4KTCA

Ns3/ns4a protease with inhibitor
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
175
structure length
175
Chain Sequence
APITAYSQQTRGLLGCIITSLTGRDKNQVDGEVQVLSTATQSFLATCVNGVCWTVYHGAGSKTLAGPKGPITQMYTNVDQDLVGWPAPPGARSMTPCTCGSSDLYLVTRHADVIPVRRRGDSRGSLLSPRPVSYLKGSSGGPLLCPSGHVVGIFRAAVCTRGVAKAVDFIPVESM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Serine protease NS3
publication title Discovery of Danoprevir (ITMN-191/R7227), a Highly Selective and Potent Inhibitor of Hepatitis C Virus (HCV) NS3/4A Protease.
pubmed doi rcsb
source organism Hepatitis c virus (isolate japanese)
total genus 40
structure length 175
sequence length 175
chains with identical sequence C
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2013-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02907 Peptidase_S29 Hepatitis C virus NS3 protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4ktcA02
2.40.10.120 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 4ktcA01
5C5OA 4Y8YA 3PV5A 3EYDA 5H4IB 1AFEH 3FFGA 1BMLA 1RTKA 4Z0KA 2R3UA 1O2RA 3MFJA 2PTCE 4ASHA 1A0HB 2ZFFH 1TIOA 3LGVA 3TJOA 3UNQA 1SGYE 1PYTD 1HYLA 3ATKA 4O03A 4B76A 1TRYA 2C8ZB 5A0CA 2ESTE 3SU2A 3KQEA 2IPHA 2Y5HA 1G30B 1GJBB 5AFYH 4X6PA 3DT0H 1O3EA 2GCHF 4YESB 3UNRA 1GL1A 2F9NA 1SGTA 4E06H 1E35B 3ZVGA 2J38A 1Q3XA 2VGCC 1QA7A 1F5RA 1HJAC 3LC5A 1TA6A 1UMAH 1D3PB 1O2UA 4X8TH 3VXEH 1QY6A 5DK1A 4ABEA 5I25A 1SR5C 5DO4H 1W2KH 2OINA 2Y82A 1ABJH 3ZZ5A 1KLJH 4TWWA 4DCDA 4MDSA 6CHAB 2BMGB 3DUXH 1AB9C 1GGDB 4ZH8A 4BNRA 2GZ9A 2OP9A 2F9VA 1MBMA 4O3UA 1GI3A 2C8WB 4FVDA 5T6FA 2CGAA 2CHAC 1S82A 3RMMH 3HKJB 3EA8A 1AGJA 2P3UB 1YYY1 1TNJA 1O3BA 1O3FA 2OK5A 1FZZA 1PQ8A 2FMJA 3LJOA 3MNSA 1S5SA 5CHAB 5CE1A 1FMGA 1Z8GA 2ZA5A 3U8RH 3RXLA 3ENSB 3QUMP 3N7OA 5HYOA 1C5NH 3Q76A 4ISNA 1QIXB 1W13U 1ZTJA 2AEIH 2ZFSA 4YT6H 3ZVDA 4UD9H 3LONA 3AW0A 2AIPA 4AFSA 1PFXC 1QRZA 3MNBA 1C4V2 3KQCA 1EOJA 5DKMA 4AG2A 3UPEA 2GZ8A 2GD4B 1O5EH 2XCFA 4H6TA 1LO6A 4TY7A 3SUEA 1EAXA 1A3EH 1FQ3A 1QR3E 5GWZA 1C1OA 3KL6A 2ZHFH 1HRTH 4I8KA 1A1RA 3UWJH 1LHCH 5FX6A 4H4FA 1DPOA 1XMNB 2EI8A 1NN6A 2K1QA 4K8YA 3F9GA 4IC6A 1C2LA 3TNTA 1KY9A 5E0HA 1Z1JA 3K9XB 1QCPA 3ESTA 1Z7KA 2A32A 2YNBA 3SN8A 2ILNA 3A8BA 2ZGJA 1SGFG 1TPSA 4WMDA 1TPAE 3ZZDA 2HVXA 1DY9A 5GDSH 3M5LA 1AFQC 3HATH 4X0WU 5ESBA 1TGSZ 1ZLRA 2SGDE 5DG6A 3SHAH 1XUGA 3TGKE 1CT0E 3HPTB 1O3NA 3P17H 5IYTA 3UR9A 4X8UH 1O37A 5I46H 1TYNA 2EI7A 3A7VA 2HALA 1P9UA 2XBVA 1GHBG 3T29A 4MPVA 1EAWA 1MU6B 1EB1H 4GHQA 3VEQB 1TGCA 1BTWA 3DFJA 3UQOA 9ESTA 3M37A 3T27A 4DT7B 1GI9B 2ZU5A 3RMNH 3E1XB 1TQ7B 3T25A 5J4SA 2ZGXH 1FLEE 1QL7A 1OWIA 1BMAA 2FO9A 3BTHE 1XKAC 2Y7ZA 1CBWC 1YM0A 3LOXA 1RIWC 1E34B 1ESAA 5HXFA 1SGQE 1DY8A 4WXIA 3QGNB 3RXTA 3S7HB 3T26A 2G55A 1THRH 1UK3A 5AHGH 1QB1A 2A31A 1ELFA 3ZZBA 1HGTH 2P59A 5JBAS 1H4WA 1O3OA 3SZEA 1GHBF 3RXEA 1NROH 2PKSB 3VPKA 3NXPA 1B5GH 1C9PA 1V2UT 1MTVA 3PMHB 3SNEA 5GIBA 2VNTA 1P06A 2QN5T 3B23B 3HGNA 1ANBA 5A0AE 2ZFRH 3FP6E 3E16B 3OY5U 2HPPH 1M9UA 4NIXA 2WYGA 1BJVA 1HAXB 5BPEA 3ZZ7A 4Y0ZE 2QF0A 3DHKH 2C3SA 4CRDA 1IQKA 3AK5A 2UWPA 3Q3YA 1UVSH 2DUCA 2CF9H 3ZVEA 4BOHA 1LVOA 1OOKB 1YPMH 2XC4A 2GCTB 5JBBS 4BTUB 2SGPE 1ETRH 2NWNA 1UVTH 1LHGH 2F83A 4TPIZ 3UFAA 2GVFA 2VWOA 4Y7BA 1D4PB 1C1QA 4X8VH 1NTPA 4NG9H 3MU4A 1WUNH 1O2GH 3SU5A 4M9FA 1HAOH 1GDNA 1QBOA 3TNSA 1IQLA 1CE5A 3DD2H 4IN2A 3VGCC 1ZMNA 1C1NA 1HLTH 1MUEB 2BDCA 3M7QA 3WY8A 1IQGA 1FPHH 3TITA 2G52A 1EXFA 2GMTC 4FU8A 1KSNA 4Y0YE 1B0EA 1C5ZB 1CA8B 1ZTLA 2FS9A 1SMFE 3AVZA 1DUEA 1EZSC 4Q7YA 2Z9LA 1ZZZA 3BTGE 3A7ZA 1NU7B 1GJ7B 2BDGA 2HNTE 1EPTC 2PKAA 1WTHD 4X2YA 1DICA 1V6DA 1WAYB 3BG4C 1MKWH 4Y8ZA 5DP7A 4WWYA 1L1GA 3P70B 3U9AH 1TBZH 1SGFA 3RUOA 2VINA 1QNJA 3GY6A 4LZ4B 1TAWA 4I8LA 5B6LA 3GISB 2YNAA 1T7CA 1C5UA 3LGTA 5T6GA 2FM2A 1UCYE 1MD8A 1O2TA 2OC0A 3UREA 5C3NA 3S0NA 1GCTB 4GAWA 1C1RA 4TYDA 2QY0B 1RD3B 3K6YA 2WUBA 5EPNA 3D49H 2O8WA 4GPGA 3A83A 4CR5A 5HMAA 3SOSA 1GI5A 2R0KA 2TGAA 5FPSA 3ZVFA 1ZMLA 1D9IA 1GL0E 1LTOA 2ZGCA 1KXAA 1RTLA 2AYWA 3STIA 5EXMA 2ZTXA 2BX4A 3GCHB 1GBTA 3FP8E 1SGDE 5C2ZA 3F9FA 1TOCB 5LGOA 1DWEH 1HAVA 2O8TA 4SGAE 5JYIA 2AMQA 1JWTA 1VITG 4JCNA 3PO1C 3RM2H 5EU8A 2Z3CA 2QF3A 3BEUA 1O2ZA 1PQAA 1FIZA 4B1TA 1O5FH 1LVMA 1W7XH 1UK4A 1EATA 1O3IA 1DX5M 3AAVA 1OYTH 2ZCHP 2BLVA 1TX8A 1P2MA 2QV1A 1V2LT 1O2LA 2R0LA 1QHRB 3B8JA 2A2XH 1WCZA 1VJAU 2BTCE 1L0ZA 2Z9JA 2FOEA 1ZTKA 4R8TB 2AERH 3HKIB 1S6HA 1MH0A 3GY7A 2BQWB 2F9OA 3SU6A 3QO6A 5JBCS 1VITF 4B6EA 2ZP0H 2BB4A 3BTTE 3KQBA 2OXSA 4K1EA 1P8VC 1ZHRA 1ABIH 2AGGX 4FUCA 3SNDA 1GI8B 2Z7FE 3RXDA 4B2CA 3Q3XA 1D6WA 5G4BA 4A5TS 1O39A 5A8YA 4MNXA 4MPUA 1MKWK 1TPPA 5L6NH 1TGTA 3VB7A 1PPBH 3M3TA 3P8GA 1A46H 1NM6A 1FDPA 5C1XA 2EI6A 4JZDH 1DSUA 3VXFH 5T6DA 1W14U 2ZHWH 4A1VA 4TPYA 4MVNA 4THNH 5EODA 3QLPH 4RN6A 3ZZ3A 2PSXA 4INHA 1C5OH 1FAKH 2Q1JA 1NRNH 2FOHA 1BBRH 1J14A 1P3EA 1D3TB 1HAVB 1HBTH 1AQ7A 1YKTA 1SLUB 1B7XB 3FZDA 2WV4A 4FUDA 1SHHB 1QTFA 1O2QA 2BDAA 1CU1A 1O3AA 5C1YA 4X8SH 3QDZB 3I77A 1SFIA 1ELCA 2H9EH 4J2YB 1TRNA 1CT4E 3GCNA 3SNAA 4NFEA 1SGPE 5K0HA 1MZDA 3RXOA 1O2PA 4VGCB 3VFEA 1ZSJA 5C1UA 1FY3A 2OD3B 1AUTC 3Q3KA 4AGKA 1YPJH 1RS0A 2GV6A 2ZGBH 4UDWH 3RXKA 1TRMA 2B0FA 1DE7H 2G51A 1MTNC 1QJ7B 3VB6A 1IQMA 1GG6B 1BA8B 2GT8A 2UUFB 4B2BA 4FU9A 1TGBA 1EASA 1G37A 4GSOA 4MPWA 2P16A 1WQSA 3RMOH 4Q80A 1LHEH 4JYVH 1UVOA 1LCYA 2FPZA 2DE9A 1C2KA 4D76A 3BN9A 1C5RA 1TMBH 1HAHH 3I29A 3FAOA 2G00A 4I32A 8LPRA 3TIUA 1ELVA 3MWIU 2A5KA 4ZUHA 3GY8A 2W26A 1MAXA 1AVWA 1QJ6B 2ZFTA 2ODQA 3TJUA 1EAUA 1ETSH 1V2RT 5JDUB 4AZ2B 1L4ZA 1ELDE 1O2OA 3QZQA 1OWJA 1DXWA 1N6YA 1GBMA 5DP9A 1VGCB 1P05A 1P10A 2J95A 2PLXA 4XFQA 5JPMH 1GBEA 3A8CA 1GHWH 1KYNA 1ZR0A 3E90B 3AAUA 2ZDLA 1S0RA 2QGRA 1NRQH 4ABAA 3BIVH 1TA2A 1LQEA 3A8AA 3P8OA 3RMLH 1GMDG 3MU5A 3KNXA 1BTZA 3V7TA 1BBRK 3MO3A 1QQUA 2O8LA 3PM3A 2OC1A 1Y8TA 5DP5A 1Q2WA 2A1DB 1ELTA 1H9IE 1NC6A 4X6NA 1RRKA 1LDTT 1ZHMA 1K1PA 2W3IA 3NUMA 1WBGB 2BHGA 4GVUA 1SGRE 2P8OB 5BRRE 2BQ7B 4LOYH 3MO6A 4UFGH 3V12A 4FU7A 3UOPA 4D9QA 3STJA 6LPRA 2RA3A 2J4IA 2P93A 1IQFA 1FUJA 1GMDF 3SHCH 1DITH 3GDVA 1C2GA 1QGFA 2HPQH 3L33A 4XSKU 1AZ8A 3QK1A 1JOUB 3OSYA 3RXQA 2FOGA 1P2KA 4J1YA 1GJ4H 1TE0A 3SJIA 1J9CH 2ZHQH 4ZHMU 3L3TA 3O8DA 1KXEA 1C1UH 1T4VH 2FP7B 2C8YB 1NZQH 2O8MA 2UUJB 3HK3B 1KLIH 3SV8A 7ESTE 2WYJA 2ZIQH 2BYAX 1NS3A 1V2OT 2ZWLH 2FI3E 3MU0A 1AU8A 3RXVA 2AMDA 1V3XA 2OC8A 2J9NA 1N1LA 2ZU2A 3SGAE 4X1SU 4AOQA 1AB9B 1H9HE 4QT8C 3A8DA 1MCTA 1FAXA 1BUIA 1LVBA 2ASUB 1GJ9B 1EQ9A 2A4RA 3RXUA 3BEFB 1V2ST 3QN7A 1AVGH 4GUXA 5E2OA 3OTJE 1YF4A 2HLCA 2ZGHA 1EJNA 3P8FA 4B71A 1DSTA 1ESTA 2ZTYA 2F91A 2ZHEH 3V3MA 3RXHA 3SI4H 2QXJA 3H5CB 4XOJA 2FS8A 3P8NA 2VB0A 3MU1A 2OUAA 5EOKA 1XX9A 3S9BA 1YPGH 3EA9A 3H7OA 3KEEA 2A7JA 1O2MA 1T8OA 3RU4D 3SU4A 4ISOA 3RC6A 4X1NU 1C5MD 2GZ7A 4K69A 1NO9H 2Z94A 4DY7B 3PWBA 2DE8A 2Z9KA 1ETTH 1EZUC 1P11E 1GBIA 1MCVA 1OSSA 3OYPA 4A92A 2XTTB 3T2NA 4A1TA 1Z6EA 1ELEE 1XUKA 3M36A 3TH4H 4B75A 5GPIB 1MQ5A 1ZOMA 4WMFA 4YTAA 3SU1A 2WHXA 1P0SH 4MTBA 1EOLA 3RXCA 2HNTC 2B7DH 4MG3A 2A45B 1MKXH 1O3JA 4UE7H 4CR9A 1O3PB 4RKJB 2VIQA 1C5WB 4IGDA 2JETB 3E0NB 1IOEA 1LHFH 2OC7A 3PLKA 4K3JA 1Z71A 5FBEA 3PYHA 3M35A 3SZNA 1C4Y2 1GGDC 1BRBE 3UR6A 4NA7A 1S84A 3BG8A 1DS2E 1MMJN 4CBNA 1YLCA 5FHTA 1MTUA 3S7KB 5GXPA 1YCPH 1D3DB 1O2XA 2PGBB 4RSPA 3AW1A 1AHTH 1UTQA 2OBOA 4CHAB 1MZAA 4WY3A 3OX7U 1CHGA 6ESTA 1Y3YA 2PV9B 1TFXA 3M5OA 5DP6A 1RIWB 2XWBI 1NFXA 1G36A 4XBBA 1UTPA 1IQHA 2QC2A 1EUFA 1HJ9A 1K2I1 3U98H 1FN6A 5FPTA 5TCCA 1TOMH 1AKSA 1T8LA 1Y5BT 4Q7ZA 5F03A 5LPEA 2SGQE 2FTLE 5FAHA 3LPRA 4YO9A 1GBJA 3A80A 4AORA 2BOHB 1C5XB 1T31A 2I6SA 2IJD1 3RLWH 2V35A 3UTUH 3TH3H 1EPTA 1EZXC 3ZYEA 4Q2KA 2XBWA 1NFWA 2ALPA 1AVXA 4NIYA 2ODPA 5ESTE 2P95A 3RC5A 1DANH 3L6PA 4WVPE 2XCNA 5LPFA 1CGJE 3GY4A 4DW2U 1C2EA 1HB0B 5E0JA 1V2JT 3UNSA 3LGYA 1P9SA 3O8BA 3GDSA 3ZZ4A 2PUQH 2Z3EA 1H1BA 1K21H 2FYRA 3SUDA 4I8GA 1HUTH 2VJ1A 1VZQH 1ZPZA 1MKXK 4KKDA 4LK4A 3PTNA 4MLFB 1S81A 1AMHA 4OS6A 4ZKNU 1P2OA 1VJ9U 1UVPA 3NPSA 1V2WT 1CGHA 5FCRA 1YPHE 3QTVH 2VBCA 1MTWA 3SNCA 5L30H 2BD9A 4BAKB 2B5TB 3SJKA 4B74A 3PMJA 2BD3A 1W7GH 2SGFE 4CRBA 3SV2H 4ESTE 1ESBA 1QJ1B 2CF8H 1YPKH 3MYWA 1TNGA 5GJ4B 2VWNA 4OS1A 1P2JA 1YCPK 1AKSB 1HNEE 2P94A 1XVOA 3S69A 3KHVA 3E91A 2ODYB 1PYTC 3ELAH 1C1SA 5ABWA 4RI0A 4AGJA 1ANCA 3PTBA 1EPTB 1CA0C 1UTOA 3BG4B 4YOGA 1P2NA 2F9PA 2VIDA 1ELAA 5HGGA 2R3YA 5DP3A 2FDAA 1S83A 2TBSA 4Y6DA 3A89A 1DUAA 2BVSH 2BY7X 5GCHG 3RXSA 1KTSB 2Y81A 2BDHA 1CO7E 4YOJA 2OQUA 4F49A 2EEKA 4PROA 1UO6A 3UUZA 1FJSA 1H8IH 1BDAA 1C2DA 1W11U 2ZFPH 3FANA 5C67A 1FIWA 3BV9B 4FUJA 1P04A 2ZKSA 3URDA 1KTTB 1J16A 2V3HH 1AZZA 4OS2A 3RXPA 2GCTC 4X1QU 3M3SA 1IQIA 2NU0E 1RTFB 2SFAA 4U30A 1Q31A 1NU9A 3ZVCA 3R3GB 1GMCG 5GCHF 1KXFA 1YC0A 2GDDA 4JK5A 2A4QA 2FWWA 3F9HA 5J4QA 3MH7A 1BBRE 4X2XA 1SB1H 1PPEE 2Z3DA 2VH6A 2PW8H 1NFUA 2FOBA 5DP4A 1MD7A 4MNVA 2QAAA 3O8RA 1PPZA 4D9RA 2FIRH 5EGMA 1CT2E 3SNBA 4UFFH 2LNCA 1WV7H 3VB5A 2F3CE 1O3GA 3TH2H 1JMOH 3QGJA 1AIXH 1W0YH 3ZVBA 2Y5FA 8ESTE 5AFZH 3M5MA 1F5KU 1GMCF 1E36B 3RXMA 4FVBA 3TU7H 4D8NA 4KTUA 3PMAB 1O5DH 4X1RU 4XBCA 3OY6U 4IC5A 1O5GH 1A3BH 1BRCE 1O2NA 2ALVA 2FOCA 1OWHA 3LGWA 4CRFA 3M7TA 1D6RA 1U6QA 3D62A 2D2DA 3NWUA 1AN1E 2VU8E 1YLDA 4XE4A 4M7GA 3QWCH 4BXSA 1UTKA 2NU1E 3ATMA 3ODDA 3V13A 3BTQE 2ZDAH 4MNWA 4XDEA 1ZRBA 5TCAA 1A7SA 5L2ZH 1AE5A 1GCTC 3BTFE 4AYVB 1VITH 2OBQA 3M5NA 2THFB 1GI2A 1YGCH 3GDUA 4FUIA 1KXCA 3RXFA 1ZHPA 4ZXXH 3F9EA 2P3FH 3LKWA 4ISLA 3UQVA 2FLRH 2FLBH 3LH3A 1DLKB 2RDLA 1QQ4A 1F2SE 1SGCA 3EDXB 2ANMH 1O2JA 1P02A 1GBAA 2Q6GA 4YM9A 3E8LA 1C2JA 1TX7A 3VB4A 1L4DA 1AWHB 3ZV8A 4X6MA 1ACBE 3MNCA 4WMEA 1X7AC 2CMYA 2M5TA 1ID5H 1L1NA 2G4TA 3EGKH 1UHBA 3SJOA 3F1SB 4D7GA 2QIQA 2HOBA 1O2WA 3TGJE 1QRWA 4DOQA 1ORFA 1GBFA 5EQQA 3SYJA 3ATIA 1J17T 4ABBA 3RDZA 4JK6A 2G5VA 1OPHB 5A09A 4HI3A 2RCEA 1LKBA 1KDQB 1WTGH 1XKBC 3K6ZA 1LPGB 2BXUH 4A7IB 2YOLA 1GI1A 3BTEE 1GVKB 3TK5A 5T1VA 3SV7A 2EC9H 1EP5A 3ZZAA 1O2SA 3OTPA 2VWLA 2QXHA 3MOCA 3A7TA 2AGIX 1SLXB 2FOMB 2HRVA 1QBNA 3GY2A 3TPIZ 3TK6A 4BAQB 1OP0A 1QL9A 2PR3A 4BAOB 1Y3UA 1K1OA 2H1UA 1GI0A 4OGXA 2ANKH 1D3QB 1TLDA 2TRMA 1EJAA 1A2CH 5DJ7A 1SQTA 2SNWA 1DWCH 1T4UH 2FESH 3ZZ6A 4ABDA 2JH5D 3BTDE 2FI5E 3LDXH 3MH6A 3TVJB 1GBDA 4O97A 2VWMA 2A5AA 5FXLA 1C1VH 1HIAA 2BM2A 4B73A 2VIVA 3SU3A 5F8XA 4A1XA 2Q6FA 1UHBB 4BAHB 2SGAA 2IJOB 2ZHDA 1EKBB 5E0GA 1FPCH 1BMNH 1O5CB 2F9UA 1GBLA 1TX6A 1SOZA 1Y5UT 1SLVB 1SL3A 1P57B 1J8AA 1XUHA 1AE8H 2FOAA 4Y79A 2HGTH 1IHSH 3E0PB 2AFQB 1G2LA 3A81A 4HZHA 2F4LA 3D23A 2BZ6H 3BF6H 2QA9E 4JMYA 1HAPH 1GG6C 1K1LA 1MQ6A 3A88A 1CVWH 3BEIB 3VB3A 1S6FA 2XRCA 5EXNA 2ZNKH 5JB9S 3LT3A 4HFPB 5SGAE 1ANEA 1RGQA 1F92A 1O3KA 4E7RG 1N8OB 3BSQA 3TJNA 4U2WA 3M61U 2WV9A 3A85A 1L1JA 2BD8A 2ZU4A 1BHXF 4IN1A 5JB8S 4AB9A 1BIOA 5HM9A 2ZDVH 1UVUH 5FCKA 1C1WH 1WXRA 2Z6BD 4GHTA 5A0BA 2W5EA 1AD8H 1GBHA 1JIRA 1VGCC 1BTXA 5HM2A 1JIMA 1HIAB 2EA3A 3M7UA 4LZ1H 4A6LA 1LKAA 1QL8A 1FN8A 3KF2A 5JBTA 1Z8RA 1QURH 1UTLM 1LPKB 5PTPA 1RJXB 1G32B 1H8DH 1DVAH 1T32A 3BIUH 7GCHG 1O2IA 1DWBH 2VGCB 1ZJKA 4Y76A 1HJAB 1ZPBA 2J2UA 1THSH 4ZXYH 1A5IA 4NWKA 1OXGA 3SBKA 2ANYA 4X2VA 1BOQA 2GP9B 4CRGA 2VIPA 2WPMS 3MO9A 4BAMB 1WSSH 4Z6AH 3U1JB 3A84A 1O2HA 2SGEE 3GYLB 1UTNA 2R2MB 1SVPA 1SBWA 1QA0A 1YPHC 2TGTA 2ZDNA 1GJ8B 1SGEE 1SC8U 4OS7A 2P8OC 4FUHA 4CREA 2H6MA 2CHAB 1O2KA 4ABJA 4NIWA 1VR1H 7GCHF 1K1JA 3URCA 2FX6A 3TK9A 1VCPA 1HDTH 4FXGH 4ZKSU 1ARBA 1LVYA 2C90B 3CP7A 2CXVA 5LH8A 2V3OH 1LMWB 1HPGA 2ZPSA 3G01A 3GCTG 3U8TH 1YPLH 2RG3A 4LXBH 1AY6H 3K2UA 4DVAU 1GMHG 3C27B 1A5HA 4E7NA 1XUIA 1EP6A 1F0TA 1Y3VA 2J34A 4AFQA 3QZRA 1FV9A 1VCWA 2LPRA 2ZG0H 3EE0B 1HXEH 3SGQE 1SGNE 2PTNA 7KMEH 2WPJS 4JZEH 2ZCLP 3P92A 4ZHAA 4TWYA 1AUJA 2JH6D 1O3LA 3C1KA 4JZ1A 4UEHH 1TONA 5AVDA 4F4OC 3SGBE 1V2VT 5GNDA 3BTWE 1DT2A 2TPIZ 9LPRA 2D26C 3GCTF 3CS7A 1XM1A 3MMGA 3SJ9A 2ZU3A 2ANWA 3A7YA 1GMHF 3EAJA 3HK6B 1BMMH 1C5YB 1AWFH 1YPEH 5EPYA 2Y7XA 3SW2B 3W94A 2XW9A 1SQAA 1BZXE 1AI8H 1TNHA 1WOFA 2WV5A 1CQQA 2Y5GA 4IW4E 3PV4A 4IS5A 2WPKS 1SHYA 2GT7A 3LJJA 1O0DH 5T3HA 1Y59T 1O3CA 1WYKA 2W7SA 1DM4B 6CHAC 3RXAA 1E0FD 3F6UH 1Y3WA 2ZDKA 4ABHA 3UY9A 1AFQB 3RXGA 1W3CA 2A7HA 1BRAA 5A8XA 5EW1H 3FP7E 2PSYA 1K1IA 2IOTA 3SUGA 3F68H 1G3DA 3ZYDA 4AYYB 2F9BH 3KN2A 1O38A 5CHAC 3ITIA 1O30A 2BY5X 5ETXA 1GHYH 2O9QA 2GV7A 4K5ZA 1K9OE 1TBQH 2UWOA 1KIGH 1DXPA 1Y5AT 2PGQB 1ELBA 1CBWB 4OS5A 1P3CA 1T8MA 1PPGE 4JZFH 2CJIA 1K22H 2ZF0H 3BTME 3RXJA 2WUCA 3U8OH 2TGPZ 1W0ZU 3Q00A 1F0RA 1FY8E 2H5CA 4KGAA 1OKXA 5K7RA 1QRXA 3U1IB 2G8TA 1Y3XA 1ZRKA 2JETC 3EQ0H 2FI4E 3ATLA 3RC4A 3LU9B 4K2YA 2W7UA 1FXYA 3ZVAA 2G81E 2BQ6B 2ZEBA 1Z8JB 1G2MA 1GWAA 1Z1IA 2OQ5A 2H5DA 1IQEA 1A4WH 1JRTA 4NZQA 2BD5A 1BHXB 4B6FA 1E38B 1XXFA 2VH0A 3PLBA 2ZQ1A 4CHAC 3MHWU 1XXDA 4R0IA 3D65E 2V0BA 1UK2A 4ABIA 2FODA 2ZPRA 4CBOA 1VCQA 4INKA 2VVUA 3U69H 2TIOA 3MU8A 1O36A 1GBBA 1QBVH 2OTVA 3S9AA 4ZROA 4TY6A 3I78A 1HFDA 1W10U 2XXLA 2BZAA 1J15A 5FX5A 1CGIE 4YLUA 1W12U 1C5VA 1SLWB 1DDJA 4HGCA 1FY5A 2QXIA 3SV9A 1BTYA 2BY6X 1CA0B 2FZZA 1RFNA 2R2WU 2XC0A 4YT7H 2WPLS 2STBE 5C20A 3QX5H 1A5GH 2GX4A 3VGCB 1P2QA 1SSXA 4BTTB 3SU0A 1JRSA 2UWLA 4U01A 1IHTH 2D8WA 2RA0A 2UUKB 2GMTB 2ZI2H 4NSYA 1MU8B 2J94A 2QXGA 4X1PU 1GJ6A 4K60A 4ZHLU 5EQSA 2C8XB 2ZU1A 3AASA 5F8TA 3A82A 4OS4A 2B8OH 2A5IA 3TJVA 1HCGA 1K1NA 1P03A 1GHVH 3A7XA 1ZGVA 1GI7B 1C4U2 2GDEH 1C5TA 1CSOE 1BRUP 1MAYA 3A7WA 2QCYA 1BT7A 4MQAA 2PKSC 1V2KT 3ZZCA 4I8JA 2ZO3H 3RU4T 3KQDA 2STAE 1ZYOA 1DWDH 1C2IA 1C5QA 2WINI 1G3EA 4KTCA 1A0JA 1TQ0B 1NPMA 5EW2H 2BVRH 4CH2B 1F0UA 1ANDA 1SOTA 1ZJDA 2B9LA 1DFPA 3KGPA 2WZQA 1BQYA 2P3TB 3LIWA 3Q77A 3NCLA 2G5NA 1EJMA 4ZAEA 1RXPA 4X2WA 2XYAA 1A0LA 2Y6TA 2FXRA 4NSVA 2PWXA 4ZMAH 3DFLA 2KAIA 1GVLA 2PHBA 1GVZA 3T62A 2BY9X 3PWCA 1CHOG 3MNXA 5TJXA 5E2PA 1G9IE 1UJ1A 1MBQA 3UWIA 1OP2A 2FYQA 1TGNA 2BY8X 4UONA 3MI4A 4KP0A 4WXVA 1O32A 4JZIA 1P2IA 4INLA 4DG4A 4Y71A 2BVXH 1GI6A 3LC3A 4CH8B 1AO5A 1O5AB 3M3VA 1GHZA 3RXIA 1SI5H 1FI8A 1OWEA 3GICB 2TGDA 1NRSH 4Y8XA 1JBUH 3ZZ8A 3LGUA 3V0XA 4B2AA 1Z8IB 1PPCE 1C2FA 3RXRA 3P95A 3PO1B 2ZDMA 5FBIA 1O33A 3RXBA 7LPRA 4NA8A 1TABE 1C5SA 4Y10E 1CHOF 4OM9A 4CRCA 1HJ8A 2JKHA 1ZSLA 4NZLA 1OWDA 1O35A 3BTKE 5DGJA 2ZTZA 2A2QH 3NKKA 5LPRA 4NWLA 2Z9GA 3RLYH 5F8ZA 1GJDB 1YBWA 1SQOA 2I6QA 1C1TA 1GJCB 1E37B 1OYQA 4KTSA 2BDIA 1FONA 3DA9B 3LGIA 3T28A 4ABGA 1KDQA 2AMPA 4K8BA 2IN2A 4O9VA 4ISIH 2BXTH 3GOVB 4I31A 2VIOA 4DGJA 4ZKOU 1O2VA 4FUFA 2ZC9H 4ISHH 1NY22 2A4OA 1WQVH 2ZPQA 1HAYB 2CV3A 4IMZA 1G3CA 1C1MA 2XBYA 3KCGH 2KAIB 1EZQA 3ZV9A 3T5FH 3H7TA 1IQJA 5A8ZA 3SO3A 3ATWA 4AB8A 4NFFA 1SPJA 1GBCA 3CENA 4ABFA 1V2MT 1TNIA 1TALA 1TB6H 3UIRA 2V6NA 3GYMA 1B0FA 1GDQA 4SGBE 4DJZB 2FX4A 4WF8A 1OWKA 4BTIB 5F6MA 1SG8B 8GCHG 4NCYA 3PLPA 1V2TT 1NT1A 2PKAB 2UUYA 1BB0B 1QB6A 1EX3A 3GCHC 1O31A 1L2EA 1C5PA 1GHAG 3JZ1B 4O3TA 1O5BB 1C2MA 2SNVA 3SORA 2W3KA 1UTJA 3W95A 1ARCA 1NFYA 2A4GA 1V2QT 1DLEA 3IITA 3OU0A 4KELA 2BDYA 1INCA 1FNIA 4UFEH 4OGYA 2WPHS 2A7CA 3GCOA 8GCHF 4H42U 4FUGA 2BLQA 3E3TA 1QFKH 1Z6JH 2NU4E 3PB1E 1F7ZA 2NU3E 3K65B 3JZ2B 3SV6A 1T8NA 2BD2A 1FY1A 4NGAH 2OLGA 1C5LH 1LHDH 2QYIA 1GHAF 4CRAA 1K28D 2HNTF 2BD4A 3B9FH 1FY4A 1MTNB 3SQHE 1TBRH 8KME2 2PFEA 4AN7A 5IDKA 1A61H 1IAUA 1PQ5A 5A2MH 1UCYH 3EA7A 1LQDB 1SGIB 3O8CA 1BCUH 4BANB 4I33A 3FVFB 1GPZA 4NA9H 2VVCA 1GJ5H 1P12E 2AGEX 4AG1A 2H9HA 3PV2A 2D1JA 1KLTA 3E6PH 2AS9A 1HAZB 2FOFA 4WH6A 4JYUH 5EXLA 1S85A 4DIHH 1PPFE 1P01A 1YCPM 1S0QA 4DURA 1TPOA 4JYTA 1GBKA 2XWAA 4DIIH 1YP9A 1KXBA 3QTOH 2BOKA 1NRRH 4YZUA 1TNKA 4AX9H 3KIDU 1TMTH 1HAGE 2A0QB 1XUJA 4X6OA 5AF9H 3MH5A 1ZGIA 3LH1A 3RU4E 1EAIA 1WU1A 6GCHG 3S9CA 1F0SA 4H6SB 3H09A 2ZQ2A 1NRPH 2OCVB 1C2HA 1F5LA 1LPZB 4IMQA 2J92A 2BLWA 1XUFA 1ZPCA 1BITA 2ZZUH 1BTHH 2JH0D 3PROA 4FUEA 3RM0H 4K1SA 4Y11E 2H2ZA 2ZFQH 4I8HA 2XBXA 1G3BA 2BD7A 1DOJA 3TLOA 5DPAA 4RKOB 4MPXA 2Z9IA 4VGCC 4GCHG 3PMBB 1BTPA 1BJUA 3ODFA 4AFUA 3GY5A 1C1PA 3RP2A 3NK8A 2HWLB 1GHXH 3A86A 2XNIA 1PQ7A 5CMXH 1HXFH 1GDUA 1N6XA 3UOUA 2Y80A 2XC5A 3MH4A 6GCHF 2Q6DA 4D7FA 5E8EH 4ZKRU 1HV7A 4IBLH 1BTUA 1P09A 2BDBA 4AFZA 1PPHE 1ZSKA 1MTSA 3CS0A 3SJ8A 4WH8A 1HAIH 1TWXB 1O3DA 5FPYA 3SUFA 1O2YA 1TMUH 4I7YH 1GCDA 2AIQA 2H9TH 1ZMJA 2ULLA 2BLOA 2FEQH 4GCHF 2AH4X 4Q7XA 1OX1A 1TNLA 1K1MA 4XBDA 2CN0H 2FTMA 1V2NT 3GY3A 1OP8A 4BXWA 4E05H 2PUXB 4WJG2 2C93B 2VVVA 4K1TA 1UCYK 1ELGA 5EG4A 1GJAB 4Y7AA 4FUBA 1O34A 1UTMA 1THPB 1NESE 2GTBA 5L2YH 1OS8A 1XVMA 2BX3A 2GKVE 2VIWA 1KXDA 2O8UA 3SI3H 1JXPA 3IWMA 2R9PA 1IQNA 2WPIS 3A87A 4HTCH 2G4UA 1O3HA 3R0FA 3IG6B 3TGIE 4MNYA 3P6ZB 3SQEE 1QB9A 3FZZA 3NZIA 5C5NA 3HGPA 2ZCKP 4NIVA 4YOIA 5EQRA 2NU2E 2GGVB 2ZECA 1GI4A 1PJPA 1H9LB 1W8BH 2GCHG 4U32A 1C9TA 1N8OC 1SFQB 1EB2A 2C4FH 4GLYA 1O3MA 1V2PT 5DP8A 3MTYA 4UFDH 5B6OA 3ZZ9A 4YLQH
chains in the Genus database with same CATH superfamily
3PV5A 4Y8YA 5C5OA 3EYDA 5H4IB 1AFEH 3FFGA 1BMLA 1RTKA 3GS9A 4Z0KA 2R3UA 1O2RA 3MFJA 2PTCE 4ASHA 1A0HB 2ZFFH 1TIOA 3LGVA 3TJOA 3UNQA 1SGYE 1PYTD 1HYLA 3ATKA 4O03A 4B76A 1TRYA 2C8ZB 2XNDD 5A0CA 2ESTE 3SU2A 3FKSD 3KQEA 2IPHA 2Y5HA 1G30B 1GJBB 3PRBA 5AFYH 4X6PA 3DT0H 1O3EA 2GCHF 4YESB 3UNRA 1GL1A 2F9NA 1SGTA 4E06H 1E35B 3ZVGA 2L6OA 2J38A 1Q3XA 2VGCC 1QA7A 1F5RA 1HJAC 2W6ID 3LC5A 2AHME 1TA6A 1UMAH 1D3PB 1O2UA 4X8TH 3VXEH 1QY6A 3DSOA 5DK1A 4ABEA 5I25A 1SR5C 5DO4H 1W2KH 2OINA 2Y82A 1ABJH 3ZZ5A 1KLJH 4TWWA 4DCDA 4MDSA 6CHAB 2BMGB 3DUXH 1AB9C 1GGDB 4ZH8A 4BNRA 2GZ9A 2OP9A 2F9VA 1MBMA 4O3UA 1GI3A 2C8WB 4FVDA 5T6FA 2CGAA 2CHAC 1S82A 3RMMH 3HKJB 3EA8A 1AGJA 2P3UB 1YYY1 1TNJA 1O3BA 1O3FA 2OK5A 1FZZA 1PQ8A 2FMJA 3LJOA 3MNSA 1S5SA 5CHAB 5CE1A 1FMGA 1Z8GA 2ZA5A 3U8RH 3RXLA 3ENSB 3QUMP 3N7OA 5HYOA 1C5NH 3Q76A 4ISNA 1QIXB 1W13U 1ZTJA 2AEIH 2ZFSA 4YT6H 5F53A 3ZVDA 4UD9H 3LONA 3AW0A 2AIPA 4AFSA 1PFXC 1QRZA 3MNBA 1C4V2 3KQCA 1EOJA 5DKMA 4AG2A 1FX0B 3UPEA 2GZ8A 2GD4B 1O5EH 2XCFA 4H6TA 1LO6A 4TY7A 3SUEA 1EAXA 1A3EH 1FQ3A 1QR3E 5GWZA 1C1OA 3KL6A 4Q63A 2ZHFH 1HRTH 4I8KA 1A1RA 3DSPA 3UWJH 1LHCH 5FX6A 4H4FA 1DPOA 1XMNB 2EI8A 1NN6A 2K1QA 1BMFD 4K8YA 3F9GA 4XD7D 4IC6A 1C2LA 3TNTA 1KY9A 5E0HA 1Z1JA 3K9XB 1QCPA 3ESTA 3WW7A 1Z7KA 2A32A 2YNBA 3SN8A 2ILNA 3A8BA 2ZGJA 1SGFG 3N7EA 1TPSA 5EJZA 4WMDA 1TPAE 3ZZDA 2HVXA 1DY9A 5GDSH 3M5LA 1AFQC 3HATH 4X0WU 5ESBA 1EFRD 1TGSZ 1ZLRA 2SGDE 5DG6A 3SHAH 1XUGA 3VG8A 3TGKE 1CT0E 3HPTB 1O3NA 3OAAD 3P17H 5IYTA 4X8UH 3UR9A 1O37A 5I46H 1TYNA 2EI7A 3A7VA 2HALA 1P9UA 2XBVA 3FN8A 1GHBG 3T29A 4MPVA 1EAWA 1MU6B 1EB1H 4GHQA 3VEQB 1TGCA 1BTWA 3DFJA 3UQOA 9ESTA 3M37A 3T27A 4DT7B 1GI9B 2ZU5A 3RMNH 3E1XB 1TQ7B 4TT3D 3T25A 2ZGXH 5J4SA 1FLEE 1QL7A 1OWIA 1BMAA 2FO9A 3BTHE 1XKAC 1H8HD 2Y7ZA 1CBWC 1YM0A 3LOXA 1RIWC 1E34B 1ESAA 5HXFA 1SGQE 1DY8A 4WXIA 3QGNB 3RXTA 3S7HB 3T26A 2G55A 1THRH 1UK3A 5AHGH 1QB1A 2A31A 1ELFA 3ZZBA 1HGTH 2P59A 5JBAS 1H4WA 1O3OA 3SZEA 1GHBF 3RXEA 1NROH 2PKSB 3VPKA 3NXPA 1B5GH 1C9PA 1V2UT 1MTVA 3PMHB 3SNEA 5GIBA 2VNTA 1P06A 2QN5T 3B23B 3HGNA 5HKKD 1ANBA 5A0AE 2ZFRH 3FP6E 3E16B 3OY5U 2HPPH 1M9UA 4NIXA 2WYGA 1BJVA 1HAXB 5BPEA 3ZZ7A 4Y0ZE 2QF0A 3DHKH 2C3SA 4CRDA 1IQKA 3AK5A 2UWPA 3Q3YA 2CK3D 1UVSH 2DUCA 2CF9H 3ZVEA 4BOHA 1LVOA 1OOKB 1YPMH 2XC4A 2GCTB 5JBBS 4BTUB 2SGPE 2JJ1D 1ETRH 2NWNA 3MQKC 1UVTH 1LHGH 2F83A 4TPIZ 3UFAA 2GVFA 2VWOA 4Y7BA 1D4PB 1C1QA 4X8VH 1NTPA 3N7DA 4NG9H 3MU4A 1WUNH 1O2GH 3SU5A 4M9FA 1HAOH 1GDNA 1QBOA 3TNSA 1IQLA 1CE5A 3DD2H 4IN2A 3VGCC 1ZMNA 1C1NA 1HLTH 1MUEB 2BDCA 3M7QA 3WY8A 1IQGA 1FPHH 3TITA 2G52A 1EXFA 2GMTC 2XOKD 4FU8A 1KSNA 4Y0YE 1B0EA 1C5ZB 1CA8B 1ZTLA 2FS9A 1SMFE 3AVZA 1DUEA 1EZSC 4Q7YA 2Z9LA 1ZZZA 3BTGE 3A7ZA 1NU7B 1GJ7B 2BDGA 2HNTE 1EPTC 2PKAA 1WTHD 4X2YA 1DICA 1V6DA 1WAYB 3BG4C 1MKWH 4Y8ZA 5DP7A 4WWYA 1L1GA 3P70B 3U9AH 1TBZH 1SGFA 3RUOA 2VINA 1QNJA 3GY6A 4LZ4B 1TAWA 4I8LA 5B6LA 2WSSD 2YNAA 3GISB 1T7CA 1C5UA 3LGTA 5T6GA 2FM2A 1UCYE 1MD8A 1O2TA 2OC0A 3UREA 5C3NA 3S0NA 1GCTB 4GAWA 1C1RA 4TYDA 2QY0B 1RD3B 3K6YA 2WUBA 5EPNA 3D49H 2O8WA 4GPGA 3UB0A 4DT4A 3A83A 4CR5A 5HMAA 3SOSA 1GI5A 2R0KA 2TGAA 5FPSA 3ZVFA 1ZMLA 1D9IA 1GL0E 1LTOA 2ZGCA 1KXAA 1RTLA 2AYWA 3STIA 5EXMA 2ZTXA 2BX4A 3GCHB 1GBTA 3FP8E 1SGDE 5C2ZA 4RT1A 3F9FA 1TOCB 5LGOA 1DWEH 1HAVA 2O8TA 4SGAE 5JYIA 2AMQA 1JWTA 1VITG 4JCNA 3PO1C 2V3MA 3RM2H 5EU8A 2Z3CA 2QF3A 3BEUA 1O2ZA 1PQAA 1FIZA 4B1TA 1O5FH 2WPDD 1LVMA 1W7XH 1UK4A 1EATA 1O3IA 1DX5M 3AAVA 1OYTH 2ZCHP 2BLVA 1TX8A 1P2MA 2QV1A 1V2LT 1O2LA 2R0LA 1QHRB 3B8JA 2A2XH 1WCZA 1VJAU 2BTCE 1L0ZA 2Z9JA 2FOEA 1ZTKA 4R8TB 2AERH 3HKIB 1S6HA 1MH0A 3GY7A 2BQWB 2F9OA 3SU6A 3QO6A 4B6EA 1VITF 5JBCS 2ZP0H 2PP6A 2BB4A 3BTTE 3KQBA 3UAIC 2OXSA 4K1EA 2KR7A 1P8VC 1ZHRA 1ABIH 2AGGX 4FUCA 3SNDA 1GI8B 2Z7FE 3RXDA 4B2CA 3Q3XA 1D6WA 5G4BA 4A5TS 1O39A 5A8YA 4MNXA 4MPUA 1MKWK 1TPPA 5L6NH 1TGTA 1NBMD 3VB7A 1PPBH 3M3TA 3P8GA 1A46H 1NM6A 1FDPA 5C1XA 2EI6A 4JZDH 1DSUA 3VXFH 5T6DA 1W14U 3F2FA 2ZHWH 4A1VA 4TPYA 4MVNA 4Q4LA 4THNH 5EODA 3QLPH 4RN6A 3ZZ3A 2PSXA 4INHA 1C5OH 1FAKH 2Q1JA 2FOHA 1NRNH 1BBRH 1J14A 1MABB 1P3EA 5EIYA 1D3TB 1HAVB 2L74A 1HBTH 1AQ7A 1YKTA 1SLUB 3OFND 1B7XB 3FZDA 2WV4A 4FUDA 1SHHB 1QTFA 1O2QA 2BDAA 1CU1A 1O3AA 5C1YA 4X8SH 3QDZB 2K8IA 1SFIA 3I77A 1ELCA 2H9EH 4J2YB 1TRNA 1CT4E 5EJ1A 3GCNA 3SNAA 4NFEA 3CNRA 1SGPE 5K0HA 1MZDA 3RXOA 1O2PA 4VGCB 3VFEA 1ZSJA 5C1UA 1FY3A 2J97A 2OD3B 1AUTC 3Q3KA 4AGKA 1YPJH 1RS0A 2GV6A 2ZGBH 4UDWH 3RXKA 1TRMA 2B0FA 1DE7H 4XRNA 2G51A 1MTNC 1QJ7B 3VB6A 1IQMA 1GG6B 1BA8B 2GT8A 2UUFB 4B2BA 4FU9A 1TGBA 1EASA 1G37A 4GSOA 4MPWA 2P16A 1WQSA 3RMOH 4Q80A 1LHEH 4JYVH 1UVOA 1LCYA 2FPZA 2DE9A 1C2KA 2KZ4A 4D76A 3BN9A 1C5RA 1TMBH 1HAHH 3I29A 3FAOA 2G00A 4I32A 8LPRA 3TIUA 1ELVA 3MWIU 2A5KA 4ZUHA 3GY8A 2W26A 1MAXA 1AVWA 1QJ6B 2ZFTA 2ODQA 3TJUA 1EAUA 1ETSH 1V2RT 5JDUB 4AZ2B 1L4ZA 1ELDE 1O2OA 3QZQA 1OWJA 1DXWA 2J5UA 1N6YA 1GBMA 5DP9A 1VGCB 1P05A 1COWD 1P10A 2J95A 2PLXA 5DN6D 4XFQA 2HVYB 5JPMH 1GBEA 3A8CA 1GHWH 4AC9A 1KYNA 1ZR0A 3E90B 3AAUA 2ZDLA 1S0RA 2QGRA 1NRQH 4ABAA 3BIVH 1TA2A 1LQEA 3A8AA 3P8OA 3RMLH 1GMDG 3MU5A 3KNXA 1BTZA 3V7TA 1BBRK 3MO3A 1QQUA 2O8LA 3PM3A 2OC1A 1Y8TA 5DP5A 3WWBA 1Q2WA 2A1DB 1ELTA 1H9IE 1NC6A 1YWUA 4X6NA 1RRKA 1LDTT 1ZHMA 1K1PA 2W3IA 3NUMA 1WBGB 2BHGA 4GVUA 1SGRE 2P8OB 5BRRE 2BQ7B 4LOYH 3MO6A 4UFGH 3V12A 4FU7A 3UOPA 4D9QA 3STJA 6LPRA 2RA3A 2J4IA 2P93A 1IQFA 1FUJA 1GMDF 3SHCH 1DITH 3GDVA 1C2GA 1QGFA 2HPQH 3L33A 4XSKU 1AZ8A 3QK1A 1JOUB 3OSYA 3RXQA 2FOGA 1P2KA 4J1YA 1GJ4H 1TE0A 3SJIA 1J9CH 2ZHQH 4ZHMU 3L3TA 3O8DA 1KXEA 1C1UH 1T4VH 2FP7B 2C8YB 1NZQH 2O8MA 2UUJB 3HK3B 1KLIH 3SV8A 7ESTE 2WYJA 2ZIQH 2BYAX 1NS3A 1V2OT 2ZWLH 2FI3E 3MU0A 1AU8A 3RXVA 2AMDA 1V3XA 2J9NA 1N1LA 2OC8A 2ZU2A 3SGAE 4X1SU 4AOQA 1AB9B 1H9HE 4QT8C 3A8DA 1MCTA 1FAXA 1BUIA 1LVBA 2ASUB 1GJ9B 1EQ9A 2A4RA 2EQNA 3RXUA 3BEFB 1V2ST 3QN7A 1AVGH 4GUXA 5E2OA 3OTJE 1OHHD 1YF4A 2HLCA 2ZGHA 1EJNA 3P8FA 4B71A 1DSTA 1ESTA 2ZTYA 2F91A 2ZHEH 3V3MA 3RXHA 3SI4H 2QXJA 3H5CB 4XOJA 2FS8A 3P8NA 2VB0A 3MU1A 2OUAA 5EOKA 1XX9A 1K0HA 3S9BA 1YPGH 3EA9A 3H7OA 3KEEA 2A7JA 1O2MA 1T8OA 3RU4D 3SU4A 4ISOA 3RC6A 4X1NU 1C5MD 2GZ7A 2IPQX 2YMSD 4K69A 1NO9H 2Z94A 4DY7B 3PWBA 2DE8A 2Z9KA 1ETTH 1EZUC 1P11E 1GBIA 1MCVA 1OSSA 3OYPA 4A92A 2XTTB 3T2NA 4A1TA 1Z6EA 1ELEE 1XUKA 3M36A 3TH4H 2KX4A 4B75A 5GPIB 1MQ5A 1ZOMA 2WHXA 4WMFA 4YTAA 3SU1A 1P0SH 4MTBA 1EOLA 3RXCA 2HNTC 2B7DH 4MG3A 2A45B 1MKXH 1O3JA 4UE7H 4CR9A 3F2HA 1O3PB 4RKJB 2VIQA 1C5WB 4IGDA 2JETB 3E0NB 1IOEA 1LHFH 2OC7A 3PLKA 4K3JA 1Z71A 5FBEA 3PYHA 3M35A 3SZNA 1C4Y2 1GGDC 1BRBE 1VKYA 3UR6A 4NA7A 1S84A 3BG8A 1DS2E 1MMJN 4CBNA 1YLCA 5FHTA 1MTUA 3S7KB 5GXPA 1YCPH 2QE7D 1D3DB 1O2XA 2PGBB 4RSPA 3AW1A 1AHTH 1UTQA 5KGOA 2OBOA 4CHAB 1MZAA 4WY3A 3OX7U 1CHGA 6ESTA 1Y3YA 2PV9B 1TFXA 3M5OA 5DP6A 1RIWB 2XWBI 1NFXA 1G36A 2EY4C 4XBBA 1UTPA 5IK2D 1IQHA 2QC2A 1EUFA 1HJ9A 1K2I1 3U98H 1FN6A 5FPTA 5TCCA 1TOMH 4RT0A 1AKSA 1T8LA 1Y5BT 4Q7ZA 5F03A 5LPEA 2SGQE 2FTLE 5FAHA 3LPRA 4YO9A 1GBJA 3A80A 4AORA 2BOHB 1C5XB 1T31A 2I6SA 2IJD1 3RLWH 2HLDD 2V35A 3UTUH 3TH3H 1EPTA 1EZXC 3ZYEA 4Q2KA 2XBWA 1NFWA 2ALPA 1AVXA 4NIYA 2ODPA 5ESTE 3F2GA 2P95A 3DSGA 3RC5A 1DANH 3L6PA 4WVPE 2XCNA 5LPFA 1CGJE 3GY4A 4P00A 1C2EA 4DW2U 1HB0B 4ACAA 3FOAA 5E0JA 1V2JT 3UNSA 3LGYA 1P9SA 3O8BA 3GDSA 3ZZ4A 2F43B 2PUQH 5FL7D 2Z3EA 1H1BA 1K21H 2FYRA 3SUDA 4I8GA 1HUTH 2VJ1A 1VZQH 1ZPZA 1MKXK 4KKDA 4LK4A 3PTNA 4MLFB 1S81A 1AMHA 4OS6A 4ZKNU 1P2OA 1VJ9U 3OE7D 1UVPA 3NPSA 1V2WT 1CGHA 5FCRA 1YPHE 2VBCA 3QTVH 1MTWA 3SNCA 5L30H 2BD9A 4BAKB 2B5TB 3SJKA 4B74A 3PMJA 2BD3A 1W7GH 2SGFE 4CRBA 3SV2H 4ESTE 1ESBA 1QJ1B 2CF8H 1YPKH 3MYWA 1TNGA 5GJ4B 2VWNA 4OS1A 1P2JA 1YCPK 1AKSB 1HNEE 2P94A 2YMSB 1XVOA 3F0PA 3S69A 3KHVA 3E91A 2ODYB 1PYTC 3ELAH 1C1SA 1NBME 5ABWA 4RI0A 4AGJA 1ANCA 3PTBA 1YLNA 1EPTB 1CA0C 1UTOA 3BG4B 4YOGA 1P2NA 2F9PA 2VIDA 1ELAA 5HGGA 2R3YA 5DP3A 2KCOA 2FDAA 1S83A 2TBSA 4Y6DA 3A89A 1DUAA 2BVSH 2BY7X 5GCHG 3RXSA 1KTSB 2Y81A 2BDHA 1CO7E 4YOJA 2OQUA 4F49A 2EEKA 4PROA 1UO6A 3UUZA 1FJSA 1H8IH 1BDAA 1C2DA 1W11U 2ZFPH 3FANA 5C67A 1FIWA 3BV9B 4FUJA 1P04A 2ZKSA 3URDA 1KTTB 1J16A 2V3HH 2K0QA 1AZZA 4F48B 1E1QD 4OS2A 3RXPA 2GCTC 4X1QU 3M3SA 1IQIA 2NU0E 1RTFB 2SFAA 4U30A 1Q31A 1NU9A 3ZVCA 3R3GB 1GMCG 5GCHF 1KXFA 1YC0A 2GDDA 4JK5A 2A4QA 2FWWA 3F9HA 5J4QA 1W0KD 3MH7A 1BBRE 4X2XA 1SB1H 1PPEE 2Z3DA 2VH6A 2PW8H 1NFUA 2FOBA 5DP4A 1MD7A 4MNVA 2QAAA 3O8RA 1PPZA 4D9RA 2FIRH 1W0JD 5EGMA 1CT2E 3SNBA 4UFFH 2LNCA 1WV7H 3VB5A 2JIZD 2F3CE 1O3GA 3TH2H 1JMOH 3QGJA 1AIXH 1W0YH 3ZVBA 2Y5FA 8ESTE 5AFZH 3M5MA 1F5KU 1GMCF 1E36B 3RXMA 4FVBA 3TU7H 4D8NA 4KTUA 3PMAB 3PRDA 1O5DH 4X1RU 4XBCA 3OY6U 4IC5A 1O5GH 1A3BH 1BRCE 1O2NA 2ALVA 2FOCA 1OWHA 3LGWA 4CRFA 3M7TA 4P02A 1D6RA 1U6QA 3D62A 2D2DA 3NWUA 1AN1E 3WWFA 2VU8E 1YLDA 4XE4A 4M7GA 3QWCH 4BXSA 1UTKA 2NU1E 3ATMA 3ODDA 3V13A 3BTQE 2ZDAH 4MNWA 4XDEA 1ZRBA 5TCAA 1A7SA 5L2ZH 1AE5A 1GCTC 3BTFE 2JDID 1VITH 2OBQA 3M5NA 2LP6A 2THFB 4AYVB 1GI2A 1YGCH 3GDUA 4FUIA 1KXCA 3RXFA 1ZHPA 4ZXXH 3F9EA 2P3FH 3LKWA 4ISLA 4ZCNA 3UQVA 2FLRH 2FLBH 3LH3A 1DLKB 2GJGA 2RDLA 1QQ4A 1F2SE 1SGCA 3EDXB 2ANMH 1O2JA 3NRLA 1P02A 1GBAA 2Q6GA 4YM9A 3U28C 3E8LA 1C2JA 1TX7A 3VB4A 1L4DA 1AWHB 3ZV8A 2KM0A 4X6MA 1ACBE 5KEDA 3MNCA 4WMEA 1X7AC 2CMYA 2M5TA 1ID5H 1L1NA 2G4TA 3EGKH 1UHBA 3SJOA 3F1SB 4D7GA 2QIQA 2HOBA 2QF5A 1O2WA 3TGJE 1QRWA 4DOQA 5HIYA 1ORFA 1GBFA 5EQQA 3SYJA 3ATIA 1J17T 4ABBA 3RDZA 4JK6A 2G5VA 1OPHB 5A09A 4HI3A 2RCEA 1LKBA 1KDQB 1WTGH 1XKBC 3K6ZA 1LPGB 2BXUH 4A7IB 2YOLA 1GI1A 3BTEE 1GVKB 3TK5A 5T1VA 3SV7A 2EC9H 1EP5A 3ZZAA 1O2SA 3OTPA 2VWLA 2QXHA 3MOCA 3A7TA 2AGIX 1SLXB 2FOMB 2HRVA 1QBNA 3GY2A 3TPIZ 3TK6A 4BAQB 1OP0A 1QL9A 2PR3A 4I86A 4BAOB 1Y3UA 1K1OA 2H1UA 1GI0A 3N99A 3OEED 4OGXA 2ANKH 1D3QB 1TLDA 2TRMA 1EJAA 1A2CH 5DJ7A 1SQTA 2SNWA 1DWCH 1T4UH 2FESH 3ZZ6A 4ABDA 2JH5D 3BTDE 2FI5E 5DSFA 3LDXH 3MH6A 3TVJB 2RFKC 1GBDA 2V7QD 3FO8D 4O97A 2VWMA 2J98A 2A5AA 5FXLA 1C1VH 1HIAA 2BM2A 4B73A 2VIVA 3SU3A 5F8XA 4A1XA 2Q6FA 1UHBB 4BAHB 2SGAA 2IJOB 2ZHDA 1EKBB 5E0GA 1FPCH 1BMNH 1O5CB 2F9UA 1GBLA 1TX6A 1SOZA 1Y5UT 1SLVB 1SL3A 1P57B 1J8AA 1XUHA 4F55A 1AE8H 2FOAA 4Y79A 1SKYE 2HGTH 1IHSH 3E0PB 2AFQB 1G2LA 3A81A 4HZHA 2F4LA 3D23A 2BZ6H 3KYGA 2W6JD 3BF6H 2QA9E 4JMYA 1HAPH 1GG6C 1K1LA 1MQ6A 3A88A 1CVWH 3BEIB 3VB3A 1S6FA 2XRCA 5EXNA 2ZNKH 5JB9S 3LT3A 4HFPB 5SGAE 1ANEA 1RGQA 1F92A 1O3KA 4E7RG 1N8OB 3BSQA 3TJNA 4U2WA 3M61U 2WV9A 3A85A 1L1JA 2BD8A 2ZU4A 1BHXF 4IN1A 5JB8S 4AB9A 1BIOA 5HM9A 2ZDVH 1UVUH 5FCKA 1C1WH 1WXRA 2QF4A 2Z6BD 4GHTA 5A0BA 2W5EA 1AD8H 1GBHA 1JIRA 1VGCC 2J98B 1BTXA 5HM2A 1JIMA 1HIAB 2EA3A 3M7UA 4LZ1H 4A6LA 1LKAA 1QL8A 1FN8A 3KF2A 5JBTA 1Z8RA 1QURH 1UTLM 1LPKB 5PTPA 1RJXB 1G32B 1H8DH 5C17A 1DVAH 1T32A 3BIUH 7GCHG 1O2IA 1DWBH 2VGCB 1ZJKA 4Y76A 1HJAB 1ZPBA 2J2UA 1THSH 4ZXYH 1A5IA 4NWKA 1OXGA 3SBKA 2ANYA 4X2VA 1BOQA 2GP9B 4CRGA 2VIPA 2WPMS 3MO9A 4BAMB 1WSSH 4Z6AH 3U1JB 3A84A 1O2HA 2SGEE 3GYLB 1UTNA 2R2MB 1SVPA 1SBWA 1UW7A 1QA0A 1YPHC 2TGTA 2ZDNA 1GJ8B 1SGEE 1SC8U 4OS7A 2P8OC 4FUHA 4CREA 2H6MA 3W1EA 2CHAB 1O2KA 4ABJA 4NIWA 1VR1H 7GCHF 1K1JA 3KQ5A 3URCA 2FX6A 3TK9A 1VCPA 1HDTH 4FXGH 4ZKSU 1ARBA 1LVYA 2C90B 3CP7A 2CXVA 5LH8A 2V3OH 1LMWB 1HPGA 2ZPSA 3G01A 3GCTG 3U8TH 1YPLH 2RG3A 4LXBH 1AY6H 3K2UA 4DVAU 1GMHG 3C27B 1A5HA 4E7NA 1XUIA 1EP6A 1F0TA 1Y3VA 2J34A 4AFQA 3QZRA 1FV9A 4TSFD 1VCWA 2LPRA 2ZG0H 3EE0B 1HXEH 3SGQE 1SGNE 2PTNA 7KMEH 2WPJS 4JZEH 2ZCLP 3P92A 4ZHAA 4TWYA 1AUJA 2JH6D 1O3LA 3C1KA 4JZ1A 4UEHH 1TONA 5AVDA 4F4OC 3SGBE 1V2VT 5GNDA 3BTWE 3F3BA 1DT2A 2TPIZ 9LPRA 2D26C 3GCTF 3CS7A 1XM1A 3MMGA 3SJ9A 2ZU3A 2ANWA 3A7YA 1GMHF 3EAJA 3HK6B 1BMMH 1C5YB 1AWFH 1YPEH 5EPYA 2Y7XA 3SW2B 3W94A 2XW9A 1SQAA 1BZXE 1AI8H 1TNHA 1WOFA 2WV5A 1CQQA 2Y5GA 4IW4E 3PV4A 4IS5A 2WPKS 1SHYA 2GT7A 4FETA 3LJJA 1O0DH 5T3HA 1Y59T 1O3CA 1WYKA 2W7SA 1DM4B 6CHAC 3RXAA 1E0FD 3F6UH 1Y3WA 2ZDKA 4ABHA 3UY9A 1AFQB 3RXGA 1W3CA 2A7HA 1BRAA 5A8XA 5EW1H 3FP7E 2PSYA 1K1IA 2IOTA 3SUGA 3F68H 1G3DA 3ZYDA 4AYYB 2F9BH 3KN2A 1O38A 5CHAC 3ITIA 1O30A 2BY5X 5ETXA 1GHYH 2O9QA 2GV7A 4K5ZA 1K9OE 1TBQH 5C94A 2UWOA 1KIGH 1DXPA 1Y5AT 2PGQB 1ELBA 1CBWB 4OS5A 1P3CA 1T8MA 1PPGE 4JZFH 2CJIA 1K22H 2ZF0H 3BTME 3RXJA 2WUCA 3U8OH 2TGPZ 1W0ZU 3Q00A 1F0RA 1FY8E 2H5CA 4KGAA 2KFWA 1OKXA 5K7RA 1QRXA 3U1IB 2G8TA 1Y3XA 1ZRKA 2JETC 3EQ0H 2FI4E 3ATLA 3RC4A 3LU9B 4K2YA 2W7UA 1FXYA 3ZVAA 2G81E 2BQ6B 5C0TA 2ZEBA 1Z8JB 1G2MA 1GWAA 1Z1IA 2OQ5A 2H5DA 1IQEA 1A4WH 1JRTA 4NZQA 2BD5A 1BHXB 4B6FA 1E38B 1XXFA 2VH0A 3PLBA 2ZQ1A 4CHAC 2KCYA 3MHWU 1XXDA 4R0IA 3D65E 2V0BA 1UK2A 4ABIA 2FODA 2ZPRA 4CBOA 1VCQA 4INKA 2VVUA 3U69H 2TIOA 3MU8A 1O36A 1GBBA 1QBVH 4FOUC 2OTVA 3S9AA 4ZROA 4TY6A 3I78A 1HFDA 1W10U 2XXLA 2BZAA 1J15A 5FX5A 5C0UA 1CGIE 4YLUA 1W12U 1C5VA 1SLWB 1DDJA 4HGCA 1FY5A 2QXIA 3SV9A 1BTYA 2BY6X 1CA0B 2FZZA 1RFNA 2R2WU 2XC0A 4YT7H 2WPLS 2STBE 5C20A 3QX5H 1A5GH 2GX4A 3VGCB 1P2QA 1SSXA 4BTTB 2JJ2D 3SU0A 1JRSA 2UWLA 4U01A 3DCLA 1IHTH 2D8WA 2RA0A 2UUKB 2GMTB 2ZI2H 4NSYA 1MU8B 2J94A 2QXGA 4X1PU 1GJ6A 4K60A 4ZHLU 5EQSA 2C8XB 2ZU1A 3AASA 5F8TA 3A82A 4OS4A 2B8OH 2A5IA 3TJVA 1HCGA 1K1NA 1P03A 1GHVH 3A7XA 1ZGVA 1GI7B 1C4U2 2GDEH 1C5TA 1CSOE 1BRUP 1MAYA 3A7WA 2QCYA 1BT7A 1WDIA 4MQAA 1YY3A 1V2KT 2PKSC 3ZZCA 4I8JA 2ZO3H 3RU4T 3KQDA 2STAE 1ZYOA 1S6LA 1DWDH 1C2IA 1C5QA 2WINI 1G3EA 4KTCA 1A0JA 1TQ0B 1NPMA 5EW2H 4ASUD 2BVRH 4CH2B 1F0UA 1ANDA 1SOTA 1ZJDA 2B9LA 1DFPA 3KGPA 2WZQA 1BQYA 2P3TB 3LIWA 3Q77A 3NCLA 2G5NA 1EJMA 4ZAEA 1RXPA 4X2WA 2XYAA 1A0LA 5CHBA 2Y6TA 2FXRA 4NSVA 2PWXA 4ZMAH 3DFLA 2KAIA 1GVLA 2PHBA 1GVZA 3T62A 2BY9X 3PWCA 2KCPA 1CHOG 3MNXA 5TJXA 5E2PA 1G9IE 1UJ1A 1MBQA 3UWIA 1OP2A 2YMSC 2FYQA 1TGNA 2BY8X 4UONA 3MI4A 4KP0A 4WXVA 1O32A 4JZIA 1P2IA 4INLA 1KMHB 4DG4A 4Y71A 2BVXH 1GI6A 3LC3A 4CH8B 1AO5A 1H8ED 1O5AB 3M3VA 1GHZA 3RXIA 4ACBA 2LELA 1SI5H 1FI8A 1OWEA 1SQRA 3GICB 2TGDA 1NRSH 4Y8XA 1JBUH 3ZZ8A 3LGUA 3V0XA 4B2AA 1Z8IB 1PPCE 1C2FA 3RXRA 3P95A 3PO1B 2ZDMA 5FBIA 1O33A 3RXBA 7LPRA 4NA8A 1TABE 1C5SA 4Y10E 1CHOF 4OM9A 1E1RD 4CRCA 1HJ8A 2JKHA 1ZSLA 4NZLA 1OWDA 1O35A 3BTKE 5DGJA 2ZTZA 2A2QH 5EJLA 3NKKA 4HG6A 5LPRA 4NWLA 2Z9GA 3RLYH 5F8ZA 1GJDB 1YBWA 1SQOA 2I6QA 1C1TA 1GJCB 1E37B 1OYQA 4KTSA 2BDIA 1FONA 3DA9B 3LGIA 3T28A 4ABGA 1KDQA 2AMPA 4K8BA 2IN2A 4O9VA 4Z1MD 4ISIH 2BXTH 3GOVB 4I31A 2VIOA 5CDFE 4DGJA 4ZKOU 1O2VA 4FUFA 2ZC9H 4ISHH 1NY22 2A4OA 1WQVH 2ZPQA 1HAYB 2CV3A 4IMZA 1G3CA 1C1MA 2XBYA 3KCGH 2KAIB 1EZQA 3ZV9A 3T5FH 3H7TA 3EE7A 1IQJA 5A8ZA 3SO3A 3ATWA 4AB8A 4NFFA 1SPJA 1GBCA 3CENA 4ABFA 1V2MT 1TNIA 1TALA 1TB6H 3UIRA 3KYFA 2V6NA 3GYMA 1B0FA 1GDQA 4SGBE 4DJZB 2FX4A 4WF8A 1OWKA 4BTIB 5F6MA 1SG8B 8GCHG 4NCYA 3PLPA 1V2TT 1NT1A 2PKAB 2UUYA 1BB0B 1QB6A 1EX3A 3GCHC 1O31A 1L2EA 1C5PA 1GHAG 3JZ1B 4O3TA 3OEHD 1O5BB 1C2MA 2SNVA 3SORA 2W3KA 1UTJA 3W95A 1ARCA 1NFYA 2A4GA 1V2QT 1DLEA 3IITA 3OU0A 4KELA 2BDYA 1INCA 1FNIA 4UFEH 4OGYA 2WPHS 2A7CA 3GCOA 8GCHF 4H42U 4FUGA 1QZ8A 2BLQA 3E3TA 1QFKH 1Z6JH 2NU4E 3PB1E 1F7ZA 2NU3E 3K65B 3JZ2B 3SV6A 1T8NA 2BD2A 2M2AA 1FY1A 4NGAH 2OLGA 1C5LH 1LHDH 2QYIA 1GHAF 4CRAA 1K28D 2HNTF 2BD4A 3B9FH 1FY4A 1MTNB 3SQHE 1TBRH 8KME2 2PFEA 4AN7A 2RDEA 5IDKA 1A61H 1IAUA 1PQ5A 5A2MH 1UCYH 3EA7A 1LQDB 1SGIB 3O8CA 1BCUH 4BANB 4I33A 3FVFB 1GPZA 4NA9H 2VVCA 1GJ5H 1P12E 2AGEX 4AG1A 2H9HA 3PV2A 2D1JA 1KLTA 3E6PH 2AS9A 1HAZB 2FOFA 4WH6A 4JYUH 5EXLA 1S85A 4DIHH 1PPFE 1P01A 1YCPM 1S0QA 4DURA 1TPOA 4JYTA 1GBKA 2XWAA 4DIIH 1YP9A 1KXBA 3QTOH 2BOKA 5KECA 1NRRH 4YZUA 1TNKA 4AX9H 3KIDU 1TMTH 1HAGE 2A0QB 1XUJA 4X6OA 5AF9H 3MH5A 1ZGIA 3LH1A 3RU4E 1EAIA 1WU1A 6GCHG 3S9CA 1F0SA 4H6SB 3H09A 2ZQ2A 1NRPH 2OCVB 1C2HA 1F5LA 1LPZB 4IMQA 2J92A 2BLWA 1XUFA 1ZPCA 1BITA 2ZZUH 1BTHH 2JH0D 3PROA 4FUEA 3RM0H 4K1SA 4Y11E 2H2ZA 2ZFQH 4I8HA 2XBXA 1G3BA 2BD7A 1DOJA 3TLOA 5DPAA 4RKOB 4MPXA 2Z9IA 4VGCC 4GCHG 3PMBB 1BTPA 1BJUA 3ODFA 4AFUA 3GY5A 1C1PA 3RP2A 3NK8A 2HWLB 1GHXH 3A86A 2XNIA 1PQ7A 5CMXH 1HXFH 1GDUA 1N6XA 3UOUA 2Y80A 2XC5A 3MH4A 4YXWD 6GCHF 2Q6DA 4D7FA 5E8EH 4ZKRU 1HV7A 4IBLH 5HIZA 1BTUA 1P09A 2BDBA 4AFZA 1PPHE 1ZSKA 1MTSA 3CS0A 3SJ8A 4WH8A 1HAIH 1TWXB 1O3DA 5FPYA 3SUFA 1O2YA 1TMUH 4I7YH 1GCDA 2AIQA 2H9TH 1ZMJA 2ULLA 2BLOA 2FEQH 4GCHF 2AH4X 4Q7XA 1OX1A 1TNLA 1K1MA 4XBDA 2CN0H 2FTMA 1V2NT 3GY3A 1OP8A 3ZIAD 4BXWA 4E05H 2PUXB 4WJG2 2C93B 2VVVA 4K1TA 1UCYK 1ELGA 5EG4A 1GJAB 4Y7AA 4FUBA 1O34A 1UTMA 1THPB 1NESE 2GTBA 3F0OA 5L2YH 1OS8A 1XVMA 2BX3A 2GKVE 2VIWA 1KXDA 2O8UA 3SI3H 1JXPA 3IWMA 2R9PA 1IQNA 2WPIS 3A87A 4HTCH 2G4UA 1O3HA 3R0FA 3IG6B 3TGIE 4MNYA 3P6ZB 1E79D 3SQEE 1QB9A 3FZZA 3NZIA 5C5NA 2KCAA 3HGPA 2ZCKP 4NIVA 4YOIA 5EQRA 2NU2E 2GGVB 2ZECA 1GI4A 1PJPA 1H9LB 1W8BH 2GCHG 4U32A 1C9TA 1N8OC 1SFQB 1EB2A 2C4FH 4GLYA 1O3MA 1V2PT 5DP8A 3MTYA 4UFDH 5B6OA 3ZZ9A 4YLQH
chains in the Genus database with same CATH topology
5C5OA 4Y8YA 3PV5A 3EYDA 5H4IB 1AFEH 3FFGA 1BMLA 1RTKA 3GS9A 4Z0KA 2R3UA 1O2RA 3MFJA 2PTCE 4ASHA 1A0HB 2ZFFH 1TIOA 3LGVA 3TJOA 3UNQA 1SGYE 1PYTD 1HYLA 3ATKA 4O03A 4B76A 1TRYA 2C8ZB 2XNDD 5A0CA 2ESTE 3SU2A 3FKSD 3KQEA 2IPHA 2Y5HA 1G30B 1GJBB 3PRBA 5AFYH 4X6PA 3DT0H 1O3EA 2GCHF 4YESB 3UNRA 1GL1A 2F9NA 1SGTA 4E06H 1E35B 3ZVGA 2L6OA 2J38A 1Q3XA 2VGCC 1QA7A 1F5RA 1HJAC 2W6ID 3LC5A 2AHME 1TA6A 1UMAH 1D3PB 1O2UA 4X8TH 3VXEH 1QY6A 3DSOA 5DK1A 4ABEA 5I25A 1SR5C 5DO4H 1W2KH 2OINA 2Y82A 1ABJH 3ZZ5A 1KLJH 4TWWA 4DCDA 4MDSA 6CHAB 2BMGB 3DUXH 1AB9C 1GGDB 4ZH8A 4BNRA 2GZ9A 2OP9A 2F9VA 1MBMA 4O3UA 1GI3A 2C8WB 4FVDA 5T6FA 2CGAA 2CHAC 1S82A 3RMMH 3HKJB 3EA8A 1AGJA 2P3UB 1YYY1 1TNJA 1O3BA 1O3FA 2OK5A 1FZZA 1PQ8A 2FMJA 3LJOA 3MNSA 1S5SA 5CHAB 5CE1A 1FMGA 1Z8GA 2ZA5A 3U8RH 3RXLA 3ENSB 3QUMP 3N7OA 5HYOA 1C5NH 3Q76A 4ISNA 1QIXB 1W13U 1ZTJA 2AEIH 2ZFSA 4YT6H 3ZVDA 5F53A 4UD9H 3LONA 3AW0A 2AIPA 4AFSA 1PFXC 1QRZA 3MNBA 1C4V2 3KQCA 1EOJA 5DKMA 4AG2A 1FX0B 3UPEA 2GZ8A 2GD4B 1O5EH 2XCFA 4H6TA 1LO6A 4TY7A 3SUEA 1EAXA 1A3EH 1FQ3A 1QR3E 5GWZA 1C1OA 3KL6A 4Q63A 2ZHFH 1HRTH 4I8KA 1A1RA 3DSPA 3UWJH 1LHCH 5FX6A 4H4FA 1DPOA 1XMNB 2EI8A 1NN6A 2K1QA 1BMFD 4K8YA 3F9GA 4XD7D 4IC6A 1C2LA 3TNTA 1KY9A 5E0HA 1Z1JA 3K9XB 1QCPA 3ESTA 3WW7A 1Z7KA 2A32A 2YNBA 3SN8A 2ILNA 3A8BA 2ZGJA 1SGFG 3N7EA 1TPSA 4WMDA 1TPAE 3ZZDA 2HVXA 1DY9A 5GDSH 3M5LA 1AFQC 3HATH 4X0WU 5ESBA 1TGSZ 1ZLRA 2SGDE 5DG6A 3SHAH 1EFRD 1XUGA 3VG8A 3TGKE 1CT0E 3HPTB 1O3NA 3P17H 5IYTA 3UR9A 4X8UH 3OAAD 1O37A 5I46H 1TYNA 2EI7A 3A7VA 2HALA 1P9UA 2XBVA 3FN8A 1GHBG 3T29A 4MPVA 1EAWA 1MU6B 1EB1H 4GHQA 3VEQB 1TGCA 1BTWA 3DFJA 3UQOA 9ESTA 3M37A 3T27A 4DT7B 1GI9B 2ZU5A 3RMNH 3E1XB 1TQ7B 3T25A 5J4SA 2ZGXH 4TT3D 1FLEE 1QL7A 1OWIA 1BMAA 2FO9A 3BTHE 1XKAC 2Y7ZA 1H8HD 1CBWC 1YM0A 3LOXA 1RIWC 1E34B 1ESAA 5HXFA 1SGQE 1DY8A 4WXIA 3QGNB 3RXTA 3S7HB 3T26A 2G55A 1THRH 1UK3A 5AHGH 1QB1A 2A31A 1ELFA 3ZZBA 1HGTH 2P59A 5JBAS 1H4WA 1O3OA 3SZEA 1GHBF 3RXEA 1NROH 2PKSB 3VPKA 3NXPA 1B5GH 1C9PA 1V2UT 1MTVA 3PMHB 3SNEA 5GIBA 2VNTA 1P06A 2QN5T 3B23B 3HGNA 5HKKD 1ANBA 5A0AE 2ZFRH 3FP6E 3E16B 3OY5U 2HPPH 1M9UA 4NIXA 2WYGA 1BJVA 1HAXB 5BPEA 3ZZ7A 4Y0ZE 2QF0A 3DHKH 2C3SA 4CRDA 1IQKA 3AK5A 2UWPA 3Q3YA 2CK3D 1UVSH 2DUCA 2CF9H 3ZVEA 4BOHA 1LVOA 1OOKB 1YPMH 2XC4A 2GCTB 5JBBS 4BTUB 2SGPE 2JJ1D 1ETRH 2NWNA 1UVTH 1LHGH 2F83A 4TPIZ 3UFAA 2GVFA 2VWOA 4Y7BA 1D4PB 1C1QA 4X8VH 1NTPA 3N7DA 4NG9H 3MU4A 1WUNH 1O2GH 3SU5A 4M9FA 1HAOH 1GDNA 1QBOA 3TNSA 1IQLA 1CE5A 3DD2H 4IN2A 3VGCC 1ZMNA 1C1NA 1HLTH 1MUEB 2BDCA 3M7QA 3WY8A 1IQGA 1FPHH 3TITA 2G52A 1EXFA 2GMTC 2XOKD 4FU8A 1KSNA 4Y0YE 1B0EA 1C5ZB 1CA8B 1ZTLA 2FS9A 1SMFE 3AVZA 1DUEA 1EZSC 4Q7YA 2Z9LA 1ZZZA 3BTGE 3A7ZA 1NU7B 1GJ7B 2BDGA 2HNTE 1EPTC 2PKAA 1WTHD 4X2YA 1DICA 1V6DA 1WAYB 3BG4C 1MKWH 4Y8ZA 5DP7A 4WWYA 1L1GA 3P70B 3U9AH 1TBZH 1SGFA 3RUOA 2VINA 1QNJA 3GY6A 4LZ4B 1TAWA 4I8LA 5B6LA 3GISB 2YNAA 2WSSD 1T7CA 1C5UA 3LGTA 5T6GA 2FM2A 1UCYE 1MD8A 1O2TA 2OC0A 3UREA 5C3NA 3S0NA 1GCTB 4GAWA 1C1RA 4TYDA 2QY0B 1RD3B 3K6YA 2WUBA 5EPNA 3D49H 2O8WA 4GPGA 3UB0A 4DT4A 3A83A 4CR5A 5HMAA 3SOSA 1GI5A 2R0KA 2TGAA 5FPSA 3ZVFA 1ZMLA 1D9IA 1GL0E 1LTOA 2ZGCA 1KXAA 1RTLA 2AYWA 3STIA 5EXMA 2ZTXA 2BX4A 3GCHB 1GBTA 3FP8E 1SGDE 5C2ZA 3F9FA 1TOCB 5LGOA 1DWEH 1HAVA 2O8TA 4SGAE 5JYIA 2AMQA 1JWTA 1VITG 4JCNA 3PO1C 3RM2H 5EU8A 2Z3CA 2QF3A 3BEUA 1O2ZA 1PQAA 1FIZA 4B1TA 1O5FH 2WPDD 1LVMA 1W7XH 1UK4A 1EATA 1O3IA 1DX5M 3AAVA 1OYTH 2ZCHP 2BLVA 1TX8A 1P2MA 2QV1A 1V2LT 1O2LA 2R0LA 1QHRB 3B8JA 2A2XH 1WCZA 1VJAU 2BTCE 1L0ZA 2Z9JA 2FOEA 1ZTKA 4R8TB 2AERH 3HKIB 1S6HA 1MH0A 3GY7A 2BQWB 2F9OA 3SU6A 3QO6A 5JBCS 1VITF 4B6EA 2ZP0H 2BB4A 3BTTE 3KQBA 2OXSA 4K1EA 2KR7A 1P8VC 1ZHRA 1ABIH 2AGGX 4FUCA 3SNDA 1GI8B 2Z7FE 3RXDA 4B2CA 3Q3XA 1D6WA 5G4BA 4A5TS 1O39A 5A8YA 4MNXA 4MPUA 1MKWK 1TPPA 5L6NH 1TGTA 1NBMD 3VB7A 1PPBH 3M3TA 3P8GA 1A46H 1NM6A 1FDPA 5C1XA 2EI6A 4JZDH 1DSUA 3VXFH 5T6DA 1W14U 3F2FA 2ZHWH 4A1VA 4TPYA 4MVNA 4THNH 5EODA 4Q4LA 3QLPH 4RN6A 3ZZ3A 2PSXA 4INHA 1C5OH 1FAKH 2Q1JA 1NRNH 2FOHA 1BBRH 1J14A 1MABB 1P3EA 1D3TB 1HAVB 1HBTH 1AQ7A 1YKTA 1SLUB 3OFND 1B7XB 3FZDA 2WV4A 4FUDA 1SHHB 1QTFA 1O2QA 2BDAA 1CU1A 1O3AA 5C1YA 4X8SH 3QDZB 3I77A 1SFIA 2K8IA 1ELCA 2H9EH 4J2YB 1TRNA 1CT4E 3GCNA 3SNAA 4NFEA 1SGPE 5K0HA 1MZDA 3RXOA 1O2PA 4VGCB 3VFEA 1ZSJA 5C1UA 1FY3A 2OD3B 1AUTC 3Q3KA 4AGKA 1YPJH 1RS0A 2GV6A 2ZGBH 4UDWH 3RXKA 1TRMA 2B0FA 1DE7H 2G51A 1MTNC 1QJ7B 3VB6A 1IQMA 1GG6B 1BA8B 2GT8A 2UUFB 4B2BA 4FU9A 1TGBA 1EASA 1G37A 4GSOA 4MPWA 2P16A 1WQSA 3RMOH 4Q80A 1LHEH 4JYVH 1UVOA 1LCYA 2FPZA 2DE9A 1C2KA 4D76A 2KZ4A 3BN9A 1C5RA 1TMBH 1HAHH 3I29A 3FAOA 2G00A 4I32A 8LPRA 3TIUA 1ELVA 3MWIU 2A5KA 4ZUHA 3GY8A 2W26A 1MAXA 1AVWA 1QJ6B 2ZFTA 2ODQA 3TJUA 1EAUA 1ETSH 1V2RT 5JDUB 4AZ2B 1L4ZA 1ELDE 1O2OA 3QZQA 1OWJA 1DXWA 2J5UA 1N6YA 1GBMA 5DP9A 1VGCB 1P05A 1P10A 2J95A 2PLXA 1COWD 5DN6D 4XFQA 5JPMH 1GBEA 3A8CA 1GHWH 1KYNA 1ZR0A 3E90B 3AAUA 2ZDLA 1S0RA 2QGRA 1NRQH 4ABAA 3BIVH 1TA2A 1LQEA 3A8AA 3P8OA 3RMLH 1GMDG 3MU5A 3KNXA 1BTZA 3V7TA 1BBRK 3MO3A 1QQUA 2O8LA 3PM3A 2OC1A 1Y8TA 5DP5A 3WWBA 1Q2WA 2A1DB 1ELTA 1H9IE 1NC6A 4X6NA 1RRKA 1LDTT 1ZHMA 1K1PA 2W3IA 3NUMA 1WBGB 2BHGA 4GVUA 1SGRE 2P8OB 5BRRE 2BQ7B 4LOYH 3MO6A 4UFGH 3V12A 4FU7A 3UOPA 4D9QA 3STJA 6LPRA 2RA3A 2J4IA 2P93A 1IQFA 1FUJA 1GMDF 3SHCH 1DITH 3GDVA 1C2GA 1QGFA 2HPQH 3L33A 4XSKU 1AZ8A 3QK1A 1JOUB 3OSYA 3RXQA 2FOGA 1P2KA 4J1YA 1GJ4H 1TE0A 3SJIA 1J9CH 2ZHQH 4ZHMU 3L3TA 3O8DA 1KXEA 1C1UH 1T4VH 2FP7B 2C8YB 1NZQH 2O8MA 2UUJB 3HK3B 1KLIH 3SV8A 7ESTE 2WYJA 2ZIQH 2BYAX 1NS3A 1V2OT 2ZWLH 2FI3E 3MU0A 1AU8A 3RXVA 2AMDA 1V3XA 2OC8A 2J9NA 1N1LA 2ZU2A 3SGAE 4X1SU 4AOQA 1AB9B 1H9HE 4QT8C 3A8DA 1MCTA 1FAXA 1BUIA 1LVBA 2ASUB 1GJ9B 1EQ9A 2A4RA 3RXUA 3BEFB 1V2ST 3QN7A 1AVGH 4GUXA 5E2OA 3OTJE 1OHHD 1YF4A 2HLCA 2ZGHA 1EJNA 3P8FA 4B71A 1DSTA 1ESTA 2ZTYA 2F91A 2ZHEH 3V3MA 3RXHA 3SI4H 2QXJA 3H5CB 4XOJA 2FS8A 3P8NA 2VB0A 3MU1A 2OUAA 5EOKA 1XX9A 3S9BA 1YPGH 3EA9A 3H7OA 3KEEA 2A7JA 1O2MA 1T8OA 3RU4D 3SU4A 4ISOA 3RC6A 4X1NU 1C5MD 2GZ7A 2YMSD 4K69A 1NO9H 2Z94A 4DY7B 3PWBA 2DE8A 2Z9KA 1ETTH 1EZUC 1P11E 1GBIA 1MCVA 1OSSA 3OYPA 4A92A 2XTTB 3T2NA 4A1TA 1Z6EA 1ELEE 1XUKA 3M36A 3TH4H 4B75A 5GPIB 1MQ5A 1ZOMA 4WMFA 4YTAA 3SU1A 2WHXA 1P0SH 4MTBA 1EOLA 3RXCA 2HNTC 2B7DH 4MG3A 2A45B 1MKXH 1O3JA 4UE7H 4CR9A 3F2HA 1O3PB 4RKJB 2VIQA 1C5WB 4IGDA 2JETB 3E0NB 1IOEA 1LHFH 2OC7A 3PLKA 4K3JA 1Z71A 5FBEA 3PYHA 3M35A 3SZNA 1C4Y2 1GGDC 1BRBE 3UR6A 4NA7A 1S84A 3BG8A 1DS2E 1MMJN 4CBNA 1YLCA 5FHTA 1MTUA 3S7KB 5GXPA 1YCPH 2QE7D 1D3DB 1O2XA 2PGBB 4RSPA 3AW1A 1AHTH 1UTQA 2OBOA 4CHAB 1MZAA 4WY3A 3OX7U 1CHGA 6ESTA 1Y3YA 2PV9B 1TFXA 3M5OA 5DP6A 1RIWB 2XWBI 1NFXA 1G36A 5IK2D 4XBBA 1UTPA 1IQHA 2QC2A 1EUFA 1HJ9A 1K2I1 3U98H 1FN6A 5FPTA 5TCCA 1TOMH 1AKSA 1T8LA 1Y5BT 4Q7ZA 5F03A 5LPEA 2SGQE 2FTLE 5FAHA 3LPRA 4YO9A 1GBJA 3A80A 4AORA 2BOHB 1C5XB 1T31A 2I6SA 2IJD1 3RLWH 2HLDD 2V35A 3UTUH 3TH3H 1EPTA 1EZXC 3ZYEA 4Q2KA 2XBWA 1NFWA 2ALPA 1AVXA 4NIYA 2ODPA 5ESTE 3F2GA 2P95A 3RC5A 1DANH 3L6PA 4WVPE 2XCNA 5LPFA 1CGJE 3GY4A 4DW2U 1C2EA 1HB0B 3FOAA 5E0JA 1V2JT 3UNSA 3LGYA 1P9SA 3O8BA 3GDSA 3ZZ4A 2PUQH 2F43B 5FL7D 2Z3EA 1H1BA 1K21H 2FYRA 3SUDA 4I8GA 1HUTH 2VJ1A 1VZQH 1ZPZA 1MKXK 4KKDA 4LK4A 3PTNA 4MLFB 1S81A 1AMHA 4OS6A 4ZKNU 1P2OA 1VJ9U 3OE7D 1UVPA 3NPSA 1V2WT 1CGHA 5FCRA 1YPHE 3QTVH 2VBCA 1MTWA 3SNCA 5L30H 2BD9A 4BAKB 2B5TB 3SJKA 4B74A 3PMJA 2BD3A 1W7GH 2SGFE 4CRBA 3SV2H 4ESTE 1ESBA 1QJ1B 2CF8H 1YPKH 3MYWA 1TNGA 5GJ4B 2VWNA 4OS1A 1P2JA 1YCPK 1AKSB 1HNEE 2P94A 2YMSB 1XVOA 3S69A 3F0PA 3KHVA 3E91A 2ODYB 1PYTC 3ELAH 1C1SA 1NBME 5ABWA 4RI0A 4AGJA 1ANCA 3PTBA 1EPTB 1CA0C 1UTOA 3BG4B 4YOGA 1P2NA 2F9PA 2VIDA 1ELAA 5HGGA 2R3YA 5DP3A 2KCOA 2FDAA 1S83A 2TBSA 4Y6DA 3A89A 1DUAA 2BVSH