2ZDLA

Exploring trypsin s3 pocket
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Congeneric but still distinct: how closely related trypsin ligands exhibit different thermodynamic and structural properties
pubmed doi rcsb
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Cationic trypsin
total genus 59
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2007-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2zdlA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2zdlA02
2NU1E 4QT8C 3NK8A 1KXEA 4IBLH 3BTQE 3A8CA 1OWKA 3E91A 4ZHMU 3RXOA 3LU9B 2BY6X 2G5VA 1ZRKA 3LJOA 2BD2A 2PWXA 4GSOA 1F92A 3M7TA 2QXJA 1Y59T 1QA0A 3MU5A 1GBFA 1NRNH 2V6NA 4U30A 3RC6A 5EQQA 3QGNB 1FMGA 3VB5A 1KTSB 1HAZB 3T2NA 2BQWB 3SUEA 3AAUA 3GCHC 1UCYH 4BXSA 1GI9B 3QGJA 1L4ZA 5DP5A 3URDA 1OWHA 1OP0A 4B74A 4XBCA 3Q3YA 4TWYA 2Z6BD 4ABHA 2ANMH 1IQGA 3A8AA 2W3KA 3BTWE 2BY5X 4H6SB 4Y8YA 1Z6JH 1XKAC 1GHYH 1H9IE 2SFAA 1C5UA 3D65E 3ESTA 4KELA 1D3PB 1LQEA 3LGTA 1ANBA 2GCTB 3URCA 1BHXB 1M9UA 1O2UA 1W7GH 2VB0A 1XUHA 1A5IA 1L1NA 3RM2H 1SGQE 4K1TA 3ZVDA 1QBNA 1HAPH 2QF0A 5SGAE 3SJIA 3RXJA 5LPEA 2AMDA 2OUAA 3FP7E 1AKSA 2TGPZ 1L2EA 2HALA 3EA8A 1LKAA 1BMMH 1ZPBA 1C9TA 1S85A 1QRWA 2FMJA 3AVZA 1GBCA 2AERH 1MAYA 1HAYB 4Y79A 1C1MA 3SV6A 2CJIA 2GD4B 1O2TA 1V2JT 4DW2U 2A45B 2C90B 1P2NA 4Y0YE 1G37A 4ZKRU 3M61U 3GDVA 1QB1A 1EPTC 1FDPA 3IG6B 1PYTC 1UTMA 5FHTA 3UREA 3RXLA 1E38B 3DHKH 1TBRH 4ISOA 4NA7A 2IOTA 3RXMA 1IQEA 1VJAU 1AWHB 3FANA 3GCOA 5HXFA 1TNKA 4WMDA 1MKWK 1QJ1B 3ZV8A 1NESE 1EQ9A 1C1SA 1QRZA 3IITA 4X1NU 5JB9S 1KTTB 4U2WA 1O5GH 3PMJA 1BT7A 3LH1A 4MNVA 5DJ7A 3UWJH 1A7SA 2G4UA 3KEEA 3MO9A 1C2DA 2Q6FA 3S9AA 3A8BA 1GJ4H 4XBBA 4BNRA 4GLYA 1VITG 2JH5D 3GDSA 2ZZUH 1OWIA 2A4QA 1IQHA 4CH2B 1ZSKA 4MDSA 1O32A 3BTTE 5A8XA 2GX4A 1YYY1 1LPZB 3ZZ6A 2F9UA 2Y7XA 1AFQC 5J4QA 3ZZ4A 1NN6A 3ZZ5A 3V7TA 3M5OA 1ESBA 4AB8A 3E1XB 3BF6H 1MTNB 1AI8H 1DXPA 2P93A 3U9AH 2SGAA 1OX1A 1ETRH 3SQHE 1F0UA 4NZQA 4RN6A 4D7GA 4RSPA 3FFGA 1CT2E 1GJAB 1QA7A 1DE7H 2PR3A 4GAWA 1ARBA 4KTUA 3QTVH 1XUJA 3HATH 2QA9E 1BTXA 4GUXA 2QIQA 5C1XA 1G2MA 1G3DA 2Z3DA 1GMCG 4NG9H 1UHBA 1VITH 2BDHA 3P92A 1LO6A 5B6OA 4ABGA 3O8DA 2G81E 4ISHH 2ZNKH 1FY3A 3ATLA 1JRTA 4AG2A 4A92A 2C8YB 1NY22 4YLUA 1UTOA 1CVWH 2C8XB 2BX3A 1C1UH 2VH6A 1HRTH 1MQ5A 1GHAF 3P8GA 1SGFG 1ZLRA 3E3TA 1YCPM 4FUGA 3PLKA 1GHZA 4IGDA 1K1NA 2FI3E 1MTWA 5C67A 2PKAB 1G9IE 4X1PU 2GT7A 4THNH 4X6NA 4CRGA 4ASHA 2TGTA 2CV3A 1ESTA 1WQSA 1FJSA 1O30A 2FX4A 3MH6A 3EA9A 2A4OA 2YOLA 1GJ8B 3ZYDA 4E7RG 2R0LA 4NFFA 4A1TA 4AN7A 1C1RA 2BZAA 1G30B 4ZKSU 5T3HA 2PV9B 1GI7B 2O8TA 1O2NA 5JBBS 1EZUC 2ZGHA 4D76A 6GCHG 2JKHA 3A7TA 2PGBB 1MUEB 2O8WA 3MHWU 2Z9IA 1VCQA 1LVYA 4MG3A 1HFDA 3FP6E 1RIWB 1DVAH 1TBZH 3LGVA 2C3SA 1AVGH 4JYVH 1HAGE 7LPRA 1A5GH 3ZZ9A 4BAHB 1BB0B 1TRNA 1AQ7A 1NFYA 3RXPA 3UPEA 1DLKB 4DGJA 4ISLA 1K2I1 1THSH 4MPWA 1QB6A 4OGXA 2XBYA 2P3UB 1JIRA 5BPEA 5T6FA 3BEFB 3ATKA 2ODQA 3QZQA 3Q3KA 3SGAE 1QJ7B 2A2XH 2FXRA 2WV5A 4DVAU 4NIYA 1C2HA 2FO9A 3KQBA 5T6GA 1BITA 1F0RA 4KKDA 4D8NA 1AY6H 3KCGH 2QCYA 1Z1JA 3T28A 1YPKH 3A84A 2CF9H 1F2SE 2ANKH 2H9TH 1AB9C 2OCVB 3TJVA 4BANB 2GTBA 1PPFE 1FLEE 5E0JA 2FZZA 4AZ2B 3N7OA 1ELDE 3RMOH 1T4VH 3MNXA 1DWBH 7GCHG 1VGCB 3T5FH 2CMYA 1RTLA 1LDTT 1P2QA 2SGQE 1E35B 7ESTE 3TK5A 2UWPA 4B75A 1O3KA 4X6OA 3UOUA 2VJ1A 2ESTE 3SQEE 1TPPA 1BJVA 2HLCA 1KYNA 3RDZA 2C8WB 2D2DA 3QWCH 3JZ1B 5DKMA 3BSQA 3QLPH 1EAUA 5HM2A 4ZKOU 3S7KB 5DGJA 5TJXA 1EOJA 4FUFA 5FX6A 1LHEH 3QO6A 4NZLA 1EJNA 3U1JB 5GDSH 1K1JA 4JZFH 3MO6A 3K2UA 5EU8A 2FP7B 4K2YA 5GWZA 4JCNA 1MH0A 3LH3A 4RKJB 2LPRA 2UUFB 3P8NA 4DT7B 3MWIU 2CHAB 4OS7A 1GI4A 2OC1A 2FOBA 1O3MA 5GXPA 1CHGA 2TIOA 3LIWA 1A2CH 2NU3E 1GHBF 1UTKA 4A5TS 1CT4E 1GCTB 3RXTA 3QK1A 3DUXH 3P95A 2FIRH 1DICA 1ZSJA 4K1EA 2ZHFH 5DP7A 1P04A 4KGAA 1TX6A 3S9CA 4CH8B 4F49A 1GGDB 2ZGBH 5EOKA 2PKSB 2Z7FE 2O8MA 3VGCB 1WCZA 1FPHH 1MZAA 1TYNA 4ZH8A 2Y5FA 5LPFA 1O3CA 4LXBH 4I8KA 2GMTB 3GY3A 1ANDA 4Z6AH 1C1PA 1MTVA 2HWLB 4AFZA 2VWMA 4LK4A 4BXWA 3ODDA 3K65B 5CHAB 1HGTH 1K1IA 2BZ6H 3CS0A 5DG6A 2A5AA 1VZQH 1HAHH 1HXEH 1KXBA 3BG4B 3TLOA 1SGIB 3OTJE 5AFYH 5CE1A 2A1DB 1QFKH 1TA2A 2GGVB 1GDUA 3AAVA 1CQQA 1MU8B 1C5TA 1SHHB 3DFJA 1O2SA 3EDXB 2F9OA 2BB4A 4YT6H 4CHAC 1WV7H 3QDZB 3QUMP 3E16B 4X1SU 1QNJA 4RKOB 1H4WA 1ZOMA 3PWBA 4ZHAA 1IQMA 2XCFA 1DDJA 4LZ4B 3Q3XA 2ZDVH 3QX5H 1SLVB 1TRYA 4Y7AA 1DOJA 3V12A 2BLVA 2BXUH 3F1SB 3SNBA 3A88A 1KDQB 3MYWA 1NRSH 1RTKA 4WY3A 1T32A 1A4WH 2FS8A 1B0FA 4DIIH 3RXDA 3PLPA 1W8BH 1TX8A 3TITA 2LNCA 3VB4A 1UO6A 1OWEA 4AX9H 3BTFE 2ZQ2A 2ZECA 1UTLM 2FOEA 2VINA 5PTPA 3P17H 1DXWA 4UONA 3V13A 1J15A 2XBWA 3MU4A 3U69H 3S7HB 1Z6EA 2SGDE 1BMNH 1A3EH 1SR5C 4AOQA 1O2QA 3UY9A 1Y3WA 2QGRA 2WPLS 1GJCB 1TQ0B 1GCDA 3MNSA 5JDUB 2ZHDA 2A4GA 1QBOA 3V0XA 1D6WA 1TABE 1DITH 1F0TA 1FQ3A 1V2PT 2WPHS 1O2LA 4FUDA 3RXUA 4MPXA 4ZUHA 1NTPA 2J9NA 3Q00A 1Z1IA 1O3NA 2H5DA 3UR9A 4IN1A 1AO5A 5JBAS 1QY6A 4Q7XA 3TH3H 1UTQA 5EPYA 1EZSC 1C1TA 4B2AA 1TIOA 4IC6A 2A5KA 2R3UA 4OS1A 1LPKB 1H9LB 1ZTLA 1FONA 1MU6B 1X7AC 1DX5M 3NXPA 4B2BA 1C5RA 1NO9H 1P0SH 5AFZH 1ZJDA 3VB6A 1FZZA 1C5MD 1BTUA 1IQFA 3GY8A 3VB7A 3PO1C 5C3NA 1Y5UT 1DANH 2TBSA 3HK6B 1GI1A 3UNSA 2ZDMA 4AFUA 1FY4A 4MLFB 1WBGB 1Z71A 5I25A 1BOQA 1GHAG 1ID5H 1EAXA 1OPHB 4Y7BA 1O5FH 2GCTC 2BLQA 3GY4A 1V2QT 3K6ZA 1SMFE 1KXAA 1P8VC 2ANWA 3MH7A 2R0KA 1PPEE 4TPIZ 3C27B 5FBEA 2P95A 4UFGH 3T26A 2WYJA 2XWAA 1O3FA 4OS5A 1FPCH 1C1WH 1TBQH 2VWOA 1V2RT 2PTNA 1AD8H 1L4DA 2P3TB 3LDXH 4X2XA 2GT8A 4ABBA 4JYTA 4D7FA 1CGJE 4BAQB 1TPSA 4Q2KA 4UFFH 1GJ6A 1LHDH 5IDKA 3QN7A 1K1LA 4BTIB 1QRXA 1ZGIA 2H6MA 4Y11E 1YPHE 3SV9A 1W10U 1UVOA 1L0ZA 3S69A 2W5EA 4TPYA 1LHFH 3SI4H 3KGPA 2ULLA 2VIOA 2ANYA 1O3AA 3AW1A 5AVDA 5H4IB 5K7RA 3UQVA 1S6HA 3ODFA 1P9SA 1XXFA 3SUFA 1EPTB 1C2LA 2QN5T 4ABFA 3AASA 1KXFA 1O5EH 4K60A 1C9PA 2VGCC 3M7UA 2EA3A 1AWFH 5L2ZH 5K0HA 3SGBE 2RA0A 1NROH 3SJKA 1BCUH 3TNTA 2YNBA 2AIQA 4KP0A 1C5YB 2QXGA 2A5IA 1S0QA 1SBWA 1E36B 1D3DB 4X8TH 1VCWA 5C1UA 3UTUH 2BD4A 1MKXK 3UOPA 1ZSLA 2KAIB 2QXIA 1AVXA 1TMBH 4DOQA 1XKBC 4ABJA 2UUJB 1BIOA 1ELBA 1G2LA 2BY7X 1FAKH 4O3UA 5A8ZA 2ZU4A 4FVBA 2BVRH 3A82A 1LCYA 1V2ST 1TB6H 2WPIS 2UUYA 1MMJN 1EAWA 1UMAH 4ESTE 4JZEH 2AIPA 1AFQB 4NSYA 3TIUA 3SUDA 2PSXA 4WXVA 1O2KA 1IQNA 2TGDA 1GHXH 5FXLA 1RJXB 1SQAA 1KDQA 1O5BB 4ZXYH 1O5DH 1BMLA 3M3SA 3LPRA 3M36A 5J4SA 2BDBA 1GJ5H 5F03A 3A8DA 3RXEA 1HLTH 2FX6A 3ZYEA 1BRCE 3H7OA 4CR9A 1NT1A 1XVOA 1GBKA 5JYIA 1UTNA 2WPMS 2I6QA 2G5NA 1A0HB 3E0PB 1O37A 1S5SA 3PV4A 3T25A 4HGCA 2JH0D 1GBMA 2ILNA 2P3FH 2VVCA 4O3TA 4OGYA 1LPGB 3E90B 1C5LH 1W14U 2XC0A 2FI5E 1BTWA 2BMGB 4Y76A 1LKBA 1SGFA 3F6UH 1PFXC 3SV8A 3LGIA 1TQ7B 3RU4E 4X8VH 2QV1A 2B8OH 1SPJA 1D9IA 1C4U2 2A2QH 1V6DA 4MPUA 2GDEH 2DE8A 4IN2A 3EAJA 1VITF 3BTGE 4K5ZA 1ARCA 1FN8A 3SBKA 4LZ1H 2FTMA 4YESB 3I29A 1V2MT 4X0WU 4FUIA 1H1BA 4X6PA 2FODA 1ELEE 3QTOH 1INCA 1GBHA 4HZHA 5I46H 4FU7A 1C2IA 2GZ9A 2G52A 1P06A 2ZCLP 2OXSA 2C4FH 3A89A 4XE4A 2Y6TA 1HCGA 3D23A 3LONA 5G4BA 3FZDA 2BQ7B 1T31A 2ASUB 1RIWC 1TRMA 4O9VA 2J94A 3G01A 4CR5A 3LJJA 2ZGCA 3ZVCA 3NCLA 3MI4A 1EOLA 3NWUA 2GDDA 1OXGA 4ZROA 1N6YA 1EP5A 1J9CH 3GY2A 1ZMLA 1NC6A 4I7YH 4XOJA 1EXFA 3VXEH 2BD5A 2OD3B 1CGIE 4DY7B 4HFPB 5EG4A 1BTZA 4R8TB 4MNYA 2BDGA 5FPTA 1SI5H 1HB0B 2VH0A 3ZVBA 3GY7A 3PROA 1FN6A 1J14A 2VIPA 1YPHC 4X2YA 1Y3VA 4BAOB 1MBQA 4A1VA 2A7HA 3O8RA 1GI6A 1AE5A 3VFEA 4XFQA 3P8FA 1GBIA 1O2GH 3SZNA 2GP9B 3ITIA 1TNHA 1Q31A 2BD9A 1GI2A 1P03A 1C4V2 2BXTH 4UFEH 1ETSH 5T6DA 1FY5A 4OS4A 2PGQB 1TNGA 3SU0A 2FDAA 1SGDE 1UVSH 3ZZ8A 4JMYA 1E37B 4WH6A 3KQCA 2WPJS 3CP7A 1CA0B 5GCHG 1W3CA 2OINA 4VGCC 4MNWA 2GCHF 5A0BA 3FZZA 5HYOA 2FS9A 2BDYA 2Y81A 4IC5A 1AKSB 5GCHF 2F83A 3SOSA 1Z8RA 1HNEE 2G00A 3ATMA 1KLJH 1ZHMA 2BYAX 2XRCA 2FPZA 1LVMA 2GZ7A 1OWDA 4H42U 1UVTH 1GHWH 1C5QA 5F6MA 1NRQH 1P9UA 3ZZ3A 1L1JA 3RMLH 1T8LA 3SU3A 1O5CB 4M7GA 4A1XA 3ZZBA 2UWLA 1HAOH 1MKXH 2QYIA 2OBQA 3VXFH 5EQRA 4TY7A 1MCTA 1ELGA 3A7WA 4IS5A 3WY8A 2G51A 2HVXA 1KLIH 1GBJA 1TNIA 2EC9H 1A0LA 1H8IH 1Y5BT 2ZPRA 3ZVEA 1C5SA 1G36A 4SGBE 4TY6A 3U98H 1HDTH 1QCPA 1P2OA 1SL3A 1EZXC 1DPOA 2BDIA 1NU7B 1QBVH 2FLBH 2XC4A 3L6PA 1HJ9A 1XUKA 1Q2WA 3Q77A 4X1QU 2FTLE 4Y10E 1GCTC 5EPNA 5A0AE 5JBCS 1O3EA 2RCEA 1P2IA 2ZFPH 1IQIA 1MD8A 3SHAH 3OSYA 5FCKA 2ZTZA 1NFXA 2ZI2H 1W7XH 2AGEX 1THRH 1AUTC 3GCTF 1GGDC 5EODA 1TGBA 2FOCA 4I8HA 7KMEH 1UHBB 4YT7H 2PKSC 1MTSA 1C2JA 3VGCC 1TNJA 5HMAA 1UTJA 1B7XB 2BD3A 1YP9A 4MTBA 2GMTC 3SJOA 1UK4A 1Z8GA 1Y3YA 4Y6DA 1OP2A 4K8BA 1DY8A 2ZKSA 3STJA 1D4PB 1CE5A 2ZA5A 3UIRA 1BTYA 4NCYA 1SGRE 1GI8B 2J38A 3T29A 3BG4C 2YNAA 2FEQH 4ABDA 3O8BA 4FU9A 2CGAA 1GHBG 4INHA 3TK9A 4H4FA 1NZQH 1F0SA 3ZZDA 2ZC9H 3RXQA 4XSKU 2CXVA 2NU2E 1KY9A 1ZMNA 3L33A 6GCHF 1WU1A 1C5PA 4WWYA 4CHAB 1NU9A 2OC7A 1CA8B 1NRRH 1QGFA 4UFDH 2G8TA 4O03A 3U8OH 1UCYK 2PUQH 3LGYA 1S81A 2OQ5A 1H9HE 1YPGH 1GWAA 1N6XA 1AFEH 2O9QA 5EXMA 3UFAA 1HJAB 1S0RA 1ZTKA 5DPAA 1TE0A 2BVSH 2WUBA 1F7ZA 3SO3A 4X1RU 1EX3A 1UK3A 1YM0A 4CRBA 3B8JA 1JMOH 3RXBA 3SNDA 5A09A 4E06H 4CRFA 3RXCA 1ZYOA 5GJ4B 1NS3A 4I31A 4U01A 1O3HA 3PLBA 5IYTA 2ZHQH 1P09A 2H2ZA 2ZFFH 3TH4H 3SU5A 1D6RA 1RTFB 1HAXB 3STIA 5FPYA 1C2EA 1C2FA 3PTNA 2NU4E 2OC8A 2R3YA 5EGMA 2BLOA 3HGPA 1DWDH 1GMHG 2FYQA 4K3JA 4JZIA 5DP4A 2QY0B 1B5GH 3RC5A 2OC0A 3GOVB 1BA8B 3OU0A 3VEQB 2XXLA 5LGOA 1CBWC 4TWWA 1UTPA 3UQOA 4ZAEA 5GPIB 1KSNA 2BD7A 2FOAA 2B9LA 1GMCF 4FUJA 2SNWA 3M35A 2OLGA 4NFEA 1OP8A 1YLDA 8GCHF 2ZFQH 3D49H 1ZJKA 1DSUA 2WUCA 3KHVA 4X6MA 1OSSA 4FUCA 5JBTA 5F8TA 1DFPA 3ZZ7A 1O2XA 6CHAC 3P8OA 1Q3XA 1QQUA 1F5LA 2FI4E 1IHSH 3TGKE 4KTCA 2HGTH 1WOFA 1KIGH 2J95A 3VPKA 4FUBA 4YOGA 1YKTA 1HAVB 2FOFA 2ZFRH 2VWNA 1K28D 1YPJH 3PO1B 3PM3A 4X2VA 1EP6A 1WTGH 2GCHG 3RXVA 1F5KU 1JXPA 2B5TB 5TCAA 3CENA 3SU4A 2OP9A 1ZPCA 1A61H 1RXPA 1UJ1A 2ZP0H 1V2LT 3A7VA 3RLYH 3TH2H 1FUJA 4ZKNU 1NM6A 2P8OB 6LPRA 1EASA 3TVJB 4NA8A 1ZZZA 1MZDA 2GV6A 4UEHH 2F9NA 5F8XA 1H8DH 2J4IA 1DLEA 1DY9A 1BRBE 1SLWB 3BTME 1SFIA 2W7UA 3L3TA 4X2WA 4CRAA 4DIHH 1GJ9B 2P94A 4X8UH 4I8GA 2Y80A 3ELAH 1OWJA 1PPBH 3FP8E 4WF8A 3MOCA 2BDCA 3DD2H 2B7DH 4IW4E 1Z7KA 2H9EH 3RU4D 5EXLA 1T8NA 4R0IA 5ABWA 1Y8TA 1SB1H 1CHOG 1A3BH 3SU2A 3R3GB 1U6QA 2TRMA 3OY6U 1DM4B 5C20A 2VGCB 2ZG0H 1S84A 1SGCA 1EJAA 4H6TA 1D3TB 4OS6A 2XBVA 1B0EA 1C1OA 4CBNA 3KIDU 1CT0E 2W26A 1DSTA 3TPIZ 1ZPZA 1NPMA 2THFB 4FUEA 1TFXA 2DUCA 3LT3A 1V2TT 2HOBA 2ZDAH 2J2UA 1DS2E 2SGFE 1SGTA 1TLDA 4AGKA 3NPSA 1GBAA 1RFNA 3SJ8A 3W95A 1O3PB 5JPMH 3RXFA 2EI6A 4B2CA 4ABIA 1AU8A 1W0YH 3R0FA 3FVFB 2AMQA 2F9BH 1AZ8A 5DK1A 3HGNA 4UE7H 3BTEE 1O3JA 4K8YA 1O36A 2RDLA 4AYYB 1LHGH 2XBXA 2WYGA 2HRVA 2AMPA 2PLXA 1KXDA 2BD8A 2BY8X 1DUAA 4ABAA 1GMDF 3SUGA 2XNIA 2IJOB 4ZMAH 3ATWA 4WVPE 1BQYA 3SI3H 4NIXA 2G4TA 2QC2A 4Y8XA 4FUHA 4I32A 4CRCA 1N8OC 1OOKB 1O3IA 2ZU2A 1P2JA 3I77A 4NIWA 1YPEH 3IWMA 1XUIA 1SGEE 4WJG2 3MU8A 2XYAA 2XWBI 5ESBA 3MNBA 4JYUH 1VR1H 3M5MA 2PTCE 1P10A 4NA9H 2D8WA 4XDEA 3BTHE 4NGAH 4UDWH 1OS8A 5C1YA 1O5AB 2JETB 4YZUA 6ESTA 1BTPA 1CO7E 3SN8A 1SLUB 1IOEA 1O2VA 5FCRA 4B1TA 2TGAA 1LTOA 4NIVA 3H7TA 3B9FH 3GY5A 9LPRA 5L6NH 1O2ZA 1GHVH 3MU0A 1MQ6A 4ISIH 3VB3A 1W2KH 1HAIH 1BUIA 1LQDB 5DP9A 3F68H 1THPB 1ELTA 1AN1E 1MKWH 3S0NA 2GVFA 2SNVA 3BTKE 5FAHA 2ZGJA 3ENSB 1P05A 2GV7A 1N1LA 2BLWA 5FX5A 3ZVAA 1EUFA 3A86A 5EW1H 3BN9A 5DP6A 1P02A 1RRKA 3A80A 3ZZAA 4MPVA 1AIXH 1S6FA 1C2GA 2ZCKP 2ZCHP 1O0DH 1QTFA 2HNTF 2XCNA 5A0CA 3H5CB 5DO4H 5C5OA 2P16A 4GHTA 5A2MH 1BJUA 4J2YB 3PMHB 3JZ2B 3MO3A 1Z8IB 2Y5HA 1C4Y2 1GL1A 1TGCA 1GG6C 3A83A 3DFLA 2Q6GA 4A7IB 1O2WA 3SORA 2VNTA 1XVMA 1GVKB 2DE9A 3BEUA 1ABIH 2UUKB 1C5XB 2PUXB 3GYLB 3RUOA 2P59A 3PYHA 4JZ1A 1A46H 1JOUB 2R9PA 4BAKB 1DT2A 2ZF0H 4YO9A 1TMUH 3ZZCA 8LPRA 1ZHRA 2BY9X 3F9HA 3U1IB 1GBBA 2ZHWH 3MNCA 3SV7A 1JRSA 2K1QA 3RC4A 1YCPH 2Z9GA 3SU1A 1CA0C 2VIQA 4J1YA 2VVUA 2ZU1A 1O3LA 2ZHEH 3PTBA 1FAXA 5ETXA 4VGCB 1QHRB 1TAWA 1AGJA 1ZMJA 2IPHA 4HTCH 1HIAA 1OYTH 1O2PA 1K1PA 1HPGA 2OTVA 3MH4A 1O2YA 3SHCH 1Y3UA 2A31A 2BDAA 5DP3A 3RU4T 3EGKH 3QZRA 1TOMH 1UVPA 4LOYH 1TX7A 1RS0A 2SGEE 3KQDA 1G3EA 4AFSA 3A7XA 4AG1A 4E7NA 5AF9H 1GI3A 1DWCH 1T4UH 1S83A 1PPZA 1C5ZB 2ZO3H 3P70B 1GMHF 2W3IA 5FPSA 1QB9A 1GDNA 2Z9LA 3M5NA 4BAMB 5C2ZA 1C2MA 1V2OT 2TPIZ 1P11E 3Q76A 4MVNA 5CMXH 2ZTYA 4I8JA 4YM9A 2A4RA 5F8ZA 1XM1A 3GCHB 1TONA 2F9PA 4WXIA 1K1MA 2Z94A 2A7CA 1P12E 2V3HH 2Y82A 2IN2A 1TA6A 4YTAA 1SG8B 3ZVGA 1LMWB 2AGGX 3TJOA 1GDQA 1K21H 1PQ7A 3RXKA 1AUJA 1C5OH 3MH5A 3UR6A 1W12U 4CREA 4GPGA 3SU6A 1HYLA 8KME2 2O8UA 2PW8H 2ALVA 1EKBB 2ZFTA 1L1GA 3OX7U 5BRRE 2FOMB 1BDAA 4Q7YA 3TK6A 1IQLA 4FVDA 3SJ9A 1HIAB 3PMAB 1GJBB 3MFJA 4IMZA 1K22H 1O3DA 1EATA 1T7CA 1HUTH 1PQAA 3E8LA 1GJ7B 3UUZA 2ZIQH 1TGSZ 5E0HA 1YPLH 1EZQA 1QIXB 4AB9A 4XBDA 3SW2B 1F5RA 2XTTB 3GCNA 1PQ8A 4Y71A 3BEIB 1ELCA 3M37A 1WTHD 2QXHA 1TPAE 2FWWA 5E0GA 2RG3A 2BOKA 2D1JA 1HJ8A 1O2OA 3ZVFA 2HPQH 3KN2A 5AHGH 5ESTE 1Y3XA 3RXIA 1C1QA 1GPZA 1EB1H 5C5NA 2AYWA 1HJAC 1GBLA 1AVWA 2EI8A 4E05H 3E0NB 4AORA 1DWEH 5TCCA 3KQEA 1FY1A 1UK2A 1Y5AT 2B0FA 2VIDA 5GIBA 1CU1A 4BTTB 1SOZA 2BVXH 2Q6DA 3KL6A 3OYPA 2C93B 4OS2A 5EXNA 1P2MA 1P3EA 1ZHPA 4F4OC 1QQ4A 4NSVA 5E2PA 1OKXA 2HNTE 3FAOA 2J34A 3SV2H 5L2YH 3W94A 3BV9B 4ZHLU 2BX4A 1PJPA 1J17T 1K1OA 1V2VT 3A87A 2FM2A 2W7SA 3A7YA 3RXSA 1W0ZU 2JH6D 1A1RA 3PWCA 1C5WB 1RGQA 5EW2H 2G55A 1O35A 4DJZB 1WSSH 2ZPQA 1SLXB 1BMAA 1MTNC 1S82A 2O8LA 1E0FD 1J16A 2FYRA 1BHXF 1CBWB 4B73A 2AFQB 4B76A 3EYDA 2ODYB 2R2WU 2ODPA 1O3GA 1QR3E 2ZQ1A 4ISNA 3T27A 3SNCA 4AFQA 1YCPK 1GI5A 2VIWA 4IMQA 1MTUA 1FIWA 2GKVE 2R2MB 1C1NA 4X8SH 2F91A 1YPMH 1SQOA 2AEIH 3LGUA 1YGCH 3RXGA 2ZGXH 1QJ6B 1GJDB 1GMDG 2OQUA 5E2OA 2ZPSA 2BTCE 6CHAB 4CBOA 1O2RA 5JB8S 3LC3A 1P01A 2ZWLH 3M5LA 1SQTA 1PPCE 4INLA 1O39A 1O2HA 4Y8ZA 4Y0ZE 1XXDA 1BBRH 1TWXB 4I8LA 1YF4A 1GBDA 1ZR0A 4NWKA 3NUMA 4O97A 2ZU5A 5L30H 4YOIA 2FOHA 3TGIE 3M3VA 1CGHA 3LGWA 2ALPA 1WAYB 3B23B 1ESAA 1HBTH 3S9BA 2V0BA 1FV9A 1MBMA 3F9EA 1SC8U 2PHBA 1O2MA 1QL7A 1J8AA 1SSXA 3RXRA 1SVPA 3A81A 3GCTG 2P8OC 4NWLA 1E34B 3A7ZA 3LC5A 1LVBA 5HGGA 2Y7ZA 3LKWA 1CHOF 3A85A 3OY5U 2PFEA 3K9XB 4FU8A 3PMBB 4MNXA 1O31A 1BRAA 1WUNH 1WQVH 1SGYE 2H1UA 1P3CA 1D3QB 7GCHF 2BOHB 1BBRE 3BIVH 2ZEBA 4B71A 3AW0A 3NZIA 1QL8A 2STAE 1XMNB 2VVVA 1KXCA 1QURH 1W11U 2PKAA 3ATIA 1TMTH 1TNLA 2V3OH 4FXGH 2NWNA 3SNEA 1G32B 1T8MA 8ESTE 2ZDLA 2A7JA 2AS9A 1T8OA 1ELVA 2VIVA 2FOGA 2WPKS 2Z3EA 4ZXXH 1ANEA 3C1KA 1AZZA 1ZTJA 5DP8A 3D62A 2EI7A 4SGAE 3SNAA 1AB9B 3UNQA 1MCVA 1O3BA 3GY6A 1TPOA 3TNSA 1VGCC 3NKKA 1TOCB 2H9HA 1MAXA 4I33A 1SHYA 2CN0H 1JIMA 4WMEA 5LH8A 3BIUH 3T62A 2VU8E 2AH4X 1ANCA 1V2KT 3GYMA 3SGQE 4BTUB 1FIZA 1AHTH 3M7QA 3HKJB 3P6ZB 3RMMH 4A6LA 8GCHG 3K6YA 1EJMA 3PB1E 1LVOA 4K1SA 2PSYA 5HM9A 2KAIA 2UWOA 1IQKA 1JWTA 1FI8A 1XUFA 3MU1A 1N8OB 3I78A 1FNIA 3RM0H 2QAAA 3EE0B 4YLQH 2Z9JA 9ESTA 1SGNE 3F9FA 2CHAC 4INKA 2Z3CA 1IHTH 2Q1JA 1O33A 1ELFA 3RXAA 2Z9KA 1NRPH 3GDUA 4ABEA 3LOXA 4UD9H 3BG8A 2M5TA 3EQ0H 2NU0E 2A32A 1IAUA 2I6SA 3KNXA 1DUEA 2JETC 1EPTA 1O34A 4KTSA 4AYVB 2Y5GA 1ORFA 1BZXE 1PQ5A 3MTYA 4PROA 3RP2A 1EB2A 1SGPE 4TYDA 1SOTA 1UVUH 1BTHH 2CF8H 1O3OA 4GCHF 3MMGA 1G3BA 2ZDKA 1PYTD 1NFWA 1W13U 3ZV9A 2RA3A 3V3MA 1K9OE 4U32A 1EAIA 1O2JA 2AGIX 3UNRA 3GICB 1TGNA 1GBTA 3RLWH 5A8YA 1FY8E 1TALA 4MQAA 2BHGA 5CHAC 3DA9B 2GZ8A 5LPRA 1VCPA 2ZU3A 1C5VA 1SFQB 1V2UT 4YOJA 1O2IA 3DT0H 3E6PH 2SGPE 3F9GA 3TU7H 1C1VH 2HNTC 3TJNA 1FXYA 1P57B 1A0JA 3U8RH 1AE8H 3RXHA 1OYQA 5E8EH 1GVZA 2ZTXA 3KF2A 1XX9A 1WYKA 4GHQA 1ELAA 1ZGVA 2J92A 1HXFH 1HV7A 3O8CA 1NFUA 3UWIA 1ZRBA 1BRUP 1RD3B 1VJ9U 3BTDE 4JZDH 4K69A 4D9RA 2BM2A 4AGJA 1GI0A 2BQ6B 1BBRK 3TGJE 1YLCA 1ACBE 1P2KA 4DG4A 4Q80A 3EA7A 2WINI 1GG6B 4CRDA 2F9VA 4D9QA 1JBUH 1V3XA 2C8ZB 1Z8JB 2D26C 2A0QB 4JK5A 1A5HA 3TJUA 1PPGE 1PPHE 1ABJH 1AMHA 1IQJA 4DURA 1GBEA 2WV4A 1V2NT 1G3CA 1GL0E 2XC5A 1LHCH 2V35A 1HAVA 2XW9A 2OBOA 4Z0KA 2FESH 4Q7ZA 1MD7A 2HPPH 1XUGA 1C5NH 1KLTA 2F3CE 2EEKA 4HI3A 1UCYE 2H5CA 4WH8A 1YBWA 3GISB 1C2KA 3M3TA 4BOHA 3HPTB 2ZDNA 4WMFA 5EQSA 2QF3A 2STBE 3HK3B 2VWLA 1QL9A 2FLRH 1CSOE 4JK6A 2ZFSA 1TGTA 1O38A 1ETTH 3U8TH 5FBIA 1GVLA 3CS7A 3HKIB 4GCHG 4GVUA 4DCDA 1YC0A 1V2WT 3RMNH
chains in the Genus database with same CATH superfamily
2NU1E 4QT8C 3NK8A 1KXEA 4IBLH 3BTQE 3A8CA 1OWKA 3E91A 4ZHMU 3RXOA 3LU9B 2BY6X 2G5VA 1ZRKA 5EIYA 3LJOA 2BD2A 2PWXA 2K8IA 4GSOA 5CDFE 1F92A 3M7TA 2QXJA 1Y59T 1QA0A 3MU5A 1GBFA 1NRNH 2V6NA 4U30A 3RC6A 5EQQA 3QGNB 1FMGA 3VB5A 1KTSB 1HAZB 3T2NA 2BQWB 3SUEA 3AAUA 3GCHC 1UCYH 4BXSA 1GI9B 3QGJA 1L4ZA 5DP5A 3URDA 1OWHA 1OP0A 4B74A 4XBCA 3Q3YA 4TWYA 2Z6BD 4ABHA 2ANMH 1IQGA 3A8AA 2W3KA 3BTWE 2BY5X 4H6SB 4Y8YA 1Z6JH 1XKAC 1GHYH 1H9IE 2SFAA 1C5UA 3D65E 3ESTA 4KELA 1D3PB 1LQEA 3LGTA 1ANBA 2GCTB 3URCA 1BHXB 1M9UA 1O2UA 1W7GH 2VB0A 1XUHA 1A5IA 1L1NA 4AC9A 3RM2H 1SGQE 4K1TA 1SQRA 3ZVDA 1QBNA 1HAPH 2QF0A 5SGAE 3SJIA 3RXJA 5LPEA 2AMDA 2OUAA 2VBCA 3FP7E 1AKSA 2TGPZ 1L2EA 2HALA 3EA8A 3FN8A 1LKAA 1BMMH 1ZPBA 1C9TA 1S85A 1QRWA 2FMJA 3AVZA 1GBCA 2AERH 1MAYA 1HAYB 4Y79A 1C1MA 3SV6A 2CJIA 2GD4B 1O2TA 4OM9A 1V2JT 4DW2U 2A45B 2C90B 1P2NA 4Y0YE 1G37A 4ZKRU 3M61U 3GDVA 1QB1A 1EPTC 1FDPA 3IG6B 1PYTC 1UTMA 5FHTA 3UREA 3RXLA 1E38B 3DHKH 1TBRH 4ISOA 4NA7A 2IOTA 3RXMA 1IQEA 3F2GA 1VJAU 1AWHB 3FANA 3GCOA 5HXFA 4YXWD 1TNKA 3N99A 4WMDA 1MKWK 1QJ1B 3ZV8A 1NESE 1EQ9A 1C1SA 1QRZA 3IITA 2WV9A 5KGOA 4X1NU 4B6EA 5JB9S 1KTTB 4U2WA 1O5GH 3PMJA 1BT7A 3LH1A 4MNVA 5DJ7A 3UWJH 1A7SA 2G4UA 3KEEA 3MO9A 1C2DA 2Q6FA 3S9AA 3A8BA 1GJ4H 4XBBA 3UB0A 4BNRA 4GLYA 1VITG 2JH5D 3GDSA 2ZZUH 1OWIA 2A4QA 1IQHA 4CH2B 1ZSKA 4MDSA 1O32A 3BTTE 2KR7A 5A8XA 2GX4A 1YYY1 1LPZB 3ZZ6A 2F9UA 2Y7XA 1AFQC 5J4QA 3ZZ4A 1NN6A 3ZZ5A 3V7TA 3M5OA 1ESBA 4AB8A 3E1XB 5DN6D 3BF6H 1MTNB 1AI8H 1DXPA 2P93A 3U9AH 2SGAA 1OX1A 1ETRH 3SQHE 1F0UA 4NZQA 4RN6A 4D7GA 2JJ1D 4RSPA 3FFGA 1CT2E 1GJAB 1QA7A 1DE7H 2PR3A 4GAWA 1ARBA 4KTUA 3QTVH 1XUJA 3HATH 2QA9E 1BTXA 4GUXA 4F55A 2QIQA 5C1XA 1G2MA 1G3DA 2Z3DA 1GMCG 4NG9H 1UHBA 1VITH 2BDHA 3P92A 1LO6A 5B6OA 4ABGA 1OHHD 2G81E 3O8DA 2ZNKH 4ISHH 1FY3A 3ATLA 1JRTA 1W0KD 4AG2A 4A92A 2C8YB 1NY22 4YLUA 1UTOA 1CVWH 2C8XB 2BX3A 1C1UH 2VH6A 1HRTH 1MQ5A 1GHAF 3P8GA 1SGFG 1ZLRA 3E3TA 1YCPM 1S6LA 4FUGA 3PLKA 1GHZA 4IGDA 1K1NA 2FI3E 1MTWA 5C67A 2PKAB 1G9IE 4X1PU 2GT7A 4THNH 2QF4A 4X6NA 4CRGA 4ASHA 2TGTA 2CV3A 1ESTA 1WQSA 1FJSA 1O30A 2FX4A 3MH6A 3EA9A 2A4OA 2YOLA 1GJ8B 3ZYDA 2KFWA 4E7RG 2R0LA 4NFFA 3DSGA 4A1TA 4AN7A 1C1RA 2BZAA 1G30B 4ZKSU 5T3HA 2PV9B 1GI7B 2O8TA 1O2NA 2IPQX 5JBBS 1EZUC 2ZGHA 4D76A 6GCHG 3OEED 2JKHA 3A7TA 2PGBB 1MUEB 2O8WA 3MHWU 2Z9IA 1VCQA 1LVYA 4MG3A 1HFDA 2JIZD 3FP6E 1RIWB 1DVAH 1TBZH 3LGVA 2C3SA 1AVGH 4JYVH 1HAGE 7LPRA 1A5GH 3ZZ9A 4BAHB 1BB0B 1TRNA 1AQ7A 1NFYA 2QF5A 1QZ8A 3WWBA 3RXPA 2L74A 3UPEA 1DLKB 4DGJA 4ISLA 1K2I1 1THSH 4MPWA 1QB6A 4OGXA 2XBYA 2P3UB 1JIRA 5BPEA 5T6FA 3BEFB 3ATKA 2ODQA 3QZQA 3Q3KA 3SGAE 1QJ7B 2A2XH 2FXRA 2WV5A 4DVAU 4NIYA 2J97A 1C2HA 3SYJA 2FO9A 3KQBA 5T6GA 1BITA 1F0RA 4KKDA 4D8NA 1AY6H 3KCGH 2QCYA 1Z1JA 3T28A 1YPKH 3A84A 2CF9H 1F2SE 2ANKH 2H9TH 1AB9C 2OCVB 3TJVA 4BANB 2GTBA 1YLNA 1PPFE 1FLEE 5E0JA 2FZZA 4AZ2B 3N7OA 1ELDE 3RMOH 1T4VH 2J98A 3MNXA 1DWBH 7GCHG 1VGCB 3T5FH 2CMYA 1RTLA 1LDTT 1P2QA 2SGQE 1E35B 7ESTE 3TK5A 2UWPA 4B75A 1O3KA 4X6OA 3UOUA 2VJ1A 2ESTE 3SQEE 1TPPA 1BJVA 2WZQA 2HLCA 1KYNA 3RDZA 2C8WB 2D2DA 3QWCH 5CHBA 3JZ1B 3OFND 3OEHD 5DKMA 3BSQA 3QLPH 1EAUA 5HM2A 4ZKOU 3S7KB 5DGJA 5TJXA 1EOJA 5EJLA 4FUFA 5FX6A 1LHEH 3QO6A 4NZLA 1EJNA 3U1JB 5GDSH 1K1JA 4JZFH 2HLDD 3MO6A 3K2UA 5EU8A 2FP7B 4K2YA 5GWZA 4JCNA 1MH0A 3LH3A 4RKJB 2LPRA 2UUFB 3P8NA 4DT7B 3MWIU 2CHAB 4OS7A 1GI4A 2OC1A 2FOBA 1O3MA 5GXPA 1CHGA 2TIOA 3LIWA 1A2CH 2NU3E 1GHBF 5GNDA 1UTKA 4A5TS 1CT4E 1GCTB 3RXTA 3QK1A 3DUXH 3P95A 2FIRH 1DICA 1ZSJA 4K1EA 2ZHFH 5DP7A 1P04A 4KGAA 1TX6A 3S9CA 4CH8B 4F49A 1GGDB 2ZGBH 5EOKA 2PKSB 2Z7FE 4P00A 2O8MA 3VGCB 1WCZA 1FPHH 4XD7D 1MZAA 1TYNA 4ZH8A 2Y5FA 5LPFA 1O3CA 4LXBH 4I8KA 2GMTB 3GY3A 1ANDA 4Z6AH 1C1PA 1MTVA 2HWLB 4AFZA 2VWMA 4LK4A 4BXWA 3ODDA 2XOKD 3K65B 5CHAB 1HGTH 2L6OA 3FOAA 1K1IA 2BZ6H 3CS0A 1YWUA 5DG6A 2A5AA 1VZQH 1HAHH 1HXEH 1KXBA 3BG4B 5EJZA 3TLOA 1SGIB 3OTJE 5AFYH 5CE1A 2A1DB 1QFKH 1TA2A 2GGVB 1GDUA 3AAVA 1CQQA 1MU8B 1C5TA 1SHHB 3DFJA 1O2SA 3EDXB 2F9OA 2BB4A 4YT6H 4CHAC 1WV7H 3QDZB 3QUMP 3E16B 4X1SU 1QNJA 4RKOB 1H4WA 1ZOMA 3PWBA 4ZHAA 1IQMA 2XCFA 1DDJA 4LZ4B 3Q3XA 2ZDVH 3QX5H 1SLVB 1TRYA 4Y7AA 1DOJA 3V12A 2BLVA 2BXUH 2KCYA 3F1SB 4P02A 3SNBA 3A88A 1KDQB 3MYWA 1NRSH 1RTKA 4WY3A 1T32A 1A4WH 2FS8A 1B0FA 4DIIH 3U28C 3RXDA 3PLPA 1W8BH 3DSOA 1TX8A 3TITA 2LNCA 3VB4A 1UO6A 1OWEA 4AX9H 3BTFE 1UW7A 2ZQ2A 2ZECA 1UTLM 2FOEA 2JDID 2VINA 5PTPA 3P17H 1DXWA 4UONA 3V13A 1J15A 2XBWA 3MU4A 3U69H 3S7HB 1Z6EA 2SGDE 1BMNH 1A3EH 1SR5C 2PP6A 4AOQA 1O2QA 3UY9A 1Y3WA 2QGRA 2WPLS 1GJCB 1TQ0B 1GCDA 3MNSA 5JDUB 1COWD 2A4GA 2ZHDA 1QBOA 3V0XA 1D6WA 1TABE 1DITH 1F0TA 1FQ3A 1V2PT 2WPHS 1O2LA 4FUDA 3RXUA 4MPXA 4ZUHA 1NTPA 2J9NA 3Q00A 1Z1IA 1O3NA 2H5DA 3UR9A 4IN1A 1AO5A 5JBAS 1QY6A 4Q7XA 3TH3H 1UTQA 5EPYA 1EZSC 1C1TA 2W6JD 2OK5A 4B2AA 2WPDD 1TIOA 4IC6A 2A5KA 2R3UA 4OS1A 1LPKB 2JJ2D 1H9LB 1ZTLA 1FONA 1MU6B 1X7AC 1DX5M 3NXPA 4B2BA 1C5RA 1NO9H 3PRDA 1P0SH 5AFZH 1ZJDA 3VB6A 1FZZA 1C5MD 1BTUA 1IQFA 3GY8A 3VB7A 3PO1C 5C3NA 4ZCNA 1Y5UT 1DANH 2TBSA 3HK6B 1GI1A 3UNSA 2ZDMA 4AFUA 1FY4A 4MLFB 1WBGB 1Z71A 5IK2D 5I25A 1BOQA 1GHAG 1ID5H 1EAXA 1OPHB 4Y7BA 1O5FH 2GCTC 2BLQA 3GY4A 1V2QT 3K6ZA 1SMFE 1KXAA 1P8VC 2ANWA 1NBME 3MH7A 2R0KA 1PPEE 4TPIZ 3C27B 5FBEA 2P95A 4UFGH 3T26A 2WYJA 2XWAA 1O3FA 4OS5A 1FPCH 1C1WH 1TBQH 2VWOA 1V2RT 2PTNA 1AD8H 1L4DA 2P3TB 3LDXH 4X2XA 2GT8A 4ABBA 4JYTA 4D7FA 1CGJE 4BAQB 1TPSA 4Q2KA 4UFFH 1GJ6A 1LHDH 5IDKA 3F2FA 3QN7A 1K1LA 4BTIB 1QRXA 1ZGIA 2H6MA 4Y11E 1YPHE 3SV9A 1W10U 1FX0B 1UVOA 1L0ZA 3S69A 2W5EA 4TPYA 1LHFH 3SI4H 3KGPA 2ULLA 3CNRA 2VIOA 2ANYA 1O3AA 3AW1A 5AVDA 5H4IB 5K7RA 3UQVA 1S6HA 3ODFA 1P9SA 1XXFA 3SUFA 1EPTB 1C2LA 2QN5T 4ABFA 3AASA 1KXFA 1O5EH 4K60A 1C9PA 2VGCC 3M7UA 2EA3A 1AWFH 5L2ZH 5K0HA 3SGBE 2RA0A 1NROH 3SJKA 1BCUH 3TNTA 2YNBA 2AIQA 4KP0A 1C5YB 2QXGA 2A5IA 1S0QA 1SBWA 4RT1A 1E36B 1D3DB 4X8TH 1VCWA 5C1UA 2LELA 3UTUH 2BD4A 1MKXK 3UOPA 1ZSLA 2KAIB 2QXIA 1AVXA 1TMBH 4DOQA 1XKBC 4ABJA 2UUJB 1BIOA 1ELBA 1G2LA 2BY7X 1FAKH 4O3UA 5A8ZA 2ZU4A 4FVBA 2BVRH 3A82A 1LCYA 1V2ST 1TB6H 2WPIS 2UUYA 1MMJN 1EAWA 1UMAH 4ESTE 1KMHB 4JZEH 2AIPA 1AFQB 4NSYA 3TIUA 3SUDA 2PSXA 4WXVA 2LP6A 2QE7D 1O2KA 1IQNA 2TGDA 1GHXH 5FXLA 1RJXB 1SQAA 1KDQA 1O5BB 4ZXYH 1O5DH 1BMLA 3M3SA 3LPRA 3M36A 5J4SA 2BDBA 1GJ5H 1K0HA 5F03A 3A8DA 3RXEA 1HLTH 2FX6A 3ZYEA 1BRCE 3H7OA 4CR9A 1NT1A 1XVOA 1GBKA 5JYIA 1UTNA 2WPMS 2I6QA 2G5NA 1A0HB 3E0PB 1O37A 1S5SA 3PV4A 3T25A 4HGCA 2JH0D 1GBMA 2ILNA 2P3FH 2VVCA 4O3TA 4OGYA 1LPGB 3E90B 1MABB 1C5LH 1W14U 2XC0A 2FI5E 1BTWA 2BMGB 4Y76A 1LKBA 1SGFA 5F53A 3H09A 3F6UH 1PFXC 3SV8A 3LGIA 1TQ7B 3RU4E 5C94A 4X8VH 2QV1A 2B8OH 1SPJA 1D9IA 3GS9A 1C4U2 2A2QH 1V6DA 4MPUA 2GDEH 2DE8A 4IN2A 3EAJA 1VITF 3BTGE 4K5ZA 1ARCA 1FN8A 3SBKA 4LZ1H 2FTMA 4YESB 3DSPA 3I29A 1V2MT 4X0WU 4FUIA 2HVYB 1H1BA 3VG8A 4X6PA 2FODA 1ELEE 3QTOH 1INCA 1GBHA 4HZHA 5I46H 4FU7A 1C2IA 2GZ9A 2G52A 1P06A 2ZCLP 2OXSA 2C4FH 3A89A 4XE4A 2Y6TA 1HCGA 2KCPA 3D23A 3LONA 5G4BA 3FZDA 2BQ7B 1T31A 2ASUB 1RIWC 1TRMA 4O9VA 2J94A 3G01A 4CR5A 3LJJA 2ZGCA 3ZVCA 3NCLA 3MI4A 1EOLA 2KX4A 3NWUA 2GDDA 1OXGA 4ZROA 1N6YA 1EP5A 1J9CH 3GY2A 1ZMLA 1NC6A 4I7YH 4XOJA 1EXFA 3VXEH 2BD5A 2F43B 1CGIE 2OD3B 4DY7B 4HFPB 5EG4A 1BTZA 4R8TB 4RI0A 4MNYA 2BDGA 5FPTA 1SI5H 1HB0B 2VH0A 3ZVBA 2XNDD 3GY7A 3PROA 4FOUC 1FN6A 1J14A 3PV5A 2VIPA 1YPHC 4X2YA 1Y3VA 4BAOB 1MBQA 4A1VA 2A7HA 3O8RA 1GI6A 1AE5A 3VFEA 4XFQA 3P8FA 1GBIA 1O2GH 3SZNA 2GP9B 3ITIA 5C0TA 1TNHA 1Q31A 2BD9A 1GI2A 1P03A 1C4V2 2BXTH 4UFEH 1ETSH 5T6DA 1FY5A 4OS4A 2PGQB 1TNGA 3SU0A 2FDAA 1SGDE 1UVSH 3ZZ8A 4JMYA 1E37B 4WH6A 3KQCA 2WPJS 3CP7A 2V7QD 1CA0B 5GCHG 1W3CA 2OINA 4VGCC 4MNWA 2GCHF 5A0BA 3FZZA 5HYOA 2FS9A 2BDYA 2Y81A 4IC5A 1AKSB 5GCHF 2F83A 3SOSA 1Z8RA 1HNEE 2G00A 3ATMA 1KLJH 1ZHMA 2BYAX 2XRCA 2FPZA 1LVMA 2GZ7A 1OWDA 4H42U 1UVTH 1GHWH 1C5QA 5F6MA 1NRQH 1P9UA 3ZZ3A 2EY4C 1L1JA 3RMLH 1T8LA 3SU3A 1O5CB 4M7GA 4A1XA 3ZZBA 2UWLA 1HAOH 1MKXH 2QYIA 2OBQA 3VXFH 5EQRA 4TY7A 1MCTA 1ELGA 3A7WA 5EJ1A 4IS5A 3WY8A 2G51A 2HVXA 1H8HD 1KLIH 1GBJA 1TNIA 2EC9H 1A0LA 1H8IH 1Y5BT 2ZPRA 3ZVEA 1C5SA 1G36A 4SGBE 4TY6A 3U98H 1HDTH 1QCPA 1P2OA 1SL3A 1EZXC 3F2HA 3F0PA 1DPOA 2BDIA 1NU7B 1QBVH 2FLBH 2V3MA 2XC4A 3L6PA 1HJ9A 1XUKA 1Q2WA 3Q77A 4X1QU 2FTLE 4Y10E 1GCTC 5EPNA 5A0AE 5JBCS 1O3EA 2RCEA 1P2IA 2ZFPH 1IQIA 1MD8A 3SHAH 3OSYA 5FCKA 4FETA 2ZTZA 1NFXA 2ZI2H 1W7XH 2AGEX 1THRH 1AUTC 3GCTF 1GGDC 5EODA 1TGBA 2FOCA 4I8HA 7KMEH 1UHBB 4YT7H 2PKSC 1MTSA 1C2JA 3VGCC 1TNJA 5HMAA 1UTJA 1B7XB 2BD3A 1YP9A 4MTBA 2GMTC 3SJOA 1UK4A 1Z8GA 1Y3YA 4Y6DA 1OP2A 4K8BA 3PV2A 1DY8A 2ZKSA 3STJA 1D4PB 2YMSD 1CE5A 2ZA5A 3UIRA 1BTYA 4NCYA 1SGRE 1GI8B 2J38A 3T29A 3BG4C 2YNAA 2FEQH 4ABDA 3O8BA 4FU9A 2CGAA 1GHBG 4INHA 3TK9A 4H4FA 1NZQH 1F0SA 3ZZDA 2ZC9H 3RXQA 4XSKU 2CXVA 2NU2E 1KY9A 1ZMNA 3L33A 6GCHF 1WU1A 1C5PA 4WWYA 4CHAB 1NU9A 2OC7A 1CA8B 1NRRH 1QGFA 4UFDH 2G8TA 4O03A 3U8OH 1UCYK 2PUQH 3LGYA 1S81A 2OQ5A 1H9HE 1YPGH 1GWAA 1N6XA 1AFEH 2O9QA 5EXMA 3UFAA 1HJAB 1S0RA 1ZTKA 5DPAA 1TE0A 2BVSH 2WUBA 1F7ZA 3SO3A 4X1RU 1EX3A 1UK3A 1YM0A 4CRBA 3B8JA 1JMOH 3RXBA 3SNDA 5A09A 4E06H 4CRFA 3RXCA 1ZYOA 5GJ4B 1NS3A 4I31A 4U01A 1O3HA 2WHXA 3PLBA 5IYTA 2ZHQH 1P09A 2H2ZA 2ZFFH 3TH4H 3SU5A 1D6RA 1RTFB 1HAXB 3STIA 5FPYA 1C2EA 1C2FA 3PTNA 2NU4E 2OC8A 2R3YA 5EGMA 2BLOA 3HGPA 1DWDH 1GMHG 2FYQA 4K3JA 4JZIA 5DP4A 2QY0B 1B5GH 3RC5A 2OC0A 3GOVB 1BA8B 3OU0A 3VEQB 2XXLA 5LGOA 1CBWC 4TWWA 1UTPA 4F48B 3UQOA 4ZAEA 5GPIB 1KSNA 2BD7A 1E1RD 2FOAA 2B9LA 1GMCF 4FUJA 2SNWA 3M35A 2OLGA 4NFEA 1OP8A 1YLDA 1NBMD 2AHME 8GCHF 2ZFQH 5C0UA 3D49H 1ZJKA 1DSUA 2WUCA 3KHVA 4X6MA 1EFRD 1OSSA 4FUCA 5JBTA 3N7DA 5F8TA 1DFPA 3ZZ7A 1O2XA 6CHAC 3P8OA 1Q3XA 1QQUA 1F5LA 2FI4E 1IHSH 3TGKE 4KTCA 2HGTH 1WOFA 1KIGH 4TT3D 2J95A 3VPKA 4FUBA 4YOGA 5DSFA 1YKTA 1HAVB 2FOFA 2ZFRH 2VWNA 1K28D 1YPJH 3PO1B 3PM3A 4X2VA 1EP6A 1WTGH 2GCHG 3RXVA 1F5KU 1JXPA 2B5TB 5TCAA 3CENA 3SU4A 2OP9A 1ZPCA 1A61H 1RXPA 1UJ1A 2ZP0H 1V2LT 3A7VA 3RLYH 3TH2H 4RT0A 1FUJA 4ZKNU 1NM6A 2P8OB 6LPRA 1EASA 3TVJB 4NA8A 1ZZZA 1MZDA 2GV6A 4UEHH 2F9NA 5FL7D 3EE7A 5F8XA 1H8DH 2J4IA 1DLEA 4ASUD 1DY9A 1BRBE 1SLWB 3BTME 1SFIA 2W7UA 3L3TA 4X2WA 4CRAA 4DIHH 1GJ9B 2P94A 4X8UH 4I8GA 2Y80A 3ELAH 1OWJA 1PPBH 2J98B 3FP8E 4WF8A 2YMSB 3MOCA 2BDCA 3DD2H 2B7DH 4IW4E 1Z7KA 2H9EH 3RU4D 5EXLA 1T8NA 4R0IA 5ABWA 1Y8TA 1SB1H 1CHOG 1A3BH 3SU2A 3R3GB 1U6QA 2TRMA 3OY6U 1DM4B 1WXRA 5C20A 2VGCB 2ZG0H 1S84A 1SGCA 1EJAA 4H6TA 1D3TB 4OS6A 2F4LA 2XBVA 5HIZA 1B0EA 1C1OA 4CBNA 3KIDU 1CT0E 2W26A 1DSTA 3TPIZ 1ZPZA 1NPMA 2THFB 4FUEA 5HKKD 1TFXA 2DUCA 3LT3A 1V2TT 2HOBA 2ZDAH 2J2UA 1DS2E 2SGFE 1SGTA 1TLDA 4AGKA 3NPSA 1GBAA 3SZEA 1RFNA 3SJ8A 3W95A 1O3PB 2W6ID 5JPMH 3RXFA 2EI6A 4B2CA 4ABIA 1AU8A 1W0YH 3R0FA 3FVFB 2AMQA 2F9BH 1AZ8A 5DK1A 3HGNA 4UE7H 3BTEE 1O3JA 4K8YA 1O36A 2RDLA 4AYYB 1VKYA 1LHGH 2XBXA 2WYGA 2HRVA 2AMPA 3AK5A 2PLXA 1KXDA 2BD8A 2RDEA 2BY8X 1DUAA 4ABAA 1GMDF 3SUGA 2XNIA 2IJOB 4ZMAH 3ATWA 4WVPE 1BQYA 3SI3H 4NIXA 2G4TA 2QC2A 4Y8XA 4FUHA 4I32A 4CRCA 1N8OC 1OOKB 1O3IA 2ZU2A 1P2JA 3I77A 4NIWA 1YPEH 3IWMA 1XUIA 5KEDA 1SGEE 4WJG2 3MU8A 2XYAA 2XWBI 5ESBA 3MNBA 4JYUH 1VR1H 3M5MA 2PTCE 1P10A 4NA9H 2D8WA 4XDEA 3BTHE 4NGAH 4UDWH 1OS8A 5C1YA 1O5AB 2JETB 4YZUA 6ESTA 1BTPA 1CO7E 3SN8A 1SLUB 2CK3D 1IOEA 3F0OA 1WDIA 1O2VA 5FCRA 4B1TA 2TGAA 1LTOA 4NIVA 3H7TA 3B9FH 3GY5A 9LPRA 5L6NH 1O2ZA 1GHVH 3MU0A 1MQ6A 4ISIH 3VB3A 1W2KH 1HAIH 1BUIA 1LQDB 5DP9A 3F68H 1THPB 1ELTA 1AN1E 1MKWH 3S0NA 2GVFA 2SNVA 3BTKE 5FAHA 2ZGJA 3ENSB 1P05A 2GJGA 2KM0A 2GV7A 1N1LA 2BLWA 5FX5A 3ZVAA 1EUFA 3A86A 5EW1H 1YY3A 3BN9A 5DP6A 1P02A 1RRKA 3A80A 3ZZAA 4MPVA 4Q4LA 1AIXH 1S6FA 1C2GA 2ZCKP 2ZCHP 1O0DH 1QTFA 2HNTF 2XCNA 5A0CA 3H5CB 5DO4H 5C5OA 2P16A 4GHTA 5A2MH 1BJUA 4J2YB 3PMHB 3JZ2B 3MO3A 2EQNA 1Z8IB 2Y5HA 1C4Y2 1GL1A 1TGCA 1GG6C 3A83A 3DFLA 2Q6GA 4A7IB 1O2WA 3SORA 2VNTA 1XVMA 1GVKB 2DE9A 3BEUA 1ABIH 2UUKB 1C5XB 2PUXB 3GYLB 3RUOA 2P59A 3PYHA 4JZ1A 1A46H 1JOUB 2R9PA 4BAKB 1DT2A 2ZF0H 4YO9A 1TMUH 3ZZCA 8LPRA 1ZHRA 2BY9X 3F9HA 3U1IB 4ACBA 1GBBA 2ZHWH 3MNCA 3SV7A 1JRSA 2K1QA 3DCLA 3RC4A 1YCPH 2Z9GA 3SU1A 1CA0C 2VIQA 4J1YA 5C17A 2VVUA 2ZU1A 1SKYE 1O3LA 2ZHEH 3PTBA 1FAXA 5ETXA 4VGCB 1QHRB 1TAWA 1AGJA 1ZMJA 2IPHA 4HTCH 1HIAA 1OYTH 1O2PA 1K1PA 1HPGA 2OTVA 3MH4A 1O2YA 3SHCH 1Y3UA 3W1EA 2A31A 2BDAA 5DP3A 3RU4T 3EGKH 3QZRA 1TOMH 1UVPA 4LOYH 1TX7A 1RS0A 2SGEE 3KQDA 1G3EA 4AFSA 3A7XA 4AG1A 4E7NA 4TSFD 5AF9H 1GI3A 1DWCH 1T4UH 1S83A 1PPZA 1C5ZB 2ZO3H 3P70B 1GMHF 2W3IA 5FPSA 1QB9A 1GDNA 2Z9LA 3M5NA 4BAMB 5C2ZA 1C2MA 1V2OT 2TPIZ 1P11E 3Q76A 4MVNA 5CMXH 2ZTYA 2M2AA 4I8JA 4YM9A 2A4RA 5F8ZA 1XM1A 3GCHB 1TONA 2F9PA 4WXIA 1K1MA 3KYGA 2Z94A 2A7CA 1P12E 2V3HH 2Y82A 2IN2A 1TA6A 4YTAA 1SG8B 3ZVGA 1LMWB 2AGGX 3TJOA 1GDQA 1K21H 1PQ7A 3RXKA 1AUJA 1C5OH 3MH5A 2RFKC 3UR6A 1W12U 4CREA 4GPGA 3SU6A 1HYLA 8KME2 2O8UA 2PW8H 2ALVA 1EKBB 2ZFTA 1L1GA 3OX7U 5BRRE 2FOMB 1BDAA 4XRNA 4Q7YA 3TK6A 1IQLA 4FVDA 3SJ9A 1HIAB 3PMAB 1GJBB 3MFJA 4IMZA 1K22H 1O3DA 1EATA 1T7CA 1HUTH 1PQAA 3E8LA 1GJ7B 3UUZA 2ZIQH 1TGSZ 3NRLA 1YPLH 5E0HA 1EZQA 1QIXB 4AB9A 4XBDA 3SW2B 1F5RA 2XTTB 3GCNA 1PQ8A 4Y71A 3BEIB 1ELCA 3M37A 1WTHD 2QXHA 1TPAE 2FWWA 5E0GA 2RG3A 2BOKA 2D1JA 1HJ8A 1O2OA 3ZVFA 2HPQH 3KN2A 5AHGH 5ESTE 1Y3XA 3RXIA 1C1QA 1GPZA 1EB1H 5C5NA 2AYWA 1HJAC 1GBLA 1AVWA 2EI8A 4E05H 3E0NB 4AORA 1DWEH 5TCCA 3KQEA 1FY1A 1UK2A 1Y5AT 2B0FA 2VIDA 3F3BA 1CU1A 5GIBA 1SOZA 2BVXH 2Q6DA 3KL6A 4BTTB 3OYPA 2C93B 4OS2A 5EXNA 1P2MA 1P3EA 1ZHPA 4F4OC 1QQ4A 4NSVA 5E2PA 1OKXA 2HNTE 3FAOA 2J34A 3SV2H 5L2YH 3W94A 3BV9B 4ZHLU 2BX4A 1PJPA 1J17T 1K1OA 1V2VT 3A87A 2FM2A 2W7SA 1W0JD 3A7YA 3RXSA 1W0ZU 2JH6D 2K0QA 1A1RA 3PWCA 1C5WB 5B6LA 1RGQA 5EW2H 2G55A 1O35A 2KCAA 4DJZB 1WSSH 2ZPQA 1SLXB 1BMAA 1MTNC 1S82A 2O8LA 1E0FD 1J16A 2FYRA 1BHXF 1CBWB 4B73A 2AFQB 4B76A 3EYDA 2ODYB 2R2WU 2ODPA 1O3GA 1QR3E 2ZQ1A 4ISNA 3T27A 3PRBA 3SNCA 4AFQA 1YCPK 1GI5A 2VIWA 4IMQA 1MTUA 2WSSD 1FIWA 2GKVE 2R2MB 1C1NA 4X8SH 3WW7A 2F91A 1YPMH 1SQOA 2AEIH 3LGUA 1YGCH 3RXGA 2ZGXH 1QJ6B 1GJDB 1GMDG 2OQUA 5E2OA 2ZPSA 2BTCE 6CHAB 4CBOA 1O2RA 2KCOA 5JB8S 3LC3A 1P01A 2ZWLH 3M5LA 1SQTA 1PPCE 2J5UA 4INLA 1O39A 1O2HA 4Y8ZA 4Y0ZE 1XXDA 1BBRH 1TWXB 4I8LA 1YF4A 1GBDA 1ZR0A 4NWKA 3NUMA 4O97A 2ZU5A 5L30H 4YOIA 2FOHA 3TGIE 3M3VA 1CGHA 3LGWA 3WWFA 2ALPA 1WAYB 3B23B 1ESAA 1HBTH 3S9BA 2V0BA 1FV9A 3MQKC 1MBMA 3F9EA 1SC8U 2PHBA 1O2MA 1QL7A 1J8AA 1SSXA 3RXRA 1SVPA 3A81A 3GCTG 2P8OC 3FO8D 4NWLA 1E34B 3A7ZA 3LC5A 1LVBA 5HGGA 2Y7ZA 3LKWA 4B6FA 1CHOF 3A85A 3OY5U 5T1VA 2PFEA 3K9XB 4FU8A 3PMBB 4MNXA 3OTPA 1O31A 1BRAA 1BMFD 1WUNH 1WQVH 1SGYE 2H1UA 1P3CA 1D3QB 7GCHF 2BOHB 1BBRE 3BIVH 2ZEBA 4B71A 3AW0A 3NZIA 1E1QD 1QL8A 2STAE 1XMNB 2VVVA 2YMSC 1KXCA 1QURH 1W11U 2PKAA 3ATIA 1TMTH 1TNLA 2V3OH 4FXGH 2NWNA 3SNEA 1G32B 1T8MA 8ESTE 2ZDLA 2A7JA 2AS9A 1T8OA 1ELVA 2VIVA 2FOGA 2WPKS 2Z3EA 4ZXXH 1ANEA 3C1KA 1AZZA 1ZTJA 5DP8A 3D62A 2EI7A 4SGAE 3SNAA 1AB9B 3KYFA 3UNQA 1MCVA 1O3BA 3GY6A 1TPOA 3TNSA 1VGCC 3NKKA 1TOCB 2H9HA 1MAXA 4I33A 1SHYA 2CN0H 1JIMA 4WMEA 5LH8A 3BIUH 3T62A 2VU8E 2AH4X 1ANCA 1V2KT 3GYMA 3SGQE 4BTUB 1FIZA 1AHTH 3M7QA 3HKJB 3P6ZB 3RMMH 4A6LA 8GCHG 3K6YA 1EJMA 3PB1E 1LVOA 4K1SA 2PSYA 5HM9A 2KAIA 2UWOA 1IQKA 1JWTA 1FI8A 1XUFA 3MU1A 1N8OB 3I78A 1FNIA 4I86A 3RM0H 2QAAA 3EE0B 4YLQH 2Z9JA 3KQ5A 9ESTA 1SGNE 3F9FA 2CHAC 3N7EA 4INKA 2Z3CA 1IHTH 2Q1JA 1O33A 1ELFA 3RXAA 2Z9KA 1NRPH 3GDUA 4ABEA 3LOXA 4UD9H 3BG8A 2M5TA 3EQ0H 2NU0E 2A32A 1E79D 1IAUA 2I6SA 3KNXA 4Q63A 1DUEA 2JETC 1EPTA 1O34A 4KTSA 4AYVB 2Y5GA 1ORFA 1BZXE 1PQ5A 3MTYA 4PROA 3RP2A 1EB2A 1SGPE 4TYDA 1SOTA 1UVUH 1BTHH 2CF8H 1O3OA 4GCHF 3MMGA 1G3BA 2ZDKA 4HG6A 1PYTD 1NFWA 1W13U 3ZV9A 2RA3A 3V3MA 1K9OE 4U32A 3UAIC 1EAIA 1O2JA 2AGIX 3UNRA 3GICB 1TGNA 1GBTA 3RLWH 5A8YA 1FY8E 5HIYA 1TALA 4MQAA 2BHGA 5CHAC 3DA9B 2GZ8A 5LPRA 1VCPA 2ZU3A 1C5VA 1SFQB 1V2UT 4YOJA 3FKSD 1O2IA 3DT0H 2KZ4A 3E6PH 2SGPE 3F9GA 3TU7H 1C1VH 2HNTC 3TJNA 1FXYA 1P57B 1A0JA 3U8RH 1AE8H 3RXHA 1OYQA 5E8EH 1GVZA 5KECA 2ZTXA 3KF2A 1XX9A 1WYKA 4GHQA 1ELAA 1ZGVA 2J92A 3ZIAD 1HXFH 1HV7A 3O8CA 1NFUA 3UWIA 1ZRBA 1BRUP 1RD3B 1VJ9U 3BTDE 4JZDH 4K69A 4D9RA 2BM2A 2IJD1 4AGJA 1GI0A 2BQ6B 1BBRK 3TGJE 1YLCA 1ACBE 1P2KA 4DG4A 4Q80A 3EA7A 2WINI 1GG6B 4CRDA 3OAAD 2F9VA 4D9QA 1JBUH 1V3XA 2C8ZB 4DT4A 1Z8JB 2D26C 2A0QB 1H8ED 1A5HA 4JK5A 3TJUA 1PPGE 1PPHE 1ABJH 1AMHA 1IQJA 4DURA 1GBEA 2WV4A 1V2NT 1G3CA 1GL0E 2XC5A 1LHCH 2V35A 1HAVA 2XW9A 2OBOA 4Z0KA 2FESH 4Q7ZA 1MD7A 4ACAA 2HPPH 1XUGA 1C5NH 1KLTA 2F3CE 2EEKA 4HI3A 1UCYE 2H5CA 3OE7D 4WH8A 1YBWA 3GISB 4Z1MD 1C2KA 3M3TA 4BOHA 3HPTB 2ZDNA 4WMFA 5EQSA 2QF3A 2STBE 3HK3B 2VWLA 1QL9A 2FLRH 1CSOE 4JK6A 2ZFSA 1TGTA 1O38A 1ETTH 3U8TH 5FBIA 1GVLA 3CS7A 3HKIB 4GCHG 4M9FA 4GVUA 4DCDA 1YC0A 1V2WT 3RMNH
chains in the Genus database with same CATH topology
2NU1E 4QT8C 3NK8A 1KXEA 4IBLH 3BTQE 3A8CA 1OWKA 3E91A 4ZHMU 3RXOA 3LU9B 2BY6X 2G5VA 1ZRKA 3LJOA 2BD2A 2PWXA 4GSOA 1F92A 3M7TA 2QXJA 1Y59T 1QA0A 3MU5A 1GBFA 1NRNH 2V6NA 4U30A 3RC6A 5EQQA 3QGNB 1FMGA 3VB5A 1KTSB 1HAZB 3T2NA 2BQWB 3SUEA 3AAUA 3GCHC 1UCYH 4BXSA 1GI9B 3QGJA 1L4ZA 5DP5A 3URDA 1OWHA 1OP0A 4B74A 4XBCA 3Q3YA 4TWYA 2Z6BD 4ABHA 2ANMH 1IQGA 3A8AA 2W3KA 3BTWE 2BY5X 4H6SB 4Y8YA 1Z6JH 1XKAC 1GHYH 1H9IE 2SFAA 1C5UA 3D65E 3ESTA 4KELA 1D3PB 1LQEA 3LGTA 1ANBA 2GCTB 3URCA 1BHXB 1M9UA 1O2UA 1W7GH 2VB0A 1XUHA 1A5IA 1L1NA 3RM2H 1SGQE 4K1TA 3ZVDA 1QBNA 1HAPH 2QF0A 5SGAE 3SJIA 3RXJA 5LPEA 2AMDA 2OUAA 3FP7E 1AKSA 2TGPZ 1L2EA 2HALA 3EA8A 1LKAA 1BMMH 1ZPBA 1C9TA 1S85A 1QRWA 2FMJA 3AVZA 1GBCA 2AERH 1MAYA 1HAYB 4Y79A 1C1MA 3SV6A 2CJIA 2GD4B 1O2TA 1V2JT 4DW2U 2A45B 2C90B 1P2NA 4Y0YE 1G37A 4ZKRU 3M61U 3GDVA 1QB1A 1EPTC 1FDPA 3IG6B 1PYTC 1UTMA 5FHTA 3UREA 3RXLA 1E38B 3DHKH 1TBRH 4ISOA 4NA7A 2IOTA 3RXMA 1IQEA 1VJAU 1AWHB 3FANA 3GCOA 5HXFA 1TNKA 4WMDA 1MKWK 1QJ1B 3ZV8A 1NESE 1EQ9A 1C1SA 1QRZA 3IITA 4X1NU 5JB9S 1KTTB 4U2WA 1O5GH 3PMJA 1BT7A 3LH1A 4MNVA 5DJ7A 3UWJH 1A7SA 2G4UA 3KEEA 3MO9A 1C2DA 2Q6FA 3S9AA 3A8BA 1GJ4H 4XBBA 4BNRA 4GLYA 1VITG 2JH5D 3GDSA 2ZZUH 1OWIA 2A4QA 1IQHA 4CH2B 1ZSKA 4MDSA 1O32A 3BTTE 5A8XA 2GX4A 1YYY1 1LPZB 3ZZ6A 2F9UA 2Y7XA 1AFQC 5J4QA 3ZZ4A 1NN6A 3ZZ5A 3V7TA 3M5OA 1ESBA 4AB8A 3E1XB 3BF6H 1MTNB 1AI8H 1DXPA 2P93A 3U9AH 2SGAA 1OX1A 1ETRH 3SQHE 1F0UA 4NZQA 4RN6A 4D7GA 4RSPA 3FFGA 1CT2E 1GJAB 1QA7A 1DE7H 2PR3A 4GAWA 1ARBA 4KTUA 3QTVH 1XUJA 3HATH 2QA9E 1BTXA 4GUXA 2QIQA 5C1XA 1G2MA 1G3DA 2Z3DA 1GMCG 4NG9H 1UHBA 1VITH 2BDHA 3P92A 1LO6A 5B6OA 4ABGA 3O8DA 2G81E 4ISHH 2ZNKH 1FY3A 3ATLA 1JRTA 4AG2A 4A92A 2C8YB 1NY22 4YLUA 1UTOA 1CVWH 2C8XB 2BX3A 1C1UH 2VH6A 1HRTH 1MQ5A 1GHAF 3P8GA 1SGFG 1ZLRA 3E3TA 1YCPM 4FUGA 3PLKA 1GHZA 4IGDA 1K1NA 2FI3E 1MTWA 5C67A 2PKAB 1G9IE 4X1PU 2GT7A 4THNH 4X6NA 4CRGA 4ASHA 2TGTA 2CV3A 1ESTA 1WQSA 1FJSA 1O30A 2FX4A 3MH6A 3EA9A 2A4OA 2YOLA 1GJ8B 3ZYDA 4E7RG 2R0LA 4NFFA 4A1TA 4AN7A 1C1RA 2BZAA 1G30B 4ZKSU 5T3HA 2PV9B 1GI7B 2O8TA 1O2NA 5JBBS 1EZUC 2ZGHA 4D76A 6GCHG 2JKHA 3A7TA 2PGBB 1MUEB 2O8WA 3MHWU 2Z9IA 1VCQA 1LVYA 4MG3A 1HFDA 3FP6E 1RIWB 1DVAH 1TBZH 3LGVA 2C3SA 1AVGH 4JYVH 1HAGE 7LPRA 1A5GH 3ZZ9A 4BAHB 1BB0B 1TRNA 1AQ7A 1NFYA 3RXPA 3UPEA 1DLKB 4DGJA 4ISLA 1K2I1 1THSH 4MPWA 1QB6A 4OGXA 2XBYA 2P3UB 1JIRA 5BPEA 5T6FA 3BEFB 3ATKA 2ODQA 3QZQA 3Q3KA 3SGAE 1QJ7B 2A2XH 2FXRA 2WV5A 4DVAU 4NIYA 1C2HA 2FO9A 3KQBA 5T6GA 1BITA 1F0RA 4KKDA 4D8NA 1AY6H 3KCGH 2QCYA 1Z1JA 3T28A 1YPKH 3A84A 2CF9H 1F2SE 2ANKH 2H9TH 1AB9C 2OCVB 3TJVA 4BANB 2GTBA 1PPFE 1FLEE 5E0JA 2FZZA 4AZ2B 3N7OA 1ELDE 3RMOH 1T4VH 3MNXA 1DWBH 7GCHG 1VGCB 3T5FH 2CMYA 1RTLA 1LDTT 1P2QA 2SGQE 1E35B 7ESTE 3TK5A 2UWPA 4B75A 1O3KA 4X6OA 3UOUA 2VJ1A 2ESTE 3SQEE 1TPPA 1BJVA 2HLCA 1KYNA 3RDZA 2C8WB 2D2DA 3QWCH 3JZ1B 5DKMA 3BSQA 3QLPH 1EAUA 5HM2A 4ZKOU 3S7KB 5DGJA 5TJXA 1EOJA 4FUFA 5FX6A 1LHEH 3QO6A 4NZLA 1EJNA 3U1JB 5GDSH 1K1JA 4JZFH 3MO6A 3K2UA 5EU8A 2FP7B 4K2YA 5GWZA 4JCNA 1MH0A 3LH3A 4RKJB 2LPRA 2UUFB 3P8NA 4DT7B 3MWIU 2CHAB 4OS7A 1GI4A 2OC1A 2FOBA 1O3MA 5GXPA 1CHGA 2TIOA 3LIWA 1A2CH 2NU3E 1GHBF 1UTKA 4A5TS 1CT4E 1GCTB 3RXTA 3QK1A 3DUXH 3P95A 2FIRH 1DICA 1ZSJA 4K1EA 2ZHFH 5DP7A 1P04A 4KGAA 1TX6A 3S9CA 4CH8B 4F49A 1GGDB 2ZGBH 5EOKA 2PKSB 2Z7FE 2O8MA 3VGCB 1WCZA 1FPHH 1MZAA 1TYNA 4ZH8A 2Y5FA 5LPFA 1O3CA 4LXBH 4I8KA 2GMTB 3GY3A 1ANDA 4Z6AH 1C1PA 1MTVA 2HWLB 4AFZA 2VWMA 4LK4A 4BXWA 3ODDA 3K65B 5CHAB 1HGTH 1K1IA 2BZ6H 3CS0A 5DG6A 2A5AA 1VZQH 1HAHH 1HXEH 1KXBA 3BG4B 3TLOA 1SGIB 3OTJE 5AFYH 5CE1A 2A1DB 1QFKH 1TA2A 2GGVB 1GDUA 3AAVA 1CQQA 1MU8B 1C5TA 1SHHB 3DFJA 1O2SA 3EDXB 2F9OA 2BB4A 4YT6H 4CHAC 1WV7H 3QDZB 3QUMP 3E16B 4X1SU 1QNJA 4RKOB 1H4WA 1ZOMA 3PWBA 4ZHAA 1IQMA 2XCFA 1DDJA 4LZ4B 3Q3XA 2ZDVH 3QX5H 1SLVB 1TRYA 4Y7AA 1DOJA 3V12A 2BLVA 2BXUH 3F1SB 3SNBA 3A88A 1KDQB 3MYWA 1NRSH 1RTKA 4WY3A 1T32A 1A4WH 2FS8A 1B0FA 4DIIH 3RXDA 3PLPA 1W8BH 1TX8A 3TITA 2LNCA 3VB4A 1UO6A 1OWEA 4AX9H 3BTFE 2ZQ2A 2ZECA 1UTLM 2FOEA 2VINA 5PTPA 3P17H 1DXWA 4UONA 3V13A 1J15A 2XBWA 3MU4A 3U69H 3S7HB 1Z6EA 2SGDE 1BMNH 1A3EH 1SR5C 4AOQA 1O2QA 3UY9A 1Y3WA 2QGRA 2WPLS 1GJCB 1TQ0B 1GCDA 3MNSA 5JDUB 2ZHDA 2A4GA 1QBOA 3V0XA 1D6WA 1TABE 1DITH 1F0TA 1FQ3A 1V2PT 2WPHS 1O2LA 4FUDA 3RXUA 4MPXA 4ZUHA 1NTPA 2J9NA 3Q00A 1Z1IA 1O3NA 2H5DA 3UR9A 4IN1A 1AO5A 5JBAS 1QY6A 4Q7XA 3TH3H 1UTQA 5EPYA 1EZSC 1C1TA 4B2AA 1TIOA 4IC6A 2A5KA 2R3UA 4OS1A 1LPKB 1H9LB 1ZTLA 1FONA 1MU6B 1X7AC 1DX5M 3NXPA 4B2BA 1C5RA 1NO9H 1P0SH 5AFZH 1ZJDA 3VB6A 1FZZA 1C5MD 1BTUA 1IQFA 3GY8A 3VB7A 3PO1C 5C3NA 1Y5UT 1DANH 2TBSA 3HK6B 1GI1A 3UNSA 2ZDMA 4AFUA 1FY4A 4MLFB 1WBGB 1Z71A 5I25A 1BOQA 1GHAG 1ID5H 1EAXA 1OPHB 4Y7BA 1O5FH 2GCTC 2BLQA 3GY4A 1V2QT 3K6ZA 1SMFE 1KXAA 1P8VC 2ANWA 3MH7A 2R0KA 1PPEE 4TPIZ 3C27B 5FBEA 2P95A 4UFGH 3T26A 2WYJA 2XWAA 1O3FA 4OS5A 1FPCH 1C1WH 1TBQH 2VWOA 1V2RT 2PTNA 1AD8H 1L4DA 2P3TB 3LDXH 4X2XA 2GT8A 4ABBA 4JYTA 4D7FA 1CGJE 4BAQB 1TPSA 4Q2KA 4UFFH 1GJ6A 1LHDH 5IDKA 3QN7A 1K1LA 4BTIB 1QRXA 1ZGIA 2H6MA 4Y11E 1YPHE 3SV9A 1W10U 1UVOA 1L0ZA 3S69A 2W5EA 4TPYA 1LHFH 3SI4H 3KGPA 2ULLA 2VIOA 2ANYA 1O3AA 3AW1A 5AVDA 5H4IB 5K7RA 3UQVA 1S6HA 3ODFA 1P9SA 1XXFA 3SUFA 1EPTB 1C2LA 2QN5T 4ABFA 3AASA 1KXFA 1O5EH 4K60A 1C9PA 2VGCC 3M7UA 2EA3A 1AWFH 5L2ZH 5K0HA 3SGBE 2RA0A 1NROH 3SJKA 1BCUH 3TNTA 2YNBA 2AIQA 4KP0A 1C5YB 2QXGA 2A5IA 1S0QA 1SBWA 1E36B 1D3DB 4X8TH 1VCWA 5C1UA 3UTUH 2BD4A 1MKXK 3UOPA 1ZSLA 2KAIB 2QXIA 1AVXA 1TMBH 4DOQA 1XKBC 4ABJA 2UUJB 1BIOA 1ELBA 1G2LA 2BY7X 1FAKH 4O3UA 5A8ZA 2ZU4A 4FVBA 2BVRH 3A82A 1LCYA 1V2ST 1TB6H 2WPIS 2UUYA 1MMJN 1EAWA 1UMAH 4ESTE 4JZEH 2AIPA 1AFQB 4NSYA 3TIUA 3SUDA 2PSXA 4WXVA 1O2KA 1IQNA 2TGDA 1GHXH 5FXLA 1RJXB 1SQAA 1KDQA 1O5BB 4ZXYH 1O5DH 1BMLA 3M3SA 3LPRA 3M36A 5J4SA 2BDBA 1GJ5H 5F03A 3A8DA 3RXEA 1HLTH 2FX6A 3ZYEA 1BRCE 3H7OA 4CR9A 1NT1A 1XVOA 1GBKA 5JYIA 1UTNA 2WPMS 2I6QA 2G5NA 1A0HB 3E0PB 1O37A 1S5SA 3PV4A 3T25A 4HGCA 2JH0D 1GBMA 2ILNA 2P3FH 2VVCA 4O3TA 4OGYA 1LPGB 3E90B 1C5LH 1W14U 2XC0A 2FI5E 1BTWA 2BMGB 4Y76A 1LKBA 1SGFA 3F6UH 1PFXC 3SV8A 3LGIA 1TQ7B 3RU4E 4X8VH 2QV1A 2B8OH 1SPJA 1D9IA 1C4U2 2A2QH 1V6DA 4MPUA 2GDEH 2DE8A 4IN2A 3EAJA 1VITF 3BTGE 4K5ZA 1ARCA 1FN8A 3SBKA 4LZ1H 2FTMA 4YESB 3I29A 1V2MT 4X0WU 4FUIA 1H1BA 4X6PA 2FODA 1ELEE 3QTOH 1INCA 1GBHA 4HZHA 5I46H 4FU7A 1C2IA 2GZ9A 2G52A 1P06A 2ZCLP 2OXSA 2C4FH 3A89A 4XE4A 2Y6TA 1HCGA 3D23A 3LONA 5G4BA 3FZDA 2BQ7B 1T31A 2ASUB 1RIWC 1TRMA 4O9VA 2J94A 3G01A 4CR5A 3LJJA 2ZGCA 3ZVCA 3NCLA 3MI4A 1EOLA 3NWUA 2GDDA 1OXGA 4ZROA 1N6YA 1EP5A 1J9CH 3GY2A 1ZMLA 1NC6A 4I7YH 4XOJA 1EXFA 3VXEH 2BD5A 2OD3B 1CGIE 4DY7B 4HFPB 5EG4A 1BTZA 4R8TB 4MNYA 2BDGA 5FPTA 1SI5H 1HB0B 2VH0A 3ZVBA 3GY7A 3PROA 1FN6A 1J14A 2VIPA 1YPHC 4X2YA 1Y3VA 4BAOB 1MBQA 4A1VA 2A7HA 3O8RA 1GI6A 1AE5A 3VFEA 4XFQA 3P8FA 1GBIA 1O2GH 3SZNA 2GP9B 3ITIA 1TNHA 1Q31A 2BD9A 1GI2A 1P03A 1C4V2 2BXTH 4UFEH 1ETSH 5T6DA 1FY5A 4OS4A 2PGQB 1TNGA 3SU0A 2FDAA 1SGDE 1UVSH 3ZZ8A 4JMYA 1E37B 4WH6A 3KQCA 2WPJS 3CP7A 1CA0B 5GCHG 1W3CA 2OINA 4VGCC 4MNWA 2GCHF 5A0BA 3FZZA 5HYOA 2FS9A 2BDYA 2Y81A 4IC5A 1AKSB 5GCHF 2F83A 3SOSA 1Z8RA 1HNEE 2G00A 3ATMA 1KLJH 1ZHMA 2BYAX 2XRCA 2FPZA 1LVMA 2GZ7A 1OWDA 4H42U 1UVTH 1GHWH 1C5QA 5F6MA 1NRQH 1P9UA 3ZZ3A 1L1JA 3RMLH 1T8LA 3SU3A 1O5CB 4M7GA 4A1XA 3ZZBA 2UWLA 1HAOH 1MKXH 2QYIA 2OBQA 3VXFH 5EQRA 4TY7A 1MCTA 1ELGA 3A7WA 4IS5A 3WY8A 2G51A 2HVXA 1KLIH 1GBJA 1TNIA 2EC9H 1A0LA 1H8IH 1Y5BT 2ZPRA 3ZVEA 1C5SA 1G36A 4SGBE 4TY6A 3U98H 1HDTH 1QCPA 1P2OA 1SL3A 1EZXC 1DPOA 2BDIA 1NU7B 1QBVH 2FLBH 2XC4A 3L6PA 1HJ9A 1XUKA 1Q2WA 3Q77A 4X1QU 2FTLE 4Y10E 1GCTC 5EPNA 5A0AE 5JBCS 1O3EA 2RCEA 1P2IA 2ZFPH 1IQIA 1MD8A 3SHAH 3OSYA 5FCKA 2ZTZA 1NFXA 2ZI2H 1W7XH 2AGEX 1THRH 1AUTC 3GCTF 1GGDC 5EODA 1TGBA 2FOCA 4I8HA 7KMEH 1UHBB 4YT7H 2PKSC 1MTSA 1C2JA 3VGCC 1TNJA 5HMAA 1UTJA 1B7XB 2BD3A 1YP9A 4MTBA 2GMTC 3SJOA 1UK4A 1Z8GA 1Y3YA 4Y6DA 1OP2A 4K8BA