2ZDLA

Exploring trypsin s3 pocket
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cationic trypsin
publication title Congeneric but still distinct: how closely related trypsin ligands exhibit different thermodynamic and structural properties
pubmed doi rcsb
molecule tags Hydrolase/hydrolase inhibitor
total genus 59
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2007-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2zdlA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2zdlA02
1A61H 2G4UA 4JCNA 3F9GA 1TQ7B 1UHBB 3RP2A 1VGCB 1ZPZA 1N1LA 2AS9A 4YLUA 1HGTH 4KTSA 1KXFA 3U8TH 3T62A 1EJNA 2CJIA 1C1SA 3ODDA 1O37A 1AFQB 1TNLA 3UNSA 1QR3E 4IC6A 1BRBE 1TA6A 2PSXA 3K2UA 4NWKA 5B6OA 1A3BH 1O3KA 4FUJA 1YBWA 4NSYA 5L30H 2Q1JA 2FOAA 2NU4E 4K8BA 1V2JT 4INHA 1SQAA 3TPIZ 2HOBA 1XKAC 1UTLM 1QRZA 1C9TA 3ZVEA 1BHXB 2OD3B 1IQFA 2ZDLA 2BDYA 1DSTA 4K5ZA 1O3FA 1RIWC 1O2SA 1J8AA 1P05A 3FP8E 3HK6B 4YESB 3LGTA 1V2QT 5ABWA 1O2WA 3P8NA 2D2DA 3GY8A 1QJ1B 2VH6A 1O33A 3L6PA 3A7VA 4BAMB 2Z3DA 1HJ9A 1SLUB 1T8LA 3E0PB 1O2ZA 1GMCF 1DXWA 2PGBB 2ZF0H 1LPGB 1PPZA 3ZVDA 1A46H 4DGJA 3QGJA 2TRMA 4IMQA 4JMYA 1O3EA 2OC1A 3VXFH 1BJUA 5FBIA 3ZVGA 9ESTA 5G4BA 2XW9A 1MTVA 4Y10E 1UTOA 2PKSC 4K3JA 1UTQA 3K9XB 2G5VA 4LXBH 2P94A 1LVMA 1VR1H 3M7QA 1XXDA 1Y59T 1ETSH 3BSQA 1MTUA 2ZI2H 4LK4A 1KXDA 1SLXB 2ALPA 1VITH 2VGCC 1GHBG 1PPFE 2J38A 3LONA 2AH4X 2PLXA 3A84A 1NT1A 3UPEA 5E2PA 3SOSA 3RMNH 1TOMH 2GGVB 1UTMA 1P09A 1TNHA 1UK3A 2RA3A 5GDSH 1O2VA 2GDEH 3S9AA 3BTWE 1QGFA 3FP7E 4IGDA 5JBCS 1B0FA 4X0WU 3SJIA 4X6NA 1INCA 1YPKH 2OC7A 1GGDC 2VH0A 4FU9A 1GDUA 1BTYA 6LPRA 1JRTA 1SR5C 1GVLA 4NA9H 4U32A 1GMHG 1SC8U 3RXUA 3TH3H 3NZIA 4IS5A 3URDA 2DE8A 1C2FA 2VIVA 4WXIA 3MU4A 1UVPA 3NKKA 3RXJA 2BM2A 4WY3A 1SGYE 1UVUH 4K2YA 5E8EH 3L33A 4MPXA 2BDGA 1O2PA 1C5QA 1EJMA 2Z7FE 3P70B 3MO9A 2ZP0H 1W0YH 3R0FA 1IQMA 1C1VH 4D7GA 1AO5A 1O3GA 2WYGA 4KP0A 5EOKA 1ANCA 1MCTA 1XUHA 4AFZA 2P16A 4AFQA 1CBWC 4VGCC 2ANYA 2ZKSA 2BVXH 1CA8B 1N8OC 1SOTA 5I46H 1C1WH 2P93A 1AWFH 3I29A 1QA7A 1RS0A 3DT0H 1NU9A 1TBRH 3LOXA 5DG6A 2BXUH 4JK5A 5GJ4B 1O0DH 3BTME 3KNXA 1KYNA 4QT8C 3T5FH 2TPIZ 1DPOA 1S82A 1SSXA 2ZHWH 1AKSB 1DUEA 1BTZA 2XWAA 2FYQA 1ZOMA 1SB1H 1IQNA 1SI5H 3MO3A 5JBAS 1AB9C 1FN8A 1KY9A 3A7TA 2DE9A 1HIAA 2Y5HA 2OC8A 3FANA 4GUXA 1VGCC 1T31A 4X8TH 4AFSA 1GJCB 2GDDA 3U9AH 3E90B 1XUGA 2AGGX 1V2WT 3MFJA 5LGOA 4BTIB 1BBRH 1HAVA 1DLKB 1G32B 1HYLA 4MQAA 1AFQC 4CRDA 3EQ0H 3HKJB 3SNBA 4I8HA 1DWEH 1TNJA 1MAXA 3SI4H 1GBAA 1IHTH 2OCVB 3MTYA 1K9OE 2P3UB 3A89A 4JYVH 5J4SA 4FUEA 4X8SH 3MWIU 2ZU4A 1TABE 3GDVA 3SU6A 4WF8A 4ZMAH 1BA8B 1ESAA 2OTVA 3PMBB 1NS3A 1IQLA 4IMZA 4CH8B 4U2WA 5DP8A 4CRGA 1LVYA 1Q2WA 4JK6A 5E0GA 2H9EH 2ZDAH 2BY5X 4KELA 1KDQB 3VFEA 1J15A 2WPKS 3BTGE 5DP9A 3RC6A 2B7DH 4DG4A 1K1OA 1S0RA 5EXMA 4GHQA 3QN7A 1YPHE 1CU1A 4GPGA 3W94A 1PPGE 2OINA 2QY0B 1ANDA 3ODFA 1F5KU 3ZZBA 2ASUB 3I78A 1LHFH 1TX7A 5HGGA 1O2UA 1UJ1A 1LO6A 2ZFPH 3BN9A 2ZO3H 1AD8H 1TYNA 2XBXA 4J2YB 3TITA 1BHXF 1PQ8A 1O36A 1Z7KA 2GT8A 2G4TA 1LHCH 2BOHB 2P59A 1GI2A 2ZFRH 5EODA 3SJOA 2WUCA 3ZZ6A 2B9LA 3UWIA 3RXKA 2GVFA 5TCAA 2FODA 3SW2B 4Z6AH 3GY7A 4DURA 1F2SE 1K1MA 2VVVA 3MHWU 2OC0A 3M37A 2B0FA 5IYTA 3GDUA 3LGYA 5AHGH 1NRSH 3O8RA 1W7XH 5F8ZA 2A0QB 2A5IA 3UTUH 3HGNA 4IBLH 1C1OA 4D8NA 3VGCB 1HAPH 2BDBA 5DJ7A 1SGFA 3LJOA 1BTPA 1KTTB 4F4OC 1GBEA 5E0JA 1K2I1 2Q6DA 2BVSH 1ZTJA 4UONA 1A0JA 5FXLA 1GJ8B 2ANKH 4ZHLU 1A5IA 1WAYB 4IC5A 1DSUA 1YCPK 3D49H 5SGAE 5TJXA 2CGAA 4NFFA 1AWHB 3BEUA 1GMCG 8LPRA 1W12U 3MNBA 4CRFA 3MU8A 2FX6A 2HLCA 1MTWA 2P8OB 1PPCE 3M36A 1MBMA 3LIWA 2ZFFH 1OXGA 1AUJA 3LT3A 1THPB 3GOVB 2J94A 2XTTB 1LPKB 4YM9A 3SU2A 2G00A 1LVOA 4X2VA 3DFJA 1B7XB 4BXSA 2ZC9H 3SUFA 2BDHA 1D9IA 4J1YA 3BTEE 1TB6H 1K1PA 1FPCH 4D9QA 2UUKB 4H6SB 1JXPA 3HPTB 5JYIA 1C1UH 2A31A 1Y5AT 3SGQE 3TK6A 1V2VT 4OGXA 3QZRA 1TOCB 5E2OA 5EQRA 2GZ7A 1TAWA 2ZTYA 3E16B 2F83A 1H9HE 5CHAB 3OYPA 2BB4A 5T6DA 1ZTKA 3M61U 1K21H 1SFQB 2OQ5A 1O3HA 2NU1E 3A88A 1EQ9A 1FLEE 1AE5A 2TGTA 2V3HH 4Q80A 4NA7A 1BT7A 3ZVFA 2HNTE 4Y7BA 3T28A 1BTUA 1MQ5A 1T8NA 1UVTH 2QN5T 4OS6A 4AG1A 2Y7XA 1G30B 3JZ1B 3E0NB 3MYWA 2M5TA 2C90B 1NRQH 1O2MA 3IG6B 1GDQA 1K1NA 3A85A 4TY7A 1LMWB 1NFWA 1THSH 4Y8XA 3LC5A 2D8WA 2HPPH 4XSKU 3SU3A 2A45B 1EZSC 2Q6FA 2ZA5A 4WMDA 2OXSA 2A7HA 2FI4E 1OWHA 4AGJA 2ODQA 1P03A 1KXBA 1ELEE 1GBKA 1YCPM 2CHAB 3GYLB 1G2LA 2C93B 2ZQ2A 1EB1H 5C1UA 4ZHMU 3PV4A 1O2HA 3SJ9A 3VB5A 3QTOH 4CR9A 1HBTH 1F5RA 2VIQA 4WJG2 4YT6H 1TBZH 5A8ZA 3FAOA 4AYVB 5HMAA 3RXEA 3PTNA 2HNTF 1OWDA 2YNAA 1EATA 4ESTE 4TWYA 2ZDMA 1SVPA 4HFPB 3GY2A 3PMJA 2VB0A 2ZG0H 4SGBE 2ZU1A 1HJAB 2I6QA 4YOGA 4ASHA 4ZUHA 3B8JA 4MNYA 2O8TA 2WV5A 4BTUB 2VU8E 5L2ZH 1FV9A 5DP5A 1C2GA 1QBOA 3EA7A 1EZQA 1K28D 4Y8YA 1W14U 2GZ8A 2F3CE 1TIOA 1NRRH 2AMQA 3A7XA 1EUFA 4K1SA 2BVRH 2AMDA 2BXTH 3F9FA 1SQTA 1UVOA 2ILNA 3SNAA 4A1TA 1ZJDA 1GBJA 3SV6A 2J9NA 1UCYH 1KLIH 1ELBA 2NU0E 4O3TA 3PTBA 2IJOB 1A0LA 2ZHEH 2BLOA 2BDIA 1T7CA 2HVXA 1W2KH 3RXHA 4I7YH 5EU8A 5FPSA 5A2MH 3LPRA 4NWLA 1DWCH 1XKBC 1NFXA 4B74A 3ZZ5A 3EE0B 4JZEH 1F0RA 4ISNA 1OYQA 1QNJA 5FPYA 1UVSH 1ELFA 3UR9A 1WBGB 4UE7H 4UFDH 2A4QA 1SGQE 2PKAB 4K1EA 1MAYA 2CMYA 2BD2A 4A92A 4Y71A 1L4DA 3D65E 1MZAA 1E0FD 1KXEA 1ZMNA 3GY6A 2THFB 3TK9A 2ZFQH 3GCTF 1YPLH 2Z3CA 4FUFA 1RTLA 4JYTA 3ZZDA 3ITIA 3MMGA 1P12E 2H9HA 2FO9A 1C2KA 1RTKA 5EG4A 4FUBA 1PYTD 1GHAF 1SGNE 1MKXH 2VWLA 3SUDA 1T32A 1Z1JA 4RSPA 2C4FH 5IDKA 1RTFB 2Z9GA 3P8OA 4H4FA 2P8OC 4ZKSU 1C5LH 3S0NA 1B5GH 4INKA 5DO4H 2FOFA 2W3KA 3E1XB 3PO1B 2FTMA 2ZDKA 2ZU5A 2XBWA 4JYUH 1FY5A 2ZTZA 1TRMA 4Y76A 1SGIB 4I8GA 4MVNA 1AZZA 1IQEA 1FY1A 4BANB 2FESH 2R2MB 2OUAA 4JZDH 3U8OH 1IAUA 3TNTA 3UREA 1O5CB 3AAVA 5HM2A 3QGNB 2F9UA 1FMGA 4K60A 3SU0A 4JZ1A 2TGPZ 2ZGXH 1C4Y2 3ZVBA 2BY6X 2Y6TA 2F9BH 1EOLA 2ANWA 1QL9A 3S69A 2Z94A 1BTWA 5DKMA 1C1NA 1JOUB 2BOKA 1SL3A 3ZZ4A 1GBCA 5CHAC 1WTHD 3LH1A 4UFGH 4NFEA 1SMFE 5LPRA 1SGPE 2NWNA 3SO3A 4FUDA 2GV6A 1XUKA 2K1QA 5DGJA 1F5LA 1GVZA 4XE4A 1O3DA 4GLYA 2ODYB 2AGEX 1NC6A 1K22H 1GVKB 2ZDVH 2ZPSA 2SGQE 1JWTA 3EA8A 1GI3A 1OPHB 1ZTLA 3MNCA 3H5CB 1YPEH 2AIQA 4WMFA 4ZKNU 1CVWH 5T6FA 1QJ7B 4Y7AA 2BD9A 3A7ZA 3P8FA 4MPUA 2BQWB 3NPSA 3V12A 1TA2A 1YCPH 1C2MA 2PW8H 1C2DA 5C5NA 1Z1IA 2CHAC 1VJAU 2PWXA 2QF3A 1HAIH 3I77A 4ABHA 3UOPA 1EAIA 1YLCA 4ZH8A 1MCVA 1P2IA 2ZGHA 2A2XH 1GBMA 4GCHF 1S85A 3V7TA 4E7RG 2A4GA 1HAOH 1YGCH 1C5RA 5EXLA 2JKHA 1P2KA 1C1RA 1EAXA 1QCPA 1BQYA 2WPJS 3LGVA 4FU8A 4TWWA 5ESTE 1WOFA 1TRNA 1H8IH 1RFNA 4K1TA 4CH2B 4GSOA 3RM2H 2OBQA 4WXVA 5C3NA 2AYWA 1GBHA 4JZIA 5FHTA 3D23A 2OP9A 3ZZAA 1HJAC 1TPSA 1H9LB 2QA9E 1GJ9B 2SGFE 3S9CA 1TNIA 1O3NA 5ETXA 1MBQA 4DJZB 1TGSZ 2QXJA 1O39A 2ODPA 1KLJH 1A5HA 3DHKH 4FU7A 1ELVA 1ZGVA 3MU1A 1A2CH 2TIOA 2VIWA 5CMXH 3NXPA 3KQEA 1EPTA 4U30A 3RXOA 1J14A 3ZVCA 3RU4E 1V3XA 5LH8A 5BPEA 3GDSA 4X6OA 2RG3A 1P3EA 3UFAA 1CGJE 2J34A 5F03A 1GI8B 4UFFH 1S81A 1XUIA 1GHXH 1EOJA 2Y5GA 2ZECA 4H42U 4WH8A 1OP2A 2W26A 1TONA 1F92A 3VXEH 4B71A 1DLEA 1UTNA 4U01A 5JB8S 2ULLA 5FX6A 1PFXC 5DK1A 1HNEE 3S7KB 5DP7A 1O2XA 1EX3A 1PPEE 3H7TA 2O8UA 1S5SA 2BD8A 1YKTA 5BRRE 4RN6A 2W5EA 4UD9H 1J17T 1OP8A 3F68H 1U6QA 6GCHF 1BB0B 3RXVA 2A5KA 2ALVA 2VNTA 5C1YA 2LNCA 3ATWA 3L3TA 3SNCA 3SQEE 1FZZA 1O3CA 1A3EH 3FFGA 5I25A 1A5GH 1V2PT 4X1SU 5F6MA 1FNIA 2XWBI 5A0CA 3MH7A 4TPIZ 2P3FH 3TJVA 1BUIA 2J2UA 3K6YA 3PO1C 2VIDA 1O32A 4NIYA 4X8UH 2J4IA 3C1KA 1ZZZA 1SHHB 2XNIA 2XYAA 4MNWA 2QAAA 1H1BA 3A80A 3JZ2B 3PLBA 4KKDA 1UCYK 4ISLA 4AOQA 8GCHG 1WUNH 1ZYOA 2QGRA 5LPEA 2BX3A 3GISB 1Z8RA 2ZCHP 2FOEA 5HYOA 2QCYA 4A5TS 1ZRBA 4FVDA 4CRCA 3K65B 2FOBA 1C1PA 2QF0A 3RXIA 1BMMH 2UUJB 3SU4A 1AHTH 1OOKB 3A7WA 3GCTG 1UTKA 1GJ4H 4D7FA 1HIAB 2ZU2A 1V2NT 4OS7A 3BTKE 4OS1A 1HXFH 4BAKB 3T26A 1GHAG 1V2UT 5C1XA 1CE5A 1KXAA 1K1IA 1HAVB 2KAIA 1AVWA 2BDAA 1LHGH 1C5OH 3KHVA 3KQCA 1C9PA 1BCUH 1MKXK 3EAJA 3HK3B 5EPYA 1G2MA 3KCGH 2VWNA 2JETB 1X7AC 4DT7B 3UUZA 3NCLA 3ATMA 3TLOA 3RXMA 1F0TA 3V3MA 2QC2A 1ARBA 4X6PA 1T8OA 1E36B 2A4OA 2AEIH 1AFEH 1KLTA 3M5MA 1S6HA 3A8DA 2PR3A 4AGKA 3AW1A 2XC5A 1CA0B 3A82A 2VIPA 3VEQB 1V2TT 1L0ZA 7GCHF 1GHVH 2AFQB 2BY8X 2R2WU 1QL7A 1WSSH 3B23B 3RXAA 1YPHC 1HAYB 3SBKA 5K0HA 1HAZB 1O5DH 2JH5D 2FS8A 3TU7H 3AVZA 1TFXA 3ATIA 1AU8A 3LGUA 2PHBA 1XUJA 3PMHB 2UWPA 4Y0ZE 5TCCA 3VB3A 2B8OH 4BXWA 4R0IA 2G8TA 1GBLA 3A87A 2GMTB 2ZCKP 1QBNA 2PFEA 1KTSB 2XCFA 1F0SA 1K1LA 2C8ZB 1TMUH 1DE7H 3AAUA 2R3YA 3M3SA 3SV7A 1YYY1 1KXCA 1MTSA 2BZ6H 4Q7YA 1CT0E 1N6YA 3F1SB 3O8BA 4GAWA 3RXLA 3VB6A 4FXGH 1FIWA 4MLFB 1DWDH 3ZZ8A 1THRH 2VVCA 1V2RT 4GCHG 2AIPA 3P95A 1O2QA 2ZEBA 1N6XA 3MU5A 4HI3A 1S84A 2ZZUH 4ISHH 7ESTE 3QLPH 3RC5A 2XC4A 3A86A 1HAHH 1HRTH 1GJDB 5FAHA 4B73A 2FZZA 3A8AA 1GHWH 1OWIA 4WWYA 1DITH 1O3OA 3MI4A 1C1MA 4NZQA 1O5GH 1EXFA 4Y0YE 1C2HA 1P57B 1IHSH 3SUEA 4ABFA 5HXFA 1V2OT 3RXRA 2EI8A 1YLDA 2ZHDA 2C3SA 2FPZA 3TGJE 4TY6A 1HXEH 1FY8E 1DWBH 1AI8H 1KIGH 2FYRA 4ISOA 3P6ZB 1UTPA 3SU5A 3IITA 3ZZCA 4ZHAA 3BTFE 1Y3WA 3TVJB 1EKBB 1XVMA 3UOUA 3MU0A 1JBUH 1GPZA 2FOGA 1HJ8A 2P3TB 3HKIB 5EW2H 3CENA 3RU4T 1O2TA 4B1TA 1Z8IB 2Z9LA 4XBDA 3BTTE 1V2LT 2FLRH 2WINI 4AB8A 3SI3H 4THNH 2EA3A 2H6MA 1SQOA 3OY5U 3LGWA 1ELGA 1P2NA 1C2EA 4SGAE 3PWCA 3AASA 4YOIA 5AF9H 1G37A 1QA0A 1C5MD 3KL6A 4DY7B 4CR5A 3E6PH 1BTXA 4XBBA 1GBTA 2BX4A 5FPTA 2TGAA 2Z3EA 1YPMH 2G55A 3EGKH 3FZDA 3UQVA 1HV7A 1ELTA 1O2RA 1DY9A 2FM2A 1M9UA 2PV9B 4KTCA 2ZHQH 5GXPA 3S7HB 1O31A 1UTJA 1BMNH 1UK2A 4E7NA 1D6RA 1CGHA 1L2EA 2P95A 3BF6H 1LVBA 1QY6A 2HNTC 4YZUA 3RDZA 4LZ4B 2BY7X 1GJ5H 1PPBH 1O2JA 4IW4E 1V6DA 3M7UA 3Q00A 5EXNA 1CT4E 1S0QA 4Y6DA 1GBBA 3A83A 1HB0B 2SNWA 1GI6A 2OLGA 2BHGA 6GCHG 3FP6E 1P2MA 1OWJA 3P8GA 2BLWA 1V2ST 4X2YA 1DXPA 3CP7A 2BTCE 2UUFB 2PGQB 1OKXA 3U98H 4E05H 3ENSB 4A1XA 1TLDA 4M7GA 4K69A 3OY6U 1G3CA 1SGDE 3SNDA 3GCNA 1RIWB 1OWKA 3ZVAA 3A8CA 1SOZA 1DT2A 2W7UA 2ZDNA 3V13A 1C2LA 1ANBA 4I8JA 2FOMB 1FPHH 4AYYB 1C5WB 3O8CA 2BYAX 3DD2H 4WH6A 4ZAEA 1LHDH 2FDAA 2SGAA 2V6NA 2JETC 8KME2 2ZGCA 4AX9H 4YTAA 2WPLS 1GI9B 1GI1A 2RA0A 2ZFSA 1F0UA 1XXFA 1P11E 4X1NU 3VB4A 1C5PA 4I8LA 3RXSA 3RXQA 1XUFA 2FXRA 1Q31A 3ZYDA 1EB2A 1ZSJA 1CA0C 2PTCE 1O3LA 1Y3VA 4CBNA 3GY5A 3SHAH 2BD7A 5AVDA 1ZSLA 3D62A 1TGTA 4FUHA 4YT7H 1XX9A 4UFEH 1O5BB 3EDXB 1IQGA 4ABGA 3NK8A 2A1DB 4GHTA 4WVPE 2GV7A 1GBFA 1QL8A 1UO6A 1CQQA 1MD8A 1FIZA 1DOJA 1LCYA 3Q3YA 5JB9S 1DANH 2XBVA 1B0EA 2GCHF 3GICB 1ARCA 1GMDF 1RRKA 4Q7XA 5ESBA 3BIVH 2I6SA 5C5OA 1QRWA 3F9EA 2GMTC 2R0LA 2DUCA 1NPMA 1FAKH 1FAXA 3FVFB 2GTBA 1T4VH 1O3PB 1GGDB 1DX5M 1GI0A 1O3IA 4O03A 1ZHPA 5K7RA 3VGCC 1E35B 2ZQ1A 2GCTB 4B2AA 4ABDA 1GWAA 1F7ZA 4CBOA 2LPRA 1YPGH 2BQ7B 1VCWA 3LGIA 2ZHFH 7GCHG 4AB9A 1S6FA 1GG6B 3KN2A 4DOQA 1SGEE 1MH0A 1NFUA 3PM3A 3BG4B 1P8VC 1HAGE 4A6LA 3M5LA 3HGPA 3NUMA 4XOJA 3GCHB 3TJNA 1FI8A 1C5NH 2QYIA 2HPQH 1RGQA 1JMOH 1Z6EA 4AN7A 1GCDA 1CHOF 4D76A 4BNRA 1G9IE 3GY4A 3QO6A 4FUGA 3PMAB 2VINA 3PB1E 1P01A 1LKBA 1GBIA 1C5YB 3NWUA 1TRYA 3SV8A 2FWWA 3MH5A 4DIIH 3TIUA 3ELAH 3Q3KA 3TNSA 1AN1E 1G3DA 1XM1A 3SGAE 3STJA 1EP6A 4CRAA 3TH2H 3OSYA 1TPAE 1UHBA 1Y5UT 3VPKA 3A81A 2D26C 3T29A 4MNXA 4O97A 2UUYA 1NY22 4I33A 1EJAA 1LHEH 1MD7A 1DUAA 3KQDA 1HAXB 5T3HA 3LU9B 1NTPA 1K1JA 1QJ6B 4K8YA 3KF2A 1OX1A 2FOCA 4NIVA 5H4IB 3Q76A 5FCRA 1GJBB 1TGNA 4TYDA 1IQKA 2AGIX 1L1JA 2Z9KA 3E3TA 1BRUP 1AUTC 4X8VH 1L1GA 1YPJH 1Z8JB 5C20A 1A4WH 1XVOA 1JRSA 1C4U2 5GPIB 4ABAA 3SUGA 2EEKA 4BAOB 1GCTB 4OS5A 4NA8A 1T4UH 3QDZB 3T2NA 1YF4A 1WQSA 4R8TB 4X6MA 1ZPBA 3ZZ7A 2SNVA 2A7CA 3M3TA 1W10U 3MNXA 3SQHE 1W0ZU 2J95A 3BTQE 4CREA 1O3MA 1P2QA 4H6TA 1ZJKA 3MO6A 1FY3A 1FONA 2GX4A 3RXPA 1NESE 3VB7A 3SN8A 1EASA 4AFUA 1RJXB 1WU1A 1AMHA 9LPRA 4YOJA 1WTGH 3M7TA 3U1JB 3SZNA 5GCHF 4CHAB 2W7SA 3V0XA 2H9TH 5C2ZA 3OX7U 7KMEH 3DA9B 1O2GH 1C5ZB 1TWXB 4FUIA 1CO7E 1HFDA 2Z9IA 4NIWA 1O5AB 1JIRA 1SGCA 3BIUH 3ATLA 4BTTB 1AE8H 1ABJH 1RXPA 1LQDB 4I8KA 3M3VA 2FX4A 1P06A 1OP0A 1D3DB 1TBQH 2QXGA 1GHYH 3BV9B 1Y3YA 1OS8A 2IN2A 6CHAB 1ETTH 1ELDE 3LC3A 4A1VA 1HDTH 1CT2E 3TGIE 1O2OA 4NGAH 1MKWH 1TNGA 1FN6A 1LTOA 5JDUB 2CF9H 2RCEA 4O9VA 1EPTB 1NN6A 4HGCA 2A2QH 3P17H 1JIMA 1MTNB 5JBTA 1NO9H 3LJJA 1BOQA 3RM0H 1C5UA 2H5CA 2XC0A 2BD5A 1SLWB 2FIRH 1P10A 2HGTH 1QB1A 1S83A 4OS2A 1C5XB 1QQUA 3T25A 3ZV9A 1BZXE 3N7OA 5EW1H 2HALA 2TBSA 1CGIE 1ZHRA 2GCTC 3K6ZA 3SHCH 5A0AE 2ZTXA 5A8XA 1PQ5A 2BMGB 5AFYH 4B75A 1FY4A 4X2XA 1V2KT 2BLVA 1P2OA 1J16A 1ZHMA 3WY8A 1P04A 3ZZ9A 4WMEA 1QHRB 4X1QU 2VVUA 1ACBE 1GG6C 4MG3A 1BRCE 1QIXB 1GL0E 2B5TB 3BG4C 5FX5A 3ZYEA 2GKVE 4INLA 3GCHC 1ZPCA 4Y79A 4ZXYH 3RMOH 1TQ0B 2CV3A 3PLPA 1MU6B 1SHYA 1HCGA 2D1JA 2H5DA 2Y80A 4LZ1H 3SORA 1A0HB 2GCHG 1GMDG 3QWCH 4HTCH 3ZV8A 4B76A 2G5NA 1ZR0A 4ZXXH 2PUQH 4I31A 4KTUA 1D3TB 4XDEA 5DP6A 1AKSA 2UWLA 1ESBA 5C67A 1VZQH 3RXDA 3Q3XA 3E8LA 5AFZH 1DY8A 2PSYA 1VCPA 2ZPRA 3BEIB 1PJPA 2OQUA 1Q3XA 1VITF 1MMJN 1W11U 1WV7H 1BTHH 2J92A 1IOEA 3F6UH 7LPRA 1NRNH 3TJUA 3PLKA 1OYTH 1GHZA 1C2IA 2QXHA 4CRBA 4Q2KA 3DUXH 2HRVA 3SV2H 3RXFA 3ESTA 2ZU3A 1T8MA 3RUOA 1XMNB 2ZWLH 1LDTT 1GJ6A 2H2ZA 1CSOE 3QTVH 1ESTA 3U1IB 1O3AA 1VJ9U 4NCYA 4DIHH 4GVUA 4ZROA 1ZSKA 2KAIB 1C4V2 1ELCA 3S9BA 4DCDA 2C8WB 1GCTC 1RD3B 1CHOG 1O35A 1H4WA 1MZDA 2XBYA 4MPVA 2QXIA 3DFLA 3MOCA 2OBOA 2GT7A 1P3CA 1QFKH 1CHGA 2ZIQH 2WUBA 3RU4D 3QUMP 3R3GB 3A8BA 5PTPA 2ZGBH 4TPYA 1Z8GA 1SGFG 3F9HA 4AZ2B 5FBEA 1KDQA 1O3BA 1J9CH 2C8XB 1DM4B 2BZAA 1DFPA 4MDSA 1ZGIA 3IWMA 2YOLA 2R9PA 3TGKE 1AIXH 4OGYA 1BBRE 1ZRKA 1SBWA 1O5EH 1WQVH 3P92A 1O38A 2FMJA 3TH4H 3UWJH 4CHAC 5A09A 1O2NA 5DP3A 2ANMH 5JPMH 3W95A 4X1PU 3SJKA 3BTDE 3UY9A 4KGAA 4ABBA 2R0KA 1P9SA 2A7JA 1P9UA 3RMMH 3RMLH 4ISIH 2STAE 1TMTH 2BDCA 3BTHE 3GY3A 2A4RA 2TGDA 4A7IB 1ANEA 1GI4A 1TGBA 1ZLRA 2G52A 2HWLB 1Z6JH 6CHAC 1ABIH 4I32A 4Z0KA 1P0SH 1SGTA 1BDAA 1GL1A 3UQOA 1BIOA 1PQAA 1LQEA 2Y81A 3C27B 1EPTC 4NIXA 3RLYH 1W7GH 3CS7A 1TX8A 1BITA 1MTNC 1DS2E 1H8DH 1D6WA 3UNRA 3CS0A 2F9PA 1NU7B 1C1QA 3GYMA 4Y11E 2UWOA 1ELAA 5GCHG 4X2WA 1GI7B 1PQ7A 2ZPQA 5J4QA 1Y8TA 2ZNKH 1O2YA 2F9NA 2EI6A 2XRCA 5EPNA 2EC9H 1BRAA 3M5NA 2Y5FA 4OS4A 1TMBH 1GDNA 1E34B 1D4PB 3M5OA 2WPMS 1O2KA 3T27A 4ABIA 1WCZA 2EI7A 2H1UA 4NZLA 1C2JA 2W3IA 4FUCA 4YLQH 5HM9A 1O5FH 4RKJB 1C5SA 5A8YA 3RXBA 1G3EA 1SFIA 1A1RA 2XXLA 3A7YA 4HZHA 2Y82A 5FCKA 5DP4A 4ABJA 2ESTE 3AW0A 5CE1A 1D3PB 3KGPA 2XCNA 2F91A 2BLQA 4BAHB 3EA9A 2BD3A 1QB6A 4FVBA 3SV9A 2FI5E 2BD4A 3QX5H 3TK5A 2F9VA 1IQHA 4D9RA 1MKWK 1WYKA 2O8MA 3QK1A 1UMAH 5LPFA 3E91A 1L1NA 1BMAA 1SPJA 1GI5A 4ABEA 2AMPA 2A5AA 3EYDA 2GP9B 4UDWH 1NFYA 1O34A 3SU1A 1AQ7A 2ZGJA 3HATH 2BY9X 1MU8B 2SGEE 4LOYH 3Q77A 1AVGH 3PWBA 2CN0H 1TE0A 2Y7ZA 1EAUA 2VJ1A 2VWMA 5JBBS 2FOHA 1PYTC 3QZQA 4F49A 4O3UA 5F8TA 2V0BA 1GHBF 5EGMA 1TX6A 1GBDA 2RDLA 5A0BA 1ZMJA 1O30A 1SLVB 4ZKRU 1D3QB 1DVAH 1HPGA 1O2LA 3BG8A 2JH6D 1QBVH 4XFQA 1DICA 1NM6A 1W13U 5T6GA 3STIA 5DPAA 1QTFA 2Z6BD 1C1TA 2ZCLP 4MPWA 4IN1A 3KQBA 5E0HA 5EQQA 2FTLE 3SNEA 1GMHF 1TNKA 1IQJA 2CXVA 1Y3XA 1IQIA 3KIDU 4MNVA 4IN2A 3M35A 2O8LA 2BQ6B 2JH0D 4B2BA 1VITG 2Z9JA 2VWOA 2PKSB 3H7OA 3OU0A 1FQ3A 3PROA 1QURH 1LPZB 1P2JA 4E06H 2GZ9A 1C5TA 3O8DA 3U69H 4XBCA 4X1RU 3B9FH 3SGBE 1QRXA 1Y3UA 4Q7ZA 2Q6GA 2IOTA 2VGCB 4UEHH 2G51A 1HUTH 1PPHE 2FI3E 3SJ8A 2CF8H 1V2MT 3LH3A 4AG2A 1QQ4A 1ETRH 2NU2E 1HLTH 3OTJE 4BAQB 2F9OA 2O9QA 1FUJA 4MTBA 3RC4A 3ZZ3A 2PUXB 1QB9A 1TPOA 4PROA 3UIRA 1YC0A 1TGCA 1NRPH 2PTNA 1ID5H 3MH4A 2O8WA 3RXCA 1FXYA 1BJVA 1O3JA 1NZQH 1Z71A 1AZ8A 3PYHA 2QV1A 2IPHA 1BBRK 1NROH 3BEFB 3FZZA 1E38B 2PKAA 4NG9H 1E37B 1FDPA 1SG8B 2C8YB 8GCHF 1EP5A 2SGPE 3RXGA 4DVAU 1A7SA 1AGJA 5L6NH 3MH6A 3RLWH 5GWZA 1BMLA 4JZFH 1OSSA 1UK4A 1YM0A 2STBE 2WYJA 3MNSA 3GCOA 5F8XA 2FEQH 2GD4B 2NU3E 1UCYE 3UNQA 2G81E 3LKWA 4AORA 1FJSA 3G01A 2R3UA 2A32A 2WPIS 1AY6H 3KEEA 6ESTA 1CBWB 1AVXA 4VGCB 2QIQA 4RKOB 1DDJA 1OWEA 1N8OB 1C5VA 1ORFA 1EAWA 1EZXC 3TJOA 1H9IE 1LKAA 2WPHS 2FLBH 1W3CA 2FP7B 1TPPA 1MQ6A 1SGRE 1EZUC 1L4ZA 1GJ7B 1GJAB 1O2IA 2V3OH 1ZMLA 4ZKOU 1Y5BT 2SGDE 3URCA 2AERH 3U8RH 2SFAA 1KSNA 1MUEB 5L2YH 5EQSA 2WV4A 4YO9A 4NSVA 1VCQA 3UR6A 4Y8ZA 3RXTA 1G3BA 2VIOA 4B2CA 3LDXH 1P02A 2ZFTA 1G36A 1AB9B 1YP9A 1TALA 3ATKA 5GIBA 2FS9A 4BOHA 4DW2U 8ESTE 2YNBA 2V35A 1W8BH
chains in the Genus database with same CATH superfamily
1A61H 2G4UA 4JCNA 3F9GA 1TQ7B 1UHBB 5KGOA 3RP2A 2L6OA 1VGCB 1ZPZA 1N1LA 3DSPA 2AS9A 4YLUA 1HGTH 4KTSA 1KXFA 3U8TH 3T62A 1EJNA 4Q63A 2CJIA 1C1SA 3ODDA 1O37A 1AFQB 1TNLA 3UNSA 1QR3E 4IC6A 1BRBE 1TA6A 2PSXA 3K2UA 4NWKA 5B6OA 1A3BH 1O3KA 4FUJA 1YBWA 4NSYA 5L30H 2Q1JA 2FOAA 2NU4E 4K8BA 1V2JT 4INHA 1SQAA 3TPIZ 2HOBA 1XKAC 1UTLM 1QRZA 1C9TA 3ZVEA 1BHXB 2OD3B 1IQFA 2ZDLA 2BDYA 1DSTA 4K5ZA 1O3FA 3N7DA 1RIWC 1O2SA 1J8AA 1P05A 4HG6A 3FP8E 3HK6B 4YESB 3LGTA 1V2QT 5ABWA 1O2WA 3P8NA 2D2DA 3GY8A 1QJ1B 2VH6A 1O33A 3L6PA 3A7VA 4BAMB 2Z3DA 1HJ9A 1SLUB 1T8LA 3E0PB 1O2ZA 1GMCF 1DXWA 2PGBB 2ZF0H 1LPGB 1PPZA 3OEED 3ZVDA 1A46H 4DGJA 3QGJA 2TRMA 4IMQA 4JMYA 1O3EA 2OC1A 3VXFH 1BJUA 4RT0A 5FBIA 3ZVGA 9ESTA 5G4BA 2XW9A 1MTVA 4Y10E 1UTOA 2PKSC 4K3JA 1UTQA 3K9XB 2G5VA 4LXBH 2P94A 1LVMA 1VR1H 3M7QA 4YXWD 1XXDA 1Y59T 1ETSH 3BSQA 1WDIA 1MTUA 2ZI2H 4LK4A 1KXDA 1SLXB 2ALPA 1VITH 2VGCC 1GHBG 1PPFE 2J38A 3LONA 2AH4X 2PLXA 3A84A 1NT1A 3UPEA 5E2PA 3SOSA 3RMNH 1TOMH 2GGVB 1UTMA 4B6EA 1P09A 1TNHA 1UK3A 2RA3A 5GDSH 1O2VA 3CNRA 2GDEH 3S9AA 3BTWE 1QGFA 3FP7E 4IGDA 5JBCS 1B0FA 4X0WU 3SJIA 4X6NA 1INCA 1YPKH 2OC7A 1GGDC 2VH0A 4FU9A 1GDUA 1BTYA 6LPRA 1JRTA 1SR5C 1GVLA 4NA9H 4U32A 1GMHG 1SC8U 2J5UA 2YMSD 3RXUA 3TH3H 3NZIA 4IS5A 3URDA 2DE8A 1C2FA 2VIVA 4WXIA 3MU4A 1UVPA 3NKKA 3RXJA 2BM2A 4WY3A 1SGYE 1UVUH 4K2YA 5E8EH 3L33A 4MPXA 2BDGA 1O2PA 1C5QA 2LELA 1EJMA 2Z7FE 3P70B 5CHBA 3MO9A 2ZP0H 1W0YH 3R0FA 1IQMA 1C1VH 4D7GA 1AO5A 1O3GA 2WYGA 4KP0A 5EOKA 1ANCA 1MCTA 1XUHA 4AFZA 2P16A 4AFQA 1CBWC 4VGCC 2ANYA 2ZKSA 2BVXH 1CA8B 1N8OC 1SOTA 5I46H 1C1WH 2P93A 1AWFH 3I29A 1QA7A 1RS0A 3DT0H 1NU9A 1TBRH 1W0KD 3LOXA 5DG6A 2BXUH 4JK5A 4ACAA 5GJ4B 1O0DH 3BTME 3KNXA 1KYNA 4QT8C 3T5FH 2TPIZ 1DPOA 1S82A 1SSXA 2ZHWH 1AKSB 1DUEA 1BTZA 3VG8A 2XWAA 2FYQA 1ZOMA 1SB1H 1IQNA 1SI5H 3MO3A 5JBAS 1AB9C 1FN8A 1KY9A 3A7TA 5DSFA 2DE9A 1HIAA 2Y5HA 2OC8A 3FANA 4GUXA 1NBME 1VGCC 1T31A 4X8TH 4AFSA 1GJCB 2GDDA 3U9AH 3E90B 1XUGA 2AGGX 1V2WT 3MFJA 5LGOA 4BTIB 1BBRH 1HAVA 1DLKB 1G32B 1HYLA 4MQAA 1AFQC 4CRDA 3EQ0H 3HKJB 3SNBA 3AK5A 4I8HA 1DWEH 1TNJA 1MAXA 2RDEA 3SI4H 1GBAA 1IHTH 2OCVB 3MTYA 1K9OE 2P3UB 3A89A 1W0JD 4JYVH 5J4SA 4FUEA 4X8SH 3MWIU 2ZU4A 1TABE 3GDVA 3SU6A 4WF8A 4ZMAH 1BA8B 1ESAA 2OTVA 3PMBB 3WWBA 1NS3A 1IQLA 4IMZA 4CH8B 4U2WA 5DP8A 4CRGA 1LVYA 1Q2WA 4JK6A 5E0GA 2H9EH 2ZDAH 2BY5X 4KELA 1KDQB 3VFEA 1J15A 2WPKS 3BTGE 5DP9A 3RC6A 2B7DH 4DG4A 1K1OA 1S0RA 5EXMA 4GHQA 2JJ2D 3QN7A 1YPHE 1CU1A 4GPGA 2KCAA 3W94A 1PPGE 2OINA 2QY0B 1ANDA 3ODFA 1F5KU 3ZZBA 2ASUB 3I78A 1LHFH 1TX7A 5HGGA 3OE7D 1O2UA 1UJ1A 1LO6A 2ZFPH 3BN9A 2ZO3H 1AD8H 1TYNA 2XBXA 4J2YB 3TITA 1BHXF 1PQ8A 1O36A 1Z7KA 2GT8A 2G4TA 1LHCH 2BOHB 2P59A 1GI2A 2ZFRH 5EODA 4AC9A 3SJOA 2WUCA 3ZZ6A 2B9LA 3UWIA 5HKKD 3RXKA 2GVFA 5TCAA 2FODA 3SW2B 4Z6AH 3GY7A 4DURA 1F2SE 1K1MA 2VVVA 3MHWU 2OC0A 3FOAA 3M37A 2B0FA 5IYTA 3GDUA 3LGYA 5AHGH 1NRSH 3O8RA 1W7XH 5F8ZA 2A0QB 2A5IA 3UTUH 3HGNA 4IBLH 1C1OA 4D8NA 2JDID 3VGCB 1HAPH 2BDBA 5DJ7A 1SGFA 3LJOA 1BTPA 1KTTB 4F4OC 1GBEA 5E0JA 1K2I1 2Q6DA 2BVSH 1ZTJA 4UONA 1A0JA 5FXLA 1GJ8B 2ANKH 4ZHLU 1A5IA 1WAYB 4IC5A 1DSUA 1YCPK 3D49H 5SGAE 5TJXA 2CGAA 4NFFA 1AWHB 3BEUA 1GMCG 8LPRA 1W12U 3MNBA 4CRFA 3MU8A 2FX6A 2HLCA 1MTWA 2P8OB 1PPCE 3M36A 1MBMA 3LIWA 2EY4C 2ZFFH 1OXGA 1AUJA 3LT3A 1THPB 3GOVB 2J94A 2XTTB 4DT4A 1LPKB 4YM9A 3SU2A 2G00A 1LVOA 4X2VA 3DFJA 1B7XB 4BXSA 2ZC9H 3SUFA 2BDHA 1D9IA 4J1YA 3BTEE 1TB6H 4XRNA 1K1PA 1FPCH 4D9QA 2UUKB 4H6SB 1JXPA 3HPTB 5JYIA 1C1UH 2A31A 1Y5AT 3SGQE 3TK6A 1V2VT 4OGXA 3QZRA 1TOCB 5E2OA 5EQRA 2GZ7A 1TAWA 2ZTYA 3E16B 2F83A 1H9HE 5CHAB 3OYPA 2BB4A 5T6DA 1ZTKA 3M61U 1K21H 1SFQB 2OQ5A 1O3HA 2NU1E 3A88A 1EQ9A 1FLEE 1AE5A 2TGTA 2V3HH 4Q80A 4NA7A 1BT7A 3MQKC 3ZVFA 2HNTE 4Y7BA 3T28A 1BTUA 1MQ5A 1T8NA 1UVTH 2QN5T 4OS6A 3ZIAD 2QF5A 4AG1A 2Y7XA 1G30B 3JZ1B 3E0NB 3MYWA 2M5TA 2C90B 1NRQH 1O2MA 3IG6B 1GDQA 1K1NA 3A85A 4TY7A 1LMWB 1NFWA 1THSH 4Y8XA 3LC5A 2D8WA 2HPPH 4XSKU 3SU3A 2A45B 1EZSC 2Q6FA 2ZA5A 4WMDA 2OXSA 2A7HA 2FI4E 1OWHA 4AGJA 2XNDD 2ODQA 1P03A 1KXBA 1ELEE 1GBKA 1YCPM 2CHAB 3GYLB 4XD7D 1G2LA 2C93B 2ZQ2A 1EB1H 2J98B 3WWFA 5C1UA 4ZHMU 3PV4A 1O2HA 3SJ9A 3VB5A 3QTOH 4CR9A 1HBTH 1F5RA 2VIQA 4WJG2 4YT6H 1TBZH 5A8ZA 3FAOA 4AYVB 5HMAA 3RXEA 3PTNA 2HNTF 1OWDA 2YNAA 1EATA 4ESTE 4TWYA 2ZDMA 1SVPA 4HFPB 3GY2A 3PMJA 2VB0A 2ZG0H 4SGBE 2ZU1A 1HJAB 2I6QA 4YOGA 4ASHA 4ZUHA 3B8JA 4MNYA 2O8TA 2WV5A 4BTUB 2VU8E 5L2ZH 1FV9A 5DP5A 1C2GA 1QBOA 3EA7A 1EZQA 1K28D 4Y8YA 1W14U 2GZ8A 2F3CE 1TIOA 4Z1MD 1NRRH 5HIYA 2AMQA 3A7XA 1EUFA 4K1SA 2BVRH 2V7QD 2AMDA 2BXTH 3F9FA 1SQTA 3UAIC 1UVOA 2ILNA 3SNAA 4A1TA 1ZJDA 1GBJA 3GS9A 3SV6A 2J9NA 1UCYH 1KLIH 1ELBA 2M2AA 2NU0E 3PTBA 4O3TA 2IJOB 2QE7D 1A0LA 2ZHEH 2BLOA 2BDIA 1T7CA 2HVXA 1W2KH 3RXHA 4I7YH 5EU8A 5FPSA 5A2MH 3LPRA 4NWLA 1DWCH 1XKBC 1NFXA 4B74A 3ZZ5A 3EE0B 4JZEH 1F0RA 4ISNA 1OYQA 1QNJA 2OK5A 5FPYA 1UVSH 1ELFA 3UR9A 1WBGB 4UE7H 4UFDH 2A4QA 1SGQE 2PKAB 4K1EA 1MAYA 2CMYA 2BD2A 4A92A 4Y71A 1L4DA 3D65E 1MZAA 1E0FD 1KXEA 1ZMNA 3GY6A 2THFB 3NRLA 3TK9A 2ZFQH 3GCTF 1YPLH 2Z3CA 4FUFA 1RTLA 4JYTA 2K8IA 3ZZDA 3ITIA 3MMGA 1P12E 5EJ1A 2H9HA 2FO9A 1C2KA 1RTKA 5EG4A 4FUBA 1PYTD 1GHAF 1SGNE 1MKXH 2VWLA 3SUDA 1T32A 1Z1JA 4RSPA 2C4FH 5IDKA 1RTFB 2Z9GA 3P8OA 4H4FA 2P8OC 4ZKSU 1C5LH 3S0NA 1B5GH 4INKA 5DO4H 2FOFA 2W3KA 3E1XB 3PO1B 2FTMA 2ZDKA 2ZU5A 2XBWA 4JYUH 1FY5A 2ZTZA 1TRMA 4Y76A 1SGIB 4I8GA 4MVNA 1AZZA 1IQEA 1FY1A 4BANB 2FESH 2R2MB 2OUAA 4JZDH 3U8OH 1IAUA 3TNTA 3UREA 5IK2D 1O5CB 3AAVA 5HM2A 1BMFD 3F3BA 3QGNB 2F9UA 1FMGA 3EE7A 4K60A 4JZ1A 3SU0A 2TGPZ 2ZGXH 1C4Y2 3ZVBA 2BY6X 2Y6TA 3N7EA 2F9BH 1EOLA 2ANWA 1QL9A 3S69A 2Z94A 2GJGA 1BTWA 5DKMA 1C1NA 1JOUB 1FX0B 2BOKA 1SL3A 3H09A 3ZZ4A 1GBCA 5CHAC 1WTHD 3LH1A 4UFGH 4NFEA 1SMFE 5LPRA 1SGPE 2NWNA 3SO3A 4FUDA 2GV6A 1XUKA 2K1QA 5DGJA 1F5LA 1GVZA 4XE4A 1O3DA 4GLYA 5EJLA 2ODYB 2AGEX 1NC6A 1K22H 1GVKB 2ZDVH 2ZPSA 2SGQE 1JWTA 3EA8A 1GI3A 1OPHB 1ZTLA 3MNCA 3H5CB 1YPEH 2AIQA 4WMFA 4ZKNU 1CVWH 5T6FA 1QJ7B 4Y7AA 2BD9A 3A7ZA 4ZCNA 3P8FA 4MPUA 2BQWB 3NPSA 3V12A 1TA2A 1YCPH 1C2MA 2PW8H 1C2DA 5C5NA 1Z1IA 2CHAC 1VJAU 2PWXA 2QF3A 1HAIH 3I77A 4ABHA 3UOPA 1EAIA 1YLCA 4ZH8A 1MCVA 1P2IA 2ZGHA 2A2XH 1GBMA 4GCHF 1S85A 3V7TA 4E7RG 2A4GA 1HAOH 1YGCH 1C5RA 5EXLA 2JKHA 1P2KA 1C1RA 1EAXA 1QCPA 1BQYA 2WPJS 3LGVA 4FU8A 4TWWA 5ESTE 1WOFA 1TRNA 1H8IH 1RFNA 4K1TA 4CH2B 4GSOA 3RM2H 2OBQA 2L74A 4WXVA 5C3NA 2AYWA 1GBHA 4JZIA 5FHTA 3D23A 2OP9A 3ZZAA 5KEDA 1HJAC 2F4LA 1TPSA 1H9LB 2QA9E 1GJ9B 2SGFE 2WSSD 1TNIA 3S9CA 1O3NA 5ETXA 1MBQA 4DJZB 1TGSZ 2QXJA 1O39A 2ODPA 1KLJH 1A5HA 3DHKH 4FU7A 1ELVA 1ZGVA 3FKSD 3MU1A 1A2CH 2TIOA 2VIWA 5CMXH 3NXPA 3KQEA 1EPTA 4U30A 3RXOA 1J14A 3ZVCA 3RU4E 1V3XA 5LH8A 5BPEA 3GDSA 4X6OA 2RG3A 1P3EA 3UFAA 1CGJE 2J34A 5F03A 1GI8B 4UFFH 1S81A 1XUIA 1GHXH 1EOJA 2Y5GA 2ZECA 3KQ5A 4H42U 4WH8A 1OP2A 2W26A 1TONA 1F92A 3VXEH 4B71A 1DLEA 1UTNA 4U01A 5JB8S 2ULLA 5FX6A 2KR7A 1PFXC 5DK1A 1HNEE 3S7KB 5DP7A 1O2XA 1EX3A 1PPEE 3H7TA 2O8UA 1S5SA 2BD8A 1YKTA 5BRRE 4RN6A 2W5EA 4UD9H 1J17T 1OP8A 3F68H 1U6QA 6GCHF 1BB0B 3RXVA 2A5KA 2ALVA 2VNTA 5C1YA 2LNCA 3ATWA 4B6FA 3L3TA 3SNCA 3SQEE 1FZZA 1O3CA 1A3EH 3FFGA 5I25A 1A5GH 1V2PT 4X1SU 5F6MA 1FNIA 2XWBI 5A0CA 3MH7A 4TPIZ 2P3FH 3TJVA 1BUIA 2J2UA 3K6YA 3PO1C 2VIDA 1O32A 4NIYA 4X8UH 2J4IA 3C1KA 1ZZZA 1SHHB 2XNIA 2XYAA 4MNWA 1E79D 5B6LA 2QAAA 1H1BA 3A80A 3JZ2B 3PLBA 4KKDA 1UCYK 4ISLA 4AOQA 8GCHG 1WUNH 1ZYOA 2QGRA 5LPEA 2BX3A 3GISB 1Z8RA 2ZCHP 5C17A 2FOEA 5HYOA 2QCYA 4A5TS 1ZRBA 4FVDA 4FOUC 4CRCA 3K65B 2FOBA 1C1PA 2QF0A 3RXIA 1BMMH 2UUJB 3SU4A 1AHTH 1OOKB 3A7WA 3GCTG 1UTKA 1GJ4H 4D7FA 1HIAB 2ZU2A 1V2NT 5F53A 4OS7A 3BTKE 4OS1A 1HXFH 4BAKB 3T26A 1GHAG 1V2UT 5C1XA 1CE5A 1KXAA 1K1IA 1HAVB 1SKYE 2KAIA 1AVWA 2BDAA 1LHGH 1C5OH 3KHVA 1SQRA 3KQCA 1C9PA 1BCUH 4RT1A 1H8HD 1MKXK 3EAJA 3HK3B 5EPYA 1G2MA 5FL7D 3KCGH 2VWNA 2JETB 1X7AC 4DT7B 3UUZA 3NCLA 3ATMA 3TLOA 3RXMA 1F0TA 3V3MA 2QC2A 1ARBA 3DCLA 2WZQA 4X6PA 1T8OA 1E36B 2WHXA 2A4OA 2AEIH 1AFEH 1KLTA 3M5MA 1S6HA 3A8DA 2PR3A 4AGKA 3AW1A 2XC5A 1CA0B 3A82A 2VIPA 3VEQB 1V2TT 1L0ZA 7GCHF 2KZ4A 1GHVH 2AFQB 2BY8X 2R2WU 1QL7A 1WSSH 3B23B 3RXAA 1YPHC 1HAYB 3F2HA 3SBKA 5K0HA 1HAZB 1O5DH 2JH5D 2FS8A 3TU7H 3AVZA 1TFXA 3ATIA 4ACBA 1AU8A 3LGUA 2PHBA 1XUJA 3PMHB 2UWPA 4Y0ZE 3SYJA 5TCCA 3VB3A 2B8OH 4BXWA 4R0IA 2G8TA 1GBLA 3A87A 2GMTB 2ZCKP 1QBNA 2PFEA 1KTSB 2XCFA 1F0SA 1K1LA 2C8ZB 1TMUH 1DE7H 3AAUA 1H8ED 2R3YA 3M3SA 3SV7A 1YYY1 1KXCA 1MTSA 2BZ6H 4Q7YA 1CT0E 1N6YA 3N99A 3F1SB 3O8BA 4GAWA 3RXLA 3VB6A 4FXGH 1FIWA 4MLFB 1DWDH 2KCPA 3ZZ8A 2QF4A 1THRH 2VVCA 1V2RT 4GCHG 2AIPA 3P95A 1O2QA 2ZEBA 1N6XA 3MU5A 4HI3A 1S84A 2ZZUH 4ISHH 7ESTE 3QLPH 3RC5A 2XC4A 3A86A 1HAHH 1HRTH 1GJDB 5FAHA 4B73A 2FZZA 3A8AA 1GHWH 1OWIA 4WWYA 1DITH 1O3OA 3MI4A 1C1MA 4NZQA 1O5GH 1EXFA 4Y0YE 1C2HA 1P57B 1IHSH 3SUEA 5C94A 4ABFA 5HXFA 1V2OT 3F2GA 4FETA 3RXRA 2EI8A 1YLDA 2ZHDA 2C3SA 2FPZA 3TGJE 4TY6A 1HXEH 3OTPA 1FY8E 1DWBH 1AI8H 1KIGH 5C0TA 2FYRA 4ISOA 3P6ZB 1UTPA 3SU5A 3IITA 3ZZCA 4ZHAA 2J97A 3BTFE 1Y3WA 3TVJB 1EKBB 1XVMA 3UOUA 3MU0A 1JBUH 1GPZA 2FOGA 1HJ8A 2P3TB 3HKIB 5EW2H 3CENA 3RU4T 1O2TA 4B1TA 1Z8IB 2Z9LA 4XBDA 3BTTE 1V2LT 2FLRH 2WINI 4AB8A 3SI3H 4THNH 2EA3A 2H6MA 1SQOA 3OY5U 3LGWA 1ELGA 1P2NA 1C2EA 4SGAE 3PWCA 3AASA 4YOIA 5AF9H 1G37A 1QA0A 1C5MD 3KL6A 4DY7B 4CR5A 3E6PH 1BTXA 4XBBA 1GBTA 2BX4A 5FPTA 2TGAA 2Z3EA 1YPMH 1E1RD 5DN6D 2G55A 5GNDA 3EGKH 3FZDA 3UQVA 1HV7A 5T1VA 1ELTA 1O2RA 1DY9A 2FM2A 1M9UA 2PV9B 4KTCA 2ZHQH 2YMSB 5GXPA 3S7HB 1O31A 1UTJA 1BMNH 1UK2A 2KX4A 1D6RA 1CGHA 1L2EA 4E7NA 2P95A 3BF6H 1LVBA 1QY6A 2HNTC 4YZUA 2JJ1D 3RDZA 4LZ4B 3PV2A 2BY7X 2WPDD 1GJ5H 1WXRA 1PPBH 1O2JA 4IW4E 4P02A 1V6DA 3M7UA 3Q00A 5EXNA 1CT4E 1S0QA 4Y6DA 1GBBA 3A83A 1HB0B 2SNWA 1GI6A 2OLGA 2BHGA 6GCHG 3FP6E 1P2MA 1OWJA 3P8GA 2BLWA 1V2ST 4X2YA 1DXPA 3CP7A 2BTCE 2UUFB 2PGQB 1OKXA 3U98H 4E05H 3ENSB 4A1XA 1TLDA 4M7GA 4K69A 3OY6U 1G3CA 1SGDE 3SNDA 3GCNA 1RIWB 1OWKA 3OEHD 3A8CA 3ZVAA 1SOZA 1DT2A 2W7UA 2ZDNA 3V13A 1C2LA 1ANBA 4I8JA 2FOMB 1FPHH 4AYYB 1C5WB 3SZEA 3O8CA 2BYAX 3DD2H 4WH6A 4ZAEA 1LHDH 2FDAA 2SGAA 2V6NA 2JETC 2IPQX 2CK3D 5EIYA 8KME2 2ZGCA 4AX9H 4YTAA 2WPLS 1GI9B 1GI1A 2RA0A 2ZFSA 1F0UA 1XXFA 1P11E 4X1NU 3VB4A 1VKYA 1C5PA 4I8LA 3RXSA 3RXQA 1XUFA 2FXRA 1Q31A 3ZYDA 1EB2A 1ZSJA 1CA0C 2PTCE 1O3LA 1Y3VA 4CBNA 3GY5A 3SHAH 2BD7A 5AVDA 1ZSLA 3D62A 1TGTA 4FUHA 4YT7H 1XX9A 4UFEH 1O5BB 3EDXB 1IQGA 4ABGA 3NK8A 4P00A 2A1DB 4GHTA 4WVPE 2GV7A 1GBFA 1QL8A 1UO6A 1CQQA 1MD8A 1FIZA 3DSOA 1DOJA 1LCYA 3Q3YA 5JB9S 1DANH 2XBVA 1B0EA 2GCHF 3GICB 1ARCA 1GMDF 1RRKA 4Q7XA 5ESBA 3BIVH 2I6SA 5C5OA 1QRWA 3F9EA 2GMTC 2R0LA 2DUCA 1NPMA 1FAKH 1FAXA 3FVFB 2GTBA 1T4VH 1O3PB 1GGDB 1DX5M 1GI0A 1O3IA 4O03A 1ZHPA 5K7RA 3VGCC 1E35B 2ZQ1A 2GCTB 4B2AA 4ABDA 1GWAA 2AHME 1F7ZA 4CBOA 2LPRA 1YPGH 2BQ7B 1VCWA 3LGIA 2ZHFH 7GCHG 4AB9A 1S6FA 1GG6B 3KN2A 4DOQA 1SGEE 1MH0A 1NFUA 3PM3A 3BG4B 1P8VC 1HAGE 4A6LA 3M5LA 3HGPA 3NUMA 4XOJA 3KYFA 3GCHB 3TJNA 1FI8A 1C5NH 2QYIA 2HPQH 1RGQA 1JMOH 1Z6EA 4AN7A 1GCDA 1CHOF 4D76A 4BNRA 1G9IE 2VBCA 3GY4A 3QO6A 4FUGA 1MABB 3PMAB 2VINA 3PB1E 1P01A 2WV9A 1LKBA 3OFND 1GBIA 1C5YB 3NWUA 1TRYA 3SV8A 2FWWA 3MH5A 4DIIH 3TIUA 3ELAH 3Q3KA 3TNSA 3UB0A 1AN1E 1G3DA 1XM1A 3SGAE 3STJA 1EP6A 4CRAA 3TH2H 3OSYA 1TPAE 1UHBA 1Y5UT 3VPKA 3A81A 2D26C 3T29A 4MNXA 4O97A 2UUYA 1NY22 4OM9A 4I33A 1EJAA 1LHEH 1MD7A 1DUAA 3KQDA 1HAXB 5T3HA 3LU9B 1NTPA 1K1JA 1QJ6B 4K8YA 3KF2A 1OX1A 2FOCA 4NIVA 5H4IB 3Q76A 5FCRA 1GJBB 1TGNA 4TYDA 1IQKA 2AGIX 1L1JA 1COWD 2Z9KA 3E3TA 1BRUP 2YMSC 1AUTC 4X8VH 2W6ID 1L1GA 1YPJH 1Z8JB 5C20A 1A4WH 1XVOA 1JRSA 1C4U2 5GPIB 4ABAA 3SUGA 2EEKA 4BAOB 1GCTB 4OS5A 4NA8A 1T4UH 3QDZB 3T2NA 1YF4A 1WQSA 4R8TB 4X6MA 1ZPBA 3ZZ7A 2SNVA 2A7CA 3M3TA 1W10U 3MNXA 3SQHE 1W0ZU 2J95A 3BTQE 4CREA 1O3MA 1P2QA 4H6TA 1ZJKA 3MO6A 1FY3A 1FONA 4I86A 2GX4A 3RXPA 1NESE 3VB7A 3SN8A 1EASA 4AFUA 1RJXB 1WU1A 1AMHA 9LPRA 4YOJA 1WTGH 3M7TA 3U1JB 3SZNA 5GCHF 4CHAB 2W7SA 3V0XA 4F48B 2H9TH 5C2ZA 3OX7U 7KMEH 3DA9B 1O2GH 1C5ZB 1TWXB 4FUIA 1CO7E 1HFDA 2Z9IA 4NIWA 1O5AB 1S6LA 1JIRA 3FN8A 1SGCA 3BIUH 3ATLA 4BTTB 1AE8H 3PRBA 1ABJH 1RXPA 1LQDB 4I8KA 5C0UA 3M3VA 3W1EA 2FX4A 3FO8D 1P06A 1OP0A 1D3DB 1TBQH 5EJZA 2QXGA 1GHYH 3BV9B 1Y3YA 1OS8A 2IN2A 6CHAB 1ETTH 1ELDE 3LC3A 4A1VA 1HDTH 1CT2E 4F55A 3TGIE 1O2OA 4NGAH 1MKWH 1TNGA 1FN6A 1LTOA 5JDUB 2CF9H 2RCEA 4O9VA 1EPTB 1NN6A 4HGCA 2A2QH 3P17H 2EQNA 1JIMA 1MTNB 5JBTA 3F0PA 1NO9H 2HLDD 3LJJA 1BOQA 3RM0H 5KECA 1C5UA 2H5CA 2HVYB 2XC0A 2BD5A 1SLWB 2FIRH 1P10A 2HGTH 1QB1A 1S83A 4OS2A 1C5XB 1QQUA 3T25A 3ZV9A 1BZXE 3N7OA 5EW1H 2HALA 2TBSA 1CGIE 1ZHRA 2GCTC 3K6ZA 3SHCH 5A0AE 2ZTXA 5A8XA 1PQ5A 2BMGB 5AFYH 4B75A 2KFWA 1FY4A 4X2XA 1V2KT 2BLVA 1P2OA 1J16A 1ZHMA 3WY8A 1P04A 3ZZ9A 4WMEA 1QHRB 4X1QU 2VVUA 1ACBE 1GG6C 4MG3A 1BRCE 1QIXB 1GL0E 2B5TB 3BG4C 5HIZA 5FX5A 3ZYEA 2GKVE 4INLA 3GCHC 1ZPCA 4Y79A 4ZXYH 3RMOH 1TQ0B 1K0HA 2CV3A 3PLPA 1MU6B 1SHYA 1HCGA 2D1JA 2H5DA 2Y80A 4LZ1H 3SORA 1A0HB 2GCHG 1GMDG 3QWCH 4HTCH 3ZV8A 4B76A 2G5NA 1ZR0A 4ZXXH 2PUQH 4I31A 4KTUA 1D3TB 4XDEA 5DP6A 1AKSA 2UWLA 1ESBA 5C67A 1VZQH 3RXDA 3Q3XA 3E8LA 5AFZH 4TT3D 1DY8A 2PSYA 1VCPA 2ZPRA 3BEIB 1PJPA 2OQUA 1Q3XA 1VITF 1MMJN 1W11U 1WV7H 1BTHH 2J92A 1IOEA 3F6UH 7LPRA 1NRNH 3TJUA 3PLKA 1OYTH 1GHZA 1C2IA 2QXHA 4CRBA 4Q2KA 3DUXH 2HRVA 3SV2H 3RXFA 2V3MA 3ESTA 2ZU3A 1T8MA 3RUOA 1XMNB 2ZWLH 1LDTT 1GJ6A 2H2ZA 1CSOE 3QTVH 1ESTA 3U1IB 1YY3A 1EFRD 1O3AA 1VJ9U 4NCYA 4DIHH 4GVUA 4ZROA 1ZSKA 2KAIB 1C4V2 1ELCA 3S9BA 4DCDA 2C8WB 1GCTC 1RD3B 1CHOG 1O35A 1H4WA 1MZDA 2XBYA 4MPVA 2QXIA 3DFLA 3MOCA 2OBOA 2GT7A 1P3CA 1QFKH 1CHGA 2ZIQH 2WUBA 3RU4D 3QUMP 3R3GB 3A8BA 5PTPA 2ZGBH 4TPYA 1Z8GA 1SGFG 3F9HA 4AZ2B 5FBEA 1KDQA 2RFKC 1O3BA 1J9CH 2IJD1 2C8XB 1DM4B 2BZAA 1DFPA 2KCYA 4MDSA 1ZGIA 3IWMA 2YOLA 4RI0A 2R9PA 3TGKE 1AIXH 4OGYA 1BBRE 1ZRKA 1SBWA 1O5EH 1WQVH 3P92A 1O38A 2FMJA 3TH4H 3UWJH 4CHAC 5A09A 1O2NA 5DP3A 2ANMH 5JPMH 3W95A 4X1PU 3SJKA 3BTDE 3UY9A 3KYGA 4KGAA 4ABBA 2R0KA 1P9SA 2A7JA 1P9UA 3RMMH 3RMLH 4ISIH 2STAE 1TMTH 2BDCA 3BTHE 2JIZD 3GY3A 2A4RA 2TGDA 4A7IB 1ANEA 1GI4A 1TGBA 1ZLRA 2G52A 5CDFE 2HWLB 1Z6JH 6CHAC 1ABIH 1UW7A 4I32A 4Z0KA 1P0SH 1SGTA 1BDAA 1GL1A 3UQOA 1BIOA 3PV5A 2PP6A 1PQAA 1LQEA 2Y81A 3C27B 1EPTC 4NIXA 3U28C 3RLYH 1W7GH 3CS7A 1TX8A 1BITA 1MTNC 1DS2E 1H8DH 1D6WA 3UNRA 3CS0A 2F9PA 1NU7B 1C1QA 3GYMA 4Y11E 2UWOA 1NBMD 1ELAA 5GCHG 4X2WA 1GI7B 1PQ7A 2ZPQA 5J4QA 1Y8TA 2ZNKH 1O2YA 2F9NA 2EI6A 1E1QD 2XRCA 5EPNA 2EC9H 1BRAA 3M5NA 2Y5FA 4OS4A 1TMBH 1GDNA 1E34B 1D4PB 3M5OA 2WPMS 1O2KA 3OAAD 3T27A 4ABIA 1WCZA 2EI7A 2H1UA 4NZLA 1C2JA 2W3IA 4FUCA 4YLQH 5HM9A 1O5FH 4RKJB 1C5SA 5A8YA 2LP6A 3RXBA 1G3EA 1SFIA 1A1RA 2XXLA 3A7YA 4HZHA 2Y82A 2KM0A 5FCKA 5DP4A 4ABJA 2ESTE 3AW0A 5CE1A 1D3PB 3KGPA 2XCNA 2F91A 2BLQA 4BAHB 3EA9A 2BD3A 1QB6A 4FVBA 3SV9A 2FI5E 2BD4A 3QX5H 3TK5A 2F9VA 1IQHA 2KCOA 4D9RA 4M9FA 1MKWK 1WYKA 2O8MA 3QK1A 1UMAH 5LPFA 3E91A 1L1NA 1BMAA 1SPJA 1GI5A 4ABEA 2AMPA 2A5AA 3EYDA 2GP9B 4UDWH 1NFYA 1O34A 3SU1A 1AQ7A 2ZGJA 3HATH 2BY9X 1MU8B 1OHHD 2SGEE 4LOYH 3Q77A 4ASUD 1AVGH 3PWBA 2CN0H 1TE0A 2Y7ZA 1EAUA 2VJ1A 2VWMA 5JBBS 2FOHA 1YLNA 1PYTC 3QZQA 4F49A 4O3UA 5F8TA 2V0BA 1GHBF 2J98A 5EGMA 1TX6A 1GBDA 2RDLA 2K0QA 5A0BA 1ZMJA 1O30A 1SLVB 4ZKRU 1D3QB 1DVAH 1HPGA 1O2LA 3BG8A 2JH6D 1QBVH 4XFQA 1DICA 1NM6A 1W13U 5T6GA 3STIA 5DPAA 1QTFA 2Z6BD 1C1TA 2ZCLP 4MPWA 4IN1A 3KQBA 5E0HA 5EQQA 2FTLE 3SNEA 3DSGA 1GMHF 1TNKA 1IQJA 2CXVA 1Y3XA 1IQIA 3KIDU 4MNVA 4IN2A 3M35A 3WW7A 2O8LA 2BQ6B 2JH0D 4B2BA 1KMHB 1VITG 2Z9JA 2VWOA 2PKSB 3H7OA 3OU0A 1FQ3A 3PROA 1QURH 1LPZB 1P2JA 4E06H 2GZ9A 1C5TA 3O8DA 1YWUA 3U69H 4XBCA 4X1RU 1QZ8A 3B9FH 3SGBE 1QRXA 1Y3UA 4Q7ZA 3PRDA 2Q6GA 2IOTA 2VGCB 4UEHH 2G51A 1HUTH 1PPHE 2FI3E 3SJ8A 2CF8H 1V2MT 3LH3A 4AG2A 1QQ4A 1ETRH 2NU2E 1HLTH 3OTJE 4BAQB 2F9OA 2O9QA 1FUJA 3F0OA 4MTBA 3RC4A 3ZZ3A 2PUXB 1QB9A 1TPOA 4PROA 3UIRA 1YC0A 1TGCA 1NRPH 2PTNA 1ID5H 3MH4A 3F2FA 2O8WA 3RXCA 1FXYA 1BJVA 1O3JA 1NZQH 1Z71A 1AZ8A 3PYHA 2QV1A 2IPHA 1BBRK 1NROH 3BEFB 3FZZA 1E38B 2PKAA 4NG9H 1E37B 1FDPA 1SG8B 2C8YB 8GCHF 1EP5A 2SGPE 3RXGA 4DVAU 1A7SA 1AGJA 5L6NH 3MH6A 3RLWH 5GWZA 1BMLA 4JZFH 1OSSA 1UK4A 1YM0A 2STBE 2WYJA 3MNSA 3GCOA 5F8XA 2FEQH 2GD4B 2NU3E 1UCYE 3UNQA 2G81E 3LKWA 4AORA 1FJSA 3G01A 2R3UA 2A32A 2WPIS 1AY6H 3KEEA 6ESTA 1CBWB 1AVXA 4VGCB 2QIQA 4RKOB 1DDJA 4Q4LA 1OWEA 2W6JD 1N8OB 1C5VA 1ORFA 1EAWA 1EZXC 3TJOA 1H9IE 1LKAA 2WPHS 2FLBH 1W3CA 2FP7B 1TPPA 1MQ6A 1SGRE 1EZUC 1L4ZA 1GJ7B 1GJAB 1O2IA 2V3OH 1ZMLA 4ZKOU 1Y5BT 2SGDE 4TSFD 3URCA 2AERH 3U8RH 2SFAA 1KSNA 1MUEB 5L2YH 5EQSA 2WV4A 4YO9A 4NSVA 1VCQA 3UR6A 4Y8ZA 2XOKD 3RXTA 1G3BA 2F43B 2VIOA 4B2CA 3LDXH 1P02A 2ZFTA 1G36A 1AB9B 1YP9A 1TALA 3ATKA 5GIBA 2FS9A 4BOHA 4DW2U 8ESTE 2YNBA 2V35A 1W8BH
chains in the Genus database with same CATH topology
1A61H 2G4UA 4JCNA 3F9GA 1TQ7B 1UHBB 3RP2A 1VGCB 1ZPZA 1N1LA 2AS9A 4YLUA 1HGTH 4KTSA 1KXFA 3U8TH 3T62A 1EJNA 2CJIA 1C1SA 3ODDA 1O37A 1AFQB 1TNLA 3UNSA 1QR3E 4IC6A 1BRBE 1TA6A 2PSXA 3K2UA 4NWKA 5B6OA 1A3BH 1O3KA 4FUJA 1YBWA 4NSYA 5L30H 2Q1JA 2FOAA 2NU4E 4K8BA 1V2JT 4INHA 1SQAA 3TPIZ 2HOBA 1XKAC 1UTLM 1QRZA 1C9TA 3ZVEA 1BHXB 2OD3B 1IQFA 2ZDLA 2BDYA 1DSTA 4K5ZA 1O3FA 1RIWC 1O2SA 1J8AA 1P05A 3FP8E 3HK6B 4YESB 3LGTA 1V2QT 5ABWA 1O2WA 3P8NA 2D2DA 3GY8A 1QJ1B 2VH6A 1O33A 3L6PA 3A7VA 4BAMB 2Z3DA 1HJ9A 1SLUB 1T8LA 3E0PB 1O2ZA 1GMCF 1DXWA 2PGBB 2ZF0H 1LPGB 1PPZA 3ZVDA 1A46H 4DGJA 3QGJA 2TRMA 4IMQA 4JMYA 1O3EA 2OC1A 3VXFH 1BJUA 5FBIA 3ZVGA 9ESTA 5G4BA 2XW9A 1MTVA 4Y10E 1UTOA 2PKSC 4K3JA 1UTQA 3K9XB 2G5VA 4LXBH 2P94A 1LVMA 1VR1H 3M7QA 1XXDA 1Y59T 1ETSH 3BSQA 1MTUA 2ZI2H 4LK4A 1KXDA 1SLXB 2ALPA 1VITH 2VGCC 1GHBG 1PPFE 2J38A 3LONA 2AH4X 2PLXA 3A84A 1NT1A 3UPEA 5E2PA 3SOSA 3RMNH 1TOMH 2GGVB 1UTMA 1P09A 1TNHA 1UK3A 2RA3A 5GDSH 1O2VA 2GDEH 3S9AA 3BTWE 1QGFA 3FP7E 4IGDA 5JBCS 1B0FA 4X0WU 3SJIA 4X6NA 1INCA 1YPKH 2OC7A 1GGDC 2VH0A 4FU9A 1GDUA 1BTYA 6LPRA 1JRTA 1SR5C 1GVLA 4NA9H 4U32A 1GMHG 1SC8U 3RXUA 3TH3H 3NZIA 4IS5A 3URDA 2DE8A 1C2FA 2VIVA 4WXIA 3MU4A 1UVPA 3NKKA 3RXJA 2BM2A 4WY3A 1SGYE 1UVUH 4K2YA 5E8EH 3L33A 4MPXA 2BDGA 1O2PA 1C5QA 1EJMA 2Z7FE 3P70B 3MO9A 2ZP0H 1W0YH 3R0FA 1IQMA 1C1VH 4D7GA 1AO5A 1O3GA 2WYGA 4KP0A 5EOKA 1ANCA 1MCTA 1XUHA 4AFZA 2P16A 4AFQA 1CBWC 4VGCC 2ANYA 2ZKSA 2BVXH 1CA8B 1N8OC 1SOTA 5I46H 1C1WH 2P93A 1AWFH 3I29A 1QA7A 1RS0A 3DT0H 1NU9A 1TBRH 3LOXA 5DG6A 2BXUH 4JK5A 5GJ4B 1O0DH 3BTME 3KNXA 1KYNA 4QT8C 3T5FH 2TPIZ 1DPOA 1S82A 1SSXA 2ZHWH 1AKSB 1DUEA 1BTZA 2XWAA 2FYQA 1ZOMA 1SB1H 1IQNA 1SI5H 3MO3A 5JBAS 1AB9C 1FN8A 1KY9A 3A7TA 2DE9A 1HIAA 2Y5HA 2OC8A 3FANA 4GUXA 1VGCC 1T31A 4X8TH 4AFSA 1GJCB 2GDDA 3U9AH 3E90B 1XUGA 2AGGX 1V2WT 3MFJA 5LGOA 4BTIB 1BBRH 1HAVA 1DLKB 1G32B 1HYLA 4MQAA 1AFQC 4CRDA 3EQ0H 3HKJB 3SNBA 4I8HA 1DWEH 1TNJA 1MAXA 3SI4H 1GBAA 1IHTH 2OCVB 3MTYA 1K9OE 2P3UB 3A89A 4JYVH 5J4SA 4FUEA 4X8SH 3MWIU 2ZU4A 1TABE 3GDVA 3SU6A 4WF8A 4ZMAH 1BA8B 1ESAA 2OTVA 3PMBB 1NS3A 1IQLA 4IMZA 4CH8B 4U2WA 5DP8A 4CRGA 1LVYA 1Q2WA 4JK6A 5E0GA 2H9EH 2ZDAH 2BY5X 4KELA 1KDQB 3VFEA 1J15A 2WPKS 3BTGE 5DP9A 3RC6A 2B7DH 4DG4A 1K1OA 1S0RA 5EXMA 4GHQA 3QN7A 1YPHE 1CU1A 4GPGA 3W94A 1PPGE 2OINA 2QY0B 1ANDA 3ODFA 1F5KU 3ZZBA 2ASUB 3I78A 1LHFH 1TX7A 5HGGA 1O2UA 1UJ1A 1LO6A 2ZFPH 3BN9A 2ZO3H 1AD8H 1TYNA 2XBXA 4J2YB 3TITA 1BHXF 1PQ8A 1O36A 1Z7KA 2GT8A 2G4TA 1LHCH 2BOHB 2P59A 1GI2A 2ZFRH 5EODA 3SJOA 2WUCA 3ZZ6A 2B9LA 3UWIA 3RXKA 2GVFA 5TCAA 2FODA 3SW2B 4Z6AH 3GY7A 4DURA 1F2SE 1K1MA 2VVVA 3MHWU 2OC0A 3M37A 2B0FA 5IYTA 3GDUA 3LGYA 5AHGH 1NRSH 3O8RA 1W7XH 5F8ZA 2A0QB 2A5IA 3UTUH 3HGNA 4IBLH 1C1OA 4D8NA 3VGCB 1HAPH 2BDBA 5DJ7A 1SGFA 3LJOA 1BTPA 1KTTB 4F4OC 1GBEA 5E0JA 1K2I1 2Q6DA 2BVSH 1ZTJA 4UONA 1A0JA 5FXLA 1GJ8B 2ANKH 4ZHLU 1A5IA 1WAYB 4IC5A 1DSUA 1YCPK 3D49H 5SGAE 5TJXA 2CGAA 4NFFA 1AWHB 3BEUA 1GMCG 8LPRA 1W12U 3MNBA 4CRFA 3MU8A 2FX6A 2HLCA 1MTWA 2P8OB 1PPCE 3M36A 1MBMA 3LIWA 2ZFFH 1OXGA 1AUJA 3LT3A 1THPB 3GOVB 2J94A 2XTTB 1LPKB 4YM9A 3SU2A 2G00A 1LVOA 4X2VA 3DFJA 1B7XB 4BXSA 2ZC9H 3SUFA 2BDHA 1D9IA 4J1YA 3BTEE 1TB6H 1K1PA 1FPCH 4D9QA 2UUKB 4H6SB 1JXPA 3HPTB 5JYIA 1C1UH 2A31A 1Y5AT 3SGQE 3TK6A 1V2VT 4OGXA 3QZRA 1TOCB 5E2OA 5EQRA 2GZ7A 1TAWA 2ZTYA 3E16B 2F83A 1H9HE 5CHAB 3OYPA 2BB4A 5T6DA 1ZTKA 3M61U 1K21H 1SFQB 2OQ5A 1O3HA 2NU1E 3A88A 1EQ9A 1FLEE 1AE5A 2TGTA 2V3HH 4Q80A 4NA7A 1BT7A 3ZVFA 2HNTE 4Y7BA 3T28A 1BTUA 1MQ5A 1T8NA 1UVTH 2QN5T 4OS6A 4AG1A 2Y7XA 1G30B 3JZ1B 3E0NB 3MYWA 2M5TA 2C90B 1NRQH 1O2MA 3IG6B 1GDQA 1K1NA 3A85A 4TY7A 1LMWB 1NFWA 1THSH 4Y8XA 3LC5A 2D8WA 2HPPH 4XSKU 3SU3A 2A45B 1EZSC 2Q6FA 2ZA5A 4WMDA 2OXSA 2A7HA 2FI4E 1OWHA 4AGJA 2ODQA 1P03A 1KXBA 1ELEE 1GBKA 1YCPM 2CHAB 3GYLB 1G2LA 2C93B 2ZQ2A 1EB1H 5C1UA 4ZHMU 3PV4A 1O2HA 3SJ9A 3VB5A 3QTOH 4CR9A 1HBTH 1F5RA 2VIQA 4WJG2 4YT6H 1TBZH 5A8ZA 3FAOA 4AYVB 5HMAA 3RXEA 3PTNA 2HNTF 1OWDA 2YNAA 1EATA 4ESTE 4TWYA 2ZDMA 1SVPA 4HFPB 3GY2A 3PMJA 2VB0A 2ZG0H 4SGBE 2ZU1A 1HJAB 2I6QA 4YOGA 4ASHA 4ZUHA 3B8JA 4MNYA 2O8TA 2WV5A 4BTUB 2VU8E 5L2ZH 1FV9A 5DP5A 1C2GA 1QBOA 3EA7A 1EZQA 1K28D 4Y8YA 1W14U 2GZ8A 2F3CE 1TIOA 1NRRH 2AMQA 3A7XA 1EUFA 4K1SA 2BVRH 2AMDA 2BXTH 3F9FA 1SQTA 1UVOA 2ILNA 3SNAA 4A1TA 1ZJDA 1GBJA 3SV6A 2J9NA 1UCYH 1KLIH 1ELBA 2NU0E 4O3TA 3PTBA 2IJOB 1A0LA 2ZHEH 2BLOA 2BDIA 1T7CA 2HVXA 1W2KH 3RXHA 4I7YH 5EU8A 5FPSA 5A2MH 3LPRA 4NWLA 1DWCH 1XKBC 1NFXA 4B74A 3ZZ5A 3EE0B 4JZEH 1F0RA 4ISNA 1OYQA 1QNJA 5FPYA 1UVSH 1ELFA 3UR9A 1WBGB 4UE7H 4UFDH 2A4QA 1SGQE 2PKAB 4K1EA 1MAYA 2CMYA 2BD2A 4A92A 4Y71A 1L4DA 3D65E 1MZAA 1E0FD 1KXEA 1ZMNA 3GY6A 2THFB 3TK9A 2ZFQH 3GCTF 1YPLH 2Z3CA 4FUFA 1RTLA 4JYTA 3ZZDA 3ITIA 3MMGA 1P12E 2H9HA 2FO9A 1C2KA 1RTKA 5EG4A 4FUBA 1PYTD 1GHAF 1SGNE 1MKXH 2VWLA 3SUDA 1T32A 1Z1JA 4RSPA 2C4FH 5IDKA 1RTFB 2Z9GA 3P8OA 4H4FA 2P8OC 4ZKSU 1C5LH 3S0NA 1B5GH 4INKA 5DO4H 2FOFA 2W3KA 3E1XB 3PO1B 2FTMA 2ZDKA 2ZU5A 2XBWA 4JYUH 1FY5A 2ZTZA 1TRMA 4Y76A 1SGIB 4I8GA 4MVNA 1AZZA 1IQEA 1FY1A 4BANB 2FESH 2R2MB 2OUAA 4JZDH 3U8OH 1IAUA 3TNTA 3UREA 1O5CB 3AAVA 5HM2A 3QGNB 2F9UA 1FMGA 4K60A 3SU0A 4JZ1A 2TGPZ 2ZGXH 1C4Y2 3ZVBA 2BY6X 2Y6TA 2F9BH 1EOLA 2ANWA 1QL9A 3S69A 2Z94A 1BTWA 5DKMA 1C1NA 1JOUB 2BOKA 1SL3A 3ZZ4A 1GBCA 5CHAC 1WTHD 3LH1A 4UFGH 4NFEA 1SMFE 5LPRA 1SGPE 2NWNA 3SO3A 4FUDA 2GV6A 1XUKA 2K1QA 5DGJA 1F5LA 1GVZA 4XE4A 1O3DA 4GLYA 2ODYB 2AGEX 1NC6A 1K22H 1GVKB 2ZDVH 2ZPSA 2SGQE 1JWTA 3EA8A 1GI3A 1OPHB 1ZTLA 3MNCA 3H5CB 1YPEH 2AIQA 4WMFA 4ZKNU 1CVWH 5T6FA 1QJ7B 4Y7AA 2BD9A 3A7ZA 3P8FA 4MPUA 2BQWB 3NPSA 3V12A 1TA2A 1YCPH 1C2MA 2PW8H 1C2DA 5C5NA 1Z1IA 2CHAC 1VJAU 2PWXA 2QF3A 1HAIH 3I77A 4ABHA 3UOPA 1EAIA 1YLCA 4ZH8A 1MCVA 1P2IA 2ZGHA 2A2XH 1GBMA 4GCHF 1S85A 3V7TA 4E7RG 2A4GA 1HAOH 1YGCH 1C5RA 5EXLA 2JKHA 1P2KA 1C1RA 1EAXA 1QCPA 1BQYA 2WPJS 3LGVA 4FU8A 4TWWA 5ESTE 1WOFA 1TRNA 1H8IH 1RFNA 4K1TA 4CH2B 4GSOA 3RM2H 2OBQA 4WXVA 5C3NA 2AYWA 1GBHA 4JZIA 5FHTA 3D23A 2OP9A 3ZZAA 1HJAC 1TPSA 1H9LB 2QA9E 1GJ9B 2SGFE 3S9CA 1TNIA 1O3NA 5ETXA 1MBQA 4DJZB 1TGSZ 2QXJA 1O39A 2ODPA 1KLJH 1A5HA 3DHKH 4FU7A 1ELVA 1ZGVA 3MU1A 1A2CH 2TIOA 2VIWA 5CMXH 3NXPA 3KQEA 1EPTA 4U30A 3RXOA 1J14A 3ZVCA 3RU4E 1V3XA 5LH8A 5BPEA 3GDSA 4X6OA 2RG3A 1P3EA 3UFAA 1CGJE 2J34A 5F03A 1GI8B 4UFFH 1S81A 1XUIA 1GHXH 1EOJA 2Y5GA 2ZECA 4H42U 4WH8A 1OP2A 2W26A 1TONA 1F92A 3VXEH 4B71A 1DLEA 1UTNA 4U01A 5JB8S 2ULLA 5FX6A 1PFXC 5DK1A 1HNEE 3S7KB 5DP7A 1O2XA 1EX3A 1PPEE 3H7TA 2O8UA 1S5SA 2BD8A 1YKTA 5BRRE 4RN6A 2W5EA 4UD9H 1J17T 1OP8A 3F68H 1U6QA 6GCHF 1BB0B 3RXVA 2A5KA 2ALVA 2VNTA 5C1YA 2LNCA 3ATWA 3L3TA 3SNCA 3SQEE 1FZZA 1O3CA 1A3EH 3FFGA 5I25A 1A5GH 1V2PT 4X1SU 5F6MA 1FNIA 2XWBI 5A0CA 3MH7A 4TPIZ 2P3FH 3TJVA 1BUIA 2J2UA 3K6YA 3PO1C 2VIDA 1O32A 4NIYA 4X8UH 2J4IA 3C1KA 1ZZZA 1SHHB 2XNIA 2XYAA 4MNWA 2QAAA 1H1BA 3A80A 3JZ2B 3PLBA 4KKDA 1UCYK 4ISLA 4AOQA 8GCHG 1WUNH 1ZYOA 2QGRA 5LPEA 2BX3A 3GISB 1Z8RA 2ZCHP 2FOEA 5HYOA 2QCYA 4A5TS 1ZRBA 4FVDA 4CRCA 3K65B 2FOBA 1C1PA 2QF0A 3RXIA 1BMMH 2UUJB 3SU4A 1AHTH 1OOKB 3A7WA 3GCTG 1UTKA 1GJ4H 4D7FA 1HIAB 2ZU2A 1V2NT 4OS7A 3BTKE 4OS1A 1HXFH 4BAKB 3T26A 1GHAG 1V2UT 5C1XA 1CE5A 1KXAA 1K1IA 1HAVB 2KAIA 1AVWA 2BDAA 1LHGH 1C5OH 3KHVA 3KQCA 1C9PA 1BCUH 1MKXK 3EAJA 3HK3B 5EPYA 1G2MA 3KCGH 2VWNA 2JETB 1X7AC 4DT7B 3UUZA 3NCLA 3ATMA 3TLOA 3RXMA 1F0TA 3V3MA 2QC2A 1ARBA 4X6PA 1T8OA 1E36B 2A4OA 2AEIH 1AFEH 1KLTA 3M5MA 1S6HA 3A8DA 2PR3A 4AGKA 3AW1A 2XC5A 1CA0B 3A82A 2VIPA 3VEQB 1V2TT 1L0ZA 7GCHF 1GHVH 2AFQB 2BY8X 2R2WU 1QL7A 1WSSH 3B23B 3RXAA 1YPHC 1HAYB 3SBKA 5K0HA 1HAZB 1O5DH 2JH5D 2FS8A 3TU7H 3AVZA 1TFXA 3ATIA 1AU8A 3LGUA 2PHBA 1XUJA 3PMHB 2UWPA 4Y0ZE 5TCCA 3VB3A 2B8OH 4BXWA 4R0IA 2G8TA 1GBLA 3A87A 2GMTB 2ZCKP 1QBNA 2PFEA 1KTSB 2XCFA 1F0SA 1K1LA 2C8ZB 1TMUH 1DE7H 3AAUA 2R3YA 3M3SA 3SV7A 1YYY1 1KXCA 1MTSA 2BZ6H 4Q7YA 1CT0E 1N6YA 3F1SB 3O8BA 4GAWA 3RXLA 3VB6A 4FXGH 1FIWA