4KTCA

Ns3/ns4a protease with inhibitor
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
175
structure length
175
Chain Sequence
APITAYSQQTRGLLGCIITSLTGRDKNQVDGEVQVLSTATQSFLATCVNGVCWTVYHGAGSKTLAGPKGPITQMYTNVDQDLVGWPAPPGARSMTPCTCGSSDLYLVTRHADVIPVRRRGDSRGSLLSPRPVSYLKGSSGGPLLCPSGHVVGIFRAAVCTRGVAKAVDFIPVESM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Serine protease NS3
publication title Discovery of Danoprevir (ITMN-191/R7227), a Highly Selective and Potent Inhibitor of Hepatitis C Virus (HCV) NS3/4A Protease.
pubmed doi rcsb
source organism Hepatitis c virus (isolate japanese)
molecule tags Hydrolase/hydrolase inhibitor
total genus 40
structure length 175
sequence length 175
chains with identical sequence C
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2013-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02907 Peptidase_S29 Hepatitis C virus NS3 protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4ktcA02
2.40.10.120 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 4ktcA01
5FX5A 1NZQH 3KNXA 3Q3KA 1MCTA 2VGCB 3OTJE 4AFZA 4I32A 4Y11E 1IQEA 1GBTA 3KN2A 4ZKRU 3U1IB 3ZVAA 1FMGA 3EYDA 3VGCC 5F03A 1JOUB 3HK6B 2A45B 2WV9A 5TCCA 4AFQA 1QRXA 4UD9H 2CHAC 4TY6A 2XNIA 8GCHF 5EQRA 1M9UA 2Y5FA 1EB1H 1YPGH 1CHOG 1TRMA 2ZFPH 3AVZA 3FZZA 3ZZAA 1H9LB 1GI0A 3FP8E 3LPRA 1WV7H 3ELAH 3VB7A 1A46H 1KLIH 1L1NA 2Y7ZA 2ODYB 1L1JA 1Y3VA 3RC4A 1GBEA 2ZGBH 1PQ7A 5TJXA 4FU9A 1QJ7B 1SLUB 4IC6A 1JMOH 3GDSA 5DP8A 5A09A 2YNBA 1SFIA 1HAXB 1AFEH 4I8GA 4D7FA 1BTUA 3PWBA 4FU7A 1AVGH 2BZAA 1BTZA 1O2TA 7KMEH 1UTLM 2ZQ2A 4K60A 1K1NA 5DJ7A 3TGKE 1QA0A 3SJ9A 4B75A 1LHDH 3D49H 5GDSH 3SO3A 1YF4A 2P3UB 1Y3UA 2BZ6H 2ZHDA 1W11U 4PROA 3VB6A 1SLWB 2FYQA 4B2CA 2AMPA 1IQLA 5EQQA 5F8ZA 5LPFA 2YOLA 4TWWA 3Q3YA 4NWLA 4F49A 4SGBE 3MYWA 1QB9A 3UQVA 2GMTC 1GDUA 5BRRE 3RLWH 5E8EH 1OPHB 3P92A 1C5ZB 3TH2H 4K2YA 5A2MH 1F0RA 1O2QA 1C2LA 4AFUA 1MTNB 1Z1IA 4RN6A 2EEKA 1D4PB 3VFEA 4OM9A 6CHAC 3MU5A 1EUFA 1GMHG 4HTCH 2OC7A 1MCVA 1KXAA 5HGGA 1KXCA 1NS3A 1GWAA 1Z6JH 2OTVA 1O3MA 3MTYA 3SNCA 1VGCC 1C2IA 4FXGH 5C1UA 1O2LA 2O9QA 1C5YB 2STBE 4FUFA 4U32A 1AWFH 1YPJH 1F5LA 1LKAA 1O2KA 4ZH8A 1GJ5H 1Z1JA 1C4V2 2AIQA 2ZHQH 4WMDA 2VH6A 2QIQA 1Y3XA 5K0HA 2B8OH 1DXPA 3A88A 3P6ZB 4KGAA 1ETTH 1NRSH 1AUTC 4NIYA 4E7NA 4WJG2 2FDAA 2ZDNA 4CRFA 1HXFH 2ANKH 1IAUA 1S82A 3CP7A 3OY5U 4CHAB 1EOLA 1SGRE 1ZGVA 1O3OA 1TGTA 2QXIA 5T3HA 1EATA 1O2JA 4J1YA 3VB5A 1HAYB 1EPTC 5FPYA 1TMTH 1NM6A 5AF9H 1NFXA 2G5VA 3MU8A 4NSYA 3U8RH 1EKBB 1GJBB 1ELTA 1WU1A 4JK5A 5T6GA 1RIWC 2HNTF 3SV6A 1C1TA 1JRSA 1V2RT 6LPRA 2R9PA 1THRH 1TONA 1DSUA 3S0NA 4ZUHA 3EAJA 3ZV8A 2F9PA 4DY7B 1C2GA 3A85A 2ZFRH 4KP0A 2VVVA 3H7TA 1SSXA 4RSPA 2OCVB 3F9HA 2Y7XA 2BX3A 5GCHG 1Z8JB 1FY3A 1T4VH 2IPHA 5H4IB 1C2EA 5F8TA 3QGNB 5E2OA 1BBRH 1UTPA 5DG6A 4O03A 1VJ9U 4UFDH 1TPOA 2CV3A 1NO9H 5G4BA 6GCHG 1H1BA 1V2KT 1EZSC 2R0KA 3BTKE 3RMOH 2BD7A 4TPYA 1C5MD 2CF9H 2GT7A 1QFKH 2G51A 1A3BH 2GD4B 2OC0A 4CR5A 3KQCA 3BTME 2W26A 2ZZUH 1D9IA 1OWEA 1PQAA 4YZUA 4ZMAH 1SQAA 1GMHF 2C8ZB 1DANH 2STAE 1HXEH 4UFEH 2FXRA 3MNSA 2PUQH 2SGQE 5JBCS 2QYIA 4X2VA 2ZGHA 1OYQA 4K1TA 1MKXH 1Q3XA 5DP5A 7GCHG 1WAYB 1Y3YA 2OXSA 5A0CA 4ABAA 1GG6B 5DP7A 4BAOB 3SGBE 2ZGXH 1GBHA 1MBQA 1PFXC 1TNLA 2GCHG 4ABGA 4J2YB 1BMNH 5EODA 1HFDA 3GY6A 1NRQH 1V2WT 3HKJB 2DE8A 4U2WA 4A1XA 4ABBA 1ELDE 1QJ1B 3C27B 8ESTE 5JPMH 1F5RA 2WINI 1O3DA 1ANDA 2ZC9H 4INHA 4X1PU 3A87A 3SQHE 2FOEA 2F4LA 3O8RA 3KCGH 1AFQC 3RXGA 3UR6A 2A1DB 1ANBA 2NU3E 1W10U 2FIRH 2Z9KA 3AW1A 2OP9A 5JDUB 4NIXA 3T29A 1SGQE 2BMGB 1O3BA 1RTLA 3TLOA 3T62A 2TRMA 2AFQB 3MO9A 2V35A 1HV7A 2BLVA 4X2WA 3UTUH 1K1LA 5A8XA 3RXQA 3A8BA 1MD8A 4Q80A 1NY22 1ZGIA 2ZU3A 1O3HA 1FONA 2ZTZA 1YC0A 1AZ8A 2WV4A 4K1SA 3BTQE 2FI3E 1O2YA 2NU0E 4XDEA 2TIOA 5GCHF 4VGCB 2NU1E 4YO9A 1KXFA 1O2SA 1GI3A 3A7XA 1W13U 5C5OA 1YP9A 1OXGA 1C5UA 2O8MA 1GI5A 3MH7A 4IW4E 2ZHEH 6GCHF 2ZPSA 2C90B 3GY7A 1P10A 2JETB 1HJAB 4U01A 1QQUA 1AQ7A 1A2CH 2B0FA 3AW0A 2HNTE 2ZDAH 2QXHA 1J17T 1BTHH 1G32B 1LVMA 2R0LA 2F9UA 2ZPQA 2EI6A 3MO3A 4CRAA 4A92A 4FUJA 2SNWA 1K9OE 3M5OA 4R8TB 1OWDA 2Z9JA 1A1RA 2M5TA 2A4QA 1K1OA 1TPAE 2IJOB 1T4UH 1P2KA 1EX3A 4Q7YA 7GCHF 1P01A 2A2XH 1ELBA 2I6QA 1C1WH 1EAXA 1TLDA 2BOKA 1O3IA 3ATKA 1ZPZA 1YCPH 5A0AE 2W5EA 3PB1E 3VEQB 2GCHF 3U98H 3GISB 1C9PA 4XBCA 2P3FH 1NRRH 4K8BA 1FNIA 1GI6A 2EA3A 4IBLH 2J92A 1W8BH 1A61H 1O2WA 5L6NH 1BQYA 4JK6A 4AX9H 2PTNA 2ZNKH 2IJD1 1RXPA 1ZMLA 3BEFB 1ESBA 1OYTH 3N7OA 3URDA 4JZEH 1G2LA 2G52A 1CSOE 1V2PT 4OS4A 1GJ9B 2WPIS 2BVXH 2WPJS 1DS2E 1LPZB 3MU1A 1V6DA 3TK6A 1GJCB 1O39A 1ESAA 1PPBH 1IQJA 1ANEA 3LONA 1C2FA 1DWBH 4AZ2B 2WUCA 1BB0B 2GDEH 3R0FA 3BG4B 2O8LA 1T31A 1AE8H 1FI8A 4B76A 1GJ6A 1O5BB 1W14U 1BMMH 3BEUA 2ZU1A 4XSKU 1QNJA 2OBOA 5L30H 5JYIA 1E34B 1WXRA 5LH8A 1GGDB 3BTFE 1O32A 1N8OC 1PJPA 2FTLE 4H6SB 1RTFB 4B71A 3LGIA 1NFYA 4JZ1A 1FPCH 3GYMA 2PV9B 2QGRA 1SB1H 1BA8B 2UUYA 1O3FA 1O38A 4GHTA 2VVCA 1EZQA 2UUJB 1LHCH 1O2IA 4ISHH 4FVDA 2EI7A 1BTPA 3EA9A 4CRBA 5HYOA 1BJVA 1D3QB 3SI3H 2XW9A 1D6RA 1DVAH 2BVRH 5FCRA 4O97A 5E0JA 1P2MA 9LPRA 2HVXA 3RXKA 3A7ZA 5AFYH 1DSTA 2UUFB 2UWOA 1GHWH 1O2MA 1RRKA 4YM9A 4ABDA 3E16B 5EXMA 4ABHA 1OP0A 1P3CA 1UVPA 2ZDVH 4U30A 1O2OA 1O2PA 5LGOA 1TYNA 2ZDLA 1FAKH 2VVUA 3UPEA 3SU1A 4YLUA 1HAOH 3VGCB 4D8NA 2TPIZ 2B5TB 1VCWA 1HAHH 1XKAC 3M7UA 3VB4A 2FYRA 2XCFA 4YOGA 3RXBA 1E38B 4B73A 1AZZA 2CHAB 3SHCH 3V13A 1W0ZU 2JH6D 4BANB 5C20A 3RC5A 3ZZBA 2ODPA 1NPMA 4Y7AA 4NG9H 3LJJA 1O2UA 1HAZB 2CF8H 1RGQA 1J8AA 1PQ8A 4NIWA 1SGEE 4MNVA 3SU3A 1LMWB 1Q31A 4MNXA 3BIUH 4DCDA 1FN8A 1LTOA 4INLA 2AGIX 4AYYB 5FCKA 5IDKA 1GBBA 3KHVA 1MU6B 3O8BA 2P8OB 4X8TH 1C5OH 1IQIA 1GBFA 1GJ7B 1BMLA 4X2YA 2V3OH 1A5GH 2J94A 3QK1A 3D65E 3F1SB 3SUGA 3PMBB 2FTMA 4GPGA 2NU2E 1QRWA 1J14A 3ITIA 3UR9A 2Z94A 1TA2A 1LVYA 1HDTH 4DURA 1OWIA 2A31A 1AU8A 2W7SA 3TU7H 2ZFFH 2R2WU 4WH6A 1XVOA 4AB8A 1TGCA 3QLPH 3E0NB 1UVUH 1TWXB 1SGCA 3SU2A 1KTSB 3TK5A 5E0GA 1QBNA 4Y10E 4IMQA 1BOQA 1UVTH 3ZZ9A 1TGSZ 3DFJA 1AGJA 3W95A 5SGAE 4YT7H 5GWZA 5FHTA 2WHXA 2UUKB 1SHYA 1GL0E 5FBIA 3QWCH 2G8TA 3GCHC 4MQAA 3RU4T 1P06A 1Z8RA 1C1VH 4JZDH 3ZZ6A 1DITH 3A7VA 3A86A 2W3KA 3SORA 2SGPE 1C1PA 1NROH 1RTKA 1JXPA 1GHAG 2AEIH 2FS9A 1LHGH 1UCYE 2ZCKP 5LPEA 3HGPA 3DFLA 3QZRA 1HBTH 3PTBA 5FPSA 1GJAB 1EQ9A 3KQEA 1KIGH 2QAAA 2D2DA 1CGIE 1NTPA 1OX1A 1ABJH 2Y5HA 3S7KB 3KIDU 1VITF 3GCNA 5ABWA 3RMLH 2Q6FA 1BZXE 4TWYA 1WOFA 4JYUH 2SNVA 1O3KA 1WBGB 3PO1B 3VXFH 1ETRH 4OS7A 4ABFA 1FY1A 3FANA 5ESTE 4O9VA 5EU8A 2H5CA 2BOHB 3F9FA 1GI1A 2AH4X 3ZVGA 1F0UA 1J16A 5C67A 3UOUA 1H9HE 4GSOA 1Z8GA 5C1XA 4ZROA 3LKWA 4ZKOU 1BT7A 1TB6H 5L2YH 3S69A 2QA9E 3VPKA 3MNCA 1ZPCA 1C5LH 3B8JA 1P11E 1ZJKA 1VCQA 1L1GA 3PLPA 1ZHPA 2ZHWH 3SJ8A 1GDNA 2HNTC 1TX7A 1SHHB 3DA9B 1MAYA 3M61U 1S0QA 3P8GA 2O8WA 1PPEE 2XYAA 3JZ2B 1XX9A 2VIQA 4HGCA 1HYLA 1DICA 4BAHB 3NPSA 4ISNA 1C5VA 3HKIB 1CGHA 2C4FH 1GJ4H 4NA9H 1TNKA 4X2XA 2J34A 3PROA 1MD7A 4BAKB 1CQQA 1ZOMA 1QL9A 1QY6A 3MWIU 1AB9C 1S0RA 1IQNA 2XBWA 3RMNH 1YPHE 3ODFA 1TNJA 1GVLA 3HK3B 4IS5A 1QIXB 4BAQB 1KDQA 1T7CA 3OX7U 1TPPA 2C8XB 1GHYH 1EJAA 1XUHA 3KF2A 4GCHG 5A8ZA 1GHAF 1AMHA 1W7GH 3H7OA 2JH5D 2ZFSA 1C5NH 2VWNA 2FPZA 3BEIB 1XVMA 1C5TA 2D8WA 2PFEA 5ESBA 1V2ST 1RS0A 5J4QA 2V0BA 1TIOA 3T2NA 1GMCG 2XWBI 1DXWA 1O5CB 4I33A 1CBWC 3MI4A 5ETXA 1P04A 5JBAS 1S6HA 4I8LA 1QJ6B 2F9VA 1A0LA 1Z8IB 2ZKSA 4I7YH 2G4UA 3RXCA 1O3CA 4CRCA 1KDQB 2GV7A 1V2JT 4FUGA 2AGGX 1JBUH 3E6PH 3U8TH 1AFQB 3UNRA 1ZSJA 4E06H 4GHQA 4NFFA 1FXYA 2BDCA 1DDJA 3A89A 2OQUA 3F6UH 1C4U2 3SUDA 1IQFA 5LPRA 1OP2A 1CA0B 1WTHD 3VB3A 2Y5GA 3MNBA 1W7XH 4D7GA 3V3MA 1ELAA 2BY7X 1TBQH 3EDXB 2PKSC 4OS2A 3U1JB 1AUJA 4DIHH 3T25A 3A8CA 3OYPA 3MMGA 1A7SA 3EE0B 1AE5A 1SOTA 4ABJA 1GHBF 2BTCE 5FX6A 3SV2H 2H5DA 3DUXH 1LQDB 2WPHS 3MH5A 2FO9A 3RP2A 3WY8A 1UJ1A 5EG4A 4KTSA 1TBRH 1TOMH 2OC8A 1H9IE 3U69H 1C2DA 5HXFA 1MUEB 3RXUA 3NUMA 3TH4H 3STJA 1HJ8A 3U9AH 1FLEE 1ELFA 1KTTB 4B6FA 3A83A 3BTTE 3PMJA 5E0HA 3SU5A 2PW8H 1P2QA 1XM1A 4NCYA 3LT3A 3S7HB 1TNHA 1T8LA 2PR3A 3VXEH 1UVSH 2AIPA 1K21H 2ZG0H 3UWIA 1Y5BT 2SGEE 3NWUA 4DGJA 1UMAH 4GCHF 1WSSH 4X8VH 3P70B 1LQEA 1N1LA 4LZ4B 3B23B 1BRBE 4H4FA 1ACBE 3LGVA 2FOBA 1ZPBA 3NKKA 3SU4A 4RKOB 3RXMA 1U6QA 2ULLA 3G01A 3KL6A 1GBJA 1MTVA 4X1NU 2HWLB 3SUEA 5CHAB 1GMCF 1MKWH 1TABE 2QXGA 4XFQA 4A1VA 2GT8A 4AB9A 1A4WH 3E0PB 1O2HA 4UDWH 3QZQA 1Y3WA 1HAPH 3D23A 1ZTJA 1DWEH 4IMZA 4OS6A 3SV8A 5J4SA 1SGYE 4INKA 1D6WA 2PUXB 1TAWA 1V2QT 1P9SA 3AASA 1T8MA 3MFJA 3TNSA 1ORFA 1GBMA 4AGKA 1H4WA 2Z3CA 2BQ6B 3EA7A 2FOFA 4ABIA 1JIMA 3AK5A 1WYKA 2J4IA 5A0BA 1JIRA 2WPMS 1LHEH 2F9BH 1YGCH 2V3HH 2F9OA 4A1TA 4ISOA 1FJSA 1MTSA 1DY9A 4R0IA 4WXIA 1HUTH 2P94A 5DP6A 5AHGH 1OWJA 3GY5A 1C5SA 1B7XB 2HLCA 1MZDA 1SGFA 4A7IB 3O8CA 4RI0A 4B1TA 3M3VA 4MPVA 4YOJA 4HFPB 1XKBC 4K69A 5T6DA 1CT4E 1TQ7B 2H9HA 1ELVA 4AGJA 4FUIA 5AFZH 2V6NA 2D1JA 1MKWK 2BM2A 3AAUA 1GVKB 2FEQH 2OLGA 1DUAA 2F3CE 4Y76A 3PM3A 4UONA 3ZZDA 2ILNA 1FDPA 1RD3B 2HPPH 3LU9B 3ODDA 1GCTB 2H6MA 1TNGA 1LPGB 4Y71A 5DK1A 3R3GB 3RXVA 3RM0H 1BCUH 1O5AB 2W7UA 3ZV9A 4CBNA 5GJ4B 2PGQB 2XTTB 4MG3A 3STIA 4KTUA 3RXDA 1ELGA 4FVBA 4CHAC 5BPEA 1W3CA 1ZSLA 1XUFA 4Y0ZE 4XBBA 1MQ5A 1GBIA 2JH0D 5FPTA 2FLRH 2RDLA 5DPAA 4ZXXH 1IHTH 1O2VA 1C1NA 3ESTA 2CMYA 4BTIB 1O3PB 3RXEA 4K8YA 5GXPA 2BD4A 2ANWA 5JB8S 3RXOA 4Y8XA 4D9RA 1YPMH 1EB2A 2P95A 3NXPA 4NFEA 3RU4E 2VIDA 3TGIE 1LVBA 1DFPA 1JWTA 1O33A 3E90B 5JBBS 3M37A 1VCPA 1V2OT 4DOQA 2FOHA 2LNCA 1CU1A 4WY3A 3A7TA 1WQVH 3LIWA 4X0WU 2CJIA 3SNBA 2GGVB 4NWKA 2ALVA 3L6PA 4JMYA 3ZVCA 1PYTD 2ZCHP 1SG8B 2GP9B 3TJVA 1S6FA 3V12A 2RA3A 3K6YA 5A8YA 2P3TB 4Y7BA 3Q00A 4NA7A 4WMEA 1SQOA 2ZA5A 3A81A 2G4TA 3MHWU 3PV5A 1EJNA 2OINA 1YYY1 1O2ZA 2BHGA 1ZRKA 2PSYA 5DP4A 2AS9A 2CXVA 2HALA 2P93A 1C1QA 2I6SA 4NSVA 2FOAA 3A80A 1YPHC 1GHZA 1C2HA 2G5NA 3M7QA 1P8VC 2A5IA 1S5SA 4Y8ZA 1G3CA 1GCDA 1BBRE 3P8OA 1CVWH 1TMBH 1WTGH 3FVFB 3RXTA 2UWPA 3RXRA 1UCYH 3K6ZA 2Q1JA 1P03A 2PWXA 1QHRB 1ID5H 3FZDA 1NRNH 5GNDA 1GG6C 2BY5X 4KTCA 1Q2WA 4ZXYH 1AKSA 3SV9A 5PTPA 4QT8C 4Y8YA 8LPRA 1GBCA 3GCHB 4FUHA 3UQOA 1AVXA 3M5NA 2QXJA 1EZXC 1L4ZA 2HGTH 3K2UA 3QGJA 1FY5A 1Y5UT 2GCTB 1PYTC 1MH0A 5EW2H 1UTOA 2XXLA 2WZQA 1MMJN 1BMAA 2H1UA 2LPRA 2O8TA 2ZU2A 3V7TA 4WF8A 2OK5A 3OY6U 2AGEX 5L2ZH 1NU9A 2Y81A 1G2MA 4ZHMU 1BTYA 5CE1A 4UFGH 1P0SH 2BD5A 3GCTG 4MLFB 4AG1A 1OOKB 3QO6A 3ZZCA 1KXEA 1AKSB 1K1PA 1UK3A 3A7YA 1J15A 1O35A 3GY3A 5HMAA 1D3TB 1ARBA 1SR5C 3QDZB 5AVDA 2NWNA 4HI3A 1GMDG 3PTNA 1BDAA 1THSH 1W12U 1HAIH 4CRDA 1AD8H 1GI8B 3TITA 4XBDA 3GYLB 1F92A 2ZTYA 1T32A 1UCYK 4M9FA 1SVPA 1LKBA 3RC6A 2BD8A 3TNTA 4K5ZA 1ANCA 3EQ0H 2XCNA 2QF0A 3HPTB 1VITG 5HM9A 4YOIA 4VGCC 3KQBA 3KQDA 4BAMB 3LJOA 1ZLRA 2WUBA 2OUAA 3H5CB 1Y8TA 2TGAA 2C8YB 4AOQA 1EP6A 1V2TT 4Q7ZA 3OSYA 1SGFG 1OWHA 1HJAC 3TGJE 1XMNB 2VJ1A 1O37A 4DVAU 1C5PA 3LC3A 4M7GA 3CS7A 4H42U 2F91A 3RDZA 1VZQH 2ZGJA 1L0ZA 1A0HB 4OGYA 1OWKA 2A0QB 2J2UA 1Z7KA 4GUXA 5EOKA 1DT2A 1O36A 4A5TS 1G9IE 1IQHA 2QY0B 1HGTH 3P8FA 4JCNA 1C1UH 4ABEA 1CT0E 1TX6A 3RLYH 1H8IH 2XRCA 2BDIA 1XUJA 1GJ8B 1SGNE 2ZIQH 2P59A 3MOCA 1AY6H 1UTNA 2WYGA 1SGIB 4NZLA 1KLTA 2QCYA 4NIVA 1TA6A 3GOVB 5FAHA 4MDSA 1OP8A 2H9EH 4B6EA 1ZJDA 2ZFQH 1PPHE 3GDVA 1C1MA 2C8WB 1NFUA 2GMTB 3LGTA 1D3PB 2G55A 3F9GA 1C5QA 1P3EA 1AHTH 3IITA 1UVOA 3IG6B 1EP5A 2DUCA 2H2ZA 3GCTF 1T8NA 3ZVDA 4IGDA 1SOZA 4NZQA 4X8SH 3ATLA 2BLWA 4MPUA 2G00A 4I8KA 1TNIA 2BD9A 1CBWB 6CHAB 1HRTH 4XOJA 2GTBA 3BG4C 3L33A 1O3AA 4ZKNU 1GMDF 1SGPE 1V2NT 3BTWE 1MTWA 1VGCB 2SGFE 1QBOA 4Y79A 1LVOA 1P05A 3MU4A 3LH1A 3RMMH 1EPTA 5EGMA 2C3SA 5F8XA 1UK4A 1GGDC 1CGJE 2ZECA 5JBTA 1NFWA 1QCPA 1AI8H 1FAXA 2FX6A 1P9UA 1PPCE 2UWLA 4YESB 1TRNA 2VH0A 1G30B 1PQ5A 2PKSB 1LO6A 2TBSA 1QTFA 1W2KH 1GBLA 1JRTA 4FU8A 1GJDB 3MH6A 1KXDA 3RXLA 1S84A 2BY8X 1ARCA 3SV7A 1EPTB 2Z9GA 3UIRA 5HM2A 1NRPH 2OC1A 5GPIB 1V3XA 1XUGA 1RIWB 1FUJA 1WUNH 1GDQA 2SFAA 4X1RU 1P12E 1BITA 1HPGA 4X1QU 1HLTH 2AERH 5C5NA 3RXAA 5K7RA 1UO6A 1DM4B 1J9CH 1ZR0A 1QR3E 3DHKH 2VWLA 3LH3A 1SBWA 1PPFE 1GHBG 1F5KU 2Y80A 4NA8A 1SLXB 2ZGCA 1S81A 3ZVEA 2GDDA 3NCLA 1DWCH 1HAGE 1TE0A 2FP7B 2FOGA 3SU0A 3EGKH 1FQ3A 2XC4A 1O0DH 3S9CA 2IN2A 4MNWA 4F4OC 2O8UA 2A7JA 2BDAA 1HJ9A 3FAOA 1KLJH 1FV9A 3ZYEA 1SPJA 2ZDKA 3UY9A 1O5EH 2A5KA 2XBVA 3PWCA 2P8OC 5E2PA 3UFAA 1G3DA 4I8JA 1FY8E 1GBAA 1S85A 1HAVA 1GBDA 1B0FA 4Y6DA 3OTPA 2THFB 4ESTE 1GBKA 2ODQA 4CR9A 1QGFA 3P17H 1F0SA 3GICB 1BRAA 3GY2A 1F2SE 2VBCA 4ZKSU 1HB0B 1MQ6A 1SGTA 3TJOA 1DLKB 2C93B 3GY8A 1K1MA 1NU7B 2Z3EA 2AMQA 3A82A 1YLCA 2FLBH 3LDXH 1EXFA 2Z3DA 4AG2A 3PLBA 4TPIZ 1XXFA 1P09A 2OBQA 1YM0A 1HAVB 3ATMA 1RFNA 7LPRA 1WQSA 8KME2 2SGDE 4XE4A 4GAWA 3H09A 5DGJA 4BTUB 3ATIA 1XUIA 1E37B 3TVJB 1G3BA 2VIOA 1EAWA 1DX5M 2VU8E 3D62A 3LGYA 2FESH 2K1QA 1TGBA 4TY7A 1QA7A 1Z71A 2ASUB 3QTOH 4CREA 3K65B 1DPOA 1TGNA 1B0EA 2JKHA 4FUDA 1GI2A 3FFGA 4JYTA 1F7ZA 1O34A 1TALA 1YBWA 2BQWB 2FZZA 2Z7FE 3LGUA 4YLQH 3SNEA 3SYJA 3HGNA 4WVPE 1CT2E 1C4Y2 4WH8A 3M5LA 3SNDA 1PPZA 1YKTA 3PO1C 2VIWA 1KY9A 1LCYA 4CH8B 1GHVH 1CHOF 1A3EH 1C5XB 2VGCC 1X7AC 3PMHB 4GLYA 2F83A 1BHXB 3FP7E 1D3DB 1S83A 4THNH 3FP6E 5FXLA 3SJKA 4AORA 3ATWA 4ISLA 2BXTH 5C1YA 1V2LT 3RXHA 2ZEBA 1V2UT 4ZHLU 2FOMB 1QQ4A 1EZUC 4FUBA 1IHSH 4UE7H 1AWHB 1BTXA 1FN6A 3MH4A 4O3UA 3I77A 5EW1H 4X1SU 4Z6AH 1Z6EA 1UTMA 3T26A 1INCA 3M5MA 2BD2A 3UNSA 4MNYA 1ABIH 2Z9LA 4CRGA 2BY6X 4CBOA 1O5GH 1TMUH 4YTAA 3PV4A 3TH3H 1CA8B 1QL8A 2XC5A 3HATH 1IQGA 2A7CA 3RUOA 1HNEE 1QB1A 1SQTA 2PLXA 3E1XB 2A4OA 4IC5A 1ZHRA 1SMFE 1E0FD 4GVUA 3ZVFA 1C5RA 3UNQA 3BSQA 4ISIH 1DE7H 1O3EA 3BF6H 3E8LA 1P2NA 1SL3A 2GV6A 1GI4A 4FUEA 2OQ5A 3QX5H 4ZHAA 4BOHA 1C1SA 1OSSA 1KYNA 1TPSA 3T27A 3ZZ7A 2P16A 4AN7A 2BQ7B 1DUEA 4O3TA 1B5GH 1G36A 3Q76A 1G37A 1P2IA 1GHXH 2WYJA 1O2RA 1BRUP 1IQMA 3IWMA 4I8HA 1OS8A 1BJUA 2ZU5A 3RXJA 1EOJA 1MTNC 2BLOA 2FWWA 3UREA 4LK4A 1N8OB 4NGAH 2VNTA 2XBXA 2BB4A 3SI4H 3Q3XA 2FMJA 3SZNA 5I25A 4MVNA 2W3IA 3S9BA 4K1EA 2ZWLH 1O3LA 5JB9S 1BBRK 3SGQE 3UUZA 5C3NA 3BV9B 2PGBB 4Z0KA 5DO4H 2GVFA 5EQSA 3KGPA 3SU6A 1IQKA 1C1RA 5B6LA 1GVZA 1ZTKA 3A84A 3URCA 3LOXA 2WV5A 1NN6A 1VR1H 1CA0C 4I31A 4K3JA 4Q7XA 2HOBA 3ZZ5A 2A4RA 4B74A 4E05H 2ZPRA 2F9NA 3PMAB 2A2QH 4OS5A 3BTHE 4HZHA 4WMFA 3U8OH 3F68H 4Y0YE 4UFFH 2ZU4A 1MKXK 1ZMJA 3GCOA 4BXWA 1XUKA 3M3SA 4JYVH 3MNXA 3P95A 2BY9X 1SFQB 1C2KA 2ZFTA 4KELA 2BXUH 3TIUA 2AYWA 5TCAA 3SBKA 1O2GH 2NU4E 3UWJH 3BTEE 4WXVA 2BD3A 1T8OA 1SI5H 3P8NA 2Y6TA 4WWYA 1QRZA 1C2MA 5DP3A 1H8DH 2Q6GA 2AMDA 4DIIH 3MO6A 3AAVA 2ESTE 3SN8A 3SOSA 4A6LA 2ZCLP 1SGDE 4IN2A 4JZIA 1BUIA 4B2AA 1FY4A 3A8DA 4D76A 2RA0A 3RXIA 1GPZA 5C2ZA 1AIXH 2QF3A 3DD2H 4DW2U 1P2OA 2VWMA 2A5AA 2WPKS 3PV2A 2FM2A 2D26C 3K9XB 3S9AA 1CO7E 1UK2A 2B7DH 2TGPZ 1GL1A 1YPLH 3SQEE 5CMXH 4IN1A 2BX4A 2ZTXA 2B9LA 1BRCE 1Y5AT 3LGWA 3W94A 2ZF0H 3SUFA 3UOPA 1DWDH 3I78A 5EPNA 1LPKB 2SGAA 4AFSA 4YT6H 2XC0A 1KSNA 2WPLS 1K22H 2RCEA 1A5HA 1CE5A 1NT1A 5CHAC 3EA8A 1O5DH 2GZ9A 2PHBA 1LDTT 3PYHA 1A0JA 1CHGA 3BTDE 3MU0A 4RKJB 2XWAA 2J95A 1YLDA 1FPHH 4BXSA 1L2EA 4MTBA 4UEHH 3L3TA 1BTWA 1QB6A 2PTCE 3CENA 1HIAA 1TOCB 4DG4A 2IOTA 2PSXA 1O5FH 4E7RG 4FUCA 4KKDA 1TX8A 1UHBA 3M36A 2J9NA 1ELEE 1ELCA 1TFXA 1QURH 1EASA 1O30A 1K2I1 3QTVH 2BVSH 4DT7B 1FIWA 2BDHA 3RM2H 2A32A 3SGAE 3SJIA 2A7HA 5B6OA 4BTTB 2ALPA 3C1KA 2YNAA 2KAIA 3RXPA 1O3NA 2R2MB 2Y82A 6ESTA 1DOJA 2DE9A 2EC9H 4ZAEA 1YPKH 1MBMA 1HIAB 1TQ0B 1HCGA 3NK8A 1GI7B 1XXDA 2R3YA 1ZZZA 3BN9A 3T5FH 1C9TA 3RXFA 1UHBB 3O8DA 1C2JA 2ZO3H 1P02A 2J38A 4H6TA 1YCPK 2VINA 1OKXA 1O31A 1ESTA 1E36B 1NESE 2GX4A 5T6FA 1AVWA 1ZRBA 3TPIZ 2ANMH 1F0TA 3ZZ3A 1LHFH 1NC6A 1GI9B 2KAIB 1FZZA 2ZHFH 1L4DA 1P57B 3BTGE 3ZYDA 5T1VA 3PLKA 1K28D 1GCTC 2QN5T 5FBEA 1BHXF 4OGXA 2VIVA 1O2NA 3M35A 5DP9A 3DT0H 1YPEH 1P2JA 3A8AA 3SNAA 3V0XA 1ETSH 5DKMA 1EJMA 1QBVH 1AN1E 1KXBA 1ZTLA 2RG3A 2FI4E 2JETC 3A7WA 4DJZB 1O3GA 1QL7A 1ZSKA 3QN7A 3ZVBA 4X8UH 2FODA 2TGTA 4X6OA 1A5IA 3SW2B 2GZ7A 1DY8A 1K1IA 4D9QA 4Q2KA 2BDBA 1UTKA 3Q77A 2Z6BD 2G81E 1ZMNA 2CGAA 2FI5E 2BYAX 3JZ1B 5EXLA 1V2VT 3OU0A 1C5WB 1N6YA 3BIVH 3QUMP 3NZIA 2Q6DA 3E91A 1E35B 2EI8A 2HPQH 5F6MA 1Y59T 4MPXA 2OD3B 2Z9IA 4JZFH 4X6MA 1W0YH 1ZYOA 1IOEA 1C1OA 3ENSB 2ANYA 4MPWA 1THPB 1BIOA 1AB9B 2FOCA 1MAXA 3M7TA 1DLEA 1EAIA 5EPYA 1MTUA 3F9EA 8GCHG 2BDYA 4ASHA 3SZEA 3SJOA 3RXSA 2ZQ1A 2QC2A 4LOYH 4TYDA 1RJXB 4X6NA 2QV1A 3SHAH 1SC8U 3GDUA 3TK9A 5GIBA 3ZZ4A 3KEEA 1UTJA 1V2MT 2ZP0H 4LXBH 4LZ1H 1YCPM 1TRYA 2XBYA 3E3TA 3M3TA 7ESTE 4B2BA 2H9TH 4X6PA 2VWOA 2FS8A 3I29A 3CS0A 2VB0A 1VITH 2PKAA 1PPGE 2FX4A 1TBZH 2ZI2H 4CH2B 9ESTA 3TJUA 3ZZ8A 2GZ8A 2ZDMA 2BLQA 2VIPA 5I46H 4SGAE 3RU4D 2TGDA 2GCTC 4AYVB 1MZAA 3LC5A 1AO5A 4OS1A 1G3EA 1MU8B 1O2XA 2R3UA 5EXNA 1N6XA 2A4GA 3B9FH 2GKVE 1WCZA 1FIZA 1VJAU 1O3JA 2CN0H 1ZHMA 3GY4A 2PKAB 3T28A 3BG8A 2HRVA 4BNRA 2BDGA 1UTQA 5IYTA 1EAUA 1SLVB 3TJNA 1K1JA
chains in the Genus database with same CATH superfamily
5FX5A 1NZQH 3KNXA 3Q3KA 1MCTA 2VGCB 3OTJE 5KECA 4AFZA 4I32A 4Y11E 1IQEA 3UB0A 1GBTA 3KN2A 4ZKRU 3U1IB 4P00A 3ZVAA 1FMGA 3EYDA 3VGCC 2YMSC 5F03A 1JOUB 3HK6B 2A45B 2WV9A 5TCCA 4AFQA 1QRXA 4UD9H 2CHAC 4TY6A 2XNIA 8GCHF 5EQRA 1M9UA 2Y5FA 1EB1H 1YPGH 1CHOG 1TRMA 2ZFPH 3AVZA 3FZZA 3ZZAA 1H9LB 1GI0A 3FP8E 3LPRA 1WV7H 3ELAH 3VB7A 1A46H 1KLIH 1L1NA 4TT3D 2Y7ZA 3U28C 2ODYB 1L1JA 1Y3VA 3RC4A 1GBEA 2ZGBH 1PQ7A 3F2FA 5TJXA 4FU9A 1QJ7B 1SLUB 4IC6A 1JMOH 3GDSA 5DP8A 5A09A 2YNBA 1SFIA 1HAXB 1AFEH 4I8GA 4D7FA 1BTUA 1WDIA 3PWBA 4FU7A 1AVGH 2BZAA 1BTZA 1O2TA 7KMEH 1UTLM 2ZQ2A 4K60A 1K1NA 5DJ7A 3TGKE 1QA0A 3SJ9A 4B75A 1LHDH 3D49H 5GDSH 3SO3A 1YF4A 2P3UB 1Y3UA 2BZ6H 2ZHDA 1W11U 4PROA 1W0JD 3VB6A 1SLWB 2FYQA 4B2CA 2AMPA 1IQLA 5EQQA 5F8ZA 5LPFA 2YOLA 4TWWA 3Q3YA 4NWLA 4F49A 4SGBE 3MYWA 1QB9A 3UQVA 2GMTC 1GDUA 5BRRE 3RLWH 5E8EH 1OPHB 3P92A 1C5ZB 3TH2H 4K2YA 5A2MH 1F0RA 1O2QA 1C2LA 4AFUA 1MTNB 1Z1IA 4RN6A 2EEKA 1D4PB 3VFEA 2LELA 4OM9A 6CHAC 3MU5A 4YXWD 1EUFA 1GMHG 1OHHD 4HTCH 2OC7A 1MCVA 1KXAA 5CHBA 5HGGA 1KXCA 1NS3A 1GWAA 1Z6JH 2OTVA 1O3MA 3MTYA 3SNCA 1VGCC 1C2IA 4FXGH 5C1UA 1O2LA 2O9QA 1C5YB 2STBE 4FUFA 4U32A 1AWFH 1YPJH 1F5LA 1LKAA 1O2KA 4ZH8A 1GJ5H 1Z1JA 1C4V2 2AIQA 2ZHQH 4WMDA 2VH6A 2QIQA 1Y3XA 5K0HA 2B8OH 1DXPA 3A88A 3P6ZB 4KGAA 1ETTH 1NRSH 1AUTC 4NIYA 4E7NA 4WJG2 2FDAA 2ZDNA 2L6OA 4CRFA 1HXFH 2ANKH 1IAUA 1S82A 3CP7A 3OY5U 4CHAB 1EOLA 1SGRE 1ZGVA 5HKKD 1O3OA 1TGTA 2QXIA 5T3HA 1EATA 1O2JA 4J1YA 3VB5A 1HAYB 1EPTC 5FPYA 1TMTH 1NM6A 5AF9H 1NFXA 2G5VA 3MU8A 4NSYA 3U8RH 1EKBB 1GJBB 1ELTA 1WU1A 4JK5A 5T6GA 1RIWC 2HNTF 3SV6A 1C1TA 1JRSA 1V2RT 6LPRA 2R9PA 1THRH 1TONA 1DSUA 3S0NA 4ZUHA 3EAJA 3ZV8A 2F9PA 4DY7B 1C2GA 3A85A 4XRNA 2ZFRH 4KP0A 2VVVA 3H7TA 1SSXA 4RSPA 2OCVB 3F9HA 2Y7XA 2BX3A 5GCHG 1Z8JB 1FY3A 1T4VH 2IPHA 5H4IB 1C2EA 5F8TA 3QGNB 5E2OA 1BBRH 1UTPA 5DG6A 4O03A 1VJ9U 4UFDH 1TPOA 2CV3A 1NO9H 5G4BA 6GCHG 1H1BA 1V2KT 1EZSC 2R0KA 3BTKE 3RMOH 2BD7A 3F0OA 4TPYA 1C5MD 2CF9H 2GT7A 1QFKH 2G51A 1A3BH 3MQKC 2GD4B 5KGOA 2OC0A 4CR5A 3KQCA 3BTME 2W26A 2ZZUH 1D9IA 1OWEA 1PQAA 4YZUA 4ZMAH 1SQAA 1GMHF 2C8ZB 1DANH 2STAE 4I86A 1HXEH 4UFEH 2FXRA 3MNSA 2PUQH 2SGQE 5JBCS 2QYIA 4X2VA 2ZGHA 1OYQA 4K1TA 1MKXH 1Q3XA 5DP5A 7GCHG 1WAYB 1Y3YA 2OXSA 5A0CA 4ABAA 1GG6B 4FOUC 5DP7A 4BAOB 3SGBE 2ZGXH 1GBHA 1MBQA 1PFXC 1TNLA 2GCHG 4ABGA 4J2YB 1BMNH 5EODA 1HFDA 3N99A 3GY6A 1NRQH 1V2WT 3HKJB 2DE8A 4U2WA 4A1XA 4ABBA 1ELDE 1QJ1B 3C27B 8ESTE 3WWFA 5JPMH 1F5RA 2WINI 1O3DA 1ANDA 2ZC9H 4INHA 4X1PU 3A87A 3SQHE 2FOEA 2F4LA 3O8RA 1COWD 3KCGH 1AFQC 3RXGA 3UR6A 2A1DB 1ANBA 2NU3E 1W10U 2FIRH 2Z9KA 3AW1A 2OP9A 5JDUB 4NIXA 3T29A 1SGQE 2BMGB 1O3BA 1RTLA 3TLOA 3T62A 2TRMA 3F2HA 2AFQB 3MO9A 2V35A 1HV7A 2BLVA 1YY3A 2IPQX 4X2WA 3UTUH 1K1LA 5A8XA 3RXQA 3A8BA 2QE7D 1MD8A 2LP6A 1NY22 1ZGIA 2ZU3A 4Q80A 1O3HA 1FONA 2ZTZA 1YC0A 1AZ8A 2JJ2D 2WV4A 4K1SA 3BTQE 2FI3E 1O2YA 2NU0E 4XDEA 2TIOA 5GCHF 3DCLA 4VGCB 2NU1E 4YO9A 1KXFA 1O2SA 1GI3A 3A7XA 1W13U 5C5OA 1YP9A 1OXGA 1C5UA 2O8MA 1GI5A 3MH7A 4IW4E 2ZHEH 6GCHF 2ZPSA 2C90B 3GY7A 1P10A 2JETB 1HJAB 4U01A 1QQUA 1AQ7A 2HVYB 1A2CH 2B0FA 3AW0A 2HNTE 2ZDAH 2QXHA 1J17T 1BTHH 1G32B 1LVMA 2R0LA 2F9UA 2ZPQA 2EI6A 3MO3A 4CRAA 4A92A 4FUJA 2SNWA 1K9OE 2K8IA 3M5OA 4RT1A 4R8TB 1OWDA 5C0TA 2Z9JA 1A1RA 2M5TA 2A4QA 1K1OA 1TPAE 2IJOB 1T4UH 1P2KA 1EX3A 3N7EA 4Q7YA 7GCHF 1P01A 2A2XH 1ELBA 2I6QA 1C1WH 1EAXA 1TLDA 2BOKA 1O3IA 3ATKA 1ZPZA 1YCPH 5A0AE 2W5EA 3PB1E 3VEQB 2GCHF 3U98H 2HLDD 3GISB 1C9PA 1VKYA 4Z1MD 4XBCA 2P3FH 1NRRH 4K8BA 1FNIA 1GI6A 2EA3A 4IBLH 2J92A 1W8BH 1A61H 1O2WA 5L6NH 1BQYA 4JK6A 4AX9H 2PTNA 2CK3D 2ZNKH 2IJD1 1RXPA 1ZMLA 3BEFB 1ESBA 1OYTH 3N7OA 3URDA 4JZEH 1G2LA 2G52A 1CSOE 1V2PT 4OS4A 1GJ9B 2WPIS 2BVXH 2WPJS 1DS2E 1LPZB 3MU1A 1V6DA 3TK6A 1GJCB 1O39A 1ESAA 1PPBH 1IQJA 1ANEA 3LONA 1C2FA 1DWBH 4AZ2B 2WUCA 1BB0B 2GDEH 3R0FA 3BG4B 2O8LA 1T31A 1AE8H 1FI8A 4B76A 1GJ6A 1O5BB 1W14U 1BMMH 3BEUA 2ZU1A 4XSKU 1QNJA 2OBOA 5L30H 5JYIA 1E34B 1WXRA 5LH8A 1GGDB 3BTFE 1O32A 1N8OC 1PJPA 2FTLE 4H6SB 1RTFB 4B71A 3LGIA 1NFYA 4JZ1A 1FPCH 3GYMA 2PV9B 2QGRA 1SB1H 1BA8B 2UUYA 1O3FA 1O38A 4GHTA 2VVCA 1EZQA 2UUJB 1LHCH 1O2IA 4ISHH 4FVDA 2EI7A 4Q4LA 1BTPA 3EA9A 4CRBA 5HYOA 1BJVA 1D3QB 3SI3H 2XW9A 2GJGA 1D6RA 1DVAH 2BVRH 5FCRA 4O97A 5E0JA 1P2MA 9LPRA 1NBMD 2HVXA 3RXKA 3A7ZA 5AFYH 1DSTA 4F55A 2UUFB 2KX4A 2UWOA 1GHWH 1O2MA 1RRKA 4YM9A 4ABDA 3E16B 5EXMA 4ABHA 1OP0A 1P3CA 1UVPA 2ZDVH 4U30A 1O2OA 1O2PA 5LGOA 1TYNA 2ZDLA 1FAKH 2VVUA 3UPEA 3SU1A 4YLUA 1HAOH 3VGCB 4D8NA 2TPIZ 2B5TB 1VCWA 1HAHH 1XKAC 3M7UA 3VB4A 2FYRA 2XCFA 4YOGA 3RXBA 1E38B 4B73A 1AZZA 2CHAB 3SHCH 3V13A 1W0ZU 2JH6D 4BANB 5C20A 3RC5A 3ZZBA 2M2AA 2ODPA 1NPMA 4Y7AA 4NG9H 2WSSD 3LJJA 1O2UA 1HAZB 2CF8H 1RGQA 5HIYA 1J8AA 1PQ8A 4NIWA 1SGEE 4MNVA 3SU3A 1LMWB 1Q31A 4MNXA 3BIUH 4DCDA 1FN8A 1LTOA 4INLA 2AGIX 4AYYB 5FCKA 5IDKA 1GBBA 3KHVA 1MU6B 3O8BA 2P8OB 4X8TH 1C5OH 1IQIA 1GBFA 1GJ7B 1BMLA 4X2YA 2V3OH 1A5GH 2J94A 3QK1A 3D65E 3F1SB 3SUGA 3PMBB 2FTMA 4GPGA 2NU2E 1QRWA 1J14A 3ITIA 3UR9A 2Z94A 1TA2A 1LVYA 1HDTH 4DURA 1OWIA 2A31A 1AU8A 2W7SA 3TU7H 2ZFFH 2R2WU 4WH6A 1XVOA 4AB8A 1TGCA 3QLPH 2J97A 1UVUH 3CNRA 3E0NB 1TWXB 1SGCA 3SU2A 1KTSB 3TK5A 5E0GA 1QBNA 4Y10E 4IMQA 1BOQA 1UVTH 3ZZ9A 1TGSZ 3DFJA 1AGJA 3W95A 5SGAE 4YT7H 5GWZA 5FHTA 2WHXA 2UUKB 1SHYA 1GL0E 5FBIA 3QWCH 2G8TA 3GCHC 4MQAA 3RU4T 3KQ5A 1P06A 1Z8RA 1C1VH 4JZDH 3ZZ6A 1DITH 3A7VA 3A86A 2W3KA 3SORA 2SGPE 1C1PA 1NROH 1RTKA 1JXPA 1GHAG 2AEIH 2FS9A 1LHGH 1UCYE 2ZCKP 5LPEA 3HGPA 3DFLA 3QZRA 1HBTH 3PTBA 5FPSA 1GJAB 1EQ9A 3KQEA 1KIGH 2QAAA 2D2DA 1CGIE 1NTPA 1OX1A 1ABJH 2Y5HA 3S7KB 3KIDU 1VITF 3GCNA 5ABWA 3RMLH 2Q6FA 1BZXE 4TWYA 1WOFA 4JYUH 2SNVA 1O3KA 1WBGB 3PO1B 3VXFH 4F48B 1ETRH 4OS7A 4ABFA 1FY1A 3FANA 5ESTE 4O9VA 5EU8A 2H5CA 2BOHB 3F9FA 1GI1A 2AH4X 3ZVGA 1F0UA 1J16A 5C67A 3UOUA 1H9HE 4GSOA 1Z8GA 5C1XA 3NRLA 4ZROA 3LKWA 4ZKOU 1BT7A 1TB6H 5L2YH 3S69A 2QA9E 3VPKA 5CDFE 3MNCA 1ZPCA 1C5LH 3B8JA 1P11E 1ZJKA 1VCQA 1L1GA 3PLPA 1ZHPA 2ZHWH 3SJ8A 1GDNA 2HNTC 1TX7A 1SHHB 2QF5A 3DA9B 1MAYA 3M61U 1S0QA 3P8GA 2O8WA 3VG8A 1PPEE 2XYAA 3JZ2B 1XX9A 2VIQA 4HGCA 2KZ4A 1HYLA 3FN8A 1DICA 4BAHB 3NPSA 4ISNA 1C5VA 3HKIB 1CGHA 2C4FH 5EJ1A 1GJ4H 4NA9H 1S6LA 1TNKA 4X2XA 2J34A 3PROA 1MD7A 4BAKB 1CQQA 1ZOMA 1QL9A 1QY6A 3MWIU 1AB9C 1S0RA 1IQNA 2XBWA 3RMNH 1YPHE 3ODFA 1TNJA 1GVLA 3HK3B 4IS5A 1QIXB 4BAQB 1KDQA 1T7CA 3OX7U 1TPPA 2C8XB 1GHYH 1EJAA 1XUHA 3KF2A 4GCHG 5A8ZA 1GHAF 1AMHA 1W7GH 3H7OA 2JH5D 2ZFSA 1C5NH 2VWNA 2FPZA 3BEIB 1XVMA 1C5TA 2D8WA 2PFEA 4ACAA 5ESBA 1V2ST 1RS0A 5J4QA 2V0BA 1TIOA 3T2NA 1GMCG 2XWBI 2XOKD 1DXWA 1O5CB 4I33A 1CBWC 3MI4A 5ETXA 1P04A 5JBAS 1S6HA 4I8LA 1QJ6B 2F9VA 1A0LA 5C0UA 1Z8IB 2ZKSA 4I7YH 2G4UA 3RXCA 1O3CA 4CRCA 1KDQB 2GV7A 1V2JT 4FUGA 2AGGX 1JBUH 3E6PH 1KMHB 3U8TH 1AFQB 3UNRA 1ZSJA 4E06H 4GHQA 4NFFA 1FXYA 2BDCA 1DDJA 3A89A 2OQUA 3F6UH 1C4U2 3SUDA 1IQFA 5LPRA 1OP2A 1CA0B 1WTHD 3VB3A 2Y5GA 3MNBA 1W7XH 4D7GA 3V3MA 1ELAA 2BY7X 1TBQH 3EDXB 2PKSC 4OS2A 3U1JB 1AUJA 4DIHH 3T25A 3A8CA 3OYPA 3MMGA 1A7SA 3EE0B 1AE5A 1SOTA 4ABJA 1GHBF 2BTCE 5FX6A 3SV2H 2H5DA 3DUXH 1LQDB 2WPHS 3MH5A 2FO9A 3RP2A 3WY8A 1UJ1A 5EG4A 4KTSA 1TBRH 1TOMH 2OC8A 1H9IE 3U69H 1C2DA 5HXFA 1MUEB 3RXUA 3NUMA 3TH4H 3STJA 1HJ8A 3U9AH 1FLEE 1ELFA 1KTTB 2V3MA 4B6FA 3A83A 3BTTE 3PMJA 5E0HA 3WWBA 3SU5A 2PW8H 1P2QA 1XM1A 4NCYA 3LT3A 3S7HB 1TNHA 1T8LA 2PR3A 3VXEH 1UVSH 2AIPA 1K21H 2ZG0H 3UWIA 1Y5BT 2SGEE 3NWUA 4DGJA 1UMAH 4GCHF 1WSSH 4X8VH 3P70B 1LQEA 1N1LA 4LZ4B 3B23B 1BRBE 4H4FA 1ACBE 1E79D 3LGVA 2FOBA 1ZPBA 3NKKA 3SU4A 4RKOB 3RXMA 1U6QA 2ULLA 3G01A 3KL6A 1GBJA 1MTVA 4X1NU 2HWLB 3SUEA 5CHAB 1H8ED 1GMCF 1MKWH 1TABE 2QXGA 4XFQA 4A1VA 2GT8A 4AB9A 1A4WH 2L74A 3E0PB 1O2HA 4UDWH 3QZQA 1Y3WA 1K0HA 2JJ1D 3D23A 1HAPH 1ZTJA 1DWEH 4IMZA 4OS6A 3SV8A 5J4SA 1SGYE 4INKA 1D6WA 2PUXB 1TAWA 1V2QT 1P9SA 3AASA 1T8MA 3MFJA 3TNSA 1ORFA 2RDEA 1GBMA 4AGKA 1H4WA 2Z3CA 2BQ6B 3EA7A 2FOFA 4ABIA 1JIMA 3AK5A 1WYKA 2J4IA 5A0BA 1JIRA 2WPMS 1LHEH 2F9BH 1YGCH 2V3HH 2F9OA 4A1TA 4ISOA 3UAIC 1FJSA 1MTSA 1DY9A 4R0IA 4WXIA 1HUTH 2P94A 5DP6A 5AHGH 1OWJA 3GY5A 1C5SA 3FKSD 1B7XB 2HLCA 1MZDA 1SGFA 4A7IB 3O8CA 4RI0A 4B1TA 3M3VA 4MPVA 4YOJA 4HFPB 1XKBC 4K69A 5T6DA 1CT4E 1TQ7B 2H9HA 1ELVA 4AGJA 4FUIA 5AFZH 2V6NA 2D1JA 1MKWK 2BM2A 3AAUA 1GVKB 2FEQH 2OLGA 1DUAA 2F3CE 4Y76A 3PM3A 4UONA 3ZZDA 2ILNA 1FDPA 1RD3B 2HPPH 3LU9B 3ODDA 1GCTB 2H6MA 1TNGA 1LPGB 4Y71A 5DK1A 3R3GB 3RXVA 3RM0H 1BCUH 1O5AB 2W7UA 3ZV9A 4CBNA 5GJ4B 2PGQB 2XTTB 4MG3A 3STIA 4KTUA 3RXDA 1ELGA 4FVBA 4CHAC 5BPEA 1W3CA 1ZSLA 1XUFA 4Y0ZE 4XBBA 4TSFD 1MQ5A 1GBIA 2JH0D 5FPTA 2FLRH 2RDLA 5DPAA 4ZXXH 1IHTH 1O2VA 1C1NA 3ESTA 5EJLA 2CMYA 4BTIB 2RFKC 1O3PB 3RXEA 4K8YA 5GXPA 2BD4A 2ANWA 5JB8S 3RXOA 4Y8XA 4D9RA 1H8HD 1EB2A 1YPMH 2P95A 3NXPA 4NFEA 3RU4E 3F2GA 2VIDA 3TGIE 1LVBA 1DFPA 1JWTA 1O33A 3E90B 5JBBS 3M37A 1VCPA 1V2OT 4DOQA 2FOHA 2LNCA 1CU1A 4WY3A 3A7TA 1WQVH 3LIWA 4X0WU 2CJIA 3SNBA 2GGVB 4NWKA 2ALVA 3L6PA 1E1QD 4JMYA 3ZVCA 1PYTD 2ZCHP 1SG8B 2GP9B 3TJVA 1S6FA 3V12A 2RA3A 3K6YA 5A8YA 2P3TB 5EIYA 2PP6A 4Y7BA 3Q00A 4NA7A 4WMEA 1SQOA 2ZA5A 3A81A 2G4TA 3MHWU 3PV5A 1EJNA 2OINA 1YYY1 1O2ZA 2BHGA 1ZRKA 2PSYA 5DP4A 2AS9A 2CXVA 2HALA 2P93A 1C1QA 2I6SA 4NSVA 2FOAA 3A80A 1YPHC 1GHZA 5FL7D 1C2HA 2G5NA 3M7QA 1P8VC 2A5IA 1S5SA 4Y8ZA 1G3CA 1GCDA 1BBRE 3P8OA 1CVWH 1TMBH 1WTGH 3FVFB 3KYFA 2UWPA 3RXTA 2W6ID 3RXRA 1UCYH 3K6ZA 2Q1JA 1P03A 2PWXA 1QHRB 1ID5H 3FZDA 1NRNH 5GNDA 1GG6C 2BY5X 4KTCA 1Q2WA 4ZXYH 1AKSA 3SV9A 5PTPA 2K0QA 4QT8C 4Y8YA 8LPRA 1GBCA 3GCHB 4FUHA 3UQOA 1AVXA 3M5NA 2QXJA 1EZXC 1L4ZA 2HGTH 4AC9A 3K2UA 3QGJA 1FY5A 1Y5UT 2GCTB 1PYTC 1MH0A 5EW2H 1UTOA 2XXLA 3PRBA 2V7QD 2WZQA 3PRDA 1MMJN 1BMAA 2H1UA 2LPRA 2O8TA 2ZU2A 3V7TA 4WF8A 2OK5A 5HIZA 3OY6U 2AGEX 5L2ZH 1NU9A 2Y81A 1G2MA 4ZHMU 1BTYA 5CE1A 4UFGH 1P0SH 2BD5A 3GCTG 5DN6D 4MLFB 4AG1A 1OOKB 3QO6A 3ZZCA 1KXEA 1AKSB 1K1PA 1UK3A 3A7YA 1J15A 1O35A 3GY3A 2KFWA 5HMAA 1D3TB 1ARBA 1SR5C 3QDZB 5AVDA 2NWNA 4HI3A 1GMDG 3PTNA 1BDAA 1THSH 1W12U 1HAIH 4CRDA 1AD8H 1GI8B 3TITA 4XBDA 3GYLB 1F92A 2ZTYA 1T32A 1UCYK 4M9FA 1SVPA 1LKBA 3RC6A 2BD8A 3TNTA 2YMSB 4K5ZA 1ANCA 3EQ0H 2XCNA 2QF0A 3HPTB 1VITG 5HM9A 4YOIA 3WW7A 4VGCC 3KQBA 3KQDA 4BAMB 3LJOA 1ZLRA 2WUBA 2OUAA 3H5CB 1Y8TA 2KCOA 2TGAA 2C8YB 4AOQA 1EP6A 1V2TT 4Q7ZA 3OSYA 1SGFG 1OWHA 1HJAC 2KM0A 3TGJE 1XMNB 2VJ1A 1O37A 4DVAU 1YLNA 1C5PA 3LC3A 4M7GA 3CS7A 4H42U 2F91A 3RDZA 1VZQH 2ZGJA 1L0ZA 1A0HB 4OGYA 3KYGA 1OWKA 2A0QB 2J2UA 1Z7KA 4GUXA 5EOKA 1DT2A 1O36A 4A5TS 1G9IE 2KCPA 1IQHA 2QY0B 1HGTH 3P8FA 4JCNA 1C1UH 4ABEA 1CT0E 3DSGA 1TX6A 3RLYH 1H8IH 2XRCA 2JIZD 2BDIA 3GS9A 1XUJA 1GJ8B 1SGNE 2ZIQH 4XD7D 2P59A 3MOCA 1AY6H 1UTNA 2WYGA 1SGIB 4NZLA 1KLTA 2QCYA 4HG6A 4NIVA 1TA6A 3GOVB 5FAHA 4MDSA 1OP8A 1SQRA 4ASUD 2H9EH 4B6EA 1ZJDA 2ZFQH 1PPHE 3GDVA 1C1MA 2C8WB 1NFUA 2GMTB 3LGTA 1D3PB 2G55A 3F9GA 1C5QA 1P3EA 1AHTH 3IITA 1UVOA 3IG6B 1EP5A 2DUCA 2H2ZA 3GCTF 1T8NA 3ZVDA 4IGDA 1SOZA 4NZQA 4X8SH 3ATLA 2BLWA 4MPUA 2G00A 4I8KA 1TNIA 2BD9A 1CBWB 6CHAB 1HRTH 4XOJA 2GTBA 3BG4C 3L33A 1O3AA 4ZKNU 1GMDF 1SGPE 1V2NT 3BTWE 3F0PA 1MTWA 1VGCB 2SGFE 1QBOA 4Y79A 1LVOA 1P05A 3MU4A 3LH1A 3RMMH 1EPTA 5EGMA 2C3SA 5F8XA 1UK4A 1GGDC 5IK2D 1CGJE 2ZECA 5JBTA 1NFWA 1QCPA 1AI8H 1FAXA 2FX6A 1P9UA 1PPCE 2UWLA 4YESB 1TRNA 2VH0A 1G30B 1PQ5A 3FOAA 2PKSB 1LO6A 2TBSA 1QTFA 1W2KH 1GBLA 1JRTA 1QZ8A 4FU8A 1GJDB 3MH6A 1KXDA 2J98A 3RXLA 2BY8X 1S84A 1ARCA 3SV7A 1EPTB 2Z9GA 3UIRA 1UW7A 5HM2A 1NRPH 2OC1A 5GPIB 1V3XA 1XUGA 1RIWB 1FUJA 1WUNH 1GDQA 2SFAA 4X1RU 1P12E 1BITA 5KEDA 1HPGA 4X1QU 1HLTH 2AERH 5C5NA 3RXAA 5K7RA 1UO6A 1DM4B 1J9CH 1ZR0A 1QR3E 3DHKH 2VWLA 3LH3A 1SBWA 1PPFE 1GHBG 1MABB 1F5KU 2Y80A 4NA8A 2J98B 1SLXB 2ZGCA 1S81A 3ZVEA 2GDDA 3NCLA 1DWCH 1HAGE 1TE0A 2FP7B 2JDID 2FOGA 3SU0A 3EGKH 1FQ3A 2XC4A 1O0DH 3S9CA 2IN2A 4MNWA 4F4OC 2O8UA 2A7JA 2BDAA 1HJ9A 3FAOA 1KLJH 1FV9A 3ZYEA 1SPJA 2ZDKA 3UY9A 1O5EH 2A5KA 2XBVA 3FO8D 3PWCA 2P8OC 5E2PA 3UFAA 1G3DA 4I8JA 1FY8E 1GBAA 1S85A 1HAVA 3EE7A 1GBDA 1B0FA 4Y6DA 3OTPA 2THFB 4ESTE 1GBKA 2ODQA 4CR9A 1QGFA 3P17H 1F0SA 2VBCA 1BRAA 3GICB 1F2SE 3GY2A 4RT0A 4ZKSU 1HB0B 1MQ6A 1SGTA 3TJOA 4P02A 1DLKB 5DSFA 2C93B 3GY8A 1K1MA 1NU7B 2Z3EA 2AMQA 3A82A 1YLCA 2FLBH 3LDXH 1EXFA 2Z3DA 4AG2A 3PLBA 4TPIZ 1XXFA 1P09A 2OBQA 1YM0A 1HAVB 3ATMA 1RFNA 7LPRA 1WQSA 8KME2 2SGDE 4XE4A 4GAWA 3H09A 5DGJA 3DSPA 4BTUB 3ATIA 1XUIA 1E37B 3TVJB 1G3BA 2VIOA 1EAWA 1DX5M 2VU8E 3D62A 3LGYA 2FESH 2K1QA 1TGBA 4TY7A 1QA7A 1Z71A 2ASUB 3QTOH 4CREA 3K65B 1DPOA 1TGNA 1B0EA 2JKHA 4FUDA 1GI2A 3FFGA 4JYTA 1F7ZA 1O34A 1TALA 1YBWA 2BQWB 2FZZA 2Z7FE 3LGUA 4YLQH 3SNEA 3SYJA 3HGNA 4WVPE 1CT2E 1C4Y2 4WH8A 2KCYA 3M5LA 3SNDA 1PPZA 1YKTA 3PO1C 2VIWA 1KY9A 1LCYA 4CH8B 1GHVH 1EFRD 1CHOF 1A3EH 1C5XB 2VGCC 1X7AC 3PMHB 4GLYA 2F83A 1BHXB 3FP7E 1D3DB 1S83A 4THNH 3FP6E 5FXLA 3SJKA 4AORA 3ATWA 4ISLA 2BXTH 5C1YA 1V2LT 3RXHA 2ZEBA 1V2UT 4ZHLU 2FOMB 1QQ4A 1EZUC 4FUBA 1IHSH 4UE7H 1AWHB 1BTXA 1FN6A 3MH4A 4O3UA 3I77A 5EW1H 4X1SU 4Z6AH 1Z6EA 1UTMA 3T26A 1INCA 3M5MA 2BD2A 3UNSA 4MNYA 1ABIH 2Z9LA 4CRGA 2BY6X 4CBOA 1O5GH 1W0KD 1TMUH 4YTAA 3PV4A 3TH3H 1CA8B 1QL8A 2XC5A 3HATH 1IQGA 2A7CA 3RUOA 1HNEE 1QB1A 1SQTA 1NBME 2PLXA 3E1XB 2A4OA 4IC5A 1ZHRA 1SMFE 1E0FD 4GVUA 3ZVFA 1C5RA 3UNQA 3BSQA 4ISIH 5C17A 1DE7H 1O3EA 3BF6H 3E8LA 1P2NA 1SL3A 2J5UA 2GV6A 3OEHD 2EQNA 1GI4A 4FUEA 2OQ5A 3QX5H 5C94A 4ZHAA 4BOHA 1C1SA 1OSSA 1KYNA 1TPSA 3T27A 3ZZ7A 1FX0B 2P16A 4AN7A 2BQ7B 1DUEA 4O3TA 1B5GH 1G36A 3Q76A 1G37A 1P2IA 1GHXH 2WYJA 3OEED 5F53A 1O2RA 1BRUP 1IQMA 3IWMA 4I8HA 1OS8A 1BJUA 2ZU5A 3RXJA 1EOJA 1MTNC 2BLOA 2FWWA 3UREA 4LK4A 1N8OB 4NGAH 2VNTA 2XBXA 5EJZA 2BB4A 3SI4H 3Q3XA 2FMJA 3SZNA 5I25A 4MVNA 2W3IA 3S9BA 4K1EA 2ZWLH 1O3LA 5JB9S 1BBRK 3SGQE 3UUZA 5C3NA 3BV9B 2PGBB 4Z0KA 5DO4H 4FETA 2GVFA 5EQSA 3KGPA 3SU6A 1IQKA 1C1RA 5B6LA 1GVZA 1ZTKA 3A84A 3URCA 3LOXA 2WV5A 1NN6A 1VR1H 3OE7D 1CA0C 4I31A 4K3JA 4Q7XA 2HOBA 3ZZ5A 2A4RA 4B74A 4E05H 2ZPRA 2F9NA 3PMAB 2A2QH 4OS5A 3BTHE 4HZHA 4WMFA 3U8OH 3F68H 4Y0YE 4UFFH 2ZU4A 1MKXK 1ZMJA 3GCOA 4BXWA 1XUKA 3M3SA 4JYVH 3MNXA 3P95A 2BY9X 1SFQB 1C2KA 2ZFTA 4KELA 2BXUH 3TIUA 2AYWA 5TCAA 3SBKA 1O2GH 2NU4E 3UWJH 3BTEE 4WXVA 2BD3A 1T8OA 1SI5H 3P8NA 2Y6TA 4WWYA 1QRZA 1C2MA 5DP3A 1H8DH 2Q6GA 2AMDA 4DIIH 3MO6A 3AAVA 2AHME 2ESTE 3SN8A 3SOSA 4A6LA 2ZCLP 4ZCNA 1SGDE 4IN2A 4JZIA 1BUIA 4B2AA 1FY4A 3A8DA 4D76A 2W6JD 2RA0A 3RXIA 1GPZA 5C2ZA 1AIXH 2QF3A 3DD2H 4DW2U 1P2OA 2VWMA 2A5AA 2WPKS 3PV2A 1SKYE 2FM2A 3DSOA 2D26C 3K9XB 3S9AA 1CO7E 1UK2A 2B7DH 2TGPZ 1GL1A 1YPLH 3SQEE 5CMXH 4IN1A 2BX4A 2ZTXA 2B9LA 1BRCE 1Y5AT 3LGWA 3W94A 2ZF0H 3SUFA 3UOPA 1DWDH 3I78A 5EPNA 1LPKB 1BMFD 2SGAA 4AFSA 4YT6H 2XC0A 1KSNA 2WPLS 1K22H 2RCEA 1A5HA 1CE5A 1NT1A 4ACBA 5CHAC 3EA8A 1O5DH 2GZ9A 2PHBA 1LDTT 3PYHA 1A0JA 1CHGA 3BTDE 3MU0A 4RKJB 2XWAA 2J95A 1YLDA 1FPHH 4BXSA 1L2EA 4MTBA 4UEHH 3L3TA 1BTWA 1QB6A 2PTCE 3CENA 1HIAA 1TOCB 4DG4A 2IOTA 2PSXA 1O5FH 4E7RG 4FUCA 4KKDA 1TX8A 1UHBA 3M36A 2J9NA 1ELEE 1ELCA 1TFXA 1QURH 1EASA 1O30A 1K2I1 3QTVH 2BVSH 4DT7B 1FIWA 2BDHA 3RM2H 2A32A 3SGAE 3SJIA 2A7HA 5B6OA 4BTTB 2QF4A 2ALPA 3C1KA 2YNAA 2KAIA 3RXPA 1O3NA 2R2MB 2Y82A 6ESTA 1DOJA 2DE9A 2EC9H 4ZAEA 1YPKH 1MBMA 2F43B 1HIAB 1TQ0B 1HCGA 3NK8A 1GI7B 1XXDA 2R3YA 1ZZZA 3BN9A 3T5FH 1C9TA 3RXFA 1UHBB 3O8DA 1C2JA 2ZO3H 1P02A 2J38A 4H6TA 3ZIAD 1YCPK 2VINA 1OKXA 1O31A 1ESTA 1E36B 1NESE 2GX4A 5T6FA 1AVWA 1ZRBA 3TPIZ 2ANMH 1F0TA 3ZZ3A 3OAAD 1LHFH 1NC6A 1GI9B 2KAIB 1FZZA 3F3BA 2ZHFH 1L4DA 1P57B 3BTGE 3ZYDA 5T1VA 3PLKA 1K28D 1GCTC 2QN5T 5FBEA 1BHXF 4OGXA 2VIVA 1O2NA 3M35A 5DP9A 3DT0H 1YPEH 1P2JA 3A8AA 3SNAA 3V0XA 1ETSH 5DKMA 1EJMA 1QBVH 1AN1E 1KXBA 1ZTLA 2RG3A 2FI4E 2JETC 3A7WA 4DJZB 1O3GA 1QL7A 1ZSKA 3QN7A 3ZVBA 4X8UH 2FODA 2TGTA 4X6OA 4Q63A 1A5IA 3SW2B 2KR7A 3N7DA 2GZ7A 1DY8A 1K1IA 4D9QA 4Q2KA 2BDBA 1UTKA 2EY4C 3Q77A 2Z6BD 2G81E 1ZMNA 2CGAA 2FI5E 2BYAX 3JZ1B 5EXLA 1V2VT 3OU0A 1C5WB 1N6YA 3BIVH 3QUMP 3NZIA 2Q6DA 3E91A 1E35B 2EI8A 2HPQH 5F6MA 1Y59T 4MPXA 2OD3B 2Z9IA 4JZFH 4X6MA 1W0YH 1ZYOA 1IOEA 1C1OA 3ENSB 2ANYA 4MPWA 1THPB 1BIOA 1AB9B 1E1RD 1MAXA 2FOCA 1DLEA 1EAIA 3M7TA 5EPYA 1MTUA 2XNDD 3F9EA 2BDYA 8GCHG 4ASHA 3SZEA 3SJOA 3RXSA 2ZQ1A 2QC2A 4LOYH 4TYDA 1RJXB 4X6NA 2QV1A 3SHAH 1SC8U 3GDUA 3TK9A 5GIBA 3ZZ4A 3KEEA 1UTJA 1V2MT 2ZP0H 4LXBH 2KCAA 4LZ1H 1YCPM 1TRYA 2XBYA 3E3TA 3M3TA 7ESTE 4B2BA 2H9TH 4X6PA 2VWOA 2FS8A 3I29A 3CS0A 2WPDD 2VB0A 1VITH 2PKAA 2YMSD 4DT4A 1PPGE 2FX4A 1TBZH 2ZI2H 4CH2B 9ESTA 3TJUA 3ZZ8A 2GZ8A 2ZDMA 2BLQA 2VIPA 5I46H 4SGAE 3RU4D 2TGDA 2GCTC 4AYVB 1MZAA 3LC5A 1AO5A 4OS1A 1G3EA 1MU8B 1O2XA 2R3UA 5EXNA 1N6XA 2A4GA 3B9FH 2GKVE 1WCZA 3OFND 1FIZA 1VJAU 1O3JA 2CN0H 1ZHMA 3GY4A 2PKAB 3T28A 3BG8A 2HRVA 4BNRA 2BDGA 1YWUA 1UTQA 5IYTA 1EAUA 1SLVB 3W1EA 3TJNA 1K1JA
chains in the Genus database with same CATH topology
5FX5A 1NZQH 3KNXA 3Q3KA 1MCTA 2VGCB 3OTJE 4AFZA 4I32A 4Y11E 1IQEA 3UB0A 1GBTA 3KN2A 4ZKRU 3U1IB 3ZVAA 1FMGA 3EYDA 3VGCC 2YMSC 5F03A 1JOUB 3HK6B 2A45B 2WV9A 5TCCA 4AFQA 1QRXA 4UD9H 2CHAC 4TY6A 2XNIA 8GCHF 5EQRA 1M9UA 2Y5FA 1EB1H 1YPGH 1CHOG 1TRMA 2ZFPH 3AVZA 3FZZA 3ZZAA 1H9LB 1GI0A 3FP8E 3LPRA 1WV7H 3ELAH 3VB7A 1A46H 1KLIH 1L1NA 4TT3D 2Y7ZA 2ODYB 1L1JA 1Y3VA 3RC4A 1GBEA 2ZGBH 1PQ7A 3F2FA 5TJXA 4FU9A 1QJ7B 1SLUB 4IC6A 1JMOH 3GDSA 5DP8A 5A09A 2YNBA 1SFIA 1HAXB 1AFEH 4I8GA 4D7FA 1BTUA 3PWBA 4FU7A 1AVGH 2BZAA 1BTZA 1O2TA 7KMEH 1UTLM 2ZQ2A 4K60A 1K1NA 5DJ7A 3TGKE 1QA0A 3SJ9A 4B75A 1LHDH 3D49H 5GDSH 3SO3A 1YF4A 2P3UB 1Y3UA 2BZ6H 2ZHDA 1W11U 4PROA 1W0JD 3VB6A 1SLWB 2FYQA 4B2CA 2AMPA 1IQLA 5EQQA 5F8ZA 5LPFA 2YOLA 4TWWA 3Q3YA 4NWLA 4F49A 4SGBE 3MYWA 1QB9A 3UQVA 2GMTC 1GDUA 5BRRE 3RLWH 5E8EH 1OPHB 3P92A 1C5ZB 3TH2H 4K2YA 5A2MH 1F0RA 1O2QA 1C2LA 4AFUA 1MTNB 1Z1IA 4RN6A 2EEKA 1D4PB 3VFEA 2LELA 4OM9A 6CHAC 3MU5A 4YXWD 1EUFA 1GMHG 1OHHD 4HTCH 2OC7A 1MCVA 1KXAA 5CHBA 5HGGA 1KXCA 1NS3A 1GWAA 1Z6JH 2OTVA 1O3MA 3MTYA 3SNCA 1VGCC 1C2IA 4FXGH 5C1UA 1O2LA 2O9QA 1C5YB 2STBE 4FUFA 4U32A 1AWFH 1YPJH 1F5LA 1LKAA 1O2KA 4ZH8A 1GJ5H 1Z1JA 1C4V2 2AIQA 2ZHQH 4WMDA 2VH6A 2QIQA 1Y3XA 5K0HA 2B8OH 1DXPA 3A88A 3P6ZB 4KGAA 1ETTH 1NRSH 1AUTC 4NIYA 4E7NA 4WJG2 2FDAA 2ZDNA 4CRFA 2L6OA 1HXFH 2ANKH 1IAUA 1S82A 3CP7A 3OY5U 4CHAB 1EOLA 1SGRE 1ZGVA 5HKKD 1O3OA 1TGTA 2QXIA 5T3HA 1EATA 1O2JA 4J1YA 3VB5A 1HAYB 1EPTC 5FPYA 1TMTH 1NM6A 5AF9H 1NFXA 2G5VA 3MU8A 4NSYA 3U8RH 1EKBB 1GJBB 1ELTA 1WU1A 4JK5A 5T6GA 1RIWC 2HNTF 3SV6A 1C1TA 1JRSA 1V2RT 6LPRA 2R9PA 1THRH 1TONA 1DSUA 3S0NA 4ZUHA 3EAJA 3ZV8A 2F9PA 4DY7B 1C2GA 3A85A 2ZFRH 4KP0A 2VVVA 3H7TA 1SSXA 4RSPA 2OCVB 3F9HA 2Y7XA 2BX3A 5GCHG 1Z8JB 1FY3A 1T4VH 2IPHA 5H4IB 1C2EA 5F8TA 3QGNB 5E2OA 1BBRH 1UTPA 5DG6A 4O03A 1VJ9U 4UFDH 1TPOA 2CV3A 1NO9H 5G4BA 6GCHG 1H1BA 1V2KT 1EZSC 2R0KA 3BTKE 3RMOH 2BD7A 4TPYA 3F0OA 1C5MD 2CF9H 2GT7A 1QFKH 2G51A 1A3BH 2GD4B 2OC0A 4CR5A 3KQCA 3BTME 2W26A 2ZZUH 1D9IA 1OWEA 1PQAA 4YZUA 4ZMAH 1SQAA 1GMHF 2C8ZB 1DANH 2STAE 1HXEH 4UFEH 2FXRA 3MNSA 2PUQH 2SGQE 5JBCS 2QYIA 4X2VA 2ZGHA 1OYQA 4K1TA 1MKXH 1Q3XA 5DP5A 7GCHG 1WAYB 1Y3YA 2OXSA 5A0CA 4ABAA 1GG6B 5DP7A 4BAOB 3SGBE 2ZGXH 1GBHA 1MBQA 1PFXC 1TNLA 2GCHG 4ABGA 4J2YB 1BMNH 5EODA 1HFDA 3N99A 3GY6A 1NRQH 1V2WT 3HKJB 2DE8A 4U2WA 4A1XA 4ABBA 1ELDE 1QJ1B 3C27B 8ESTE 5JPMH 3WWFA 1F5RA 2WINI 1O3DA 1ANDA 2ZC9H 4INHA 4X1PU 3A87A 3SQHE 2FOEA 2F4LA 3O8RA 3KCGH 1COWD 1AFQC 3RXGA 3UR6A 2A1DB 1ANBA 2NU3E 1W10U 2FIRH 2Z9KA 3AW1A 2OP9A 5JDUB 4NIXA 3T29A 1SGQE 2BMGB 1O3BA 1RTLA 3TLOA 3T62A 2TRMA 3F2HA 2AFQB 3MO9A 2V35A 1HV7A 2BLVA 4X2WA 3UTUH 1K1LA 5A8XA 3RXQA 3A8BA 2QE7D 1MD8A 4Q80A 1NY22 1ZGIA 2ZU3A 1O3HA 1FONA 2ZTZA 1YC0A 1AZ8A 2JJ2D 2WV4A 4K1SA 3BTQE 2FI3E 1O2YA 2NU0E 4XDEA 2TIOA 5GCHF 3DCLA 4VGCB 2NU1E 4YO9A 1KXFA 1O2SA 1GI3A 3A7XA 1W13U 5C5OA 1YP9A 1OXGA 1C5UA 2O8MA 1GI5A 3MH7A 4IW4E 2ZHEH 6GCHF 2ZPSA 2C90B 3GY7A 1P10A 2JETB 1HJAB 4U01A 1QQUA 1AQ7A 1A2CH 2B0FA 3AW0A 2HNTE 2ZDAH 2QXHA 1J17T 1BTHH 1G32B 1LVMA 2R0LA 2F9UA 2ZPQA 2EI6A 3MO3A 4CRAA 4A92A 4FUJA 2SNWA 1K9OE 3M5OA 2K8IA 4R8TB 1OWDA 5C0TA 2Z9JA 1A1RA 2M5TA 2A4QA 1K1OA 1TPAE 2IJOB 1T4UH 1P2KA 1EX3A 4Q7YA 3N7EA 7GCHF 1P01A 2A2XH 1ELBA 2I6QA 1C1WH 1EAXA 1TLDA 2BOKA 1O3IA 3ATKA 1ZPZA 1YCPH 5A0AE 2W5EA 3PB1E 3VEQB 2GCHF 3U98H 2HLDD 3GISB 1C9PA 4Z1MD 4XBCA 2P3FH 1NRRH 4K8BA 1FNIA 1GI6A 2EA3A 4IBLH 2J92A 1W8BH 1A61H 1O2WA 5L6NH 1BQYA 4JK6A 4AX9H 2PTNA 2ZNKH 2CK3D 2IJD1 1RXPA 1ZMLA 3BEFB 1ESBA 1OYTH 3N7OA 3URDA 4JZEH 1G2LA 2G52A 1CSOE 1V2PT 4OS4A 1GJ9B 2WPIS 2BVXH 2WPJS 1DS2E 1LPZB 3MU1A 1V6DA 3TK6A 1GJCB 1O39A 1ESAA 1PPBH 1IQJA 1ANEA 3LONA 1C2FA 1DWBH 4AZ2B 2WUCA 1BB0B 2GDEH 3R0FA 3BG4B 2O8LA 1T31A 1AE8H 1FI8A 4B76A 1GJ6A 1O5BB 1W14U 1BMMH 3BEUA 2ZU1A 4XSKU 1QNJA 2OBOA 5L30H 5JYIA 1E34B 1WXRA 5LH8A 1GGDB 3BTFE 1O32A 1N8OC 1PJPA 2FTLE 4H6SB 1RTFB 4B71A 3LGIA 1NFYA 4JZ1A 1FPCH 3GYMA 2PV9B 2QGRA 1SB1H 1BA8B 2UUYA 1O3FA 1O38A 4GHTA 2VVCA 1EZQA 2UUJB 1LHCH 1O2IA 4ISHH 4FVDA 2EI7A 4Q4LA 1BTPA 3EA9A 4CRBA 5HYOA 1BJVA 1D3QB 3SI3H 2XW9A 1D6RA 1DVAH 2BVRH 5FCRA 4O97A 5E0JA 1P2MA 9LPRA 1NBMD 2HVXA 3RXKA 3A7ZA 5AFYH 1DSTA 4F55A 2UUFB 2UWOA 1GHWH 1O2MA 1RRKA 4YM9A 4ABDA 3E16B 5EXMA 4ABHA 1OP0A 1P3CA 1UVPA 2ZDVH 4U30A 1O2OA 1O2PA 5LGOA 1TYNA 2ZDLA 1FAKH 2VVUA 3UPEA 3SU1A 4YLUA 1HAOH 3VGCB 4D8NA 2TPIZ 2B5TB 1VCWA 1HAHH 1XKAC 3M7UA 3VB4A 2FYRA 2XCFA 4YOGA 3RXBA 1E38B 4B73A 1AZZA 2CHAB 3SHCH 3V13A 1W0ZU 2JH6D 4BANB 5C20A 3RC5A 3ZZBA 2M2AA 2ODPA 1NPMA 4Y7AA 4NG9H 2WSSD 3LJJA 1O2UA 1HAZB 2CF8H 1RGQA 1J8AA 1PQ8A 4NIWA 1SGEE 4MNVA 3SU3A 1LMWB 1Q31A 4MNXA 3BIUH 4DCDA 1FN8A 1LTOA 4INLA 2AGIX 4AYYB 5FCKA 5IDKA 1GBBA 3KHVA 1MU6B 3O8BA 2P8OB 4X8TH 1C5OH 1IQIA 1GBFA 1GJ7B 1BMLA 4X2YA 2V3OH 1A5GH 2J94A 3QK1A 3D65E 3F1SB 3SUGA 3PMBB 2FTMA 4GPGA 2NU2E 1QRWA 1J14A 3ITIA 3UR9A 2Z94A 1TA2A 1LVYA 1HDTH 4DURA 1OWIA 2A31A 1AU8A 2W7SA 3TU7H 2ZFFH 2R2WU 4WH6A 1XVOA 4AB8A 1TGCA 3QLPH 3E0NB 1UVUH 1TWXB 1SGCA 3SU2A 1KTSB 3TK5A 5E0GA 1QBNA 4Y10E 4IMQA 1BOQA 1UVTH 3ZZ9A 1TGSZ 3DFJA 1AGJA 3W95A 5SGAE 4YT7H 5GWZA 5FHTA 2WHXA 2UUKB 1SHYA 1GL0E 5FBIA 3QWCH 2G8TA 3GCHC 4MQAA 3RU4T 1P06A 1Z8RA 1C1VH 4JZDH 3ZZ6A 1DITH 3A7VA 3A86A 2W3KA 3SORA 2SGPE 1C1PA 1NROH 1RTKA 1JXPA 1GHAG 2AEIH 2FS9A 1LHGH 1UCYE 2ZCKP 5LPEA 3HGPA 3DFLA 3QZRA 1HBTH 3PTBA 5FPSA 1GJAB 1EQ9A 3KQEA 1KIGH 2QAAA 2D2DA 1CGIE 1NTPA 1OX1A 1ABJH 2Y5HA 3S7KB 3KIDU 1VITF 3GCNA 5ABWA 3RMLH 2Q6FA 1BZXE 4TWYA 1WOFA 4JYUH 2SNVA 1O3KA 1WBGB 3PO1B 3VXFH 1ETRH 4OS7A 4ABFA 1FY1A 3FANA 5ESTE 4O9VA 5EU8A 2H5CA 2BOHB 3F9FA 1GI1A 2AH4X 3ZVGA 1F0UA 1J16A 5C67A 3UOUA 1H9HE 4GSOA 1Z8GA 5C1XA 3NRLA 4ZROA 3LKWA 4ZKOU 1BT7A 1TB6H 5L2YH 3S69A 2QA9E 3VPKA 5CDFE 3MNCA 1ZPCA 1C5LH 3B8JA 1P11E 1ZJKA 1VCQA 1L1GA 3PLPA 1ZHPA 2ZHWH 3SJ8A 1GDNA 2HNTC 1TX7A 1SHHB 2QF5A 3DA9B 1MAYA 3M61U 1S0QA 3P8GA 2O8WA 3VG8A 1PPEE 2XYAA 3JZ2B 1XX9A 2VIQA 4HGCA 2KZ4A 1HYLA 3FN8A 1DICA 4BAHB 3NPSA 4ISNA 1C5VA 3HKIB 1CGHA 2C4FH 1GJ4H 4NA9H 1S6LA 1TNKA 4X2XA 2J34A 3PROA 1MD7A 4BAKB 1CQQA 1ZOMA 1QL9A 1QY6A 3MWIU 1AB9C 1S0RA 1IQNA 2XBWA 3RMNH 1YPHE 3ODFA 1TNJA 1GVLA 3HK3B 4IS5A 1QIXB 4BAQB 1KDQA 1T7CA 3OX7U 1TPPA 2C8XB 1GHYH 1EJAA 1XUHA 3KF2A 4GCHG 5A8ZA 1GHAF 1AMHA 1W7GH 3H7OA 2JH5D 2ZFSA 1C5NH 2VWNA 2FPZA 3BEIB 1XVMA 1C5TA 2D8WA 2PFEA 5ESBA 1V2ST 1RS0A 5J4QA 2V0BA 1TIOA 3T2NA 1GMCG 2XWBI 2XOKD 1DXWA 1O5CB 4I33A 1CBWC 3MI4A 5ETXA 1P04A 5JBAS 1S6HA 4I8LA 1QJ6B 2F9VA 1A0LA 5C0UA 1Z8IB 2ZKSA 4I7YH 2G4UA 3RXCA 1O3CA 4CRCA 1KDQB 2GV7A 1V2JT 4FUGA 2AGGX 1JBUH 3E6PH 1KMHB 3U8TH 1AFQB 3UNRA 1ZSJA 4E06H 4GHQA 4NFFA 1FXYA 2BDCA 1DDJA 3A89A 2OQUA 3F6UH 1C4U2 3SUDA 1IQFA 5LPRA 1OP2A 1CA0B 1WTHD 3VB3A 2Y5GA 3MNBA 1W7XH 4D7GA 3V3MA 1ELAA 2BY7X 1TBQH 3EDXB 2PKSC 4OS2A 3U1JB 1AUJA 4DIHH 3T25A 3A8CA 3OYPA 3MMGA 1A7SA 3EE0B 1AE5A 1SOTA 4ABJA 1GHBF 2BTCE 5FX6A 3SV2H 2H5DA 3DUXH 1LQDB 2WPHS 3MH5A 2FO9A 3RP2A 3WY8A 1UJ1A 5EG4A 4KTSA 1TBRH 1TOMH 2OC8A 1H9IE 3U69H 1C2DA 5HXFA 1MUEB 3RXUA 3NUMA 3TH4H 3STJA 1HJ8A 3U9AH 1FLEE 1ELFA 1KTTB 4B6FA 3A83A 3BTTE 3PMJA 5E0HA 3WWBA 3SU5A 2PW8H 1P2QA 1XM1A 4NCYA 3LT3A 3S7HB 1TNHA 1T8LA 2PR3A 3VXEH 1UVSH 2AIPA 1K21H 2ZG0H 3UWIA 1Y5BT 2SGEE 3NWUA 4DGJA 1UMAH 4GCHF 1WSSH 4X8VH 3P70B 1LQEA 1N1LA 4LZ4B 3B23B 1BRBE 4H4FA 1ACBE 1E79D 3LGVA 2FOBA 1ZPBA 3NKKA 3SU4A 4RKOB 3RXMA 1U6QA 2ULLA 3G01A 3KL6A 1GBJA 1MTVA 4X1NU 2HWLB 3SUEA 5CHAB 1H8ED 1GMCF 1MKWH 1TABE 2QXGA 4XFQA 4A1VA 2GT8A 4AB9A 1A4WH 3E0PB 1O2HA 4UDWH 3QZQA 1Y3WA 1HAPH 3D23A 2JJ1D 1ZTJA 1DWEH 4IMZA 4OS6A 3SV8A 5J4SA 1SGYE 4INKA 1D6WA 2PUXB 1TAWA 1V2QT 1P9SA 3AASA 1T8MA 3MFJA 3TNSA 1ORFA 1GBMA 4AGKA 1H4WA 2Z3CA 2BQ6B 3EA7A 2FOFA 4ABIA 1JIMA 3AK5A 1WYKA 2J4IA 5A0B<