHH 4E7RG 1GG6B 1MQ6A 5EW2H 4MNWA 5EPYA 4DW2U 3LU9B 4BXWA 1DXWA 3RXVA 1BRCE 2V35A 2FEQH 1XX9A 3P6ZB 4XOJA 5E2OA 2LPRA 1TMBH 2UUYA 4IGDA 2GCTC 3MNCA 1HLTH 1TPOA 1GI9B 2BYAX 1P2JA 2HNTE 1C1UH 1G3CA 1P3CA 2ZTZA 1P2OA 2JH6D 5FHTA 3M3VA 1FIWA 2WPKS 3UTUH 1XUFA 3CS0A 1SLWB 3SNEA 1SL3A 2BX4A 1HAIH 2CF8H 1ZYOA 4UFGH 3ZZBA 3SUFA 4YLQH 3ZZDA 5T6DA 1KDQA 3ZZAA 4DCDA 5JYIA 3BTTE 1OWKA 3SO3A 2OTVA 2ANKH 3ODDA 1UK3A 3D62A 1GMHG 5BRRE 2D2DA 4AGJA 3LIWA 2VIQA 4IW4E 1V2OT 1UO6A 4IC5A 2C3SA 1G36A 3T28A 4D76A 4B2BA 5AVDA 2BM2A 1ZZZA 5HGGA 1FJSA 5IYTA 1J15A 1LPKB 2OUAA 4XBDA 1TNGA 1T8OA 2ZDKA 4FUIA 1UK4A 5AHGH 1T7CA 1NU9A 1VR1H 1ZGVA 2ASUB 1QB9A 1VGCB 1F5LA 5AFZH 1EQ9A 1IQKA 1D3DB 5F8ZA 2BD5A 2WPIS 4XBBA 5EU8A 1J8AA 2ZDNA 1NS3A 2EA3A 1QJ1B 1Y59T 4AB9A 4BTUB 2O8TA 2SGDE 3P8OA 3RDZA 1QTFA 1C5RA 1C5VA 2ZU2A 1UVTH 2C8XB 3U1IB 1DWEH 1G2MA 2WYJA 4IN1A 3URDA 2AMPA 2STAE 3SJOA 3SI4H 2GCHG 3ZZ7A 1V2JT 1O2XA 7LPRA 3Q00A 1NC6A 5DJ7A 2ZU3A 2K7XA 1ZPZA 2BD7A 3RXAA 4OS1A 3SJ8A 3BEUA 1SGIB 1UMAH 1Y5UT 2ZHQH 1GI4A 2ZQ1A 3VB4A 4CR5A 1QBNA 1BUIA 3RXOA 1EZQA 4LXBH 1IHSH 3BSQA 1GJ5H 1RIWC 4ISNA 1TX6A 1EAWA 3PTNA 3M35A 1H1BA 1UVSH 1EX3A 4J2YB 3ZZ3A 1KDQB 4AN7A 1C1SA 3SORA 3EA8A 2OLGA 2PHBA 3BTHE 1V2VT 4WH8A 5GDSH 4GHTA 2ZTXA 1IQHA 5HM2A 1FY3A 2A4QA 1HAZB 5JPMH 3SNBA 3PYHA 1C4Y2 2FYRA 3W94A 4THNH 5HMAA 5FPTA 1C5LH 3Q76A 5SGAE 4YOIA 2PLXA 2AYWA 1O2UA 1O3OA 2SNWA 4FU8A 4TPIZ 4ABDA 3HPTB 2WPHS 1GHAF 1CGJE 3P8GA 1TOCB 1IQJA 1FONA 1C5YB 4ABHA 4BOHA 1TGBA 2THFB 3F9HA 1V2RT 2ZFSA 3AASA 2R0KA 2K1QA 1EUFA 3IWMA 1AKSB 2Y7ZA 1S84A 1ZMJA 2JETB 5L2YH 1TGNA 1IQMA 5CHAC 4JYUH 3T62A 1GHWH 1GMDG 1LTOA 1DM4B 2O8UA 1F0TA 3RXFA 1MUEB 1SSXA 1UTOA 1G3EA 1QL7A 1O2YA 1ELTA 2RG3A 1G37A 1DICA 3QUMP 4VGCC 4IBLH 1JOUB 4INKA 2FI5E 3A8BA 1YPHE 3GYLB 2A31A 2DE9A 4YT6H 1UTQA 1QL9A 2C90B 1OPHB 3TPIZ 4CRFA 1Z1IA 1HXEH 3M3SA 2YOLA 3PTBA 2ODPA 4A5TS 1GCDA 5E2PA 2F9NA 5ESTE 1LVBA 1GBDA 2R0LA 3MU8A 1TRMA 2P95A 1SQOA 2FDAA 4IN2A 3MU0A 1LO6A 4JK6A 1G30B 1RRKA 3DD2H 1ZJKA 4K8YA 1O2GH 2B0FA 2OC0A 5C67A 3ZV8A 4X2XA 2A7JA 5ABWA 5DP3A 5C3NA 2R3UA 5A8XA 3OU0A 3PO1C 2V6NA 1AWFH 2FLBH 2H9HA 2PKSC 2CV3A 3V3MA 2W5EA 3MI4A 4JZFH 1A0HB 1C5ZB 5JDUB 4CRBA 4B2AA 1V2ST 2A5IA 3UFAA 3NXPA 3A85A 2BTCE 2SGEE 1DSUA 2ZDAH 1P57B 3ZVDA 1J14A 1D4PB 1O5BB 1O36A 1ESBA 1QURH 2VVCA 1MZAA 3GDSA 1BBRK 1D3PB 1H4WA 3H5CB 2QCYA 4Y8XA 4NFEA 3A7VA 1LQEA 1YPMH 5EPNA 4YESB 5FX5A 2R2WU 1YCPK 1MTSA 1W14U 2WPMS 1QQ4A 1THRH 3ZZ8A 2FOGA 4GSOA 2TPIZ 1O39A 1BMAA 1L4ZA 1DUAA 1QB6A 1GHVH 1C5OH 1Z6EA 1M9UA 3MHWU 2G4TA 2BY9X 4YM9A 7ESTE 5HM9A 1S5SA 3WY8A 4FUJA 1FXYA 3U8OH 4U2WA 1N8OB 2ZNKH 1PQ5A 3ESTA 4ZHAA 1O3FA 4LK4A 3LONA 1LMWB 1GI3A 1O3HA 2AIQA 4QT8C 1AO5A 1GJCB 1C5UA 2XBXA 1BTPA 3AAVA 1HJAC 2OP9A 3RMNH 4GCHF 3M7QA 4K1SA 3C1KA 3QK1A 2SGFE 1DS2E 2EI8A 3FP6E 4CBNA 1GJ4H 3UIRA 1RGQA 1J9CH 1OYTH 1CGIE 3MYWA 2EI6A 1SPJA 4JZEH 3P95A 1P03A 2GMTB 3JZ1B 4ZAEA 3RXHA 1GVLA 2HALA 1TQ7B 2BDBA 3DT0H 4K3JA 3RXCA 4A6LA 3DFLA 3PMBB 2A7HA 3A7XA 3UWJH 3VPKA 2BDGA 5GCHF 3KQBA 5I25A 2J95A 1A7SA 1QIXB 2FPZA 3F1SB 1T8MA 3Q3KA 2QXGA 1OWIA 1WU1A 3PMHB 3SUDA 2ZI2H 4Z0KA 1K9OE 2ZCHP 1UTPA 3OYPA 1BTZA 1EAIA 3M61U 5L6NH 3SJ9A 4AFQA 3BEIB 5TCAA 6ESTA 2Z3EA 2H2ZA 1Q3XA 3TGKE 2CN0H 2DUCA 2GT7A 1GBLA 3M36A 4TWWA 3A81A 4HGCA 1UK2A 4CRAA 4JCNA 1TMUH 3ZZ5A 2VIPA 5GXPA 2P16A 2VIDA 1P04A 1TIOA 3VB5A 2C8ZB 1MCTA 4MPVA 2OC1A 2XBYA 3GOVB 4DGJA 1TB6H 4LZ4B 2VVUA 1BMMH 2G52A 2IJOB 2Z9LA 4NFFA 1S82A 1GJ7B 1CE5A 3SV2H 1XXDA 3TK9A 3BTDE 1DXPA 4WXVA 1GBEA 1GJDB 1L0ZA 3ZZ4A 1A3EH 1ZSLA 1OP0A 4CREA 1W8BH 4ABBA 2HPQH 1TFXA 2O9QA 3VEQB 4CHAC 2FYQA 2V3OH 3UREA 2XYAA 3UOPA 2BOHB 3VGCC 3ZZ6A 5LPFA 2ALVA 3STIA 1HAYB 5FXLA 4ZHLU 1WSSH 1UTMA 4B71A 2ALPA 3UQVA 2AH4X 4K5ZA 4Y71A 4ABGA 1MTUA 3ZVFA 1Q2WA 4BAOB 2ESTE 1ZOMA 2BOKA 3SU0A 3MO3A 2FO9A 1O31A 3SGBE 3VB7A 2YNAA 3RM0H 4ZMAH 4MLFB 5DK1A 1V2UT 4ZXYH 5FPYA 2BDHA 4GLYA 1OOKB 1XVOA 1WQSA 3GCNA 1C5XB 2JKHA 3MNSA 1P2IA 3S9CA 2OQ5A 1W7XH 1AB9C 1DOJA 1GPZA 2C4FH 3MNBA 2XTTB 2GV6A 4X2YA 3QX5H 1MCVA 2QF0A 1NN6A 1C1OA 1PFXC 2BLVA 4MNYA 1VITG 1C5NH 5EXLA 3A88A 3PM3A 1TAWA 4X1NU 4M7GA 3FZZA 1S81A 1J16A 1D9IA 5JBCS 1BJVA 3O8BA 3QZRA 3F9EA 1LVMA 1QL8A 4X8VH 2Z7FE 3H7TA 4AX9H 1O2NA 2PKAA 4XE4A 1VJ9U 2GTBA 1AHTH 1SGDE 5T3HA 2PTCE 2VH0A 4NWKA 1D6RA 2ZECA 1GI0A 2FM2A 1JMOH 1NFYA 4TY6A 2UWLA 2FOCA 1MH0A 4ASHA 9ESTA 4OS2A 3SGAE 3I29A 3TIUA 1V2MT 6CHAC 2QC2A 1E35B 1E34B 1ZLRA 2TBSA 1JRSA 2ZGXH 1FDPA 1O3PB 3GY2A 1GHYH 1AZZA 2ZWLH 1IQGA 1BB0B 1D6WA 1HAXB 4O03A 3RXDA 1CBWB 3TH3H 5A0CA 1CA0B 1NROH 1HV7A 1DFPA 1SGNE 1A0LA 4NGAH 2PGQB 4RKJB 1TALA 1HBTH 2KAIA 4TY7A 3E8LA 1F92A 1CGHA 2C8WB 5C1UA 4X6OA 2OXSA 1TNKA 1BT7A 3RU4D 3LH3A 1ANEA 1KLTA 4FU9A 4DOQA 1F2SE 1YLCA 3GY7A 3RXKA 2P3TB 2ULLA 3BTME 1O3NA 3TITA 2QGRA 4B2CA 1E37B 1ZRKA 1C2FA 4MPWA 1C2MA 4D9QA 1GBCA 1THPB 4AYVB 4MQAA 3UOUA 3ZVAA 2ZPSA 1S85A 4O9VA 5LPRA 1BQYA 4UFFH 1GGDC 3T2NA 2HVXA 1SC8U 3A84A 3MO6A 1TBQH 1RFNA 2A5AA 3F68H 4U01A 3LJJA 3UPEA 3ATKA 1P2QA 2IPHA 1LHCH 4NA9H 1ESAA 1BITA 3RXBA 1LHEH 3TJNA 1QA0A 2VJ1A 4ABJA 5HXFA 2QN5T 2PKAB 3RXIA 4O3TA 2Y5HA 4Q7YA 4HI3A 1QGFA 3NUMA 5T6GA 2FTLE 2O8WA 1ABIH 4K2YA 1KTSB 2NU0E 3MH5A 1GG6C 1YPKH 4O97A 3ODFA 3EA7A 2P3FH 3PROA 4JZ1A 3SV6A 7KMEH 2AIPA 7GCHG 2TGPZ 2QA9E 1MKXH 2XRCA 1XUHA 1NO9H 3LOXA 1RTFB 1XKAC 1P9SA 1AGJA 1QJ6B 3IG6B 3QTOH 1GBIA 2Q6DA 1KLJH 1Y3VA 3QN7A 2F91A 1UHBA 3E16B 1GVZA 2KAIB 2ZKSA 1QRZA 3EA9A 3RXPA 1DE7H 4Q7ZA 1IQNA 1NRPH 1GJAB 5EGMA 4ISOA 3LJOA 4D8NA 4LZ1H 1Y5BT 1YP9A 4K1EA 1P09A 5C2ZA 1XUIA 5EG4A 1TNJA 1VZQH 2FWWA 5DP8A 4DG4A 1OWHA 3L3TA 3P17H 1TA6A 2ZFTA 3K6ZA 1ELAA 2A0QB 1V2LT 3OSYA 1GMCG 3A8AA 4AFSA 2ILNA 1HAPH 1AUJA 1C9TA 2BQ6B 3AW1A 3GY8A 1QHRB 3U98H 3M37A 2WPLS 2Z9KA 3K6YA 1FUJA 3EGKH 1VGCC 2BQ7B 3GY6A 4NSVA 1AWHB 1EOLA 1BCUH 1O5FH 3SW2B 2G4UA 1TRNA 4X1SU 2JH5D 1GHZA 3FVFB 1DPOA 5DG6A 1O2JA 1FY4A 5JBAS 2TGAA 3SQEE 3U8TH 3SU2A 4DVAU 4IMZA 3BIVH 1O3IA 2GZ7A 1BA8B 1GBHA 2H5CA 4NIXA 4NG9H 1WQVH 1BMLA 1PYTC 1GHBG 2DE8A 1QCPA 2BXUH 4LOYH 5F8XA 2TRMA 3E1XB 2F9BH 1GBTA 4Z6AH 3ZV9A 5EQQA 5A8YA 1P3EA 1D3QB 1A0JA 3BIUH 3Q77A 3EBNA 4ABAA 1WUNH 1OXGA 4Y79A 5A09A 2ZHWH 1TABE 1XXFA 3FP7E 1L1JA 1OSSA 2ZGJA 4TPYA 3LKWA 1EZXC 2NWNA 1Z8GA 1K1MA 1C4U2 2ZFQH 3RXLA 1DUEA 3GCHB 2ZGBH 1ZTLA 2FLRH 2XBVA 3RXSA 2BDCA 5JB8S 1E38B 1CHOF 1SI5H 2OD3B 3NK8A 4NWLA 4OGYA 5FBIA 3QLPH 1L1NA 3PMAB 3L33A 3CS7A 2CJIA 1YPJH 4I8LA 3GISB 5EXMA 5DGJA 1QA7A 1HUTH 2ODQA 1FV9A 2Z3DA 1ZTJA 3FAOA 3UR9A 1SBWA 5JBBS 9LPRA 1HJ8A 2ZPQA 1P01A 3V7TA 4JYVH 4WMFA 3SU1A 4WWYA 5GWZA 1PQ7A 4H4FA 3E3TA 1B0FA 3P8FA 4A92A 1HFDA 1VCQA 4ABIA 2M5TA 4NCYA 1B0EA 3MMGA 4K60A 3ATMA 1O32A 1KXBA 3O8CA 2ZU1A 2G55A 3KQCA 1BMNH 3UUZA 1AY6H 4MNVA 5EQRA 2JETC 4NSYA 1Y3XA 1CSOE 1NPMA 2BDAA 3V13A 5J4QA 1GJ9B 2VIOA 1O3DA 1Y3YA 3QGJA 1F0UA 1TGSZ 1KXDA 1Q31A 2ZDMA 4D9RA 2OINA 3S7HB 2ZG0H 3LC5A 1P9UA 1C9PA 3A7YA 1A61H 2FOFA 1UVOA 3FZDA 1NFWA 3EE0B 7GCHF 1SHHB 1NRRH 4FUDA 1MTWA 4RSPA 1AIXH 4F49A 1C2KA 3MNXA 1TOMH 3SHCH 4BAQB 1SLUB 1ELDE 4XBCA 2G81E 3BTWE 1L2EA 3Q3XA 1A4WH 2BVSH 2I6QA 3EYDA 1UJ1A 1B7XB 3ZZCA 1BHXB 2R2MB 1AE8H 1L4DA 1O2WA 2TGDA 2FI3E 4YLUA 4MVNA 4NIYA 4ABEA 3QGNB 1A5HA 3T26A 3M3TA 3GCTG 2H5DA 5DP9A 1O2QA 2OC7A 3RLYH 1H8IH 1O5AB 3ZVBA 1BIOA 4B1TA 4IMQA 3U1JB 1GMHF 2AGIX 1C2HA 2A4GA 3N7OA 1ID5H 3A7TA 1OWJA 5LGOA 2ANMH 3DFJA 1ZHMA 1O3MA 4WY3A 2FMJA 5G4BA 4MTBA 4AORA 5E8EH 3TK5A 2Q6GA 2A7CA 2XC4A 4Y7BA 1PYTD 2VWNA 1W10U 3TNSA 2BY5X 3KL6A 1SLXB 1O30A 5HYOA 4K69A 2ZFRH 4CRDA 4U32A 4E05H 4WMDA 5L30H 1P11E 3A7WA 3SZNA 2XWBI 5FAHA 2SFAA 1O2HA 3OTJE 1N6YA 1EB1H 4Y0YE 3SU4A 5DP6A 1AVGH 2BLWA 1GCTB 1RTLA 3B9FH 2FIRH 1EPTA 1SQTA 1K1LA 4WMEA 2VWLA 3JZ2B 5F8TA 1GI6A 2NU1E 2FXRA 3VB3A 1HAOH 3HGPA 4CRCA 3SNDA 1O3LA 1GI1A 1O2OA 3TJOA 1ELVA 2O8LA 1N8OC 1P02A 5GIBA 1MU6B 2HGTH 3SV8A 3VXFH 4BAHB 2XNIA 4JZIA 4BAKB 1OWEA 1C1MA 2GCHF 4Y6DA 3MO9A 1ANCA 3VFEA 3UQOA 1AFQB 1GBBA 2JH0D 2XCFA 4XDEA 2OCVB 1C2IA 4Q7XA 2R9PA 2OQUA 1CQQA 1CO7E 2C93B 2ZU4A 1QR3E 3QWCH 4MPUA 2TIOA 1O2RA 1BTYA 1DWCH 3ENSB 1HYLA 2GMTC 1YC0A 1MKXK 1Z6JH 1V2NT 2A1DB 3TLOA 4HTCH 1EZUC 3TNTA 2H9EH 1KLIH 1TX8A 1KSNA 1UTKA 3MWIU 1GDUA 3BG4B 4ZKOU 1H9LB 1SG8B 3DUXH 2J34A 1TPSA 2ZHDA 4KGAA 3BV9B 4FUFA 2FOEA 1G32B 3LPRA 1W11U 1WBGB 1DT2A 4ABFA 3RXEA 1VCPA 4X8TH 1THSH 5A0BA 2PUXB 4H6TA 4TYDA 2ANYA 1SVPA 1N6XA 1HNEE 4MPXA 4U30A 1P10A 3SBKA 2ZFPH 3UR6A 1NZQH 2WYGA 1Z71A 2PSYA 1MTNB 1PJPA 1BTUA 1YBWA 2QYIA 1RD3B 1KXAA 2GDDA 2UUKB 1DLKB 1EPTB 1O3BA 2HPPH 3FFGA 5EQSA 1EP5A 1ZHPA 4GUXA 1SGFA 2Z9GA 2BLOA 1GL0E 3A8DA 1BTXA 3KN2A 1GMDF 1ELBA 2Y7XA 1YYY1 1TRYA 1DWDH 4Y10E 3RP2A 1W13U 5C1XA 1O2TA 5L2ZH 2VWMA 4AB8A 3SGQE 3MU1A 2VB0A 3KCGH 2BD8A 1P05A 1X7AC 1TMTH 1G3BA 1MZDA 2BDYA 1ZJDA 2O8MA 3BG8A 1W7GH 4JZDH 2W7SA 1DDJA 3RU4T 5CMXH 5EW1H 3ZYDA 2BY7X 1EB2A 1IQLA 1GBAA 1C4V2 1ARBA 1HAGE 1W3CA 1A5IA 1PPFE 1C1VH 4J1YA 2YNBA 1EZSC 1GL1A 4ZKRU 2FX4A 1P8VC 1O3GA 1PPHE 1C2JA 1O2KA 2CHAB 4BAMB 1HJ9A 4K1TA 2B7DH 3SU6A 4A7IB 3SU5A 2BD4A 2AFQB 3SOSA 1IOEA 2J2UA 1FY1A 1C5QA 2F9VA 1H8DH 2Y80A 3GDVA 1OKXA 2BZ6H 4Y0ZE 2P3UB 1H9IE 1SQAA 2TGTA 4KTCA 1SFIA 1FI8A 4GVUA 5ETXA 1O2LA 3RXUA 3LGUA 1MU8B 1TONA 1AQ7A 1TGTA 3TVJB 3D49H 3U8RH 3HKIB 1IQIA 3TJVA 3MH7A 4I8JA 1UCYE 3PLKA 3M7UA 1S6FA 1NESE 3F9GA 1UCYH 3SUEA 4A1TA 8ESTE 3P70B 2Z9IA 2A4RA 1BOQA 1V2KT 1ORFA 3GY5A 3ZYEA 1O34A 3DA9B 5AFYH 3I78A 2NU2E 3I77A 1P2NA 5J4SA 2BLQA 1KXCA 1C5WB 1SLVB 1OWDA 1FZZA 1NRQH 2FP7B 1TGCA 1K22H 3EDXB 3HATH 1NFXA 5DP5A 2BVXH 5C1YA 4KP0A 3KF2A 2EI7A 2F3CE 1TLDA 5DP4A 4AFZA 3UNSA 4D7FA 4TWYA 3MU4A 3KEEA 4JYTA 2ZCKP 3LGWA 1OYQA 1DVAH 5A0AE 3MTYA 1ABJH 2PTNA 1TWXB 3QDZB 1DLEA 1CA8B 2W7UA 1CBWC 1ZSJA 4HZHA 1CA0C 1AVWA 2GZ9A 2VGCB 2XBWA 1K2I1 1XMNB 4XFQA 4IC6A 1OS8A 1XM1A 4ZROA 4Y76A 1S0RA 4B75A 3SJKA 1ZHRA 3LGYA 4KKDA 4YOJA 1IQEA 1IQFA 4Y11E 1T8LA 1FPHH 1T4VH 2F9PA 3GDUA 2XW9A 3PB1E 3F6UH 2PFEA 1P06A 3HKJB 5LH8A 1DY9A 1FAKH 2WUBA 1QBOA 1QJ7B 4WF8A 1O3EA 3SI3H 3PLBA 1TBZH 5TJXA 1AU8A 1EKBB 1FN8A 1HIAA 1SGPE 3GICB 1EJNA 1Z7KA 1NT1A 3UNQA 5ESBA 1AN1E 1C2EA 1TYNA 3RM2H 1XUJA 5I46H 1PPZA 2RCEA 1O35A 1TPPA 1GJBB 1S6HA 3HGNA 3LGVA 1AD8H 3HK3B 2J4IA 2Q1JA 3TK6A 2ZGHA 5EODA 1C1WH 1FY5A 4AYYB 2GGVB 2HLCA 2P8OB 4UE7H 5EOKA 4SGAE 4BANB 4DT7B 2BHGA 2R3YA 1BZXE 1ZRBA 2PGBB 1SHYA 4R0IA 1JBUH 1G3DA 3STJA 2AMQA 4JK5A 4ISIH 2G51A 1EP6A 1GHAG 2GP9B 1MD8A 4I8KA 2ZHFH 3S0NA 2ZDLA 2BVRH 1RTKA 1BRBE 4NA8A 3GYMA 2G5NA 1ELCA 1HXFH 1K28D 1O5DH 1K1OA 1SFQB 4MNXA 1GBJA 1GI8B 4X6NA 4WVPE 3PWBA 1QRXA 3PMJA 5BPEA 2FI4E 3RMOH 4O3UA 3KQEA 2BD3A 2Z3CA 3SN8A 1A5GH 3LC3A 8KME2 1O5GH 4I32A 1A2CH 1UTJA 1NRNH 2ZDVH 4A1XA 1RS0A 1TPAE 3IITA 1HPGA 1INCA 4Y7AA 2SGAA 1GBKA 1DANH 4A1VA 3QZQA 1SOZA 3K9XB 2WUCA 3SV9A 1MD7A 4ISHH 1HIAB 1S0QA 1PPEE 1SGRE 2ZEBA 1K21H 2W3KA 3QTVH 1QRWA 1T32A 4Q80A 1L1GA 2WPJS 1ACBE 3Q3YA 4JMYA 2GCTB 4K8BA 2Y81A 3B8JA 3URCA 1ZPCA 3C27B 1TNHA 1ESTA 4FUEA 1YM0A 4DJZB 4ESTE 3VB6A 1VITF 4WH6A 2A5KA 2GT8A 5JBTA 4MDSA 2HRVA 1ARCA 1LHDH 2HWLB 1U6QA 2WINI 2Z6BD 2CF9H 3S7KB 4F4OC 2ZTYA 3RXRA 2HOBA 3BTKE 2BX3A 5A8ZA 2AGGX 3HK6B 1LHGH 2FS8A 2RA3A 4OGXA 3U69H 1CT2E 3KIDU 3GCOA 3E91A 4CRGA 1UTLM 1ELEE 3D65E 3GCHC 1HB0B 3V0XA 2QXHA 2A45B 4ZKSU 1EAUA 1AKSA 1UTNA 2GX4A 1UHBB 1CT0E 3RU4E 2FX6A 2UWOA 2P94A 4ZKNU 2Y5GA 8GCHG 4GHQA 5AF9H 3SQHE 3O8DA 1SB1H 1O3JA 3BEFB 2PUQH 4ZHMU 1O38A 3NPSA 2F9UA 3TH4H 3ATWA 5PTPA 1PPGE 1ZSKA 1SGEE 2XCNA 2RA0A 1O33A 4ZH8A 1ZGIA 1FPCH 5DP7A 1ZMNA 4GCHG 1PPCE 2QIQA 1F5RA 2ZF0H 3M7TA 3M5LA 3L6PA 4YZUA 1GBMA 3T5FH 4CH2B 2G8TA 1RIWB 3SJIA 1P2KA 2ZIQH 3FP8E 1PPBH 3W95A 3SV7A 2BY8X 1O3AA 4FVDA 1V2QT 2GZ8A 1WCZA 4DURA 1FNIA 2BDIA 3A80A 1W0ZU 1SR5C 1NRSH 1JRTA 1O2ZA 2J92A 2Y6TA 2GDEH 3UNRA 5GCHG 1ZPBA 1AVXA 1FLEE 1RJXB 3G01A 1KTTB 1UCYK 1VCWA 1BTHH 1D3TB 1XKBC 5FCRA 4FUGA 1A1RA 3MFJA 4OS5A 2ZP0H 1QQUA 4WJG2 1LHFH 3A86A 2V3HH 3TGIE 1GJ8B 1HCGA 1NY22 2LNCA 3M5NA 1MKWH 3A89A 2AERH 1TQ0B 3ATIA 5EXNA 3E6PH 4GPGA 4YT7H 2B9LA 4NIWA 3EAJA 3RXMA 3D23A 1UVPA 1TNLA 8LPRA 2GKVE 3RXGA 1LCYA 4X1PU 2LIZA 1IHTH 3TU7H 1P0SH 2ZA5A 3PWCA 1KIGH 4Q2KA 3A87A 4NZQA 1HGTH 1K1PA 5JB9S 1KYNA 3BTFE 1YCPM 1QB1A 1O3CA 2CXVA 5CHAB 1LVYA 1BTWA 3BTGE 3BTQE 2ANWA 2QF3A 1DY8A 2G5VA 1O5EH 1YPEH 4X6MA 2VWOA 1IAUA 1B5GH 2J9NA 2AS9A 4KTUA 4CR9A 1GDNA 1YPGH 2ZO3H 4VGCB 3A7ZA 1ANDA 2CMYA 1GMCF 2GV7A 2PV9B 3K65B 4X1QU 1ETSH 1JWTA 2SGQE 1MQ5A 1VJAU 2XC5A 1ZTKA 1W12U 1C2LA 2BMGB 2VVVA 2VIVA 1P12E 1LDTT 4OS4A 1YGCH 3LDXH 5DPAA 6GCHG 2F9OA 1C1RA 1Y5AT 3M5OA 1ETTH 1GCTC 2W3IA 4I31A 2FS9A 3B23B 1P2MA 3KQDA 5B6OA 1DX5M 3LT3A 3UWIA 5DO4H 1LKAA 2FESH 2BQWB 2UUFB 1GHBF 3NCLA 1NU7B 1YKTA 1TNIA 1C2GA 3VXEH 2P59A 3NKKA 1EJAA 1GI5A 3PO1B 3S9AA 4BXSA 3ITIA 2PKSB 5C20A 1EXFA 2HNTC 5IDKA 1H9HE 1HAVA 3RLWH 1A46H 4WXIA 1T4UH 3DHKH 3A82A 1AFQC 1FQ3A 1QY6A 1BHXF 2GD4B 1XUGA 1Z8IB 4UFDH 4NA7A 1GI7B 3S69A 2IN2A 2FOHA 2EEKA 1Y3WA 2QAAA 4UDWH 3AW0A 1KXFA 3BTEE 2QXJA 3P8NA 3LGIA 5GJ4B 3U9AH 2H1UA 3OY5U 4B73A 3SUGA 1ELGA 1O0DH 1FIZA 2SNVA 2Q6FA 8GCHF 4I8GA 3RC6A 1ZR0A 2V0BA 4H42U 5C5NA 3F9FA 2QV1A 3BG4C 3RMLH 4YTAA 2ODYB 2FOMB 3QO6A 1CT4E 1E0FD 2H6MA 1JIRA 2ZGCA 5FBEA 4BNRA 2D8WA 1GHXH 2VH6A 3E90B 1WTGH 1FN6A 3RC5A 4YOGA 1GI2A 4HFPB 5T6FA 1TX7A 1VITH 4UEHH 3LGTA 2I6SA 3ZVEA 4GAWA 1DSTA 3NWUA 1V2WT 1SGFG 1Y3UA 4R8TB 1AZ8A 4I8HA 3ZZ9A 2GVFA 3ELAH 2OBQA 4AGKA 1MTNC 3SNCA 1HJAB 3BN9A 1EASA 1F0SA 1C1TA 2ZQ2A 1ETRH 1TBRH 2D1JA 1EPTC 3R3GB 1NTPA 1W0YH 4ISLA 2STBE 4D7GA 1MAXA 2QY0B 1O37A 1GDQA 3RC4A 1SMFE 2BD2A 1MMJN 3TGJE
chains in the Genus database with same CATH superfamily
5HIZA 1LQDB 1FAXA 1T8NA 2HNTF 2PSXA 5H4IB 1GJ6A 1YPLH 1BDAA 1KMHB 3LH1A 4UD9H 1HAVB 2AGEX 1HRTH 1NFUA 1V6DA 1Z8JB 5E0JA 3T27A 2YMSC 1K1JA 1EATA 1JXPA 1Z1JA 3P92A 1MBQA 3OX7U 3T25A 1YF4A 2D26C 1C2DA 3RXTA 3OY6U 1KXEA 4CH8B 4FXGH 2FOBA 4UFEH 5EIYA 3GY4A 1E79D 1DITH 1O3KA 4INHA 4IS5A 1QZ8A 1HDTH 2ZHEH 1LVOA 1XUKA 1LPZB 3KGPA 4UONA 1C1NA 1MTVA 4X2VA 4BTIB 1KY9A 2CHAC 4X8SH 2BY6X 3UY9A 2FZZA 1O2SA 1CHGA 4I33A 4X1RU 3CENA 1K1IA 1FMGA 1LKBA 3TJUA 3SNAA 1OP2A 1Z8RA 3FANA 3GCTF 3RXJA 4PROA 3PV2A 5E0HA 1QFKH 1A3BH 5F6MA 2CGAA 2SGPE 2EC9H 4E7NA 2IOTA 1Y8TA 3H7OA 3O8RA 3RXQA 1MAYA 1O2IA 5LPEA 5F03A 3F2FA 4ZUHA 1SKYE 4DY7B 1C5SA 5GPIB 2XXLA 2F4LA 1QBVH 1ANBA 2Y82A 1GVKB 1V3XA 5CE1A 1AE5A 1SGYE 2ZCLP 4AOQA 2V7QD 3RUOA 2B8OH 2WV4A 3E0NB 6GCHF 4CHAB 4X6PA 2NU4E 2FOAA 4B74A 5TCCA 3VGCB 5KECA 1CU1A 1O2MA 4Y8ZA 2FODA 4CBOA 3M5MA 3ATLA 3SU3A 1AMHA 1JIMA 4OS7A 3KNXA 1TA2A 2UUJB 1C1PA 1F5KU 3MOCA 2ZZUH 4X8UH 1YPHC 2P93A 2BZAA 3A8CA 2ZPRA 5FPSA 1F0RA 1G9IE 1T31A 1F7ZA 2G00A 3RMMH 1N1LA 4XSKU 2PWXA 5FCKA 3S9BA 3SZEA 2NU3E 2FTMA 2UWPA 3E0PB 3ZVGA 1PQ8A 2VGCC 3NZIA 2VIWA 1C5TA 2QXIA 5C5OA 1AB9B 1SGCA 4BTTB 1WXRA 3CP7A 2VU8E 3AVZA 1EAXA 4KTSA 5FX6A 5K7RA 4FETA 2Y5FA 2BD9A 3BF6H 1S83A 4FVBA 3KHVA 5C0TA 1V2TT 1OX1A 2H9TH 1BRAA 5K0HA 1MBMA 1LPGB 4Q4LA 6LPRA 1WOFA 4X2WA 4B76A 2VINA 1MKWK 2ZC9H 1C5MD 1W2KH 1WV7H 3W1EA 1ZMLA 2A2QH 4X0WU 1YLDA 3MH4A 4H6SB 2J38A 1EJMA 2RDLA 4FUBA 4INLA 4ZXXH 5A2MH 3MU5A 1QNJA 2ZU5A 4YO9A 1EFRD 4RKOB 4AZ2B 2VNTA 1GBFA 4I86A 3PV4A 4SGBE 1V2PT 6CHAB 1CHOG 3AAUA 3EQ0H 5EJLA 4ASUD 5E0GA 4E06H 1O2PA 1K1NA 1XVMA 1SOTA 3F3BA 3OEHD 2OC8A 2B5TB 2P8OC 1AUTC 4AG1A 1GWAA 2A4OA 2A32A 2YMSD 2A2XH 1AI8H 3GS9A 3T29A 4I7YH 4FUCA 1SGQE 2XC0A 1BBRE 2PR3A 5DKMA 1ELFA 1O2VA 2LP6A 1C1QA 1BBRH 3SHAH 3V12A 4KELA 3MH6A 1SGTA 4MG3A 1FY8E 3K2UA 1G2LA 2WV5A 2XWAA 2C8YB 1YCPH 4NZLA 2BXTH 4AG2A 1EOJA 2Z9JA 2F83A 2BB4A 1AFEH 4XD7D 2XOKD 4DIIH 1NM6A 4RN6A 4AFUA 2ZFFH 1GGDB 5C17A 3A83A 1BJUA 3R0FA 1J17T 3TH2H 1WTHD 1OP8A 4DIHH 1DWBH 1UVUH 3PLPA 4Y8YA 2W26A 4M9FA 1O5CB 1C5PA 1WYKA 4NIVA 2J94A 3ZVCA 1PQAA 2AEIH 4Z1MD 2Z94A 3GY3A 1TE0A 1RXPA 4FU7A 2OBOA 1BRUP 1CVWH 1E36B 4OS6A 4FUHA 2PW8H 1WAYB 2AMDA 5KEDA 1HAHH 4E7RG 1GG6B 1MQ6A 5EW2H 2JDID 4MNWA 5EPYA 4DW2U 3LU9B 4BXWA 1DXWA 3RXVA 1BRCE 2V35A 2FEQH 1XX9A 3P6ZB 4XOJA 5E2OA 2LPRA 1TMBH 2UUYA 4IGDA 2GCTC 3MNCA 1HLTH 1TPOA 1GI9B 2BYAX 1P2JA 2HNTE 1C1UH 4ACBA 1G3CA 1P3CA 2ZTZA 1H8HD 1P2OA 2JH6D 5FHTA 3M3VA 1FIWA 2WPKS 3UTUH 1XUFA 3CS0A 1SLWB 3SNEA 1SL3A 2BX4A 1HAIH 2CF8H 1ZYOA 4UFGH 3ZZBA 3SUFA 4YLQH 3ZZDA 5T6DA 1KDQA 3ZZAA 4DCDA 5JYIA 3BTTE 2OK5A 1OWKA 3SO3A 2OTVA 2ANKH 3ODDA 1UK3A 3D62A 1GMHG 5BRRE 2D2DA 4AGJA 3LIWA 2VIQA 4IW4E 1V2OT 1UO6A 5B6LA 4IC5A 2C3SA 1G36A 3T28A 4D76A 4B2BA 5AVDA 2BM2A 1ZZZA 3OEED 5HGGA 1FJSA 5IYTA 1J15A 1LPKB 2OUAA 4XBDA 1TNGA 1T8OA 2ZDKA 4FUIA 1UK4A 5AHGH 1T7CA 1NU9A 1VR1H 1ZGVA 2ASUB 1QB9A 1VGCB 1F5LA 5AFZH 1EQ9A 1IQKA 1D3DB 5F8ZA 2BD5A 2WPIS 4XBBA 5EU8A 1J8AA 2ZDNA 1NS3A 2EA3A 1QJ1B 1Y59T 4AB9A 4BTUB 2O8TA 2SGDE 3P8OA 3RDZA 1QTFA 1C5RA 1C5VA 2ZU2A 1UVTH 2C8XB 3U1IB 1DWEH 1G2MA 2WYJA 4IN1A 3URDA 2AMPA 2STAE 3SJOA 3SI4H 2GCHG 3ZZ7A 1V2JT 1O2XA 7LPRA 3Q00A 1NC6A 5DJ7A 2ZU3A 2K7XA 1ZPZA 2BD7A 3RXAA 4OS1A 3SJ8A 3BEUA 1SGIB 1UMAH 1Y5UT 2ZHQH 1GI4A 2ZQ1A 3VB4A 4CR5A 1QBNA 3PRBA 1BUIA 4HG6A 3RXOA 1EZQA 4LXBH 1IHSH 3BSQA 1GJ5H 1RIWC 4ISNA 1TX6A 1EAWA 3PTNA 3M35A 1H1BA 1UVSH 1EX3A 1BMFD 4J2YB 3ZZ3A 1KDQB 4AN7A 1C1SA 3SORA 3EA8A 2OLGA 2PHBA 3BTHE 1V2VT 4WH8A 5GDSH 4GHTA 2ZTXA 1IQHA 5HM2A 1FY3A 2A4QA 2K0QA 1HAZB 5JPMH 3SNBA 3PYHA 1C4Y2 2FYRA 3W94A 4THNH 5HMAA 5FPTA 1C5LH 3Q76A 5SGAE 4YOIA 2PLXA 2AYWA 1O2UA 2KFWA 1O3OA 2SNWA 4FU8A 4TPIZ 4ABDA 3HPTB 2WPHS 1GHAF 1CGJE 3P8GA 4TT3D 1TOCB 1IQJA 1FONA 2CK3D 1C5YB 1E1QD 4ABHA 4BOHA 1TGBA 2THFB 3F2GA 3F9HA 1V2RT 2ZFSA 3AASA 2R0KA 2K1QA 1EUFA 3IWMA 1AKSB 2Y7ZA 1S84A 1ZMJA 2JETB 5L2YH 1TGNA 1IQMA 5CHAC 4JYUH 3SYJA 3T62A 1GHWH 1GMDG 1LTOA 1DM4B 2O8UA 1F0TA 3RXFA 1MUEB 1SSXA 1UTOA 1G3EA 1QL7A 1O2YA 1ELTA 2RG3A 1G37A 1DICA 3QUMP 4VGCC 2K8IA 4IBLH 1JOUB 4INKA 1NBMD 2FI5E 3A8BA 1YPHE 3KQ5A 3GYLB 2A31A 2DE9A 4YT6H 1UTQA 1QL9A 2C90B 1OPHB 3TPIZ 4CRFA 1Z1IA 1HXEH 3M3SA 2YOLA 3PTBA 2ODPA 4A5TS 1GCDA 5E2PA 2F9NA 2KX4A 5ESTE 1LVBA 3FKSD 1GBDA 2R0LA 3MU8A 1TRMA 2P95A 1SQOA 2FDAA 4IN2A 3MU0A 1LO6A 1H8ED 4JK6A 1G30B 1RRKA 2W6ID 3DD2H 1ZJKA 4K8YA 1O2GH 2B0FA 2VBCA 2OC0A 5C67A 3ZV8A 4X2XA 2A7JA 5ABWA 5DP3A 5C3NA 2R3UA 5A8XA 3OU0A 1YWUA 2RDEA 3PO1C 2V6NA 1AWFH 2FLBH 2H9HA 2PKSC 2CV3A 3V3MA 2W5EA 3MI4A 4JZFH 1A0HB 1C5ZB 5JDUB 4CRBA 4B2AA 1V2ST 2A5IA 3UFAA 3NXPA 3A85A 2BTCE 2SGEE 1DSUA 2ZDAH 1P57B 3ZVDA 1J14A 1D4PB 1O5BB 1O36A 1ESBA 1QURH 2VVCA 1MZAA 3GDSA 3N7DA 1BBRK 1D3PB 2QF5A 1H4WA 3H5CB 2QCYA 4Y8XA 4NFEA 3A7VA 1LQEA 1YPMH 5EPNA 4YESB 5FX5A 2R2WU 1YCPK 1MTSA 1W14U 2WPMS 1QQ4A 1THRH 3ZZ8A 2FOGA 4GSOA 2KCOA 2TPIZ 1O39A 1BMAA 1L4ZA 1DUAA 1QB6A 4FOUC 1GHVH 1C5OH 1Z6EA 1M9UA 3MHWU 2G4TA 2BY9X 4YM9A 7ESTE 5HM9A 1S5SA 3WY8A 2IPQX 4FUJA 1FXYA 3U8OH 4U2WA 1N8OB 2ZNKH 4B6EA 1PQ5A 3ESTA 4ZHAA 1O3FA 4LK4A 3LONA 1LMWB 1GI3A 1O3HA 2AIQA 4QT8C 1AO5A 1GJCB 1C5UA 2XBXA 1BTPA 3AAVA 1HJAC 2OP9A 3RMNH 4GCHF 3M7QA 4K1SA 3C1KA 3QK1A 2SGFE 1DS2E 2EI8A 3FP6E 4CBNA 1GJ4H 3UIRA 1RGQA 1J9CH 1OYTH 1CGIE 3MYWA 2EI6A 1SPJA 4JZEH 2KCPA 1P03A 3P95A 2GMTB 3JZ1B 4ZAEA 3RXHA 1GVLA 2HALA 1TQ7B 2BDBA 3DT0H 4K3JA 3RXCA 4A6LA 3DFLA 3PMBB 2A7HA 3A7XA 3UWJH 3VPKA 2BDGA 5GCHF 3KQBA 5I25A 2J95A 1A7SA 1QIXB 2FPZA 3F1SB 1T8MA 3Q3KA 2QXGA 1OWIA 1WU1A 3PMHB 2PP6A 3SUDA 2ZI2H 2L6OA 4Z0KA 1K9OE 2ZCHP 1UTPA 2RFKC 3OYPA 1BTZA 1EAIA 3M61U 5L6NH 3SJ9A 4AFQA 3BEIB 5TCAA 6ESTA 2Z3EA 2KM0A 2H2ZA 1Q3XA 3TGKE 2CN0H 4YXWD 2DUCA 2GT7A 1GBLA 3M36A 4TWWA 3A81A 4HGCA 1UK2A 4CRAA 4JCNA 1TMUH 3ZZ5A 2VIPA 5GXPA 2P16A 2VIDA 1P04A 5C0UA 1TIOA 3VB5A 2C8ZB 1MCTA 4MPVA 2OC1A 2XBYA 3GOVB 4DGJA 1TB6H 4LZ4B 2VVUA 5EJZA 1BMMH 2G52A 2IJOB 2Z9LA 4NFFA 1S82A 1GJ7B 1CE5A 3SV2H 1XXDA 3TK9A 3BTDE 1DXPA 3UB0A 4WXVA 1GBEA 1GJDB 1L0ZA 3ZZ4A 1A3EH 1ZSLA 1OP0A 4CREA 1W8BH 4ABBA 2HPQH 1TFXA 2O9QA 3VEQB 4CHAC 2FYQA 2KZ4A 2V3OH 3UREA 2XYAA 3UOPA 2BOHB 3VGCC 3ZZ6A 5LPFA 2ALVA 3STIA 1HAYB 5FXLA 4ZHLU 1WSSH 1UTMA 4B71A 2ALPA 3UQVA 2AH4X 4K5ZA 4Y71A 4ABGA 4RT1A 1MTUA 3ZVFA 1Q2WA 4BAOB 2ESTE 1ZOMA 2BOKA 3SU0A 2WPDD 2FO9A 3MO3A 1O31A 3SGBE 3VB7A 2YNAA 3RM0H 4ZMAH 4MLFB 5DK1A 1V2UT 4ZXYH 2JIZD 5FPYA 2BDHA 4GLYA 1OOKB 1XVOA 1WQSA 3GCNA 1C5XB 2JKHA 3MNSA 1P2IA 3S9CA 2OQ5A 1W7XH 1AB9C 1DOJA 1GPZA 2C4FH 3MNBA 2XTTB 2GV6A 4X2YA 3QX5H 1MCVA 2QF0A 1NN6A 3DSPA 5GNDA 1C1OA 1PFXC 2BLVA 4MNYA 1VITG 5KGOA 1C5NH 5EXLA 3A88A 3PM3A 1TAWA 5C94A 4X1NU 4M7GA 3FZZA 1S81A 1J16A 1D9IA 5JBCS 1BJVA 3N99A 3O8BA 3F9EA 3QZRA 1LVMA 1QL8A 4X8VH 2Z7FE 3H7TA 4AX9H 1O2NA 2PKAA 4XE4A 1VJ9U 2GTBA 1AHTH 1SGDE 3CNRA 5T3HA 2PTCE 2VH0A 4NWKA 1D6RA 2ZECA 1GI0A 2FM2A 1JMOH 1NFYA 4TY6A 2KCYA 2UWLA 2FOCA 1MH0A 4ASHA 9ESTA 4OS2A 3SGAE 3I29A 3TIUA 1V2MT 3DCLA 2QC2A 1E35B 1E34B 6CHAC 1ZLRA 2TBSA 1JRSA 2ZGXH 1FDPA 1O3PB 3GY2A 1GHYH 1AZZA 2ZWLH 1IQGA 1BB0B 1D6WA 1HAXB 4O03A 3RXDA 1CBWB 3TH3H 5A0CA 1CA0B 1NROH 1HV7A 1DFPA 1SGNE 1A0LA 4NGAH 2PGQB 4RKJB 1TALA 1HBTH 2KAIA 4TY7A 3E8LA 1F92A 1CGHA 2C8WB 5C1UA 4X6OA 2OXSA 1TNKA 1BT7A 3RU4D 3LH3A 1ANEA 1KLTA 4FU9A 4DOQA 1F2SE 1YLCA 3GY7A 3RXKA 2P3TB 2ULLA 3BTME 5HIYA 1O3NA 3TITA 2QGRA 4B2CA 1E37B 1ZRKA 2WSSD 1C2FA 4MPWA 1C2MA 4D9QA 1GBCA 1THPB 4AYVB 4MQAA 3UOUA 3ZVAA 2ZPSA 1S85A 4O9VA 5LPRA 1BQYA 4UFFH 1GGDC 3T2NA 2HVXA 1SC8U 4B6FA 3A84A 3MO6A 1W0JD 1TBQH 1RFNA 2A5AA 3F68H 2KCAA 4U01A 3LJJA 3UPEA 3ATKA 1FX0B 1P2QA 2IPHA 1LHCH 4NA9H 1ESAA 1BITA 3RXBA 1LHEH 3TJNA 1QA0A 2VJ1A 4ABJA 5HXFA 2QN5T 2PKAB 2V3MA 3RXIA 4O3TA 2Y5HA 4Q7YA 4HI3A 1QGFA 3NUMA 5T6GA 2FTLE 2O8WA 1ABIH 4K2YA 1KTSB 2NU0E 3MH5A 1GG6C 1YPKH 4O97A 3ODFA 3EA7A 2P3FH 3PROA 4JZ1A 3MQKC 3SV6A 7KMEH 2AIPA 7GCHG 2TGPZ 2QA9E 1MKXH 2XRCA 1XUHA 4OM9A 1NO9H 3LOXA 1RTFB 1XKAC 3WW7A 1P9SA 1AGJA 1QJ6B 3IG6B 3QTOH 1GBIA 2Q6DA 1KLJH 1Y3VA 3QN7A 2F91A 1UHBA 3E16B 1GVZA 2KAIB 2ZKSA 1QRZA 3EA9A 2LELA 3RXPA 1DE7H 4Q7ZA 1IQNA 1NRPH 1GJAB 5EGMA 4ISOA 3LJOA 4D8NA 4LZ1H 1Y5BT 1YP9A 4K1EA 1P09A 5C2ZA 1XUIA 5EG4A 1TNJA 1YLNA 1VZQH 2FWWA 5DP8A 4DG4A 4TSFD 1OWHA 3L3TA 3P17H 1TA6A 2J5UA 2ZFTA 3K6ZA 1ELAA 2A0QB 1V2LT 3OSYA 1GMCG 3A8AA 4AFSA 2ILNA 1HAPH 1AUJA 1C9TA 2BQ6B 3AW1A 3GY8A 1QHRB 4XRNA 3U98H 3M37A 2WPLS 1WDIA 2Z9KA 3K6YA 1FUJA 3EGKH 1VGCC 2BQ7B 3GY6A 4NSVA 1AWHB 1EOLA 1BCUH 1O5FH 3SW2B 1S6LA 2G4UA 1TRNA 4X1SU 2JH5D 1GHZA 3FVFB 1DPOA 5DG6A 1O2JA 1FY4A 5JBAS 2TGAA 3SQEE 3U8TH 3SU2A 4DVAU 4IMZA 3BIVH 1O3IA 2GZ7A 1BA8B 1GBHA 2H5CA 4NIXA 4NG9H 1WQVH 1BMLA 1PYTC 1GHBG 2DE8A 1QCPA 2BXUH 4LOYH 5F8XA 2TRMA 3E1XB 2F9BH 1GBTA 4Z6AH 3ZV9A 5EQQA 5A8YA 1P3EA 1D3QB 1A0JA 3BIUH 3Q77A 3EBNA 4ABAA 1WUNH 1OXGA 4Y79A 5A09A 2ZHWH 1TABE 1XXFA 3FP7E 1L1JA 1OSSA 2ZGJA 4TPYA 3LKWA 1EZXC 2NWNA 1Z8GA 1K1MA 1C4U2 2ZFQH 3RXLA 1DUEA 3OTPA 3GCHB 2ZGBH 1ZTLA 2FLRH 2XBVA 3RXSA 2BDCA 5JB8S 1E38B 1CHOF 2WV9A 1SI5H 2OD3B 3NK8A 4NWLA 4OGYA 5FBIA 3QLPH 1L1NA 3PMAB 3L33A 3CS7A 2CJIA 1YPJH 4I8LA 3GISB 5EXMA 5DGJA 1QA7A 1HUTH 2ODQA 1FV9A 2Z3DA 1ZTJA 3FAOA 3UR9A 1SBWA 5JBBS 9LPRA 2EQNA 1HJ8A 2ZPQA 2JJ1D 1P01A 3V7TA 4JYVH 4WMFA 3SU1A 4WWYA 5GWZA 1PQ7A 4H4FA 3E3TA 1B0FA 3AK5A 3P8FA 4A92A 3F0PA 1HFDA 1VCQA 4ABIA 2M5TA 5DN6D 4NCYA 1B0EA 3MMGA 4K60A 3ATMA 1O32A 1KXBA 3O8CA 2ZU1A 2G55A 3KQCA 1BMNH 3UUZA 1AY6H 4MNVA 5EQRA 2JETC 4NSYA 1Y3XA 1CSOE 4ZCNA 1NPMA 2BDAA 3V13A 5J4QA 1GJ9B 3U28C 2VIOA 1O3DA 1Y3YA 3QGJA 1F0UA 1TGSZ 1KXDA 1Q31A 2ZDMA 4D9RA 3FO8D 2OINA 3S7HB 2ZG0H 3LC5A 1P9UA 1C9PA 3A7YA 1A61H 2FOFA 1UVOA 3FZDA 1NFWA 3EE0B 7GCHF 1SHHB 4F48B 1NRRH 4FUDA 1MTWA 4RSPA 1AIXH 4F49A 1C2KA 3MNXA 1SQRA 1TOMH 3SHCH 4BAQB 1SLUB 1ELDE 4XBCA 2G81E 3BTWE 1L2EA 3Q3XA 1A4WH 2BVSH 2I6QA 3EYDA 1UJ1A 1B7XB 3ZZCA 1BHXB 2R2MB 1AE8H 1L4DA 1O2WA 2TGDA 2FI3E 4YLUA 4MVNA 4NIYA 4ABEA 3QGNB 1A5HA 3T26A 3M3TA 3GCTG 2H5DA 5DP9A 3WWBA 1O2QA 2OC7A 3RLYH 1H8IH 1O5AB 3ZVBA 1BIOA 4B1TA 4IMQA 3U1JB 1GMHF 2AGIX 1C2HA 2A4GA 3N7OA 1ID5H 3A7TA 1OWJA 5LGOA 2ANMH 3DFJA 1ZHMA 1O3MA 4WY3A 2FMJA 5G4BA 4MTBA 4AORA 5E8EH 3TK5A 2Q6GA 2A7CA 2XC4A 4Y7BA 1PYTD 2VWNA 1W10U 3TNSA 2BY5X 3KL6A 1SLXB 1O30A 5HYOA 4K69A 2ZFRH 4CRDA 4U32A 3NRLA 4E05H 4WMDA 5L30H 2M2AA 1P11E 3A7WA 3SZNA 2XWBI 5FAHA 2SFAA 1O2HA 3OTJE 1N6YA 1EB1H 4Y0YE 3SU4A 5DP6A 1AVGH 1MABB 2BLWA 1GCTB 1RTLA 3B9FH 2FIRH 1EPTA 1SQTA 1K1LA 4WMEA 2VWLA 3JZ2B 5F8TA 1GI6A 2NU1E 2FXRA 3VB3A 1HAOH 3HGPA 4CRCA 3SNDA 1O3LA 1GI1A 1O2OA 3TJOA 1ELVA 2KR7A 1N8OC 2O8LA 1P02A 5GIBA 1MU6B 2HGTH 3SV8A 3VXFH 4BAHB 2XNIA 4JZIA 4BAKB 1OWEA 1C1MA 2GCHF 4Y6DA 3MO9A 1ANCA 3VFEA 3UQOA 1AFQB 1GBBA 2JH0D 2XCFA 4XDEA 1VKYA 2OCVB 1C2IA 4Q7XA 2R9PA 2OQUA 4Q63A 1CQQA 1CO7E 2C93B 2ZU4A 1QR3E 3QWCH 4MPUA 2TIOA 5DSFA 1O2RA 1BTYA 1DWCH 3ENSB 3OFND 1HYLA 2GMTC 1YC0A 1MKXK 1Z6JH 1V2NT 2A1DB 3TLOA 4HTCH 1EZUC 3TNTA 2H9EH 1KLIH 1TX8A 1KSNA 1UTKA 3MWIU 1GDUA 3BG4B 4ZKOU 1H9LB 1SG8B 3DUXH 2J34A 1TPSA 2ZHDA 2GJGA 4KGAA 3BV9B 4FUFA 2FOEA 1G32B 4RT0A 3LPRA 1W11U 1WBGB 1DT2A 4ABFA 3RXEA 1VCPA 4X8TH 1THSH 5T1VA 5A0BA 2PUXB 4H6TA 4TYDA 2ANYA 1SVPA 1N6XA 1HNEE 4MPXA 4U30A 1P10A 3SBKA 2ZFPH 3UR6A 1NZQH 2WYGA 1Z71A 2PSYA 1MTNB 1PJPA 1BTUA 1YBWA 2QYIA 3FN8A 1RD3B 1KXAA 2GDDA 2UUKB 1DLKB 1EPTB 1O3BA 2HPPH 3FFGA 5EQSA 1EP5A 1ZHPA 4GUXA 1SGFA 2Z9GA 2BLOA 1GL0E 3A8DA 1BTXA 1NBME 3KN2A 1GMDF 1ELBA 2Y7XA 1YYY1 1TRYA 1DWDH 4Y10E 3RP2A 1W13U 5C1XA 1O2TA 5L2ZH 2VWMA 4AB8A 3SGQE 3MU1A 2VB0A 3KCGH 2BD8A 2YMSB 1P05A 1X7AC 1TMTH 2QE7D 1G3BA 1MZDA 2BDYA 1ZJDA 2O8MA 3BG8A 1W7GH 4JZDH 2W7SA 1DDJA 3RU4T 5CMXH 5EW1H 3ZYDA 1W0KD 2BY7X 1EB2A 1IQLA 1GBAA 1C4V2 1ARBA 1HAGE 1W3CA 1A5IA 1PPFE 1C1VH 4J1YA 2YNBA 1EZSC 1GL1A 4ZKRU 1COWD 2FX4A 1P8VC 1O3GA 1PPHE 3H09A 1C2JA 1O2KA 2CHAB 4BAMB 2W6JD 1HJ9A 4K1TA 2B7DH 3SU6A 4A7IB 3SU5A 2BD4A 2AFQB 3SOSA 1IOEA 2J2UA 1FY1A 1C5QA 2F9VA 1H8DH 2Y80A 3GDVA 1OKXA 2BZ6H 4Y0ZE 2P3UB 1H9IE 1SQAA 2TGTA 4KTCA 1SFIA 1FI8A 4GVUA 5ETXA 1O2LA 3RXUA 3LGUA 1MU8B 1TONA 2HVYB 1AQ7A 1TGTA 3TVJB 3D49H 3U8RH 3HKIB 1IQIA 3TJVA 3MH7A 4I8JA 1UCYE 3PLKA 3M7UA 1S6FA 1NESE 3F9GA 1UCYH 3SUEA 4A1TA 8ESTE 3P70B 2Z9IA 2A4RA 1BOQA 1V2KT 1ORFA 3GY5A 3ZYEA 1O34A 3DA9B 5AFYH 3I78A 2NU2E 5IK2D 3I77A 1P2NA 3WWFA 5J4SA 2BLQA 1KXCA 1C5WB 1SLVB 1OWDA 1FZZA 3EE7A 1NRQH 2FP7B 1TGCA 1K22H 3EDXB 3HATH 1NFXA 5DP5A 2EY4C 2BVXH 5C1YA 4KP0A 3KF2A 2EI7A 2F3CE 1TLDA 5DP4A 4AFZA 3UNSA 4D7FA 4TWYA 3MU4A 3KEEA 4JYTA 2ZCKP 2J98A 3LGWA 1OYQA 2HLDD 1DVAH 5A0AE 3MTYA 1ABJH 2PTNA 1TWXB 3QDZB 1DLEA 1CA8B 2W7UA 1CBWC 1ZSJA 4HZHA 1CA0C 1AVWA 2GZ9A 2VGCB 2XBWA 1K2I1 1XMNB 4XFQA 4IC6A 1OS8A 1XM1A 4ZROA 4Y76A 1S0RA 4B75A 3SJKA 1ZHRA 3LGYA 4KKDA 4YOJA 1IQEA 1IQFA 4Y11E 1T8LA 3PRDA 1FPHH 1T4VH 3F0OA 2F9PA 3GDUA 2XW9A 3PB1E 3F6UH 2PFEA 1P06A 3HKJB 5LH8A 1DY9A 1FAKH 2WUBA 2J97A 1QBOA 1QJ7B 4WF8A 1O3EA 3SI3H 3PLBA 3PV5A 1TBZH 5TJXA 1AU8A 1EKBB 1FN8A 1HIAA 1SGPE 3GICB 1EJNA 1Z7KA 1NT1A 3UNQA 5ESBA 1AN1E 1C2EA 1TYNA 3RM2H 1XUJA 5I46H 1PPZA 2RCEA 1O35A 3KYGA 1TPPA 1GJBB 1S6HA 3HGNA 3LGVA 1AD8H 3HK3B 2J4IA 2Q1JA 3TK6A 2ZGHA 5EODA 1C1WH 1FY5A 4AYYB 2GGVB 2HLCA 2P8OB 4UE7H 5EOKA 4SGAE 4BANB 4DT7B 2BHGA 2R3YA 1BZXE 1ZRBA 2PGBB 1SHYA 4R0IA 1JBUH 1G3DA 3STJA 2AMQA 4JK5A 4ISIH 4F55A 2G51A 1EP6A 2J98B 1YY3A 1GHAG 2GP9B 1MD8A 4I8KA 2ZHFH 3KYFA 3S0NA 2ZDLA 2BVRH 1RTKA 2WHXA 1BRBE 4NA8A 3GYMA 2G5NA 1ELCA 1HXFH 1K28D 1O5DH 1K1OA 1SFQB 4MNXA 1GBJA 1GI8B 4X6NA 4WVPE 3PWBA 1QRXA 3PMJA 5BPEA 2FI4E 3RMOH 4O3UA 3KQEA 2BD3A 2Z3CA 3SN8A 1A5GH 3LC3A 8KME2 1O5GH 4I32A 1A2CH 1UTJA 1NRNH 2ZDVH 4A1XA 1RS0A 1TPAE 3IITA 1HPGA 1INCA 4Y7AA 2SGAA 1GBKA 1DANH 4A1VA 3QZQA 1SOZA 3K9XB 2WUCA 3SV9A 1MD7A 4ISHH 1HIAB 1S0QA 1PPEE 1SGRE 2ZEBA 1K21H 2W3KA 3QTVH 1QRWA 1T32A 4Q80A 1L1GA 2WPJS 1ACBE 3Q3YA 4JMYA 2WZQA 2GCTB 3DSGA 4K8BA 2Y81A 3B8JA 3URCA 1ZPCA 3C27B 1TNHA 1ESTA 4FUEA 1YM0A 4DJZB 4ESTE 3VB6A 1VITF 4WH6A 2A5KA 3OE7D 2GT8A 5JBTA 4MDSA 2HRVA 1ARCA 1LHDH 2HWLB 1U6QA 2WINI 2Z6BD 3F2HA 2CF9H 3S7KB 4F4OC 2ZTYA 3RXRA 2HOBA 3BTKE 3ZIAD 2BX3A 5A8ZA 2AGGX 3HK6B 1LHGH 2FS8A 2RA3A 4OGXA 3U69H 1CT2E 3KIDU 3GCOA 3E91A 4CRGA 3OAAD 3DSOA 1UTLM 1ELEE 3D65E 3GCHC 1HB0B 3V0XA 2QXHA 2A45B 4ZKSU 1EAUA 1AKSA 1UTNA 2GX4A 1UHBB 1CT0E 4RI0A 3RU4E 2FX6A 2UWOA 2P94A 4ZKNU 2Y5GA 8GCHG 4GHQA 5AF9H 3SQHE 3O8DA 1SB1H 1O3JA 3BEFB 2PUQH 4ZHMU 5CHBA 1O38A 3NPSA 2F9UA 3TH4H 3ATWA 5PTPA 1PPGE 1ZSKA 1SGEE 2XCNA 2RA0A 1O33A 4ZH8A 1ZGIA 2QF4A 1FPCH 5DP7A 1ZMNA 4GCHG 1PPCE 2QIQA 1F5RA 2ZF0H 3M7TA 3M5LA 3L6PA 4YZUA 1GBMA 3T5FH 4CH2B 2G8TA 1RIWB 3SJIA 1P2KA 2ZIQH 3FP8E 1PPBH 3W95A 3SV7A 2BY8X 1O3AA 4FVDA 1V2QT 2GZ8A 1WCZA 2F43B 4DURA 1FNIA 2BDIA 3A80A 1W0ZU 1SR5C 1NRSH 1JRTA 1O2ZA 2J92A 2Y6TA 2GDEH 3UNRA 5GCHG 1ZPBA 1AVXA 1FLEE 2L74A 1RJXB 3G01A 1KTTB 1UCYK 1VCWA 1BTHH 1D3TB 1XKBC 5FCRA 4FUGA 1A1RA 3MFJA 4OS5A 2ZP0H 1QQUA 4WJG2 1LHFH 3A86A 2V3HH 3TGIE 1GJ8B 1HCGA 1NY22 2LNCA 3M5NA 1MKWH 3A89A 2AERH 1TQ0B 3ATIA 5FL7D 5EXNA 3E6PH 4GPGA 4YT7H 2B9LA 4NIWA 5EJ1A 3EAJA 3RXMA 3D23A 1UVPA 1TNLA 8LPRA 2GKVE 3RXGA 1LCYA 4X1PU 2LIZA 1IHTH 3TU7H 4P02A 1P0SH 2ZA5A 5CDFE 3PWCA 1KIGH 4Q2KA 3A87A 4NZQA 1HGTH 1K1PA 5JB9S 1KYNA 1K0HA 3BTFE 1YCPM 1QB1A 1O3CA 2CXVA 5CHAB 1UW7A 1LVYA 1BTWA 3BTGE 3BTQE 2ANWA 2QF3A 1DY8A 2G5VA 1O5EH 1E1RD 1YPEH 4X6MA 2VWOA 1IAUA 1B5GH 2J9NA 2AS9A 4KTUA 4AC9A 4CR9A 1GDNA 1YPGH 2ZO3H 4VGCB 3FOAA 3A7ZA 1ANDA 4P00A 2CMYA 1GMCF 2GV7A 2PV9B 3K65B 4X1QU 5F53A 1ETSH 1JWTA 2XNDD 2SGQE 1MQ5A 5HKKD 1VJAU 2XC5A 1ZTKA 1W12U 1C2LA 2BMGB 2VVVA 2VIVA 1P12E 1LDTT 4OS4A 1YGCH 3LDXH 5DPAA 6GCHG 2F9OA 1C1RA 1Y5AT 3M5OA 1ETTH 1GCTC 2W3IA 4I31A 2IJD1 2FS9A 3B23B 1P2MA 1OHHD 3KQDA 5B6OA 1DX5M 3LT3A 3UWIA 5DO4H 3VG8A 1LKAA 2FESH 2BQWB 2UUFB 1GHBF 3NCLA 1NU7B 1YKTA 1TNIA 1C2GA 3VXEH 2P59A 3NKKA 1EJAA 1GI5A 3PO1B 3S9AA 4BXSA 3ITIA 2PKSB 5C20A 1EXFA 2HNTC 5IDKA 1H9HE 1HAVA 3RLWH 1A46H 4WXIA 1T4UH 3DHKH 3A82A 1AFQC 1FQ3A 1QY6A 1BHXF 2GD4B 1XUGA 1Z8IB 4UFDH 4NA7A 1GI7B 3S69A 2IN2A 2FOHA 2EEKA 1Y3WA 2QAAA 4UDWH 3UAIC 3AW0A 4ACAA 1KXFA 3BTEE 2JJ2D 2QXJA 3P8NA 3LGIA 5GJ4B 3U9AH 2H1UA 3OY5U 3N7EA 4B73A 3SUGA 1ELGA 1O0DH 1FIZA 2SNVA 2Q6FA 8GCHF 4I8GA 3RC6A 1ZR0A 2V0BA 4H42U 5C5NA 3F9FA 2QV1A 3BG4C 3RMLH 4YTAA 2ODYB 2FOMB 3QO6A 1CT4E 1E0FD 2H6MA 1JIRA 2ZGCA 5FBEA 4BNRA 2D8WA 1GHXH 2VH6A 3E90B 1WTGH 1FN6A 3RC5A 4YOGA 1GI2A 4HFPB 5T6FA 1TX7A 1VITH 4UEHH 3LGTA 2I6SA 3ZVEA 4GAWA 1DSTA 3NWUA 1V2WT 1SGFG 1Y3UA 4R8TB 1AZ8A 4I8HA 3ZZ9A 2GVFA 3ELAH 2OBQA 4AGKA 1MTNC 3SNCA 1HJAB 3BN9A 1EASA 1F0SA 1C1TA 2ZQ2A 1ETRH 1TBRH 2D1JA 1EPTC 3R3GB 1NTPA 1W0YH 2AHME 2STBE 4ISLA 4DT4A 4D7GA 1MAXA 2QY0B 1O37A 1GDQA 3RC4A 1SMFE 2BD2A 1MMJN 3TGJE
chains in the Genus database with same CATH topology
1LQDB 1FAXA 1T8NA 2HNTF 2PSXA 5H4IB 1GJ6A 1YPLH 1BDAA 3LH1A 4UD9H 1HAVB 2AGEX 1HRTH 1NFUA 1V6DA 1Z8JB 5E0JA 3T27A 1K1JA 1EATA 1JXPA 1Z1JA 3P92A 1MBQA 3OX7U 3T25A 1YF4A 2D26C 1C2DA 3RXTA 3OY6U 1KXEA 4CH8B 4FXGH 2FOBA 4UFEH 3GY4A 1DITH 1O3KA 4INHA 4IS5A 1HDTH 2ZHEH 1LVOA 1XUKA 1LPZB 3KGPA 4UONA 1C1NA 1MTVA 4X2VA 4BTIB 1KY9A 2CHAC 4X8SH 2BY6X 3UY9A 2FZZA 1O2SA 1CHGA 4I33A 4X1RU 3CENA 1K1IA 1FMGA 1LKBA 3TJUA 3SNAA 1OP2A 1Z8RA 3FANA 3GCTF 3RXJA 4PROA 5E0HA 1QFKH 1A3BH 5F6MA 2CGAA 2SGPE 2EC9H 4E7NA 2IOTA 1Y8TA 3H7OA 3O8RA 3RXQA 1MAYA 1O2IA 5LPEA 5F03A 4ZUHA 4DY7B 1C5SA 5GPIB 2XXLA 1QBVH 1ANBA 2Y82A 1GVKB 1V3XA 5CE1A 1AE5A 1SGYE 2ZCLP 4AOQA 3RUOA 2B8OH 2WV4A 3E0NB 6GCHF 4CHAB 4X6PA 2NU4E 2FOAA 4B74A 5TCCA 3VGCB 1CU1A 1O2MA 4Y8ZA 2FODA 4CBOA 3M5MA 3ATLA 3SU3A 1AMHA 1JIMA 4OS7A 3KNXA 1TA2A 2UUJB 1C1PA 1F5KU 3MOCA 2ZZUH 4X8UH 1YPHC 2P93A 2BZAA 3A8CA 2ZPRA 5FPSA 1F0RA 1G9IE 1T31A 1F7ZA 2G00A 3RMMH 1N1LA 4XSKU 2PWXA 5FCKA 3S9BA 2NU3E 2FTMA 2UWPA 3E0PB 3ZVGA 1PQ8A 2VGCC 3NZIA 2VIWA 1C5TA 2QXIA 5C5OA 1AB9B 1SGCA 4BTTB 3CP7A 2VU8E 3AVZA 1EAXA 4KTSA 5FX6A 5K7RA 2Y5FA 2BD9A 3BF6H 1S83A 4FVBA 3KHVA 1V2TT 1OX1A 2H9TH 1BRAA 5K0HA 1MBMA 1LPGB 6LPRA 1WOFA 4X2WA 4B76A 2VINA 1MKWK 2ZC9H 1C5MD 1W2KH 1WV7H 1ZMLA 2A2QH 4X0WU 1YLDA 3MH4A 4H6SB 2J38A 1EJMA 2RDLA 4FUBA 4INLA 4ZXXH 5A2MH 3MU5A 1QNJA 2ZU5A 4YO9A 4RKOB 4AZ2B 2VNTA 1GBFA 3PV4A 4SGBE 1V2PT 6CHAB 1CHOG 3AAUA 3EQ0H 5E0GA 4E06H 1O2PA 1K1NA 1XVMA 1SOTA 2OC8A 2B5TB 2P8OC 1AUTC 4AG1A 1GWAA 2A4OA 2A32A 2A2XH 1AI8H 3T29A 4I7YH 4FUCA 1SGQE 2XC0A 1BBRE 2PR3A 5DKMA 1ELFA 1O2VA 1C1QA 1BBRH 3SHAH 3V12A 4KELA 3MH6A 1SGTA 4MG3A 1FY8E 3K2UA 1G2LA 2WV5A 2XWAA 2C8YB 1YCPH 4NZLA 2BXTH 4AG2A 1EOJA 2Z9JA 2F83A 2BB4A 1AFEH 4DIIH 1NM6A 4RN6A 4AFUA 2ZFFH 1GGDB 3A83A 1BJUA 3R0FA 1J17T 3TH2H 1WTHD 1OP8A 4DIHH 1DWBH 1UVUH 3PLPA 4Y8YA 2W26A 1O5CB 1C5PA 1WYKA 4NIVA 2J94A 3ZVCA 1PQAA 2AEIH 2Z94A 3GY3A 1TE0A 1RXPA 4FU7A 2OBOA 1BRUP 1CVWH 1E36B 4OS6A 4FUHA 2PW8H 1WAYB 2AMDA 1HAHH 4E7RG 1GG6B 1MQ6A 5EW2H 4MNWA 5EPYA 4DW2U 3LU9B 4BXWA 1DXWA 3RXVA 1BRCE 2V35A 2FEQH 1XX9A 3P6ZB 4XOJA 5E2OA 2LPRA 1TMBH 2UUYA 4IGDA 2GCTC 3MNCA 1HLTH 1TPOA 1GI9B 2BYAX 1P2JA 2HNTE 1C1UH 1G3CA 1P3CA 2ZTZA 1P2OA 2JH6D 5FHTA 3M3VA 1FIWA 2WPKS 3UTUH 1XUFA 3CS0A 1SLWB 3SNEA 1SL3A 2BX4A 1HAIH 2CF8H 1ZYOA 4UFGH 3ZZBA 3SUFA 4YLQH 3ZZDA 5T6DA 1KDQA 3ZZAA 4DCDA 5JYIA 3BTTE 1OWKA 3SO3A 2OTVA 2ANKH 3ODDA 1UK3A 3D62A 1GMHG 5BRRE 2D2DA 4AGJA 3LIWA 2VIQA 4IW4E 1V2OT 1UO6A 4IC5A 2C3SA 1G36A 3T28A 4D76A 4B2BA 5AVDA 2BM2A 1ZZZA 5HGGA 1FJSA 5IYTA 1J15A 1LPKB 2OUAA 4XBDA 1TNGA 1T8OA 2ZDKA 4FUIA 1UK4A 5AHGH 1T7CA 1NU9A 1VR1H 1ZGVA 2ASUB 1QB9A 1VGCB 1F5LA 5AFZH 1EQ9A 1IQKA 1D3DB 5F8ZA 2BD5A 2WPIS 4XBBA 5EU8A 1J8AA 2ZDNA 1NS3A 2EA3A 1QJ1B 1Y59T 4AB9A 4BTUB 2O8TA 2SGDE 3P8OA 3RDZA 1QTFA 1C5RA 1C5VA 2ZU2A 1UVTH 2C8XB 3U1IB 1DWEH 1G2MA 2WYJA 4IN1A 3URDA 2AMPA 2STAE 3SJOA 3SI4H 2GCHG 3ZZ7A 1V2JT 1O2XA 7LPRA 3Q00A 1NC6A 5DJ7A 2ZU3A 2K7XA 1ZPZA 2BD7A 3RXAA 4OS1A 3SJ8A 3BEUA 1SGIB 1UMAH 1Y5UT 2ZHQH 1GI4A 2ZQ1A 3VB4A 4CR5A 1QBNA 1BUIA 3RXOA 1EZQA 4LXBH 1IHSH 3BSQA 1GJ5H 1RIWC 4ISNA 1TX6A 1EAWA 3PTNA 3M35A 1H1BA 1UVSH 1EX3A 4J2YB 3ZZ3A 1KDQB 4AN7A 1C1SA 3SORA 3EA8A 2OLGA 2PHBA 3BTHE 1V2VT 4WH8A 5GDSH 4GHTA 2ZTXA 1IQHA 5HM2A 1FY3A 2A4QA 1HAZB 5JPMH 3SNBA 3PYHA 1C4Y2 2FYRA 3W94A 4THNH 5HMAA 5FPTA 1C5LH 3Q76A 5SGAE 4YOIA 2PLXA 2AYWA 1O2UA 1O3OA 2SNWA 4FU8A 4TPIZ 4ABDA 3HPTB 2WPHS 1GHAF 1CGJE 3P8GA 1TOCB 1IQJA 1FONA 1C5YB 4ABHA 4BOHA 1TGBA 2THFB 3F9HA 1V2RT 2ZFSA 3AASA 2R0KA 2K1QA 1EUFA 3IWMA 1AKSB 2Y7ZA 1S84A 1ZMJA 2JETB 5L2YH 1TGNA 1IQMA 5CHAC 4JYUH 3T62A 1GHWH 1GMDG 1LTOA 1DM4B 2O8UA 1F0TA 3RXFA 1MUEB 1SSXA 1UTOA 1G3EA 1QL7A 1O2YA 1ELTA 2RG3A 1G37A 1DICA 3QUMP 4VGCC 4IBLH 1JOUB 4INKA 2FI5E 3A8BA 1YPHE 3GYLB 2A31A 2DE9A 4YT6H 1UTQA 1QL9A 2C90B 1OPHB 3TPIZ 4CRFA 1Z1IA 1HXEH 3M3SA 2YOLA 3PTBA 2ODPA 4A5TS 1GCDA 5E2PA 2F9NA 5ESTE 1LVBA 1GBDA 2R0LA 3MU8A 1TRMA 2P95A 1SQOA 2FDAA 4IN2A 3MU0A 1LO6A 4JK6A 1G30B 1RRKA 3DD2H 1ZJKA 4K8YA 1O2GH 2B0FA 2OC0A 5C67A 3ZV8A 4X2XA 2A7JA 5ABWA 5DP3A 5C3NA 2R3UA 5A8XA 3OU0A 3PO1C 2V6NA 1AWFH 2FLBH 2H9HA 2PKSC 2CV3A 3V3MA 2W5EA 3MI4A 4JZFH 1A0HB 1C5ZB 5JDUB 4CRBA 4B2AA 1V2ST 2A5IA 3UFAA 3NXPA 3A85A 2BTCE 2SGEE 1DSUA 2ZDAH 1P57B 3ZVDA 1J14A 1D4PB 1O5BB 1O36A 1ESBA 1QURH 2VVCA 1MZAA 3GDSA 1BBRK 1D3PB 1H4WA 3H5CB 2QCYA 4Y8XA 4NFEA 3A7VA 1LQEA 1YPMH 5EPNA 4YESB 5FX5A 2R2WU 1YCPK 1MTSA 1W14U 2WPMS 1QQ4A 1THRH 3ZZ8A 2FOGA 4GSOA 2TPIZ 1O39A 1BMAA 1L4ZA 1DUAA 1QB6A 1GHVH 1C5OH 1Z6EA 1M9UA 3MHWU 2G4TA 2BY9X 4YM9A 7ESTE 5HM9A 1S5SA 3WY8A 4FUJA 1FXYA 3U8OH 4U2WA 1N8OB 2ZNKH 1PQ5A 3ESTA 4ZHAA 1O3FA 4LK4A 3LONA 1LMWB 1GI3A 1O3HA 2AIQA 4QT8C 1AO5A 1GJCB 1C5UA 2XBXA 1BTPA 3AAVA 1HJAC 2OP9A 3RMNH 4GCHF 3M7QA 4K1SA 3C1KA 3QK1A 2SGFE 1DS2E 2EI8A 3FP6E 4CBNA 1GJ4H 3UIRA 1RGQA 1J9CH 1OYTH 1CGIE 3MYWA 2EI6A 1SPJA 4JZEH 3P95A 1P03A 2GMTB 3JZ1B 4ZAEA 3RXHA 1GVLA 2HALA 1TQ7B 2BDBA 3DT0H 4K3JA 3RXCA 4A6LA 3DFLA 3PMBB 2A7HA 3A7XA 3UWJH 3VPKA 2BDGA 5GCHF 3KQBA 5I25A 2J95A 1A7SA 1QIXB 2FPZA 3F1SB 1T8MA 3Q3KA 2QXGA 1OWIA 1WU1A 3PMHB 3SUDA 2ZI2H 4Z0KA 1K9OE 2ZCHP 1UTPA 3OYPA 1BTZA 1EAIA 3M61U 5L6NH 3SJ9A 4AFQA 3BEIB 5TCAA 6ESTA 2Z3EA 2H2ZA 1Q3XA 3TGKE 2CN0H 2DUCA 2GT7A 1GBLA 3M36A 4TWWA 3A81A 4HGCA 1UK2A 4CRAA 4JCNA 1TMUH 3ZZ5A 2VIPA 5GXPA 2P16A 2VIDA 1P04A 1TIOA 3VB5A 2C8ZB 1MCTA 4MPVA 2OC1A 2XBYA 3GOVB 4DGJA 1TB6H 4LZ4B 2VVUA 1BMMH 2G52A 2IJOB 2Z9LA 4NFFA 1S82A 1GJ7B 1CE5A 3SV2H 1XXDA 3TK9A 3BTDE 1DXPA 4WXVA 1GBEA 1GJDB 1L0ZA 3ZZ4A 1A3EH 1ZSLA 1OP0A 4CREA 1W8BH 4ABBA 2HPQH 1TFXA 2O9QA 3VEQB 4CHAC 2FYQA 2V3OH 3UREA 2XYAA 3UOPA 2BOHB 3VGCC 3ZZ6A 5LPFA 2ALVA 3STIA 1HAYB 5FXLA 4ZHLU 1WSSH 1UTMA 4B71A 2ALPA 3UQVA 2AH4X 4K5ZA 4Y71A 4ABGA 1MTUA 3ZVFA 1Q2WA 4BAOB 2ESTE 1ZOMA 2BOKA 3SU0A 3MO3A 2FO9A 1O31A 3SGBE 3VB7A 2YNAA 3RM0H 4ZMAH 4MLFB 5DK1A 1V2UT 4ZXYH 5FPYA 2BDHA 4GLYA 1OOKB 1XVOA 1WQSA 3GCNA 1C5XB 2JKHA 3MNSA 1P2IA 3S9CA 2OQ5A 1W7XH 1AB9C 1DOJA 1GPZA 2C4FH 3MNBA 2XTTB 2GV6A 4X2YA 3QX5H 1MCVA 2QF0A 1NN6A 1C1OA 1PFXC 2BLVA 4MNYA 1VITG 1C5NH 5EXLA 3A88A 3PM3A 1TAWA 4X1NU 4M7GA 3FZZA 1S81A 1J16A 1D9IA 5JBCS 1BJVA 3O8BA 3QZRA 3F9EA 1LVMA 1QL8A 4X8VH 2Z7FE 3H7TA 4AX9H 1O2NA 2PKAA 4XE4A 1VJ9U 2GTBA 1AHTH 1SGDE 5T3HA 2PTCE 2VH0A 4NWKA 1D6RA 2ZECA 1GI0A 2FM2A 1JMOH 1NFYA 4TY6A 2UWLA 2FOCA 1MH0A 4ASHA 9ESTA 4OS2A 3SGAE 3I29A 3TIUA 1V2MT 6CHAC 2QC2A 1E35B 1E34B 1ZLRA 2TBSA 1JRSA 2ZGXH 1FDPA 1O3PB 3GY2A 1GHYH 1AZZA 2ZWLH 1IQGA 1BB0B 1D6WA 1HAXB 4O03A 3RXDA 1CBWB 3TH3H 5A0CA 1CA0B 1NROH 1HV7A 1DFPA 1SGNE 1A0LA 4NGAH 2PGQB 4RKJB 1TALA 1HBTH 2KAIA 4TY7A 3E8LA 1F92A 1CGHA 2C8WB 5C1UA 4X6OA 2OXSA 1TNKA 1BT7A 3RU4D 3LH3A 1ANEA 1KLTA 4FU9A 4DOQA 1F2SE 1YLCA 3GY7A 3RXKA 2P3TB 2ULLA 3BTME 1O3NA 3TITA 2QGRA 4B2CA 1E37B 1ZRKA 1C2FA 4MPWA 1C2MA 4D9QA 1GBCA 1THPB 4AYVB 4MQAA 3UOUA 3ZVAA 2ZPSA 1S85A 4O9VA 5LPRA 1BQYA 4UFFH 1GGDC 3T2NA 2HVXA 1SC8U 3A84A 3MO6A 1TBQH 1RFNA 2A5AA 3F68H 4U01A 3LJJA 3UPEA 3ATKA 1P2QA 2IPHA 1LHCH 4NA9H 1ESAA 1BITA 3RXBA 1LHEH 3TJNA 1QA0A 2VJ1A 4ABJA 5HXFA 2QN5T 2PKAB 3RXIA 4O3TA 2Y5HA 4Q7YA 4HI3A 1QGFA 3NUMA 5T6GA 2FTLE 2O8WA 1ABIH 4K2YA 1KTSB 2NU0E 3MH5A 1GG6C 1YPKH 4O97A 3ODFA 3EA7A 2P3FH 3PROA 4JZ1A 3SV6A 7KMEH 2AIPA 7GCHG 2TGPZ 2QA9E 1MKXH 2XRCA 1XUHA 1NO9H 3LOXA 1RTFB 1XKAC 1P9SA 1AGJA 1QJ6B 3IG6B 3QTOH 1GBIA 2Q6DA 1KLJH 1Y3VA 3QN7A 2F91A 1UHBA 3E16B 1GVZA 2KAIB 2ZKSA 1QRZA 3EA9A 3RXPA 1DE7H 4Q7ZA 1IQNA 1NRPH 1GJAB 5EGMA 4ISOA 3LJOA 4D8NA 4LZ1H 1Y5BT 1YP9A 4K1EA 1P09A 5C2ZA 1XUIA 5EG4A 1TNJA 1VZQH 2FWWA 5DP8A 4DG4A 1OWHA 3L3TA 3P17H 1TA6A 2ZFTA 3K6ZA 1ELAA 2A0QB 1V2LT 3OSYA 1GMCG 3A8AA 4AFSA 2ILNA 1HAPH 1AUJA 1C9TA 2BQ6B 3AW1A 3GY8A 1QHRB 3U98H 3M37A 2WPLS 2Z9KA 3K6YA 1FUJA 3EGKH 1VGCC 2BQ7B 3GY6A 4NSVA 1AWHB 1EOLA 1BCUH 1O5FH 3SW2B 2G4UA 1TRNA 4X1SU