2ZDLA

Exploring trypsin s3 pocket
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Cationic trypsin
publication title Congeneric but still distinct: how closely related trypsin ligands exhibit different thermodynamic and structural properties
pubmed doi rcsb
total genus 59
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2007-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2zdlA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2zdlA02
2VB0A 1LMWB 4NWLA 4NZQA 3D65E 1HAVA 1SGDE 3MFJA 1O2YA 3MU1A 2C8XB 3B9FH 4JZEH 1S6HA 1KXEA 3R0FA 5JB8S 2FODA 2ZZUH 4FU7A 5AHGH 1W2KH 1WBGB 3VXEH 2A32A 2RCEA 3RXDA 1MUEB 2VIDA 3RXJA 2W7UA 3MU5A 1A5GH 2ZCKP 3EDXB 1AN1E 1MTUA 2SGQE 1SPJA 4K5ZA 4MLFB 1O2KA 2FOFA 4B2AA 1GBAA 5AF9H 3S9CA 2A4RA 2Q1JA 4MPUA 4E05H 1GJ6A 1GVKB 1AFQC 1P06A 2BX4A 1AWFH 1PYTC 5FX6A 4JMYA 2H6MA 3U1IB 1ZR0A 1GI2A 1T8NA 1KTSB 5ESTE 2ZECA 2G52A 5GPIB 1GMHF 2VH0A 3LONA 2H9HA 1ESTA 3PWCA 3T2NA 2FOAA 1O2GH 3V3MA 2PSXA 1GCTC 4GPGA 1JXPA 1YP9A 2CHAC 1Y3UA 1EPTC 3E3TA 4MVNA 5JBCS 1XMNB 1F2SE 1C1UH 2ZDMA 1BTXA 4A5TS 1P2JA 1O3CA 1ELVA 5K0HA 2J34A 3SGAE 1LCYA 2ZDAH 1GL0E 1FONA 1O2PA 1GWAA 2CF8H 4XFQA 4RKJB 1YCPH 4FUHA 1OS8A 1TOCB 3SI3H 2BD7A 4TPIZ 2J4IA 1SR5C 1C5QA 1KIGH 3RDZA 1AB9C 1GG6B 1TALA 2OC1A 2VGCB 4X8UH 3RMLH 2SGAA 1A61H 3OY6U 1FIZA 1CT4E 3TK5A 2VVCA 1O35A 1L1GA 1O3AA 1J9CH 3TH2H 2WUBA 1VJ9U 1V2QT 1YYY1 1QQUA 1UTOA 3RM2H 2IPHA 4Y8YA 1W11U 3GYLB 1EJNA 1GHXH 3RU4E 3U9AH 4Y6DA 1JOUB 1TMUH 1QJ7B 1GBTA 2C8YB 5L6NH 3IG6B 2IOTA 3LDXH 2JH5D 3K6YA 1W0YH 1DOJA 1O2VA 1CA0C 2Z94A 1EASA 1C5MD 3LGWA 1GBKA 2CMYA 2ZU4A 3U8OH 1NO9H 1F0RA 3TH3H 3V13A 3MWIU 4CREA 1GMDF 3SORA 3RXIA 4HFPB 2XBWA 1HXFH 2ZTYA 4KTCA 1SFQB 3E8LA 2V3OH 1FNIA 4JK5A 2BZ6H 1DM4B 1Y5AT 3RXTA 2NU4E 3TH4H 1QRXA 4ZXYH 1T4VH 5C3NA 1SFIA 2XBVA 3A8AA 1ANCA 3ZV8A 1TNHA 3Q00A 1HAHH 1C5YB 2KAIA 4AX9H 5I25A 4K60A 1P8VC 4NG9H 1SBWA 3QX5H 1ZMNA 5FPSA 1O30A 1DY8A 4X2WA 5DP5A 4AFZA 2D1JA 4DY7B 1QGFA 1EAUA 1AO5A 3M37A 1LHDH 2Y82A 4Z6AH 3SGBE 2UUFB 1UTKA 1BBRK 2ULLA 2TGPZ 2WPHS 3RUOA 3VB5A 1TBQH 1D3PB 1TIOA 4BTIB 2P16A 4ABGA 3E16B 2QC2A 2G00A 1ABJH 1ZOMA 2PGBB 2AH4X 5JBTA 2XYAA 1SGNE 2F9BH 3MU4A 1XUKA 2HALA 1BBRE 3V12A 1HXEH 1MU8B 2FP7B 3LT3A 1DUEA 2SNVA 4NA9H 2O9QA 1P2IA 1EP6A 1ORFA 3KN2A 1NRQH 2QY0B 1N8OB 1K1OA 3ESTA 1BTUA 1Z8RA 5EQRA 1O2HA 1MH0A 1OKXA 4RN6A 4UONA 4CR9A 1P11E 3K6ZA 1PPGE 1GI1A 4KTUA 1J15A 1WU1A 1V2TT 3GY5A 1FY5A 1ZGVA 2GGVB 2GVFA 1DUAA 2A1DB 2TBSA 1UK4A 3UFAA 2AMDA 2ANWA 2BVSH 2ZPRA 1TE0A 1PQ8A 3GCNA 4UEHH 2XBYA 3OY5U 1AFEH 5JB9S 2B8OH 3UQOA 1ETTH 1AQ7A 4AB9A 2NWNA 5GWZA 1MKWK 2LNCA 1DLEA 4ZKNU 4YLUA 1C5ZB 1O5CB 1PPHE 1SGFG 2GCTB 2UWPA 3MO6A 3T26A 2ZFQH 2F9VA 2GDEH 3LU9B 4MQAA 2ZU3A 3AASA 4DOQA 2J94A 1S84A 2XC5A 4AYVB 1L1JA 1NS3A 4CHAC 2G51A 3MH7A 4OGXA 2PSYA 1ABIH 4ZXXH 1P9UA 1XVOA 2WPIS 1QHRB 4ISLA 3ZVCA 3U8TH 1EB2A 1SHYA 2Z6BD 4ZKOU 4X1NU 1C1OA 4TY7A 1GHBG 1SOTA 4DCDA 3VPKA 2OBOA 1H8DH 1GI0A 2FLBH 1EPTA 2F3CE 2PV9B 1G3EA 1EZUC 1EP5A 2ILNA 3PB1E 1A0HB 1A5IA 5E0JA 3DHKH 1BOQA 3UWJH 1O3IA 1BB0B 2XW9A 1DITH 3G01A 4GVUA 2ZF0H 3FVFB 2VWNA 2BDGA 3UNRA 3PLBA 1UVPA 2QAAA 3TJNA 4D9QA 1UCYK 2J92A 4U2WA 2VVUA 4WJG2 1GDQA 4Y8ZA 1O5AB 3FFGA 1TX8A 4DIIH 1AVGH 1EOJA 1CBWC 1SGFA 2H9TH 2QXJA 4FUIA 1ZHMA 1KY9A 4NCYA 1PPEE 3S0NA 1A0LA 1LVOA 4CRDA 1OWIA 1QTFA 1TX7A 1QJ1B 2NU0E 5BRRE 2A4OA 1THPB 2BDYA 1UCYE 1BRBE 2PTCE 5T6DA 3AW1A 2ZDNA 3RXUA 1V2MT 4O03A 5FX5A 1ARBA 4ZROA 1GL1A 3BG4C 1HJ8A 1TNJA 4IN2A 3SJKA 1RS0A 1C9PA 2R2WU 1GBMA 3HATH 1TRMA 1IOEA 2HPQH 1V2NT 3BG8A 5L2YH 4ZKRU 1EZSC 5A09A 3SU2A 3Q3KA 3SBKA 1A4WH 1C1PA 1TNGA 2VNTA 2AGEX 2Z3DA 2BD2A 4CBOA 1QURH 1LKBA 1BRAA 4B2BA 1E34B 1SQTA 4JZ1A 1A3EH 3WY8A 1O3KA 1Q31A 5ESBA 1GJ5H 1EZXC 1FJSA 1GJBB 1O5GH 5C5NA 1JWTA 2HPPH 1IQJA 3P17H 5GIBA 3OYPA 1AI8H 1GPZA 1O2QA 1T32A 1LHFH 2ZCLP 1WQSA 2O8MA 3MMGA 4M7GA 1FPCH 1G3CA 3LGIA 3SHCH 3RC4A 1KLIH 1BA8B 2Y6TA 1GI7B 1HV7A 1S85A 1OP2A 3TJOA 1GHVH 2FMJA 3A7TA 1WAYB 3PLKA 1GBIA 1ZMJA 1DSTA 3A88A 1THRH 5EPNA 3RXAA 2UWLA 2FI3E 1O3NA 1HUTH 4Y7BA 3S69A 3TLOA 1SG8B 1ELBA 5BPEA 3LGTA 2GZ7A 1BHXB 3BN9A 1C2HA 8GCHG 1TMBH 2F9NA 3AW0A 4GCHF 1FZZA 2A5KA 1H8IH 5T3HA 1MKXK 1OYQA 2F9UA 4IC6A 4K1EA 4BTTB 1W7GH 3BTGE 3GICB 1C5UA 3QK1A 1ID5H 2WPLS 3FP8E 4MDSA 4Y11E 1A0JA 4HI3A 2W26A 1TX6A 1O2TA 3UQVA 4FUGA 2FM2A 4HZHA 3QLPH 2VIQA 1WYKA 3UR9A 4KKDA 3GY6A 3E90B 4KTSA 2BDIA 3QGJA 2J2UA 2BY6X 2VH6A 2W7SA 4XE4A 1CQQA 4BANB 6CHAB 1GJDB 3A81A 4CRCA 1P9SA 1O2XA 3LOXA 3A8CA 4NA7A 1O2JA 2WYGA 1AE5A 5LPEA 4MPXA 4BAQB 1FY8E 2ZPSA 2BVXH 2BY8X 1GG6C 1CE5A 2QYIA 1K9OE 2VGCC 4D8NA 3Q3YA 2V6NA 4NWKA 2BLVA 2P93A 1CGIE 3BTFE 3A85A 5SGAE 3F9EA 4KGAA 1KXDA 4CH8B 1HFDA 1T4UH 1JIRA 2AS9A 5FBIA 5CMXH 1CHOG 1P01A 1SHHB 2P8OB 2Y7XA 3RXFA 1ETRH 5EW1H 2H1UA 1BDAA 1TGSZ 3GCTG 1Y3XA 2ZG0H 2BLOA 2PFEA 3SNEA 3DUXH 4UFGH 1YPLH 4UFDH 3CS0A 5DP9A 4BXSA 3SW2B 2JH6D 4A6LA 4H42U 1D6WA 1TLDA 1FI8A 1K1NA 1PYTD 1G9IE 2VIWA 2UWOA 4I8HA 1C1MA 1YCPK 2YOLA 1VCPA 2JETB 1O3DA 2JH0D 2PWXA 2Z7FE 3PMHB 5L2ZH 4O9VA 1QB6A 4OS4A 4ISOA 4D9RA 1O3EA 2XCNA 1MCTA 1O2OA 2G81E 3P70B 1UHBA 1O39A 1ZSLA 5FBEA 1Y3YA 3BTWE 2ZFPH 2A4QA 1CHGA 1BRCE 1HAOH 2M5TA 3A8BA 1C2KA 1G32B 1EQ9A 1KDQA 8ESTE 1TA6A 1WSSH 3SV8A 3JZ2B 3K9XB 1NFYA 4U32A 5A2MH 4DIHH 1NESE 3SV9A 5TJXA 3RU4T 3SGQE 2Z3EA 3M7TA 5F8ZA 2FS9A 2HNTE 2PKSB 3SN8A 2PUXB 1C9TA 1ACBE 3SNDA 3TU7H 3LPRA 4A1XA 1O2ZA 3N7OA 3ZVBA 1GMCG 4H4FA 2EC9H 5DP6A 3SUGA 2BXUH 3VB4A 1GJ4H 1O33A 3SU6A 2GTBA 2XRCA 2BDAA 1K22H 1N8OC 1LPZB 1DWBH 2RA0A 3QO6A 4NFEA 1ZYOA 2STAE 1ANDA 3A86A 3M61U 1WTHD 2BY5X 4DJZB 1C4U2 2BM2A 3H5CB 1K1IA 3A84A 1F5RA 1GJAB 2H5CA 2P94A 2AGIX 1NRNH 1ZRBA 1C5RA 2FI4E 1B7XB 4GHTA 3PMBB 3DFJA 1S81A 4NIVA 3T62A 3W95A 3UTUH 2GZ9A 3DA9B 2R0KA 3LJOA 2J38A 2A2XH 2A2QH 2ZGXH 1FAXA 2A7CA 2OTVA 1P0SH 3MH6A 3QTVH 2UUYA 1LDTT 3D23A 3IITA 2GCTC 2TPIZ 3P8GA 3MYWA 4XSKU 1HLTH 1HJ9A 1AUJA 5E2PA 1OPHB 1EX3A 4FUBA 5F8TA 1OSSA 1MTNB 3KGPA 1NM6A 1O5BB 2ZGJA 1XX9A 2A5AA 1AIXH 1K21H 5I46H 2PKAB 5EG4A 1P09A 3P95A 3BIVH 3T25A 4Y0YE 5C1UA 4H6TA 2VU8E 3A8DA 2PKAA 3SQHE 1B0FA 1BJVA 1LO6A 1GBEA 3UPEA 4CH2B 5LPRA 4I31A 2VVVA 1GJCB 2VIPA 2FOMB 5LH8A 4JK6A 3F9GA 1NC6A 2ZEBA 3KNXA 1S0QA 2A7JA 3F9FA 5GCHG 8LPRA 2YNBA 1YC0A 1YPMH 1PQAA 1P04A 1BMAA 1DS2E 4YO9A 2ZC9H 2BD3A 2Z9IA 2C3SA 1DDJA 1T31A 4ABHA 5IYTA 3K2UA 1NRSH 1MTWA 3UNQA 4UFEH 3I29A 5EOKA 5FCRA 2OQUA 1XUHA 2G5VA 4X2VA 1GHBF 1Q2WA 4WVPE 1GBCA 1CA8B 5GXPA 4F4OC 2VIVA 4ISHH 3BTHE 3PLPA 3A7YA 1YCPM 1RTLA 1HAGE 2Q6FA 5FXLA 1GHYH 2GCHG 2CN0H 4DW2U 4WH6A 3B23B 1QFKH 1Y3VA 2V0BA 3SO3A 2FZZA 4OS7A 3O8RA 2FDAA 1GI9B 4F49A 1AVWA 1RFNA 2ZP0H 3LC3A 3ATLA 3SJ8A 4DT7B 1QCPA 2OP9A 1YGCH 1YLDA 2OD3B 4A7IB 1EB1H 1QBNA 4VGCB 2K1QA 1NPMA 1WQVH 4X8SH 1J16A 2ZU2A 3M35A 4MG3A 1GVLA 4NGAH 3URDA 1UTMA 4IGDA 3RXEA 4JZIA 1QQ4A 2BD5A 1IQHA 5DGJA 1A3BH 5FPYA 3T29A 4BOHA 3I78A 2G5NA 1FN6A 1GHWH 1OWDA 1E35B 3BTKE 3STJA 5EPYA 4QT8C 5IDKA 2ZIQH 2D26C 1SC8U 1VGCB 2BD9A 4MTBA 4JYVH 5EXLA 4ABJA 1MBQA 4Z0KA 4A92A 1O31A 4R8TB 3BEFB 4U01A 4X6PA 3ZZDA 1SL3A 1V2WT 2WYJA 3SNAA 1SGTA 2ZA5A 1O2SA 2Z9JA 3RC6A 1TPSA 1TGBA 5C20A 2B0FA 1MQ5A 4GAWA 2THFB 2G55A 1C1SA 1P2OA 1Z8JB 2BOKA 2LPRA 4WH8A 2QF3A 3E1XB 7ESTE 2PLXA 3BSQA 1Y5UT 1TOMH 1O2RA 1H9HE 5FAHA 3NK8A 2ZHWH 3ZZ9A 2QXGA 3E0NB 1RTKA 4ISIH 3PV4A 2JKHA 5DJ7A 5TCCA 1LPKB 2ZGBH 4UD9H 5LGOA 3RXKA 5J4SA 3SJIA 1HAIH 1M9UA 1OXGA 1HAYB 4AYYB 3ZZ5A 2ZKSA 2FIRH 4CR5A 1GJ9B 5DP3A 4IMZA 4ZKSU 4X2YA 2O8UA 1N6YA 4MNVA 1MZAA 1UTPA 1YM0A 4KP0A 1UMAH 4FVBA 1D6RA 3SV6A 3ODFA 3ZZ3A 4Q80A 3BTQE 2ZHDA 1FPHH 6CHAC 2Z3CA 1PPFE 3EE0B 4ZHLU 3W94A 1O3JA 1C5SA 2OQ5A 2DUCA 4WMFA 1Y5BT 5FCKA 8GCHF 1KLJH 1Z1IA 1O5EH 4ZAEA 3SZNA 2SNWA 2O8WA 4LK4A 3ZVAA 2A4GA 4TYDA 1F7ZA 1FIWA 3E6PH 3NUMA 1O32A 1DWEH 1K28D 1ELDE 1MU6B 5ABWA 3BV9B 1IHTH 2OCVB 4K8BA 5AFYH 1PJPA 2DE8A 1CU1A 2VWLA 4X8VH 4KELA 1KXBA 3U1JB 1C1TA 2XC4A 1VCWA 1ARCA 5GJ4B 3VXFH 1AZZA 1HAZB 1A5HA 2P8OC 3M5OA 1O36A 2BQ6B 2BLWA 4ABBA 1O3MA 3PROA 2XTTB 2ZU5A 2FOEA 1S82A 3C1KA 1C2LA 1GHAG 2BB4A 3GY8A 5H4IB 1C1RA 1O3OA 1Z6JH 1SGYE 5F6MA 2A0QB 2ALVA 1MAYA 2FWWA 5DP8A 3S9BA 3A7VA 1EJMA 1O3FA 3UUZA 5B6OA 2GDDA 1UTQA 2OBQA 4GLYA 5CHAB 2JETC 1UVOA 1ZPZA 4ABDA 2BDCA 2WPJS 2B7DH 4I33A 1G37A 1QIXB 3FZDA 3UREA 2SGEE 1GJ8B 5E2OA 4BNRA 1TQ0B 7KMEH 3VGCB 3TVJB 1C1NA 1MD8A 2OINA 1CHOF 1O2IA 1U6QA 3ZVDA 1BTYA 2PHBA 4Y76A 1C1VH 1EZQA 2ZU1A 5HM9A 1AY6H 2AIQA 1VITG 3M5NA 3GCTF 1YPGH 5C1YA 4NFFA 3QGNB 4Y10E 1O2NA 1ANBA 2ZTXA 1NT1A 2ASUB 1C2MA 5L30H 2QCYA 3HK3B 3I77A 3GDSA 3S7HB 1C5NH 4AFUA 4ABEA 4OS6A 1CSOE 1IQFA 2RA3A 1QA0A 1Q3XA 1TNLA 1P2KA 3OU0A 1JMOH 2FLRH 4CRGA 1FDPA 2PKSC 1H9IE 2CXVA 1C5VA 1C1QA 1GI3A 1HAXB 1V2RT 1DWCH 4MNWA 1L0ZA 2QF0A 1NU7B 1E36B 2OXSA 4X1RU 1FY4A 3BTME 3BTEE 1ZTLA 1ZMLA 1T7CA 1F0UA 3TGIE 4X2XA 4AG2A 1MTSA 5C67A 5JPMH 1C5WB 1LQEA 3LIWA 5AVDA 1J14A 1Y59T 4A1VA 1YF4A 2BDBA 1TYNA 2BTCE 1EAWA 3LGYA 2AMPA 1RD3B 1ELAA 3AAVA 1GGDB 4K69A 5E8EH 4FU9A 2PGQB 3GCHB 1ZLRA 1PPCE 3JZ1B 1Z8GA 1GI4A 2R9PA 1ZPBA 2OC7A 2BHGA 2C93B 1FAKH 4YOGA 3SU0A 3FP7E 1RIWB 3RLWH 2Y5HA 1GBHA 3ZZ7A 1F0SA 5EXNA 2D2DA 1GMCF 1SLUB 2FOBA 4AGKA 3RXGA 3EA8A 2WINI 1UTLM 1X7AC 4WF8A 1SGEE 1TFXA 1FQ3A 3P6ZB 1P10A 5FPTA 1SLVB 2YNAA 3A7ZA 5DO4H 3DFLA 5C5OA 1MTNC 2HLCA 2ZHQH 4R0IA 1C2IA 2VIOA 3Q77A 4E7NA 1O2WA 4AORA 4DG4A 3L3TA 1IAUA 2P59A 1GDUA 3HGNA 3MTYA 3CENA 3OSYA 3PTNA 3P8NA 4B1TA 4D7FA 3BTTE 5A8ZA 4WMDA 3HK6B 3KF2A 3RXQA 4YLQH 3U69H 3FAOA 2GX4A 4ZHAA 4AOQA 1UTNA 3M7UA 2RDLA 3LH1A 2CV3A 4YM9A 4TWYA 1F92A 4NA8A 1DXWA 4WY3A 2PR3A 1XUFA 1YPKH 2W5EA 4HTCH 1DX5M 1ZRKA 6ESTA 4IN1A 3TJVA 1O3BA 2WPKS 3SU5A 1OYTH 1B5GH 1ELTA 3GDUA 5JBBS 2GP9B 5DKMA 1LVBA 4X6NA 3TJUA 3H7TA 6GCHG 5T6GA 1DY9A 2BMGB 2ODQA 2TGAA 1BCUH 1ETSH 3RXLA 3ZVFA 9ESTA 3TK9A 1RTFB 4X1PU 4ZH8A 3MH5A 2ZFFH 3GY7A 1H4WA 1T8LA 1UCYH 1F5LA 4BAHB 1C2DA 1A7SA 4IW4E 3E0PB 1WCZA 3STIA 2G8TA 1TNIA 1INCA 4B75A 2FPZA 3GYMA 1O3GA 5HM2A 1DE7H 3ATWA 4AB8A 4JCNA 2HRVA 3OTJE 5G4BA 5GCHF 3GCOA 2FEQH 3SNBA 1BMNH 1UTJA 2ZDLA 5T6FA 1EXFA 1BQYA 2A31A 1DT2A 3UOPA 1TONA 1CT0E 1E38B 1SQOA 1IQMA 1ELGA 4OS2A 4FUFA 1YPEH 3H7OA 1HPGA 1XVMA 2D8WA 4H6SB 4X1QU 4VGCC 3ZYDA 1W3CA 1G36A 2ODPA 3QZRA 4X1SU 1BIOA 1GBDA 5LPFA 1AE8H 3ODDA 3KEEA 4IC5A 2HNTF 5C1XA 1DWDH 1FY3A 2ZHFH 1FY1A 3M7QA 2GCHF 5EODA 1HJAB 1XUJA 1HIAB 3NKKA 3MI4A 3T27A 2ZWLH 2R2MB 2Y80A 5A0CA 1VGCC 3A83A 1HIAA 3KIDU 1CGHA 2IN2A 3MNSA 3M5LA 1P02A 2BD8A 2HNTC 3FZZA 2ANMH 2BY7X 9LPRA 3CS7A 1P05A 1QBOA 5A0BA 1EATA 3UOUA 3OX7U 4ABIA 3TGKE 4LXBH 1BUIA 1UVSH 1E0FD 2FOGA 1ZTJA 3T28A 3ZZ6A 3RU4D 4WXIA 1GDNA 1PPZA 3RXRA 1S6FA 1WOFA 1TMTH 3D62A 3UWIA 1F0TA 1B0EA 5JYIA 3U8RH 4Q7YA 1O3HA 1YPHE 1IQLA 4NSYA 2WPMS 1C4Y2 1S83A 1W12U 1J17T 1O5FH 2SGDE 2UUKB 3LJJA 2CGAA 3A89A 2ZFSA 4YESB 4ZHMU 1W13U 1C2GA 2Q6GA 1IQIA 3KL6A 3SU4A 1MBMA 4E7RG 4MPVA 1EUFA 4XBCA 2ZDKA 1FMGA 1BT7A 3KQCA 4FUJA 5DP7A 3E91A 4Y0ZE 2GMTB 5HYOA 2Z9GA 4FUDA 1YKTA 3PYHA 1ELFA 1HAVB 2EEKA 4RKOB 1LKAA 1MMJN 1K1LA 1SVPA 3F1SB 1F5KU 3BEUA 7GCHG 2FX4A 1IHSH 3F6UH 3U98H 2NU2E 3MNBA 1XUIA 1AZ8A 1SSXA 2HWLB 1TPAE 1GI6A 3M5MA 5A8YA 1XXDA 2ANYA 4FVDA 2W3KA 1SMFE 4I8KA 4MPWA 4XBDA 3PO1B 1GBJA 3UY9A 3M3TA 3ZVEA 4AFQA 1HAPH 2Y5FA 1ZPCA 5GDSH 1AU8A 2ZQ1A 2BD4A 4AN7A 1BTHH 1H9LB 3AVZA 4K1SA 1V6DA 1ZZZA 5JDUB 3NXPA 4FUEA 2V35A 3ATMA 2BLQA 4X8TH 1NFXA 2ZI2H 4TPYA 2OUAA 5EXMA 4CRFA 1P2MA 1V2UT 2XCFA 4D76A 4I8GA 1LPGB 2ODYB 1CVWH 4Q7XA 1ESBA 3LKWA 1FXYA 3BF6H 3NCLA 3EAJA 4OS5A 5CHAC 2BQWB 1DXPA 1PFXC 2C90B 4U30A 1VCQA 1G30B 2O8LA 5EGMA 3S9AA 3UIRA 3VGCC 1HNEE 3ZYEA 1K1PA 1LQDB 3SUEA 1HBTH 2VWOA 3C27B 3SJOA 1CO7E 4GSOA 2AERH 2BOHB 1DLKB 1YPJH 2TGDA 1ESAA 2PTNA 3MH4A 1GHAF 3RMMH 3SOSA 3VB6A 1GI5A 3RXVA 2VWMA 1TPPA 4YZUA 2F9OA 4BAKB 2G4TA 2Z9LA 3M36A 4B76A 1Y3WA 1V2PT 5DPAA 4NIYA 3QN7A 4WXVA 2BYAX 1ZGIA 2TGTA 1MZDA 1G3DA 3LGVA 1BITA 2WUCA 3SI4H 5F03A 5C2ZA 1H1BA 1O2MA 2EI6A 1SGRE 1O2LA 3ATKA 2ZNKH 1TA2A 1K1MA 2C8ZB 2QIQA 4RSPA 1VITF 2A45B 2XWAA 3S7KB 2C4FH 1GBFA 1EJAA 1ZSJA 4WWYA 3DT0H 4YOIA 3RP2A 3RXMA 4ABAA 1RGQA 3RXHA 3ZZBA 4XDEA 2OC0A 4FU8A 1Y8TA 1Z1JA 3O8CA 1ELCA 1FUJA 1GGDC 2FTMA 3A80A 1A46H 3KQDA 4K3JA 1TPOA 1C5XB 1GI8B 1MCVA 3GCHC 1OWJA 3MNXA 3TGJE 1ZHPA 2KAIB 1D9IA 3VB3A 1QY6A 1BHXF 1AVXA 1RIWC 4ISNA 1SLWB 1NFUA 4NZLA 1Z8IB 1EKBB 1MTVA 4A1TA 2H9EH 3TNTA 4DGJA 3PM3A 3SQEE 3SU3A 1EOLA 1LHGH 3O8DA 1O37A 1MQ6A 4UDWH 1CT2E 3VB7A 4INHA 2RG3A 1ZTKA 2PUQH 2AIPA 1BZXE 4O3UA 1C5OH 1IQNA 2P95A 1D3QB 3HKIB 3ZZ8A 1SGIB 4IBLH 1P03A 2FOHA 3TK6A 2AFQB 4UFFH 1EAXA 5CE1A 1AMHA 3SUFA 2SFAA 1W7XH 1NN6A 1QA7A 1TRNA 1HRTH 2Y5GA 2QGRA 2ZGHA 2I6SA 4X6OA 1TNKA 3KQEA 3PMAB 1QR3E 4SGBE 2TRMA 4Y71A 1YLCA 2HOBA 3LC5A 1TGTA 3RXCA 4IS5A 4TY6A 1AWHB 2FESH 2FTLE 3AAUA 2P3UB 2ALPA 2FO9A 4JZFH 2SGFE 4JYUH 4CRAA 2BZAA 3M3VA 4J1YA 1UVUH 1BTPA 1LHCH 1DVAH 3L33A 2HVXA 2B5TB 2FI5E 2F9PA 1GMHG 1T8OA 1OP8A 4LOYH 2AEIH 1BMMH 4K2YA 2FYQA 3L6PA 2ZFTA 1O3PB 2B9LA 2ZDVH 3A87A 5EW2H 2CF9H 4ABFA 4HGCA 2A5IA 2QXIA 2XXLA 2Y81A 1UK2A 2XBXA 3A7XA 3PWBA 1ANEA 2GZ8A 2R0LA 1Z71A 3SV2H 1GBBA 1AGJA 1RJXB 2R3UA 2ZHEH 2W3IA 4Y8XA 1AFQB 1KTTB 1ZHRA 3TIUA 4ZUHA 3HKJB 1GJ7B 2BXTH 1DFPA 4XBBA 1P57B 3GDVA 6GCHF 1WTGH 2AGGX 1VJAU 1DPOA 2A7HA 1GCTB 2XNIA 2CHAB 3SUDA 5FHTA 1EPTB 3LGUA 1NY22 2F91A 3NPSA 1XXFA 1W0ZU 3ZV9A 8KME2 5E0HA 1MAXA 3RXPA 2BQ7B 1VR1H 4B2CA 1QL8A 1K1JA 2GV6A 3R3GB 5EQQA 1P3EA 3P92A 1TGNA 2HGTH 4Q7ZA 2Q6DA 1SLXB 3KHVA 1AB9B 3ZVGA 1D4PB 1SOZA 3MOCA 3QWCH 4D7GA 5PTPA 1GMDG 1HJAC 3IWMA 3SU1A 1BTZA 2TIOA 1G3BA 3M3SA 3V0XA 1G2LA 5HMAA 1OOKB 1KXAA 5TCAA 3V7TA 1ELEE 4I8JA 1DANH 2FXRA 1VITH 1KYNA 4MNYA 2P3FH 4AFSA 4E06H 4YTAA 3MHWU 3MO9A 4LZ1H 1UVTH 1W10U 4ZMAH 4PROA 1ZJKA 1JRSA 1O38A 5K7RA 3EGKH 1L4DA 1V3XA 4FUCA 4INKA 1PQ5A 4K1TA 1BBRH 5EU8A 1K2I1 1MD7A 1O34A 2H5DA 1CA0B 1THSH 1UO6A 1LTOA 3BTDE 4WMEA 1AKSB 5DK1A 1C5TA 1QB1A 1QL7A 3A7WA 4THNH 3T5FH 1AKSA 2AMQA 2ZTZA 2ESTE 3QDZB 1V2JT 2FX6A 1V2ST 4X0WU 4CRBA 1D3DB 3PMJA 1NZQH 1TABE 4UE7H 5A8XA 1UJ1A 3F9HA 2IJOB 2O8TA 2NU3E 3Q3XA 3ZZAA 5HGGA 1IQKA 1D3TB 2ZQ2A 1ZJDA 1SGCA 1P2NA 2AYWA 3FANA 2V3HH 1NU9A 1CGJE 1HYLA 2FYRA 4X6MA 2GMTC 3EYDA 1QL9A 1NROH 1TWXB 2G4UA 2QXHA 3RLYH 1GBLA 2FOCA 3RM0H 3VFEA 2DE9A 3TPIZ 3P8OA 1W14U 1EAIA 3BEIB 1AD8H 2QA9E 3BIUH 1KSNA 3QUMP 1OWEA 3UR6A 1OWHA 1N6XA 3URCA 5HXFA 1C5PA 1YBWA 1TAWA 4Y79A 4O3TA 3EA9A 1MKWH 4FXGH 2XWBI 1SQAA 2GKVE 1FN8A 2ZCHP 1JBUH 2ZPQA 5A0AE 3PO1C 4BXWA 3GY3A 4ESTE 2SGPE 1FLEE 3D49H 3RXOA 2Y7ZA 1NRPH 1XUGA 2I6QA 4K8YA 1V2KT 1TB6H 2XC0A 1P2QA 3EQ0H 3ITIA 1IQGA 4Q2KA 3MU8A 1GVZA 3Q76A 3SNCA 4YOJA 7GCHF 1TGCA 2FS8A 3EA7A 1KLTA 1BMLA 2GV7A 5DG6A 3NWUA 1SB1H 1TQ7B 2STBE 4YT6H 3ZZCA 4GHQA 3SHAH 1C2JA 3DD2H 4BTUB 1C5LH 4B74A 4XOJA 2EI8A 2PW8H 4JZDH 1XM1A 1QBVH 1T8MA 3UNSA 2EA3A 4J2YB 2C8WB 2ZFRH 1QB9A 1O0DH 2OLGA 4ASHA 4BAMB 1WV7H 2BX3A 1QRZA 4CBNA 3QTOH 3GY2A 5EQSA 4AZ2B 1O3LA 4GUXA 1S5SA 1OX1A 2QV1A 4DVAU 1OP0A 2VINA 3HPTB 4NIXA 1PPBH 3HGPA 1RRKA 3TITA 4CHAB 4TWWA 4B71A 4JYTA 1ZSKA 2ANKH 5E0GA 1E37B 6LPRA 4I7YH 1UK3A 1P3CA 1TBZH 1KXCA 1A1RA 4B73A 4SGAE 1TBRH 1O2UA 4LZ4B 1HDTH 1GHZA 1HB0B 1XKAC 3GOVB 5JBAS 1GCDA 1V2LT 4MNXA 4DURA 3GY4A 1PQ7A 2GT7A 1SGPE 4O97A 2GD4B 2QN5T 3KQBA 2BVRH 1JRTA 3MU0A 1VZQH 1O5DH 5DP4A 4AGJA 1J8AA 3QZQA 4BAOB 1QRWA 2ZGCA 3A82A 1XKBC 2GT8A 3O8BA 3ENSB 7LPRA 3ZZ4A 4NSVA 4OS1A 1NTPA 1SGQE 1C2FA 1OWKA 3NZIA 3K65B 1LVMA 1CBWB 2ZO3H 2BY9X 1A2CH 2J95A 1C4V2 4INLA 3TNSA 2WV4A 3ATIA 3FP6E 4IMQA 1UHBB 1Z6EA 2VJ1A 3MNCA 1SI5H 1AUTC 2CJIA 1HCGA 4OGYA 3GISB 1Z7KA 3LH3A 1DICA 1KDQB 1LHEH 1S0RA 2BDHA 3SJ9A 2P3TB 1L4ZA 5F8XA 1JIMA 3BG4B 1N1LA 1HGTH 1P12E 1WUNH 1TRYA 1YPHC 4AG1A 2OC8A 2NU1E 3RXBA 3RMNH 1QJ6B 3P8FA 1IQEA 1NRRH 1LVYA 3B8JA 1NFWA 2UUJB 2F83A 1V2OT 2WV5A 3F68H 3CP7A 1BTWA 1G2MA 4Y7AA 2J9NA 4I32A 5ETXA 3RC5A 1C1WH 2EI7A 1BRUP 3RMOH 2R3YA 1FV9A 1DSUA 1RXPA 1KXFA 1L2EA 1MKXH 3SV7A 2H2ZA 1V2VT 1L1NA 1BJUA 5AFZH 3ELAH 4NIWA 5J4QA 3KCGH 3PTBA 3VEQB 2Z9KA 3MO3A 1AHTH 3RXSA 1W8BH 1C2EA 4YT7H 4I8LA 1QNJA 4GCHG
chains in the Genus database with same CATH superfamily
2VB0A 1LMWB 4NWLA 4NZQA 3D65E 1HAVA 1SGDE 3MFJA 1O2YA 3MU1A 2C8XB 3B9FH 4JZEH 1S6HA 1KXEA 3R0FA 5JB8S 2FODA 2ZZUH 4FU7A 5AHGH 1W2KH 1WBGB 3VXEH 3AK5A 2A32A 2RCEA 3RXDA 4F55A 1MUEB 2VIDA 3RXJA 2W7UA 3MU5A 1A5GH 2ZCKP 3EDXB 1AN1E 1MTUA 2SGQE 1SPJA 4K5ZA 4RI0A 4MLFB 1O2KA 2FOFA 4B2AA 1GBAA 5AF9H 3S9CA 2A4RA 2Q1JA 4MPUA 1NBME 4E05H 4P00A 1GJ6A 1GVKB 1AFQC 1P06A 2BX4A 1AWFH 2KFWA 1PYTC 5FX6A 4JMYA 2H6MA 2EY4C 3U1IB 1ZR0A 1GI2A 1T8NA 1KTSB 5ESTE 2ZECA 2G52A 5GPIB 1GMHF 2VH0A 3LONA 2H9HA 1ESTA 3PWCA 3T2NA 2FOAA 4M9FA 1O2GH 3V3MA 2PSXA 1GCTC 4GPGA 1JXPA 1YP9A 2CHAC 1Y3UA 1EPTC 3E3TA 4MVNA 5JBCS 1XMNB 1F2SE 1C1UH 2ZDMA 1H8ED 3F2GA 1BTXA 4A5TS 1P2JA 1O3CA 2AHME 1ELVA 5K0HA 2J34A 3SGAE 1LCYA 2ZDAH 1GL0E 1FONA 1O2PA 1GWAA 2CF8H 4XFQA 4RKJB 5EJZA 1YCPH 4FUHA 1OS8A 1TOCB 3SI3H 2BD7A 4TPIZ 2J4IA 1SR5C 1C5QA 1KIGH 3RDZA 1AB9C 1GG6B 1TALA 2OC1A 2VGCB 4X8UH 3RMLH 2SGAA 1A61H 3OY6U 1FIZA 1CT4E 3TK5A 2VVCA 1O35A 1L1GA 1O3AA 1J9CH 3TH2H 2WUBA 2RFKC 1VJ9U 4AC9A 1V2QT 1YYY1 1QQUA 1UTOA 3RM2H 2IPHA 4Y8YA 1W11U 3GYLB 1EJNA 1GHXH 3RU4E 3U9AH 4Y6DA 1JOUB 1TMUH 1QJ7B 1GBTA 2C8YB 5L6NH 3IG6B 2IOTA 3LDXH 2JH5D 3K6YA 1W0YH 1DOJA 1O2VA 1CA0C 2Z94A 1EASA 1C5MD 3LGWA 1GBKA 1FX0B 2CMYA 2ZU4A 3U8OH 1NO9H 1F0RA 3TH3H 3V13A 3MWIU 4CREA 1GMDF 3SORA 3RXIA 4HFPB 2XBWA 1HXFH 2ZTYA 4KTCA 1SFQB 3E8LA 2V3OH 1FNIA 4JK5A 2BZ6H 5HIYA 1DM4B 1Y5AT 3RXTA 2NU4E 3TH4H 1QRXA 4ZXYH 1T4VH 3PRDA 5C3NA 1SFIA 2XBVA 3A8AA 1ANCA 3ZV8A 1TNHA 3Q00A 1HAHH 1C5YB 2KAIA 4AX9H 5I25A 4K60A 1P8VC 4NG9H 1SBWA 3QX5H 1ZMNA 5FPSA 1O30A 1DY8A 2WV9A 4X2WA 5DP5A 4AFZA 2D1JA 4DY7B 1QGFA 1EAUA 1AO5A 3M37A 1LHDH 2Y82A 4Z6AH 3SGBE 2UUFB 1UTKA 1BBRK 2ULLA 2TGPZ 2WPHS 3RUOA 3VB5A 1TBQH 1D3PB 1TIOA 4BTIB 2P16A 4ABGA 3E16B 2QC2A 1COWD 2G00A 4B6FA 1ABJH 1ZOMA 2M2AA 3KYGA 2PGBB 2AH4X 5JBTA 2XYAA 1SGNE 2F9BH 3MU4A 3OFND 1XUKA 2HALA 1BBRE 3V12A 1HXEH 1MU8B 2FP7B 3LT3A 1DUEA 2SNVA 4NA9H 2O9QA 1P2IA 1EP6A 1ORFA 3KN2A 1NRQH 2QY0B 1N8OB 1K1OA 3ESTA 1BTUA 1Z8RA 5EQRA 1O2HA 1MH0A 1OKXA 4RN6A 4UONA 4CR9A 1P11E 3K6ZA 1PPGE 1GI1A 4KTUA 1J15A 1WU1A 1V2TT 3GY5A 1FY5A 1ZGVA 2GGVB 2GVFA 1DUAA 2A1DB 2TBSA 1UK4A 3UFAA 2AMDA 2ANWA 2BVSH 2ZPRA 1TE0A 1PQ8A 3GCNA 4UEHH 2XBYA 3OY5U 1AFEH 5JB9S 2B8OH 3UQOA 1ETTH 1AQ7A 4AB9A 2NWNA 5GWZA 5HIZA 1MKWK 2LNCA 1DLEA 4ZKNU 4YLUA 1C5ZB 1O5CB 1PPHE 1SGFG 2GCTB 2UWPA 3KYFA 3MO6A 2ZFQH 2F9VA 2GDEH 3LU9B 4MQAA 2ZU3A 3AASA 4DOQA 2J94A 1S84A 2XC5A 4AYVB 2XOKD 1L1JA 1NS3A 4CHAC 2G51A 3MH7A 4OGXA 2KM0A 1ABIH 2PSYA 4ZXXH 1P9UA 1XVOA 2OK5A 2WPIS 1QHRB 4ISLA 3ZVCA 3U8TH 1EB2A 1SHYA 2Z6BD 4ZKOU 4X1NU 1C1OA 4TY7A 1GHBG 1SOTA 4DCDA 3VPKA 2OBOA 1H8DH 1GI0A 2FLBH 1EPTA 2F3CE 2PV9B 1G3EA 1EZUC 1EP5A 2ILNA 3PB1E 1A0HB 1A5IA 5E0JA 3DHKH 1BOQA 3UWJH 1O3IA 1BB0B 2XW9A 1DITH 3G01A 4GVUA 2ZF0H 3FVFB 5IK2D 2VWNA 2BDGA 3UNRA 3PLBA 1UVPA 2QAAA 3TJNA 2IPQX 4D9QA 1UCYK 2J92A 4U2WA 2VVUA 4WJG2 1GDQA 4Y8ZA 1O5AB 3FFGA 1TX8A 4DIIH 1AVGH 1EOJA 1CBWC 5C0UA 1SGFA 2H9TH 2QXJA 4FUIA 1ZHMA 1KY9A 4NCYA 1PPEE 3S0NA 1A0LA 1LVOA 2KCOA 4CRDA 1OWIA 1QTFA 1TX7A 1QJ1B 2NU0E 5BRRE 2A4OA 1THPB 2BDYA 1UCYE 3OEHD 1BRBE 2PTCE 5T6DA 3AW1A 2ZDNA 3RXUA 1V2MT 4O03A 2JJ1D 1ARBA 4ZROA 5FX5A 1GL1A 3BG4C 1HJ8A 1TNJA 4IN2A 3SJKA 1RS0A 4TSFD 1C9PA 2R2WU 1GBMA 3HATH 1TRMA 1IOEA 2HPQH 1V2NT 3BG8A 5L2YH 4ZKRU 1EZSC 2YMSD 5A09A 3SU2A 3Q3KA 3SBKA 1A4WH 1C1PA 1TNGA 2VNTA 2AGEX 2Z3DA 2BD2A 4CBOA 1QURH 1LKBA 1BRAA 4B2BA 1E34B 1SQTA 4JZ1A 1A3EH 3WY8A 1O3KA 1Q31A 5ESBA 1GJ5H 1EZXC 1FJSA 1GJBB 1O5GH 3F2HA 5C5NA 1JWTA 2HPPH 1IQJA 3P17H 5GIBA 3OYPA 1AI8H 1GPZA 1O2QA 1T32A 1LHFH 2ZCLP 1WQSA 3FKSD 2O8MA 3MMGA 4M7GA 1FPCH 1G3CA 3LGIA 5CHBA 3F2FA 3SHCH 3RC4A 5C17A 1KLIH 1BA8B 2WSSD 2Y6TA 1GI7B 1HV7A 1S85A 1OP2A 3TJOA 1GHVH 2FMJA 3A7TA 1WAYB 3PLKA 1GBIA 1ZMJA 1DSTA 3A88A 1THRH 5EPNA 3RXAA 2UWLA 2FI3E 1O3NA 1HUTH 4Y7BA 3S69A 3TLOA 1SG8B 1ELBA 5BPEA 3LGTA 2GZ7A 1BHXB 3BN9A 1C2HA 8GCHG 1TMBH 2F9NA 3AW0A 4GCHF 1FZZA 2A5KA 1H8IH 5T3HA 1MKXK 1OYQA 2F9UA 4FETA 4IC6A 4K1EA 4BTTB 1W7GH 3BTGE 3GICB 1C5UA 3QK1A 2F4LA 1ID5H 2WPLS 3FP8E 4ZCNA 4MDSA 4Y11E 1A0JA 4HI3A 2W26A 1TX6A 1O2TA 3UQVA 4FUGA 2FM2A 4HZHA 3QLPH 2VIQA 1WYKA 3UR9A 4KKDA 3GY6A 3E90B 4KTSA 2BDIA 3QGJA 3H09A 2J2UA 2BY6X 2VH6A 2W7SA 4XE4A 1CQQA 4BANB 6CHAB 1GJDB 3A81A 3W1EA 1P9SA 4CRCA 3VG8A 1O2XA 3LOXA 3A8CA 4NA7A 1O2JA 2WYGA 1AE5A 5LPEA 4MPXA 4BAQB 1FY8E 2ZPSA 2BVXH 3CNRA 2BY8X 1GG6C 1CE5A 2QYIA 1K9OE 2VGCC 4D8NA 3Q3YA 2V6NA 4NWKA 2BLVA 2P93A 1CGIE 3BTFE 3A85A 5SGAE 3F9EA 4KGAA 1KXDA 4CH8B 5C94A 1HFDA 1T4UH 1JIRA 2AS9A 4RT1A 5FBIA 5CMXH 1CHOG 1P01A 1SHHB 2P8OB 2Y7XA 3RXFA 1ETRH 5EW1H 2H1UA 1BDAA 1TGSZ 3GCTG 1Y3XA 2ZG0H 2BLOA 2PFEA 3U28C 3SNEA 3DUXH 4UFGH 1YPLH 4UFDH 3CS0A 5DP9A 4BXSA 3SW2B 2JH6D 4A6LA 4H42U 1D6WA 1TLDA 1FI8A 1K1NA 1PYTD 1G9IE 2VIWA 2UWOA 2KX4A 4I8HA 1C1MA 1YCPK 2JDID 2YOLA 1VCPA 2JETB 1O3DA 2JH0D 2PWXA 2Z7FE 3PMHB 5L2ZH 4O9VA 1QB6A 4OS4A 4ISOA 4D9RA 1O3EA 2XCNA 1MCTA 1O2OA 1WDIA 2G81E 3P70B 5DSFA 1UHBA 1O39A 1ZSLA 5FBEA 1Y3YA 3BTWE 2ZFPH 2A4QA 1YY3A 1CHGA 1BRCE 1HAOH 2M5TA 3A8BA 1C2KA 1G32B 1EQ9A 5CDFE 1KDQA 8ESTE 1TA6A 1WSSH 3SV8A 3JZ2B 3K9XB 1NFYA 4U32A 5A2MH 4DIHH 1NESE 3SV9A 5TJXA 3RU4T 3SGQE 2Z3EA 3M7TA 2PP6A 2HVYB 5F8ZA 2FS9A 2HNTE 2PKSB 3SN8A 1H8HD 2PUXB 1C9TA 1ACBE 3SNDA 3TU7H 3LPRA 4A1XA 1O2ZA 3N7OA 3ZVBA 1GMCG 4H4FA 2EC9H 5DP6A 3SUGA 2BXUH 3VB4A 1GJ4H 1O33A 3SU6A 2GTBA 2XRCA 2BDAA 3MQKC 1K22H 1N8OC 3WW7A 1LPZB 1DWBH 2RA0A 3QO6A 4NFEA 1ZYOA 2STAE 1ANDA 3A86A 3M61U 1WTHD 2BY5X 4DJZB 1C4U2 2BM2A 3H5CB 1K1IA 3A84A 1F5RA 1GJAB 2H5CA 2P94A 2AGIX 1NRNH 1ZRBA 1C5RA 2FI4E 1B7XB 4GHTA 3PMBB 3DFJA 1S81A 4NIVA 3T62A 3W95A 3UTUH 2GZ9A 3DA9B 2R0KA 3LJOA 2J38A 2A2XH 2A2QH 2ZGXH 1FAXA 2A7CA 2OTVA 1P0SH 3MH6A 3QTVH 2UUYA 1LDTT 3N7EA 2KR7A 3D23A 3IITA 2GCTC 2TPIZ 3P8GA 3MYWA 4XSKU 1HLTH 1HJ9A 2F43B 1AUJA 5E2PA 1OPHB 1EX3A 4FUBA 5F8TA 1OSSA 1MTNB 3KGPA 1NM6A 1O5BB 2ZGJA 2LELA 1XX9A 2A5AA 1AIXH 1K21H 5I46H 2PKAB 5EG4A 1P09A 3P95A 3BIVH 3T25A 4Y0YE 5C1UA 4H6TA 2VU8E 3A8DA 2PKAA 3SQHE 1B0FA 1BJVA 1LO6A 1GBEA 2QF5A 3UPEA 4CH2B 5LPRA 4I31A 2VVVA 1GJCB 2VIPA 2FOMB 5LH8A 4JK6A 3F9GA 1NC6A 2ZEBA 3KNXA 1S0QA 2A7JA 3F9FA 5GCHG 8LPRA 2YNBA 1YC0A 1YPMH 1PQAA 1P04A 1BMAA 1DS2E 4YO9A 2ZC9H 2KCPA 2BD3A 2Z9IA 2C3SA 1DDJA 1T31A 4ABHA 5IYTA 3K2UA 1NRSH 1MTWA 3UNQA 3EE7A 4UFEH 3I29A 5EOKA 5FCRA 2OQUA 1XUHA 2G5VA 4X2VA 1GHBF 1Q2WA 4WVPE 2W6JD 1GBCA 1CA8B 5GXPA 4F4OC 2VIVA 4ISHH 5F53A 3BTHE 3PLPA 3A7YA 1YCPM 1RTLA 1HAGE 2Q6FA 5FXLA 1GHYH 2GCHG 2CN0H 4DW2U 4WH6A 3B23B 1QFKH 1Y3VA 2V0BA 3SO3A 2FZZA 3SZEA 4OS7A 3O8RA 2FDAA 1GI9B 4F49A 1AVWA 1RFNA 2ZP0H 3LC3A 3ATLA 3SJ8A 4DT7B 1QCPA 2OP9A 1YGCH 1YLDA 2OD3B 4A7IB 1EB1H 1QBNA 4VGCB 2K1QA 1NPMA 1WQVH 4X8SH 1J16A 2ZU2A 3M35A 4MG3A 1GVLA 4NGAH 3URDA 1UTMA 4IGDA 3RXEA 4JZIA 3NRLA 1QQ4A 2BD5A 1IQHA 5DGJA 1A3BH 1MABB 5FPYA 3T29A 4BOHA 3I78A 2G5NA 1FN6A 1GHWH 1OWDA 1E35B 1EFRD 3BTKE 3STJA 5EPYA 4QT8C 5IDKA 2ZIQH 2D26C 2WPDD 1SC8U 1VGCB 2BD9A 4MTBA 4JYVH 5EXLA 1E1QD 2VBCA 4ABJA 1MBQA 4Z0KA 4A92A 1O31A 4R8TB 3BEFB 4U01A 4X6PA 3ZZDA 1SL3A 1V2WT 2WYJA 3SNAA 1SGTA 2ZA5A 1O2SA 2Z9JA 3RC6A 1TPSA 1TGBA 4DT4A 5C20A 2B0FA 1MQ5A 4GAWA 2THFB 2G55A 1SQRA 1C1SA 1P2OA 1Z8JB 2BOKA 2LPRA 4WH8A 2QF3A 3E1XB 7ESTE 2PLXA 3BSQA 1Y5UT 1TOMH 1O2RA 1H9HE 5FAHA 3NK8A 2ZHWH 3ZZ9A 2QXGA 3E0NB 1RTKA 4ISIH 3PV4A 2JKHA 5DJ7A 5TCCA 1LPKB 2ZGBH 2L6OA 1YLNA 4UD9H 5LGOA 3RXKA 5J4SA 3SJIA 1HAIH 1M9UA 1OXGA 1HAYB 4AYYB 3ZZ5A 2ZKSA 2FIRH 4CR5A 1GJ9B 5DP3A 4IMZA 4ZKSU 4X2YA 2O8UA 3OAAD 1N6YA 4MNVA 1MZAA 1UTPA 1YM0A 4KP0A 1UMAH 4FVBA 1D6RA 3SV6A 3ODFA 3ZZ3A 4Q80A 3BTQE 2ZHDA 1FPHH 6CHAC 2Z3CA 1PPFE 3EE0B 4ZHLU 3W94A 1O3JA 1C5SA 2OQ5A 2DUCA 4WMFA 1Y5BT 5FCKA 8GCHF 1KLJH 1Z1IA 1O5EH 4ZAEA 3SZNA 2SNWA 2O8WA 4LK4A 5EIYA 3ZVAA 2A4GA 4TYDA 1F7ZA 1FIWA 3E6PH 5GNDA 3NUMA 1O32A 1DWEH 1K28D 4Q4LA 1ELDE 1MU6B 5ABWA 1WXRA 3BV9B 1IHTH 2OCVB 4K8BA 5AFYH 2J98B 1PJPA 2DE8A 4Z1MD 1CU1A 2VWLA 4X8VH 4KELA 1KXBA 3U1JB 1C1TA 2XC4A 1VCWA 1ARCA 5GJ4B 3VXFH 1AZZA 1HAZB 2V7QD 1A5HA 2P8OC 3M5OA 1O36A 2BQ6B 2BLWA 4ABBA 1O3MA 3PROA 2XTTB 2ZU5A 2FOEA 1S82A 3C1KA 1C2LA 1GHAG 2BB4A 3GY8A 5H4IB 1C1RA 1O3OA 1Z6JH 1SGYE 2W6ID 3FN8A 5F6MA 2A0QB 2ALVA 1MAYA 2FWWA 5DP8A 3S9BA 3A7VA 1EJMA 1O3FA 3UUZA 5B6OA 2GDDA 1UTQA 2OBQA 4GLYA 5CHAB 2JETC 1UVOA 1ZPZA 4ABDA 2BDCA 2WPJS 2B7DH 4I33A 1G37A 1QIXB 3FZDA 3UREA 2SGEE 1GJ8B 5E2OA 4BNRA 1TQ0B 7KMEH 3VGCB 3TVJB 1C1NA 1MD8A 2OINA 1CHOF 1O2IA 1U6QA 3ZVDA 1BTYA 2PHBA 4Y76A 1C1VH 1EZQA 2ZU1A 5HM9A 1AY6H 5EJLA 2AIQA 1VITG 3M5NA 3WWBA 3GCTF 1YPGH 5C1YA 4NFFA 3QGNB 4Y10E 1O2NA 1ANBA 2ZTXA 1NT1A 2ASUB 1C2MA 5L30H 2QCYA 3HK3B 3I77A 3GDSA 3S7HB 1C5NH 4AFUA 4ABEA 4OS6A 1CSOE 1IQFA 2RA3A 1QA0A 1Q3XA 3KQ5A 1TNLA 1P2KA 4Q63A 3OU0A 1JMOH 2FLRH 4CRGA 1FDPA 2PKSC 1H9IE 2CXVA 1C5VA 1C1QA 1GI3A 1HAXB 5EJ1A 1V2RT 1DWCH 4MNWA 1L0ZA 2QF0A 1NU7B 1E36B 2OXSA 4X1RU 1FY4A 3BTME 3BTEE 1ZTLA 1ZMLA 1T7CA 1F0UA 3N99A 3TGIE 4X2XA 4AG2A 1MTSA 5C67A 5JPMH 1C5WB 1LQEA 3LIWA 5AVDA 1J14A 1Y59T 4A1VA 1YF4A 2BDBA 1TYNA 2BTCE 1EAWA 2V3MA 3LGYA 2AMPA 1RD3B 1ELAA 3AAVA 1GGDB 4K69A 5E8EH 4FU9A 2PGQB 3GCHB 1ZLRA 1PPCE 3JZ1B 1Z8GA 1GI4A 2R9PA 1ZPBA 2OC7A 2BHGA 2C93B 2GJGA 1FAKH 4YOGA 3SU0A 3FP7E 1RIWB 3RLWH 2Y5HA 1GBHA 3ZZ7A 1F0SA 5EXNA 2D2DA 1GMCF 1SLUB 2FOBA 5B6LA 4AGKA 3T26A 2K8IA 3RXGA 3EA8A 4XD7D 2WINI 1UTLM 1X7AC 4WF8A 1SGEE 1TFXA 1FQ3A 3P6ZB 1P10A 5FPTA 2QE7D 2CK3D 1SLVB 2YNAA 3A7ZA 5DO4H 3DFLA 5C5OA 1MTNC 2HLCA 2ZHQH 4R0IA 1C2IA 2VIOA 3Q77A 4E7NA 1O2WA 4AORA 4DG4A 3L3TA 1IAUA 2P59A 1GDUA 3HGNA 3MTYA 3CENA 3OSYA 3PTNA 3P8NA 4B1TA 4D7FA 3BTTE 5A8ZA 4WMDA 4P02A 3HK6B 3KF2A 3RXQA 4YLQH 3U69H 3FAOA 2HLDD 2GX4A 4ZHAA 4AOQA 1UTNA 3M7UA 2RDLA 3LH1A 2CV3A 4YM9A 4TWYA 1F92A 4NA8A 1DXWA 3DSOA 4WY3A 2PR3A 1XUFA 1YPKH 2W5EA 4HTCH 1DX5M 2XNDD 1ZRKA 6ESTA 4IN1A 3TJVA 1O3BA 2WPKS 3SU5A 1OYTH 1B5GH 1ELTA 3GDUA 5JBBS 2GP9B 5DKMA 1LVBA 4X6NA 3TJUA 3H7TA 6GCHG 5T6GA 1DY9A 2BMGB 2ODQA 2TGAA 1W0JD 1BCUH 1ETSH 3RXLA 3ZVFA 9ESTA 3TK9A 1RTFB 4X1PU 2EQNA 4ZH8A 3MH5A 2ZFFH 3DSGA 3GY7A 1H4WA 1T8LA 1UCYH 1F5LA 4BAHB 1C2DA 1A7SA 4IW4E 3E0PB 1WCZA 3STIA 1E1RD 2G8TA 1TNIA 1INCA 5T1VA 4B75A 2FPZA 3GYMA 1O3GA 5HM2A 1DE7H 3ATWA 4AB8A 4JCNA 2HRVA 1NBMD 3OTJE 5G4BA 4B6EA 3OE7D 5GCHF 3GCOA 2FEQH 3SNBA 1BMNH 1UTJA 2ZDLA 5T6FA 1EXFA 1BQYA 2A31A 1DT2A 3UOPA 1TONA 1CT0E 1E38B 1SQOA 1IQMA 1ELGA 4OS2A 4FUFA 1YPEH 1BMFD 1HPGA 1XVMA 2D8WA 3H7OA 4H6SB 4X1QU 4VGCC 3ZYDA 1W3CA 1G36A 2ODPA 3QZRA 4X1SU 1BIOA 1GBDA 5LPFA 1AE8H 3ODDA 3WWFA 3KEEA 4IC5A 2HNTF 5C1XA 1DWDH 1FY3A 2ZHFH 1FY1A 3M7QA 2GCHF 5EODA 1HJAB 1XUJA 1HIAB 3NKKA 3MI4A 3T27A 2ZWLH 2R2MB 2Y80A 5A0CA 1VGCC 3A83A 1HIAA 3KIDU 1CGHA 2IN2A 3MNSA 3M5LA 1P02A 2BD8A 2HNTC 3FZZA 2ANMH 2BY7X 2QF4A 9LPRA 3CS7A 1P05A 3GS9A 1QBOA 5A0BA 1EATA 3UOUA 3OX7U 4ABIA 3TGKE 2KCYA 4LXBH 1BUIA 1UVSH 1E0FD 2FOGA 1ZTJA 3T28A 3ZZ6A 3RU4D 4WXIA 1GDNA 1PPZA 3RXRA 1S6FA 1WOFA 1TMTH 3D62A 3UWIA 1F0TA 1B0EA 5JYIA 3U8RH 4Q7YA 1O3HA 1YPHE 1IQLA 4NSYA 2WPMS 1C4Y2 1S83A 1W12U 1J17T 1O5FH 2SGDE 2UUKB 1VKYA 3LJJA 2CGAA 3A89A 2ZFSA 4YESB 4ZHMU 5KEDA 1W13U 1C2GA 5KGOA 2Q6GA 1IQIA 3KL6A 3SU4A 1MBMA 4E7RG 4MPVA 4TT3D 1EUFA 4XBCA 2ZDKA 1FMGA 1BT7A 3KQCA 4FUJA 5DP7A 3E91A 2L74A 4Y0ZE 1UW7A 2GMTB 5HYOA 2Z9GA 4FUDA 1YKTA 3PYHA 1ELFA 1HAVB 2EEKA 4RKOB 1LKAA 1MMJN 3PRBA 1K1LA 1SVPA 3F1SB 1F5KU 3BEUA 7GCHG 4ASUD 2FX4A 1IHSH 3F6UH 3U98H 2NU2E 1K0HA 3MNBA 1XUIA 1AZ8A 1SSXA 2HWLB 1TPAE 1GI6A 3M5MA 5A8YA 1XXDA 2ANYA 4FVDA 2W3KA 1SMFE 4I8KA 4MPWA 4XBDA 3PO1B 1GBJA 3UY9A 3M3TA 3ZVEA 4AFQA 1HAPH 2Y5FA 1ZPCA 5GDSH 1AU8A 2ZQ1A 2BD4A 3UAIC 4AN7A 1BTHH 1H9LB 3AVZA 4K1SA 4RT0A 1V6DA 1ZZZA 5JDUB 3NXPA 4FUEA 2V35A 3ATMA 2BLQA 4X8TH 1NFXA 2ZI2H 4TPYA 2OUAA 5EXMA 4CRFA 2WHXA 1P2MA 1V2UT 2XCFA 4D76A 4I8GA 1LPGB 2ODYB 1CVWH 4Q7XA 1ESBA 3LKWA 1FXYA 3BF6H 3NCLA 3EAJA 4OS5A 5CHAC 2BQWB 1DXPA 1PFXC 2C90B 4U30A 1VCQA 1G30B 2O8LA 5EGMA 3S9AA 3UIRA 3VGCC 1HNEE 3ZYEA 1K1PA 1LQDB 3SUEA 1HBTH 2VWOA 3C27B 3SJOA 1CO7E 4GSOA 2AERH 2BOHB 1DLKB 1YPJH 2TGDA 1ESAA 2PTNA 3MH4A 1GHAF 3RMMH 3SOSA 3VB6A 1GI5A 3RXVA 2YMSB 2VWMA 1TPPA 4YZUA 2F9OA 3FOAA 4BAKB 2KCAA 3N7DA 2G4TA 2Z9LA 3M36A 4B76A 1Y3WA 1V2PT 5DPAA 4NIYA 3QN7A 4WXVA 2BYAX 1ZGIA 2TGTA 1MZDA 1G3DA 3LGVA 1BITA 2WUCA 3SI4H 5F03A 5C2ZA 1H1BA 1O2MA 2EI6A 1SGRE 1O2LA 3ATKA 2ZNKH 1TA2A 1K1MA 2C8ZB 2QIQA 4RSPA 1VITF 2A45B 2XWAA 3S7KB 2C4FH 1GBFA 1EJAA 1ZSJA 4WWYA 3DT0H 4YOIA 3RP2A 3RXMA 4ABAA 1RGQA 3RXHA 3ZZBA 4XDEA 2OC0A 4FU8A 1Y8TA 1Z1JA 3O8CA 1ELCA 1FUJA 1GGDC 2FTMA 3A80A 1A46H 3KQDA 4K3JA 1TPOA 1C5XB 1GI8B 1MCVA 3GCHC 1OWJA 3MNXA 3TGJE 1ZHPA 2KAIB 1D9IA 3VB3A 1QY6A 1BHXF 1AVXA 2J97A 2RDEA 1RIWC 4ISNA 1SLWB 1NFUA 4NZLA 1Z8IB 1EKBB 1MTVA 4A1TA 2H9EH 3TNTA 3PV5A 4DGJA 3PM3A 3SQEE 3SU3A 1EOLA 1LHGH 3O8DA 1O37A 1MQ6A 4UDWH 1CT2E 3VB7A 4INHA 2RG3A 1ZTKA 2PUQH 2AIPA 1BZXE 4O3UA 1C5OH 1IQNA 2P95A 1D3QB 3HKIB 3ZZ8A 1SGIB 4IBLH 1P03A 2FOHA 3TK6A 4FOUC 2AFQB 4UFFH 1EAXA 5CE1A 1AMHA 3SUFA 2SFAA 1W7XH 1NN6A 1QA7A 1TRNA 1HRTH 2Y5GA 2QGRA 2ZGHA 2I6SA 4X6OA 1TNKA 3KQEA 3PMAB 1QR3E 4SGBE 2TRMA 4Y71A 1YLCA 2HOBA 3LC5A 1TGTA 3RXCA 4IS5A 4TY6A 1AWHB 2FESH 2FTLE 4ACAA 3AAUA 2P3UB 2ALPA 2FO9A 4JZFH 2SGFE 5KECA 4JYUH 4CRAA 2BZAA 3M3VA 4J1YA 1UVUH 1BTPA 1LHCH 1DVAH 3L33A 2HVXA 3F0OA 2B5TB 2FI5E 2F9PA 1GMHG 1T8OA 1OP8A 4LOYH 2AEIH 1BMMH 4K2YA 2FYQA 3L6PA 2ZFTA 1O3PB 2B9LA 2ZDVH 3A87A 5EW2H 1OHHD 2CF9H 4ABFA 4HGCA 2A5IA 2QXIA 2XXLA 2Y81A 1UK2A 2XBXA 3A7XA 3PWBA 2J98A 1ANEA 2GZ8A 4XRNA 2R0LA 1Z71A 3SV2H 1GBBA 1AGJA 1RJXB 2R3UA 2ZHEH 2W3IA 4Y8XA 3F3BA 1W0KD 1AFQB 1KTTB 1ZHRA 3TIUA 4ZUHA 3HKJB 1GJ7B 1E79D 2BXTH 1DFPA 4XBBA 1P57B 2LP6A 3GDVA 6GCHF 1WTGH 2AGGX 1VJAU 1DPOA 2A7HA 1GCTB 2XNIA 2CHAB 3SUDA 5FHTA 1EPTB 3LGUA 1NY22 2F91A 3NPSA 1XXFA 1W0ZU 3ZV9A 8KME2 5E0HA 1MAXA 3RXPA 2BQ7B 1VR1H 4B2CA 1QL8A 1K1JA 2GV6A 3R3GB 5EQQA 1P3EA 3P92A 1TGNA 2HGTH 4Q7ZA 2Q6DA 1SLXB 3KHVA 1AB9B 3ZVGA 1D4PB 1SOZA 3MOCA 3QWCH 4D7GA 5PTPA 1GMDG 1HJAC 3IWMA 3SU1A 1BTZA 2TIOA 1G3BA 5C0TA 3M3SA 4HG6A 1G2LA 5HMAA 1OOKB 1KXAA 3V0XA 5TCAA 3V7TA 1ELEE 4I8JA 1DANH 2FXRA 1VITH 1KYNA 3OTPA 4MNYA 2P3FH 4AFSA 4E06H 4YTAA 3MHWU 3MO9A 4LZ1H 1UVTH 1W10U 4ZMAH 4PROA 1ZJKA 1JRSA 1O38A 5FL7D 5K7RA 3EGKH 1L4DA 1V3XA 4FUCA 4INKA 1PQ5A 4K1TA 1BBRH 5EU8A 1K2I1 1MD7A 1O34A 2H5DA 1KMHB 1CA0B 1THSH 1UO6A 1LTOA 3BTDE 4WMEA 1AKSB 5DK1A 1C5TA 1QB1A 1QL7A 3A7WA 4THNH 3T5FH 4ACBA 1AKSA 2AMQA 2ZTZA 2ESTE 3QDZB 1V2JT 2FX6A 1V2ST 4X0WU 4CRBA 1D3DB 3PMJA 1NZQH 1TABE 2JIZD 4UE7H 5A8XA 1UJ1A 3F9HA 2IJOB 3ZIAD 2O8TA 2NU3E 3Q3XA 3ZZAA 5HGGA 1IQKA 1D3TB 2ZQ2A 1ZJDA 1SGCA 1P2NA 2AYWA 3FANA 2V3HH 1NU9A 1CGJE 1HYLA 2FYRA 4X6MA 3DSPA 2GMTC 3EYDA 2JJ2D 1QL9A 1NROH 1TWXB 2G4UA 2QXHA 3RLYH 1GBLA 2FOCA 3RM0H 3VFEA 2DE9A 3TPIZ 3P8OA 3SYJA 1W14U 1EAIA 3BEIB 1AD8H 2QA9E 3BIUH 1KSNA 3QUMP 1OWEA 3UR6A 1OWHA 1N6XA 3URCA 5HXFA 1C5PA 1YBWA 4I86A 1TAWA 4Y79A 4O3TA 3EA9A 1MKWH 4FXGH 2XWBI 1SQAA 2GKVE 1FN8A 2ZCHP 1JBUH 2ZPQA 5A0AE 3PO1C 4BXWA 3GY3A 4ESTE 2SGPE 1FLEE 3D49H 3RXOA 2Y7ZA 1NRPH 1XUGA 2I6QA 4K8YA 4OM9A 1V2KT 1TB6H 2XC0A 1P2QA 3EQ0H 3ITIA 1IQGA 4Q2KA 3MU8A 1GVZA 3Q76A 3SNCA 4YOJA 7GCHF 1TGCA 2FS8A 3EA7A 1KLTA 1BMLA 2GV7A 5DG6A 3NWUA 1SB1H 1TQ7B 1QZ8A 2STBE 4YT6H 3ZZCA 4GHQA 3SHAH 1C2JA 3DD2H 4BTUB 1C5LH 4B74A 4XOJA 2EI8A 2PW8H 4JZDH 1XM1A 1QBVH 2K0QA 1T8MA 3UNSA 2EA3A 4J2YB 2C8WB 2ZFRH 1QB9A 1O0DH 2OLGA 3FO8D 4ASHA 4BAMB 1WV7H 2BX3A 1QRZA 4CBNA 3QTOH 3GY2A 5EQSA 4AZ2B 1O3LA 4GUXA 1S5SA 1OX1A 2QV1A 4DVAU 1OP0A 2VINA 3HPTB 4NIXA 1PPBH 3HGPA 1RRKA 3TITA 4CHAB 4TWWA 4B71A 4JYTA 1ZSKA 2ANKH 5E0GA 1E37B 1YWUA 2YMSC 6LPRA 4I7YH 2KZ4A 1UK3A 1P3CA 1TBZH 1KXCA 1A1RA 4B73A 4SGAE 1TBRH 3PV2A 1O2UA 4LZ4B 3UB0A 1HDTH 1GHZA 1HB0B 1SKYE 1XKAC 3GOVB 5JBAS 4YXWD 1GCDA 1V2LT 4MNXA 4DURA 3GY4A 1PQ7A 2GT7A 1SGPE 4O97A 2GD4B 2QN5T 3KQBA 2BVRH 1JRTA 3MU0A 1VZQH 1O5DH 5DP4A 4AGJA 1J8AA 3QZQA 4BAOB 1QRWA 2ZGCA 3A82A 1XKBC 2IJD1 2GT8A 3O8BA 5DN6D 3ENSB 4F48B 7LPRA 3ZZ4A 4NSVA 4OS1A 1NTPA 1SGQE 1C2FA 1OWKA 3NZIA 3K65B 1LVMA 1CBWB 2ZO3H 2BY9X 1A2CH 2J95A 1C4V2 4INLA 3DCLA 3TNSA 2WV4A 3ATIA 3FP6E 4IMQA 1UHBB 1Z6EA 2VJ1A 3MNCA 1SI5H 1AUTC 2CJIA 1HCGA 4OGYA 3GISB 1Z7KA 3LH3A 1DICA 1KDQB 1LHEH 1S0RA 2BDHA 3SJ9A 2P3TB 1L4ZA 5F8XA 1JIMA 3BG4B 3OEED 1N1LA 1HGTH 1P12E 1WUNH 1TRYA 1YPHC 4AG1A 2OC8A 3F0PA 2NU1E 3RXBA 3RMNH 1QJ6B 3P8FA 1IQEA 1NRRH 1LVYA 3B8JA 1NFWA 2J5UA 2UUJB 2F83A 1V2OT 2WV5A 3F68H 3CP7A 1BTWA 1G2MA 4Y7AA 2J9NA 4I32A 2WZQA 5ETXA 3RC5A 1C1WH 2EI7A 1BRUP 3RMOH 2R3YA 1FV9A 1DSUA 1RXPA 1KXFA 1L2EA 1MKXH 3SV7A 2H2ZA 5HKKD 1S6LA 1V2VT 1L1NA 1BJUA 5AFZH 3ELAH 4NIWA 5J4QA 3KCGH 3PTBA 3VEQB 2Z9KA 3MO3A 1AHTH 3RXSA 1W8BH 1C2EA 4YT7H 4I8LA 1QNJA 4GCHG
chains in the Genus database with same CATH topology
2VB0A 1LMWB 4NWLA 4NZQA 3D65E 1HAVA 1SGDE 3MFJA 1O2YA 3MU1A 2C8XB 3B9FH 4JZEH 1S6HA 1KXEA 3R0FA 5JB8S 2FODA 2ZZUH 4FU7A 5AHGH 1W2KH 1WBGB 3VXEH 2A32A 2RCEA 3RXDA 1MUEB 2VIDA 3RXJA 2W7UA 3MU5A 1A5GH 2ZCKP 3EDXB 1AN1E 1MTUA 2SGQE 1SPJA 4K5ZA 4MLFB 1O2KA 2FOFA 4B2AA 1GBAA 5AF9H 3S9CA 2A4RA 2Q1JA 4MPUA 4E05H 1GJ6A 1GVKB 1AFQC 1P06A 2BX4A 1AWFH 1PYTC 5FX6A 4JMYA 2H6MA 3U1IB 1ZR0A 1GI2A 1T8NA 1KTSB 5ESTE 2ZECA 2G52A 5GPIB 1GMHF 2VH0A 3LONA 2H9HA 1ESTA 3PWCA 3T2NA 2FOAA 1O2GH 3V3MA 2PSXA 1GCTC 4GPGA 1JXPA 1YP9A 2CHAC 1Y3UA 1EPTC 3E3TA 4MVNA 5JBCS 1XMNB 1F2SE 1C1UH 2ZDMA 1BTXA 4A5TS 1P2JA 1O3CA 1ELVA 5K0HA 2J34A 3SGAE 1LCYA 2ZDAH 1GL0E 1FONA 1O2PA 1GWAA 2CF8H 4XFQA 4RKJB 1YCPH 4FUHA 1OS8A 1TOCB 3SI3H 2BD7A 4TPIZ 2J4IA 1SR5C 1C5QA 1KIGH 3RDZA 1AB9C 1GG6B 1TALA 2OC1A 2VGCB 4X8UH 3RMLH 2SGAA 1A61H 3OY6U 1FIZA 1CT4E 3TK5A 2VVCA 1O35A 1L1GA 1O3AA 1J9CH 3TH2H 2WUBA 1VJ9U 1V2QT 1YYY1 1QQUA 1UTOA 3RM2H 2IPHA 4Y8YA 1W11U 3GYLB 1EJNA 1GHXH 3RU4E 3U9AH 4Y6DA 1JOUB 1TMUH 1QJ7B 1GBTA 2C8YB 5L6NH 3IG6B 2IOTA 3LDXH 2JH5D 3K6YA 1W0YH 1DOJA 1O2VA 1CA0C 2Z94A 1EASA 1C5MD 3LGWA 1GBKA 2CMYA 2ZU4A 3U8OH 1NO9H 1F0RA 3TH3H 3V13A 3MWIU 4CREA 1GMDF 3SORA 3RXIA 4HFPB 2XBWA 1HXFH 2ZTYA 4KTCA 1SFQB 3E8LA 2V3OH 1FNIA 4JK5A 2BZ6H 1DM4B 1Y5AT 3RXTA 2NU4E 3TH4H 1QRXA 4ZXYH 1T4VH 5C3NA 1SFIA 2XBVA 3A8AA 1ANCA 3ZV8A 1TNHA 3Q00A 1HAHH 1C5YB 2KAIA 4AX9H 5I25A 4K60A 1P8VC 4NG9H 1SBWA 3QX5H 1ZMNA 5FPSA 1O30A 1DY8A 4X2WA 5DP5A 4AFZA 2D1JA 4DY7B 1QGFA 1EAUA 1AO5A 3M37A 1LHDH 2Y82A 4Z6AH 3SGBE 2UUFB 1UTKA 1BBRK 2ULLA 2TGPZ 2WPHS 3RUOA 3VB5A 1TBQH 1D3PB 1TIOA 4BTIB 2P16A 4ABGA 3E16B 2QC2A 2G00A 1ABJH 1ZOMA 2PGBB 2AH4X 5JBTA 2XYAA 1SGNE 2F9BH 3MU4A 1XUKA 2HALA 1BBRE 3V12A 1HXEH 1MU8B 2FP7B 3LT3A 1DUEA 2SNVA 4NA9H 2O9QA 1P2IA 1EP6A 1ORFA 3KN2A 1NRQH 2QY0B 1N8OB 1K1OA 3ESTA 1BTUA 1Z8RA 5EQRA 1O2HA 1MH0A 1OKXA 4RN6A 4UONA 4CR9A 1P11E 3K6ZA 1PPGE 1GI1A 4KTUA 1J15A 1WU1A 1V2TT 3GY5A 1FY5A 1ZGVA 2GGVB 2GVFA 1DUAA 2A1DB 2TBSA 1UK4A 3UFAA 2AMDA 2ANWA 2BVSH 2ZPRA 1TE0A 1PQ8A 3GCNA 4UEHH 2XBYA 3OY5U 1AFEH 5JB9S 2B8OH 3UQOA 1ETTH 1AQ7A 4AB9A 2NWNA 5GWZA 1MKWK 2LNCA 1DLEA 4ZKNU 4YLUA 1C5ZB 1O5CB 1PPHE 1SGFG 2GCTB 2UWPA 3MO6A 3T26A 2ZFQH 2F9VA 2GDEH 3LU9B 4MQAA 2ZU3A 3AASA 4DOQA 2J94A 1S84A 2XC5A 4AYVB 1L1JA 1NS3A 4CHAC 2G51A 3MH7A 4OGXA 2PSYA 1ABIH 4ZXXH 1P9UA 1XVOA 2WPIS 1QHRB 4ISLA 3ZVCA 3U8TH 1EB2A 1SHYA 2Z6BD 4ZKOU 4X1NU 1C1OA 4TY7A 1GHBG 1SOTA 4DCDA 3VPKA 2OBOA 1H8DH 1GI0A 2FLBH 1EPTA 2F3CE 2PV9B 1G3EA 1EZUC 1EP5A 2ILNA 3PB1E 1A0HB 1A5IA 5E0JA 3DHKH 1BOQA 3UWJH 1O3IA 1BB0B 2XW9A 1DITH 3G01A 4GVUA 2ZF0H 3FVFB 2VWNA 2BDGA 3UNRA 3PLBA 1UVPA 2QAAA 3TJNA 4D9QA 1UCYK 2J92A 4U2WA 2VVUA 4WJG2 1GDQA 4Y8ZA 1O5AB 3FFGA 1TX8A 4DIIH 1AVGH 1EOJA 1CBWC 1SGFA 2H9TH 2QXJA 4FUIA 1ZHMA 1KY9A 4NCYA 1PPEE 3S0NA 1A0LA 1LVOA 4CRDA 1OWIA 1QTFA 1TX7A 1QJ1B 2NU0E 5BRRE 2A4OA 1THPB 2BDYA 1UCYE 1BRBE 2PTCE 5T6DA 3AW1A 2ZDNA 3RXUA 1V2MT 4O03A 5FX5A 1ARBA 4ZROA 1GL1A 3BG4C 1HJ8A 1TNJA 4IN2A 3SJKA 1RS0A 1C9PA 2R2WU 1GBMA 3HATH 1TRMA 1IOEA 2HPQH 1V2NT 3BG8A 5L2YH 4ZKRU 1EZSC 5A09A 3SU2A 3Q3KA 3SBKA 1A4WH 1C1PA 1TNGA 2VNTA 2AGEX 2Z3DA 2BD2A 4CBOA 1QURH 1LKBA 1BRAA 4B2BA 1E34B 1SQTA 4JZ1A 1A3EH 3WY8A 1O3KA 1Q31A 5ESBA 1GJ5H 1EZXC 1FJSA 1GJBB 1O5GH 5C5NA 1JWTA 2HPPH 1IQJA 3P17H 5GIBA 3OYPA 1AI8H 1GPZA 1O2QA 1T32A 1LHFH 2ZCLP 1WQSA 2O8MA 3MMGA 4M7GA 1FPCH 1G3CA 3LGIA 3SHCH 3RC4A 1KLIH 1BA8B 2Y6TA 1GI7B 1HV7A 1S85A 1OP2A 3TJOA 1GHVH 2FMJA 3A7TA 1WAYB 3PLKA 1GBIA 1ZMJA 1DSTA 3A88A 1THRH 5EPNA 3RXAA 2UWLA 2FI3E 1O3NA 1HUTH 4Y7BA 3S69A 3TLOA 1SG8B 1ELBA 5BPEA 3LGTA 2GZ7A 1BHXB 3BN9A 1C2HA 8GCHG 1TMBH 2F9NA 3AW0A 4GCHF 1FZZA 2A5KA 1H8IH 5T3HA 1MKXK 1OYQA 2F9UA 4IC6A 4K1EA 4BTTB 1W7GH 3BTGE 3GICB 1C5UA 3QK1A 1ID5H 2WPLS 3FP8E 4MDSA 4Y11E 1A0JA 4HI3A 2W26A 1TX6A 1O2TA 3UQVA 4FUGA 2FM2A 4HZHA 3QLPH 2VIQA 1WYKA 3UR9A 4KKDA 3GY6A 3E90B 4KTSA 2BDIA 3QGJA 2J2UA 2BY6X 2VH6A 2W7SA 4XE4A 1CQQA 4BANB 6CHAB 1GJDB 3A81A 4CRCA 1P9SA 1O2XA 3LOXA 3A8CA 4NA7A 1O2JA 2WYGA 1AE5A 5LPEA 4MPXA 4BAQB 1FY8E 2ZPSA 2BVXH 2BY8X 1GG6C 1CE5A 2QYIA 1K9OE 2VGCC 4D8NA 3Q3YA 2V6NA 4NWKA 2BLVA 2P93A 1CGIE 3BTFE 3A85A 5SGAE 3F9EA 4KGAA 1KXDA 4CH8B 1HFDA 1T4UH 1JIRA 2AS9A 5FBIA 5CMXH 1CHOG 1P01A 1SHHB 2P8OB 2Y7XA 3RXFA 1ETRH 5EW1H 2H1UA 1BDAA 1TGSZ 3GCTG 1Y3XA 2ZG0H 2BLOA 2PFEA 3SNEA 3DUXH 4UFGH 1YPLH 4UFDH 3CS0A 5DP9A 4BXSA 3SW2B 2JH6D 4A6LA 4H42U 1D6WA 1TLDA 1FI8A 1K1NA 1PYTD 1G9IE 2VIWA 2UWOA 4I8HA 1C1MA 1YCPK 2YOLA 1VCPA 2JETB 1O3DA 2JH0D 2PWXA 2Z7FE 3PMHB 5L2ZH 4O9VA 1QB6A 4OS4A 4ISOA 4D9RA 1O3EA 2XCNA 1MCTA 1O2OA 2G81E 3P70B 1UHBA 1O39A 1ZSLA 5FBEA 1Y3YA 3BTWE 2ZFPH 2A4QA 1CHGA 1BRCE 1HAOH 2M5TA 3A8BA 1C2KA 1G32B 1EQ9A 1KDQA 8ESTE 1TA6A 1WSSH 3SV8A 3JZ2B 3K9XB 1NFYA 4U32A 5A2MH 4DIHH 1NESE 3SV9A 5TJXA 3RU4T 3SGQE 2Z3EA 3M7TA 5F8ZA 2FS9A 2HNTE 2PKSB 3SN8A 2PUXB 1C9TA 1ACBE 3SNDA 3TU7H 3LPRA 4A1XA 1O2ZA 3N7OA 3ZVBA 1GMCG 4H4FA 2EC9H 5DP6A 3SUGA 2BXUH 3VB4A 1GJ4H 1O33A 3SU6A 2GTBA 2XRCA 2BDAA 1K22H 1N8OC 1LPZB 1DWBH 2RA0A 3QO6A 4NFEA 1ZYOA 2STAE 1ANDA 3A86A 3M61U 1WTHD 2BY5X 4DJZB 1C4U2 2BM2A 3H5CB 1K1IA 3A84A 1F5RA 1GJAB 2H5CA 2P94A 2AGIX 1NRNH 1ZRBA 1C5RA 2FI4E 1B7XB 4GHTA 3PMBB 3DFJA 1S81A 4NIVA 3T62A 3W95A 3UTUH 2GZ9A 3DA9B 2R0KA 3LJOA 2J38A 2A2XH 2A2QH 2ZGXH 1FAXA 2A7CA 2OTVA 1P0SH 3MH6A 3QTVH 2UUYA 1LDTT 3D23A 3IITA 2GCTC 2TPIZ 3P8GA 3MYWA 4XSKU 1HLTH 1HJ9A 1AUJA 5E2PA 1OPHB 1EX3A 4FUBA 5F8TA 1OSSA 1MTNB 3KGPA 1NM6A 1O5BB 2ZGJA 1XX9A 2A5AA 1AIXH 1K21H 5I46H 2PKAB 5EG4A 1P09A 3P95A 3BIVH 3T25A 4Y0YE 5C1UA 4H6TA 2VU8E 3A8DA 2PKAA 3SQHE 1B0FA 1BJVA 1LO6A 1GBEA 3UPEA 4CH2B 5LPRA 4I31A 2VVVA 1GJCB 2VIPA 2FOMB 5LH8A 4JK6A 3F9GA 1NC6A 2ZEBA 3KNXA 1S0QA 2A7JA 3F9FA 5GCHG 8LPRA 2YNBA 1YC0A 1YPMH 1PQAA 1P04A 1BMAA 1DS2E 4YO9A 2ZC9H 2BD3A 2Z9IA 2C3SA 1DDJA 1T31A 4ABHA 5IYTA 3K2UA 1NRSH 1MTWA 3UNQA 4UFEH 3I29A 5EOKA 5FCRA 2OQUA 1XUHA 2G5VA 4X2VA 1GHBF 1Q2WA 4WVPE 1GBCA 1CA8B 5GXPA 4F4OC 2VIVA 4ISHH 3BTHE 3PLPA 3A7YA 1YCPM 1RTLA 1HAGE 2Q6FA 5FXLA 1GHYH 2GCHG 2CN0H 4DW2U 4WH6A 3B23B 1QFKH 1Y3VA 2V0BA 3SO3A 2FZZA 4OS7A 3O8RA 2FDAA 1GI9B 4F49A 1AVWA 1RFNA 2ZP0H 3LC3A 3ATLA 3SJ8A 4DT7B 1QCPA 2OP9A 1YGCH 1YLDA 2OD3B 4A7IB 1EB1H 1QBNA 4VGCB 2K1QA 1NPMA 1WQVH 4X8SH 1J16A 2ZU2A 3M35A 4MG3A 1GVLA 4NGAH 3URDA 1UTMA 4IGDA 3RXEA 4JZIA 1QQ4A 2BD5A 1IQHA 5DGJA 1A3BH 5FPYA 3T29A 4BOHA 3I78A 2G5NA 1FN6A 1GHWH 1OWDA 1E35B 3BTKE 3STJA 5EPYA 4QT8C 5IDKA 2ZIQH 2D26C 1SC8U 1VGCB 2BD9A 4MTBA 4JYVH 5EXLA 4ABJA 1MBQA 4Z0KA 4A92A 1O31A 4R8TB 3BEFB 4U01A 4X6PA 3ZZDA 1SL3A 1V2WT 2WYJA 3SNAA 1SGTA 2ZA5A 1O2SA 2Z9JA 3RC6A 1TPSA 1TGBA 5C20A 2B0FA 1MQ5A 4GAWA 2THFB 2G55A 1C1SA 1P2OA 1Z8JB 2BOKA 2LPRA 4WH8A 2QF3A 3E1XB 7ESTE 2PLXA 3BSQA 1Y5UT 1TOMH 1O2RA 1H9HE 5FAHA 3NK8A 2ZHWH 3ZZ9A 2QXGA 3E0NB 1RTKA 4ISIH 3PV4A 2JKHA 5DJ7A 5TCCA 1LPKB 2ZGBH 4UD9H 5LGOA 3RXKA 5J4SA 3SJIA 1HAIH 1M9UA 1OXGA 1HAYB 4AYYB 3ZZ5A 2ZKSA 2FIRH 4CR5A 1GJ9B 5DP3A 4IMZA 4ZKSU 4X2YA 2O8UA 1N6YA 4MNVA 1MZAA 1UTPA 1YM0A 4KP0A 1UMAH 4FVBA 1D6RA 3SV6A 3ODFA 3ZZ3A 4Q80A 3BTQE 2ZHDA 1FPHH 6CHAC 2Z3CA 1PPFE 3EE0B 4ZHLU 3W94A 1O3JA 1C5SA 2OQ5A 2DUCA 4WMFA 1Y5BT 5FCKA 8GCHF 1KLJH 1Z1IA 1O5EH 4ZAEA 3SZNA 2SNWA 2O8WA 4LK4A 3ZVAA 2A4GA 4TYDA 1F7ZA 1FIWA 3E6PH 3NUMA 1O32A 1DWEH 1K28D 1ELDE 1MU6B 5ABWA 3BV9B 1IHTH 2OCVB 4K8BA 5AFYH 1PJPA 2DE8A 1CU1A 2VWLA 4X8VH 4KELA 1KXBA 3U1JB 1C1TA 2XC4A 1VCWA 1ARCA 5GJ4B 3VXFH 1AZZA 1HAZB 1A5HA 2P8OC 3M5OA 1O36A 2BQ6B 2BLWA 4ABBA 1O3MA 3PROA 2XTTB 2ZU5A 2FOEA 1S82A 3C1KA 1C2LA 1GHAG 2BB4A 3GY8A 5H4IB 1C1RA 1O3OA 1Z6JH 1SGYE 5F6MA 2A0QB 2ALVA 1MAYA 2FWWA 5DP8A 3S9BA 3A7VA 1EJMA 1O3FA 3UUZA 5B6OA 2GDDA 1UTQA 2OBQA 4GLYA 5CHAB 2JETC 1UVOA 1ZPZA 4ABDA 2BDCA 2WPJS 2B7DH 4I33A 1G37A 1QIXB 3FZDA 3UREA 2SGEE 1GJ8B 5E2OA 4BNRA 1TQ0B 7KMEH 3VGCB 3TVJB 1C1NA 1MD8A 2OINA 1CHOF 1O2IA 1U6QA 3ZVDA 1BTYA 2PHBA 4Y76A 1C1VH 1EZQA 2ZU1A 5HM9A 1AY6H 2AIQA