4KTCA

Ns3/ns4a protease with inhibitor
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
175
structure length
175
Chain Sequence
APITAYSQQTRGLLGCIITSLTGRDKNQVDGEVQVLSTATQSFLATCVNGVCWTVYHGAGSKTLAGPKGPITQMYTNVDQDLVGWPAPPGARSMTPCTCGSSDLYLVTRHADVIPVRRRGDSRGSLLSPRPVSYLKGSSGGPLLCPSGHVVGIFRAAVCTRGVAKAVDFIPVESM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Serine protease NS3
publication title Discovery of Danoprevir (ITMN-191/R7227), a Highly Selective and Potent Inhibitor of Hepatitis C Virus (HCV) NS3/4A Protease.
pubmed doi rcsb
source organism Hepatitis c virus (isolate japanese)
molecule tags Hydrolase/hydrolase inhibitor
total genus 40
structure length 175
sequence length 175
chains with identical sequence C
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2013-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02907 Peptidase_S29 Hepatitis C virus NS3 protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4ktcA02
2.40.10.120 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 4ktcA01
2XCNA 1ZJDA 3A87A 2AGIX 3ZYEA 2FZZA 4MNYA 2OP9A 1G3EA 2GV6A 1LKAA 4X0WU 1D4PB 3SN8A 1EZXC 5IYTA 3T2NA 1PPFE 4H4FA 2SFAA 1UVUH 3S7KB 1CHOF 1BMLA 4O3UA 1XVOA 3MNXA 3RXJA 1YGCH 1FY4A 2W3IA 4LOYH 2QGRA 1QL9A 1NS3A 3U8TH 1ETSH 5JBCS 1FY5A 1T4VH 4NZLA 1J16A 4VGCB 2B0FA 4E7NA 2JH6D 4OS2A 1EXFA 2R0KA 4D9QA 1ESAA 4HTCH 2Q6GA 1AMHA 1WTGH 3LC3A 1GBKA 3LJJA 1SQAA 4CRGA 5LH8A 4XDEA 1O2NA 3UIRA 1GI3A 1NRNH 1VCQA 4JZFH 4GPGA 3MI4A 1Z6EA 3LPRA 4DIHH 1QTFA 1TOCB 5FBEA 1KXFA 2BY9X 2PWXA 2BHGA 3UY9A 4YM9A 1SL3A 5C67A 4HI3A 3VFEA 4LZ1H 1EJNA 4ISLA 3QZQA 1LPKB 1C5LH 2EEKA 2Y6TA 4JZDH 1P02A 1UK2A 3SGQE 3S69A 4HZHA 5L6NH 1UHBB 4THNH 1O32A 3A85A 4AN7A 1BJVA 1QRXA 3FAOA 5HMAA 3KF2A 3D62A 3ESTA 1BTPA 1RXPA 2BDGA 4JYTA 2ZFPH 4X6MA 5E0JA 2A1DB 3GCTG 1N6XA 1OX1A 1H9HE 3MU0A 4HFPB 4MG3A 1O2SA 5F8XA 1O2UA 2P16A 1MCVA 4B2AA 4YTAA 3T25A 1VR1H 1UJ1A 1ZOMA 4A6LA 4B73A 1QJ1B 3LH3A 3EYDA 3LGWA 2ZCKP 3KN2A 2G4UA 1BTYA 1O31A 1W8BH 3U8RH 3OY5U 1ZTKA 1D6RA 1GI1A 1HB0B 4E05H 4CBNA 1YP9A 1EATA 5GCHF 4CH2B 1ZRKA 3T62A 4Y0ZE 2ZDLA 7GCHG 1NESE 5AFZH 1AWFH 1ZGVA 3SJOA 1ZSLA 4FXGH 2IJOB 1KXDA 2DE8A 1ZRBA 2FX6A 2OTVA 3S9BA 1C5PA 1OWEA 2Z7FE 2QV1A 3KHVA 1PQ7A 2IPHA 2ZGXH 2ESTE 1CA0B 1C2HA 1GJ5H 4KKDA 1Y3VA 3SNAA 4UD9H 1IQFA 3U98H 1H8DH 1C5ZB 1FAKH 1CU1A 1LHGH 1OWDA 1QBVH 1WSSH 2GZ8A 4DIIH 2FM2A 1P8VC 3AAVA 3UTUH 3MNSA 5C2ZA 1OOKB 1TPSA 5C3NA 1SGRE 1TBQH 3M35A 4IW4E 2ZDAH 4B74A 1QBNA 1TA6A 4JCNA 5HM9A 1NU7B 1K28D 2IN2A 1P9SA 3PWBA 3T5FH 2WINI 1P2NA 2FWWA 3A88A 3ZZ3A 1NY22 3GY7A 1GBLA 4X1RU 1UTQA 1Y3WA 1IQMA 3KQCA 1C2GA 4H6SB 2H5CA 3EDXB 3M5MA 2ZGCA 2SGAA 3PWCA 1EOLA 2XTTB 1QBOA 1GJ4H 2BD7A 3CS7A 1G36A 1VITH 4AFUA 1GBBA 2EC9H 3P92A 1V2JT 1S84A 4YO9A 3TITA 3RMMH 1BMAA 2ZDNA 2OC1A 3FVFB 1O2LA 1PQ8A 2RA3A 1W0YH 5T6GA 2ZTZA 1RD3B 2VU8E 5EG4A 1YYY1 2PKAB 8ESTE 1CBWC 3A89A 2XBWA 3ZVEA 2OK5A 5FAHA 4INLA 2STBE 2XRCA 2GDEH 2EA3A 1LHFH 1MD7A 1RFNA 1AWHB 2A7CA 1OP2A 3SNCA 1LVMA 1ZPZA 2XXLA 2BD3A 1K1IA 5FBIA 3SJIA 1T31A 1DWDH 2AH4X 1O3EA 2GP9B 2XBVA 3PTBA 2P59A 2BD9A 2VBCA 1K1NA 1ZTJA 3SNBA 1V2MT 3F1SB 1JBUH 2R0LA 3SV8A 1FNIA 1SGIB 1IQKA 3MH5A 5FPSA 3PMBB 2D26C 1QQ4A 2OD3B 5ESBA 1O5CB 1WUNH 3SNEA 2Y5FA 2FLRH 2BX4A 1BTXA 1ELFA 1HLTH 4MLFB 4ISNA 1RTLA 1PJPA 1P2JA 3SU3A 1B5GH 3HPTB 1UTPA 3LH1A 2WV5A 5EPYA 2BD2A 4ZUHA 4CRDA 1GJ8B 2G5NA 2R3YA 3SJ9A 1BT7A 1WAYB 2SGQE 1KXAA 4A1XA 3BIVH 1O3LA 1SHYA 3GYMA 4BAKB 4R0IA 4O03A 3FZDA 1VGCC 3SW2B 3URCA 4KTCA 1O5DH 5E2OA 1AZZA 5DG6A 3SI3H 5EOKA 3A7VA 4E7RG 1J15A 2VB0A 2A5KA 3LDXH 1SI5H 1OWHA 1CA0C 2CHAB 3EE0B 4X2YA 3AK5A 1FPHH 2XBYA 4KP0A 2FO9A 3SUEA 1EPTC 1VJAU 4AORA 2EI7A 2W7SA 1Y5UT 2XYAA 1ZPBA 1EQ9A 2W7UA 2VWLA 2BLQA 4B1TA 2Z9IA 1TLDA 1BQYA 1BTUA 1MKXK 4X8TH 1IQIA 1BB0B 1QIXB 1LPGB 3EQ0H 2P3UB 5C1YA 2TPIZ 4WH8A 2JETB 3E3TA 1NFUA 3ZZDA 2HNTE 3LC5A 2BOHB 3A86A 2H9HA 2H9TH 1SLXB 1E36B 5FCKA 2ZU2A 1P2MA 1C5WB 2ASUB 1P2QA 3SO3A 3UQVA 1OP8A 2J34A 4BXWA 3K65B 1L4DA 2FOFA 1ELAA 1O37A 3PO1C 4MNWA 1XXDA 1HDTH 1YPKH 3TK6A 2NWNA 1F5RA 4YT6H 2PFEA 1SGDE 2BVSH 3M3SA 2ZO3H 1O3DA 1HJ9A 2BDIA 1XMNB 1BTWA 5HM2A 1DY9A 1O5BB 3RC5A 1RJXB 1W2KH 3F9EA 2ZZUH 3T26A 1XVMA 4Z6AH 5A09A 1ZSKA 5K7RA 1C9TA 3VB5A 1SGNE 1FN8A 3ATMA 1BBRE 1SMFE 4IS5A 1D3PB 1NFWA 5IDKA 2JKHA 1MTNB 4FVDA 2FESH 4ABHA 1UVTH 1O2VA 3QGJA 1O38A 3Q3XA 3N7OA 1GDUA 5DP3A 1TB6H 3BG4B 4MVNA 3DFLA 5TCCA 1BBRH 2NU1E 3ZV8A 2BLWA 2WV4A 4K69A 1VCWA 3SQHE 1DT2A 1MKWK 1KYNA 4ABGA 1AVGH 4K1TA 1A3EH 1S81A 1SLVB 1EPTA 2RA0A 1BOQA 1GI6A 2F9NA 1ID5H 2Q6DA 2A0QB 4ABBA 3TH4H 3ZYDA 1UCYE 2WPKS 2D1JA 5I46H 2QN5T 3FP6E 4WF8A 1SGCA 1Z6JH 4F4OC 1JXPA 1KXEA 1GBAA 1IQJA 3NZIA 2SGDE 4FU9A 3RM0H 3AAUA 1SGYE 1AFQC 1GI5A 1KLJH 5ESTE 2VGCC 1JMOH 1RS0A 1PYTD 3TK9A 1UCYH 1XUJA 3RXVA 3GCTF 1G2LA 5T3HA 2NU3E 1KXBA 1LPZB 4DCDA 1O5AB 2FMJA 4Y8XA 1O3AA 2FOHA 4B76A 3R0FA 3AASA 3TPIZ 1O3GA 5DP7A 2QXJA 2ZGHA 4B6EA 1NM6A 3FP8E 4XSKU 2QXGA 1GMCG 1HAZB 1YCPH 1ANBA 1GHBG 1JRTA 1ABIH 4JYVH 4Y11E 3A7TA 1P9UA 2UWOA 1HAHH 2C8XB 1TAWA 1LKBA 1DICA 2WYGA 3DD2H 3NCLA 1O33A 7GCHF 1VJ9U 3ODFA 2ANMH 1CHGA 4BTUB 3SV9A 3E0PB 3TH3H 2KAIA 1ETRH 3E91A 3LGYA 3QTOH 2ZI2H 1O2GH 3QX5H 1WXRA 4PROA 1PQ5A 1C4V2 1TALA 3GY2A 4K1SA 1YF4A 3FZZA 1F0TA 3BTME 4I8JA 3KQDA 4FUGA 1T32A 1F92A 1ORFA 1A5HA 1KIGH 1XXFA 5J4SA 3OTJE 1V2WT 2ZGJA 1HNEE 3M3TA 3A8CA 2C8ZB 1IQNA 2ZF0H 1NC6A 5ETXA 4NA7A 1YPGH 3K9XB 4X8VH 1PPCE 2RCEA 1NPMA 4X1PU 1O3KA 1F0UA 4BTTB 2P3TB 3RDZA 1ZZZA 4NG9H 1O5FH 1XX9A 2HVXA 3P70B 2F9BH 1O3MA 1FMGA 1SFIA 3SNDA 7LPRA 1XUGA 1GJ9B 2J95A 2OC7A 2WPLS 1O2YA 1DFPA 1YPHE 3KCGH 1YPLH 1SQTA 1O2RA 1TNGA 2A5AA 1FUJA 1WU1A 1NFYA 1SQOA 2B5TB 3GCHC 3HKJB 3BTQE 1WYKA 2K1QA 1FAXA 3ODDA 2Y82A 2TIOA 4NIYA 2GT8A 1JRSA 1DOJA 2AYWA 3KQBA 2CN0H 3D49H 4FUBA 1SGFG 4GHQA 1TBZH 3UR9A 1G32B 1RRKA 5FX5A 4CREA 4XBBA 4NSYA 3MH6A 4CH8B 1UTMA 3UOPA 1HAOH 3GCNA 1C4Y2 1LDTT 1A46H 3Q3KA 1QRWA 1BTZA 4J2YB 3SV7A 1ZTLA 1GHXH 2W3KA 2ZFSA 5CHAC 2XBXA 4D76A 5HXFA 4R8TB 1QHRB 3L33A 3KL6A 2BD5A 3ZZ5A 4AGJA 4UDWH 1C2MA 3HKIB 4UFGH 5ABWA 3A7WA 1Y3UA 2BDBA 1KLIH 2XC5A 3VXFH 1ELGA 1HXEH 1CO7E 1VITG 4AB8A 4WMEA 7ESTE 1UVSH 3A8DA 4NWLA 2FDAA 4JK6A 2NU4E 1DDJA 2P93A 1QGFA 4ZXYH 5A2MH 3EA9A 3MYWA 3RMOH 1LHDH 3PROA 1XKAC 1V2LT 4K5ZA 3RXIA 3U9AH 3TGIE 5DJ7A 3MU4A 3ENSB 1C5OH 3E16B 4OS6A 1P0SH 3A83A 3RXCA 2CV3A 1TONA 4MDSA 4TPIZ 1TWXB 3M3VA 4I8LA 3QUMP 2XWAA 1AI8H 2GD4B 5EPNA 1HAGE 4OM9A 1GI9B 1C5MD 2J4IA 2R3UA 3HK3B 3AVZA 4BAMB 3GY6A 2A45B 1C5NH 2V3OH 1QB9A 1DS2E 1GDQA 3RXUA 4D7FA 1TGNA 2BY8X 4ZXXH 2HRVA 1Q3XA 3QK1A 2G8TA 2ULLA 5T1VA 2FS9A 2PKSC 2TGAA 1GMDG 4Y79A 3MH4A 4NIVA 3A7YA 3LU9B 5DKMA 5EQQA 1A61H 1CBWB 1MU8B 2PUXB 2G55A 3ZV9A 3CP7A 1EZUC 1SGQE 2BMGB 4YOGA 1OWJA 1DXPA 1FV9A 1K9OE 4JMYA 5F6MA 1GCTC 2G00A 2GCHF 1QJ6B 5DP4A 3QDZB 4AX9H 1AN1E 1V3XA 1PFXC 3M5LA 1OSSA 1BITA 3K2UA 2Z94A 3SU1A 1C1QA 1W11U 4UE7H 3GY4A 4IGDA 1DWBH 4RI0A 3ZVCA 2HPPH 1Y8TA 3CENA 1EOJA 4SGAE 2G4TA 1DY8A 1MZAA 2A4GA 1C1TA 1DUEA 1J14A 1XUFA 1AE5A 4OS7A 3BTKE 4K2YA 4WVPE 1QFKH 4ZKOU 4JZIA 2ZA5A 2HWLB 3Q76A 2SNWA 1V2OT 2ZHEH 3SJ8A 1TQ7B 3SV2H 1K1PA 1F2SE 1TGCA 4AZ2B 1WTHD 1P57B 1M9UA 1BHXB 1MTUA 1GL0E 1TIOA 1HFDA 1EASA 1CT2E 1VGCB 4FUIA 4JZ1A 2BDCA 8KME2 1UK3A 1THSH 2C3SA 1QRZA 1AKSA 4NIXA 5G4BA 4MPXA 4AB9A 2BOKA 1V6DA 1S0QA 1O5GH 1EPTB 1HIAA 3RU4E 1H4WA 2CJIA 2ZEBA 2BLVA 3RC6A 1FY3A 2XC4A 1GBIA 2IOTA 2OLGA 2QC2A 3V3MA 1FZZA 4Q7ZA 2WPJS 1LMWB 4K8BA 2FOEA 1DSTA 1HYLA 2RG3A 3UPEA 1O3HA 1MBQA 4YZUA 3ZZAA 5T6FA 3UWJH 4DG4A 1GHBF 2TBSA 1GVKB 2BD8A 2WUBA 5E0GA 1HAXB 3UR6A 3P17H 4XOJA 2TGDA 2H2ZA 1S0RA 3RLYH 1G9IE 2M5TA 1EX3A 4MPUA 4Y7AA 3SGAE 5JBAS 2FS8A 1MTWA 1WQVH 3V0XA 3PO1B 3F6UH 2LNCA 5A0CA 2AERH 1THPB 3Q77A 5BRRE 1GJAB 4IBLH 1ACBE 2VIWA 3UFAA 1ELDE 1GI4A 1V2RT 2VWOA 2C4FH 1K22H 5FHTA 2ALPA 2QA9E 2ZPSA 5A8ZA 4K1EA 1AFEH 1LQEA 1P03A 2WUCA 1QR3E 3O8RA 1OS8A 2Z9JA 5C1XA 4FUCA 1DVAH 2F9UA 1DANH 3FFGA 3RXQA 3O8CA 4I8GA 2F9PA 4FUEA 4INKA 2KAIB 1E38B 3RXEA 2QXHA 2ZPQA 1IHTH 3ZZCA 2PV9B 2UWLA 1O39A 1EKBB 2G52A 3M36A 2ZC9H 3NK8A 2YNAA 4AG2A 1SVPA 3MFJA 1GBMA 2OXSA 2FOCA 4ISOA 1WBGB 1BRCE 4MTBA 4D9RA 2BB4A 2R9PA 4ZROA 1BHXF 3STIA 4K3JA 1V2PT 1K2I1 2V0BA 4Q2KA 4BAHB 1EAWA 3MU1A 4FU8A 1J8AA 1E35B 3KIDU 4NZQA 1IQEA 1GG6C 3EAJA 4NFEA 4AFQA 3KGPA 1C1VH 4E06H 2GTBA 1V2ST 3TK5A 1JIMA 3OYPA 2QYIA 1ZHPA 5H4IB 1YCPM 2J9NA 4RN6A 2ALVA 1AFQB 1O36A 2ANWA 2J94A 2BXUH 4K8YA 3RMLH 2FPZA 2VGCB 1KTTB 1NFXA 1ARBA 2R2MB 1O3PB 1QL8A 1GHAG 3A8AA 1MMJN 2P94A 1AU8A 2PSXA 1EAIA 1GI7B 1ZHMA 1O34A 3R3GB 3BTDE 2AMDA 3EA7A 1ZGIA 3MU8A 4B2CA 3SHAH 1KDQA 5EW1H 2ZHFH 2GZ9A 1CVWH 3E8LA 2Y80A 2PW8H 4TY7A 1H9IE 1D6WA 4ABAA 4JZEH 2ODQA 1HXFH 4UFEH 5FX6A 4U01A 4INHA 4YLQH 4GAWA 2PTNA 1DE7H 1OWKA 1VITF 1MTSA 3ZVGA 2FYRA 1XKBC 2I6QA 1AE8H 1A2CH 1GDNA 1HRTH 5EODA 1AB9C 1C1WH 1GBEA 4Y0YE 1HBTH 4KTSA 2OC0A 2IJD1 5JDUB 5L2YH 1K1LA 2HGTH 2PGQB 4GVUA 2AIPA 4B2BA 3SUFA 1YLCA 1O3JA 3SGBE 1UTLM 3ATLA 3PLKA 4MPWA 1F5LA 1P3CA 3P6ZB 1INCA 2YNBA 1D3TB 1C2LA 1GBDA 4X8UH 3VXEH 1UTOA 1GJ6A 4OS1A 3SJKA 1A5GH 1BJUA 2RDLA 2BQWB 2JH5D 1IOEA 3EGKH 2ZCHP 3URDA 3PMAB 1A1RA 2QAAA 4TPYA 2GV7A 3BF6H 3RXTA 3PV4A 2Y7XA 1EZSC 3E1XB 3H7OA 3M37A 2G5VA 4Z0KA 3SUGA 1DLKB 1ETTH 2BY7X 1PPHE 1Z7KA 3PB1E 5EGMA 9ESTA 1SLWB 1CGIE 1TGSZ 4ZHMU 1IHSH 3UNQA 5C20A 1C2FA 1GMDF 3NUMA 4XFQA 1K21H 4LK4A 1HJ8A 4NWKA 3LJOA 1ZLRA 3ATIA 3GCHB 1S83A 1P2KA 4GCHG 2FLBH 1SGFA 1A0JA 1AO5A 3SU0A 1C2DA 1TOMH 3OU0A 2SGFE 5EU8A 5EXLA 1GPZA 1HJAC 1TNLA 2W5EA 3L6PA 2TGPZ 4ABEA 6ESTA 1GMHG 1B0FA 4AYYB 4CRAA 1FXYA 2HLCA 1HGTH 5FXLA 2A31A 1DXWA 2D2DA 4CR9A 4WMFA 2V6NA 1G3CA 3TNSA 4NFFA 4X1SU 1H1BA 3V7TA 4ZKRU 4FUJA 2FXRA 5CHAB 2EI6A 1TNIA 1GGDC 1Y3XA 3UOUA 3U8OH 3MH7A 1DITH 1G3DA 2BDHA 1D9IA 3QLPH 2BLOA 1L1NA 5AF9H 1S6HA 1C1OA 2FI4E 1AHTH 5J4QA 2AGGX 2ZFFH 2GX4A 1GHVH 3A84A 3TJUA 4I31A 1O2OA 4ZMAH 3LGVA 1N6YA 1C1MA 2VIQA 2Y5HA 2BXTH 2ZDVH 1LO6A 6LPRA 5LPFA 2A2QH 3TJNA 2HNTF 4GUXA 2H9EH 1C5QA 2XWBI 3JZ2B 4ZHAA 2Y81A 1Z8IB 3VB4A 4IN1A 3NPSA 1ZPCA 1L4ZA 1TPOA 4DT7B 3AW1A 1KSNA 2PLXA 4I8HA 2HNTC 3PLBA 4CR5A 1T8OA 5GIBA 4SGBE 4Y71A 3F68H 4ABDA 2Y5GA 4BTIB 1B7XB 5JB8S 1S6FA 2OC8A 2A5IA 3RXDA 1IQLA 3KEEA 3B23B 1AKSB 5GPIB 5I25A 1O3IA 1WV7H 3GDVA 1A4WH 1MKXH 2VWNA 1E34B 1C9PA 1T4UH 2GKVE 3NKKA 1HIAB 3T29A 3M5OA 1O0DH 1PPZA 2OBQA 5A0BA 2PKSB 3HGPA 5JBBS 3SZEA 2XCFA 5F8ZA 3TGJE 1DUAA 1C2KA 5C5NA 1O3NA 3ZVAA 2O8WA 1A0LA 2AGEX 2ZQ2A 2TGTA 2PTCE 1HPGA 3TJOA 4Y8YA 1GCTB 2Z9GA 3HK6B 2XC0A 3D23A 3UQOA 3MHWU 4A1VA 1TFXA 3RXPA 4JK5A 3SU2A 1QQUA 4Y8ZA 3B9FH 1SLUB 3LKWA 4WWYA 5JPMH 1RTFB 2BDAA 4GHTA 2CF8H 1V2TT 2BVRH 1DSUA 2P95A 2C90B 3O8BA 1O2ZA 4HGCA 4YT7H 5FCRA 1CA8B 3RXHA 1NROH 1C2IA 2UUJB 5EXMA 1JIRA 5JB9S 2YOLA 1QL7A 4YLUA 2OUAA 4XBDA 1DLEA 2XW9A 1TX6A 4Y6DA 1SGEE 3M61U 3S0NA 3PTNA 2NU0E 2WHXA 3FP7E 4DY7B 4ASHA 2UUFB 1MKWH 2G81E 2BZ6H 5FPTA 1GI0A 1OXGA 4TYDA 4XE4A 1LVBA 1MAXA 3QWCH 4TY6A 5PTPA 2EI8A 2ZU4A 2AFQB 1EZQA 4KTUA 4X1QU 3RC4A 2SGPE 9LPRA 4M7GA 6GCHG 3C1KA 1SBWA 3LGTA 3NWUA 1BUIA 3QTVH 3TNTA 3D65E 4XBCA 1SC8U 4FUDA 1N1LA 6CHAC 4YOIA 1UO6A 1OP0A 1GWAA 1RIWC 2C93B 1GHAF 3SU4A 3ITIA 1GHZA 2ZWLH 3DUXH 1EAXA 5A0AE 1TGTA 5DK1A 2GVFA 1KTSB 3PLPA 1PYTC 3UUZA 1BRBE 2BY6X 4YESB 4F49A 2VVVA 3BV9B 3TH2H 3PV2A 4JYUH 1O30A 2FOAA 1O5EH 3VB7A 1HAVA 1TMTH 2BYAX 1A0HB 1O2JA 4GSOA 5GDSH 2ZQ1A 4AFSA 3H09A 1CGHA 1GJBB 3VEQB 1ESTA 1BIOA 5FPYA 1MZDA 1P06A 4I32A 2OQ5A 4GLYA 1QCPA 1AY6H 1FIWA 4OGXA 3RXLA 1AGJA 1KDQB 1MU6B 1E0FD 4O97A 4DJZB 1N8OC 1HCGA 1UMAH 1PQAA 1MQ5A 2P8OC 3GICB 1OKXA 1FN6A 3RP2A 1QURH 4TWWA 2ZHWH 5C1UA 1MAYA 4NA9H 1AZ8A 1O35A 4DGJA 1OPHB 1LVOA 1SFQB 1LTOA 1NTPA 5F03A 1T8MA 4X1NU 1GVLA 2J38A 3BTEE 1IQHA 2GMTC 1Y5AT 3S9CA 3RXOA 1XUKA 2D8WA 1TX7A 1YPHC 2GCTC 3A80A 1O2HA 3F9GA 5E2PA 5LPEA 1ZHRA 1SOZA 1QB6A 3BTFE 1W3CA 2WZQA 3MTYA 4WMDA 3T28A 2THFB 1SGPE 3BTWE 4I33A 3WY8A 1O2XA 3I78A 3SOSA 2B8OH 4ABFA 3MO9A 1ZMNA 3K6YA 4BXSA 3ZZ8A 2O8LA 1O2PA 1WOFA 4CRFA 5L2ZH 1UK4A 4KGAA 3GYLB 5AVDA 2FOBA 5F8TA 2CF9H 1NN6A 4UONA 2PUQH 3O8DA 4A5TS 1GG6B 1GI8B 4J1YA 3BIUH 3RU4D 5B6LA 4GCHF 2A4OA 4NGAH 1P12E 2A4RA 1S82A 4X2VA 3RLWH 3P8FA 1YC0A 5DP8A 3RXSA 2BD4A 1NZQH 4UFDH 1KXCA 1F5KU 5LPRA 3GISB 4CRBA 4U2WA 2FP7B 1GMHF 1GHWH 1J17T 1MQ6A 3M5NA 3VGCC 1FPCH 4D8NA 4X8SH 1BCUH 1GBTA 2P3FH 1CT0E 3M7TA 1GJ7B 2ILNA 4Q7YA 2Q6FA 1ZJKA 1Z71A 2F9VA 3BTHE 1TYNA 3EA8A 3W95A 3SV6A 5TCAA 3MO3A 3RM2H 2TRMA 1VCPA 1ZSJA 3LGIA 5GJ4B 2Z3EA 3P8NA 3OX7U 1GMCF 3IWMA 2H6MA 4CHAB 3SUDA 1GHYH 1TPPA 2FTMA 3A8BA 2VIOA 4AG1A 1AB9B 5GNDA 1OWIA 1RGQA 1FLEE 1TQ0B 1GBCA 3RXGA 1YPJH 4FUHA 1ABJH 1GBJA 1MD8A 1K1MA 4ZHLU 5LGOA 1QA7A 3SU5A 3SORA 1Y3YA 4ABJA 4TWYA 2QXIA 4WXIA 2AIQA 3ZVFA 2QCYA 3UREA 4VGCC 1BBRK 1C1UH 1ELBA 1TABE 3DA9B 7KMEH 1J9CH 4YOJA 1IQGA 2ZG0H 2ZTYA 3KNXA 4NIWA 3U1JB 1GI2A 1C1RA 5TJXA 3BEUA 2FI5E 1ZR0A 3MMGA 4QT8C 3MNCA 1BTHH 4DVAU 1KY9A 2H1UA 1YM0A 2HPQH 1TBRH 4Y10E 1SHHB 2AS9A 2ZHQH 1BMMH 1NRSH 2G51A 2VNTA 5T6DA 2WV9A 2FOGA 2A2XH 3ATWA 4NA8A 4ISIH 3L3TA 4A7IB 2PR3A 3PMJA 2ZKSA 3VB3A 2B7DH 1LVYA 2BZAA 3T27A 1C5UA 1P11E 1HV7A 3MO6A 5DPAA 3E0NB 1S5SA 1Q2WA 1P05A 1UCYK 3G01A 2SNVA 3TU7H 4BOHA 4FUFA 2AMPA 3H7TA 3FANA 1BRUP 2VJ1A 1FI8A 1HJAB 3H5CB 3I29A 2VINA 1AUJA 2J92A 1HAPH 8GCHG 2GDDA 3V12A 1TX8A 2Z9LA 4IMQA 1ELVA 4ZKNU 1O2KA 3B8JA 1QY6A 1MH0A 1AIXH 1NO9H 3I77A 2WPIS 2ZTXA 3RUOA 1C2EA 2GT7A 1YCPK 2LPRA 1EJAA 4I8KA 2UWPA 2AMQA 4B6FA 2BY5X 3LOXA 2ZECA 3PM3A 4MQAA 5HGGA 3RU4T 1P2IA 1GVZA 4H42U 3OSYA 1PPEE 2BQ7B 1GGDB 1MTVA 5GWZA 1EB2A 5C5OA 1P04A 4FVBA 2SGEE 3A7XA 2ZNKH 2OBOA 3S7HB 1C5RA 1H9LB 4D7GA 1MBMA 1TNKA 1PPGE 2F9OA 1SGTA 2QF0A 2VH6A 4X6OA 1H8IH 3GOVB 3GY8A 3TGKE 3BN9A 4KELA 4CHAC 5K0HA 2O8MA 3SI4H 1LHEH 5L30H 4WH6A 4AFZA 1O3CA 3TLOA 1G2MA 5AFYH 1ZYOA 3BEFB 1G37A 1K1JA 6GCHF 4ZAEA 1OYQA 1UTJA 5EQRA 4ZKSU 1DWEH 4O3TA 5CMXH 2QY0B 1ANEA 4CRCA 1CHOG 1Y59T 2CMYA 3LONA 1V2QT 4LXBH 4MPVA 1P01A 3LT3A 2C8YB 1AD8H 1TPAE 5CE1A 5A8XA 1TMBH 4NCYA 5BPEA 3HATH 1LCYA 1FDPA 1UTNA 1NT1A 2Y7ZA 3Q3YA 2ZDKA 1SOTA 1YKTA 1ELCA 1SG8B 3BSQA 1LHCH 5DGJA 1F7ZA 1SR5C 1GL1A 3TVJB 1DPOA 1C4U2 3QN7A 2F91A 1GJDB 5B6OA 2UUYA 1O2TA 1UHBA 2A4QA 2H5DA 1E37B 2ZDMA 1Z1JA 5DP6A 3RXAA 4IN2A 1W7GH 2FYQA 3M7QA 4Q7XA 1YBWA 2W26A 1IAUA 1YPEH 3QGNB 1BMNH 1O3FA 2GCHG 2Z3CA 2BM2A 3A82A 1G3BA 1G30B 1UVOA 1T8NA 1WCZA 1O3BA 4MNVA 2ANKH 2ZU5A 2BQ6B 1ESBA 2ZU1A 3M7UA 1TE0A 3QZRA 2Q1JA 2WPHS 3ZZ6A 3KQEA 2C8WB 3RXMA 2VVUA 2ZGBH 1HAVB 2A7HA 2OQUA 4IC5A 3ZVDA 1XUIA 1EAUA 1W10U 1AQ7A 1O2IA 3RXKA 3MU5A 1EUFA 3GDUA 3RXBA 1BRAA 1K1OA 1V2UT 3CS0A 3ELAH 2FOMB 2ODPA 5DO4H 1ANCA 2ANYA 1TGBA 2ZCLP 4B71A 1L0ZA 3PYHA 1QB1A 3SHCH 3ZZ9A 3ZZ7A 3U1IB 1QNJA 1C5SA 3RXFA 2R2WU 3VPKA 2FIRH 1P10A 1TRYA 2V35A 2VH0A 1HUTH 1Z8GA 1WQSA 2BVXH 3QO6A 1O2WA 1GBFA 1KLTA 1JWTA 4UEHH 5GCHG 4WJG2 3JZ1B 1HAYB 4BAQB 1O2MA 1QJ7B 2O9QA 3MNBA 3GCOA 4ZH8A 3PV5A 5EQSA 1SPJA 3IG6B 1EP6A 2V3HH 3DFJA 3SZNA 1JOUB 2B9LA 1CE5A 1TNHA 1CQQA 1EJMA 1DWCH 3E90B 2ODYB 8LPRA 2PGBB 1FY1A 4CBOA 2PSYA 4U32A 1YPMH 2CHAC 1V2VT 2ZPRA 5HYOA 1NRQH 1V2KT 3DHKH 4NSVA 1FONA 1OYTH 1Z8RA 3SYJA 1EB1H 3A7ZA 1XM1A 1F0RA 6CHAB 1TNJA 4H6TA 1BA8B 4LZ4B 1RIWB 3PMHB 3C27B 4DOQA 5SGAE 2F4LA 4OS5A 4Y7BA 2PKAA 3BEIB 1F0SA 3VB6A 2QIQA 2O8UA 3RXRA 3ATKA 4I7YH 3MOCA 1C1NA 1O2QA 4X6PA 2JETC 2CGAA 1A3BH 2A32A 2VWMA 2I6SA 1QA0A 2PHBA 1EP5A 3Q00A 2GGVB 3V13A 2VIDA 3F9FA 3UWIA 1RTKA 2ZHDA 2HALA 2FODA 3STJA 1C2JA 1AVXA 3E6PH 3BTGE 4AOQA 1THRH 2Z6BD 2F83A 1C5XB 2UUKB 4U30A 1BDAA 1XUHA 2ZFTA 4IMZA 1GJCB 1NRRH 1NU9A 3GDSA 4X2XA 2BX3A 4WXVA 4ABIA 2HOBA 2WYJA 3A81A 3OY6U 5JYIA 4O9VA 4ISHH 4AGKA 1P3EA 1N8OB 1ZMLA 1O3OA 1FIZA 1P09A 1SB1H 1DX5M 1TMUH 1ZMJA 2P8OB 1ANDA 1GBHA 4MNXA 1X7AC 2FI3E 2F3CE 1T8LA 5AHGH 4AYVB 3SU6A 2OINA 4BNRA 1BZXE 4B75A 2WPMS 1UVPA 2VIPA 5E0HA 1L1GA 2FTLE 1MTNC 2GMTB 2FEQH 4RSPA 4X6NA 1ELEE 1A5IA 2VVCA 2GCTB 3S9AA 5DP9A 3DT0H 1DM4B 5E8EH 3W94A 4A1TA 2NU2E 1A7SA 2CXVA 2JH0D 3AW0A 2BTCE 1S85A 3BG4C 4M9FA 1C5YB 3P8OA 3BTTE 2AEIH 2GZ7A 1AVWA 1FJSA 4BANB 1CT4E 3K6ZA 1L2EA 2A7JA 3P95A 1L1JA 2ZP0H 1C1SA 1MCTA 2ZFQH 3NXPA 1W7XH 3HGNA 2XNIA 2BDYA 3RMNH 1Z8JB 2J2UA 1HAIH 1FY8E 4OS4A 4UFFH 4Y76A 3BG8A 4WY3A 3UNRA 3IITA 1CGJE 1D3DB 3ZZ4A 1T7CA 3F9HA 1CSOE 2ZFRH 5DP5A 1UTKA 5EXNA 1YLDA 1W12U 4RKJB 1LQDB 3OTPA 1AUTC 4ESTE 5GXPA 1C1PA 3GY3A 8GCHF 1W13U 1ELTA 3ZZBA 1D3QB 1Z1IA 4BAOB 2ZU3A 1GCDA 1U6QA 5JBTA 4OGYA 3P8GA 1NRPH 4A92A 1PPBH 1TRNA 4Q80A 3VGCB 3LIWA 3SBKA 4DW2U 2QF3A 1ARCA 2DE9A 4RKOB 2VIVA 1W0ZU 3UNSA 2Z3DA 1Y5BT 1B0EA 3TIUA 3U69H 3MWIU 2Z9KA 2OCVB 1MUEB 4IC6A 1TRMA 1P2OA 1W14U 2ZIQH 1C5VA 2STAE 5A8YA 1SSXA 4DURA 3TJVA 2O8TA 4FU7A 3SQEE 1C5TA 2DUCA 1V2NT 3GY5A 4K60A 3ZVBA 4X2WA 1TA2A 1VZQH 1Q31A 1FQ3A 5EW2H 2FX4A 3LGUA
chains in the Genus database with same CATH superfamily
2XCNA 1ZJDA 3A87A 2AGIX 3N99A 3ZYEA 2FZZA 4MNYA 2OP9A 1G3EA 2GV6A 1LKAA 4X0WU 1D4PB 3SN8A 1EZXC 5IYTA 3T2NA 1PPFE 4H4FA 2SFAA 1UVUH 3S7KB 1CHOF 1BMLA 4O3UA 1XVOA 3MNXA 3RXJA 1YGCH 1FY4A 2W3IA 4LOYH 2QGRA 1QL9A 1NS3A 3U8TH 1ETSH 5JBCS 1FY5A 1T4VH 5DSFA 4NZLA 1J16A 4VGCB 2B0FA 4E7NA 2JH6D 4OS2A 1EXFA 2R0KA 4D9QA 1ESAA 4HTCH 2Q6GA 5C17A 1AMHA 1WTGH 3LC3A 1GBKA 3LJJA 1SQAA 4CRGA 5LH8A 4XDEA 1O2NA 3UIRA 1GI3A 1NRNH 1VCQA 4JZFH 4GPGA 3MI4A 1Z6EA 3LPRA 4DIHH 1QTFA 1TOCB 5FBEA 1KXFA 2BY9X 2PWXA 2BHGA 3UY9A 4YM9A 1SL3A 5C67A 4HI3A 3VFEA 4LZ1H 1EJNA 4ISLA 3QZQA 1LPKB 1C5LH 2EEKA 2Y6TA 4JZDH 1P02A 1UK2A 3SGQE 3S69A 4HZHA 5L6NH 1UHBB 4THNH 1O32A 3A85A 4AN7A 1BJVA 1QRXA 3FAOA 5HMAA 3KF2A 3D62A 3ESTA 1BTPA 1RXPA 2BDGA 4JYTA 2ZFPH 4X6MA 5E0JA 2A1DB 3GCTG 1N6XA 1OX1A 1H9HE 3MU0A 4HFPB 4MG3A 1O2SA 5F8XA 1O2UA 2P16A 1MCVA 4B2AA 4YTAA 3T25A 1VR1H 1UJ1A 1ZOMA 4A6LA 4B73A 1QJ1B 3LH3A 3EYDA 3LGWA 2ZCKP 3KN2A 2G4UA 1BTYA 1O31A 1W8BH 3U8RH 3OY5U 1ZTKA 1D6RA 1GI1A 1HB0B 4E05H 4CBNA 1YP9A 1EATA 5GCHF 4CH2B 1ZRKA 3T62A 4Y0ZE 2ZDLA 1K0HA 7GCHG 1NESE 5AFZH 1AWFH 1ZGVA 3SJOA 1ZSLA 4FXGH 2IJOB 1KXDA 2DE8A 1ZRBA 2FX6A 2OTVA 3S9BA 1C5PA 1OWEA 2Z7FE 2QV1A 3KHVA 1PQ7A 2IPHA 2ZGXH 4F55A 2ESTE 1CA0B 2EQNA 1C2HA 1GJ5H 4KKDA 1Y3VA 3SNAA 4UD9H 1IQFA 3U98H 1H8DH 1C5ZB 1FAKH 1CU1A 1LHGH 1OWDA 1QBVH 1WSSH 2GZ8A 4DIIH 2FM2A 1P8VC 3AAVA 3UTUH 3MNSA 5C2ZA 1OOKB 1TPSA 5C3NA 2QF4A 1SGRE 1TBQH 5EIYA 3M35A 4IW4E 2ZDAH 4B74A 1QBNA 1TA6A 4JCNA 5HM9A 1NU7B 1K28D 2IN2A 1P9SA 3PWBA 3T5FH 2WINI 1P2NA 2FWWA 3A88A 3ZZ3A 1NY22 3GY7A 1GBLA 4X1RU 1UTQA 1Y3WA 1IQMA 3KQCA 1C2GA 5HKKD 4H6SB 2H5CA 3EDXB 3M5MA 2ZGCA 2SGAA 3PWCA 1EOLA 2XTTB 1QBOA 1GJ4H 2BD7A 3CS7A 1G36A 1VITH 4AFUA 1GBBA 2EC9H 3P92A 1V2JT 1S84A 4YO9A 3TITA 3RMMH 1BMAA 2ZDNA 2OC1A 3FVFB 1O2LA 1PQ8A 3VG8A 2RA3A 1W0YH 5T6GA 2ZTZA 1RD3B 2VU8E 5EG4A 1YYY1 2PKAB 8ESTE 1CBWC 3A89A 2XBWA 3ZVEA 2OK5A 5FAHA 4INLA 2STBE 2XRCA 2GDEH 2EA3A 1LHFH 1MD7A 1RFNA 1AWHB 2A7CA 1OP2A 3SNCA 1LVMA 1ZPZA 2XXLA 2BD3A 1K1IA 5FBIA 3SJIA 1T31A 1DWDH 2AH4X 1O3EA 2GP9B 2XBVA 3PTBA 2P59A 2BD9A 2VBCA 1K1NA 1ZTJA 3SNBA 1V2MT 3F0PA 3F1SB 1JBUH 2R0LA 3SV8A 1FNIA 1SGIB 1IQKA 3MH5A 5FPSA 4Z1MD 3PMBB 2D26C 1QQ4A 2OD3B 5ESBA 1O5CB 1WUNH 3SNEA 2Y5FA 2FLRH 2BX4A 1BTXA 1ELFA 1HLTH 4MLFB 4ISNA 1RTLA 1PJPA 1P2JA 3SU3A 1B5GH 3HPTB 1UTPA 3LH1A 2WV5A 5EPYA 2BD2A 4ZUHA 4CRDA 1GJ8B 2G5NA 2R3YA 3FOAA 3SJ9A 1BT7A 1WAYB 2SGQE 1KXAA 4A1XA 3BIVH 1O3LA 1SHYA 3GYMA 4BAKB 4R0IA 4O03A 3FZDA 1VGCC 3SW2B 3URCA 4KTCA 1O5DH 5E2OA 1AZZA 5DG6A 3SI3H 5EOKA 5EJLA 3A7VA 4E7RG 1J15A 2VB0A 2A5KA 3LDXH 1SI5H 1OWHA 1CA0C 2CHAB 3EE0B 4X2YA 3AK5A 1FPHH 2XBYA 4KP0A 2FO9A 3SUEA 1EPTC 1VJAU 4AORA 2EI7A 2W7SA 1Y5UT 2XYAA 1ZPBA 1EQ9A 2W7UA 2VWLA 2BLQA 4B1TA 2Z9IA 1TLDA 1BQYA 1BTUA 1MKXK 4X8TH 1IQIA 1BB0B 3KYFA 1QIXB 1LPGB 3EQ0H 2P3UB 5C1YA 2TPIZ 4WH8A 2JETB 3E3TA 1NFUA 3ZZDA 2HNTE 3LC5A 2BOHB 3A86A 2H9HA 2H9TH 1SLXB 1E36B 5FCKA 2ZU2A 1P2MA 1C5WB 2ASUB 1P2QA 3SO3A 3UQVA 1OP8A 2J34A 4BXWA 3K65B 1L4DA 2FOFA 1ELAA 1O37A 3PO1C 4MNWA 1XXDA 1HDTH 1YPKH 3TK6A 2NWNA 1F5RA 4YT6H 2PFEA 1SGDE 2BVSH 2KM0A 2ZO3H 3M3SA 1O3DA 1HJ9A 2BDIA 1XMNB 1BTWA 5HM2A 1DY9A 1O5BB 3RC5A 1RJXB 1W2KH 3F9EA 2ZZUH 3T26A 1XVMA 4Z6AH 5A09A 1ZSKA 5K7RA 1C9TA 3VB5A 1SGNE 1FN8A 3ATMA 1BBRE 4ASUD 1SMFE 4IS5A 1D3PB 1NFWA 5IDKA 2JKHA 1MTNB 4FVDA 2FESH 4ABHA 5C94A 1UVTH 1O2VA 3QGJA 1O38A 3Q3XA 3N7OA 1GDUA 5DP3A 1TB6H 3BG4B 4MVNA 3DFLA 5TCCA 1BBRH 2NU1E 3ZV8A 2BLWA 2WV4A 4K69A 1VCWA 3SQHE 1DT2A 1MKWK 1EFRD 1KYNA 4ABGA 1AVGH 4K1TA 1A3EH 1S81A 1SLVB 3PRDA 2K0QA 1EPTA 2RA0A 1BOQA 4YXWD 1GI6A 2F9NA 3ZIAD 1ID5H 2Q6DA 2A0QB 4ABBA 1NBMD 3TH4H 3ZYDA 1UCYE 2WPKS 2D1JA 5I46H 2QN5T 3FP6E 4WF8A 1SGCA 1Z6JH 4F4OC 1JXPA 1KXEA 1GBAA 1IQJA 3NZIA 2SGDE 4FU9A 3RM0H 1BMFD 3AAUA 1SGYE 1AFQC 1GI5A 1KLJH 5ESTE 3F2GA 2VGCC 1JMOH 1RS0A 1PYTD 3TK9A 3WWFA 1UCYH 1XUJA 2V3MA 3RXVA 3GCTF 1G2LA 5T3HA 2NU3E 1KXBA 1LPZB 4DCDA 1O5AB 2FMJA 4Y8XA 1O3AA 2FOHA 4B76A 3R0FA 3AASA 3TPIZ 1O3GA 5DP7A 2QXJA 2ZGHA 4B6EA 1NM6A 3FP8E 4XSKU 2QXGA 1GMCG 1HAZB 1YCPH 1ANBA 1GHBG 1JRTA 1ABIH 4JYVH 4Y11E 3A7TA 1P9UA 2UWOA 4AC9A 1HAHH 2C8XB 1TAWA 1LKBA 1DICA 2WSSD 2WYGA 3DD2H 3NCLA 1O33A 7GCHF 1VJ9U 3ODFA 2ANMH 1CHGA 4BTUB 3SV9A 3E0PB 3TH3H 2KAIA 1ETRH 3E91A 3LGYA 3QTOH 2ZI2H 1O2GH 3QX5H 1WXRA 4PROA 1PQ5A 1C4V2 2EY4C 1TALA 3GY2A 4K1SA 1YF4A 3FZZA 1F0TA 3BTME 4I8JA 3KQDA 4FUGA 1T32A 1F92A 1ORFA 1A5HA 2J5UA 1KIGH 1XXFA 5J4SA 2KZ4A 3OTJE 1V2WT 2ZGJA 1HNEE 3M3TA 2IPQX 3A8CA 2C8ZB 1IQNA 2ZF0H 1NC6A 5ETXA 4NA7A 1YPGH 3K9XB 4X8VH 1PPCE 2RCEA 1NPMA 4X1PU 1O3KA 1F0UA 4BTTB 2P3TB 3RDZA 1ZZZA 4NG9H 1O5FH 1XX9A 2HVXA 3P70B 2F9BH 1O3MA 1FMGA 1SFIA 3SNDA 7LPRA 1XUGA 1GJ9B 2J95A 2OC7A 2WPLS 2YMSD 1O2YA 1DFPA 1YPHE 3KCGH 1YPLH 1SQTA 1O2RA 1TNGA 2A5AA 1FUJA 1WU1A 1NFYA 1SQOA 2B5TB 3GCHC 3HKJB 3BTQE 1WYKA 2K1QA 1FAXA 3ODDA 2Y82A 2TIOA 4NIYA 2GT8A 1JRSA 1DOJA 2AYWA 3KQBA 2CN0H 3D49H 4FUBA 1SGFG 3W1EA 4GHQA 1TBZH 2KCPA 3UR9A 1G32B 1RRKA 5FX5A 4CREA 4XBBA 4NSYA 3MH6A 4CH8B 1UTMA 3UOPA 1HAOH 3GCNA 1C4Y2 1LDTT 1A46H 3Q3KA 1QRWA 2RFKC 1BTZA 4J2YB 3SV7A 1ZTLA 1GHXH 2W3KA 2ZFSA 5CHAC 2XBXA 4D76A 5HXFA 4R8TB 1QHRB 3L33A 3KL6A 2BD5A 3ZZ5A 4AGJA 4UDWH 1C2MA 3HKIB 1H8ED 2GJGA 4UFGH 5ABWA 3A7WA 1Y3UA 2BDBA 1KLIH 2XC5A 3VXFH 1ELGA 1HXEH 1CO7E 1VITG 1E1RD 4AB8A 4WMEA 7ESTE 1UVSH 3A8DA 4NWLA 2M2AA 2FDAA 4JK6A 2NU4E 1DDJA 2P93A 1QGFA 4ZXYH 5A2MH 3EA9A 3MYWA 3RMOH 1LHDH 3PROA 1XKAC 1V2LT 4K5ZA 3RXIA 1W0KD 3U9AH 3TGIE 3N7EA 5DJ7A 3MU4A 3ENSB 1C5OH 3E16B 4OS6A 1P0SH 3A83A 3RXCA 2CV3A 1TONA 4MDSA 3OAAD 4TPIZ 1TWXB 3M3VA 4I8LA 3QUMP 2XWAA 1AI8H 2GD4B 5EPNA 1HAGE 4OM9A 1GI9B 1C5MD 2J4IA 2R3UA 3HK3B 1W0JD 3AVZA 4BAMB 3GY6A 2A45B 1C5NH 2V3OH 1QB9A 1DS2E 1GDQA 3RXUA 4D7FA 1TGNA 2BY8X 5HIZA 4ZXXH 2HRVA 1Q3XA 3QK1A 2G8TA 2QE7D 2ULLA 5T1VA 2FS9A 2PKSC 2TGAA 1GMDG 4Y79A 3MH4A 4NIVA 3A7YA 3LU9B 4FOUC 5DKMA 5EQQA 1A61H 1CBWB 1MU8B 2PUXB 2G55A 3ZV9A 3CP7A 1EZUC 3F2HA 1SGQE 2BMGB 4YOGA 1OWJA 4ACAA 1DXPA 1FV9A 1K9OE 4JMYA 5F6MA 1GCTC 2G00A 2GCHF 1QJ6B 5DP4A 3QDZB 4AX9H 1AN1E 1V3XA 1PFXC 3M5LA 1OSSA 1BITA 3K2UA 2Z94A 3SU1A 1C1QA 1W11U 4UE7H 3GY4A 4IGDA 3DSOA 1DWBH 2JIZD 4RI0A 3ZVCA 2HPPH 1KMHB 1Y8TA 3CENA 3F0OA 1EOJA 4SGAE 2G4TA 1DY8A 1MZAA 2A4GA 1C1TA 1DUEA 1J14A 1XUFA 2KFWA 1AE5A 4OS7A 3BTKE 4K2YA 2L74A 4WVPE 1QFKH 3N7DA 4ZKOU 4JZIA 2ZA5A 2F43B 2HWLB 3Q76A 5KGOA 2SNWA 1V2OT 2ZHEH 3SJ8A 1TQ7B 3SV2H 1K1PA 1F2SE 2YMSC 1TGCA 3OFND 4AZ2B 1WTHD 1P57B 1M9UA 3FN8A 1BHXB 1MTUA 1GL0E 1TIOA 1HFDA 1EASA 1CT2E 1VGCB 4FUIA 4JZ1A 2BDCA 8KME2 1UK3A 1THSH 2C3SA 1QRZA 1AKSA 5HIYA 4NIXA 5G4BA 4MPXA 4AB9A 5CDFE 2BOKA 1V6DA 1S0QA 1O5GH 1EPTB 1HIAA 3RU4E 2XNDD 1H4WA 2CJIA 2ZEBA 2BLVA 3RC6A 1FY3A 2XC4A 1GBIA 2IOTA 1MABB 2OLGA 2QC2A 3V3MA 1FZZA 4Q7ZA 2WPJS 1LMWB 4K8BA 2FOEA 1DSTA 1HYLA 2RG3A 3UPEA 1O3HA 1MBQA 4YZUA 3ZZAA 5T6FA 3UWJH 4DG4A 1GHBF 2TBSA 1GVKB 2BD8A 2WUBA 5E0GA 1HAXB 3UR6A 3P17H 4XOJA 2TGDA 2H2ZA 1S0RA 3RLYH 1G9IE 2M5TA 1EX3A 4MPUA 4Y7AA 3SGAE 5JBAS 2FS8A 1MTWA 1WQVH 3V0XA 3PO1B 3F6UH 2LNCA 5A0CA 2AERH 3U28C 1THPB 3Q77A 5BRRE 1GJAB 4IBLH 1ACBE 2VIWA 3UFAA 1ELDE 2XOKD 1GI4A 1V2RT 2VWOA 2C4FH 1K22H 5FHTA 2ALPA 2QA9E 2ZPSA 5A8ZA 4K1EA 1AFEH 1LQEA 1P03A 2WUCA 1QR3E 3O8RA 1OS8A 2Z9JA 5C1XA 4FUCA 1DVAH 2F9UA 1DANH 3FFGA 3RXQA 3O8CA 4I8GA 2F9PA 4FUEA 4INKA 2KAIB 1E38B 3RXEA 2QXHA 2ZPQA 1IHTH 3ZZCA 2PV9B 2UWLA 1O39A 1EKBB 2G52A 3M36A 2ZC9H 3NK8A 2YNAA 4AG2A 1SVPA 3MFJA 1GBMA 2OXSA 2FOCA 4ISOA 1WBGB 1BRCE 4MTBA 4D9RA 2BB4A 2R9PA 4ZROA 1BHXF 3STIA 4K3JA 1V2PT 1K2I1 2V0BA 4Q2KA 4BAHB 1EAWA 3MU1A 4FU8A 1J8AA 1E35B 3KIDU 4NZQA 1IQEA 1GG6C 3EAJA 4NFEA 4AFQA 3KGPA 1C1VH 3OEHD 1OHHD 4E06H 2GTBA 2WPDD 1V2ST 3TK5A 1JIMA 3OYPA 2QYIA 1ZHPA 5H4IB 1YCPM 2J9NA 4RN6A 2ALVA 1AFQB 1O36A 2ANWA 2J94A 2BXUH 4K8YA 3RMLH 2FPZA 2VGCB 1KTTB 1NFXA 1ARBA 2R2MB 1O3PB 1QL8A 1GHAG 3A8AA 1MMJN 2P94A 1AU8A 2PSXA 1EAIA 1GI7B 1ZHMA 1O34A 3R3GB 3BTDE 2AMDA 3EA7A 1ZGIA 3MU8A 4B2CA 3SHAH 1KDQA 5EW1H 2ZHFH 2GZ9A 1CVWH 3E8LA 2Y80A 2PW8H 4TY7A 1H9IE 1D6WA 4ABAA 4JZEH 2ODQA 1HXFH 4UFEH 5FX6A 4U01A 4INHA 4YLQH 4GAWA 2PTNA 1DE7H 1OWKA 1VITF 1MTSA 3ZVGA 2FYRA 1XKBC 2I6QA 5FL7D 1AE8H 1A2CH 1GDNA 1HRTH 5EODA 5KEDA 1AB9C 1C1WH 1GBEA 4Y0YE 1HBTH 4KTSA 2IJD1 2OC0A 5JDUB 5L2YH 1K1LA 2HGTH 2PGQB 4GVUA 2AIPA 4B2BA 3SUFA 1YLCA 1O3JA 3SGBE 1UTLM 3ATLA 2KCAA 3PLKA 4MPWA 1F5LA 1P3CA 3P6ZB 1INCA 2YNBA 1D3TB 1C2LA 1GBDA 4X8UH 3VXEH 1UTOA 1GJ6A 4OS1A 3SJKA 1A5GH 1BJUA 2RDLA 2BQWB 2JH5D 1IOEA 3EGKH 2ZCHP 3URDA 3PMAB 1A1RA 2QAAA 4TPYA 2GV7A 3BF6H 3RXTA 3PV4A 2K8IA 2Y7XA 1EZSC 3E1XB 3H7OA 3M37A 2G5VA 4Z0KA 3SUGA 1DLKB 1ETTH 2BY7X 1PPHE 1Z7KA 3PB1E 5EGMA 9ESTA 1SLWB 1CGIE 1E1QD 1TGSZ 4ZHMU 1IHSH 3UNQA 5C20A 2KR7A 1C2FA 1GMDF 3NUMA 4XFQA 1K21H 4LK4A 1HJ8A 4NWKA 3LJOA 1ZLRA 3ATIA 3GCHB 3GS9A 1S83A 1P2KA 4GCHG 2FLBH 1SGFA 1A0JA 1AO5A 3SU0A 1C2DA 1TOMH 3OU0A 2SGFE 5EU8A 5EXLA 1GPZA 1HJAC 1TNLA 2W5EA 3L6PA 2TGPZ 4ABEA 6ESTA 1GMHG 1B0FA 4AYYB 4CRAA 1FXYA 2HLCA 1HGTH 5FXLA 2A31A 1DXWA 5EJ1A 2D2DA 4CR9A 4WMFA 2V6NA 1G3CA 3TNSA 4NFFA 4X1SU 1H1BA 3V7TA 4ZKRU 4FUJA 2FXRA 5CHAB 2EI6A 1TNIA 1GGDC 1Y3XA 3UOUA 3U8OH 3MH7A 1DITH 3WW7A 5IK2D 1G3DA 2BDHA 1D9IA 3QLPH 2BLOA 1L1NA 5AF9H 1S6HA 1C1OA 2FI4E 1AHTH 5J4QA 2AGGX 2ZFFH 1YWUA 2GX4A 1GHVH 3A84A 3TJUA 3DSPA 4I31A 1O2OA 4ZMAH 3LGVA 1N6YA 1C1MA 2VIQA 2Y5HA 2BXTH 2ZDVH 1LO6A 6LPRA 5LPFA 2A2QH 3TJNA 2HNTF 4GUXA 2H9EH 1C5QA 2XWBI 3JZ2B 4ZHAA 2Y81A 1Z8IB 3VB4A 4IN1A 3NPSA 1ZPCA 1L4ZA 1TPOA 4DT7B 3AW1A 1KSNA 2PLXA 4I8HA 2HNTC 3PLBA 4CR5A 1T8OA 5GIBA 3UB0A 4SGBE 4Y71A 3F68H 4ABDA 2Y5GA 4BTIB 1B7XB 5JB8S 1S6FA 2OC8A 2A5IA 3RXDA 1IQLA 3KEEA 3B23B 1AKSB 5GPIB 5I25A 1O3IA 1WV7H 3GDVA 1A4WH 1MKXH 4Q63A 2VWNA 1E34B 1C9PA 1T4UH 2GKVE 3NKKA 1HIAB 3T29A 3M5OA 1O0DH 1PPZA 2OBQA 5A0BA 2PKSB 3HGPA 5JBBS 3SZEA 2XCFA 5F8ZA 3TGJE 1DUAA 1C2KA 5C5NA 1O3NA 3ZVAA 2O8WA 1A0LA 2AGEX 2ZQ2A 2TGTA 4P00A 2PTCE 1HPGA 3TJOA 4Y8YA 1GCTB 2Z9GA 3HK6B 2XC0A 3D23A 3UQOA 3MHWU 4A1VA 1TFXA 3RXPA 4JK5A 5KECA 3SU2A 1QQUA 4Y8ZA 3B9FH 3PRBA 1SLUB 3LKWA 4WWYA 5JPMH 1SKYE 1RTFB 2BDAA 4GHTA 2CF8H 1V2TT 2BVRH 1DSUA 2P95A 2C90B 3O8BA 1O2ZA 4HGCA 4YT7H 5FCRA 1CA8B 3RXHA 1NROH 1C2IA 2UUJB 5EXMA 1JIRA 5JB9S 2YOLA 1QL7A 4YLUA 2OUAA 3KQ5A 2W6ID 4XBDA 2YMSB 1DLEA 2XW9A 1TX6A 4Y6DA 1SGEE 3M61U 3S0NA 3PTNA 2NU0E 2WHXA 3FP7E 4DY7B 4ASHA 2UUFB 1MKWH 2G81E 2BZ6H 5FPTA 1GI0A 1OXGA 4TYDA 4XE4A 1LVBA 1MAXA 3QWCH 4TY6A 5PTPA 3UAIC 4RT1A 4XRNA 2EI8A 2ZU4A 2AFQB 1EZQA 4KTUA 4X1QU 3RC4A 2SGPE 9LPRA 4M7GA 6GCHG 3C1KA 1SBWA 3LGTA 3NWUA 1BUIA 3QTVH 3TNTA 3D65E 4XBCA 1SC8U 4FUDA 1N1LA 6CHAC 4YOIA 1UO6A 1OP0A 1GWAA 1RIWC 2C93B 1GHAF 3SU4A 3ITIA 1GHZA 3F3BA 2ZWLH 3DUXH 1EAXA 2KX4A 5A0AE 1TGTA 5DK1A 2GVFA 1KTSB 3PLPA 1PYTC 3UUZA 1BRBE 2BY6X 4YESB 4F49A 2VVVA 3BV9B 3TH2H 3PV2A 4JYUH 1O30A 2FOAA 1O5EH 3VB7A 2HVYB 1HAVA 1TMTH 2BYAX 1A0HB 1O2JA 4GSOA 5GDSH 2ZQ1A 4AFSA 5C0TA 3H09A 1CGHA 1GJBB 3VEQB 1ESTA 1BIOA 5FPYA 1MZDA 1P06A 4I32A 2OQ5A 4GLYA 1QCPA 1AY6H 1FIWA 4OGXA 4F48B 3RXLA 3KYGA 1AGJA 2HLDD 1KDQB 1MU6B 3OE7D 1E0FD 4O97A 5DN6D 4DJZB 1N8OC 1HCGA 1UMAH 1PQAA 1MQ5A 2P8OC 3GICB 1OKXA 1FN6A 3RP2A 1QURH 4TWWA 2ZHWH 5C1UA 1MAYA 4NA9H 1AZ8A 1O35A 4DGJA 1OPHB 1LVOA 1SFQB 1LTOA 1NTPA 5F03A 1T8MA 4X1NU 1GVLA 2J38A 3BTEE 1IQHA 2GMTC 1Y5AT 3S9CA 3FO8D 3RXOA 1XUKA 2D8WA 1TX7A 1YPHC 2GCTC 3A80A 1O2HA 3F9GA 3MQKC 5E2PA 5LPEA 1ZHRA 1SOZA 1QB6A 3BTFE 1W3CA 2WZQA 3MTYA 4WMDA 3T28A 2THFB 1SGPE 3BTWE 4I33A 3WY8A 1O2XA 3I78A 3SOSA 2B8OH 4ABFA 3MO9A 1ZMNA 3K6YA 4BXSA 3ZZ8A 2O8LA 1O2PA 1WOFA 4CRFA 5L2ZH 1VKYA 1UK4A 4KGAA 3GYLB 5AVDA 2FOBA 5F8TA 2CF9H 1NN6A 4FETA 4UONA 2PUQH 3O8DA 4A5TS 1GG6B 1GI8B 4J1YA 3BIUH 3RU4D 5B6LA 4GCHF 2A4OA 4NGAH 1P12E 2A4RA 1S82A 4X2VA 3RLWH 3P8FA 1YC0A 5DP8A 3RXSA 2BD4A 1NZQH 4UFDH 1KXCA 1F5KU 5LPRA 3GISB 4CRBA 4U2WA 2FP7B 1GMHF 1GHWH 1J17T 2PP6A 1S6LA 1MQ6A 3M5NA 3VGCC 1FPCH 4D8NA 4X8SH 1BCUH 4I86A 1GBTA 2P3FH 1FX0B 1CT0E 3M7TA 1GJ7B 2ILNA 4Q7YA 2Q6FA 1ZJKA 1Z71A 2F9VA 3BTHE 1TYNA 3EA8A 3W95A 3SV6A 5TCAA 3MO3A 3RM2H 2TRMA 1VCPA 1SQRA 1ZSJA 3LGIA 5GJ4B 2Z3EA 3P8NA 3OX7U 1GMCF 3IWMA 2H6MA 4CHAB 3SUDA 1GHYH 1TPPA 2J98A 2FTMA 3A8BA 2VIOA 4AG1A 1AB9B 3EE7A 5GNDA 1OWIA 1RGQA 1FLEE 1TQ0B 1GBCA 2LELA 3RXGA 1YPJH 4FUHA 1ABJH 1GBJA 1MD8A 1K1MA 4ZHLU 5LGOA 1QA7A 2JJ1D 3SU5A 3WWBA 3SORA 1Y3YA 4ABJA 4TWYA 2QXIA 4WXIA 2AIQA 3ZVFA 2QCYA 3UREA 4VGCC 1BBRK 1C1UH 1ELBA 1TABE 3DA9B 7KMEH 1J9CH 4YOJA 1IQGA 2ZG0H 2ZTYA 3KNXA 4NIWA 3U1JB 1GI2A 1C1RA 5TJXA 3BEUA 2FI5E 1ZR0A 3MMGA 4QT8C 3MNCA 1BTHH 4DVAU 1KY9A 2H1UA 1YM0A 2HPQH 1TBRH 4Y10E 1SHHB 2AS9A 2JDID 1BMMH 1NRSH 2G51A 2VNTA 2ZHQH 5T6DA 2KCOA 2WV9A 2FOGA 2A2XH 3ATWA 4NA8A 4ISIH 3L3TA 4A7IB 2PR3A 3PMJA 2ZKSA 3VB3A 2B7DH 1LVYA 2BZAA 3T27A 1C5UA 1P11E 1HV7A 3MO6A 5DPAA 3E0NB 1E79D 1S5SA 1Q2WA 1P05A 1UCYK 3G01A 2SNVA 3CNRA 3TU7H 4BOHA 4FUFA 2AMPA 3H7TA 3FANA 1BRUP 2VJ1A 3NRLA 1FI8A 4XD7D 1HJAB 3H5CB 3I29A 2VINA 4P02A 1AUJA 2J92A 1HAPH 8GCHG 2GDDA 3V12A 1TX8A 2Z9LA 4IMQA 1ELVA 4ZKNU 1O2KA 3B8JA 5CHBA 1QY6A 1MH0A 1AIXH 1NO9H 3I77A 2WPIS 2ZTXA 3RUOA 1C2EA 2GT7A 1YCPK 2LPRA 1EJAA 4I8KA 2UWPA 2AMQA 4B6FA 2BY5X 3LOXA 2ZECA 5EJZA 3PM3A 4MQAA 5HGGA 3RU4T 1P2IA 4HG6A 1GVZA 4H42U 3OSYA 1PPEE 2BQ7B 1GGDB 1MTVA 5GWZA 1EB2A 5C5OA 1P04A 4FVBA 2SGEE 3A7XA 2ZNKH 2OBOA 1UW7A 3S7HB 1C5RA 1H9LB 4D7GA 1MBMA 1TNKA 1PPGE 2F9OA 1SGTA 2QF0A 2VH6A 4X6OA 1H8IH 3GOVB 3GY8A 3TGKE 4TSFD 3BN9A 4KELA 4CHAC 5K0HA 2O8MA 3SI4H 1LHEH 5L30H 4WH6A 4AFZA 1O3CA 3TLOA 1G2MA 5AFYH 1ZYOA 3BEFB 1G37A 1K1JA 6GCHF 4ZAEA 1OYQA 1UTJA 5EQRA 4ZKSU 1DWEH 4O3TA 5CMXH 2QY0B 1ANEA 4CRCA 1CHOG 1Y59T 2CMYA 3LONA 1V2QT 4LXBH 4MPVA 1P01A 3LT3A 2C8YB 1AD8H 1TPAE 5F53A 5CE1A 5A8XA 1TMBH 4NCYA 5BPEA 3HATH 4ACBA 1LCYA 1FDPA 1UTNA 1NT1A 2Y7ZA 3Q3YA 2ZDKA 1SOTA 1YKTA 1ELCA 1SG8B 3BSQA 1LHCH 5DGJA 1F7ZA 1SR5C 1GL1A 3TVJB 1DPOA 1C4U2 3QN7A 2F91A 1GJDB 5B6OA 2UUYA 1O2TA 1UHBA 2A4QA 2H5DA 1E37B 2ZDMA 1Z1JA 5DP6A 4TT3D 3RXAA 4IN2A 1W7GH 2FYQA 3M7QA 4Q7XA 1YBWA 2W26A 1IAUA 1YPEH 3QGNB 1BMNH 1O3FA 2GCHG 2Z3CA 2BM2A 3A82A 1G3BA 1G30B 1UVOA 1T8NA 1WCZA 1O3BA 4MNVA 2ANKH 2ZU5A 2BQ6B 1ESBA 1COWD 2ZU1A 3M7UA 1TE0A 3QZRA 2Q1JA 2WPHS 3ZZ6A 3KQEA 2C8WB 3RXMA 2VVUA 2J97A 2ZGBH 1HAVB 2A7HA 2OQUA 4IC5A 3ZVDA 1XUIA 1EAUA 1W10U 1AQ7A 1O2IA 3RXKA 3MU5A 1EUFA 3GDUA 3RXBA 1BRAA 1K1OA 1V2UT 3CS0A 3ELAH 2FOMB 2ODPA 5DO4H 1ANCA 2ANYA 1TGBA 2ZCLP 4B71A 1L0ZA 3PYHA 1QB1A 3SHCH 3ZZ9A 3ZZ7A 3U1IB 1QNJA 1C5SA 3RXFA 2R2WU 3VPKA 2FIRH 1P10A 1TRYA 2V35A 2VH0A 1HUTH 1Z8GA 1WQSA 2BVXH 3QO6A 4ZCNA 1O2WA 1GBFA 1KLTA 1JWTA 4UEHH 5GCHG 4WJG2 3JZ1B 1HAYB 3FKSD 4BAQB 1O2MA 1QJ7B 2O9QA 3MNBA 3GCOA 4ZH8A 3PV5A 5EQSA 1SPJA 3IG6B 1EP6A 2V3HH 3DFJA 3SZNA 1JOUB 2B9LA 1CE5A 1TNHA 1CQQA 1EJMA 1DWCH 3E90B 2ODYB 8LPRA 2PGBB 2CK3D 1FY1A 2W6JD 4CBOA 2PSYA 4U32A 1YPMH 2CHAC 1V2VT 2V7QD 2ZPRA 5C0UA 5HYOA 2L6OA 1NRQH 1V2KT 3DHKH 4NSVA 1FONA 1OYTH 1Z8RA 3SYJA 1EB1H 1YY3A 3A7ZA 1XM1A 1F0RA 6CHAB 1TNJA 4H6TA 1BA8B 1NBME 4LZ4B 1RIWB 3PMHB 3C27B 1YLNA 4DOQA 2F4LA 5SGAE 4OS5A 4Y7BA 2PKAA 3BEIB 1F0SA 3VB6A 2QIQA 2O8UA 3RXRA 3ATKA 4I7YH 3MOCA 1C1NA 1O2QA 4X6PA 2JETC 2CGAA 1A3BH 2A32A 2VWMA 2I6SA 1QA0A 2PHBA 1EP5A 3Q00A 2GGVB 3V13A 2VIDA 3F9FA 3UWIA 1RTKA 2ZHDA 2HALA 2FODA 3STJA 1C2JA 1AVXA 3E6PH 3BTGE 4AOQA 1THRH 2Z6BD 2F83A 1C5XB 3DCLA 2UUKB 4U30A 1BDAA 1XUHA 2ZFTA 4IMZA 1GJCB 1NRRH 1NU9A 3GDSA 4X2XA 4RT0A 2BX3A 4WXVA 4ABIA 2HOBA 2WYJA 3A81A 3OY6U 5JYIA 4O9VA 4ISHH 4AGKA 1P3EA 1N8OB 1ZMLA 1O3OA 1FIZA 1P09A 1SB1H 1DX5M 1TMUH 1ZMJA 2P8OB 1ANDA 1GBHA 1H8HD 1X7AC 4MNXA 2FI3E 1WDIA 2F3CE 1T8LA 5AHGH 4AYVB 3SU6A 2OINA 4BNRA 1BZXE 4B75A 2WPMS 4DT4A 1UVPA 2VIPA 1QZ8A 5E0HA 1L1GA 2JJ2D 2FTLE 1MTNC 2GMTB 2J98B 2FEQH 4RSPA 4X6NA 1ELEE 1A5IA 2VVCA 2GCTB 3S9AA 5DP9A 3DT0H 3DSGA 1DM4B 5E8EH 3W94A 4A1TA 2NU2E 1A7SA 2CXVA 2JH0D 3AW0A 2BTCE 3F2FA 1S85A 3BG4C 4M9FA 2RDEA 1C5YB 3P8OA 3BTTE 2AEIH 2AHME 2GZ7A 1AVWA 1FJSA 4BANB 1CT4E 3K6ZA 1L2EA 2A7JA 3P95A 1L1JA 2ZP0H 1C1SA 1MCTA 2ZFQH 3NXPA 1W7XH 3HGNA 2XNIA 2BDYA 3RMNH 1Z8JB 2J2UA 1HAIH 1FY8E 4OS4A 4UFFH 4Y76A 3BG8A 4WY3A 3UNRA 4Q4LA 3IITA 1CGJE 1D3DB 3ZZ4A 1T7CA 3F9HA 1CSOE 2ZFRH 5DP5A 1UTKA 5EXNA 1YLDA 1W12U 4RKJB 1LQDB 3OTPA 1AUTC 4ESTE 5GXPA 1C1PA 3GY3A 8GCHF 1W13U 1ELTA 3ZZBA 1D3QB 1Z1IA 4BAOB 2ZU3A 1GCDA 1U6QA 5JBTA 4OGYA 3P8GA 1NRPH 4A92A 1PPBH 1TRNA 4Q80A 3VGCB 3LIWA 3SBKA 4DW2U 2QF3A 1ARCA 2DE9A 4RKOB 2VIVA 1W0ZU 3UNSA 2Z3DA 1Y5BT 1B0EA 3TIUA 3U69H 3MWIU 2Z9KA 2OCVB 1MUEB 4IC6A 2KCYA 1TRMA 1P2OA 1W14U 2ZIQH 1C5VA 2STAE 5A8YA 1SSXA 4DURA 3TJVA 2O8TA 4FU7A 3SQEE 1C5TA 2DUCA 2LP6A 1V2NT 3GY5A 4K60A 2QF5A 3ZVBA 4X2WA 1TA2A 1VZQH 1Q31A 3OEED 1FQ3A 5EW2H 2FX4A 3LGUA
chains in the Genus database with same CATH topology
2XCNA 1ZJDA 3A87A 2AGIX 3N99A 3ZYEA 2FZZA 4MNYA 2OP9A 1G3EA 2GV6A 1LKAA 4X0WU 1D4PB 3SN8A 1EZXC 5IYTA 3T2NA 1PPFE 4H4FA 2SFAA 1UVUH 3S7KB 1CHOF 1BMLA 4O3UA 1XVOA 3MNXA 3RXJA 1YGCH 1FY4A 2W3IA 4LOYH 2QGRA 1QL9A 1NS3A 3U8TH 1ETSH 5JBCS 1FY5A 1T4VH 5DSFA 4NZLA 1J16A 4VGCB 2B0FA 4E7NA 2JH6D 4OS2A 1EXFA 2R0KA 4D9QA 1ESAA 4HTCH 2Q6GA 5C17A 1AMHA 1WTGH 3LC3A 1GBKA 3LJJA 1SQAA 4CRGA 5LH8A 4XDEA 1O2NA 3UIRA 1GI3A 1NRNH 1VCQA 4JZFH 4GPGA 3MI4A 1Z6EA 3LPRA 4DIHH 1QTFA 1TOCB 5FBEA 1KXFA 2BY9X 2PWXA 2BHGA 3UY9A 4YM9A 1SL3A 5C67A 4HI3A 3VFEA 4LZ1H 1EJNA 4ISLA 3QZQA 1LPKB 1C5LH 2EEKA 2Y6TA 4JZDH 1P02A 1UK2A 3SGQE 3S69A 4HZHA 5L6NH 1UHBB 4THNH 1O32A 3A85A 4AN7A 1BJVA 1QRXA 3FAOA 5HMAA 3KF2A 3D62A 3ESTA 1BTPA 1RXPA 2BDGA 4JYTA 2ZFPH 4X6MA 5E0JA 2A1DB 3GCTG 1N6XA 1OX1A 1H9HE 3MU0A 4HFPB 4MG3A 1O2SA 5F8XA 1O2UA 2P16A 1MCVA 4B2AA 4YTAA 3T25A 1VR1H 1UJ1A 1ZOMA 4A6LA 4B73A 1QJ1B 3LH3A 3EYDA 3LGWA 2ZCKP 3KN2A 2G4UA 1BTYA 1O31A 1W8BH 3U8RH 3OY5U 1ZTKA 1D6RA 1GI1A 1HB0B 4E05H 4CBNA 1YP9A 1EATA 5GCHF 4CH2B 1ZRKA 3T62A 4Y0ZE 2ZDLA 7GCHG 1NESE 5AFZH 1AWFH 1ZGVA 3SJOA 1ZSLA 4FXGH 2IJOB 1KXDA 2DE8A 1ZRBA 2FX6A 2OTVA 3S9BA 1C5PA 1OWEA 2Z7FE 2QV1A 3KHVA 1PQ7A 2IPHA 2ZGXH 4F55A 2ESTE 1CA0B 1C2HA 1GJ5H 4KKDA 1Y3VA 3SNAA 4UD9H 1IQFA 3U98H 1H8DH 1C5ZB 1FAKH 1CU1A 1LHGH 1OWDA 1QBVH 1WSSH 2GZ8A 4DIIH 2FM2A 1P8VC 3AAVA 3UTUH 3MNSA 5C2ZA 1OOKB 1TPSA 5C3NA 2QF4A 1SGRE 1TBQH 3M35A 4IW4E 2ZDAH 4B74A 1QBNA 1TA6A 4JCNA 5HM9A 1NU7B 1K28D 2IN2A 1P9SA 3PWBA 3T5FH 2WINI 1P2NA 2FWWA 3A88A 3ZZ3A 1NY22 3GY7A 1GBLA 4X1RU 1UTQA 1Y3WA 1IQMA 3KQCA 1C2GA 5HKKD 4H6SB 2H5CA 3EDXB 3M5MA 2ZGCA 2SGAA 3PWCA 1EOLA 2XTTB 1QBOA 1GJ4H 2BD7A 3CS7A 1G36A 1VITH 4AFUA 1GBBA 2EC9H 3P92A 1V2JT 1S84A 4YO9A 3TITA 3RMMH 1BMAA 2ZDNA 2OC1A 3FVFB 1O2LA 1PQ8A 3VG8A 2RA3A 1W0YH 5T6GA 2ZTZA 1RD3B 2VU8E 5EG4A 1YYY1 2PKAB 8ESTE 1CBWC 3A89A 2XBWA 3ZVEA 2OK5A 5FAHA 4INLA 2STBE 2XRCA 2GDEH 2EA3A 1LHFH 1MD7A 1RFNA 1AWHB 2A7CA 1OP2A 3SNCA 1LVMA 1ZPZA 2XXLA 2BD3A 1K1IA 5FBIA 3SJIA 1T31A 1DWDH 2AH4X 1O3EA 2GP9B 2XBVA 3PTBA 2P59A 2BD9A 2VBCA 1K1NA 1ZTJA 3SNBA 1V2MT 3F0PA 3F1SB 1JBUH 2R0LA 3SV8A 1FNIA 1SGIB 1IQKA 3MH5A 5FPSA 4Z1MD 3PMBB 2D26C 1QQ4A 2OD3B 5ESBA 1O5CB 1WUNH 3SNEA 2Y5FA 2FLRH 2BX4A 1BTXA 1ELFA 1HLTH 4MLFB 4ISNA 1RTLA 1PJPA 1P2JA 3SU3A 1B5GH 3HPTB 1UTPA 3LH1A 2WV5A 5EPYA 2BD2A 4ZUHA 4CRDA 1GJ8B 2G5NA 2R3YA 3SJ9A 3FOAA 1BT7A 1WAYB 2SGQE 1KXAA 4A1XA 3BIVH 1O3LA 1SHYA 3GYMA 4BAKB 4R0IA 4O03A 3FZDA 1VGCC 3SW2B 3URCA 4KTCA 1O5DH 5E2OA 1AZZA 5DG6A 3SI3H 5EOKA 3A7VA 4E7RG 1J15A 2VB0A 2A5KA 3LDXH 1SI5H 1OWHA 1CA0C 2CHAB 3EE0B 4X2YA 3AK5A 1FPHH 2XBYA 4KP0A 2FO9A 3SUEA 1EPTC 1VJAU 4AORA 2EI7A 2W7SA 1Y5UT 2XYAA 1ZPBA 1EQ9A 2W7UA 2VWLA 2BLQA 4B1TA 2Z9IA 1TLDA 1BQYA 1BTUA 1MKXK 4X8TH 1IQIA 1BB0B 1QIXB 1LPGB 3EQ0H 2P3UB 5C1YA 2TPIZ 4WH8A 2JETB 3E3TA 1NFUA 3ZZDA 2HNTE 3LC5A 2BOHB 3A86A 2H9HA 2H9TH 1SLXB 1E36B 5FCKA 2ZU2A 1P2MA 1C5WB 2ASUB 1P2QA 3SO3A 3UQVA 1OP8A 2J34A 4BXWA 3K65B 1L4DA 2FOFA 1ELAA 1O37A 3PO1C 4MNWA 1XXDA 1HDTH 1YPKH 3TK6A 2NWNA 1F5RA 4YT6H 2PFEA 1SGDE 2BVSH 3M3SA 2ZO3H 2KM0A 1O3DA 1HJ9A 2BDIA 1XMNB 1BTWA 5HM2A 1DY9A 1O5BB 3RC5A 1RJXB 1W2KH 3F9EA 2ZZUH 3T26A 1XVMA 4Z6AH 5A09A 1ZSKA 5K7RA 1C9TA 3VB5A 1SGNE 1FN8A 3ATMA 1BBRE 4ASUD 1SMFE 4IS5A 1D3PB 1NFWA 5IDKA 2JKHA 1MTNB 4FVDA 2FESH 4ABHA 1UVTH 1O2VA 3QGJA 1O38A 3Q3XA 3N7OA 1GDUA 5DP3A 1TB6H 3BG4B 4MVNA 3DFLA 5TCCA 1BBRH 2NU1E 3ZV8A 2BLWA 2WV4A 4K69A 1VCWA 3SQHE 1DT2A 1MKWK 1EFRD 1KYNA 4ABGA 1AVGH 4K1TA 1A3EH 1S81A 1SLVB 3PRDA 2K0QA 1EPTA 2RA0A 1BOQA 4YXWD 1GI6A 2F9NA 3ZIAD 1ID5H 2Q6DA 2A0QB 4ABBA 1NBMD 3TH4H 3ZYDA 1UCYE 2WPKS 2D1JA 5I46H 2QN5T 3FP6E 4WF8A 1SGCA 1Z6JH 4F4OC 1JXPA 1KXEA 1GBAA 1IQJA 3NZIA 2SGDE 4FU9A 3RM0H 1BMFD 3AAUA 1SGYE 1AFQC 1GI5A 1KLJH 5ESTE 3F2GA 2VGCC 1JMOH 1RS0A 1PYTD 3TK9A 3WWFA 1UCYH 1XUJA 3RXVA 3GCTF 1G2LA 5T3HA 2NU3E 1KXBA 1LPZB 4DCDA 1O5AB 2FMJA 4Y8XA 1O3AA 2FOHA 4B76A 3R0FA 3AASA 3TPIZ 1O3GA 5DP7A 2QXJA 2ZGHA 4B6EA 1NM6A 3FP8E 4XSKU 2QXGA 1GMCG 1HAZB 1YCPH 1ANBA 1GHBG 1JRTA 1ABIH 4JYVH 4Y11E 3A7TA 1P9UA 2UWOA 1HAHH 2C8XB 1TAWA 1LKBA 1DICA 2WSSD 2WYGA 3DD2H 3NCLA 1O33A 7GCHF 1VJ9U 3ODFA 2ANMH 1CHGA 4BTUB 3SV9A 3E0PB 3TH3H 2KAIA 1ETRH 3E91A 3LGYA 3QTOH 2ZI2H 1O2GH 3QX5H 1WXRA 4PROA 1PQ5A 1C4V2 1TALA 3GY2A 4K1SA 1YF4A 3FZZA 1F0TA 3BTME 4I8JA 3KQDA 4FUGA 1T32A 1F92A 1ORFA 1A5HA 2J5UA 1KIGH 1XXFA 5J4SA 2KZ4A 3OTJE 1V2WT 2ZGJA 1HNEE 3M3TA 3A8CA 2C8ZB 1IQNA 2ZF0H 1NC6A 5ETXA 4NA7A 1YPGH 3K9XB 4X8VH 1PPCE 2RCEA 1NPMA 4X1PU 1O3KA 1F0UA 4BTTB 2P3TB 3RDZA 1ZZZA 4NG9H 1O5FH 1XX9A 2HVXA 3P70B 2F9BH 1O3MA 1FMGA 1SFIA 3SNDA 7LPRA 1XUGA 1GJ9B 2J95A 2OC7A 2WPLS 2YMSD 1O2YA 1DFPA 1YPHE 3KCGH 1YPLH 1SQTA 1O2RA 1TNGA 2A5AA 1FUJA 1WU1A 1NFYA 1SQOA 2B5TB 3GCHC 3HKJB 3BTQE 1WYKA 2K1QA 1FAXA 3ODDA 2Y82A 2TIOA 4NIYA 2GT8A 1JRSA 1DOJA 2AYWA 3KQBA 2CN0H 3D49H 4FUBA 1SGFG 3W1EA 4GHQA 1TBZH 2KCPA 3UR9A 1G32B 1RRKA 5FX5A 4CREA 4XBBA 4NSYA 3MH6A 4CH8B 1UTMA 3UOPA 1HAOH 3GCNA 1C4Y2 1LDTT 1A46H 3Q3KA 1QRWA 1BTZA 4J2YB 3SV7A 1ZTLA 1GHXH 2W3KA 2ZFSA 5CHAC 2XBXA 4D76A 5HXFA 4R8TB 1QHRB 3L33A 3KL6A 2BD5A 3ZZ5A 4AGJA 4UDWH 1C2MA 3HKIB 4UFGH 1H8ED 5ABWA 3A7WA 1Y3UA 2BDBA 1KLIH 2XC5A 3VXFH 1ELGA 1HXEH 1CO7E 1VITG 4AB8A 1E1RD 4WMEA 7ESTE 1UVSH 3A8DA 4NWLA 2M2AA 2FDAA 4JK6A 2NU4E 1DDJA 2P93A 1QGFA 4ZXYH 5A2MH 3EA9A 3MYWA 3RMOH 1LHDH 3PROA 1XKAC 1V2LT 4K5ZA 3RXIA 3U9AH 3TGIE 1W0KD 3N7EA 5DJ7A 3MU4A 3ENSB 1C5OH 3E16B 4OS6A 1P0SH 3A83A 3RXCA 2CV3A 1TONA 4MDSA 3OAAD 4TPIZ 1TWXB 3M3VA 4I8LA 3QUMP 2XWAA 1AI8H 2GD4B 5EPNA 1HAGE 4OM9A 1GI9B 1C5MD 2J4IA 2R3UA 3HK3B 1W0JD 3AVZA 4BAMB 3GY6A 2A45B 1C5NH 2V3OH 1QB9A 1DS2E 1GDQA 3RXUA 4D7FA 1TGNA 2BY8X 4ZXXH 2HRVA 1Q3XA 3QK1A 2G8TA 2QE7D 2ULLA 5T1VA 2FS9A 2PKSC 2TGAA 1GMDG 4Y79A 3MH4A 4NIVA 3A7YA 3LU9B 5DKMA 5EQQA 1A61H 1CBWB 1MU8B 2PUXB 2G55A 3ZV9A 3CP7A 1EZUC 3F2HA 1SGQE 2BMGB 4YOGA 1OWJA 1DXPA 1FV9A 1K9OE 4JMYA 5F6MA 1GCTC 2G00A 2GCHF 1QJ6B 5DP4A 3QDZB 4AX9H 1AN1E 1V3XA 1PFXC 3M5LA 1OSSA 1BITA 3K2UA 2Z94A 3SU1A 1C1QA 1W11U 4UE7H 3GY4A 4IGDA 3DSOA 1DWBH 2JIZD 4RI0A 3ZVCA 2HPPH 1KMHB 1Y8TA 3CENA 3F0OA 1EOJA 4SGAE 2G4TA 1DY8A 1MZAA 2A4GA 1C1TA 1DUEA 1J14A 1XUFA 2KFWA 1AE5A 4OS7A 3BTKE 4K2YA 4WVPE 1QFKH 4ZKOU 3N7DA 4JZIA 2ZA5A 2F43B 2HWLB 3Q76A 2SNWA 1V2OT 2ZHEH 3SJ8A 1TQ7B 3SV2H 1K1PA 1F2SE 2YMSC 1TGCA 3OFND 4AZ2B 1WTHD 1P57B 1M9UA 3FN8A 1BHXB 1MTUA 1GL0E 1TIOA 1HFDA 1EASA 1CT2E 1VGCB 4FUIA 4JZ1A 2BDCA 8KME2 1UK3A 1THSH 2C3SA 1QRZA 1AKSA 4NIXA 5G4BA 4MPXA 4AB9A 5CDFE 2BOKA 1V6DA 1S0QA 1O5GH 1EPTB 1HIAA 3RU4E 2XNDD 1H4WA 2CJIA 2ZEBA 2BLVA 3RC6A 1FY3A 2XC4A 1GBIA 2IOTA 2OLGA 1MABB 2QC2A 3V3MA 1FZZA 4Q7ZA 2WPJS 1LMWB 4K8BA 2FOEA 1DSTA 1HYLA 2RG3A 3UPEA 1O3HA 1MBQA 4YZUA 3ZZAA 5T6FA 3UWJH 4DG4A 1GHBF 2TBSA 1GVKB 2BD8A 2WUBA 5E0GA 1HAXB 3UR6A 3P17H 4XOJA 2TGDA 2H2ZA 1S0RA 3RLYH 1G9IE 2M5TA 1EX3A 4MPUA 4Y7AA 3SGAE 5JBAS 2FS8A 1MTWA 1WQVH 3V0XA 3PO1B 3F6UH 2LNCA 5A0CA 2AERH 1THPB 3Q77A 5BRRE 1GJAB 4IBLH 1ACBE 2VIWA 3UFAA 1ELDE 2XOKD 1GI4A 1V2RT 2VWOA 2C4FH 1K22H 5FHTA 2ALPA 2QA9E 2ZPSA 5A8ZA 4K1EA 1AFEH 1LQEA 1P03A 2WUCA 1QR3E 3O8RA 1OS8A 2Z9JA 5C1XA 4FUCA 1DVAH 2F9UA 1DANH 3FFGA 3RXQA 3O8CA 4I8GA 2F9PA 4FUEA 4INKA 2KAIB 1E38B 3RXEA 2QXHA 2ZPQA 1IHTH 3ZZCA 2PV9B 2UWLA 1O39A 1EKBB 2G52A 3M36A 2ZC9H 3NK8A 2YNAA 4AG2A 1SVPA 3MFJA 1GBMA 2OXSA 2FOCA 4ISOA 1WBGB 1BRCE 4MTBA 4D9RA 2BB4A 2R9PA 4ZROA 1BHXF 3STIA 4K3JA 1V2PT 1K2I1 2V0BA 4Q2KA 4BAHB 1EAWA 3MU1A 4FU8A 1J8AA 1E35B 3KIDU 4NZQA 1IQEA 1GG6C 3EAJA 4NFEA 4AFQA 3KGPA 1C1VH 3OEHD 1OHHD 4E06H 2GTBA 2WPDD 1V2ST 3TK5A 1JIMA 3OYPA 2QYIA 1ZHPA 5H4IB 1YCPM 2J9NA 4RN6A 2ALVA 1AFQB 1O36A 2ANWA 2J94A 2BXUH 4K8YA 3RMLH 2FPZA 2VGCB 1KTTB 1NFXA 1ARBA 2R2MB 1O3PB 1QL8A 1GHA<