3UWIA

Bovine trypsin variant x(tripleglu217phe227) in complex with small molecule inhibitor
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSETYNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSASSFIITSNMFCVGYLEGGKDACQGDSGGPVVCSGKLQGIVSWGEGCAQKNKPGFYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Cationic trypsin
publication title Correlating structure and ligand affinity in drug discovery: a cautionary tale involving second shell residues.
pubmed doi rcsb
source organism Bos taurus
total genus 54
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2011-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3uwiA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3uwiA02
5T6DA 4DURA 3M7QA 6CHAB 1TRYA 3BTKE 4Y10E 2Q6FA 2BVRH 3U8OH 5IDKA 5G4BA 1FIWA 1D3TB 2BM2A 5C1YA 5FPTA 5AF9H 5K7RA 1A5HA 5A2MH 1UVTH 2R9PA 4H6TA 3M7TA 2BVXH 1NRQH 1BRUP 4AFUA 2A2XH 3RXRA 3MOCA 3BTWE 1L4ZA 1AIXH 4NSYA 2BDHA 4K2YA 4DVAU 3RP2A 5JBCS 3T25A 1WQSA 5DP4A 3SHAH 1IHTH 4ZH8A 1DSUA 3M5NA 1IQGA 1NY22 1UK4A 2VVCA 3OY5U 1MKXK 4X6PA 1SOZA 1SGFG 2BYAX 1FUJA 1ORFA 1S85A 1AMHA 2G4TA 1ELDE 1XKBC 2ZDNA 2ZGBH 1PFXC 1P01A 4UONA 4I32A 4NA9H 3RU4E 1G36A 1JOUB 1UTNA 2Y80A 4K60A 3VEQB 1DXPA 1QRZA 4X1SU 4FVDA 1EOLA 2XTTB 1ZRKA 5GIBA 3GY2A 4K5ZA 2ZU2A 2GCHF 4NGAH 1YCPH 2Z6BD 3TGKE 3E8LA 2BLQA 1VITF 1GGDC 4BTIB 3TGIE 3SNDA 3Q00A 1EAXA 1GCDA 1BTYA 2GCTC 1SC8U 3URDA 1TNJA 4DY7B 2B7DH 2A0QB 1P09A 4FU8A 1PPGE 4VGCC 1FLEE 3R0FA 3F1SB 3ATWA 4DCDA 3VFEA 2XNIA 3QGJA 5LPFA 2JH0D 3C27B 1TE0A 3TK9A 5EXMA 2Y81A 1WSSH 3EE0B 3A8AA 3RMNH 2XBVA 1TQ0B 1LPGB 1TGSZ 4ABDA 5JBAS 1MTSA 2BMGB 3KCGH 3M3TA 3Q3KA 1C9PA 4GHQA 2AGIX 2OC8A 3AW0A 4H6SB 2HLCA 3RXQA 2VWOA 1ZMLA 1GMHG 2ZHDA 1S6FA 1IQFA 1TALA 3SGBE 1O3GA 2W26A 2C90B 1SLWB 4YM9A 2V35A 2HWLB 2OUAA 2FOMB 1TRMA 4LK4A 2AS9A 3SU3A 1GI9B 1HDTH 2VIDA 1F0UA 2XCFA 3RXHA 2G5VA 1GWAA 5L6NH 2YNBA 1QR3E 1T31A 2VNTA 4YT7H 2J92A 3MI4A 1GI2A 1UVUH 2P3FH 2ZPRA 2OCVB 5DKMA 5C3NA 1GDNA 1EATA 1IQMA 5LPRA 3LPRA 3KF2A 1FDPA 2BDGA 1IQNA 1W0ZU 2W7SA 3STJA 1SHHB 1QY6A 1C2JA 1EJMA 1JBUH 1EP5A 2A31A 3FZDA 1NU7B 3OX7U 3CP7A 4OS4A 1AN1E 2ZWLH 3M5MA 1O3BA 1Q2WA 1QA0A 1TIOA 5TCAA 2M5TA 2I6SA 2PSYA 4RN6A 1ZMNA 2ZFSA 3SI3H 2QF0A 2BY7X 1KLJH 3FP8E 4FUGA 4Y76A 1ZR0A 1SGCA 1IQHA 2A7CA 4O03A 3TH2H 1GHBF 1YCPK 1E0FD 1RD3B 2FOBA 2XC4A 3SV6A 4ZKSU 1GL1A 4XBCA 3H7TA 1AWHB 4K1TA 1LPKB 3FZZA 3NXPA 2G00A 3RU4D 2RCEA 2KAIB 3SOSA 5EPYA 5A0AE 3UOUA 3QDZB 3T26A 1ID5H 7LPRA 1SSXA 2BD4A 1P8VC 1KXEA 1D3PB 2OBQA 3KNXA 4OGXA 4KTCA 3RXCA 4BANB 1KYNA 1OP2A 3RMMH 2QGRA 4Y8XA 3A85A 2XYAA 2Y5HA 1PQ8A 1C5SA 5EXNA 2CN0H 3S69A 4E7RG 7ESTE 1QBNA 1O2WA 4K1SA 1HIAB 3CENA 1Z1IA 4AB8A 1OYTH 1G9IE 3W95A 5CMXH 2FOCA 1WBGB 1K1JA 2A1DB 4O3UA 5EGMA 1ESBA 3SORA 1AVGH 5C2ZA 1DX5M 3D49H 3A7YA 1O2VA 2WPHS 3A87A 1E37B 3PO1C 2FS8A 1VITH 2GTBA 3BTEE 1O37A 3LKWA 2ASUB 1UK3A 1A3BH 1O2ZA 6ESTA 1GHZA 1A46H 1Q31A 2AIPA 1O2OA 3KQDA 3PV4A 1ELVA 4FUFA 1XUKA 4ZHLU 2ZU4A 1SB1H 5GCHG 1ARBA 2NWNA 4XE4A 5FX6A 1GVZA 2ZCKP 1FN6A 2O8TA 4NFFA 1TFXA 4XOJA 4B1TA 2F9PA 4ZHMU 6LPRA 1QB9A 2A4QA 2PHBA 5DP3A 3RXLA 3O8CA 1YCPM 2XXLA 3ITIA 4ASHA 4UD9H 1EOJA 1HNEE 1ZMJA 1A5IA 2OC1A 1QL9A 5FHTA 3UQOA 2NU1E 1ZTKA 1AUJA 4DG4A 4INKA 1UCYK 1ELCA 3AASA 2ZHFH 1MAXA 1N8OB 1GDQA 3MWIU 1H9HE 3M5LA 7GCHF 1HLTH 5GWZA 1EPTC 4A1VA 3BG4B 4NFEA 1C1TA 1WTGH 2SGPE 1O30A 3OYPA 3RXDA 2FLRH 2GDDA 3LDXH 2ZCLP 2FIRH 3BG8A 1UTPA 1HGTH 3BEIB 5CHAC 4WWYA 2QF3A 1C2FA 1GG6C 4BTTB 5DK1A 1XUFA 2QIQA 1QB1A 3LGVA 3BIVH 1LQEA 3SU1A 5EODA 3TH4H 1ZGIA 2R2WU 3IG6B 2VH6A 3LGWA 3P8OA 1FAKH 2ALVA 5K0HA 2P8OB 3S7KB 5IYTA 1WYKA 3SO3A 6CHAC 1XVMA 2EI7A 5EQRA 1VCPA 3S9BA 1GJ8B 1OWDA 1DXWA 2VVUA 1OWIA 1KDQB 2SNVA 1GJDB 3Q3XA 1O3DA 1VR1H 2SFAA 2RG3A 1OP0A 1ZHRA 2CHAC 2WPKS 4IS5A 1YGCH 4AB9A 1HJ8A 4DT7B 3ZYEA 4UFGH 2O8MA 4OS2A 3GYMA 2CXVA 1W12U 3GDSA 3BEFB 4MG3A 3RXFA 4BTUB 2VJ1A 1MZAA 2R0LA 1P05A 1ETSH 2BY5X 4O3TA 2FO9A 2BXTH 1O3AA 1EZXC 1MUEB 1XUGA 2F83A 1TRNA 1LQDB 1TONA 2FX6A 4GPGA 2JKHA 2QA9E 1NRNH 4DW2U 1BUIA 2TBSA 8GCHG 2A7HA 4D8NA 1O3CA 4IMQA 1JIRA 2JETC 1H8DH 1P3EA 1S81A 1LMWB 1GI3A 2FTMA 6GCHG 3H7OA 1T7CA 2ZHWH 3ELAH 1TGNA 3STIA 3K6YA 2ZI2H 1Q3XA 3NUMA 3A8DA 2FI3E 4I8KA 1SGPE 4JCNA 2AMPA 3UR6A 4U30A 1AB9C 1EB2A 2BDCA 3O8BA 1NU9A 1CE5A 1C1VH 3H5CB 3PYHA 4TWWA 1DWEH 3RXBA 4I31A 1O3KA 5ETXA 3NCLA 1O33A 2GMTB 3U1IB 5A0BA 3L33A 3M61U 1KLTA 3I78A 1EQ9A 3GCHB 1HUTH 1ABJH 1C1WH 1QJ7B 4ZKNU 5JB9S 3UPEA 4F4OC 5DP5A 4BXWA 1PPHE 3LGIA 2B0FA 3MMGA 4X6NA 5DP9A 1UCYE 3O8RA 1IHSH 1PYTC 1KXBA 3SJ9A 1BJUA 2A45B 1YP9A 3SV2H 3TK6A 1ELFA 1O39A 2QN5T 4NWLA 1S82A 2QXJA 1D4PB 8ESTE 1P2NA 3G01A 3IWMA 1Y3WA 4AGJA 3PLBA 4WH8A 1V2OT 1MMJN 1ETTH 3QN7A 1WU1A 2PV9B 2FI5E 2WPLS 1AE5A 2F9VA 1LVYA 1TOMH 4A1XA 2A4RA 1VCQA 1O34A 1OX1A 3MU0A 2XBWA 1H4WA 1J14A 1KXDA 1D6RA 1THPB 2VIOA 2TPIZ 1QA7A 1Z8RA 1TBQH 3E0PB 4AN7A 3E1XB 5FPSA 1TX6A 2PFEA 3PWBA 2PTNA 1GI6A 3ATLA 1HAYB 2HPQH 3ZVCA 2V6NA 4GLYA 5E0HA 1W0YH 3LH1A 4YLUA 3V13A 1ELBA 4X2XA 1EAIA 1CGJE 3ZZ8A 3SJIA 3SNCA 3SQEE 1BDAA 3L3TA 1ZSLA 2VGCB 1Y3UA 4ZMAH 1AFQC 1O3HA 1T8OA 4FUIA 2Y5GA 5C20A 3QWCH 1NM6A 4GCHG 3T29A 3TNSA 1A2CH 1AY6H 3F6UH 3RC5A 3M3SA 4YESB 1UK2A 1P0SH 1C5QA 2SGFE 5FBEA 2LPRA 1OSSA 1MTNB 2ULLA 1LKAA 1A1RA 3PM3A 2V0BA 1P2KA 4AX9H 1ZZZA 1F5KU 1GPZA 5FBIA 5FXLA 1J16A 1SBWA 2Q6DA 2FWWA 2HALA 1NESE 4X1NU 3SU5A 2BQ7B 2V3HH 1K1NA 2H5DA 4GUXA 3NKKA 4FU7A 2PR3A 4FU9A 1IQJA 1YLCA 1AI8H 4NA7A 1LHFH 2VIVA 2ZP0H 1SGEE 2C8WB 1MBMA 2J34A 4FUBA 1WQVH 1S5SA 3P17H 3B9FH 3RXAA 2XCNA 2A5IA 8KME2 1GI5A 1UHBA 2BDBA 1P2OA 3SUGA 3S7HB 3DHKH 2BDAA 4KELA 1MD8A 1SR5C 5JYIA 1NFXA 4K8BA 1C2EA 2IOTA 3GCNA 5DG6A 1EZSC 1K22H 3TJUA 1YPHE 2AMQA 4Y6DA 2R3YA 7KMEH 1RS0A 1TMUH 2ZTXA 1J8AA 1K1IA 1OOKB 3TU7H 3QLPH 2UUKB 2XC5A 1SLUB 1C5YB 3ESTA 1QBVH 1FY5A 1UMAH 2C4FH 2G5NA 3T2NA 2Y7XA 1GI0A 4TY7A 3SU6A 1P06A 2XWAA 4Q7ZA 4ZUHA 4JZEH 1P9UA 2WYJA 1AGJA 4BAHB 1NN6A 1PYTD 1BITA 2FP7B 1SGQE 1C5PA 2GCHG 1EJNA 1Z71A 4JZFH 1LHDH 1NC6A 2FOHA 1GBFA 1V2JT 1VITG 1FI8A 1TAWA 3URCA 2Z9LA 3AVZA 1S6HA 2UUFB 5EPNA 1HAOH 1SI5H 1HAVB 4RKOB 2BTCE 3LJJA 3AAUA 2CGAA 2CF8H 5BRRE 2Z9IA 1ZYOA 2G52A 3RXSA 4ISHH 1CA0B 2BY6X 1SQTA 1OKXA 2FOGA 2O8LA 2P3TB 4ABHA 1DY8A 3T27A 3VGCC 1TB6H 3A7WA 3UUZA 4K3JA 2GV7A 4NIXA 5HMAA 1RRKA 5LGOA 2WV5A 2ZNKH 2D2DA 3UWJH 3RMLH 2FS9A 2AMDA 3AW1A 3GCTF 1GJ4H 1Z7KA 2F9NA 3FAOA 1QRWA 1V2QT 1KXCA 3BN9A 1A0HB 1C5VA 2ANKH 4WXVA 5LPEA 1A0LA 1O5CB 1GBMA 1BHXB 3V3MA 5JDUB 2P8OC 1K1OA 3F9FA 3KGPA 2ZO3H 1LO6A 1JMOH 4XFQA 3R3GB 3MO3A 3T62A 1YBWA 2BX4A 5BPEA 3A86A 1F5LA 1FN8A 3RXOA 1TPOA 3L6PA 2BQWB 1SGNE 1X7AC 3RXJA 3ENSB 4AGKA 4BAOB 4NZLA 1P03A 1DITH 3RXTA 4Z0KA 4X0WU 2PWXA 3ZZCA 1EUFA 1O2KA 1HV7A 1ZTLA 3PWCA 1L1GA 4DIIH 4RSPA 2GZ8A 2Y5FA 2UUJB 3BTME 3A7XA 1UTMA 1O3FA 9LPRA 5EQSA 5A0CA 5TJXA 1RFNA 2ESTE 1TBRH 2BD3A 3OU0A 3CS7A 1G3DA 1W7GH 1BRBE 1NROH 1V2VT 3HK6B 3FFGA 3M5OA 2EEKA 1GCTB 3DFLA 1NFWA 3LOXA 1PPZA 4WJG2 1YPJH 4UFEH 5HXFA 1C1RA 1W10U 2VIPA 3TLOA 1HFDA 1K1MA 2BD2A 4MTBA 4CRAA 1UTOA 1RIWB 1QB6A 1V2PT 1MD7A 3HPTB 3E16B 1HXFH 3ODDA 1T8MA 4JZ1A 3VXEH 5FCKA 5JPMH 3RDZA 2SGAA 1G3EA 4AOQA 1QHRB 3MH5A 3QO6A 1TYNA 3BSQA 2FPZA 1DPOA 1V2NT 3C1KA 1H1BA 3UQVA 4JYTA 5JBBS 1BRAA 2A5AA 1MQ5A 3HK3B 3RXMA 2ZPQA 2FDAA 1FZZA 1B7XB 2A5KA 1F0SA 1TX8A 4HI3A 1EPTA 1BT7A 1P3CA 3E0NB 5E0GA 1E35B 2OINA 1UCYH 1IQKA 4E05H 1AUTC 5ESTE 1A5GH 4GHTA 3PLKA 2BD7A 2A7JA 2VIQA 1WOFA 1ACBE 2ODQA 1A7SA 2JH5D 3CS0A 2ZG0H 2OQ5A 4UFDH 5B6OA 1DE7H 4B73A 9ESTA 2C8ZB 5L30H 2WPIS 3ZVGA 3VPKA 2A32A 1MH0A 2OP9A 4I7YH 3QGNB 2ZFPH 3PMJA 4HZHA 1CBWB 4AORA 1ZPBA 1BOQA 1TNGA 5EOKA 1P11E 1PPBH 2G4UA 3Q77A 4THNH 3F9HA 1C1OA 1LHEH 3ODFA 4FUEA 2ZGXH 1A4WH 1C9TA 3LONA 1DM4B 1SOTA 2AIQA 3UIRA 3GY6A 3A7ZA 4Q7XA 4WY3A 3VB5A 1DFPA 2FM2A 1TBZH 2XC0A 5F03A 3U98H 1NO9H 2IPHA 1QGFA 1GI1A 4CHAB 1SGYE 1HPGA 7GCHG 3RM2H 1HJAC 3ZVBA 2OBOA 1V2ST 3T5FH 5F8TA 4M7GA 1F7ZA 1IAUA 2PLXA 2GT8A 1DVAH 4IC6A 3ZZ7A 2P95A 1G30B 1CSOE 1BBRH 3KQCA 2ZDLA 4CRFA 5FX5A 1UTQA 2BHGA 1CVWH 2H6MA 2G51A 3KQEA 3T28A 1TA6A 1HCGA 3BTFE 4OS5A 1GHXH 1MBQA 2ZFRH 2CF9H 2OLGA 4TPYA 1OP8A 1GDUA 3SV7A 5EXLA 4SGBE 1GJBB 1KXFA 3V0XA 3W94A 3S0NA 1C2LA 1XVOA 1D9IA 2GGVB 3ZV8A 1GHAF 3ZVAA 1HYLA 1Y5UT 3I77A 1XM1A 3PB1E 1VGCC 3A89A 4X2VA 2PGQB 1SGDE 4IC5A 3UOPA 1YPKH 3K2UA 3MU4A 4O97A 2W7UA 1GBLA 1AWFH 1B5GH 2ZU1A 8LPRA 2A4GA 1ZPZA 4LZ1H 1FY3A 2XBYA 3DD2H 1C5TA 4BXSA 1GBAA 3SNAA 1O5GH 4GAWA 1ARCA 1GL0E 5J4SA 2BD5A 4DIHH 4TWYA 3GCOA 1Y3YA 4X1RU 3LGUA 2FXRA 3NPSA 1O2SA 2BOKA 2AERH 5L2ZH 1HBTH 4ZXXH 2OQUA 1C2DA 1P12E 3RXGA 4AG1A 1NFUA 5CE1A 1L1JA 1MTUA 1O3EA 2A4OA 1G37A 1VJ9U 1CGHA 4Q2KA 3A8CA 1UTKA 4HTCH 2GVFA 5TCCA 4IN1A 1GHVH 2WYGA 3D65E 1F5RA 2DE8A 3BIUH 1F0TA 5DP6A 3UY9A 3ATKA 1O5DH 3F9GA 2ZU3A 1V2TT 2CJIA 1YC0A 1GJ9B 3P8GA 4NIYA 1WUNH 2H1UA 2QAAA 2WV4A 2YOLA 4YZUA 5GPIB 3U8RH 3FANA 3SGQE 1FY8E 2B8OH 3B23B 4Y0YE 3O8DA 3HKJB 1E34B 1DWCH 3LJOA 3P6ZB 1GMCF 3SN8A 4NG9H 5A09A 2ZDMA 2HNTF 2TGDA 1PJPA 3GDVA 3AAVA 2Y82A 2PKAA 1JXPA 3QZRA 1P04A 1QQ4A 4I8HA 1KSNA 1BBRK 1P10A 1TMTH 2GD4B 4Q7YA 3OSYA 4IBLH 4JMYA 1GGDB 4ABEA 1QL8A 1SPJA 4KTUA 2F9OA 3PTNA 4X2YA 1AVWA 1GBBA 2GCTB 1QRXA 1KTSB 4YLQH 4X8TH 5GXPA 3QX5H 3RXKA 2J95A 2UUYA 2RA0A 1O2UA 1S0QA 3SV8A 4ISOA 1UHBB 1HIAA 1ZHMA 5EG4A 3ZVFA 1UVPA 2ZDAH 4Y7BA 1XXFA 3A83A 4OGYA 3BTDE 1TGCA 1HAPH 4MNVA 1GBJA 3UREA 2CV3A 2THFB 1DUEA 3K65B 4CRBA 1BTUA 3GY4A 5EU8A 3LT3A 4CR9A 5C67A 1AFEH 1RJXB 1HRTH 1U6QA 1O32A 1PPFE 3RU4T 4MPUA 2O9QA 1FQ3A 1GI8B 2QXIA 2Z3EA 3HATH 1V2MT 1FY1A 1YF4A 3TJNA 3ZZ3A 4JZDH 1HB0B 1IOEA 1O2LA 2D1JA 1LVOA 4WMDA 4BAMB 1XX9A 1RTFB 3RXPA 4ZKOU 5PTPA 3S9AA 1XKAC 3SV9A 1C5WB 2WPJS 1F2SE 2J38A 3VB6A 1CHOF 3LGTA 1T8LA 1TGBA 5AFYH 3GY5A 3PROA 1AKSB 1ANDA 1L2EA 3TVJB 4WH6A 4OS6A 3ZZ4A 1GI4A 1DDJA 2OD3B 1GMDF 1YPMH 4JYUH 1OWEA 5HGGA 2H2ZA 2ZKSA 2NU2E 1RGQA 8GCHF 1O2PA 2FLBH 2UWLA 6GCHF 1NTPA 2IJOB 2PUXB 1MAYA 1FONA 1P2IA 2HPPH 2J94A 2ZECA 1Z6EA 1T4UH 2IN2A 2QY0B 3MFJA 1ZJDA 4CRDA 2FMJA 5I25A 3P95A 1O2JA 1KLIH 1OWHA 5T6GA 5GJ4B 1BBRE 1S84A 3V12A 2Z94A 1C5RA 1YLDA 1C2HA 4ISIH 2BZAA 4KKDA 1MKWK 2Y6TA 5HYOA 3UTUH 1QCPA 5I46H 1XXDA 1CBWC 2ZFQH 2ZGHA 5E8EH 4WXIA 5L2YH 4QT8C 4ABFA 3RM0H 3EDXB 2SNWA 1DLEA 3RC4A 1H9LB 2GKVE 2SGQE 4I33A 2STBE 4XBDA 3SJOA 5JB8S 1C5UA 1LCYA 1V3XA 4UDWH 1TOCB 2BDIA 4MPWA 4K69A 4D7FA 2RDLA 5AHGH 1W2KH 2PW8H 2VIWA 5A8YA 1GHWH 2VB0A 2VU8E 3GDUA 4Y8YA 1B0FA 3BF6H 1T32A 1ELTA 1ZPCA 1A61H 2Z3DA 2ZF0H 2BLWA 3GICB 1SHYA 3HGNA 3ZZ6A 2ILNA 3PO1B 3GCTG 1LPZB 1LHGH 1C2KA 3PLPA 2F3CE 1G3CA 1RXPA 5ABWA 3QTVH 2HGTH 1UO6A 3A84A 2ZGCA 3ZV9A 1O5BB 2PKSB 3KIDU 1HAZB 1S83A 1Y59T 3M7UA 2BB4A 1TNKA 3UR9A 4X1PU 2SGDE 1NFYA 2VWNA 3QK1A 2ZDVH 4PROA 1C1PA 2J9NA 3UNRA 1HJ9A 1QTFA 2TGTA 1CU1A 2VINA 1O3NA 2GV6A 1C2MA 4KGAA 3MTYA 1J9CH 1D6WA 1EAWA 4GCHF 1TLDA 1O2HA 4X8SH 4XSKU 1PQAA 1DT2A 3LIWA 2BOHB 1KY9A 1EAUA 1EPTB 3DA9B 1BMMH 1ZOMA 3LH3A 1O2TA 1GBEA 1TPSA 4H42U 4NSVA 5DP7A 3SU2A 3EA7A 3EA8A 3TNTA 2G81E 4HGCA 1NRPH 2G8TA 1N8OC 1OPHB 1GG6B 1KIGH 1LDTT 5F6MA 2PGBB 2BD9A 3ZVDA 3BG4C 3UFAA 1IQLA 1RTKA 1XMNB 1K28D 2Z3CA 2GT7A 5T6FA 2HOBA 1QBOA 1BQYA 1YPEH 1TWXB 2DUCA 4Q80A 1MU8B 3JZ2B 2Y7ZA 1K1LA 4FVBA 2P59A 5C5OA 1PPEE 2JH6D 4CBNA 3SNEA 1NRRH 3TJVA 1Z1JA 3MNSA 1Y8TA 4BOHA 3K9XB 3E6PH 2TRMA 1N6XA 1MCTA 1FXYA 1FY4A 2UWPA 1C5ZB 2Z9KA 2C8YB 1BZXE 4IMZA 4ABIA 3ZYDA 2CHAB 4I8LA 2SGEE 3TGJE 2PTCE 3QTOH 4X8UH 2TGPZ 4FUCA 1M9UA 3MO6A 4K8YA 4DGJA 1YM0A 4DOQA 2Q6GA 2PUQH 3K6ZA 3ZZBA 5LH8A 2FZZA 5E2OA 2GDEH 3SJ8A 3U69H 1SVPA 1EP6A 1AHTH 2XW9A 3RMOH 2R2MB 2EA3A 3BEUA 2BY8X 3EYDA 1BIOA 3MU8A 5AFZH 4AYVB 1NT1A 3FP7E 2ZA5A 5A8XA 2OTVA 1AD8H 1V2UT 4MDSA 2FX4A 2JETB 1SFIA 4CBOA 1CO7E 1A3EH 2C93B 3GOVB 3HKIB 4MPXA 3SU4A 2R0KA 1C5LH 1MTWA 2OXSA 2ZIQH 4AYYB 2I6QA 4X1QU 2STAE 3TK5A 3A8BA 1G3BA 1ZRBA 3JZ1B 3UNSA 1GJ5H 1LHCH 1QQUA 2ZEBA 1O2XA 3M37A 1C1NA 1SG8B 3ZZ9A 2ZU5A 1THSH 1AB9B 1V2LT 4YOGA 2QXHA 2Z7FE 1O3MA 3RXIA 1GJ7B 1AU8A 1ZSKA 1W11U 1ELAA 5HM2A 3MNXA 2F9UA 3SW2B 3PMBB 1CGIE 4NIWA 3DT0H 4K1EA 3DUXH 1TGTA 1DSTA 1NRSH 2ZHEH 1C5XB 3FP6E 3SHCH 1J17T 5H4IB 3VB4A 2RA3A 1CHGA 1CT2E 1LTOA 1GHBG 2H9EH 2C8XB 4LOYH 3TH3H 2GMTC 4UE7H 1ZJKA 1O3OA 1AZ8A 2QC2A 3GCHC 3MHWU 3EA9A 1L0ZA 2WUBA 3LU9B 2AH4X 4J2YB 1VZQH 1GJCB 1N6YA 3NZIA 1JIMA 1ANEA 1GBDA 3NWUA 3U1JB 2K1QA 1P57B 1O31A 4AFZA 2CMYA 2O8UA 3MNCA 1P2JA 1TNLA 3M36A 2GZ7A 4NZQA 1ETRH 4Y71A 2BZ6H 4KP0A 1SQAA 4AFQA 1DWBH 1ZGVA 3I29A 1KTTB 3OTJE 1FPHH 1SQOA 2J4IA 1RTLA 1Z8IB 4Z6AH 3KN2A 1FMGA 4XBBA 1HAVA 1O3JA 1EKBB 5DPAA 2VH0A 3F9EA 1NZQH 2ANWA 5T3HA 2BY9X 4O9VA 1IQEA 1C4U2 2LNCA 4YT6H 1L4DA 3GY7A 1Y5BT 2H5CA 2FODA 2HNTC 1J15A 1GHAG 1D3QB 1ESTA 1AFQB 1ZSJA 2H9HA 4ABAA 4XDEA 1OS8A 1OWKA 2ZDKA 1CT0E 4HFPB 1HAHH 3BV9B 3DFJA 4CRCA 3UNQA 2ANYA 1XUHA 1FPCH 1EASA 2HNTE 1FNIA 2ZTYA 1Y3XA 2AGEX 4YOIA 2BQ6B 1UTLM 3P70B 4X6OA 1BMAA 1L1NA 2FYRA 1CA8B 1H9IE 3LC3A 1GBKA 2GP9B 1FV9A 4ESTE 1GBIA 2VGCC 1O2QA 4X2WA 1WV7H 3VB3A 2PKAB 1AVXA 1BA8B 4FUJA 4Y8ZA 3N7OA 4BAQB 1MTNC 1C2IA 1NS3A 1GMHF 1O35A 3SBKA 1O5EH 5JBTA 4YOJA 1DUAA 3PMAB 3BTGE 1LVBA 1C5MD 2AFQB 1XUIA 1W8BH 1Z8GA 2ZQ1A 1B0EA 1V6DA 4B2CA 4UEHH 4NWKA 1T8NA 2R3UA 1UJ1A 2ZFTA 1MTVA 4NCYA 1ANCA 1C2GA 1E38B 1K21H 5C1XA 4A92A 1HAGE 3E90B 3ZVEA 3F68H 1E36B 4ZXYH 2VWLA 1PQ7A 4MQAA 1O2NA 4GVUA 4MPVA 3TJOA 2ZCHP 3SZNA 2FTLE 3A82A 4TY6A 1N1LA 1PPCE 2B9LA 1VJAU 4Y11E 3QZQA 1GMCG 3P8FA 4A6LA 1BTWA 1CQQA 1O5AB 1SGIB 2G55A 1O3IA 3ATMA 5EW2H 4WMFA 4ZAEA 1SL3A 5ESBA 2B5TB 2PKSC 3GYLB 5FCRA 4ABJA 1O2RA 2FI4E 3M35A 2WINI 2QCYA 5GDSH 2Z9GA 2P3UB 3LGYA 3ZZDA 1V2KT 1EZUC 2ZPSA 1PQ5A 5A8ZA 3OY6U 3ATIA 2AGGX 3A80A 4ABBA 1V2RT 1YKTA 3EAJA 4E06H 1BJVA 1O2MA 1TA2A 3PMHB 1NPMA 2F91A 1ABIH 3VGCB 4D9RA 4TYDA 3SGAE 5C5NA 2H9TH 1EX3A 1OYQA 2OC0A 4GSOA 4B71A 3MU1A 1D3DB 1O2YA 5E2PA 1DOJA 4ZKRU 1LKBA 2TIOA 1H8IH 3VXFH 1CA0C 1UVOA 1WAYB 4JYVH 4UFFH 5C1UA 1QIXB 1W3CA 3BTQE 2BLOA 1O3LA 3SUDA 4INLA 1VCWA 1BCUH 3VB7A 3KL6A 4JK5A 4I8GA 1EJAA 2QYIA 1FAXA 1EB1H 2FOAA 3QUMP 1HAXB 2EC9H 3SJKA 4B74A 3RUOA 2ODPA 3SQHE 5GCHF 2A2QH 1TX7A 2QXGA 3P92A 5F8ZA 4CR5A 3V7TA 3TITA 1HXEH 4D7GA 1GHYH 2F9BH 4NA8A 1MKWH 1CHOG 4IGDA 1F92A 3RXUA 1SLXB 2KAIA 3E91A 4CREA 5EQQA 2HRVA 5EW1H 1P02A 1DY9A 1ESAA 3E3TA 1EZQA 1GBCA 1MCVA 1ZHPA 1GMDG 4VGCB 4IN2A 3EQ0H 1C5OH 3D23A 1K2I1 3ZZ5A 4LZ4B 4X6MA 1JWTA 5DGJA 1QL7A 2WUCA 1P2QA 2BXUH 3A81A 4FXGH 4B75A 3GY8A 2GX4A 5AVDA 4A5TS 3U9AH 1P9SA 4RKJB 1Y3VA 3KQBA 4U2WA 1FJSA 1GCTC 1O38A 1O36A 1SGFA 4ZHAA 4B2AA 3SI4H 4LXBH 1TPPA 4JK6A 1AE8H 1O2GH 2UWOA 1RIWC 1UVSH 2YNAA 1C1QA 3MO9A 2OC7A 2TGAA 1BB0B 1C5NH 1C1UH 2ANMH 3RC6A 2V3OH 3BTHE 1BMNH 4D76A 3A88A 5DP8A 1GVLA 4KTSA 4IW4E 1DLKB 1TNHA 1C4V2 3A7TA 1TMBH 3RLWH 4X8VH 1UTJA 1QURH 4U01A 2NU3E 2C3SA 1LVMA 4TPIZ 1SGRE 4SGAE 3LC5A 1DANH 2P94A 4ABGA 4NIVA 4R8TB 3PTBA 1GVKB 4F49A 1BRCE 2ODYB 3MNBA 4CRGA 5SGAE 1GJ6A 4A7IB 1GBTA 2ZC9H 3MYWA 2ZZUH 4INHA 2EI6A 4DJZB 1T4VH 4FUDA 2VVVA 2Q1JA 3MU5A 2HVXA 1G2MA 1ANBA 1BMLA 3M3VA 3RXEA 1C1MA 2ZTZA 2FESH 1SLVB 3Q3YA 1SGTA 3BTTE 1SFQB 4CH2B 4WF8A 1HAIH 1W13U 4YO9A 2FOFA 4Y0ZE 1MQ6A 2P93A 2W3IA 1KDQA 1GI7B 1BTXA 4D9QA 2FOEA 2FYQA 5DO4H 1GBHA 2FEQH 2XWBI 1C1SA 4OS1A 1QFKH 2BD8A 2XBXA 1W14U 1THRH 3S9CA 1KXAA 1S0RA 3MH7A 4WVPE 3SU0A 1HJAB 1YYY1 1C4Y2 1P2MA 3MH4A 4B2BA 1DS2E 1K1PA 2BVSH 1V2WT 2NU4E 3SNBA 1MKXH 5HM9A 1EXFA 5E0JA 1W7XH 3GISB 2XRCA 1BTPA 1BHXF 4I8JA 3A7VA 4AG2A 1WCZA 2GZ9A 1TQ7B 4CHAC 2BLVA 3Q76A 2BDYA 1ELGA 4MNWA 2D26C 1OXGA 1O2IA 4U32A 1O3PB 2ALPA 4OS7A 2WPMS 4BAKB 5F8XA 3MH6A 1DWDH 3FVFB 1XUJA 3TPIZ 3UWIA 4J1YA 2W3KA 5FAHA 1O0DH 1MZDA 3KEEA 4MNXA 5FPYA 3SUEA 5J4QA 2PSXA 2D8WA 2J2UA 1JRTA 1YPHC 3D62A 1G32B 4R0IA 4ISNA 1VGCB 1OWJA 1BTZA 5DJ7A 1FIZA 2Z9JA 1MU6B 3P8NA 4CH8B 2ZGJA 1G2LA 1TABE 1Z8JB 2AYWA 3KHVA 3NK8A 3EGKH 1IQIA 1F0RA 1ELEE 4MVNA 4B76A 1ZTJA 1INCA 3IITA 2O8WA 1BTHH 1GJAB 1CT4E 3TIUA 2W5EA 2ZFFH 3RLYH 4AFSA 4ISLA 3U8TH 4FUHA 1YPGH 3ZZAA 4E7NA 1ZLRA 1K9OE 1O5FH 1JRSA 1WTHD 2AEIH 2BX3A 1A0JA 2ZQ2A 1DICA 4WMEA 5CHAB 2DE9A 4BNRA 1Z6JH 2QV1A 2P16A 1AZZA 3B8JA 3HGPA 1Y5AT 1QNJA 4JZIA 4Y7AA 4H4FA 1AO5A 4MNYA 1SMFE 1TNIA 1TPAE 3SUFA 2VWMA 1AKSA 3GY3A 4A1TA 4ZROA 2EI8A 4MLFB 1QJ1B 1AQ7A 4YTAA 2NU0E 1QJ6B 3WY8A 2ZHQH 3RXVA 4Y79A 1YPLH 4AZ2B
chains in the Genus database with same CATH superfamily
5T6DA 4DURA 3M7QA 6CHAB 1TRYA 3BTKE 4Y10E 2Q6FA 2BVRH 3U8OH 5IDKA 5G4BA 1FIWA 1D3TB 2BM2A 5C1YA 5FPTA 5AF9H 5K7RA 1A5HA 5A2MH 1UVTH 2R9PA 4H6TA 3M7TA 2BVXH 1NRQH 1BRUP 4AFUA 2A2XH 3RXRA 3MOCA 3BTWE 1L4ZA 1AIXH 4NSYA 2BDHA 4K2YA 4DVAU 3RP2A 5JBCS 3T25A 1WQSA 5DP4A 3SHAH 1IHTH 4ZH8A 1DSUA 3M5NA 1IQGA 1NY22 1UK4A 2VVCA 3OY5U 1MKXK 4X6PA 1SOZA 1SGFG 2BYAX 1FUJA 3KYGA 1ORFA 1S85A 4P02A 2PP6A 1AMHA 2G4TA 1ELDE 1XKBC 2ZDNA 2ZGBH 1PFXC 1P01A 4UONA 4I32A 4NA9H 3RU4E 1G36A 1JOUB 1YWUA 1UTNA 2Y80A 4K60A 3VEQB 4ACAA 1DXPA 1QRZA 4X1SU 4FVDA 1EOLA 2XTTB 1ZRKA 5GIBA 3GY2A 4K5ZA 2ZU2A 2GCHF 4NGAH 1YCPH 2Z6BD 5C0TA 3TGKE 3E8LA 2BLQA 1VITF 1GGDC 4BTIB 3TGIE 3SNDA 3Q00A 1EAXA 1GCDA 1BTYA 2GCTC 1SC8U 3URDA 1TNJA 4DY7B 2B7DH 2A0QB 1P09A 4FU8A 1PPGE 4VGCC 1FLEE 3R0FA 3F1SB 3ATWA 2K8IA 4DCDA 3VFEA 2XNIA 3QGJA 5LPFA 2JH0D 3C27B 1TE0A 3TK9A 5EXMA 2Y81A 1WSSH 3EE0B 3A8AA 3RMNH 2XBVA 2XOKD 1TQ0B 1LPGB 1TGSZ 4ABDA 5JBAS 1MTSA 2BMGB 3KCGH 3M3TA 3Q3KA 1C9PA 4GHQA 2AGIX 2OC8A 3AW0A 4H6SB 2HLCA 3RXQA 3GS9A 2VWOA 2YMSC 1ZMLA 1GMHG 2ZHDA 1S6FA 1IQFA 1TALA 3SGBE 1O3GA 2W26A 2C90B 1SLWB 4YM9A 2V35A 2HWLB 2OUAA 4FOUC 2FOMB 1TRMA 2L6OA 4LK4A 2AS9A 3SU3A 1GI9B 1HDTH 2VIDA 1F0UA 2KR7A 2XCFA 3RXHA 2G5VA 1GWAA 5L6NH 2YNBA 3WW7A 1QR3E 1T31A 2VNTA 4YT7H 2J92A 3MI4A 1GI2A 1UVUH 2P3FH 2JJ2D 2ZPRA 3PV5A 2OCVB 5DKMA 5C3NA 1GDNA 1EATA 1IQMA 5LPRA 3LPRA 3KF2A 1FDPA 2BDGA 1IQNA 1W0ZU 2W7SA 3STJA 1SHHB 1QY6A 1C2JA 1EJMA 1JBUH 1EP5A 2A31A 5HKKD 3FZDA 1NU7B 3OX7U 3CP7A 4OS4A 1AN1E 1SQRA 2ZWLH 3M5MA 1O3BA 1Q2WA 1QA0A 1TIOA 5TCAA 2M5TA 2I6SA 2PSYA 4RN6A 1ZMNA 2ZFSA 3SI3H 2QF0A 2BY7X 1KLJH 3FP8E 4FUGA 4Y76A 1ZR0A 1SGCA 1IQHA 2A7CA 4O03A 3TH2H 1GHBF 1YCPK 1E0FD 1RD3B 2FOBA 2XC4A 3SV6A 4ZKSU 1GL1A 4XBCA 3H7TA 1AWHB 4K1TA 1LPKB 3FZZA 3NXPA 2G00A 3RU4D 2RCEA 2KAIB 3SOSA 5EPYA 5A0AE 3UOUA 3QDZB 3T26A 1ID5H 7LPRA 1SSXA 2BD4A 1P8VC 4ACBA 1KXEA 1D3PB 2OBQA 3KNXA 4OGXA 4KTCA 3RXCA 4BANB 1KYNA 1OP2A 3RMMH 2QGRA 4Y8XA 3A85A 2XYAA 2Y5HA 2KZ4A 1PQ8A 1C5SA 5EXNA 2CN0H 3S69A 4E7RG 7ESTE 1QBNA 1O2WA 4K1SA 1HIAB 3CENA 1Z1IA 4AB8A 1OYTH 1G9IE 3W95A 2HLDD 5CMXH 2FOCA 1WBGB 1K1JA 2A1DB 4O3UA 5EGMA 1ESBA 3SORA 1AVGH 5C2ZA 1DX5M 3D49H 3A7YA 1O2VA 2WPHS 3A87A 3OTPA 5C17A 1E37B 3PO1C 3UAIC 2FS8A 1VITH 2GTBA 3BTEE 1O37A 3LKWA 2ASUB 1UK3A 1A3BH 1O2ZA 6ESTA 1GHZA 1A46H 1Q31A 2AIPA 1O2OA 3KQDA 3PV4A 3ZIAD 1ELVA 4FUFA 1XUKA 4ZHLU 2ZU4A 4Z1MD 1SB1H 3N7DA 5GCHG 1ARBA 2NWNA 4XE4A 5KGOA 5FX6A 1GVZA 2ZCKP 1FN6A 2O8TA 4NFFA 1TFXA 4XOJA 4B1TA 2F9PA 4ZHMU 6LPRA 1QB9A 2A4QA 2PHBA 5DP3A 3RXLA 3O8CA 1YCPM 2XXLA 3DCLA 3ITIA 4ASHA 1W0KD 4UD9H 1EOJA 1HNEE 1ZMJA 1A5IA 2OC1A 1QL9A 5FHTA 3UQOA 2NU1E 1ZTKA 1AUJA 4DG4A 2WHXA 4INKA 1UCYK 1ELCA 3AASA 2ZHFH 1MAXA 1N8OB 1GDQA 3MWIU 1H9HE 3M5LA 2YMSD 7GCHF 1HLTH 5GWZA 1EPTC 4A1VA 3BG4B 4NFEA 1C1TA 1WTGH 2SGPE 1O30A 3OYPA 3RXDA 2FLRH 5EIYA 2GDDA 3LDXH 2ZCLP 2FIRH 3BG8A 1UTPA 1HGTH 3BEIB 5CHAC 4WWYA 2QF3A 1C2FA 1GG6C 1WXRA 4BTTB 5DK1A 1XUFA 2QIQA 1QB1A 3LGVA 3BIVH 1LQEA 3SU1A 5EODA 3TH4H 1ZGIA 2R2WU 3IG6B 2VH6A 3LGWA 3P8OA 1FAKH 2ALVA 5K0HA 2P8OB 3S7KB 5IYTA 1WYKA 3SO3A 6CHAC 1XVMA 2EI7A 5EQRA 2F43B 4FETA 1VCPA 3S9BA 1GJ8B 1OWDA 1DXWA 2VVUA 1OWIA 1KDQB 2SNVA 1GJDB 3Q3XA 1O3DA 1VR1H 2SFAA 2RG3A 1OP0A 1ZHRA 2CHAC 2WPKS 4IS5A 1YGCH 4AB9A 1HJ8A 4DT7B 3ZYEA 4UFGH 2O8MA 4OS2A 3GYMA 2CXVA 1W12U 3GDSA 3BEFB 4MG3A 3RXFA 4BTUB 2VJ1A 1MZAA 2R0LA 1P05A 1ETSH 4F55A 2BY5X 4I86A 4O3TA 2FO9A 2BXTH 1O3AA 1EZXC 1MUEB 1XUGA 2F83A 5DSFA 1TRNA 1LQDB 1TONA 2FX6A 4GPGA 2JKHA 2QA9E 1NRNH 4DW2U 1BUIA 2TBSA 8GCHG 2A7HA 4D8NA 1O3CA 4IMQA 1JIRA 2JETC 1H8DH 1P3EA 1S81A 1LMWB 1GI3A 2FTMA 6GCHG 3H7OA 1T7CA 2ZHWH 3ELAH 1TGNA 3STIA 3K6YA 2ZI2H 1Q3XA 3NUMA 3A8DA 2XNDD 5KEDA 2FI3E 4I8KA 1SGPE 2IJD1 4JCNA 2AMPA 3UR6A 4U30A 1AB9C 1EB2A 2BDCA 1WDIA 3O8BA 1NU9A 1CE5A 1C1VH 3H5CB 3PYHA 4TWWA 1DWEH 3RXBA 4I31A 1O3KA 5ETXA 3NCLA 1O33A 2GMTB 3U1IB 5A0BA 3L33A 3M61U 1KLTA 3I78A 1EQ9A 3GCHB 1HUTH 1ABJH 1C1WH 1QJ7B 4ZKNU 5JB9S 3UPEA 4F4OC 5DP5A 4BXWA 1PPHE 3LGIA 2B0FA 3MMGA 4X6NA 5DP9A 1UCYE 3O8RA 1IHSH 1PYTC 1KXBA 3SJ9A 1BJUA 2A45B 1YP9A 3SV2H 3TK6A 1ELFA 1O39A 2QN5T 4NWLA 5HIZA 1S82A 2HVYB 2V7QD 2QXJA 1D4PB 8ESTE 1P2NA 3G01A 3IWMA 1Y3WA 4AGJA 5T1VA 3OFND 3PLBA 4WH8A 1V2OT 1MMJN 1ETTH 3QN7A 1WU1A 2PV9B 2FI5E 2WPLS 1AE5A 2F9VA 1LVYA 1TOMH 4A1XA 2A4RA 1VCQA 1O34A 1OX1A 3MU0A 2XBWA 1H4WA 1J14A 1KXDA 5C0UA 1D6RA 1THPB 1E1QD 2VIOA 2TPIZ 1QA7A 1Z8RA 1TBQH 3E0PB 4AN7A 3E1XB 5FPSA 1TX6A 2PFEA 3PWBA 2PTNA 3W1EA 1GI6A 3ATLA 1HAYB 2HPQH 3ZVCA 2V6NA 4GLYA 5E0HA 1W0YH 3LH1A 3OE7D 2WSSD 4YLUA 3V13A 1ELBA 4X2XA 1EAIA 3KQ5A 1CGJE 3ZZ8A 3SJIA 3SNCA 3SQEE 1BDAA 3L3TA 1ZSLA 2VGCB 1Y3UA 4ZMAH 1AFQC 1O3HA 1T8OA 4FUIA 3EE7A 1BMFD 2Y5GA 5C20A 3SYJA 3QWCH 1NM6A 4GCHG 3T29A 3TNSA 1A2CH 1AY6H 3F6UH 3RC5A 3M3SA 4YESB 1UK2A 1P0SH 1C5QA 4YXWD 2SGFE 5FBEA 2LPRA 1OSSA 1MTNB 2ULLA 1LKAA 1A1RA 3PM3A 2V0BA 1P2KA 4AX9H 1ZZZA 1F5KU 1GPZA 5FBIA 5FXLA 1J16A 1SBWA 2Q6DA 2FWWA 2HALA 1NESE 4X1NU 3SU5A 2BQ7B 2V3HH 1K1NA 2H5DA 4GUXA 3NKKA 4FU7A 2PR3A 4FU9A 1IQJA 1YLCA 1AI8H 4NA7A 1LHFH 2VIVA 2ZP0H 1SGEE 2C8WB 1MBMA 4XRNA 2J34A 4FUBA 1WQVH 2WV9A 1S5SA 3P17H 3B9FH 3RXAA 2XCNA 2A5IA 8KME2 1GI5A 1UHBA 2BDBA 1P2OA 3SUGA 3S7HB 3DHKH 2BDAA 4KELA 1MD8A 1SR5C 5JYIA 1NFXA 4K8BA 1C2EA 2IOTA 3GCNA 5DG6A 1EZSC 1K22H 3TJUA 1YPHE 2AMQA 4Y6DA 2R3YA 7KMEH 1RS0A 1TMUH 2ZTXA 1J8AA 1K1IA 1OOKB 3TU7H 3QLPH 2UUKB 2XC5A 1SLUB 1C5YB 3ESTA 1QBVH 1FY5A 1UMAH 2C4FH 2G5NA 3T2NA 2Y7XA 1GI0A 4TY7A 3SU6A 1P06A 2XWAA 4Q7ZA 4ZUHA 4JZEH 1P9UA 2J97A 2WYJA 1AGJA 4BAHB 1NN6A 1PYTD 1BITA 2FP7B 1SGQE 2WPDD 1C5PA 2EY4C 2GCHG 1EJNA 1Z71A 4JZFH 1LHDH 1NC6A 2FOHA 1GBFA 1V2JT 1VITG 1FI8A 1TAWA 3URCA 2Z9LA 3AVZA 1S6HA 2UUFB 5EPNA 1HAOH 2KCOA 1SI5H 1HAVB 4RKOB 2BTCE 3LJJA 3AAUA 2CGAA 2CF8H 5BRRE 2Z9IA 1ZYOA 2G52A 3RXSA 4ISHH 1CA0B 2BY6X 1SQTA 1OKXA 2FOGA 2O8LA 2P3TB 4ABHA 1DY8A 3T27A 3VGCC 1TB6H 3A7WA 3UUZA 4K3JA 2GV7A 4NIXA 5HMAA 1RRKA 5LGOA 2WV5A 2ZNKH 2D2DA 2J5UA 3UWJH 3RMLH 2FS9A 2AMDA 3AW1A 3GCTF 1GJ4H 1Z7KA 3DSGA 2F9NA 3VG8A 3FAOA 1QRWA 1V2QT 1KXCA 3BN9A 1A0HB 1C5VA 2ANKH 2QF4A 4WXVA 5LPEA 1A0LA 1O5CB 5EJZA 1GBMA 1BHXB 3V3MA 5JDUB 2P8OC 1K1OA 3F9FA 3KGPA 2EQNA 2ZO3H 4RT0A 1LO6A 1JMOH 4XFQA 3R3GB 3MO3A 3T62A 1YBWA 2BX4A 5BPEA 3A86A 1F5LA 1FN8A 3RXOA 1TPOA 3L6PA 5DN6D 2BQWB 1SGNE 1X7AC 3RXJA 3ENSB 4AGKA 4BAOB 4NZLA 1P03A 1DITH 3RXTA 4Z0KA 4X0WU 3FOAA 2PWXA 3ZZCA 1EUFA 1O2KA 2IPQX 1HV7A 1ZTLA 3PWCA 1E1RD 1L1GA 4DIIH 4RSPA 2GZ8A 1W0JD 2UUJB 2Y5FA 3BTME 3A7XA 1UTMA 1O3FA 9LPRA 5EQSA 5A0CA 5TJXA 1RFNA 2ESTE 1TBRH 2BD3A 3OU0A 3CS7A 1G3DA 1W7GH 1BRBE 1NROH 1V2VT 3HK6B 2W6JD 3FFGA 3M5OA 2EEKA 1GCTB 3DFLA 1NFWA 3LOXA 1PPZA 4WJG2 1YPJH 4UFEH 5HXFA 5EJLA 1C1RA 1W10U 2VIPA 3TLOA 1HFDA 1K1MA 2BD2A 4MTBA 4CRAA 1UTOA 1RIWB 1QB6A 1V2PT 1MD7A 3HPTB 3E16B 1HXFH 3ODDA 1T8MA 4JZ1A 3VXEH 5FCKA 3FKSD 5JPMH 3RDZA 2SGAA 1G3EA 4AOQA 1QHRB 3MH5A 3QO6A 1TYNA 3BSQA 2FPZA 1DPOA 1V2NT 3C1KA 1KMHB 1H1BA 3UQVA 4JYTA 5JBBS 1BRAA 2A5AA 1MQ5A 3HK3B 3RXMA 2ZPQA 2FDAA 1FZZA 1B7XB 2A5KA 1F0SA 1TX8A 4HI3A 1EPTA 1BT7A 1P3CA 3E0NB 5E0GA 1E35B 2GJGA 2OINA 1UCYH 1IQKA 4E05H 1AUTC 5ESTE 1A5GH 3F0PA 4GHTA 3PLKA 2BD7A 2A7JA 2VIQA 1WOFA 1ACBE 2ODQA 1A7SA 2JH5D 3CS0A 2ZG0H 2OQ5A 4UFDH 5B6OA 1DE7H 4B73A 9ESTA 4B6EA 2C8ZB 2JIZD 4OM9A 5L30H 2WPIS 3ZVGA 3VPKA 5EJ1A 2A32A 1MH0A 2OP9A 4I7YH 3QGNB 2ZFPH 3PMJA 4HZHA 1CBWB 4AORA 1ZPBA 1BOQA 4TT3D 2KFWA 1TNGA 5EOKA 1P11E 1PPBH 2G4UA 3Q77A 4THNH 3N99A 3F9HA 1C1OA 1LHEH 3ODFA 4FUEA 2ZGXH 1A4WH 1C9TA 3LONA 1DM4B 2OK5A 1SOTA 2AIQA 3FO8D 3UIRA 3GY6A 3U28C 3A7ZA 4Q7XA 4WY3A 3VB5A 1DFPA 2FM2A 1TBZH 1H8HD 2XC0A 5F03A 3U98H 1NO9H 2IPHA 1QGFA 1GI1A 4CHAB 1SGYE 1HPGA 7GCHG 3RM2H 1HJAC 3ZVBA 4AC9A 2OBOA 1V2ST 3T5FH 5F8TA 4M7GA 1F7ZA 1IAUA 2PLXA 2GT8A 1DVAH 4IC6A 3ZZ7A 2P95A 1G30B 1CSOE 1BBRH 3KQCA 2ZDLA 4CRFA 5FX5A 1UTQA 2BHGA 1CVWH 2H6MA 4TSFD 2G51A 3KQEA 3T28A 1TA6A 1NBMD 1HCGA 3BTFE 4OS5A 1GHXH 1MBQA 2ZFRH 2CF9H 2OLGA 4TPYA 2JDID 1OP8A 1GDUA 3SV7A 5EXLA 4SGBE 1GJBB 1KXFA 3V0XA 3W94A 3S0NA 1C2LA 1XVOA 1D9IA 2GGVB 3ZV8A 1GHAF 3ZVAA 1HYLA 1Y5UT 3I77A 1XM1A 3PB1E 1VGCC 3A89A 4X2VA 2PGQB 1SGDE 1YY3A 4IC5A 3UOPA 1YPKH 3K2UA 3MU4A 4O97A 2W7UA 1GBLA 1AWFH 1B5GH 2ZU1A 8LPRA 2A4GA 1ZPZA 4LZ1H 1FY3A 2XBYA 3DD2H 1C5TA 4BXSA 1GBAA 3SNAA 1O5GH 4GAWA 1ARCA 1GL0E 5J4SA 2BD5A 4DIHH 4TWYA 3GCOA 1Y3YA 4X1RU 3LGUA 5C94A 2FXRA 3NPSA 1O2SA 2BOKA 2AERH 5L2ZH 1HBTH 4ZXXH 2OQUA 1C2DA 1P12E 3RXGA 4AG1A 2LP6A 1NFUA 5CE1A 1L1JA 1MTUA 4HG6A 1O3EA 2A4OA 1G37A 1VJ9U 1CGHA 2KCAA 4Q2KA 3A8CA 1MABB 1UTKA 4HTCH 2GVFA 5TCCA 5HIYA 4IN1A 1GHVH 2WYGA 3D65E 1F5RA 2DE8A 3BIUH 1F0TA 5DP6A 3UY9A 3ATKA 1O5DH 3F9GA 2ZU3A 1V2TT 2CJIA 1YC0A 1GJ9B 3P8GA 4NIYA 1WUNH 2H1UA 2QAAA 2WV4A 2YOLA 4YZUA 5GPIB 3U8RH 3FANA 3SGQE 1FY8E 2B8OH 3B23B 3F2HA 4Y0YE 4Q63A 3O8DA 3HKJB 1E34B 1DWCH 3LJOA 3P6ZB 1GMCF 3SN8A 4NG9H 3PRBA 5A09A 1EFRD 2ZDMA 2HNTF 2TGDA 1PJPA 3GDVA 3AAVA 2Y82A 2PKAA 1JXPA 3QZRA 1P04A 1QQ4A 4I8HA 1KSNA 1BBRK 1P10A 1TMTH 2GD4B 4Q7YA 3OSYA 4IBLH 4JMYA 1GGDB 4ABEA 1QL8A 1SPJA 4KTUA 2F9OA 3PTNA 4X2YA 1AVWA 1GBBA 2GCTB 1QRXA 1KTSB 4YLQH 4X8TH 5GXPA 3QX5H 3F3BA 3RXKA 2J95A 4M9FA 2UUYA 2RA0A 1O2UA 1S0QA 3SV8A 4ISOA 1UHBB 1HIAA 1ZHMA 5EG4A 3ZVFA 1UVPA 2ZDAH 4Y7BA 1XXFA 3A83A 4OGYA 3BTDE 1TGCA 1HAPH 3UB0A 4MNVA 1GBJA 3UREA 2CV3A 2THFB 1DUEA 3K65B 4CRBA 1BTUA 3GY4A 5EU8A 3LT3A 4CR9A 5C67A 1AFEH 1RJXB 1HRTH 1U6QA 1O32A 1PPFE 3RU4T 4MPUA 4B6FA 2O9QA 1FQ3A 1GI8B 2QXIA 2Z3EA 3HATH 1V2MT 1FY1A 2KM0A 2YMSB 1YF4A 3TJNA 3ZZ3A 4JZDH 1HB0B 1IOEA 1O2LA 2D1JA 1LVOA 4WMDA 4BAMB 1XX9A 4RT1A 5CDFE 1RTFB 4ASUD 3RXPA 4ZKOU 5PTPA 3S9AA 5GNDA 1XKAC 3SV9A 1C5WB 2WPJS 1F2SE 2J38A 3VB6A 1CHOF 3LGTA 1T8LA 1TGBA 5AFYH 3GY5A 3PROA 1AKSB 1ANDA 1L2EA 3TVJB 4WH6A 4OS6A 5CHBA 3ZZ4A 3F0OA 1GI4A 1DDJA 2OD3B 2RDEA 1GMDF 1YPMH 4JYUH 1OWEA 5HGGA 2H2ZA 2ZKSA 2NU2E 1RGQA 8GCHF 1O2PA 2FLBH 2UWLA 6GCHF 1NTPA 2IJOB 2PUXB 1MAYA 1FONA 1P2IA 2HPPH 2J94A 2ZECA 1Z6EA 1T4UH 2IN2A 2QY0B 3MFJA 1ZJDA 4CRDA 2FMJA 5I25A 3P95A 1O2JA 1KLIH 1OWHA 5T6GA 5GJ4B 1BBRE 1S84A 3V12A 2Z94A 1C5RA 1YLDA 2F4LA 1C2HA 4ISIH 2BZAA 4KKDA 1MKWK 2Y6TA 4DT4A 5HYOA 3UTUH 1QCPA 5I46H 1XXDA 1CBWC 2ZFQH 2ZGHA 5E8EH 4WXIA 3N7EA 5L2YH 4QT8C 4ABFA 3RM0H 3EDXB 2SNWA 1DLEA 3RC4A 1H9LB 2GKVE 2SGQE 4I33A 2STBE 4XBDA 3SJOA 5JB8S 1C5UA 1LCYA 1V3XA 4UDWH 1TOCB 2BDIA 4MPWA 4K69A 4D7FA 2RDLA 5AHGH 3F2GA 1W2KH 2PW8H 2VIWA 5A8YA 1GHWH 2VB0A 2VU8E 3GDUA 4Y8YA 1B0FA 3BF6H 1T32A 3H09A 1ELTA 1ZPCA 1A61H 2Z3DA 2ZF0H 2BLWA 3GICB 1SHYA 3HGNA 3ZZ6A 2ILNA 3PO1B 3GCTG 5IK2D 1LPZB 3WWBA 1LHGH 1C2KA 3PLPA 2F3CE 1G3CA 1RXPA 3MQKC 5ABWA 3QTVH 2HGTH 1UO6A 3A84A 2ZGCA 3ZV9A 1O5BB 2PKSB 3KIDU 1HAZB 1S83A 1Y59T 3M7UA 2BB4A 1TNKA 3UR9A 3DSPA 4X1PU 2SGDE 1NFYA 2VWNA 3QK1A 2ZDVH 4PROA 1C1PA 2J9NA 3UNRA 1HJ9A 1QTFA 2TGTA 1CU1A 2VINA 1O3NA 2GV6A 1C2MA 2KCPA 4KGAA 3MTYA 1J9CH 1D6WA 1EAWA 2J98A 4GCHF 1TLDA 2QF5A 1O2HA 4X8SH 4XSKU 1PQAA 1DT2A 3LIWA 2BOHB 1KY9A 1EAUA 1EPTB 3DA9B 1BMMH 1ZOMA 3LH3A 1O2TA 1GBEA 1TPSA 4H42U 4NSVA 5DP7A 3SU2A 3EA7A 3EA8A 3TNTA 2G81E 4HGCA 1NRPH 2G8TA 1N8OC 1OPHB 1GG6B 1KIGH 1LDTT 5F6MA 2PGBB 2BD9A 3ZVDA 3BG4C 3UFAA 1IQLA 1RTKA 1XMNB 1K28D 2Z3CA 2GT7A 5T6FA 2HOBA 1QBOA 1BQYA 1YPEH 1TWXB 2DUCA 4Q80A 1MU8B 3JZ2B 2Y7ZA 1K1LA 4FVBA 2P59A 5C5OA 1PPEE 2JH6D 4CBNA 3SNEA 1NRRH 3TJVA 1Z1JA 3MNSA 1Y8TA 4BOHA 3K9XB 3E6PH 2TRMA 1N6XA 1MCTA 2CK3D 1FXYA 1FY4A 2UWPA 1C5ZB 2Z9KA 2C8YB 1BZXE 4IMZA 4ABIA 3ZYDA 2CHAB 4I8LA 2SGEE 3TGJE 2PTCE 3QTOH 4X8UH 2TGPZ 4FUCA 1M9UA 3MO6A 4K8YA 4DGJA 1YM0A 4DOQA 2Q6GA 2PUQH 3K6ZA 3ZZBA 5LH8A 2FZZA 5E2OA 2GDEH 3SJ8A 3U69H 1SVPA 1EP6A 1UW7A 3DSOA 1AHTH 2XW9A 3RMOH 2R2MB 2EA3A 3BEUA 2BY8X 3EYDA 1BIOA 3MU8A 5AFZH 4AYVB 1NT1A 3FP7E 2ZA5A 5A8XA 1AD8H 1V2UT 2OTVA 4MDSA 2FX4A 2JETB 1SFIA 4CBOA 2V3MA 1CO7E 1A3EH 2C93B 3GOVB 3HKIB 4MPXA 3SU4A 2R0KA 1C5LH 1MTWA 2OXSA 1NBME 2ZIQH 4AYYB 2I6QA 4X1QU 2STAE 3TK5A 3A8BA 1G3BA 1ZRBA 3JZ1B 3UNSA 1GJ5H 1LHCH 1QQUA 2ZEBA 1O2XA 3M37A 1C1NA 1SG8B 3ZZ9A 2ZU5A 1THSH 1AB9B 1V2LT 4YOGA 2QXHA 2Z7FE 1O3MA 2JJ1D 3RXIA 1GJ7B 1AU8A 1ZSKA 1W11U 1ELAA 1QZ8A 5HM2A 5FL7D 3MNXA 2F9UA 1FX0B 3SW2B 3PMBB 1CGIE 4NIWA 3DT0H 4K1EA 3DUXH 1TGTA 1DSTA 1NRSH 2ZHEH 1C5XB 3FP6E 3SHCH 1J17T 5H4IB 3VB4A 2RA3A 1CHGA 1CT2E 1LTOA 1GHBG 2H9EH 2C8XB 4LOYH 3TH3H 5KECA 2GMTC 4UE7H 1ZJKA 2L74A 1O3OA 1AZ8A 2QC2A 3GCHC 3MHWU 3EA9A 1L0ZA 2WUBA 3LU9B 2AH4X 4J2YB 1VZQH 1GJCB 1N6YA 3NZIA 1JIMA 1ANEA 1GBDA 3NWUA 3U1JB 2K1QA 1P57B 1O31A 4AFZA 2CMYA 2O8UA 3MNCA 1P2JA 1TNLA 3M36A 2GZ7A 4NZQA 1ETRH 4Y71A 2BZ6H 2KCYA 4KP0A 1SQAA 4AFQA 1DWBH 1ZGVA 3I29A 1KTTB 3OTJE 3OEHD 1FPHH 1SQOA 2J4IA 1RTLA 1Z8IB 4Z6AH 3KN2A 1FMGA 4XBBA 1HAVA 2RFKC 4ZCNA 1O3JA 1EKBB 5DPAA 2VH0A 3F9EA 1NZQH 2ANWA 5T3HA 1COWD 2BY9X 4O9VA 1IQEA 1C4U2 2LNCA 4YT6H 1OHHD 1L4DA 3GY7A 1Y5BT 2H5CA 2FODA 2HNTC 1J15A 1GHAG 1D3QB 1ESTA 1AFQB 1ZSJA 2H9HA 4ABAA 4XDEA 1OS8A 1OWKA 2ZDKA 1CT0E 4HFPB 1HAHH 3BV9B 3DFJA 4CRCA 3UNQA 2ANYA 1XUHA 1FPCH 1EASA 2HNTE 1FNIA 2AHME 2ZTYA 1Y3XA 2AGEX 4YOIA 2BQ6B 1UTLM 3P70B 4X6OA 1BMAA 1L1NA 2FYRA 1CA8B 1H9IE 3LC3A 3NRLA 1GBKA 2GP9B 1FV9A 4ESTE 1GBIA 2VGCC 1O2QA 3FN8A 4X2WA 1WV7H 3VB3A 2PKAB 1AVXA 1BA8B 4FUJA 4Y8ZA 3N7OA 4BAQB 1MTNC 3PV2A 1C2IA 1NS3A 1GMHF 1O35A 3SBKA 1O5EH 5JBTA 4YOJA 1DUAA 3PMAB 3BTGE 1LVBA 1C5MD 2AFQB 1XUIA 1W8BH 1Z8GA 2ZQ1A 1B0EA 1V6DA 4B2CA 4UEHH 4NWKA 1T8NA 4RI0A 2R3UA 1UJ1A 2ZFTA 1MTVA 4NCYA 1ANCA 1C2GA 1E38B 1K21H 5C1XA 4A92A 3CNRA 1HAGE 3E90B 3ZVEA 3F68H 1E36B 4ZXYH 2VWLA 1PQ7A 4MQAA 1O2NA 4GVUA 4MPVA 3TJOA 2ZCHP 3SZNA 2FTLE 3A82A 4TY6A 1N1LA 1PPCE 2B9LA 1VJAU 4P00A 4Y11E 3QZQA 1GMCG 3P8FA 4A6LA 1BTWA 1CQQA 1O5AB 3WWFA 1SGIB 2G55A 1O3IA 3ATMA 5EW2H 4WMFA 4ZAEA 1SL3A 1K0HA 1SKYE 5ESBA 2B5TB 2PKSC 3GYLB 5FCRA 4ABJA 1O2RA 2FI4E 3M35A 2WINI 2QCYA 5GDSH 2Z9GA 2P3UB 3LGYA 3ZZDA 1V2KT 1EZUC 2ZPSA 4XD7D 1PQ5A 5A8ZA 3OY6U 3ATIA 2AGGX 3A80A 4ABBA 1V2RT 1YKTA 3EAJA 4E06H 1BJVA 1O2MA 1TA2A 3PMHB 1NPMA 2F91A 1ABIH 3VGCB 4D9RA 2VBCA 4TYDA 3SGAE 5C5NA 2H9TH 1EX3A 1OYQA 2OC0A 4GSOA 4B71A 3MU1A 1D3DB 1O2YA 5E2PA 1DOJA 4ZKRU 1H8ED 1LKBA 2TIOA 1H8IH 3VXFH 1CA0C 1UVOA 1WAYB 4JYVH 4UFFH 5C1UA 1QIXB 1W3CA 3BTQE 2BLOA 1O3LA 3OAAD 3SUDA 4INLA 2LELA 1VCWA 1BCUH 3VB7A 3KL6A 4JK5A 4I8GA 1EJAA 2QYIA 4Q4LA 1FAXA 1EB1H 2FOAA 3QUMP 1HAXB 2EC9H 3SJKA 4B74A 3RUOA 2ODPA 3SQHE 5GCHF 2A2QH 1TX7A 2QXGA 3P92A 5F8ZA 4CR5A 2M2AA 3V7TA 3TITA 1HXEH 4D7GA 1GHYH 2F9BH 4NA8A 1MKWH 1CHOG 4IGDA 1F92A 3RXUA 1SLXB 2KAIA 3E91A 4CREA 3F2FA 5EQQA 2HRVA 5EW1H 1YLNA 1P02A 1DY9A 1ESAA 3E3TA 1EZQA 1GBCA 1MCVA 1ZHPA 1GMDG 2QE7D 4VGCB 4IN2A 3EQ0H 1C5OH 2K0QA 3D23A 1K2I1 3ZZ5A 4LZ4B 4X6MA 1JWTA 5DGJA 1QL7A 2WUCA 1P2QA 2BXUH 3A81A 4FXGH 4B75A 3GY8A 2GX4A 5AVDA 4A5TS 3U9AH 1P9SA 4RKJB 1Y3VA 3KQBA 4U2WA 1FJSA 1GCTC 1O38A 1O36A 1SGFA 4ZHAA 4B2AA 3SI4H 4LXBH 1TPPA 4JK6A 1AE8H 1O2GH 2UWOA 1RIWC 1UVSH 3OEED 2YNAA 1C1QA 3MO9A 2OC7A 2TGAA 1BB0B 1C5NH 1C1UH 2ANMH 3RC6A 2V3OH 3BTHE 1BMNH 4D76A 3A88A 5DP8A 1GVLA 4F48B 4KTSA 4IW4E 1DLKB 1TNHA 2J98B 1C4V2 3A7TA 1TMBH 3RLWH 4X8VH 1UTJA 1QURH 4U01A 2NU3E 2C3SA 1LVMA 4TPIZ 1SGRE 4SGAE 3LC5A 1DANH 2P94A 4ABGA 4NIVA 3KYFA 4R8TB 3PTBA 1GVKB 4F49A 3SZEA 1BRCE 2ODYB 3MNBA 4CRGA 5SGAE 1GJ6A 4A7IB 1GBTA 2ZC9H 3MYWA 2ZZUH 4INHA 2EI6A 4DJZB 1T4VH 4FUDA 2VVVA 2Q1JA 3MU5A 2HVXA 1G2MA 1ANBA 1BMLA 3M3VA 3RXEA 1C1MA 2ZTZA 2FESH 1SLVB 3Q3YA 1SGTA 3BTTE 1E79D 1SFQB 4CH2B 4WF8A 1HAIH 1W13U 4YO9A 2FOFA 2W6ID 4Y0ZE 1MQ6A 2P93A 2W3IA 5F53A 1KDQA 1GI7B 1BTXA 4D9QA 2FOEA 2FYQA 5DO4H 1GBHA 2FEQH 2XWBI 1C1SA 4OS1A 1QFKH 2BD8A 2XBXA 1W14U 1THRH 3S9CA 1KXAA 1S0RA 3MH7A 4WVPE 3SU0A 1HJAB 1YYY1 1C4Y2 1P2MA 3MH4A 4B2BA 1DS2E 1K1PA 2BVSH 1V2WT 2NU4E 3SNBA 1MKXH 5HM9A 1EXFA 5E0JA 1W7XH 3GISB 2XRCA 1BTPA 1BHXF 4I8JA 3A7VA 4AG2A 1WCZA 2GZ9A 1TQ7B 4CHAC 2BLVA 3Q76A 2BDYA 1ELGA 4MNWA 2D26C 1OXGA 1O2IA 4U32A 1O3PB 2ALPA 4OS7A 2WPMS 4BAKB 5F8XA 3MH6A 1DWDH 3AK5A 3FVFB 1XUJA 3TPIZ 3UWIA 4J1YA 2W3KA 5FAHA 1O0DH 1MZDA 3KEEA 4MNXA 5FPYA 3SUEA 5J4QA 2PSXA 2D8WA 2J2UA 1JRTA 1YPHC 3D62A 1G32B 1S6LA 4ISNA 4R0IA 1VGCB 1OWJA 1BTZA 5DJ7A 1FIZA 2Z9JA 1MU6B 3P8NA 4CH8B 2ZGJA 1G2LA 1TABE 1Z8JB 2AYWA 3KHVA 3NK8A 3EGKH 1IQIA 1F0RA 1ELEE 4MVNA 4B76A 1ZTJA 1INCA 3IITA 2O8WA 1BTHH 1GJAB 1CT4E 3TIUA 2W5EA 2ZFFH 3RLYH 4AFSA 4ISLA 3U8TH 4FUHA 1YPGH 3ZZAA 4E7NA 1ZLRA 1K9OE 1O5FH 1JRSA 1WTHD 2AEIH 2BX3A 5B6LA 1A0JA 2ZQ2A 1DICA 4WMEA 2KX4A 1VKYA 5CHAB 2DE9A 4BNRA 1Z6JH 2QV1A 2P16A 1AZZA 3B8JA 3HGPA 1Y5AT 1QNJA 4JZIA 4Y7AA 4H4FA 2WZQA 1AO5A 4MNYA 1SMFE 1TNIA 1TPAE 3SUFA 2VWMA 1AKSA 3GY3A 3PRDA 4ZROA 2EI8A 4A1TA 4MLFB 1QJ1B 1AQ7A 4YTAA 2NU0E 1QJ6B 3WY8A 2ZHQH 3RXVA 4Y79A 1YPLH 4AZ2B
chains in the Genus database with same CATH topology
5T6DA 4DURA 3M7QA 6CHAB 1TRYA 3BTKE 4Y10E 2Q6FA 2BVRH 3U8OH 5IDKA 5G4BA 1FIWA 1D3TB 2BM2A 5C1YA 5FPTA 5AF9H 5K7RA 1A5HA 5A2MH 1UVTH 2R9PA 4H6TA 3M7TA 2BVXH 1NRQH 1BRUP 4AFUA 2A2XH 3RXRA 3MOCA 3BTWE 1L4ZA 1AIXH 4NSYA 2BDHA 4K2YA 4DVAU 3RP2A 5JBCS 3T25A 1WQSA 5DP4A 3SHAH 1IHTH 4ZH8A 1DSUA 3M5NA 1IQGA 1NY22 1UK4A 2VVCA 3OY5U 1MKXK 4X6PA 1SOZA 1SGFG 2BYAX 1FUJA 1ORFA 1S85A 1AMHA 2G4TA 1ELDE 1XKBC 2ZDNA 2ZGBH 1PFXC 1P01A 4UONA 4I32A 4NA9H 3RU4E 1G36A 1JOUB 1UTNA 2Y80A 4K60A 3VEQB 1DXPA 1QRZA 4X1SU 4FVDA 1EOLA 2XTTB 1ZRKA 5GIBA 3GY2A 4K5ZA 2ZU2A 2GCHF 4NGAH 1YCPH 2Z6BD 3TGKE 3E8LA 2BLQA 1VITF 1GGDC 4BTIB 3TGIE 3SNDA 3Q00A 1EAXA 1GCDA 1BTYA 2GCTC 1SC8U 3URDA 1TNJA 4DY7B 2B7DH 2A0QB 1P09A 4FU8A 1PPGE 4VGCC 1FLEE 3R0FA 3F1SB 3ATWA 4DCDA 3VFEA 2XNIA 3QGJA 5LPFA 2JH0D 3C27B 1TE0A 3TK9A 5EXMA 2Y81A 1WSSH 3EE0B 3A8AA 3RMNH 2XBVA 1TQ0B 1LPGB 1TGSZ 4ABDA 5JBAS 1MTSA 2BMGB 3KCGH 3M3TA 3Q3KA 1C9PA 4GHQA 2AGIX 2OC8A 3AW0A 4H6SB 2HLCA 3RXQA 2VWOA 1ZMLA 1GMHG 2ZHDA 1S6FA 1IQFA 1TALA 3SGBE 1O3GA 2W26A 2C90B 1SLWB 4YM9A 2V35A 2HWLB 2OUAA 2FOMB 1TRMA 4LK4A 2AS9A 3SU3A 1GI9B 1HDTH 2VIDA 1F0UA 2XCFA 3RXHA 2G5VA 1GWAA 5L6NH 2YNBA 1QR3E 1T31A 2VNTA 4YT7H 2J92A 3MI4A 1GI2A 1UVUH 2P3FH 2ZPRA 2OCVB 5DKMA 5C3NA 1GDNA 1EATA 1IQMA 5LPRA 3LPRA 3KF2A 1FDPA 2BDGA 1IQNA 1W0ZU 2W7SA 3STJA 1SHHB 1QY6A 1C2JA 1EJMA 1JBUH 1EP5A 2A31A 3FZDA 1NU7B 3OX7U 3CP7A 4OS4A 1AN1E 2ZWLH 3M5MA 1O3BA 1Q2WA 1QA0A 1TIOA 5TCAA 2M5TA 2I6SA 2PSYA 4RN6A 1ZMNA 2ZFSA 3SI3H 2QF0A 2BY7X 1KLJH 3FP8E 4FUGA 4Y76A 1ZR0A 1SGCA 1IQHA 2A7CA 4O03A 3TH2H 1GHBF 1YCPK 1E0FD 1RD3B 2FOBA 2XC4A 3SV6A 4ZKSU 1GL1A 4XBCA 3H7TA 1AWHB 4K1TA 1LPKB 3FZZA 3NXPA 2G00A 3RU4D 2RCEA 2KAIB 3SOSA 5EPYA 5A0AE 3UOUA 3QDZB 3T26A 1ID5H 7LPRA 1SSXA 2BD4A 1P8VC 1KXEA 1D3PB 2OBQA 3KNXA 4OGXA 4KTCA 3RXCA 4BANB 1KYNA 1OP2A 3RMMH 2QGRA 4Y8XA 3A85A 2XYAA 2Y5HA 1PQ8A 1C5SA 5EXNA 2CN0H 3S69A 4E7RG 7ESTE 1QBNA 1O2WA 4K1SA 1HIAB 3CENA 1Z1IA 4AB8A 1OYTH 1G9IE 3W95A 5CMXH 2FOCA 1WBGB 1K1JA 2A1DB 4O3UA 5EGMA 1ESBA 3SORA 1AVGH 5C2ZA 1DX5M 3D49H 3A7YA 1O2VA 2WPHS 3A87A 1E37B 3PO1C 2FS8A 1VITH 2GTBA 3BTEE 1O37A 3LKWA 2ASUB 1UK3A 1A3BH 1O2ZA 6ESTA 1GHZA 1A46H 1Q31A 2AIPA 1O2OA 3KQDA 3PV4A 1ELVA 4FUFA 1XUKA 4ZHLU 2ZU4A 1SB1H 5GCHG 1ARBA 2NWNA 4XE4A 5FX6A 1GVZA 2ZCKP 1FN6A 2O8TA 4NFFA 1TFXA 4XOJA 4B1TA 2F9PA 4ZHMU 6LPRA 1QB9A 2A4QA 2PHBA 5DP3A 3RXLA 3O8CA 1YCPM 2XXLA 3ITIA 4ASHA 4UD9H 1EOJA 1HNEE 1ZMJA 1A5IA 2OC1A 1QL9A 5FHTA 3UQOA 2NU1E 1ZTKA 1AUJA 4DG4A 4INKA 1UCYK 1ELCA 3AASA 2ZHFH 1MAXA 1N8OB 1GDQA 3MWIU 1H9HE 3M5LA 7GCHF 1HLTH 5GWZA 1EPTC 4A1VA 3BG4B 4NFEA 1C1TA 1WTGH 2SGPE 1O30A 3OYPA 3RXDA 2FLRH 2GDDA 3LDXH 2ZCLP 2FIRH 3BG8A 1UTPA 1HGTH 3BEIB 5CHAC 4WWYA 2QF3A 1C2FA 1GG6C 4BTTB 5DK1A 1XUFA 2QIQA 1QB1A 3LGVA 3BIVH 1LQEA 3SU1A 5EODA 3TH4H 1ZGIA 2R2WU 3IG6B 2VH6A 3LGWA 3P8OA 1FAKH 2ALVA 5K0HA 2P8OB 3S7KB 5IYTA 1WYKA 3SO3A 6CHAC 1XVMA 2EI7A 5EQRA 1VCPA 3S9BA 1GJ8B 1OWDA 1DXWA 2VVUA 1OWIA 1KDQB 2SNVA 1GJDB 3Q3XA 1O3DA 1VR1H 2SFAA 2RG3A 1OP0A 1ZHRA 2CHAC 2WPKS 4IS5A 1YGCH 4AB9A 1HJ8A 4DT7B 3ZYEA 4UFGH 2O8MA 4OS2A 3GYMA 2CXVA 1W12U 3GDSA 3BEFB 4MG3A 3RXFA 4BTUB 2VJ1A 1MZAA 2R0LA 1P05A 1ETSH 2BY5X 4O3TA 2FO9A 2BXTH 1O3AA 1EZXC 1MUEB 1XUGA 2F83A 1TRNA 1LQDB 1TONA 2FX6A 4GPGA 2JKHA 2QA9E 1NRNH 4DW2U 1BUIA 2TBSA 8GCHG 2A7HA 4D8NA 1O3CA 4IMQA 1JIRA 2JETC 1H8DH 1P3EA 1S81A 1LMWB 1GI3A 2FTMA 6GCHG 3H7OA 1T7CA 2ZHWH 3ELAH 1TGNA 3STIA 3K6YA 2ZI2H 1Q3XA 3NUMA 3A8DA 2FI3E 4I8KA 1SGPE 4JCNA 2AMPA 3UR6A 4U30A 1AB9C 1EB2A 2BDCA 3O8BA 1NU9A 1CE5A 1C1VH 3H5CB 3PYHA 4TWWA 1DWEH 3RXBA 4I31A 1O3KA 5ETXA 3NCLA 1O33A 2GMTB 3U1IB 5A0BA 3L33A 3M61U 1KLTA 3I78A 1EQ9A 3GCHB 1HUTH 1ABJH 1C1WH 1QJ7B 4ZKNU 5JB9S 3UPEA 4F4OC 5DP5A 4BXWA 1PPHE 3LGIA 2B0FA 3MMGA 4X6NA 5DP9A 1UCYE 3O8RA 1IHSH 1PYTC 1KXBA 3SJ9A 1BJUA 2A45B 1YP9A 3SV2H 3TK6A 1ELFA 1O39A 2QN5T 4NWLA 1S82A 2QXJA 1D4PB 8ESTE 1P2NA 3G01A 3IWMA 1Y3WA 4AGJA 3PLBA 4WH8A 1V2OT 1MMJN 1ETTH 3QN7A 1WU1A 2PV9B 2FI5E 2WPLS 1AE5A 2F9VA 1LVYA 1TOMH 4A1XA 2A4RA 1VCQA 1O34A 1OX1A 3MU0A 2XBWA 1H4WA 1J14A 1KXDA 1D6RA 1THPB 2VIOA 2TPIZ 1QA7A 1Z8RA 1TBQH 3E0PB 4AN7A 3E1XB 5FPSA 1TX6A 2PFEA 3PWBA 2PTNA 1GI6A 3ATLA 1HAYB 2HPQH 3ZVCA 2V6NA 4GLYA 5E0HA 1W0YH 3LH1A 4YLUA 3V13A 1ELBA 4X2XA 1EAIA 1CGJE 3ZZ8A 3SJIA 3SNCA 3SQEE 1BDAA 3L3TA 1ZSLA 2VGCB 1Y3UA 4ZMAH 1AFQC 1O3HA 1T8OA 4FUIA 2Y5GA 5C20A 3QWCH 1NM6A 4GCHG 3T29A 3TNSA 1A2CH 1AY6H 3F6UH 3RC5A 3M3SA 4YESB 1UK2A 1P0SH 1C5QA 2SGFE 5FBEA 2LPRA 1OSSA 1MTNB 2ULLA 1LKAA 1A1RA 3PM3A 2V0BA 1P2KA 4AX9H 1ZZZA 1F5KU 1GPZA 5FBIA 5FXLA 1J16A 1SBWA 2Q6DA 2FWWA 2HALA 1NESE 4X1NU 3SU5A 2BQ7B 2V3HH 1K1NA 2H5DA 4GUXA 3NKKA 4FU7A 2PR3A 4FU9A 1IQJA 1YLCA 1AI8H 4NA7A 1LHFH 2VIVA 2ZP0H 1SGEE 2C8WB 1MBMA 2J34A 4FUBA 1WQVH 1S5SA 3P17H 3B9FH 3RXAA 2XCNA 2A5IA 8KME2 1GI5A 1UHBA 2BDBA 1P2OA 3SUGA 3S7HB 3DHKH 2BDAA 4KELA 1MD8A 1SR5C 5JYIA 1NFXA 4K8BA 1C2EA 2IOTA 3GCNA 5DG6A 1EZSC 1K22H 3TJUA 1YPHE 2AMQA 4Y6DA 2R3YA 7KMEH 1RS0A 1TMUH 2ZTXA 1J8AA 1K1IA 1OOKB 3TU7H 3QLPH 2UUKB 2XC5A 1SLUB 1C5YB 3ESTA 1QBVH 1FY5A 1UMAH 2C4FH 2G5NA 3T2NA 2Y7XA 1GI0A 4TY7A 3SU6A 1P06A 2XWAA 4Q7ZA 4ZUHA 4JZEH 1P9UA 2WYJA 1AGJA 4BAHB 1NN6A 1PYTD 1BITA 2FP7B 1SGQE 1C5PA 2GCHG 1EJNA 1Z71A 4JZFH 1LHDH 1NC6A 2FOHA 1GBFA 1V2JT 1VITG 1FI8A 1TAWA 3URCA 2Z9LA 3AVZA 1S6HA 2UUFB 5EPNA 1HAOH 1SI5H 1HAVB 4RKOB 2BTCE 3LJJA 3AAUA 2CGAA 2CF8H 5BRRE 2Z9IA 1ZYOA 2G52A 3RXSA 4ISHH 1CA0B 2BY6X 1SQTA 1OKXA 2FOGA 2O8LA 2P3TB 4ABHA 1DY8A 3T27A 3VGCC 1TB6H 3A7WA 3UUZA 4K3JA 2GV7A 4NIXA 5HMAA 1RRKA 5LGOA 2WV5A 2ZNKH 2D2DA 3UWJH 3RMLH 2FS9A 2AMDA 3AW1A 3GCTF 1GJ4H 1Z7KA 2F9NA 3FAOA 1QRWA 1V2QT 1KXCA 3BN9A 1A0HB 1C5VA 2ANKH 4WXVA 5LPEA 1A0LA 1O5CB 1GBMA 1BHXB 3V3MA 5JDUB 2P8OC 1K1OA 3F9FA 3KGPA 2ZO3H 1LO6A 1JMOH 4XFQA 3R3GB 3MO3A 3T62A 1YBWA 2BX4A 5BPEA 3A86A 1F5LA 1FN8A 3RXOA 1TPOA 3L6PA 2BQWB 1SGNE 1X7AC 3RXJA 3ENSB 4AGKA 4BAOB 4NZLA 1P03A 1DITH 3RXTA 4Z0KA 4X0WU 2PWXA 3ZZCA 1EUFA 1O2KA 1HV7A 1ZTLA 3PWCA 1L1GA 4DIIH 4RSPA 2GZ8A 2Y5FA 2UUJB 3BTME 3A7XA 1UTMA 1O3FA 9LPRA 5EQSA 5A0CA 5TJXA 1RFNA 2ESTE 1TBRH 2BD3A 3OU0A 3CS7A 1G3DA 1W7GH 1BRBE 1NROH 1V2VT 3HK6B 3FFGA 3M5OA 2EEKA 1GCTB 3DFLA 1NFWA 3LOXA 1PPZA 4WJG2 1YPJH 4UFEH 5HXFA 1C1RA 1W10U 2VIPA 3TLOA 1HFDA 1K1MA 2BD2A 4MTBA 4CRAA 1UTOA 1RIWB 1QB6A 1V2PT 1MD7A 3HPTB 3E16B 1HXFH 3ODDA 1T8MA 4JZ1A 3VXEH 5FCKA 5JPMH 3RDZA 2SGAA 1G3EA 4AOQA 1QHRB 3MH5A 3QO6A 1TYNA 3BSQA 2FPZA 1DPOA 1V2NT 3C1KA 1H1BA 3UQVA 4JYTA 5JBBS 1BRAA 2A5AA 1MQ5A 3HK3B 3RXMA 2ZPQA 2FDAA 1FZZA 1B7XB 2A5KA 1F0SA 1TX8A 4HI3A 1EPTA 1BT7A 1P3CA 3E0NB 5E0GA 1E35B 2OINA 1UCYH 1IQKA 4E05H 1AUTC 5ESTE 1A5GH 4GHTA 3PLKA 2BD7A 2A7JA 2VIQA 1WOFA 1ACBE 2ODQA 1A7SA 2JH5D 3CS0A 2ZG0H 2OQ5A 4UFDH 5B6OA 1DE7H 4B73A 9ESTA 2C8ZB 5L30H 2WPIS 3ZVGA 3VPKA 2A32A 1MH0A 2OP9A 4I7YH 3QGNB 2ZFPH 3PMJA 4HZHA 1CBWB 4AORA 1ZPBA 1BOQA 1TNGA 5EOKA 1P11E 1PPBH 2G4UA 3Q77A 4THNH 3F9HA 1C1OA 1LHEH 3ODFA 4FUEA 2ZGXH 1A4WH 1C9TA 3LONA 1DM4B 1SOTA 2AIQA 3UIRA 3GY6A 3A7ZA 4Q7XA 4WY3A 3VB5A 1DFPA 2FM2A 1TBZH 2XC0A 5F03A 3U98H 1NO9H 2IPHA 1QGFA 1GI1A 4CHAB 1SGYE 1HPGA 7GCHG 3RM2H 1HJAC 3ZVBA 2OBOA 1V2ST 3T5FH 5F8TA 4M7GA 1F7ZA 1IAUA 2PLXA 2GT8A 1DVAH 4IC6A 3ZZ7A 2P95A 1G30B 1CSOE 1BBRH 3KQCA 2ZDLA 4CRFA 5FX5A 1UTQA 2BHGA 1CVWH 2H6MA 2G51A 3KQEA 3T28A 1TA6A 1HCGA 3BTFE 4OS5A 1GHXH 1MBQA 2ZFRH 2CF9H 2OLGA 4TPYA 1OP8A 1GDUA 3SV7A 5EXLA 4SGBE 1GJBB 1KXFA 3V0XA 3W94A 3S0NA 1C2LA 1XVOA 1D9IA 2GGVB 3ZV8A 1GHAF 3ZVAA 1HYLA 1Y5UT 3I77A 1XM1A 3PB1E 1VGCC 3A89A 4X2VA 2PGQB 1SGDE 4IC5A 3UOPA 1YPKH 3K2UA 3MU4A 4O97A 2W7UA 1GBLA 1AWFH 1B5GH 2ZU1A 8LPRA 2A4GA 1ZPZA 4LZ1H 1FY3A 2XBYA 3DD2H 1C5TA 4BXSA 1GBAA 3SNAA 1O5GH 4GAWA 1ARCA 1GL0E 5J4SA 2BD5A 4DIHH 4TWYA 3GCOA 1Y3YA 4X1RU 3LGUA 2FXRA 3NPSA 1O2SA 2BOKA 2AERH 5L2ZH 1HBTH 4ZXXH 2OQUA 1C2DA 1P12E 3RXGA 4AG1A 1NFUA 5CE1A 1L1JA 1MTUA 1O3EA 2A4OA 1G37A 1VJ9U 1CGHA