3UWIA

Bovine trypsin variant x(tripleglu217phe227) in complex with small molecule inhibitor
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSETYNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSASSFIITSNMFCVGYLEGGKDACQGDSGGPVVCSGKLQGIVSWGEGCAQKNKPGFYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cationic trypsin
publication title Correlating structure and ligand affinity in drug discovery: a cautionary tale involving second shell residues.
pubmed doi rcsb
source organism Bos taurus
molecule tags Hydrolase/hydrolase inhibitor
total genus 54
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2011-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3uwiA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3uwiA02
1ELDE 1SB1H 3SO3A 1RJXB 1ZGIA 1MTUA 1QBNA 1VITF 2BY7X 1ZHRA 4YO9A 1GJ9B 1GBKA 4RSPA 4BAKB 1TALA 3MO6A 3F9GA 2H9HA 2AMPA 4WMEA 4NSVA 1QJ6B 1V2LT 7GCHF 1VGCC 2BLVA 3EGKH 3TH2H 1RTFB 1F5LA 2BQ6B 2BMGB 1A1RA 4XDEA 4B73A 3P8FA 1TBQH 3PO1B 5EQQA 1MKXK 1TBRH 3BTEE 2ZTYA 1K1JA 3M7QA 3SU1A 2CMYA 2HOBA 1C1TA 2BTCE 1GI8B 2F3CE 3QK1A 1FXYA 2ZNKH 1L2EA 3MNBA 2BVSH 1NFWA 3TK9A 2HPPH 4B74A 4J1YA 4CREA 3S7HB 1C2KA 1CHOG 4B2BA 1J17T 4XBDA 2GMTC 2Z6BD 4ISOA 1ANCA 1TRNA 2AS9A 1P2OA 2GT7A 2FM2A 3LGVA 2OC1A 1ETTH 3TNTA 1A2CH 1CA0B 5CHAB 3ODFA 2FOFA 3H5CB 3GOVB 4ISNA 1F0TA 1AFQB 4A92A 1TRYA 2YNBA 1BB0B 1EASA 3SZNA 1GI7B 2PKSC 3E8LA 4FUCA 2ZCHP 5FX6A 2WUBA 2A4GA 2WYGA 3O8RA 4Y8ZA 2BD9A 1VCPA 1ZTKA 1P2IA 4KTUA 2VWNA 4IBLH 2SFAA 1Y5BT 1HB0B 4CRFA 1C1RA 5EG4A 5JBCS 5FPTA 2PSYA 1RXPA 3EQ0H 5A8XA 1C9PA 1JIRA 1DDJA 1ELCA 3BTQE 3D65E 1V2ST 2PKAB 4BXWA 3KEEA 2GVFA 2BDBA 1LO6A 1GI9B 2Y5HA 3FFGA 1UK2A 2C3SA 2B0FA 3VB7A 2GZ7A 4ZMAH 1L1NA 3RXTA 4K1SA 1NRQH 1UVPA 1NFYA 2G55A 4MPXA 5CMXH 1V2MT 2CF9H 1XXFA 1OWDA 2UUYA 3AASA 1AI8H 1ANBA 3V0XA 1WU1A 1MKXH 1P0SH 1PPFE 3M5LA 2OC8A 4MNVA 3KGPA 6LPRA 2ZQ2A 4UFGH 1PQ7A 5JYIA 1D4PB 4CBNA 5C1XA 1C2GA 2Q1JA 2VIOA 2UUJB 3MOCA 4CR9A 4BTIB 5C20A 1GJDB 3S9BA 1O32A 3FANA 1MUEB 1LDTT 2FX6A 4ABEA 4E06H 3QZQA 3A8CA 2WPHS 3I29A 2FWWA 5C5NA 1UTPA 2VB0A 4ABIA 1O3LA 3NZIA 2M5TA 1SGNE 1FY1A 1LVYA 1T31A 1XUFA 1GVKB 1YGCH 3P70B 3MHWU 3V3MA 3MH5A 2JH6D 1LVMA 1EB1H 2QYIA 1GHZA 1SGCA 3GY6A 3TK5A 1UVSH 1FY5A 4FXGH 2GZ8A 2D26C 1VITH 6GCHF 4XFQA 1V2WT 1MD8A 5ESBA 4HZHA 4X1RU 3F9FA 1G37A 1N1LA 3KN2A 3A7ZA 5J4QA 3S7KB 1C1QA 1P03A 2A4QA 5FPSA 4B2CA 3OY5U 3CENA 3UOUA 2TIOA 3RXJA 2R0LA 2XWAA 1LPZB 2C8ZB 2OP9A 2ZFSA 1EAWA 2H6MA 3GY8A 1Z8GA 5C5OA 1O2YA 4QT8C 4Y10E 2Q6GA 1GHYH 1V2PT 2AMQA 3RXMA 2VINA 4AYYB 1T32A 3QGJA 5HGGA 1QURH 1A5IA 1TX8A 1THPB 2UUKB 3ZVEA 1AO5A 5GDSH 5B6OA 4U30A 1O2IA 3SUFA 2VGCC 3SI3H 1HFDA 1UK4A 3SJKA 1O36A 3I78A 1L4DA 2Y5GA 2O8UA 5EXLA 4AORA 1O5FH 1O2OA 2OBOA 1NU7B 3MMGA 4TY7A 1GJ8B 1XVOA 2ZU2A 4PROA 1Z8IB 3SNBA 1NM6A 3A8AA 3SU6A 5DJ7A 3P6ZB 2OC7A 1YPEH 2P3TB 3ZYEA 3RU4E 3F9HA 1HRTH 1Y8TA 5IDKA 1AZZA 4INKA 1BUIA 5GCHG 1WTGH 4TY6A 1GVZA 1VGCB 3A7XA 1O3KA 3S9AA 1ZGVA 1SQTA 4BANB 1KIGH 2EI7A 4O97A 2P94A 1V2NT 3L6PA 3MU0A 3ZVAA 4CRGA 1G3CA 2ZFPH 1QBOA 1QTFA 1KSNA 3ZZ5A 2HVXA 1SLUB 1WAYB 1T4VH 3ZYDA 1L1JA 4JZ1A 1AD8H 1DY9A 1D3PB 1F0SA 3RC6A 4F4OC 3RXEA 1OPHB 4KELA 3PMHB 2WV5A 1C5WB 1VITG 1YKTA 3HGPA 2FTMA 3FP6E 3UUZA 4GCHF 5EW1H 1FAKH 4THNH 1HXFH 1A5HA 5ABWA 1YF4A 4AOQA 3LGIA 1DLKB 1HDTH 1C5UA 1CVWH 1KLJH 2GMTB 4K8YA 1A0LA 1C2IA 1V2JT 2BXUH 3P17H 4NCYA 1QA0A 5E0HA 7GCHG 1YCPM 3TITA 1MTWA 3A8BA 3UNSA 1G32B 1AQ7A 1TPAE 1ZMNA 1BRBE 3Q3KA 1QL8A 3ZV9A 1LQEA 2FS8A 1GHBF 2FODA 2ZDMA 3TK6A 2PKSB 2QV1A 3MYWA 7ESTE 4FVDA 2AMDA 5F8ZA 1F0UA 6CHAC 2DE9A 1NO9H 4WVPE 1IQGA 1C2DA 4K3JA 1ZHMA 3UNQA 1FDPA 1N6XA 1O2VA 2FI5E 1TABE 2W26A 1FY3A 2I6QA 3PMAB 1C5RA 1CO7E 3SBKA 4K5ZA 1K28D 2XW9A 2ZPQA 4XE4A 3VPKA 3F68H 2FPZA 1HCGA 3RXQA 2ZGCA 1GJCB 4CH2B 1MKWK 1GDQA 1Y5UT 1EPTC 4I7YH 1TOMH 1SOZA 5A8ZA 1K1PA 3M3TA 1KY9A 4BAOB 4OS5A 1TPSA 2FDAA 5A2MH 2WYJA 1KLTA 1SGFG 1CT2E 1TGBA 4LXBH 1YC0A 3VEQB 2IPHA 1PQAA 1TX6A 1P12E 2R2MB 2VH0A 2PHBA 2FESH 3ZV8A 1C5LH 1ZRKA 1LHGH 3RXBA 5FBEA 3URDA 3PMJA 3CS7A 1BRAA 5JPMH 1C5PA 3DT0H 5LH8A 1H9LB 3Q76A 4YOIA 3U9AH 1EZUC 3RXUA 1NC6A 4DOQA 3A7VA 4MNYA 1BTUA 1AU8A 3FVFB 2BHGA 1C2JA 2H1UA 1ELTA 1QQ4A 3PM3A 1TFXA 1O3AA 1W2KH 2GGVB 3I77A 2ESTE 2QA9E 3ATMA 1QBVH 1U6QA 1EZQA 1LPGB 1MD7A 2C4FH 5FCRA 5GXPA 4NGAH 1HAIH 1MTSA 5AFYH 3GCNA 5DP6A 3DHKH 4NA7A 1GI0A 1OXGA 1W13U 2H5DA 2QXGA 2ZU3A 3FAOA 1AVWA 1A0HB 1O37A 2PTNA 2ZU5A 2QXJA 1O3EA 3KQDA 4X1PU 3SU4A 2ILNA 3Q00A 3SGBE 1JBUH 3E90B 1EKBB 2SGAA 3R0FA 3RDZA 2HPQH 2OLGA 3U69H 1W14U 4BAHB 4BTUB 1O3NA 5JDUB 2D1JA 2ZTXA 1EATA 2GP9B 1EJMA 2JH0D 2QF0A 2XWBI 3SQEE 4CR5A 3A81A 2VWOA 1MKWH 1TE0A 1QNJA 1O5DH 2YOLA 2HNTF 1CE5A 2ZTZA 5EXNA 2V3OH 2VGCB 1PYTC 2J38A 3ITIA 1HJ8A 1EPTA 1ORFA 2SGQE 1NU9A 2BXTH 1N6YA 3SHCH 1O31A 1KLIH 3LGUA 2G81E 1CT4E 1MBMA 3M3VA 1B0FA 2OQ5A 1W7XH 4WH8A 4UFFH 4HFPB 1IQHA 1LMWB 5ESTE 1NY22 1PPZA 3D23A 4YLQH 2ZHWH 2FMJA 2XCFA 1NS3A 1DXPA 1H1BA 3RXGA 1FLEE 1W11U 2J9NA 1OP8A 4ABJA 3P92A 3L33A 3RUOA 3BTWE 1TGNA 4MNWA 5A09A 1Y5AT 2BDCA 3SJ8A 1Y3XA 1THRH 3K6ZA 4O3TA 1MQ6A 4JMYA 1GMCF 1BOQA 2ZPSA 4B1TA 3K2UA 2R9PA 1BRUP 1GHAF 1WOFA 2G4TA 3P8OA 8LPRA 4LK4A 4KTCA 2A31A 3BTGE 1BTXA 3UIRA 3PWBA 1PPEE 1AMHA 1NRPH 1PPHE 3ZVDA 3JZ1B 2VWLA 1K22H 4ZKNU 1A5GH 1O39A 3QTVH 2KAIA 3P95A 1GMHF 4K8BA 1SLVB 2CXVA 1BMAA 3UFAA 1CHGA 4X8UH 3BEFB 4A1TA 2FYRA 1EAUA 4DURA 1ZR0A 4X8SH 2PSXA 1EP5A 2XNIA 1QB6A 3URCA 4A7IB 2PWXA 1NRNH 1GMDF 1W12U 6CHAB 3BSQA 4B2AA 3OU0A 2ULLA 2DE8A 4IN1A 1P3EA 4UFDH 8GCHG 5JBTA 1DVAH 1TNHA 1C2LA 4NIYA 2QC2A 4H6TA 4I8HA 3MU4A 3ZZAA 2FI4E 1RTKA 1SC8U 1BITA 1FY4A 2J4IA 4GCHG 3SJ9A 2BDGA 3RU4D 4NG9H 1GI4A 2BDAA 3KQBA 5I25A 4AG2A 3E6PH 2O8TA 2VIDA 1HJAC 4D9QA 4JK5A 1TMUH 3RP2A 1EPTB 3M36A 4DIIH 3A7WA 4Y8XA 2O9QA 4YOGA 3MI4A 1Z8RA 1OP2A 3TIUA 1TGTA 2XC0A 5EQRA 3BN9A 1NFXA 3ZZ7A 1GHBG 1C4Y2 5E0GA 3S9CA 2V0BA 1T8LA 1WQVH 4GPGA 3VXFH 1SGRE 3RMMH 3M5NA 2A7CA 1OWHA 2VH6A 2BY5X 4YLUA 4ZHAA 3ATIA 1XUHA 4D76A 1V2TT 4AYVB 1VJAU 1C2MA 1OKXA 3Q3XA 1TLDA 2FEQH 1GHVH 2Y81A 1XXDA 3HGNA 2HGTH 5DKMA 2BY8X 2R3YA 4CBOA 3C1KA 5FPYA 1O35A 2XRCA 3HPTB 2Z9LA 4D8NA 3ZZ8A 1C5YB 2QAAA 2WINI 3RXDA 1C2FA 3KQCA 3LJOA 1NPMA 1PQ5A 4BAMB 4WY3A 1O5EH 1O2QA 1TB6H 1W3CA 1DFPA 1Q3XA 1HNEE 2SNVA 4JYVH 1F92A 2H2ZA 1ZTLA 4DIHH 1G3EA 1NRRH 1ESBA 1SL3A 4O03A 3KCGH 3BTDE 1LVBA 2GV7A 3UR6A 2UWOA 1UVUH 1SFIA 1YM0A 5C1YA 1GVLA 1AWHB 2P59A 4NA9H 5LGOA 1O30A 5AHGH 2FOCA 2QY0B 1UTKA 2BYAX 1EAIA 3NUMA 3D62A 1O3BA 3NK8A 2FOHA 2KAIB 5H4IB 5DGJA 1PPGE 3F6UH 3MNSA 4AFUA 1F2SE 2W3IA 1ABIH 3ZVGA 4FUHA 5F8XA 2ZGJA 1JIMA 1O2XA 3E16B 1SG8B 1K1IA 1IQKA 1YBWA 2FXRA 3M35A 3VB6A 2XBVA 1WCZA 1OS8A 3PV4A 2VVUA 4E7NA 1T8NA 1DXWA 1TA6A 2AEIH 4FUGA 1AE8H 2FP7B 2OUAA 5EU8A 1QB1A 1GJAB 1SGDE 1WBGB 3RXCA 3BTHE 1MAXA 3U8RH 2VIPA 1DX5M 4MPUA 1P9UA 1O38A 2BM2A 2TBSA 3EDXB 2WPIS 3SV8A 1YYY1 1P2KA 2Y7ZA 4D7FA 2R2WU 2ZI2H 3KQEA 4GSOA 4DW2U 2A1DB 1O2ZA 4JCNA 3DUXH 3K6YA 1GI3A 2FX4A 2ZHFH 3LC5A 1ZSLA 2F9PA 1GL1A 3OYPA 4AGKA 1W7GH 1PQ8A 3RLWH 4ZH8A 1GG6C 2CHAC 1GDUA 3PLBA 1BJVA 2ZA5A 3BEIB 1AY6H 1E34B 1O3FA 2AIPA 4UDWH 1SHHB 1TA2A 1N8OC 2BQWB 3BTKE 3NWUA 2ODYB 2ZFRH 2UUFB 4ZUHA 1GJ7B 1EZSC 2BB4A 3GCTF 4X1SU 1HAZB 1OSSA 4UONA 3IG6B 5L30H 1G3DA 3CP7A 3G01A 7KMEH 2ZC9H 2BX3A 1H8IH 3LIWA 2GCHF 1S0RA 2BOKA 1FUJA 3FP7E 2VIVA 4WJG2 1SHYA 1ANDA 5L2ZH 2FLBH 4OS2A 1G3BA 1TYNA 1IAUA 1SI5H 2Y80A 4WF8A 3SUGA 1PFXC 4YESB 2A0QB 3S0NA 4Y79A 4YT6H 4CHAC 3BG4C 4A1XA 2G4UA 1EJAA 1BMMH 1MU6B 4FUFA 2D8WA 1KDQA 3U1JB 1O2LA 1JMOH 1NESE 1S85A 5DP9A 4J2YB 1GMCG 5HYOA 5E2OA 1O5GH 4ABBA 5FCKA 1HLTH 1MMJN 5HXFA 1GHAG 5DO4H 1O3IA 4NA8A 3T28A 2F91A 5HMAA 1L0ZA 2TGTA 3H7TA 2AFQB 4X6OA 3A87A 3RXAA 1SMFE 1EOLA 1WV7H 2TPIZ 1O2KA 1HJAB 4ZROA 1O5AB 1C5XB 3SJIA 1UTNA 3LC3A 3TGIE 3A82A 1BTYA 2WPLS 1GMHG 1HV7A 5C67A 4M7GA 1RTLA 5EQSA 1DPOA 2AGEX 4I8JA 3PTBA 2RA3A 4R8TB 5GJ4B 1S84A 2BLOA 3V12A 3GY7A 3ZZBA 2AGIX 1GBCA 3ZVFA 1P05A 2B8OH 5C1UA 4FU9A 1BTPA 4U01A 1P06A 3HK3B 1HAXB 3QX5H 4JYTA 3E91A 1NRSH 1S82A 1BJUA 1B7XB 1TNIA 4R0IA 2ZHDA 2VWMA 4DCDA 2D2DA 2JKHA 3FP8E 1OWIA 4Y0ZE 1BTWA 2K1QA 2Y7XA 3GICB 3LH3A 1VR1H 1P57B 5K7RA 1BHXF 4X2XA 1LHDH 1Z1JA 2EI6A 4IMQA 1K9OE 1ELFA 2FOAA 2P16A 4ABFA 2NU2E 2XC4A 1A3BH 2P93A 1M9UA 1BMLA 1CBWC 1C5VA 2NU0E 3UR9A 2BY6X 2BX4A 1TAWA 3LOXA 1DOJA 4Z6AH 3NPSA 4WXIA 3UTUH 1EZXC 2HNTC 2BD8A 1DWEH 3RXVA 1F7ZA 1YPHC 1T8MA 3LT3A 4ESTE 1P02A 1D6RA 1INCA 1PYTD 2F9OA 2ZKSA 4K69A 4Q2KA 2ZCLP 2NU3E 2SGPE 2DUCA 1C5QA 4Q80A 1SGEE 3SUDA 1GGDC 5BRRE 3A83A 5EPYA 3W94A 4MVNA 3RXRA 4X1QU 2R3UA 3RLYH 4BAQB 1KDQB 1FJSA 1BTHH 1D6WA 2AYWA 1SQOA 3UREA 1TQ0B 3ATLA 1H9IE 2STAE 3CS0A 3LGWA 1G2LA 3B23B 1BMNH 5A8YA 4Z0KA 1FPHH 2BVXH 2V3HH 3SGQE 3MU5A 1KYNA 2Z3CA 1KTTB 1A7SA 3M61U 2FOMB 3BV9B 5LPFA 2BDHA 1G9IE 2YNAA 1DSTA 4XSKU 2ALVA 1C4U2 1AUTC 1CU1A 2GX4A 3AVZA 2ZDVH 4K2YA 3HKIB 1V3XA 1BHXB 3RXKA 1L4ZA 1AGJA 1GBIA 1FMGA 1NZQH 2RCEA 2PR3A 2BD5A 4ZKRU 3KNXA 3ZZ6A 1Z6EA 2FOBA 1LQDB 1S6HA 4U2WA 3U8TH 5L2YH 3ZVBA 2PGBB 3ZVCA 1S81A 4GHQA 1WTHD 4DJZB 2ZFTA 2ZFFH 3DFLA 1V2RT 2VNTA 1Y3WA 2A2XH 1GG6B 2PTCE 4VGCC 2CHAB 3VXEH 5DP3A 4O9VA 1ELEE 1N8OB 3RM0H 3F1SB 2STBE 2F9VA 4ZHMU 4X2YA 5LPEA 1QRXA 3VGCC 2HNTE 4D7GA 3ZZ4A 5GPIB 5BPEA 4JZEH 1O2NA 1GCTC 1AHTH 2QCYA 1C5MD 3DFJA 4Y76A 1YPKH 4E05H 1AVGH 1CGHA 2UWLA 4Q7YA 1GI6A 4X8VH 1VJ9U 1WYKA 3E3TA 5J4SA 1C2HA 5C2ZA 1QQUA 2G52A 1MTNC 3NCLA 1ZMLA 1ZTJA 4F49A 3A84A 4B75A 4NFFA 1XMNB 2Y5FA 3LPRA 3V7TA 4CHAB 2JETC 1GI5A 3BG4B 1BQYA 3RXFA 1QRWA 1VCWA 1ZYOA 1AB9C 1ZJKA 1FAXA 1DSUA 4X6PA 4Y8YA 1LHFH 4NWLA 1TOCB 1RIWC 1TMTH 3PB1E 1ELAA 1GBJA 3GCTG 1YPMH 1ZOMA 1V6DA 2ZU1A 5CE1A 2SNWA 6GCHG 1IOEA 3MNCA 2W5EA 4ABAA 2AH4X 5JB8S 3T27A 1HAYB 4NIWA 4CRCA 1KXBA 2XBWA 1ELVA 1OP0A 4X2VA 3B9FH 3SUEA 4ZKSU 1S6FA 4TWYA 2CN0H 1Y59T 3ATWA 3PWCA 1GWAA 1IQJA 4DGJA 1AKSA 1K1MA 2LNCA 2ZDAH 3RXOA 2PGQB 3AAVA 1CT0E 1BDAA 2RG3A 1C5ZB 2Z9GA 1LHEH 1PJPA 1ZMJA 3UPEA 1BZXE 1SGPE 1SGQE 3T29A 4CRAA 1T8OA 1OWEA 3O8CA 1Z7KA 5DP7A 3SNEA 3LKWA 1H4WA 1TPPA 4AFZA 1O34A 1C1VH 2F9NA 1TQ7B 2JH5D 3Q77A 1ELBA 2VVVA 3RMLH 2OBQA 4HI3A 4MQAA 4XBBA 3E1XB 4NIVA 1TPOA 1TWXB 1IHTH 1AUJA 1Y3UA 1O3HA 2OINA 3VB3A 3SU2A 4AN7A 3SHAH 3T25A 2A5KA 2RA0A 4WMDA 2ALPA 1LKAA 5E2PA 1F5KU 1CBWB 2AIQA 1OWJA 3BTTE 4CH8B 1HPGA 2FOEA 5EGMA 3KF2A 2Z9KA 2Y6TA 3T2NA 1ZPBA 1O5CB 3B8JA 1DM4B 2NU1E 1EJNA 2ZDLA 1CSOE 2EI8A 5T3HA 2W7SA 1XVMA 8KME2 3AW0A 4KTSA 2ZO3H 3ZZDA 5A0CA 3MH7A 5T6DA 3LU9B 1ANEA 1KXFA 4XBCA 1JWTA 1BTZA 2XYAA 4K1EA 1DY8A 1BBRH 2BY9X 2ZU4A 4FUEA 4ISLA 2J95A 1O2PA 4MNXA 1CGJE 3SU0A 3S69A 1MU8B 3MFJA 1GGDB 1TNGA 1P2MA 4ISIH 2O8LA 2Z94A 3TH4H 2F9UA 1HAOH 3OSYA 3UY9A 4WMFA 1VZQH 1FN6A 4HGCA 1KXDA 1D9IA 1P2QA 2XXLA 3M5MA 1MBQA 1RFNA 3RMOH 4NSYA 3H7OA 4MLFB 4U32A 1AE5A 5AF9H 2TGPZ 3VB4A 2AERH 1TNJA 2ZHQH 1O2HA 1UVTH 2VIQA 3N7OA 1UVOA 2ZECA 4FUBA 3E0NB 4ZAEA 3MH6A 4TPIZ 1FPCH 2Y82A 1O2JA 4SGAE 2CGAA 1QB9A 4H6SB 4IGDA 1AKSB 1Z1IA 4BXSA 1LCYA 2C8XB 3F9EA 3UQOA 1NROH 2A4RA 2BD3A 2F83A 2OXSA 1TX7A 2J94A 1X7AC 2G00A 5EXMA 1YPJH 2QN5T 2FO9A 2CV3A 5DPAA 1ELGA 1FV9A 3P8NA 2PLXA 2ANKH 2H9EH 3EE0B 3E0PB 3U98H 3QZRA 1GPZA 1D3DB 1HBTH 2WPJS 3KHVA 2ANYA 5HM2A 4VGCB 4OS1A 1SGFA 2ZF0H 1GCDA 1GL0E 4H4FA 1ZSJA 1UTOA 1DE7H 3GY5A 2AGGX 1E37B 3MH4A 9ESTA 4YOJA 1ZSKA 2FS9A 4LOYH 4X0WU 3VGCB 4Y7AA 3QTOH 1O2WA 1FONA 1B5GH 1EX3A 4A5TS 4IMZA 1C5TA 3LONA 1J9CH 1GCTB 1UCYK 1GBAA 3UQVA 1GI1A 1NTPA 3A7YA 2QGRA 3SV9A 3K65B 2FLRH 4BNRA 4ZHLU 5JBAS 5PTPA 4AGJA 3UNRA 4INLA 4FUDA 1G30B 1KXAA 3SW2B 3TPIZ 1C5NH 1L1GA 1MTNB 2XCNA 3A7TA 1J16A 3RC4A 1DWCH 1UHBA 3EA8A 4AB9A 3RU4T 5TCAA 2OC0A 2ODQA 3MWIU 2Z9IA 4ABDA 2HLCA 2JETB 3M7TA 3GCOA 1SOTA 1UMAH 1TRMA 1AB9B 2BD2A 1DUAA 2ZGHA 3A89A 4JK6A 3EA7A 1E36B 1RIWB 1SLWB 2GV6A 3DA9B 4NIXA 2P3UB 3BEUA 1HAVA 2PV9B 3NXPA 1WUNH 2EEKA 1C9TA 2WUCA 3SORA 1D3TB 2BOHB 4ISHH 1DWDH 8ESTE 5GWZA 1GBLA 1TMBH 2TGAA 1P09A 5I46H 3ELAH 5L6NH 3TLOA 1W0ZU 1F0RA 1QHRB 2ZEBA 4FUIA 1UTLM 1O5BB 2GCTC 3A86A 5C3NA 1C1WH 2G5NA 3D49H 1GBMA 1E38B 4Y0YE 3SV6A 1NN6A 2ZGBH 3RXLA 3EYDA 4K60A 4AZ2B 4MDSA 2CF8H 1YLCA 4X8TH 1NFUA 1K21H 1O3JA 1DS2E 3QWCH 1RS0A 2UWPA 1HIAA 2OD3B 5FAHA 4OS4A 4UE7H 3O8DA 3BG8A 3A88A 2VU8E 1W0YH 1EP6A 3A8DA 3SOSA 1EOJA 2ZP0H 4CRDA 4AX9H 1C4V2 1ZPCA 2PFEA 1H9HE 5FX5A 5FHTA 1OYTH 1UCYH 1FQ3A 1XX9A 2BVRH 1T7CA 5JBBS 5T6FA 2ZDKA 1QA7A 4O3UA 3OTJE 5FXLA 1QRZA 3QO6A 1XUKA 4RKJB 2ZWLH 4ASHA 1AN1E 1H8DH 1GBTA 1FZZA 1QJ1B 2BZ6H 3DD2H 2QIQA 2Z7FE 4ZKOU 1MCVA 4RN6A 2V35A 2QF3A 2HRVA 3Q3YA 1QJ7B 2P95A 2P8OC 3QN7A 1ARCA 3GCHC 3PLPA 3SU5A 1P8VC 4ABGA 4MG3A 4LZ1H 1GJ5H 2SGDE 4I32A 1TNKA 2THFB 1BA8B 1EXFA 4IS5A 2GZ9A 1Q31A 3OY6U 4MPWA 2Q6FA 2A5AA 2WPKS 1D3QB 3MTYA 1Q2WA 3MNXA 5EW2H 2ZCKP 4GLYA 2C93B 1O2RA 4YZUA 1UHBB 1IQMA 1QFKH 3QUMP 3RMNH 2ANWA 5DG6A 3L3TA 2RDLA 3GY2A 1C1UH 3JZ2B 2HALA 2BLWA 2PUXB 1MZDA 5LPRA 4OGYA 3MU8A 3BTME 3M37A 4AFSA 5JB9S 1SFQB 3ZZ9A 3LH1A 1JRTA 1ABJH 1O3CA 1O0DH 1P04A 2J34A 4CRBA 9LPRA 2EA3A 2IN2A 1HAVB 3PTNA 1SLXB 1GI2A 1OX1A 1JXPA 1MQ5A 1MAYA 3MO9A 1C1MA 1UO6A 3ATKA 1V2OT 1AWFH 2BQ7B 1KXCA 1O3GA 2B7DH 2ZQ1A 3LDXH 2A7HA 1DICA 3QDZB 3PLKA 4HTCH 1GMDG 5TCCA 1XM1A 1BT7A 2A4OA 1GHWH 1IHSH 4H42U 4FUJA 2FIRH 3K9XB 3R3GB 2BZAA 3SGAE 3T5FH 2SGEE 5ETXA 2GDEH 1V2VT 4IN2A 2A7JA 4WH6A 4XOJA 1DT2A 1GBEA 1DLEA 3ZZ3A 2SGFE 2ZG0H 2O8MA 3HATH 1S83A 4UD9H 3AAUA 1HGTH 1HIAB 1C1OA 1Z8JB 4JZIA 1LPKB 1XKAC 2R0KA 2B9LA 3BTFE 2OQUA 3P8GA 4X1NU 2ASUB 3GY4A 1OOKB 3M7UA 1NT1A 4B71A 3OX7U 1ID5H 8GCHF 1P11E 1QIXB 3SI4H 3QGNB 2EC9H 4Y7BA 3C27B 1ZZZA 5IYTA 4JYUH 1QL9A 1F5RA 4INHA 1CGIE 1ESAA 1HYLA 1XUGA 3M3SA 2NWNA 1UTJA 1G36A 3W95A 1UJ1A 1FIZA 3TJVA 3PMBB 1EAXA 1A46H 5F03A 2GKVE 4MPVA 5AFZH 4BTTB 1IQIA 4X6MA 1BCUH 1J8AA 2QXHA 1HAHH 1IQLA 2ZZUH 3SV2H 3SQHE 3IITA 1C1PA 4RKOB 1DWBH 1S5SA 1S0QA 2GDDA 3RXSA 1ZHPA 4A6LA 4KKDA 3O8BA 5T6GA 4ZXXH 4AB8A 2W3KA 2WPMS 5EODA 3HK6B 3STJA 1BBRE 1GBDA 4AFQA 1QGFA 1P2NA 5DP5A 2HWLB 2IOTA 1P9SA 1C2EA 1WQSA 4ABHA 4ZXYH 2BLQA 3UOPA 3TGKE 1V2KT 1CA8B 4WWYA 7LPRA 5AVDA 3TJUA 1GBBA 3V13A 4A1VA 3LGTA 1THSH 1A0JA 1HAPH 1CHOF 2NU4E 4OGXA 1FIWA 3SNCA 3AW1A 5A0AE 5GIBA 4GAWA 4FU7A 2ZHEH 4I8KA 4WXVA 1LKBA 2GCTB 2TGDA 4JZDH 3FZDA 4SGBE 5EPNA 1A3EH 1VCQA 1JOUB 2BDIA 2XBXA 4I33A 3ZZCA 3LGYA 2G8TA 1P01A 1Z71A 1K2I1 1SGTA 4NZQA 3GY3A 2F9BH 4UEHH 3PO1C 4NZLA 2H9TH 1ETRH 2A2QH 4YM9A 1GBFA 1HJ9A 3MU1A 3TNSA 4DVAU 5DK1A 1SSXA 4GHTA 1UK3A 5F6MA 1Y3YA 2OTVA 4UFEH 1C1NA 3HKJB 1MH0A 2CJIA 3U8OH 1YCPK 1TNLA 1ESTA 1CQQA 1E0FD 1G2MA 1UTQA 1KXEA 4DG4A 1ZLRA 2ODPA 1FN8A 2ANMH 2G5VA 1O2MA 2W7UA 1TBZH 1Y3VA 4KGAA 3TGJE 1A61H 2A45B 2A5IA 4NFEA 1MTVA 4MTBA 2TRMA 2GT8A 2J2UA 1YPHE 1O2GH 1C5SA 2ZGXH 1DITH 2Z9JA 1OYQA 3TJOA 3T62A 1YLDA 4OS6A 2ZFQH 1V2UT 1GJ4H 3VB5A 1O3PB 2ZIQH 5E0JA 1P3CA 3TU7H 3VFEA 1CA0C 5CHAC 4KP0A 4Y11E 4FVBA 1ZPZA 1AFQC 1C1SA 3BF6H 3SNDA 1OWKA 2VVCA 3GYLB 1FI8A 2C8WB 4X2WA 1GJBB 4B76A 3FZZA 1LHCH 1PPCE 1HUTH 1AIXH 2P8OB 2PW8H 3GCHB 1SPJA 1QY6A 4FU8A 2Z3EA 3STIA 3WY8A 1E35B 2VIWA 5F8TA 3A80A 4D9RA 3GDVA 1YPLH 4LZ4B 3RXHA 1SR5C 1AZ8A 3A85A 1BBRK 1EQ9A 1HXEH 1XUJA 2VJ1A 2BDYA 1SVPA 1TGSZ 2GCHG 3ODDA 1JRSA 1ETSH 4NWKA 1PPBH 4E7RG 1DUEA 3PROA 2IJOB 2QXIA 1QCPA 1J14A 1SBWA 2G51A 1Z6JH 3RXPA 4JZFH 3SU3A 1RRKA 5DP8A 1YPGH 1DANH 1QR3E 2I6SA 1ZRBA 2A32A 1MCTA 2GD4B 3SV7A 2OCVB 3LJJA 4AG1A 1UTMA 2P3FH 5A0BA 1HAGE 1K1NA 4Q7XA 1K1OA 4TYDA 3RC5A 5G4BA 2FOGA 1YCPH 3TH3H 1O3DA 3PYHA 1W10U 1XUIA 1P2JA 4Y71A 3GDUA 3TVJB 1IQEA 4TPYA 3ESTA 1GBHA 1WSSH 3KIDU 3RM2H 1LVOA 4YT7H 4YTAA 2FTLE 1AFEH 1ACBE 4OS7A 3U1IB 3EA9A 3GISB 4K1TA 2XTTB 3QLPH 1SGYE 1ARBA 1T4UH 3RXIA 1YP9A 2V6NA 3KL6A 1AVXA 1EB2A 1V2QT 1XKBC 5SGAE 2FZZA 4I8GA 1EUFA 1W8BH 4DY7B 1SGIB 2XC5A 3BIVH 3EAJA 2O8WA 2PUQH 5FBIA 1J15A 1RD3B 3UWJH 2J92A 5K0HA 1KTSB 1GHXH 5DP4A 2LPRA 5HM9A 1BRCE 1UCYE 2Z3DA 2H5CA 1TIOA 2ZPRA 4I31A 1QL7A 1O3MA 2FYQA 4IW4E 1TGCA 2FI3E 2GTBA 3TJNA 3GYMA 4IC6A 2ZDNA 3SNAA 4I8LA 4Y6DA 1IQNA 1TONA 2B5TB 1O2UA 1SQAA 3IWMA 4Q7ZA 2C90B 5TJXA 1LTOA 1MZAA 2C8YB 1O2TA 1O33A 3MO3A 2WV4A 5E8EH 1IQFA 5GCHF 4IC5A 4TWWA 3M5OA 4X6NA 3T26A 3ENSB 3SN8A 2Q6DA 5EOKA 1RGQA 4GUXA 3BIUH 3NKKA 3SJOA 1GDNA 3GDSA 1O2SA 1A4WH 2PKAA 1K1LA 2XBYA 2BD7A 1FY8E 1C5OH 1GJ6A 3UWIA 1BIOA 4DT7B 6ESTA 1ZJDA 1B0EA 1O3OA 1FNIA 2BD4A 4BOHA 4GVUA 1P10A
chains in the Genus database with same CATH superfamily
1ELDE 1SB1H 3SO3A 1RJXB 5EIYA 1ZGIA 1MTUA 1QBNA 1VITF 2J98B 2BY7X 1ZHRA 4YO9A 1GJ9B 1GBKA 4RSPA 4BAKB 1TALA 3MO6A 3F9GA 2H9HA 2AMPA 1H8HD 4WMEA 4NSVA 2F43B 1QJ6B 1V2LT 7GCHF 1VGCC 2BLVA 3EGKH 3TH2H 1RTFB 1F5LA 2BQ6B 2BMGB 1A1RA 4XDEA 4B73A 3P8FA 1TBQH 3PO1B 5EQQA 1MKXK 1TBRH 3BTEE 2ZTYA 1K1JA 3M7QA 3SU1A 2CMYA 2HOBA 1C1TA 2BTCE 1GI8B 2F3CE 3QK1A 1FXYA 2ZNKH 1L2EA 3MNBA 2BVSH 1NFWA 3TK9A 2HPPH 4B74A 4J1YA 4CREA 3S7HB 1C2KA 1CHOG 4B2BA 1J17T 4XBDA 2GMTC 2Z6BD 4ISOA 1ANCA 1TRNA 2AS9A 1P2OA 2GT7A 2FM2A 3LGVA 2OC1A 2W6ID 1ETTH 3TNTA 1A2CH 1CA0B 5CHAB 3ODFA 2FOFA 3H5CB 3GOVB 4ISNA 1F0TA 1AFQB 1YWUA 4A92A 1TRYA 2YNBA 1BB0B 1EASA 3SZNA 1GI7B 2PKSC 3E8LA 4FUCA 2ZCHP 5FX6A 2WUBA 2A4GA 2KX4A 2WYGA 3O8RA 4Y8ZA 5T1VA 2BD9A 2KCYA 1VCPA 1ZTKA 1P2IA 3H09A 4KTUA 2VWNA 4IBLH 2SFAA 1Y5BT 3OAAD 1HB0B 4CRFA 1C1RA 5EG4A 5JBCS 5FPTA 2PSYA 1RXPA 3EQ0H 5A8XA 1C9PA 1JIRA 1DDJA 1ELCA 3BTQE 3D65E 1V2ST 2PKAB 4BXWA 3KEEA 2GVFA 2BDBA 1LO6A 1GI9B 2Y5HA 3FFGA 1UK2A 2C3SA 2B0FA 3VB7A 2GZ7A 4ZMAH 1L1NA 3RXTA 4K1SA 1NRQH 1UVPA 1NFYA 2G55A 1E1QD 4MPXA 5CMXH 1V2MT 2CF9H 3CNRA 1XXFA 1OWDA 2UUYA 3AASA 1AI8H 1ANBA 3V0XA 1WU1A 1MKXH 1P0SH 1PPFE 3M5LA 2OC8A 4MNVA 3KGPA 6LPRA 2ZQ2A 4UFGH 1PQ7A 5JYIA 1D4PB 4CBNA 5C1XA 1C2GA 2Q1JA 2VIOA 2UUJB 3MOCA 4CR9A 4BTIB 5C20A 1GJDB 1QZ8A 3S9BA 1O32A 3FANA 1MUEB 1LDTT 2FX6A 4ABEA 4E06H 3QZQA 3A8CA 2WPHS 3I29A 2FWWA 5C5NA 1UTPA 2VB0A 4ABIA 1O3LA 3NZIA 2M5TA 1SGNE 1FY1A 1LVYA 1T31A 1XUFA 5CHBA 1GVKB 1YGCH 3P70B 3MHWU 3V3MA 3MH5A 3U28C 2JH6D 3GS9A 1LVMA 1EB1H 2QYIA 1GHZA 1SGCA 3GY6A 3TK5A 1UVSH 1FY5A 4FXGH 2GZ8A 2D26C 4TSFD 1VITH 6GCHF 4XFQA 2QF5A 1V2WT 1MD8A 4Q63A 5ESBA 4HZHA 4X1RU 3F9FA 1G37A 1N1LA 3KN2A 3A7ZA 5J4QA 3S7KB 1C1QA 1P03A 2A4QA 5FPSA 4B2CA 3OY5U 3CENA 3UOUA 2TIOA 3RXJA 1YLNA 2R0LA 2XWAA 1LPZB 2C8ZB 2OP9A 2ZFSA 1EAWA 2H6MA 3GY8A 1Z8GA 5C5OA 1O2YA 4QT8C 4Y10E 2Q6GA 1GHYH 1V2PT 2AMQA 3RXMA 2VINA 4AYYB 1T32A 3QGJA 5HGGA 1QURH 1A5IA 1TX8A 5EJZA 1THPB 2UUKB 3ZVEA 3FKSD 1AO5A 5GDSH 5B6OA 4U30A 1O2IA 3SUFA 2VGCC 3SI3H 1HFDA 1UK4A 3SJKA 1O36A 3I78A 1L4DA 2Y5GA 2O8UA 5EXLA 4AORA 1O5FH 1O2OA 2OBOA 1NU7B 3MMGA 4TY7A 1GJ8B 1XVOA 2ZU2A 4P00A 4PROA 1Z8IB 3SNBA 1NM6A 3A8AA 3SU6A 5DJ7A 3P6ZB 2OC7A 1YPEH 2P3TB 3ZYEA 4F48B 3RU4E 3F9HA 1HRTH 1Y8TA 5IDKA 1AZZA 4INKA 1BUIA 2L74A 1WTGH 5GCHG 4TY6A 1GVZA 1VGCB 3A7XA 1O3KA 3S9AA 1ZGVA 1SQTA 4BANB 1KIGH 2EI7A 4O97A 2P94A 1V2NT 3L6PA 3MU0A 3ZVAA 4CRGA 1G3CA 2ZFPH 1QBOA 1QTFA 1KSNA 3ZZ5A 2HVXA 1SLUB 1WAYB 1T4VH 3ZYDA 1L1JA 4JZ1A 1AD8H 1DY9A 1D3PB 1F0SA 3RC6A 4B6FA 4F4OC 3RXEA 1OPHB 4KELA 3PMHB 2WV5A 1C5WB 1VITG 1YKTA 3HGPA 2FTMA 3FP6E 3UUZA 4GCHF 5EW1H 1FAKH 4THNH 1HXFH 1A5HA 5ABWA 1YF4A 4AOQA 3LGIA 3PRBA 1DLKB 1HDTH 1C5UA 1CVWH 1KLJH 2GMTB 4K8YA 1A0LA 3OTPA 1C2IA 1V2JT 2BXUH 3P17H 4NCYA 1QA0A 5E0HA 7GCHG 1YCPM 3TITA 1MTWA 3A8BA 3UNSA 1G32B 1AQ7A 1TPAE 1ZMNA 1BRBE 1FX0B 3Q3KA 1QL8A 3ZV9A 1LQEA 2FS8A 1GHBF 2FODA 2ZDMA 3TK6A 4F55A 2PKSB 2QV1A 3MYWA 7ESTE 4FVDA 2AMDA 5F8ZA 1F0UA 6CHAC 2DE9A 5HKKD 1NO9H 2QE7D 4WVPE 1IQGA 1C2DA 4K3JA 1ZHMA 3UNQA 1FDPA 1N6XA 1O2VA 2FI5E 1TABE 2W26A 3UAIC 1FY3A 2I6QA 3PMAB 1C5RA 1CO7E 3SBKA 4K5ZA 1K28D 2XW9A 2ZPQA 4XE4A 3VPKA 3F68H 2FPZA 1HCGA 3RXQA 2ZGCA 1GJCB 4CH2B 1MKWK 4XD7D 1GDQA 1Y5UT 1EPTC 4I7YH 1TOMH 1SOZA 5A8ZA 1K1PA 4YXWD 3M3TA 1KY9A 4BAOB 4OS5A 1TPSA 2FDAA 5A2MH 2WYJA 1KLTA 1SGFG 1CT2E 1TGBA 4LXBH 1YC0A 3VEQB 2IPHA 1PQAA 1TX6A 1P12E 2R2MB 2VH0A 2PHBA 2FESH 3ZV8A 1C5LH 1ZRKA 1LHGH 3RXBA 5FBEA 3URDA 3PMJA 3CS7A 1BRAA 5JPMH 1C5PA 1K0HA 3DT0H 5LH8A 2YMSC 2JJ1D 1H9LB 3OEED 3FO8D 3Q76A 5IK2D 4YOIA 3U9AH 1EZUC 3RXUA 1NC6A 4DOQA 3A7VA 4MNYA 1BTUA 1AU8A 3FVFB 2BHGA 1C2JA 2H1UA 1ELTA 1QQ4A 3PM3A 1TFXA 2KZ4A 1O3AA 1W2KH 2GGVB 3I77A 2ESTE 2QA9E 3ATMA 1QBVH 1U6QA 1EZQA 1LPGB 1MD7A 2C4FH 5FCRA 5GXPA 4NGAH 1HAIH 1MTSA 5AFYH 3GCNA 5DP6A 3DHKH 4NA7A 1GI0A 1OXGA 1W13U 2H5DA 2QXGA 2ZU3A 3FAOA 1AVWA 1A0HB 1O37A 2PTNA 2ZU5A 2QXJA 1O3EA 3KQDA 4X1PU 5C0TA 3SU4A 2ILNA 3Q00A 3SGBE 1JBUH 3E90B 1EKBB 2SGAA 3R0FA 3RDZA 2HPQH 2OLGA 3U69H 1W14U 4BAHB 4BTUB 1O3NA 5JDUB 2D1JA 2ZTXA 1EATA 2J5UA 2GP9B 1EJMA 2JH0D 2QF0A 2XWBI 3SQEE 4CR5A 3A81A 1WXRA 2VWOA 1MKWH 1TE0A 1QNJA 1O5DH 2YOLA 2HNTF 1CE5A 2ZTZA 5EXNA 2V3OH 2VGCB 1PYTC 2J38A 3ITIA 1HJ8A 1EPTA 4FETA 1ORFA 2SGQE 1NU9A 2BXTH 1N6YA 3SHCH 1O31A 3OE7D 1KLIH 3LGUA 2G81E 1CT4E 1MBMA 3M3VA 1B0FA 2OQ5A 1W7XH 2M2AA 4WH8A 4UFFH 4HFPB 1IQHA 3AK5A 1LMWB 5ESTE 1NY22 1PPZA 3D23A 4YLQH 2ZHWH 2FMJA 2XCFA 1NS3A 1DXPA 1H1BA 3RXGA 1FLEE 1W11U 2J9NA 1OP8A 4ABJA 3P92A 3L33A 3RUOA 3BTWE 1TGNA 4MNWA 5A09A 3FOAA 1Y5AT 2BDCA 3SJ8A 1Y3XA 1THRH 3K6ZA 4O3TA 1MQ6A 4JMYA 1GMCF 1BOQA 2ZPSA 4B1TA 3K2UA 2R9PA 1BRUP 1GHAF 1WOFA 2G4TA 3P8OA 8LPRA 4LK4A 4KTCA 2A31A 3BTGE 1BTXA 3UIRA 3PWBA 5HIZA 1PPEE 1AMHA 1NRPH 1PPHE 3ZVDA 3JZ1B 2VWLA 1K22H 4ZKNU 4FOUC 1A5GH 1O39A 3QTVH 2KAIA 4RI0A 3P95A 1GMHF 4K8BA 1SLVB 2CXVA 1BMAA 3UFAA 1CHGA 4X8UH 3BEFB 4A1TA 2FYRA 1EAUA 4DURA 2LP6A 1ZR0A 4X8SH 2PSXA 1EP5A 2XNIA 1QB6A 3URCA 4A7IB 2PWXA 1NRNH 1GMDF 1W12U 6CHAB 3BSQA 4B2AA 3OU0A 2ULLA 2DE8A 4IN1A 1P3EA 4UFDH 8GCHG 5JBTA 1DVAH 1TNHA 1C2LA 4NIYA 2QC2A 4H6TA 4I8HA 2EY4C 3MU4A 3ZZAA 2FI4E 1RTKA 1SC8U 2VBCA 1BITA 1FY4A 2J4IA 4GCHG 3SJ9A 2BDGA 3RU4D 4NG9H 1GI4A 2BDAA 3KQBA 5I25A 4AG2A 3E6PH 2O8TA 2VIDA 1HJAC 4D9QA 4JK5A 1TMUH 3RP2A 1EPTB 3M36A 3OFND 4DIIH 3A7WA 4Y8XA 2O9QA 4YOGA 3MI4A 1Z8RA 1OP2A 3KYFA 3TIUA 1TGTA 2XC0A 5EQRA 3BN9A 1NFXA 3ZZ7A 1GHBG 1C4Y2 5E0GA 3VG8A 2V0BA 3S9CA 3EE7A 4M9FA 1T8LA 1WQVH 4GPGA 3VXFH 1SGRE 1NBME 3RMMH 3M5NA 2A7CA 1OWHA 2VH6A 2BY5X 4YLUA 4ZHAA 3ATIA 1XUHA 4D76A 1V2TT 4AYVB 1VJAU 1C2MA 1OKXA 3Q3XA 1TLDA 2FEQH 1GHVH 2Y81A 1XXDA 2XNDD 2YMSB 3HGNA 4AC9A 2HGTH 5DKMA 2BY8X 2R3YA 4CBOA 3C1KA 5FPYA 1O35A 2XRCA 3HPTB 2Z9LA 4D8NA 3ZZ8A 1C5YB 2QAAA 2WINI 3RXDA 1C2FA 3KQCA 3LJOA 2IPQX 2JIZD 1NPMA 1PQ5A 4BAMB 4WY3A 1O5EH 1O2QA 1TB6H 1W3CA 1DFPA 1Q3XA 1HNEE 2PP6A 2SNVA 4JYVH 1F92A 2H2ZA 1ZTLA 4DIHH 1G3EA 1NRRH 1ESBA 1SL3A 3ZIAD 4O03A 3KCGH 3BTDE 1LVBA 2GV7A 3UR6A 2UWOA 1UVUH 1SFIA 1YM0A 5C1YA 1GVLA 1AWHB 2P59A 4NA9H 5LGOA 1O30A 5AHGH 2FOCA 2QY0B 1UTKA 2BYAX 1EAIA 3NUMA 3D62A 1O3BA 3NK8A 2FOHA 2KAIB 2QF4A 5H4IB 5DGJA 1PPGE 3F6UH 3MNSA 4AFUA 1F2SE 2W3IA 1ABIH 3ZVGA 4FUHA 5F8XA 2ZGJA 1JIMA 1O2XA 3E16B 1SG8B 1KMHB 1K1IA 1IQKA 1YBWA 2FXRA 3M35A 3VB6A 2XBVA 1WCZA 1OS8A 3PV4A 2VVUA 4E7NA 1T8NA 1DXWA 1TA6A 2AEIH 4FUGA 2FP7B 1AE8H 2OUAA 5EU8A 1QB1A 1GJAB 1SGDE 4I86A 1WBGB 3RXCA 3BTHE 1MAXA 3U8RH 2VIPA 1DX5M 4MPUA 1P9UA 1O38A 2BM2A 5C17A 2TBSA 3EDXB 2WPIS 5HIYA 1YYY1 3SV8A 1P2KA 2Y7ZA 4D7FA 2R2WU 2ZI2H 3DSPA 3KQEA 4GSOA 2A1DB 4DW2U 1O2ZA 4JCNA 3DUXH 3K6YA 1GI3A 2FX4A 2ZHFH 3LC5A 1ZSLA 2F9PA 1GL1A 3OYPA 2F4LA 4AGKA 1W7GH 1PQ8A 3RLWH 4ZH8A 1GG6C 2CHAC 2OK5A 1GDUA 3PLBA 1BJVA 3SZEA 3MQKC 2ZA5A 3BEIB 4ACBA 1AY6H 1E34B 1O3FA 2AIPA 4UDWH 1SHHB 1TA2A 1N8OC 2BQWB 3BTKE 3NWUA 2ODYB 2ZFRH 2UUFB 4ZUHA 1GJ7B 1EZSC 2BB4A 4ACAA 5KEDA 3GCTF 4X1SU 1HAZB 1OSSA 4UONA 3IG6B 5L30H 1G3DA 3CP7A 3G01A 7KMEH 2ZC9H 2BX3A 1H8IH 3LIWA 2GCHF 1S0RA 2BOKA 1FUJA 3FP7E 2VIVA 4WJG2 1SHYA 1ANDA 5L2ZH 2FLBH 3WWBA 3UB0A 4OS2A 1G3BA 1TYNA 1IAUA 1SI5H 2Y80A 4WF8A 3SUGA 1PFXC 4YESB 2A0QB 3S0NA 4Y79A 4YT6H 4CHAC 3BG4C 4A1XA 2JDID 2G4UA 1EJAA 1BMMH 1MU6B 4FUFA 2D8WA 1KDQA 3U1JB 1O2LA 1JMOH 1NESE 1S85A 5DP9A 2J97A 4J2YB 1GMCG 5HYOA 5E2OA 1O5GH 4ABBA 5FCKA 1HLTH 1MMJN 5HXFA 1GHAG 5DO4H 1O3IA 4NA8A 3T28A 2F91A 5HMAA 1L0ZA 2TGTA 3H7TA 1H8ED 2AFQB 4X6OA 3A87A 2WPDD 3RXAA 1SMFE 1EOLA 2CK3D 1WV7H 5CDFE 2TPIZ 3WWFA 1O2KA 1HJAB 4ZROA 1O5AB 1C5XB 3SJIA 5KGOA 1UTNA 3NRLA 3LC3A 3TGIE 3A82A 1BTYA 2WPLS 1GMHG 1HV7A 5C67A 4M7GA 1RTLA 5EQSA 1DPOA 2K0QA 2AGEX 4I8JA 3PTBA 2RA3A 4R8TB 5GJ4B 2IJD1 1S84A 2BLOA 3V12A 3GY7A 3ZZBA 2AGIX 1GBCA 3ZVFA 1P05A 2B8OH 5C1UA 4FU9A 1BTPA 4U01A 1P06A 3HK3B 1HAXB 3QX5H 4JYTA 3E91A 1NRSH 1S82A 1BJUA 1B7XB 1TNIA 4R0IA 2ZHDA 2VWMA 4DCDA 2D2DA 2JKHA 3FP8E 1OWIA 5F53A 5EJ1A 4Y0ZE 1BTWA 2K1QA 2Y7XA 3GICB 3LH3A 1VR1H 3KYGA 1P57B 5K7RA 1BHXF 4X2XA 1LHDH 1BMFD 1Z1JA 2EI6A 4IMQA 1K9OE 1ELFA 2FOAA 2P16A 4ABFA 2NU2E 2XC4A 1A3BH 1M9UA 2P93A 1BMLA 1CBWC 1C5VA 2NU0E 3UR9A 2BY6X 2BX4A 1TAWA 3LOXA 1DOJA 4Z6AH 3NPSA 4WXIA 3UTUH 1EZXC 2HNTC 2BD8A 2LELA 1DWEH 3RXVA 1F7ZA 1YPHC 1T8MA 3LT3A 4ESTE 1P02A 1D6RA 1INCA 1PYTD 2F9OA 2ZKSA 4K69A 4Q2KA 2ZCLP 2RFKC 2NU3E 2SGPE 2KFWA 1SQRA 2DUCA 1C5QA 1YY3A 4Q80A 1SGEE 3SUDA 1GGDC 3SYJA 5BRRE 3A83A 5EPYA 3W94A 4MVNA 3RXRA 4X1QU 2R3UA 3RLYH 4BAQB 1KDQB 1FJSA 1BTHH 1D6WA 2AYWA 1SQOA 3UREA 3WW7A 1TQ0B 3ATLA 1H9IE 2STAE 3CS0A 3LGWA 1G2LA 3B23B 1BMNH 5A8YA 4Z0KA 1NBMD 1FPHH 2BVXH 2V3HH 3SGQE 5DSFA 3MU5A 1KYNA 2Z3CA 1KTTB 5C0UA 1A7SA 3M61U 2FOMB 3BV9B 5LPFA 2BDHA 1G9IE 2YNAA 1DSTA 4XSKU 2ALVA 1C4U2 1AUTC 1CU1A 2GX4A 3AVZA 2ZDVH 4K2YA 5C94A 3HKIB 1V3XA 1BHXB 3RXKA 1L4ZA 1AGJA 1GBIA 1FMGA 1COWD 1NZQH 2RCEA 2PR3A 2BD5A 4ZKRU 3KNXA 3ZZ6A 1Z6EA 2FOBA 1LQDB 1S6HA 4U2WA 2AHME 3U8TH 5L2YH 3ZVBA 2PGBB 3ZVCA 1S81A 4GHQA 1WTHD 4DJZB 2ZFTA 2KCOA 2ZFFH 3DFLA 1V2RT 2VNTA 1Y3WA 3KQ5A 2A2XH 1EFRD 1GG6B 2PTCE 2CHAB 4VGCC 3VXEH 5DP3A 3N99A 4O9VA 1ELEE 1N8OB 3RM0H 3F1SB 2STBE 2F9VA 4ZHMU 4X2YA 5LPEA 1QRXA 3VGCC 2HNTE 4D7GA 3ZZ4A 5GPIB 5BPEA 4JZEH 3DCLA 4HG6A 1O2NA 1GCTC 1AHTH 2QCYA 1C5MD 3DFJA 4Y76A 1YPKH 4E05H 1AVGH 1CGHA 2UWLA 4ASUD 4Q7YA 1GI6A 4X8VH 1VJ9U 1WYKA 3E3TA 5J4SA 1C2HA 5C2ZA 1QQUA 2G52A 1MTNC 3NCLA 1ZMLA 1ZTJA 4F49A 3A84A 4B75A 4NFFA 1XMNB 2Y5FA 3LPRA 3V7TA 4CHAB 2JETC 1GI5A 3BG4B 1BQYA 3RXFA 1QRWA 1VCWA 1ZYOA 1AB9C 1ZJKA 1FAXA 1DSUA 4X6PA 4Y8YA 1LHFH 4NWLA 1TOCB 1RIWC 1TMTH 3PB1E 1ELAA 1GBJA 3GCTG 1YPMH 2WV9A 1ZOMA 1V6DA 2KR7A 2ZU1A 5CE1A 2SNWA 2WZQA 6GCHG 1IOEA 3MNCA 2W5EA 4ABAA 2AH4X 5JB8S 3T27A 1HAYB 4NIWA 4CRCA 1KXBA 2XBWA 1ELVA 1OP0A 4X2VA 3B9FH 3SUEA 4ZKSU 1S6FA 4TWYA 2CN0H 1Y59T 2J98A 3ATWA 3PWCA 1GWAA 1S6LA 1IQJA 2W6JD 5EJLA 5FL7D 4DGJA 1AKSA 1K1MA 2LNCA 2ZDAH 3RXOA 2PGQB 3AAVA 1CT0E 1BDAA 2RG3A 1C5ZB 2Z9GA 1LHEH 1PJPA 1ZMJA 3UPEA 1BZXE 1SGPE 1SGQE 3T29A 4CRAA 1T8OA 1OWEA 3O8CA 1Z7KA 5DP7A 3SNEA 3LKWA 1H4WA 1TPPA 4AFZA 1O34A 1C1VH 2F9NA 1TQ7B 2JH5D 3Q77A 1ELBA 2VVVA 3RMLH 2OBQA 4HI3A 4MQAA 4XBBA 3E1XB 4NIVA 1TPOA 1TWXB 1IHTH 1AUJA 1Y3UA 1O3HA 2OINA 3VB3A 3SU2A 4AN7A 3SHAH 3T25A 2A5KA 2RA0A 4WMDA 2ALPA 1LKAA 5E2PA 1F5KU 1CBWB 2AIQA 1OWJA 3BTTE 4CH8B 1HPGA 2FOEA 2WSSD 5EGMA 3KF2A 2Z9KA 2Y6TA 3T2NA 1ZPBA 1O5CB 3B8JA 1DM4B 2NU1E 1EJNA 2ZDLA 2V3MA 1CSOE 2EI8A 5T3HA 2W7SA 1XVMA 8KME2 3AW0A 4KTSA 2ZO3H 3ZZDA 5A0CA 3MH7A 5T6DA 3LU9B 1ANEA 1KXFA 4XBCA 1JWTA 1BTZA 2XYAA 4K1EA 1DY8A 1BBRH 2BY9X 2ZU4A 4FUEA 4ISLA 2J95A 1O2PA 4MNXA 1CGJE 3SU0A 3S69A 1MU8B 3MFJA 1GGDB 1TNGA 1P2MA 4ISIH 2O8LA 2Z94A 3TH4H 2F9UA 1HAOH 3OSYA 3UY9A 4WMFA 1VZQH 1FN6A 4HGCA 1KXDA 1D9IA 1P2QA 2XXLA 3M5MA 1MBQA 1RFNA 3RMOH 4NSYA 3H7OA 4MLFB 4U32A 1AE5A 5AF9H 2TGPZ 3VB4A 2AERH 1TNJA 2ZHQH 1O2HA 1UVTH 2VIQA 3N7OA 1UVOA 2ZECA 4FUBA 3E0NB 4ZAEA 3MH6A 4TPIZ 1FPCH 2Y82A 1O2JA 3F3BA 4SGAE 2CGAA 1QB9A 4H6SB 4IGDA 1AKSB 1Z1IA 4BXSA 1LCYA 2C8XB 3F9EA 3UQOA 1NROH 2A4RA 2BD3A 2F83A 2OXSA 1TX7A 2J94A 5GNDA 1X7AC 2G00A 5EXMA 2L6OA 1YPJH 2QN5T 2FO9A 2RDEA 2CV3A 5DPAA 1ELGA 1FV9A 3P8NA 2PLXA 2ANKH 2H9EH 3EE0B 3E0PB 3U98H 3QZRA 3DSGA 1GPZA 1D3DB 1HBTH 2WPJS 4ZCNA 3KHVA 2ANYA 5HM2A 4VGCB 4OS1A 1SGFA 2ZF0H 1GCDA 1GL0E 4H4FA 1ZSJA 1UTOA 1DE7H 3GY5A 2AGGX 1E37B 3MH4A 9ESTA 4YOJA 1ZSKA 2FS9A 4LOYH 4X0WU 3VGCB 4Y7AA 3QTOH 1O2WA 1FONA 1B5GH 1EX3A 4A5TS 4IMZA 1C5TA 3LONA 1J9CH 1GCTB 1UCYK 1GBAA 5KECA 1GI1A 3UQVA 1NTPA 3A7YA 2QGRA 3SV9A 3K65B 2FLRH 4BNRA 4ZHLU 5JBAS 5PTPA 4AGJA 3UNRA 4INLA 4FUDA 1G30B 1KXAA 3SW2B 1E79D 3TPIZ 1C5NH 1L1GA 1MTNB 2XCNA 2K8IA 4OM9A 3A7TA 1J16A 3RC4A 1DWCH 1UHBA 3EA8A 4AB9A 3RU4T 5TCAA 2OC0A 2ODQA 3MWIU 2Z9IA 4ABDA 2HLCA 2JETB 3M7TA 4DT4A 3GCOA 1SOTA 1UMAH 1TRMA 1AB9B 2BD2A 1DUAA 2ZGHA 3A89A 4JK6A 3EA7A 1E36B 3PV5A 1RIWB 1SLWB 2GV6A 3DA9B 4NIXA 1UW7A 2P3UB 3BEUA 1HAVA 2PV9B 3NXPA 1WUNH 2EEKA 1C9TA 2WUCA 3SORA 1D3TB 2BOHB 4ISHH 1DWDH 8ESTE 5GWZA 1GBLA 1TMBH 2TGAA 1P09A 5I46H 3ELAH 5L6NH 3TLOA 1W0ZU 1F0RA 1QHRB 2ZEBA 4FUIA 1UTLM 1O5BB 2GCTC 3A86A 5C3NA 1W0KD 1C1WH 2G5NA 3D49H 1GBMA 1E38B 4Y0YE 3SV6A 1NN6A 2ZGBH 3RXLA 3EYDA 4K60A 3F2GA 4AZ2B 4MDSA 2CF8H 1YLCA 4X8TH 1NFUA 1K21H 1O3JA 2GJGA 1DS2E 3QWCH 1RS0A 2UWPA 1HIAA 2OD3B 5FAHA 4OS4A 4UE7H 3O8DA 3BG8A 2HLDD 3A88A 2VU8E 1W0YH 1EP6A 3A8DA 3SOSA 1EOJA 2ZP0H 4CRDA 3PV2A 4AX9H 1C4V2 1ZPCA 2PFEA 1H9HE 5FX5A 5FHTA 1OYTH 1UCYH 1FQ3A 1XX9A 2BVRH 3W1EA 1T7CA 5JBBS 5T6FA 2ZDKA 1QA7A 4O3UA 3OTJE 5FXLA 1QRZA 3QO6A 1XUKA 4RKJB 2ZWLH 4ASHA 1AN1E 1H8DH 1GBTA 1FZZA 1QJ1B 2BZ6H 3DD2H 2QIQA 2Z7FE 4ZKOU 1MCVA 4RN6A 2V35A 2QF3A 2HRVA 3Q3YA 2WHXA 1QJ7B 2P95A 2P8OC 3QN7A 1ARCA 3GCHC 3PLPA 3SU5A 1P8VC 4ABGA 4MG3A 4LZ1H 1MABB 1GJ5H 2SGDE 4I32A 1TNKA 2THFB 1BA8B 1EXFA 4IS5A 2GZ9A 5DN6D 1Q31A 3OY6U 4MPWA 2Q6FA 2A5AA 2WPKS 1D3QB 3MTYA 1Q2WA 3MNXA 5EW2H 2ZCKP 4GLYA 2C93B 1O2RA 4YZUA 1UHBB 1IQMA 1QFKH 3QUMP 3RMNH 2ANWA 5DG6A 3L3TA 2RDLA 3GY2A 1C1UH 3JZ2B 2HALA 2BLWA 2PUXB 4RT1A 4RT0A 1MZDA 5LPRA 4OGYA 3OEHD 3MU8A 3BTME 2YMSD 3M37A 4AFSA 5JB9S 1SFQB 3ZZ9A 3LH1A 1JRTA 1ABJH 1O3CA 1O0DH 1P04A 2J34A 4CRBA 9LPRA 2EA3A 2IN2A 1HAVB 3PTNA 1SLXB 1GI2A 1OX1A 1JXPA 1MQ5A 1MAYA 3MO9A 1C1MA 1UO6A 3ATKA 1V2OT 1AWFH 1OHHD 1KXCA 2BQ7B 1O3GA 2B7DH 2ZQ1A 3LDXH 2A7HA 1DICA 1WDIA 3QDZB 3PLKA 4HTCH 1GMDG 5TCCA 1XM1A 1BT7A 2A4OA 1GHWH 1IHSH 4H42U 4FUJA 2FIRH 3K9XB 3R3GB 2BZAA 3SGAE 3T5FH 2SGEE 5ETXA 2GDEH 1V2VT 4IN2A 2A7JA 4WH6A 4XOJA 1DT2A 1GBEA 1DLEA 3ZZ3A 2SGFE 2ZG0H 2O8MA 3HATH 1S83A 4UD9H 3AAUA 1HGTH 1HIAB 1C1OA 1Z8JB 4JZIA 1LPKB 1XKAC 2R0KA 2XOKD 2B9LA 3BTFE 2OQUA 3P8GA 4X1NU 2ASUB 3GY4A 1OOKB 3M7UA 1NT1A 4B71A 3OX7U 1ID5H 8GCHF 1P11E 1QIXB 4Z1MD 3SI4H 3QGNB 2EC9H 4TT3D 4Y7BA 3C27B 1ZZZA 5IYTA 4JYUH 1QL9A 1F5RA 4INHA 1CGIE 1ESAA 1HYLA 1XUGA 3M3SA 2NWNA 2KCPA 1UTJA 1G36A 3W95A 1UJ1A 1FIZA 3TJVA 3PMBB 1EAXA 1A46H 5F03A 2GKVE 4MPVA 5AFZH 4BTTB 1IQIA 4X6MA 1BCUH 1J8AA 2QXHA 1HAHH 1IQLA 2ZZUH 3SV2H 3SQHE 3IITA 1C1PA 4RKOB 1DWBH 1S5SA 1S0QA 2GDDA 3RXSA 1ZHPA 4A6LA 1VKYA 4KKDA 3O8BA 5T6GA 4ZXXH 4AB8A 2W3KA 2WPMS 5EODA 3HK6B 3STJA 1BBRE 1GBDA 4AFQA 1QGFA 1P2NA 5DP5A 2HWLB 2IOTA 1P9SA 1C2EA 1WQSA 4ABHA 4ZXYH 2BLQA 3UOPA 3TGKE 3FN8A 1V2KT 1CA8B 3F0PA 4WWYA 7LPRA 5AVDA 3TJUA 1GBBA 3V13A 4A1VA 3LGTA 1THSH 1A0JA 1HAPH 1CHOF 2NU4E 4OGXA 1FIWA 3SNCA 3AW1A 5A0AE 5GIBA 4GAWA 4FU7A 2ZHEH 4I8KA 4WXVA 1LKBA 2GCTB 2TGDA 4JZDH 3FZDA 4SGBE 5EPNA 1A3EH 1VCQA 1JOUB 2BDIA 2XBXA 4I33A 3ZZCA 3LGYA 2G8TA 1P01A 1Z71A 1K2I1 1SGTA 4NZQA 3GY3A 2F9BH 4UEHH 3PO1C 2JJ2D 4NZLA 2H9TH 1ETRH 2A2QH 4YM9A 1GBFA 1HJ9A 3MU1A 3TNSA 4DVAU 5DK1A 1SSXA 4GHTA 1UK3A 5F6MA 1Y3YA 2OTVA 4UFEH 1C1NA 3HKJB 1MH0A 2CJIA 3DSOA 3U8OH 1YCPK 1TNLA 1ESTA 1CQQA 1E0FD 1G2MA 1UTQA 1KXEA 4DG4A 1ZLRA 2ODPA 1FN8A 2ANMH 2G5VA 1O2MA 2W7UA 1TBZH 1Y3VA 4KGAA 3TGJE 1A61H 2A45B 2A5IA 4NFEA 1MTVA 4MTBA 2TRMA 2GT8A 2J2UA 3F2FA 1YPHE 1O2GH 1C5SA 2ZGXH 1DITH 2Z9JA 2EQNA 1OYQA 3TJOA 3T62A 1YLDA 4OS6A 2ZFQH 1V2UT 1GJ4H 3VB5A 1O3PB 2ZIQH 5E0JA 1P3CA 3TU7H 3VFEA 1CA0C 5CHAC 4KP0A 4Y11E 4FVBA 1ZPZA 1AFQC 1C1SA 3BF6H 3SNDA 1OWKA 2VVCA 3GYLB 1FI8A 2C8WB 4X2WA 1GJBB 4B76A 3FZZA 1LHCH 1PPCE 1HUTH 1AIXH 2P8OB 2PW8H 3GCHB 1SPJA 1QY6A 4FU8A 5B6LA 2Z3EA 3STIA 3WY8A 4Q4LA 1E35B 2VIWA 5F8TA 3A80A 4D9RA 3GDVA 1YPLH 4LZ4B 3RXHA 1SR5C 1AZ8A 3A85A 1BBRK 1EQ9A 1HXEH 1XUJA 2VJ1A 2BDYA 1SVPA 1TGSZ 2HVYB 2GCHG 3ODDA 1JRSA 1ETSH 4NWKA 1PPBH 4E7RG 1DUEA 3PROA 2IJOB 2QXIA 1QCPA 1J14A 1SBWA 3F2HA 2G51A 1Z6JH 3RXPA 4JZFH 3SU3A 1RRKA 5DP8A 1YPGH 1DANH 1QR3E 2I6SA 1ZRBA 2A32A 1MCTA 2GD4B 3SV7A 2OCVB 3LJJA 4AG1A 1UTMA 2P3FH 5A0BA 1HAGE 1K1NA 4Q7XA 3PRDA 1K1OA 4TYDA 3RC5A 5G4BA 2FOGA 1YCPH 3TH3H 1O3DA 3PYHA 1W10U 1XUIA 1P2JA 4Y71A 3GDUA 3TVJB 1IQEA 4TPYA 3ESTA 1GBHA 1WSSH 3KIDU 3RM2H 1LVOA 4YT7H 4YTAA 2FTLE 1AFEH 1ACBE 4OS7A 3U1IB 3EA9A 3GISB 4K1TA 2XTTB 3QLPH 1SGYE 2V7QD 1ARBA 1E1RD 1T4UH 3RXIA 1YP9A 3F0OA 2V6NA 3KL6A 1AVXA 1EB2A 1V2QT 1XKBC 5SGAE 2KM0A 2FZZA 4I8GA 2KCAA 1EUFA 1W8BH 4DY7B 1SGIB 2XC5A 3BIVH 3EAJA 2O8WA 2PUQH 5FBIA 1J15A 1RD3B 3UWJH 2J92A 5K0HA 1KTSB 1GHXH 5DP4A 2LPRA 5HM9A 1BRCE 1UCYE 2Z3DA 2H5CA 1TIOA 2ZPRA 4I31A 1QL7A 1O3MA 2FYQA 4IW4E 1TGCA 2FI3E 2GTBA 3TJNA 3GYMA 4IC6A 4XRNA 2ZDNA 3SNAA 4I8LA 3N7DA 4Y6DA 1IQNA 1TONA 2B5TB 1O2UA 1SQAA 3IWMA 3N7EA 4Q7ZA 2C90B 5TJXA 1LTOA 1MZAA 2C8YB 1O2TA 1O33A 3MO3A 2WV4A 5E8EH 1IQFA 5GCHF 4IC5A 4B6EA 4TWWA 3M5OA 4X6NA 3T26A 3ENSB 1W0JD 3SN8A 2Q6DA 5EOKA 1RGQA 4GUXA 3BIUH 3NKKA 3SJOA 1GDNA 3GDSA 1O2SA 1A4WH 2PKAA 1K1LA 2XBYA 2BD7A 1FY8E 1C5OH 1GJ6A 3UWIA 1BIOA 4DT7B 1SKYE 1ZJDA 1B0EA 4P02A 6ESTA 1O3OA 1FNIA 2BD4A 4BOHA 4GVUA 1P10A
chains in the Genus database with same CATH topology
1ELDE 1SB1H 3SO3A 1RJXB 1ZGIA 1MTUA 1QBNA 1VITF 2BY7X 1ZHRA 4YO9A 1GJ9B 1GBKA 4RSPA 4BAKB 1TALA 3MO6A 3F9GA 2H9HA 2AMPA 4WMEA 4NSVA 1QJ6B 1V2LT 7GCHF 1VGCC 2BLVA 3EGKH 3TH2H 1RTFB 1F5LA 2BQ6B 2BMGB 1A1RA 4XDEA 4B73A 3P8FA 1TBQH 3PO1B 5EQQA 1MKXK 1TBRH 3BTEE 2ZTYA 1K1JA 3M7QA 3SU1A 2CMYA 2HOBA 1C1TA 2BTCE 1GI8B 2F3CE 3QK1A 1FXYA 2ZNKH 1L2EA 3MNBA 2BVSH 1NFWA 3TK9A 2HPPH 4B74A 4J1YA 4CREA 3S7HB 1C2KA 1CHOG 4B2BA 1J17T 4XBDA 2GMTC 2Z6BD 4ISOA 1ANCA 1TRNA 2AS9A 1P2OA 2GT7A 2FM2A 3LGVA 2OC1A 1ETTH 3TNTA 1A2CH 1CA0B 5CHAB 3ODFA 2FOFA 3H5CB 3GOVB 4ISNA 1F0TA 1AFQB 4A92A 1TRYA 2YNBA 1BB0B 1EASA 3SZNA 1GI7B 2PKSC 3E8LA 4FUCA 2ZCHP 5FX6A 2WUBA 2A4GA 2WYGA 3O8RA 4Y8ZA 2BD9A 1VCPA 1ZTKA 1P2IA 4KTUA 2VWNA 4IBLH 2SFAA 1Y5BT 1HB0B 4CRFA 1C1RA 5EG4A 5JBCS 5FPTA 2PSYA 1RXPA 3EQ0H 5A8XA 1C9PA 1JIRA 1DDJA 1ELCA 3BTQE 3D65E 1V2ST 2PKAB 4BXWA 3KEEA 2GVFA 2BDBA 1LO6A 1GI9B 2Y5HA 3FFGA 1UK2A 2C3SA 2B0FA 3VB7A 2GZ7A 4ZMAH 1L1NA 3RXTA 4K1SA 1NRQH 1UVPA 1NFYA 2G55A 4MPXA 5CMXH 1V2MT 2CF9H 1XXFA 1OWDA 2UUYA 3AASA 1AI8H 1ANBA 3V0XA 1WU1A 1MKXH 1P0SH 1PPFE 3M5LA 2OC8A 4MNVA 3KGPA 6LPRA 2ZQ2A 4UFGH 1PQ7A 5JYIA 1D4PB 4CBNA 5C1XA 1C2GA 2Q1JA 2VIOA 2UUJB 3MOCA 4CR9A 4BTIB 5C20A 1GJDB 3S9BA 1O32A 3FANA 1MUEB 1LDTT 2FX6A 4ABEA 4E06H 3QZQA 3A8CA 2WPHS 3I29A 2FWWA 5C5NA 1UTPA 2VB0A 4ABIA 1O3LA 3NZIA 2M5TA 1SGNE 1FY1A 1LVYA 1T31A 1XUFA 1GVKB 1YGCH 3P70B 3MHWU 3V3MA 3MH5A 2JH6D 1LVMA 1EB1H 2QYIA 1GHZA 1SGCA 3GY6A 3TK5A 1UVSH 1FY5A 4FXGH 2GZ8A 2D26C 1VITH 6GCHF 4XFQA 1V2WT 1MD8A 5ESBA 4HZHA 4X1RU 3F9FA 1G37A 1N1LA 3KN2A 3A7ZA 5J4QA 3S7KB 1C1QA 1P03A 2A4QA 5FPSA 4B2CA 3OY5U 3CENA 3UOUA 2TIOA 3RXJA 2R0LA 2XWAA 1LPZB 2C8ZB 2OP9A 2ZFSA 1EAWA 2H6MA 3GY8A 1Z8GA 5C5OA 1O2YA 4QT8C 4Y10E 2Q6GA 1GHYH 1V2PT 2AMQA 3RXMA 2VINA 4AYYB 1T32A 3QGJA 5HGGA 1QURH 1A5IA 1TX8A 1THPB 2UUKB 3ZVEA 1AO5A 5GDSH 5B6OA 4U30A 1O2IA 3SUFA 2VGCC 3SI3H 1HFDA 1UK4A 3SJKA 1O36A 3I78A 1L4DA 2Y5GA 2O8UA 5EXLA 4AORA 1O5FH 1O2OA 2OBOA 1NU7B 3MMGA 4TY7A 1GJ8B 1XVOA 2ZU2A 4PROA 1Z8IB 3SNBA 1NM6A 3A8AA 3SU6A 5DJ7A 3P6ZB 2OC7A 1YPEH 2P3TB 3ZYEA 3RU4E 3F9HA 1HRTH 1Y8TA 5IDKA 1AZZA 4INKA 1BUIA 5GCHG 1WTGH 4TY6A 1GVZA 1VGCB 3A7XA 1O3KA 3S9AA 1ZGVA 1SQTA 4BANB 1KIGH 2EI7A 4O97A 2P94A 1V2NT 3L6PA 3MU0A 3ZVAA 4CRGA 1G3CA 2ZFPH 1QBOA 1QTFA 1KSNA 3ZZ5A 2HVXA 1SLUB 1WAYB 1T4VH 3ZYDA 1L1JA 4JZ1A 1AD8H 1DY9A 1D3PB 1F0SA 3RC6A 4F4OC 3RXEA 1OPHB 4KELA 3PMHB 2WV5A 1C5WB 1VITG 1YKTA 3HGPA 2FTMA 3FP6E 3UUZA 4GCHF 5EW1H 1FAKH 4THNH 1HXFH 1A5HA 5ABWA 1YF4A 4AOQA 3LGIA 1DLKB 1HDTH 1C5UA 1CVWH 1KLJH 2GMTB 4K8YA 1A0LA 1C2IA 1V2JT 2BXUH 3P17H 4NCYA 1QA0A 5E0HA 7GCHG 1YCPM 3TITA 1MTWA 3A8BA 3UNSA 1G32B 1AQ7A 1TPAE 1ZMNA 1BRBE 3Q3KA 1QL8A 3ZV9A 1LQEA 2FS8A 1GHBF 2FODA 2ZDMA 3TK6A 2PKSB 2QV1A 3MYWA 7ESTE 4FVDA 2AMDA 5F8ZA 1F0UA 6CHAC 2DE9A 1NO9H 4WVPE 1IQGA 1C2DA 4K3JA 1ZHMA 3UNQA 1FDPA 1N6XA 1O2VA 2FI5E 1TABE 2W26A 1FY3A 2I6QA 3PMAB 1C5RA 1CO7E 3SBKA 4K5ZA 1K28D 2XW9A 2ZPQA 4XE4A 3VPKA 3F68H 2FPZA 1HCGA 3RXQA 2ZGCA 1GJCB 4CH2B 1MKWK 1GDQA 1Y5UT 1EPTC 4I7YH 1TOMH 1SOZA 5A8ZA 1K1PA 3M3TA 1KY9A 4BAOB 4OS5A 1TPSA 2FDAA 5A2MH 2WYJA 1KLTA 1SGFG 1CT2E 1TGBA 4LXBH 1YC0A 3VEQB 2IPHA 1PQAA 1TX6A 1P12E 2R2MB 2VH0A 2PHBA 2FESH 3ZV8A 1C5LH 1ZRKA 1LHGH 3RXBA 5FBEA 3URDA 3PMJA 3CS7A 1BRAA 5JPMH 1C5PA 3DT0H 5LH8A 1H9LB 3Q76A 4YOIA 3U9AH 1EZUC 3RXUA 1NC6A 4DOQA 3A7VA 4MNYA 1BTUA 1AU8A 3FVFB 2BHGA 1C2JA 2H1UA 1ELTA 1QQ4A 3PM3A 1TFXA 1O3AA 1W2KH 2GGVB 3I77A 2ESTE 2QA9E 3ATMA 1QBVH 1U6QA 1EZQA 1LPGB 1MD7A 2C4FH 5FCRA 5GXPA 4NGAH 1HAIH 1MTSA 5AFYH 3GCNA 5DP6A 3DHKH 4NA7A 1GI0A 1OXGA 1W13U 2H5DA 2QXGA 2ZU3A 3FAOA 1AVWA 1A0HB 1O37A 2PTNA 2ZU5A 2QXJA 1O3EA 3KQDA 4X1PU 3SU4A 2ILNA 3Q00A 3SGBE 1JBUH 3E90B 1EKBB 2SGAA 3R0FA 3RDZA 2HPQH 2OLGA 3U69H 1W14U 4BAHB 4BTUB 1O3NA 5JDUB 2D1JA 2ZTXA 1EATA 2GP9B 1EJMA 2JH0D 2QF0A 2XWBI 3SQEE 4CR5A 3A81A 2VWOA 1MKWH 1TE0A 1QNJA 1O5DH 2YOLA 2HNTF 1CE5A 2ZTZA 5EXNA 2V3OH 2VGCB 1PYTC 2J38A 3ITIA 1HJ8A 1EPTA 1ORFA 2SGQE 1NU9A 2BXTH 1N6YA 3SHCH 1O31A 1KLIH 3LGUA 2G81E 1CT4E 1MBMA 3M3VA 1B0FA 2OQ5A 1W7XH 4WH8A 4UFFH 4HFPB 1IQHA 1LMWB 5ESTE 1NY22 1PPZA 3D23A 4YLQH 2ZHWH 2FMJA 2XCFA 1NS3A 1DXPA 1H1BA 3RXGA 1FLEE 1W11U 2J9NA 1OP8A 4ABJA 3P92A 3L33A 3RUOA 3BTWE 1TGNA 4MNWA 5A09A 1Y5AT 2BDCA 3SJ8A 1Y3XA 1THRH 3K6ZA 4O3TA 1MQ6A 4JMYA 1GMCF 1BOQA 2ZPSA 4B1TA 3K2UA 2R9PA 1BRUP 1GHAF 1WOFA 2G4TA 3P8OA 8LPRA 4LK4A 4KTCA 2A31A 3BTGE 1BTXA 3UIRA 3PWBA 1PPEE 1AMHA 1NRPH 1PPHE 3ZVDA 3JZ1B 2VWLA 1K22H 4ZKNU 1A5GH 1O39A 3QTVH 2KAIA 3P95A 1GMHF 4K8BA 1SLVB 2CXVA 1BMAA 3UFAA 1CHGA 4X8UH 3BEFB 4A1TA 2FYRA 1EAUA 4DURA 1ZR0A 4X8SH 2PSXA 1EP5A 2XNIA 1QB6A 3URCA 4A7IB 2PWXA 1NRNH 1GMDF 1W12U 6CHAB 3BSQA 4B2AA 3OU0A 2ULLA 2DE8A 4IN1A 1P3EA 4UFDH 8GCHG 5JBTA 1DVAH 1TNHA 1C2LA 4NIYA 2QC2A 4H6TA 4I8HA 3MU4A 3ZZAA 2FI4E 1RTKA 1SC8U 1BITA 1FY4A 2J4IA 4GCHG 3SJ9A 2BDGA 3RU4D 4NG9H 1GI4A 2BDAA 3KQBA 5I25A 4AG2A 3E6PH 2O8TA 2VIDA 1HJAC 4D9QA 4JK5A 1TMUH 3RP2A 1EPTB 3M36A 4DIIH 3A7WA 4Y8XA 2O9QA 4YOGA 3MI4A 1Z8RA 1OP2A 3TIUA 1TGTA 2XC0A 5EQRA 3BN9A 1NFXA 3ZZ7A 1GHBG 1C4Y2 5E0GA 3S9CA 2V0BA 1T8LA 1WQVH 4GPGA 3VXFH 1SGRE 3RMMH 3M5NA 2A7CA 1OWHA 2VH6A 2BY5X 4YLUA 4ZHAA 3ATIA 1XUHA 4D76A 1V2TT 4AYVB 1VJAU 1C2MA 1OKXA 3Q3XA 1TLDA 2FEQH 1GHVH 2Y81A 1XXDA 3HGNA 2HGTH 5DKMA 2BY8X 2R3YA 4CBOA 3C1KA 5FPYA 1O35A 2XRCA 3HPTB 2Z9LA 4D8NA 3ZZ8A 1C5YB 2QAAA 2WINI 3RXDA 1C2FA 3KQCA 3LJOA 1NPMA 1PQ5A 4BAMB 4WY3A 1O5EH 1O2QA 1TB6H 1W3CA 1DFPA 1Q3XA 1HNEE 2SNVA 4JYVH 1F92A 2H2ZA 1ZTLA 4DIHH 1G3EA 1NRRH 1ESBA 1SL3A 4O03A 3KCGH 3BTDE 1LVBA 2GV7A 3UR6A 2UWOA 1UVUH 1SFIA 1YM0A 5C1YA 1GVLA 1AWHB 2P59A 4NA9H 5LGOA 1O30A 5AHGH 2FOCA 2QY0B 1UTKA 2BYAX 1EAIA 3NUMA 3D62A 1O3BA 3NK8A 2FOHA 2KAIB 5H4IB 5DGJA 1PPGE 3F6UH 3MNSA 4AFUA 1F2SE 2W3IA 1ABIH 3ZVGA 4FUHA 5F8XA 2ZGJA 1JIMA 1O2XA 3E16B 1SG8B 1K1IA 1IQKA 1YBWA 2FXRA 3M35A 3VB6A 2XBVA 1WCZA 1OS8A 3PV4A 2VVUA 4E7NA 1T8NA 1DXWA 1TA6A 2AEIH 4FUGA 1AE8H 2FP7B 2OUAA 5EU8A 1QB1A 1GJAB 1SGDE 1WBGB 3RXCA 3BTHE 1MAXA 3U8RH 2VIPA 1DX5M 4MPUA 1P9UA 1O38A 2BM2A 2TBSA 3EDXB 2WPIS 3SV8A 1YYY1 1P2KA 2Y7ZA 4D7FA 2R2WU 2ZI2H 3KQEA 4GSOA 4DW2U 2A1DB 1O2ZA 4JCNA 3DUXH 3K6YA 1GI3A 2FX4A 2ZHFH 3LC5A 1ZSLA 2F9PA 1GL1A 3OYPA 4AGKA 1W7GH 1PQ8A 3RLWH 4ZH8A 1GG6C 2CHAC 1GDUA 3PLBA 1BJVA 2ZA5A 3BEIB 1AY6H 1E34B 1O3FA 2AIPA 4UDWH 1SHHB 1TA2A 1N8OC 2BQWB 3BTKE 3NWUA 2ODYB 2ZFRH 2UUFB 4ZUHA 1GJ7B 1EZSC 2BB4A 3GCTF 4X1SU 1HAZB 1OSSA 4UONA 3IG6B 5L30H 1G3DA 3CP7A 3G01A 7KMEH 2ZC9H 2BX3A 1H8IH 3LIWA 2GCHF 1S0RA 2BOKA 1FUJA 3FP7E 2VIVA 4WJG2 1SHYA 1ANDA 5L2ZH 2FLBH 4OS2A 1G3BA 1TYNA 1IAUA 1SI5H 2Y80A 4WF8A 3SUGA 1PFXC 4YESB 2A0QB 3S0NA 4Y79A 4YT6H 4CHAC 3BG4C 4A1XA 2G4UA 1EJAA 1BMMH 1MU6B 4FUFA 2D8WA 1KDQA 3U1JB 1O2LA 1JMOH 1NESE 1S85A 5DP9A 4J2YB 1GMCG 5HYOA 5E2OA 1O5GH 4ABBA 5FCKA 1HLTH 1MMJN 5HXFA 1GHAG 5DO4H 1O3IA 4NA8A 3T28A 2F91A 5HMAA 1L0ZA 2TGTA 3H7TA 2AFQB 4X6OA 3A87A 3RXAA 1SMFE 1EOLA 1WV7H 2TPIZ 1O2KA 1HJAB 4ZROA 1O5AB 1C5XB 3SJIA 1UTNA 3LC3A 3TGIE 3A82A 1BTYA 2WPLS 1GMHG 1HV7A 5C67A 4M7GA 1RTLA 5EQSA 1DPOA 2AGEX 4I8JA 3PTBA 2RA3A 4R8TB 5GJ4B 1S84A 2BLOA 3V12A 3GY7A 3ZZBA 2AGIX 1GBCA 3ZVFA 1P05A 2B8OH 5C1UA 4FU9A 1BTPA 4U01A 1P06A 3HK3B 1HAXB 3QX5H 4JYTA 3E91A 1NRSH 1S82A 1BJUA 1B7XB 1TNIA 4R0IA 2ZHDA 2VWMA 4DCDA 2D2DA 2JKHA 3FP8E 1OWIA 4Y0ZE 1BTWA 2K1QA 2Y7XA 3GICB 3LH3A 1VR1H 1P57B 5K7RA 1BHXF 4X2XA 1LHDH 1Z1JA 2EI6A 4IMQA 1K9OE 1ELFA 2FOAA 2P16A 4ABFA 2NU2E 2XC4A 1A3BH 2P93A 1M9UA 1BMLA 1CBWC 1C5VA 2NU0E 3UR9A 2BY6X 2BX4A 1TAWA 3LOXA 1DOJA 4Z6AH 3NPSA 4WXIA 3UTUH 1EZXC 2HNTC 2BD8A 1DWEH 3RXVA 1F7ZA 1YPHC 1T8MA 3LT3A 4ESTE 1P02A 1D6RA 1INCA 1PYTD 2F9OA 2ZKSA 4K69A 4Q2KA 2ZCLP 2NU3E 2SGPE 2DUCA 1C5QA 4Q80A 1SGEE 3SUDA 1GGDC 5BRRE 3A83A 5EPYA 3W94A 4MVNA 3RXRA 4X1QU 2R3UA 3RLYH 4BAQB 1KDQB 1FJSA 1BTHH 1D6WA 2AYWA 1SQOA 3UREA 1TQ0B 3ATLA 1H9IE 2STAE 3CS0A 3LGWA 1G2LA 3B23B 1BMNH