1O2NA

Elaborate manifold of short hydrogen bond arrays mediating binding of active site-directed serine protease inhibitors
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords BETA-TRYPSIN
publication title Elaborate Manifold of Short Hydrogen Bond Arrays Mediating Binding of Active Site-Directed Serine Protease Inhibitors
pubmed doi rcsb
total genus 54
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2003-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1o2nA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1o2nA02
4TPYA 2BDGA 1C5LH 1WYKA 1NO9H 3LU9B 3R3GB 1EKBB 3I78A 1EJAA 1PQAA 2VH0A 4BAMB 3UWIA 2GV6A 4Y0YE 2BOHB 1P8VC 3L6PA 1XXFA 1IAUA 1SLWB 1QJ1B 4YM9A 4K5ZA 2BLOA 1RD3B 2A5KA 1GJBB 3SGAE 1GCDA 1V2OT 2ZDLA 4AOQA 3BEIB 1UK4A 1HFDA 3V7TA 1O2HA 2P95A 3A86A 5EPNA 1ELAA 1S5SA 4WH8A 2FOCA 3ZZ4A 1AE5A 4GAWA 4XOJA 3UR9A 4WMEA 1GBAA 2ZEBA 2BY5X 5GWZA 3W94A 1E0FD 1PYTC 3PV4A 3ZZCA 4TWWA 2W3KA 4A92A 4AYVB 7ESTE 3STIA 4Y8YA 4DCDA 3QGJA 1DWBH 1FPCH 1TBRH 1AFQB 4Y10E 4CRGA 4CBOA 5FBIA 1QIXB 1DFPA 1QGFA 3BTFE 2SFAA 2EA3A 3P70B 1TA2A 2EI8A 3ZVFA 1RTLA 2BD3A 2P16A 2VVUA 5H4IB 5FBEA 3SV9A 1Y3UA 1JBUH 2BVSH 2FOMB 5AVDA 4U01A 1D3TB 3M3VA 1JOUB 1LVMA 2ZDVH 1GHWH 2OTVA 3MU8A 1IQJA 1A3BH 2FOBA 3VB3A 2AMPA 5CE1A 2VGCB 4NIWA 8KME2 4X6NA 1B7XB 3TK5A 7GCHG 2VINA 1ARCA 4I8KA 3SHAH 4UEHH 3C1KA 3AAUA 4GCHG 2ESTE 1GBCA 2IOTA 1SLUB 1CGIE 4LZ4B 1GL1A 3SUEA 2QXJA 4ZUHA 1C9PA 4LXBH 3TH3H 3DFLA 4NZLA 1TWXB 1VR1H 2BDYA 4YESB 1CE5A 1W11U 2GKVE 3GDVA 3EA9A 2C8ZB 3VGCB 1ANBA 2QN5T 4XDEA 1O2SA 3MH7A 3ZZ8A 1E34B 2A31A 3A7ZA 5DGJA 5JB8S 4GHQA 1SQOA 3EA8A 1AWFH 1LMWB 1IQHA 3KQBA 4RKJB 2R9PA 2UUYA 3FAOA 1FPHH 1TNKA 3TGJE 3ATWA 1GJ5H 4K8YA 2O8WA 3BTKE 3BV9B 1P2NA 3BEUA 1O3AA 3MH4A 4X1NU 4YO9A 1ABIH 1GBJA 1F5RA 1UVUH 2UWOA 3UNRA 1TMTH 4SGAE 3ZYEA 2VB0A 2VJ1A 1O38A 1XUHA 4I7YH 1C4U2 2EI7A 2A7JA 3LC5A 4ZXYH 1MBMA 2VWNA 2J4IA 3E0PB 3SQEE 1W8BH 4MDSA 3NCLA 2FI5E 5ETXA 1UTNA 2HNTF 1AUTC 3T29A 2FXRA 1P9UA 2BD4A 1AE8H 1P06A 3HKIB 1SQTA 4K2YA 3NUMA 1PPBH 1G36A 3K6ZA 3S9AA 2ZGJA 4MPVA 3PYHA 1O5EH 5LH8A 3V12A 1MQ6A 3GY5A 1C5XB 2TGDA 3TVJB 1CT0E 1TLDA 1UVOA 4I8HA 4NWKA 3RU4E 1LCYA 1MAYA 4FUEA 2OXSA 3QX5H 1FDPA 4ISLA 2ODYB 1A1RA 3PLBA 1VGCB 3AVZA 1HAHH 1EZUC 2M5TA 1BIOA 1S0QA 1BRUP 3KHVA 4CRCA 1QNJA 1V2JT 2PHBA 1GI7B 5EW2H 1A4WH 1XKAC 1CHGA 4U30A 1TX6A 1JMOH 2ZG0H 1QJ7B 1O3EA 1UTKA 3MFJA 1TYNA 2WV4A 2Y5HA 1GG6C 2Y82A 2ZDKA 2AS9A 3A8CA 2JETB 4SGBE 2XC0A 1AZ8A 1GDQA 2ZTYA 1O30A 2P8OB 3ATIA 2AMQA 1EQ9A 5C5NA 1TNIA 1XUKA 3RXIA 4X6OA 1BMNH 1W7XH 3CS7A 1EASA 1NS3A 1JXPA 2A2XH 1GVLA 3KQEA 4UFFH 2ZWLH 1L1JA 1TFXA 4B2CA 2G52A 1GJ8B 2W7SA 1MKXH 4K60A 3QTOH 1GHZA 2HWLB 1LQDB 1GJ4H 4DW2U 2CF9H 2OC1A 3SHCH 1CA0C 2VH6A 3KNXA 3IITA 3E91A 3LGUA 1ANEA 5C2ZA 1EAIA 2A4RA 5DP4A 5C67A 5FXLA 4I31A 1KDQA 1GI2A 4D76A 1VITH 1BBRK 3UOUA 7GCHF 2R0KA 3RLYH 2ZHDA 5FX6A 5DP7A 2W7UA 4GCHF 1OYTH 1QBOA 2C3SA 5L2YH 1PQ5A 2BQWB 3MU5A 4F4OC 2HALA 5EQSA 3GCNA 4IMQA 2WV5A 3A8BA 3EGKH 1XUFA 2V3HH 3GDUA 2G5VA 1HDTH 5F6MA 1KXDA 3NXPA 3TJVA 1ZHMA 1EAWA 1N8OB 4FUFA 4O9VA 2TBSA 2CHAB 1ZJKA 1GBDA 1CBWB 3A8DA 4OS2A 1OP8A 1O5FH 5I25A 3MU0A 1BTHH 3RXTA 1C1TA 3M5LA 1O2QA 4YOJA 1XUIA 1K1OA 1TALA 4GPGA 5E0JA 3UFAA 1C1WH 3RC5A 1SBWA 1F0SA 2F9PA 2FTMA 3GY7A 1GBLA 4ESTE 5JYIA 1JRTA 1LHGH 1V2ST 1NROH 3BIVH 3Q77A 2ZTZA 4A1VA 3UQVA 1P11E 2SNWA 3U8OH 2V35A 1UHBB 1SPJA 1BMLA 1P05A 3ZZBA 4I8LA 2ODQA 3QK1A 1BTXA 4YT6H 1ELEE 2B8OH 2FOFA 3KN2A 4AG1A 1J8AA 2C8XB 2BDIA 1UCYH 4ZKSU 1QR3E 5T3HA 2O8MA 1QRZA 3VFEA 4YOIA 2GP9B 1H9HE 2CMYA 3ESTA 1AZZA 4Y71A 4BAHB 3PO1B 1TGTA 1O2KA 1AI8H 1JIMA 2YOLA 2C8WB 1O2OA 1TX7A 4D9QA 3RMMH 3R0FA 3S7KB 5F8TA 5FPYA 3SJ9A 4DY7B 1E36B 3A83A 1SOTA 4CHAC 2O9QA 3MH5A 2BHGA 1LVBA 1F92A 1ZRKA 4ABBA 4ISHH 4WF8A 4DGJA 2VIDA 5FCRA 4UFGH 1G30B 4FUIA 1ZMLA 1IQGA 2P3UB 1DT2A 4KTUA 2XCFA 3A8AA 5C20A 2QF0A 1YPHE 1EUFA 2VIOA 3VB5A 4DURA 1C5WB 3DT0H 1BMAA 2GCTB 3P95A 4YOGA 1QBNA 5LGOA 2ANWA 3T25A 1O3MA 1SC8U 1C2JA 2ZFTA 1C5ZB 4F49A 2BY8X 2ZDMA 3GY8A 1RGQA 5E2OA 2QXGA 3PMJA 4TPIZ 4I32A 2A4QA 1O0DH 3SZNA 3T2NA 1ZMNA 3M5NA 1WU1A 4IS5A 1SGRE 1GDNA 3OYPA 3Q76A 1S85A 4B2AA 1W12U 3M7QA 2BY6X 2CJIA 2F3CE 1BRBE 8ESTE 1O2WA 4A5TS 2QIQA 2STAE 2RDLA 1UTPA 1G37A 1AWHB 3P8GA 3E3TA 3M35A 1CT4E 2Z9KA 5BRRE 5DJ7A 2B9LA 1O5DH 2I6SA 3KQDA 4O97A 1CGJE 2GMTC 2OCVB 3LONA 1SGFA 2HVXA 3RXUA 2Z9LA 4DOQA 3GOVB 1GVZA 4AFZA 3M61U 2OD3B 1BT7A 2ZA5A 3RXBA 5T6FA 3URDA 3A7WA 1AQ7A 3LKWA 6ESTA 2BM2A 3SNBA 1EX3A 2UUFB 4INLA 5GCHG 1VJ9U 1U6QA 1WSSH 1C1SA 3B8JA 1L2EA 5ESBA 3MHWU 1Y59T 1W3CA 4IGDA 2VIQA 2Y7ZA 4CH8B 5EXMA 1YPHC 1NRQH 2ILNA 2PKAB 4UONA 1IQKA 2FOEA 5EU8A 1YP9A 4X8SH 3F9FA 4AN7A 3UNQA 2XTTB 1GI0A 2R3UA 4MNXA 2WPMS 4I33A 3GYLB 3BTWE 3P8NA 2A4OA 1UHBA 1DX5M 3RXLA 4FVBA 5EXNA 2XCNA 2OBQA 4Q7XA 1TQ7B 3MYWA 1ZPCA 3LH3A 1Z1JA 1HYLA 3A80A 1UK3A 3RC4A 2GTBA 3TJUA 1Z8GA 3GCTG 2BLQA 1HAOH 1K1PA 2FMJA 1A5HA 1IOEA 1SGPE 2A5IA 4BTUB 4NSYA 2ZO3H 3M3SA 1NRPH 1TPPA 3A89A 5CHAC 4YTAA 4R8TB 1QRWA 4O03A 2SGFE 4B74A 4B71A 1C1VH 3E1XB 2ANMH 4JK5A 4RKOB 3L33A 1NZQH 2FX4A 5TJXA 1OWDA 2BMGB 5PTPA 1VCQA 3AASA 4ZXXH 1NPMA 6GCHG 3FFGA 3Q3XA 1QB9A 2XBXA 3B9FH 1P01A 2VIVA 2FO9A 1AIXH 1O2LA 2ZCKP 3UQOA 1DUAA 1DSTA 1OWIA 1SLVB 1TPSA 2TGTA 3LJJA 1SGDE 1OOKB 2GVFA 1CO7E 1Y3WA 3KEEA 2GGVB 5J4SA 4K1TA 2C93B 4NA9H 3VB6A 1KLTA 5I46H 2A2QH 5JBAS 1KSNA 5C1YA 1SHHB 4YT7H 3ATLA 1BTYA 4JZEH 1QL7A 4DIIH 2PSYA 1S82A 2Y6TA 5L6NH 1C5VA 1EB1H 1YGCH 2TGAA 1S81A 4D7FA 3H7OA 2PTCE 3GISB 2ZDAH 1D4PB 3D62A 3MOCA 2VNTA 3RMNH 3SNEA 4BNRA 1IQNA 1Y5AT 4YLUA 4X2VA 5A8XA 5E0HA 1O2GH 2VWOA 4A6LA 2ASUB 5GPIB 2IPHA 1GBEA 4ABEA 1OWEA 1YM0A 1QA7A 3SQHE 1FN8A 1EB2A 2SGAA 3BTTE 4GSOA 1K2I1 1V2PT 2Y5FA 3BG4B 4D9RA 1LTOA 1RJXB 1INCA 2F91A 3TNTA 5K0HA 2TGPZ 1NY22 1AFEH 5C1XA 1BJUA 1O3KA 3HK6B 1Y3YA 1GHVH 2ZNKH 1V3XA 3VB4A 1P2QA 1UJ1A 2PWXA 3VXEH 3TIUA 3N7OA 2A7CA 4JZFH 3KCGH 3U98H 1BZXE 1K21H 3SV6A 1HGTH 3A7XA 2GDDA 2D2DA 1O3IA 1QB1A 1G2MA 3ATMA 4JK6A 1P2MA 2K1QA 4NWLA 2GDEH 1A2CH 1UK2A 2P94A 1DITH 1MAXA 1WCZA 5DP3A 4B76A 1TNLA 1SHYA 1Y5UT 2BLWA 4NG9H 1TIOA 3QWCH 2UUKB 2BD8A 2SGQE 2B5TB 2SNVA 1BBRH 2PKAA 2HLCA 1C5PA 2Q6DA 4IW4E 2JH5D 4HFPB 6CHAC 1ZRBA 4IN2A 5GCHF 1BCUH 1C5QA 3T27A 1MTUA 2PKSC 3BSQA 1GJAB 1OWKA 4DIHH 1GL0E 1KLJH 1LPZB 1O2UA 2ZHQH 2GZ8A 1PPHE 4GHTA 1AB9B 2PUXB 2WPIS 1GMCG 4Y8XA 5FPSA 3V3MA 3A85A 3PROA 3OU0A 1P10A 3RM2H 4BAKB 4B1TA 1T8NA 4XBBA 4PROA 3BG8A 1ZGVA 1CU1A 1DLKB 2P3TB 3BTHE 2FX6A 2A5AA 3KF2A 3LJOA 1XVOA 4RN6A 1FZZA 1EZXC 4ZMAH 1V2UT 1O2TA 1MBQA 1XUJA 1HLTH 1FI8A 2QAAA 2FOGA 3F1SB 3QDZB 3QN7A 3GCTF 3HGPA 1OKXA 3SO3A 2WPJS 3U8RH 3TH4H 1HNEE 1GHYH 4THNH 1GCTB 4X6MA 2DUCA 5E2PA 1D9IA 1ELBA 2V0BA 2H2ZA 1IQFA 1H1BA 4E05H 1H8DH 2FI3E 3NKKA 2A7HA 4A1TA 3ZVCA 4X1QU 3ZZ3A 3ZVGA 3SUDA 1PPZA 4AB9A 1HUTH 1H8IH 1NRRH 2H9TH 1Z8JB 1YPLH 6GCHF 1C1OA 1O35A 4ISIH 3P92A 4Y8ZA 3DD2H 1A7SA 1ZTKA 2VWLA 2FDAA 4XSKU 1SB1H 3M36A 3MO3A 4I8JA 1AFQC 1AN1E 3T5FH 1HAVB 2FPZA 1KY9A 1RIWC 2A0QB 2HGTH 1D6WA 1UVPA 4FU7A 3S69A 1DXWA 2FOAA 3IWMA 3RU4D 2PW8H 5JDUB 1HIAA 1LKAA 3U8TH 4NFEA 1V2TT 1DDJA 5GXPA 3TITA 1GJ6A 2YNBA 1QA0A 5K7RA 2ZGHA 1SI5H 2ANYA 2WINI 2BDCA 2PFEA 2VGCC 4H42U 4UFEH 1YLCA 4TWYA 1WUNH 2CN0H 1DY9A 1N1LA 1S6HA 1TRNA 2F9NA 4B2BA 2ZGCA 1ZJDA 4MLFB 1O33A 1K1MA 2BD5A 1FLEE 2R3YA 1TONA 1C4V2 4FUHA 1WQSA 1F7ZA 2ALVA 2LNCA 1ID5H 5JPMH 1ZSJA 3ENSB 1E35B 2R2WU 5EOKA 2ALPA 4FVDA 3VGCC 1AGJA 3OX7U 4ISNA 2A1DB 4ZHMU 1NU7B 3GDSA 3LDXH 1TBZH 4H6SB 2OUAA 2QXHA 1LVYA 1SLXB 2H9EH 5G4BA 3EE0B 3PMBB 1NFXA 5E0GA 3ZYDA 2RA0A 1GWAA 3MU4A 4TY6A 4FUCA 3QZQA 4JYVH 2J95A 2BY7X 2WUBA 1NTPA 5EODA 4ABFA 5A8YA 1TNJA 5ABWA 1TOCB 4E7NA 1G9IE 1RS0A 1QL8A 2BY9X 2O8TA 3WY8A 3U9AH 5TCCA 1HJ9A 5SGAE 2TIOA 3ODFA 3ELAH 2XWAA 1RFNA 4INKA 1O3JA 1ELFA 4OGXA 2VIWA 5EGMA 1X7AC 3F9EA 5F03A 1QY6A 2BVRH 3DA9B 1P02A 4WY3A 2GZ7A 1LQEA 4KP0A 1O2PA 2OC0A 3MI4A 4AG2A 4NA8A 3NPSA 2QF3A 1K1JA 1O2RA 1ETTH 1C1QA 1HJAC 1OSSA 1BHXF 1GMCF 4Y0ZE 1F5LA 1F2SE 2AGIX 3PLKA 3VXFH 1P2KA 1MH0A 2ZPSA 1C4Y2 3EAJA 5A0AE 2AGGX 3ODDA 4QT8C 3IG6B 1IQEA 1C9TA 1Q31A 2Y5GA 3OY6U 5FHTA 1Z8IB 3S9CA 1WAYB 5DKMA 1NFWA 1VGCC 1YCPH 3MO6A 1QHRB 3SUFA 5JBCS 1S6FA 3SW2B 4MQAA 1D3PB 2JH0D 1EPTB 3LH1A 1SFQB 2FS9A 1L1GA 3A7TA 5FX5A 2J38A 3UREA 1HXEH 3SV2H 3TK9A 3MNXA 4WVPE 4XBCA 2ZQ1A 3SI4H 1A0JA 3D65E 2GT8A 3JZ2B 5E8EH 1E38B 1LHDH 3RXVA 2ZCHP 1THRH 1MKWH 3FP7E 1TPOA 1G2LA 3ZVEA 1W13U 2BDHA 4X6PA 1MCVA 2H5DA 3BTGE 1KXEA 3ZZ5A 1SGCA 4Y7AA 1V2MT 2Z3EA 2ZP0H 1O5GH 3BTEE 5DG6A 1HAVA 4A1XA 5AFZH 3RXDA 3MNCA 1Y3VA 4J1YA 1ESBA 1FIZA 1KXCA 3SN8A 2DE9A 2I6QA 4R0IA 5AF9H 1TGCA 1ZOMA 1CT2E 2PR3A 4AZ2B 4UDWH 2XC4A 3H5CB 3UNSA 1OS8A 4MVNA 1MTNB 2UWPA 4WJG2 3A88A 3M37A 1MD8A 4J2YB 1KXFA 4FU8A 3E0NB 1Q3XA 3BTDE 5DP8A 1LPGB 3RXCA 3SV8A 3MNBA 1QL9A 2J34A 2TRMA 3SJKA 3TLOA 5B6OA 4NIVA 1BJVA 4MPWA 2XRCA 4KKDA 1HPGA 1HAPH 2BYAX 1DOJA 5FCKA 4HGCA 3QO6A 1SL3A 4K1EA 1V2WT 1KYNA 3RXHA 2PLXA 3D23A 1GI9B 1GI3A 4UD9H 1G3DA 1W2KH 4WH6A 3D49H 4HZHA 1O3FA 3U69H 1NESE 2OP9A 3ZZ7A 3RP2A 1C5MD 1OWJA 3SNDA 4ABIA 1GBHA 1O3CA 1N8OC 1GBBA 1GBTA 2F9OA 2CHAC 2SGDE 2ZTXA 1QQ4A 1CBWC 1MQ5A 3URCA 2WPKS 4FXGH 3P8FA 2SGPE 4HI3A 1P04A 3PB1E 2NU3E 3I29A 1GJ9B 4IC5A 1N6YA 4IMZA 1FV9A 4IN1A 4CREA 3NK8A 3S0NA 1T8MA 2JH6D 2GX4A 4AFQA 4BTTB 3NWUA 2QY0B 4MG3A 5IYTA 2A32A 2XXLA 1TPAE 2W5EA 2W26A 2ZGXH 3SI3H 1P2OA 1SGIB 1GJ7B 2FLRH 4JCNA 2SGEE 3MWIU 1H9LB 1SGYE 3RXMA 3KGPA 1YYY1 2Y80A 3STJA 4Q2KA 1GBIA 2BZ6H 2F83A 2BX3A 2Z7FE 1O3NA 5HXFA 4ASHA 2FOHA 1NN6A 9ESTA 2FYQA 2Z9IA 3EQ0H 1EJMA 3SU5A 5GIBA 1LHCH 1WTHD 2RG3A 2W3IA 3NZIA 3PO1C 3Q00A 1C2FA 1C5YB 3KL6A 1BTZA 1TE0A 1GPZA 2A45B 4NZQA 2H6MA 4WMFA 1EPTA 4Y6DA 1TGSZ 1IQLA 1T8LA 4ZKNU 3M3TA 4X8VH 3KQCA 1V6DA 3A84A 2FIRH 1AVXA 4CBNA 1GGDC 1SVPA 3GCOA 3W95A 1ZR0A 1ACBE 3T28A 3MNSA 1UMAH 2VU8E 5L30H 1HXFH 1UTQA 5J4QA 2XC5A 3GY2A 5HYOA 1QJ6B 3CP7A 3K9XB 1FQ3A 1FY8E 2PGBB 1V2VT 4DG4A 1K1NA 1MKXK 3Q3YA 2ZZUH 3SJ8A 3BTME 2QGRA 4BOHA 4ABHA 1AO5A 1BQYA 1DLEA 3GCHB 1N6XA 1OYQA 3UTUH 1BRAA 1BTPA 1MMJN 3P8OA 4BXWA 1QTFA 3TU7H 3RLWH 2XYAA 4NSVA 1J16A 1A5GH 2ZKSA 4INHA 5FPTA 1K22H 1RRKA 2UWLA 4WMDA 3AAVA 1ZSLA 1EJNA 1H4WA 1ELVA 1XXDA 4LZ1H 1QBVH 3RXAA 1SGFG 3MO9A 4B73A 1FIWA 3MTYA 4WWYA 1F0TA 3FVFB 1C5UA 2ZU5A 1XUGA 4CRFA 4LK4A 1O3PB 3SGBE 2CXVA 2ANKH 1RXPA 2P59A 1C2EA 1QB6A 1XX9A 1HAGE 3O8RA 2Z9JA 5A2MH 1Y3XA 1PYTD 3SU1A 4BTIB 3RC6A 2ZCLP 5CMXH 1A0LA 1LPKB 3EDXB 2AYWA 2D26C 2O8LA 1TMBH 2ZU1A 1KLIH 2AIQA 2ZFQH 1BOQA 2G4UA 2GV7A 1TOMH 1XMNB 7KMEH 2Z9GA 5DP6A 1YCPM 3FP8E 4MPUA 1XKBC 3TK6A 3PMAB 1CQQA 2HRVA 1ESTA 5F8ZA 1FY4A 1MTSA 2FP7B 1P9SA 1V2LT 1W0YH 2XBVA 1VCWA 1TAWA 2ZU4A 2PGQB 2G8TA 2RCEA 3KIDU 3TNSA 1GHAG 3BIUH 1V2NT 4ABAA 5DPAA 1EOJA 2BQ7B 4BAQB 2BDAA 3V0XA 5T6DA 2FODA 6CHAB 4AFSA 5JBTA 5LPEA 1O3DA 1C1UH 2OC7A 3ZZ9A 2WYGA 1O5BB 1UVSH 2PKSB 2GCHG 1C5SA 1GHBG 4AGKA 4CR9A 1GI5A 1SFIA 1O2VA 3P17H 3LGTA 3O8BA 2NU2E 1CVWH 2WUCA 5EPYA 4D8NA 4X8UH 1FAKH 4KTSA 1FY5A 3CS0A 2JKHA 4K1SA 1ANDA 3RM0H 1O2XA 2FZZA 4X2YA 1OP2A 4Q7YA 2ZFFH 3ZV8A 3FZDA 1PQ7A 2FWWA 1BMMH 1SGNE 2G55A 3F68H 4JZDH 1MZDA 1ETRH 2OINA 1VCPA 4KGAA 1EOLA 5EQRA 1HBTH 4YZUA 4Y7BA 1UCYE 2EI6A 2ODPA 2IJOB 2QXIA 1DY8A 1TNHA 1HAXB 2G5NA 2C8YB 1OX1A 1SQAA 3EA7A 1BTWA 1GVKB 2LPRA 3I77A 4VGCC 4BXSA 1NRSH 5JBBS 1Z1IA 5DP5A 1QURH 1ZMJA 2P3FH 3SNAA 4Z6AH 1CGHA 2STBE 4NFFA 3ZZDA 3QLPH 1O39A 1G3CA 1ZGIA 1UTJA 2QV1A 4OS5A 1QCPA 1YPGH 1ELTA 4WXIA 1O3BA 1RIWB 1AHTH 2J92A 3EYDA 3LGWA 1FMGA 1L4DA 4ISOA 4A7IB 1KTSB 1HCGA 8LPRA 1V2QT 2ULLA 1C1MA 1K1LA 3RDZA 2GD4B 3PWCA 5A0BA 1MTWA 2FLBH 3BG4C 1P09A 3LGYA 4JZIA 1P2IA 8GCHG 2ZF0H 3SOSA 1S83A 1ZZZA 1DWCH 2Z3DA 4IBLH 3SNCA 1VZQH 3O8DA 1EP5A 1WTGH 2AIPA 1HJ8A 1T4UH 1KDQB 1PPGE 4AGJA 2NU1E 1O37A 2CGAA 1AVWA 1T32A 4AB8A 4ZAEA 2WPLS 4AYYB 3V13A 1EAXA 3F9HA 1WV7H 1HB0B 3O8CA 1MU6B 1T4VH 5F8XA 2ZHWH 1GG6B 1DUEA 2BLVA 3AW0A 3UPEA 5DP9A 1ZSKA 1MTVA 1Y5BT 1W7GH 3SU2A 1HV7A 1FY1A 1FAXA 2A4GA 4O3TA 2QYIA 1ELDE 4ZKOU 3SORA 3TPIZ 1L4ZA 2Y81A 3A82A 1P3EA 1HRTH 1HAIH 1NC6A 1TMUH 3FANA 3LT3A 1AY6H 2Z6BD 4X1RU 4MTBA 4WXVA 4ZHAA 1O5AB 2G81E 2BD9A 1GHAF 1GMDF 2BOKA 3VB7A 1LO6A 3U1IB 5AHGH 1OXGA 2ZHFH 1S0RA 3GY4A 1QRXA 3UOPA 2VVVA 9LPRA 2HOBA 3F6UH 1IQIA 1AB9C 1C5RA 3DHKH 1TRMA 1DPOA 4K8BA 1CA0B 2G4TA 1ZYOA 2ZPRA 1C2HA 4IC6A 1O34A 2J9NA 2GCHF 1VITG 1C5TA 1GHBF 1MD7A 4AFUA 2F9UA 2PSXA 3E16B 1LKBA 1E37B 1K1IA 1ABJH 1HJAB 4I8GA 1O2MA 4JZ1A 3TJNA 2OQUA 1YPEH 5TCAA 2B0FA 1A0HB 4CRAA 1F0RA 4YLQH 2H9HA 5EQQA 1YKTA 1KTTB 1GCTC 1KXAA 3A7YA 2NU4E 1HAYB 3QTVH 4MNVA 1L1NA 1ARBA 2OBOA 1V2KT 1P2JA 1O2IA 3ZVDA 3L3TA 5BPEA 2PV9B 1GJDB 1TX8A 2GT7A 1C1NA 4ZKRU 4OS4A 1T31A 5GJ4B 4U32A 2ZU2A 4OS7A 4X1SU 1J14A 1YBWA 1ETSH 2EEKA 4E7RG 1DICA 1GBMA 2J94A 4HTCH 1AMHA 3U1JB 2Z94A 3SU4A 4OS6A 1O2JA 1TRYA 4NGAH 1LDTT 4DJZB 1AKSB 4DVAU 3ZVAA 1AVGH 2ZQ2A 1S84A 1LHEH 3SV7A 1QFKH 5A8ZA 2XNIA 1WOFA 5LPFA 2AFQB 1DE7H 2Q1JA 3S9BA 3P6ZB 1T7CA 4XFQA 1KXBA 2G00A 4LOYH 1EP6A 2C90B 5DK1A 1K9OE 1RTKA 4U2WA 1NU9A 1SG8B 2D1JA 1B5GH 3C27B 2HPQH 1F0UA 3RXRA 1JRSA 1Z6JH 1L0ZA 1A61H 2XW9A 1TQ0B 3M7UA 1DANH 2YNAA 1EZQA 3ATKA 1SGEE 4ZHLU 1IHTH 2VVCA 1ELGA 1BDAA 2BZAA 1WQVH 1BRCE 3JZ1B 3QGNB 3LC3A 3PLPA 1DWEH 2C4FH 2ZFPH 3LGVA 1D3DB 1P57B 1O5CB 1PQ8A 2ZGBH 1PPCE 5C1UA 8GCHF 4TY7A 2R2MB 1PFXC 1C2KA 3MU1A 3HATH 4CHAB 1O2ZA 1FXYA 3DFJA 3ZVBA 1T8OA 1GBFA 4UFDH 2O8UA 2NWNA 2GZ9A 1CHOG 2JETC 4MNWA 1MCTA 4B75A 2Y7XA 2THFB 3RXKA 1AD8H 1WBGB 4Y11E 2AEIH 2XWBI 4OS1A 2D8WA 1NFYA 5LPRA 3RXJA 2V3OH 1TNGA 2P8OC 1Z71A 2FESH 3M5MA 3TJOA 1BUIA 3RXPA 1O3GA 3SU0A 2PTNA 1DSUA 1BB0B 3GY6A 1IHSH 1CSOE 1NFUA 3A87A 2H5CA 3PWBA 2OLGA 1O3OA 4CRDA 4OGYA 1GI4A 2PUQH 3PMHB 3ZV9A 2ZC9H 3M5OA 3PTBA 2Q6GA 1P3CA 2BX4A 4FUBA 4Y76A 4CRBA 2FM2A 1IQMA 1OPHB 4Q80A 4TYDA 2ZFRH 1B0EA 1BBRE 1ESAA 5HM2A 3LOXA 1UO6A 3K6YA 5ESTE 3T26A 2V6NA 1KIGH 3UIRA 2FEQH 2ZI2H 2H1UA 4MPXA 4X1PU 1EATA 4NIXA 3RXSA 1ZHPA 3AW1A 4KTCA 3F9GA 1NT1A 1O2YA 2HNTE 2HPPH 1J9CH 1MUEB 3MH6A 3LGIA 4X2XA 4X0WU 1DWDH 5IDKA 1TBQH 3BEFB 3LPRA 2J2UA 3HGNA 1VITF 5C3NA 3RUOA 4Q7ZA 2GMTB 1GBKA 7LPRA 1O3LA 3ZZAA 3A81A 1A5IA 2BXUH 2R0LA 1NRNH 1EPTC 4MNYA 4JYTA 1C2LA 2KAIB 1J17T 1TGNA 1SSXA 2AERH 1UTOA 1GHXH 4UE7H 1O32A 3SGQE 1DXPA 1CA8B 1P03A 1J15A 4XBDA 1M9UA 1GGDB 2QCYA 3GY3A 1SGTA 2XBWA 2QC2A 1GDUA 3TGIE 1OWHA 1UTMA 3MMGA 4AORA 2BDBA 2ZFSA 3TH2H 5DO4H 3CENA 3SJIA 3G01A 3RXOA 2BB4A 2P93A 1W0ZU 1YPKH 1SOZA 1AKSA 3UR6A 5C5OA 1GMHG 3HPTB 5EG4A 2AH4X 3ZZ6A 3OTJE 5AFYH 5GDSH 3RXGA 1A46H 1MZAA 1UTLM 3SU6A 2ZPQA 1NM6A 3HKJB 4ABJA 2WYJA 1Y8TA 4BAOB 1JWTA 4D7GA 2BD7A 2WPHS 2AMDA 1BITA 2VIPA 4FUGA 4CH2B 1MTNC 2RA3A 4M7GA 1ELCA 2BD2A 2AGEX 1LVOA 1O3HA 1TB6H 1ZLRA 3RU4T 1C1RA 3RXEA 1GI6A 2ZU3A 1V2RT 5CHAB 6LPRA 3K2UA 4KELA 4E06H 3RMLH 3DUXH 2HNTC 2IN2A 4GLYA 4ZH8A 2Q6FA 1TABE 1ZTLA 1ZTJA 1FJSA 2XBYA 4AX9H 5EXLA 3QUMP 1FUJA 3BTQE 2G51A 3HK3B 1BHXB 3LIWA 3SUGA 2FS8A 3PM3A 1ZPZA 4RSPA 4ABDA 1C2MA 1YF4A 4ZROA 3M7TA 5HGGA 1HAZB 4K3JA 5A09A 3UUZA 5A0CA 1PPEE 2CF8H 1GI1A 3BN9A 4DT7B 2GCTC 1GJCB 3RXQA 1P12E 3FZZA 1UVTH 3Q3KA 4H4FA 2OC8A 1W10U 1G3EA 3RXFA 1CHOF 1G3BA 1XM1A 2OQ5A 3OSYA 2F9VA 1O2NA 4H6TA 4GVUA 2ZIQH 3BF6H 1JIRA 1RTFB 2BTCE 3T62A 1PJPA 4JYUH 1W14U 2VWMA 3H7TA 3GICB 2FTLE 2B7DH 3SU3A 1C5OH 2ZDNA 3RMOH 1G32B 1DVAH 4Y79A 1O36A 1EZSC 3E8LA 5T6GA 2TPIZ 3PTNA 1D3QB 4O3UA 3GYMA 1YCPK 4FUDA 1O31A 3VEQB 1DS2E 4CR5A 1FNIA 4XE4A 3S7HB 2Z3CA 1Q2WA 1H9IE 1BTUA 1BA8B 1QQUA 4NCYA 2UUJB 1SR5C 1SMFE 1YLDA 1MKWK 1K28D 1C2DA 5L2ZH 1EAUA 1ZHRA 1SGQE 1GI8B 1Z8RA 2BQ6B 3QZRA 1Z6EA 2QA9E 3E90B 4JMYA 2BVXH 5JB9S 2KAIA 1F5KU 3K65B 4NIYA 1AUJA 3OY5U 1VJAU 5HM9A 3FP6E 3SBKA 1P0SH 1YPJH 1MU8B 2NU0E 4BANB 1C5NH 3SJOA 2FI4E 1C1PA 1B0FA 1GMDG 1THSH 5FAHA 1ZPBA 4NA7A 2FYRA 1D6RA 1YC0A 2ZECA 1DM4B 1ORFA 1OP0A 1UCYK 3ITIA 1FY3A 1TGBA 1AU8A 3GCHC 4K69A 4VGCB 4X2WA 3VPKA 5EW1H 3UY9A 4X8TH 5HMAA 1ANCA 3TGKE 1C2GA 1Z7KA 4ABGA 1TA6A 1A3EH 3A7VA 1XVMA 4FUJA 2CV3A 1FONA 1FN6A 1GMHF 2DE8A 4FU9A 2F9BH 4Z0KA 1YPMH 2ZHEH 2EC9H 2BXTH 1HIAB 3B23B 1PPFE 1EXFA 1LHFH 4GUXA 1C2IA 3UWJH 1THPB 3E6PH
chains in the Genus database with same CATH superfamily
4TPYA 2BDGA 1C5LH 1WYKA 1NO9H 3LU9B 3R3GB 4OM9A 1EKBB 3I78A 1EJAA 1PQAA 2VH0A 3GS9A 4BAMB 3UWIA 2GV6A 4Y0YE 2BOHB 1P8VC 3L6PA 1XXFA 1IAUA 1SLWB 1QJ1B 4YM9A 4K5ZA 2BLOA 1RD3B 2A5KA 1GJBB 3SGAE 1GCDA 1V2OT 2ZDLA 4AOQA 3BEIB 1UK4A 1HFDA 3V7TA 1O2HA 2P95A 3A86A 5EPNA 2K8IA 1ELAA 1S5SA 4WH8A 2FOCA 3VG8A 3ZZ4A 1AE5A 4GAWA 4XOJA 3UR9A 4WMEA 1GBAA 2ZEBA 2BY5X 5GWZA 3W94A 1E1QD 1QZ8A 1E0FD 1PYTC 1UW7A 3PV4A 3ZZCA 4TWWA 2W3KA 4A92A 4AYVB 7ESTE 4RI0A 3STIA 4Y8YA 4DCDA 3QGJA 1DWBH 1FPCH 2YMSC 1TBRH 1AFQB 4Y10E 4CRGA 4CBOA 5FBIA 1QIXB 1DFPA 1QGFA 3BTFE 3PRBA 2SFAA 2EA3A 3P70B 1BMFD 1TA2A 2EI8A 3ZVFA 1RTLA 2BD3A 2P16A 2VVUA 5H4IB 5FBEA 3SV9A 1Y3UA 1JBUH 2BVSH 2FOMB 5AVDA 4U01A 1YLNA 1D3TB 3DSGA 3M3VA 1JOUB 1LVMA 2ZDVH 1GHWH 2OTVA 3MU8A 1IQJA 1A3BH 2FOBA 3VB3A 2AMPA 5CE1A 2VGCB 4NIWA 8KME2 4X6NA 1B7XB 3TK5A 7GCHG 2VINA 1ARCA 4I8KA 3SHAH 4UEHH 3C1KA 3AAUA 4GCHG 2ESTE 1GBCA 2IOTA 1SLUB 1CGIE 4LZ4B 1GL1A 2W6ID 3SUEA 2QXJA 4ZUHA 1C9PA 4LXBH 3TH3H 3DFLA 4NZLA 1TWXB 1VR1H 2BDYA 4YESB 1CE5A 1W11U 2GKVE 3GDVA 3EA9A 2C8ZB 3VGCB 1ANBA 2QE7D 2QN5T 4XDEA 1O2SA 3MH7A 3ZZ8A 1E34B 2A31A 3A7ZA 5DGJA 5JB8S 4GHQA 1SQOA 3EA8A 1AWFH 1LMWB 1IQHA 3KQBA 4RKJB 2R9PA 2UUYA 3FAOA 1FPHH 3WWBA 1TNKA 3TGJE 3ATWA 5T1VA 1GJ5H 4K8YA 2O8WA 3BTKE 3BV9B 1P2NA 3BEUA 1O3AA 3MH4A 4X1NU 4YO9A 1ABIH 1GBJA 1F5RA 1UVUH 2UWOA 3UNRA 1TMTH 4SGAE 2J97A 3ZYEA 2VB0A 2VJ1A 1O38A 1XUHA 4I7YH 1C4U2 3W1EA 2EI7A 2A7JA 3LC5A 4ZXYH 1MBMA 2VWNA 2J4IA 3E0PB 3SQEE 1W8BH 4MDSA 3NCLA 2FI5E 5ETXA 1UTNA 2HNTF 1AUTC 3T29A 2FXRA 1P9UA 2BD4A 1AE8H 1MABB 1P06A 3HKIB 1SQTA 4K2YA 3NUMA 1PPBH 1G36A 3K6ZA 3S9AA 2ZGJA 4MPVA 3OFND 3PYHA 1O5EH 5LH8A 3V12A 1MQ6A 3GY5A 1C5XB 2TGDA 3TVJB 1CT0E 1TLDA 1UVOA 4I8HA 4NWKA 3RU4E 1LCYA 1MAYA 4FUEA 2OXSA 3QX5H 1FDPA 4ISLA 2ODYB 1A1RA 3PLBA 5EJZA 1VGCB 3AVZA 1HAHH 1EZUC 2M5TA 1BIOA 1S0QA 1BRUP 3KHVA 4CRCA 1QNJA 1V2JT 2PHBA 1GI7B 2JJ2D 5EW2H 1A4WH 1XKAC 1CHGA 4U30A 1TX6A 1JMOH 3F2FA 2ZG0H 1QJ7B 1O3EA 1UTKA 3MFJA 1TYNA 2WV4A 2Y5HA 1GG6C 2Y82A 2ZDKA 2AS9A 3A8CA 2JETB 4SGBE 2XC0A 1AZ8A 1GDQA 5DN6D 2ZTYA 1O30A 2P8OB 3ATIA 2AMQA 1EQ9A 5C5NA 1TNIA 1XUKA 3RXIA 4X6OA 1BMNH 1W7XH 3CS7A 1EASA 1NS3A 2KCAA 1JXPA 2A2XH 1GVLA 3KQEA 2AHME 4UFFH 1NBMD 2ZWLH 1L1JA 1TFXA 4B2CA 2G52A 1GJ8B 2WSSD 2W7SA 1MKXH 4K60A 3QTOH 1GHZA 2HWLB 1LQDB 1GJ4H 4DW2U 2CF9H 2OC1A 4F48B 3SHCH 1CA0C 2VH6A 3KNXA 3IITA 3E91A 3LGUA 1ANEA 5C2ZA 2F43B 1EAIA 2A4RA 5DP4A 5C67A 5FXLA 4I31A 1KDQA 1GI2A 4D76A 1VITH 1BBRK 3UOUA 7GCHF 2R0KA 3RLYH 2ZHDA 5FX6A 5DP7A 2W7UA 4GCHF 1OYTH 1QBOA 2C3SA 2CK3D 5L2YH 1PQ5A 2BQWB 3MU5A 4F4OC 2HALA 5EQSA 3GCNA 4YXWD 4IMQA 2WV5A 3A8BA 3EGKH 1XUFA 3NRLA 2V3HH 3GDUA 2G5VA 1HDTH 5F6MA 1KXDA 3NXPA 3TJVA 1ZHMA 1EAWA 1N8OB 4FUFA 4O9VA 2TBSA 2CHAB 1ZJKA 1GBDA 1CBWB 3A8DA 4OS2A 1OP8A 1O5FH 5I25A 3MU0A 1BTHH 3RXTA 1C1TA 3M5LA 1O2QA 4YOJA 1XUIA 1K1OA 1TALA 4GPGA 5E0JA 3UFAA 1C1WH 3RC5A 1SBWA 1F0SA 2F9PA 2FTMA 3FN8A 1GBLA 3GY7A 4ESTE 3PV5A 5JYIA 1JRTA 1LHGH 4ZCNA 2V3MA 1V2ST 1NROH 3BIVH 3Q77A 2ZTZA 5FL7D 4A1VA 3UQVA 1P11E 2SNWA 3U8OH 2XNDD 2V35A 1UHBB 1SPJA 1BMLA 1P05A 3ZZBA 4I8LA 2ODQA 3QK1A 1BTXA 4YT6H 1ELEE 2B8OH 2FOFA 3KN2A 4AG1A 1J8AA 2C8XB 2BDIA 1UCYH 4ZKSU 3OTPA 1QR3E 5T3HA 2O8MA 1QRZA 3VFEA 4YOIA 2GP9B 1H9HE 2CMYA 3ESTA 1AZZA 4Y71A 4BAHB 3PO1B 1TGTA 1O2KA 1AI8H 1JIMA 2YOLA 2C8WB 1O2OA 1TX7A 4D9QA 3RMMH 3R0FA 3S7KB 5F8TA 5FPYA 3SJ9A 4DY7B 5CDFE 1E36B 3A83A 1SOTA 4CHAC 2KM0A 2O9QA 3MH5A 2BHGA 1LVBA 1F92A 1ZRKA 4ABBA 4ISHH 4WF8A 4DGJA 2VIDA 3ZIAD 5FCRA 4UFGH 1G30B 4FUIA 1ZMLA 1IQGA 2P3UB 1DT2A 4KTUA 2XCFA 3A8AA 5C20A 2QF0A 1YPHE 1EUFA 2VIOA 3VB5A 4DURA 1C5WB 3DT0H 1BMAA 2GCTB 3P95A 4YOGA 1QBNA 5LGOA 2ANWA 3T25A 1O3MA 1SC8U 1C2JA 2ZFTA 2WZQA 1C5ZB 4F49A 2BY8X 2ZDMA 3EE7A 3GY8A 1RGQA 5E2OA 2QXGA 3PMJA 4TPIZ 4I32A 2A4QA 1O0DH 3SZNA 3T2NA 1ZMNA 2V7QD 3M5NA 1WU1A 4IS5A 1SGRE 1GDNA 3OYPA 3Q76A 1S85A 4B2AA 1W12U 3M7QA 2BY6X 2CJIA 2F3CE 1BRBE 8ESTE 1O2WA 4A5TS 2QIQA 2STAE 2RDLA 1UTPA 1G37A 1AWHB 3P8GA 3E3TA 3M35A 1CT4E 2Z9KA 5BRRE 5DJ7A 2B9LA 1O5DH 2I6SA 3KQDA 4O97A 4DT4A 1CGJE 2GMTC 2OCVB 3LONA 1SGFA 2HVXA 3RXUA 2Z9LA 4DOQA 3GOVB 4XRNA 1GVZA 4AFZA 3M61U 2OD3B 1BT7A 2ZA5A 3RXBA 5T6FA 3URDA 3A7WA 1AQ7A 3LKWA 6ESTA 2BM2A 3SNBA 1EX3A 4F55A 2UUFB 4INLA 5GCHG 1VJ9U 1U6QA 1WSSH 1C1SA 3B8JA 1L2EA 5ESBA 3MHWU 1Y59T 1W3CA 4IGDA 2VIQA 2Y7ZA 4CH8B 5EXMA 1YPHC 1NRQH 2ILNA 2PKAB 4UONA 1IQKA 2FOEA 5EU8A 1YP9A 4X8SH 3F9FA 4AN7A 3UNQA 2XTTB 2IPQX 1GI0A 2R3UA 4MNXA 2WPMS 1OHHD 4I33A 3GYLB 3BTWE 3P8NA 2A4OA 1UHBA 1DX5M 3RXLA 4FVBA 5EXNA 2XCNA 2OBQA 4Q7XA 1TQ7B 3MYWA 1ZPCA 2M2AA 3LH3A 1FX0B 1Z1JA 1HYLA 3A80A 1UK3A 3RC4A 2GTBA 3TJUA 1Z8GA 3GCTG 2BLQA 1HAOH 1K1PA 2FMJA 1A5HA 1IOEA 1SGPE 2A5IA 4BTUB 4NSYA 2ZO3H 3M3SA 1NRPH 1TPPA 3A89A 5CHAC 4YTAA 4R8TB 1QRWA 4O03A 2SGFE 4B74A 4B71A 1C1VH 3E1XB 2ANMH 4JK5A 2IJD1 4RKOB 3L33A 2KR7A 1NZQH 2YMSD 2FX4A 5TJXA 1OWDA 2BMGB 5PTPA 1VCQA 3AASA 4ZXXH 1NPMA 6GCHG 3FFGA 3Q3XA 1QB9A 2XBXA 3B9FH 1P01A 2VIVA 2FO9A 1AIXH 1O2LA 2ZCKP 3UQOA 1DUAA 1DSTA 1OWIA 1SLVB 1TPSA 2TGTA 3LJJA 1SGDE 1OOKB 2GVFA 1CO7E 1Y3WA 3KEEA 2GGVB 5J4SA 4K1TA 2C93B 4NA9H 3VB6A 1KLTA 5I46H 2A2QH 5JBAS 1KSNA 5C1YA 1SHHB 4YT7H 3ATLA 1BTYA 4JZEH 1QL7A 1W0KD 5C0UA 4DIIH 2PSYA 1S82A 2Y6TA 5L6NH 1C5VA 1EB1H 1YGCH 2TGAA 1S81A 4D7FA 5EJ1A 3H7OA 2PTCE 2YMSB 3GISB 2ZDAH 1D4PB 3D62A 3MOCA 2VNTA 3RMNH 3SNEA 4BNRA 1IQNA 1Y5AT 4YLUA 3OE7D 4X2VA 5A8XA 2PP6A 5E0HA 1O2GH 2VWOA 4A6LA 2ASUB 5GPIB 5KEDA 2IPHA 1GBEA 4ABEA 4AC9A 1OWEA 1YM0A 1QA7A 3SQHE 1FN8A 1EB2A 2OK5A 2SGAA 2XOKD 3BTTE 4GSOA 1K2I1 1V2PT 2Y5FA 3BG4B 4D9RA 1LTOA 1RJXB 1INCA 2F91A 3TNTA 5K0HA 2TGPZ 1NY22 1AFEH 5C1XA 1BJUA 1O3KA 3HK6B 1Y3YA 1GHVH 2ZNKH 1V3XA 3VB4A 1P2QA 1UJ1A 2PWXA 3VXEH 3TIUA 3N7OA 2A7CA 4JZFH 3KCGH 3U98H 1BZXE 1K21H 2EQNA 3SV6A 1HGTH 3UAIC 3A7XA 2GDDA 2D2DA 1O3IA 1QB1A 1G2MA 3ATMA 4JK6A 1P2MA 2K1QA 4NWLA 2GDEH 1A2CH 1UK2A 2P94A 1DITH 1W0JD 1MAXA 1WCZA 5DP3A 4B76A 1TNLA 1SHYA 1Y5UT 2BLWA 4NG9H 1TIOA 3QWCH 2UUKB 2BD8A 2SGQE 2B5TB 2SNVA 1BBRH 3MQKC 2PKAA 2HLCA 1C5PA 2Q6DA 4IW4E 2JH5D 4HFPB 6CHAC 1ZRBA 4IN2A 5GCHF 1BCUH 1C5QA 3T27A 1MTUA 2PKSC 3BSQA 1GJAB 1OWKA 4DIHH 1GL0E 1KLJH 1LPZB 1O2UA 2ZHQH 2GZ8A 1PPHE 4GHTA 1AB9B 2PUXB 2WPIS 1GMCG 4Y8XA 5FPSA 2F4LA 3V3MA 3A85A 3PROA 3OU0A 1P10A 3RM2H 4BAKB 4B1TA 1T8NA 4XBBA 4PROA 3BG8A 1ZGVA 1CU1A 1DLKB 2P3TB 3BTHE 2FX6A 2A5AA 3KF2A 3LJOA 1XVOA 4RN6A 1FZZA 1EZXC 4ZMAH 1V2UT 1O2TA 1MBQA 1XUJA 1HLTH 1FI8A 2QAAA 2FOGA 3F1SB 3QDZB 3QN7A 3GCTF 3HGPA 1OKXA 3SO3A 2WPJS 5C94A 3U8RH 3TH4H 1HNEE 1GHYH 4THNH 1GCTB 4X6MA 2DUCA 3F2HA 5E2PA 1D9IA 1ELBA 2V0BA 2H2ZA 1IQFA 1H1BA 4E05H 1H8DH 2FI3E 3NKKA 2A7HA 4A1TA 3ZVCA 4X1QU 3ZZ3A 3ZVGA 3SUDA 1PPZA 4AB9A 1HUTH 1H8IH 1NRRH 2H9TH 1Z8JB 1YPLH 6GCHF 1C1OA 1O35A 4ISIH 3P92A 4Y8ZA 3DD2H 2EY4C 1A7SA 1ZTKA 2VWLA 2FDAA 2KCOA 4XSKU 1SB1H 3M36A 3MO3A 4I8JA 1AFQC 1AN1E 2JIZD 3T5FH 1HAVB 2FPZA 1KY9A 1RIWC 2A0QB 2HGTH 1D6WA 1UVPA 4FU7A 3S69A 1DXWA 2FOAA 3IWMA 3RU4D 2PW8H 5JDUB 1HIAA 1LKAA 3U8TH 4NFEA 1V2TT 1DDJA 5GXPA 3TITA 1GJ6A 2YNBA 1QA0A 5K7RA 2ZGHA 1SI5H 2ANYA 2WINI 2BDCA 2PFEA 2VGCC 4H42U 4UFEH 1YLCA 2J98B 4TWYA 1WUNH 2CN0H 1DY9A 1N1LA 1S6HA 1TRNA 2F9NA 2LP6A 2ZGCA 4B2BA 1ZJDA 4MLFB 1O33A 1K1MA 2BD5A 1FLEE 2R3YA 1TONA 1C4V2 4FUHA 1WQSA 1F7ZA 2ALVA 2LNCA 1ID5H 5JPMH 1ZSJA 3ENSB 1E35B 2R2WU 5EOKA 3F3BA 2ALPA 4FVDA 3VGCC 1AGJA 3OX7U 4ISNA 2A1DB 4ZHMU 1NU7B 3GDSA 3LDXH 1TBZH 4H6SB 2OUAA 2QXHA 1LVYA 1SLXB 2H9EH 5G4BA 3EE0B 3PMBB 1NFXA 5E0GA 3ZYDA 2RA0A 1GWAA 3MU4A 4TY6A 4FUCA 3QZQA 4JYVH 2J95A 2BY7X 2WUBA 1NTPA 5EODA 4ABFA 5A8YA 1TNJA 3UB0A 5ABWA 1TOCB 4E7NA 1G9IE 1RS0A 1QL8A 2BY9X 2O8TA 3WY8A 2LELA 2WPDD 3U9AH 5TCCA 1HJ9A 5SGAE 2TIOA 3ODFA 3ELAH 2XWAA 1RFNA 4INKA 1O3JA 1ELFA 4OGXA 1K0HA 2VIWA 5EGMA 1S6LA 1X7AC 3F9EA 2JJ1D 1QY6A 5F03A 2BVRH 3DA9B 1P02A 4WY3A 2GZ7A 1LQEA 4KP0A 1O2PA 2OC0A 3MI4A 3WWFA 4AG2A 4NA8A 3NPSA 2QF3A 1K1JA 4FOUC 1O2RA 1ETTH 1C1QA 1HJAC 1OSSA 1BHXF 1GMCF 4Y0ZE 1F5LA 1F2SE 2AGIX 3PLKA 3VXFH 1P2KA 1MH0A 2ZPSA 1C4Y2 3EAJA 5A0AE 2AGGX 3ODDA 4QT8C 3IG6B 1IQEA 1C9TA 1Q31A 2Y5GA 3OY6U 5FHTA 1Z8IB 3S9CA 1WAYB 5DKMA 1NBME 1NFWA 1VGCC 1YCPH 1QHRB 3MO6A 3SUFA 5JBCS 1S6FA 3SW2B 4MQAA 1D3PB 2JH0D 1EPTB 3FOAA 3LH1A 1SFQB 2FS9A 1L1GA 3A7TA 5FX5A 2J38A 3UREA 1HXEH 3SV2H 3TK9A 3MNXA 4WVPE 4XBCA 2ZQ1A 3SI4H 1A0JA 4B6EA 3D65E 2GT8A 3JZ2B 5E8EH 1E38B 1LHDH 3RXVA 2ZCHP 1THRH 1MKWH 3FP7E 1TPOA 1G2LA 3ZVEA 1W13U 2BDHA 4X6PA 1MCVA 2H5DA 3BTGE 1KXEA 3ZZ5A 1SGCA 4Y7AA 3N7DA 1V2MT 5HIYA 2Z3EA 2VBCA 2ZP0H 1O5GH 3BTEE 5DG6A 1HAVA 3F2GA 4A1XA 5AFZH 3RXDA 3MNCA 1Y3VA 4J1YA 1ESBA 1FIZA 1KXCA 3SN8A 2DE9A 2I6QA 4R0IA 5AF9H 1TGCA 1ZOMA 1CT2E 2PR3A 4AZ2B 4UDWH 2XC4A 1YWUA 3H5CB 3UNSA 4HG6A 1OS8A 4MVNA 3FO8D 1MTNB 2HVYB 2UWPA 4WJG2 3F0PA 3A88A 3M37A 1MD8A 4J2YB 1KXFA 4FU8A 3E0NB 1Q3XA 3BTDE 5DP8A 1LPGB 3RXCA 3SV8A 3MNBA 1QL9A 2J34A 2TRMA 3SJKA 3TLOA 5B6OA 4NIVA 1BJVA 4MPWA 2XRCA 4KKDA 1HPGA 1HAPH 2BYAX 1DOJA 5FCKA 4HGCA 3QO6A 1SL3A 4TT3D 4K1EA 1V2WT 1KYNA 3RXHA 2PLXA 3D23A 4ACBA 1GI9B 1GI3A 4UD9H 1G3DA 1W2KH 4WH6A 4XD7D 3D49H 4HZHA 1O3FA 3U69H 1NESE 2OP9A 3ZZ7A 3RP2A 1C5MD 1OWJA 3SNDA 4ABIA 1GBHA 1O3CA 1N8OC 1GBBA 1GBTA 2F9OA 2CHAC 2SGDE 2ZTXA 1QQ4A 1CBWC 1MQ5A 2QF5A 3URCA 2WPKS 4FXGH 3P8FA 3KQ5A 2SGPE 4HI3A 1P04A 2RDEA 3PB1E 2NU3E 3I29A 1GJ9B 4IC5A 1N6YA 2L6OA 1FV9A 4IN1A 4IMZA 3NK8A 4CREA 3S0NA 1T8MA 2JH6D 2GX4A 4AFQA 4BTTB 3NWUA 2QY0B 4MG3A 5IYTA 2A32A 2XXLA 1TPAE 2W5EA 2W26A 2ZGXH 3SI3H 1P2OA 1SGIB 1GJ7B 2FLRH 4JCNA 2SGEE 1H8ED 3MWIU 1H9LB 1SGYE 3RXMA 3KGPA 1YYY1 2Y80A 3STJA 4Q2KA 1GBIA 2BZ6H 2F83A 2BX3A 2Z7FE 1O3NA 5HXFA 4ASHA 2FOHA 1NN6A 9ESTA 2FYQA 2Z9IA 3EQ0H 1EJMA 3SU5A 5GIBA 1LHCH 1WTHD 2RG3A 2W3IA 3NZIA 3PO1C 3Q00A 1C2FA 1C5YB 3KL6A 1BTZA 1TE0A 1GPZA 2A45B 4NZQA 2H6MA 4WMFA 1EPTA 1WDIA 4Y6DA 1TGSZ 1IQLA 1T8LA 4ZKNU 3M3TA 4X8VH 3KQCA 1V6DA 3A84A 2FIRH 3N7EA 1AVXA 2W6JD 4CBNA 1GGDC 1SVPA 3GCOA 3W95A 1ZR0A 1ACBE 3T28A 3MNSA 1UMAH 2VU8E 5L30H 1HXFH 1UTQA 5J4QA 2XC5A 3GY2A 5HYOA 1QJ6B 3CP7A 3K9XB 1FQ3A 1FY8E 2PGBB 1V2VT 4DG4A 1K1NA 1MKXK 3Q3YA 2ZZUH 3SJ8A 3BTME 2QGRA 4BOHA 4ABHA 1AO5A 1BQYA 1DLEA 3GCHB 1N6XA 1OYQA 3UTUH 1BRAA 1BTPA 1MMJN 5IK2D 1YY3A 3P8OA 4BXWA 1QTFA 3TU7H 3RLWH 2XYAA 4NSVA 1J16A 1A5GH 2ZKSA 4INHA 5FPTA 1K22H 1RRKA 2UWLA 4WMDA 3AAVA 1ZSLA 3H09A 1EJNA 2RFKC 1H4WA 1ELVA 1XXDA 4LZ1H 1QBVH 3RXAA 1SGFG 3MO9A 4B73A 1FIWA 3MTYA 4WWYA 1F0TA 3FVFB 1C5UA 2ZU5A 1XUGA 4CRFA 4LK4A 1O3PB 3SGBE 2CXVA 2ANKH 1RXPA 2P59A 1C2EA 1QB6A 1XX9A 1HAGE 4RT0A 3O8RA 2Z9JA 5A2MH 1Y3XA 1PYTD 3SU1A 4BTIB 3RC6A 2ZCLP 5CMXH 1A0LA 1LPKB 3EDXB 2AYWA 2KCYA 2D26C 2O8LA 1TMBH 2ZU1A 5C17A 1KLIH 2AIQA 2ZFQH 1BOQA 2G4UA 2GV7A 1TOMH 1XMNB 7KMEH 2Z9GA 5DP6A 1YCPM 3FP8E 4MPUA 2QF4A 1VKYA 1XKBC 3TK6A 3PMAB 1CQQA 2HRVA 1ESTA 5F8ZA 1FY4A 1MTSA 2FP7B 1P9SA 1V2LT 1W0YH 2XBVA 1VCWA 1H8HD 3DSOA 1TAWA 2ZU4A 2PGQB 2G8TA 2RCEA 3KIDU 3TNSA 1GHAG 3BIUH 1V2NT 4ABAA 4TSFD 3N99A 5DPAA 1EOJA 2BQ7B 4BAQB 2BDAA 3V0XA 5T6DA 2FODA 6CHAB 4AFSA 5JBTA 5LPEA 1O3DA 1C1UH 2OC7A 3ZZ9A 2WYGA 1O5BB 1UVSH 2PKSB 2GCHG 1C5SA 1GHBG 4AGKA 4CR9A 1GI5A 1SFIA 1O2VA 3P17H 3LGTA 3O8BA 2NU2E 1CVWH 2WUCA 5EPYA 4D8NA 4X8UH 1FAKH 4KTSA 5KGOA 1FY5A 3CS0A 2JKHA 4K1SA 1ANDA 3RM0H 1O2XA 2FZZA 4X2YA 1OP2A 4Q7YA 2ZFFH 3ZV8A 3FZDA 1KMHB 1PQ7A 2FWWA 1BMMH 1SGNE 2G55A 3F68H 4JZDH 1MZDA 5C0TA 1ETRH 3PV2A 2OINA 1VCPA 4KGAA 1EOLA 2HLDD 5EQRA 1HBTH 4YZUA 4Y7BA 1UCYE 2EI6A 2ODPA 2IJOB 2QXIA 1DY8A 1TNHA 1HAXB 2G5NA 2C8YB 1OX1A 1SQAA 3EA7A 1BTWA 1GVKB 2LPRA 3I77A 4VGCC 4BXSA 1NRSH 5JBBS 1Z1IA 5DP5A 1QURH 1ZMJA 2P3FH 3SNAA 4Z6AH 1CGHA 2STBE 4NFFA 3ZZDA 3QLPH 1O39A 1G3CA 1ZGIA 1UTJA 2QV1A 4OS5A 1QCPA 1YPGH 1ELTA 4WXIA 1O3BA 1RIWB 1AHTH 2J92A 3EYDA 3LGWA 1FMGA 1L4DA 4ISOA 4A7IB 1KTSB 1HCGA 8LPRA 1V2QT 2ULLA 1C1MA 1K1LA 3OEED 3RDZA 2GD4B 3PWCA 5A0BA 3SYJA 1MTWA 2FLBH 3BG4C 1P09A 3LGYA 4JZIA 1P2IA 8GCHG 2ZF0H 3DSPA 3SOSA 2WV9A 1S83A 1ZZZA 1DWCH 2Z3DA 4IBLH 5DSFA 3SNCA 1VZQH 3O8DA 1EP5A 1WTGH 2AIPA 1HJ8A 1T4UH 1KDQB 1PPGE 2K0QA 4AGJA 2NU1E 1O37A 2CGAA 1AVWA 1T32A 4AB8A 4ZAEA 2WPLS 4AYYB 3V13A 1EAXA 3F9HA 1WV7H 1HB0B 3O8CA 1MU6B 2KX4A 1T4VH 5F8XA 2L74A 2ZHWH 1GG6B 1DUEA 2BLVA 3AW0A 3UPEA 5DP9A 1ZSKA 1MTVA 1Y5BT 1W7GH 3SU2A 1HV7A 1FY1A 1FAXA 2KZ4A 2A4GA 4O3TA 2QYIA 1ELDE 4ZKOU 3SORA 3TPIZ 1L4ZA 2Y81A 3A82A 1P3EA 1HRTH 4P00A 1HAIH 1NC6A 1TMUH 3FANA 3LT3A 1AY6H 2Z6BD 4X1RU 4MTBA 4WXVA 4ZHAA 1O5AB 2G81E 2BD9A 1GHAF 1GMDF 2BOKA 3VB7A 1LO6A 2KFWA 3U1IB 5AHGH 1OXGA 2ZHFH 1S0RA 3GY4A 1QRXA 3UOPA 2VVVA 9LPRA 2HOBA 3F6UH 1IQIA 1AB9C 4I86A 1C5RA 3DHKH 1TRMA 1DPOA 4K8BA 1CA0B 3OEHD 2G4TA 1ZYOA 2ZPRA 4Q63A 1C2HA 4IC6A 1O34A 3CNRA 2J9NA 2GCHF 1VITG 1C5TA 1GHBF 1MD7A 4AFUA 2F9UA 2PSXA 3E16B 1LKBA 1E37B 1K1IA 1ABJH 1HJAB 4I8GA 3SZEA 1O2MA 4JZ1A 3TJNA 2OQUA 1YPEH 3PRDA 5TCAA 2B0FA 1A0HB 4CRAA 1F0RA 4YLQH 2H9HA 5EQQA 1YKTA 1KTTB 1GCTC 1KXAA 3A7YA 3AK5A 2NU4E 1HAYB 3QTVH 4MNVA 1L1NA 1ARBA 2OBOA 1V2KT 1P2JA 1O2IA 3ZVDA 5KECA 3L3TA 5BPEA 2PV9B 1GJDB 1TX8A 2GT7A 1C1NA 4ZKRU 4OS4A 1T31A 5GJ4B 4U32A 2ZU2A 4OS7A 4X1SU 1J14A 1YBWA 2JDID 1ETSH 1COWD 2EEKA 4E7RG 1DICA 1GBMA 5B6LA 2J94A 4HTCH 1AMHA 3U1JB 2Z94A 3SU4A 4OS6A 1O2JA 1TRYA 4NGAH 1LDTT 4DJZB 1AKSB 4DVAU 3ZVAA 1AVGH 2ZQ2A 1S84A 1LHEH 3SV7A 1QFKH 5A8ZA 2XNIA 1WOFA 5LPFA 2AFQB 1DE7H 2Q1JA 3S9BA 3P6ZB 1T7CA 4XFQA 1KXBA 2G00A 4LOYH 1EP6A 2C90B 5DK1A 1K9OE 1RTKA 4U2WA 1NU9A 1SG8B 2D1JA 1B5GH 3C27B 2HPQH 1F0UA 3RXRA 1JRSA 1Z6JH 1L0ZA 1A61H 2XW9A 1TQ0B 4RT1A 3M7UA 1DANH 2YNAA 1EZQA 3ATKA 1SGEE 4ZHLU 1IHTH 2VVCA 1ELGA 1BDAA 1E79D 1WQVH 1BRCE 2BZAA 3JZ1B 3QGNB 3LC3A 3PLPA 1DWEH 2C4FH 2ZFPH 3LGVA 1D3DB 1P57B 1O5CB 1PQ8A 2ZGBH 1PPCE 5C1UA 8GCHF 4TY7A 2R2MB 1PFXC 1C2KA 3MU1A 3HATH 4CHAB 1SKYE 1O2ZA 3DCLA 1FXYA 3DFJA 3ZVBA 1T8OA 1GBFA 4UFDH 2O8UA 1EFRD 2NWNA 2GZ9A 1CHOG 2JETC 4MNWA 3WW7A 1MCTA 4B75A 2Y7XA 2THFB 3RXKA 1AD8H 1WBGB 4Y11E 2AEIH 2XWBI 4OS1A 2D8WA 1NFYA 5LPRA 3RXJA 2V3OH 1TNGA 2P8OC 1Z71A 2FESH 3M5MA 3TJOA 1BUIA 3RXPA 1O3GA 3SU0A 2PTNA 1DSUA 1BB0B 3GY6A 1IHSH 1CSOE 1NFUA 3A87A 2H5CA 3PWBA 2OLGA 1O3OA 4CRDA 4OGYA 1GI4A 2PUQH 3PMHB 3ZV9A 2ZC9H 3M5OA 3PTBA 2Q6GA 1P3CA 2BX4A 4FUBA 4Y76A 4CRBA 2FM2A 1IQMA 1OPHB 4Q80A 4TYDA 2ZFRH 1B0EA 1BBRE 1ESAA 2J98A 5HM2A 3LOXA 1UO6A 3K6YA 5ESTE 3T26A 2V6NA 1KIGH 3UIRA 2FEQH 2ZI2H 2H1UA 4MPXA 1WXRA 4X1PU 1EATA 4NIXA 3RXSA 1ZHPA 3AW1A 4KTCA 3F9GA 1NT1A 1O2YA 2HNTE 2KCPA 2HPPH 1J9CH 1MUEB 3MH6A 3LGIA 3U28C 4X2XA 4X0WU 1DWDH 5IDKA 1TBQH 3BEFB 3LPRA 2J2UA 3HGNA 5HIZA 1VITF 5C3NA 3RUOA 4Q7ZA 2GMTB 1GBKA 7LPRA 1O3LA 3ZZAA 3A81A 1A5IA 2BXUH 2R0LA 1NRNH 1EPTC 4MNYA 4JYTA 1C2LA 2KAIB 1J17T 1TGNA 1SSXA 2AERH 1UTOA 1GHXH 4UE7H 1O32A 3SGQE 1DXPA 1CA8B 1P03A 1J15A 4XBDA 1M9UA 1GGDB 2QCYA 3GY3A 1SGTA 2XBWA 2QC2A 5EJLA 1GDUA 3TGIE 1OWHA 1UTMA 3MMGA 4AORA 2BDBA 2ZFSA 3TH2H 5DO4H 3CENA 3SJIA 3G01A 3RXOA 2BB4A 2P93A 1W0ZU 1YPKH 1SOZA 1AKSA 3UR6A 5C5OA 1GMHG 3HPTB 5EG4A 2AH4X 3ZZ6A 3OTJE 5AFYH 5GDSH 3RXGA 1A46H 4ACAA 1MZAA 1UTLM 2WHXA 3SU6A 3KYFA 2ZPQA 1NM6A 5GNDA 3HKJB 4ABJA 2WYJA 1Y8TA 4BAOB 1JWTA 4D7GA 2BD7A 2WPHS 2AMDA 1BITA 2VIPA 4FUGA 4CH2B 1MTNC 2RA3A 4M7GA 1ELCA 2BD2A 2AGEX 1LVOA 1O3HA 1TB6H 1ZLRA 3RU4T 1C1RA 3RXEA 1GI6A 2ZU3A 1V2RT 5CHAB 6LPRA 3K2UA 4KELA 4E06H 3RMLH 3DUXH 2HNTC 2IN2A 4GLYA 4ZH8A 2Q6FA 1TABE 1ZTLA 1ZTJA 1FJSA 2XBYA 4AX9H 5EXLA 3QUMP 4P02A 1FUJA 3BTQE 2G51A 3HK3B 1BHXB 3LIWA 3SUGA 1SQRA 2FS8A 3PM3A 1ZPZA 4RSPA 4ABDA 1C2MA 1YF4A 4ZROA 3M7TA 5HGGA 1HAZB 2GJGA 5F53A 4K3JA 5A09A 3UUZA 5A0CA 4Z1MD 1PPEE 3OAAD 2CF8H 4B6FA 1GI1A 3BN9A 4DT7B 2GCTC 1GJCB 3RXQA 1P12E 3FZZA 1UVTH 3Q3KA 4H4FA 2OC8A 1W10U 1G3EA 3RXFA 1CHOF 1G3BA 1XM1A 2OQ5A 3OSYA 2F9VA 1O2NA 4H6TA 4GVUA 2ZIQH 3BF6H 1JIRA 1RTFB 2BTCE 3T62A 1PJPA 3KYGA 4JYUH 1W14U 2VWMA 3H7TA 3GICB 2FTLE 2B7DH 3SU3A 1C5OH 5CHBA 2ZDNA 3RMOH 1G32B 1DVAH 4Y79A 1O36A 1EZSC 3E8LA 5T6GA 2TPIZ 3PTNA 1D3QB 4O3UA 3GYMA 1YCPK 4FUDA 1O31A 3VEQB 1DS2E 4CR5A 1FNIA 3F0OA 4XE4A 3S7HB 2Z3CA 1Q2WA 1H9IE 1BTUA 1BA8B 1QQUA 2J5UA 4NCYA 2UUJB 1SR5C 1SMFE 1YLDA 1E1RD 3FKSD 1MKWK 1K28D 1C2DA 5L2ZH 1EAUA 1ZHRA 1SGQE 1GI8B 1Z8RA 2BQ6B 3QZRA 1Z6EA 2QA9E 5HKKD 3E90B 4JMYA 2BVXH 5JB9S 2KAIA 1F5KU 3K65B 4NIYA 1AUJA 3OY5U 1VJAU 5HM9A 3FP6E 3SBKA 1P0SH 1YPJH 4Q4LA 1MU8B 2NU0E 4BANB 4FETA 1C5NH 3SJOA 2FI4E 1C1PA 1B0FA 1GMDG 1THSH 5FAHA 1ZPBA 4M9FA 4NA7A 2FYRA 1D6RA 1YC0A 2ZECA 1DM4B 1ORFA 1OP0A 1UCYK 3ITIA 1FY3A 1TGBA 1AU8A 3GCHC 4K69A 4VGCB 4X2WA 3VPKA 5EW1H 3UY9A 4X8TH 5HMAA 1ANCA 3TGKE 1C2GA 1Z7KA 4ABGA 4ASUD 1TA6A 1A3EH 5EIYA 3A7VA 1XVMA 4FUJA 2CV3A 1FONA 1FN6A 1GMHF 2DE8A 4FU9A 2F9BH 4Z0KA 1YPMH 2ZHEH 2EC9H 2BXTH 1HIAB 3B23B 1PPFE 1EXFA 1LHFH 4GUXA 1C2IA 3UWJH 1THPB 3E6PH
chains in the Genus database with same CATH topology
4TPYA 2BDGA 1C5LH 1WYKA 1NO9H 3LU9B 3R3GB 1EKBB 3I78A 1EJAA 1PQAA 2VH0A 4BAMB 3UWIA 2GV6A 4Y0YE 2BOHB 1P8VC 3L6PA 1XXFA 1IAUA 1SLWB 1QJ1B 4YM9A 4K5ZA 2BLOA 1RD3B 2A5KA 1GJBB 3SGAE 1GCDA 1V2OT 2ZDLA 4AOQA 3BEIB 1UK4A 1HFDA 3V7TA 1O2HA 2P95A 3A86A 5EPNA 1ELAA 1S5SA 4WH8A 2FOCA 3ZZ4A 1AE5A 4GAWA 4XOJA 3UR9A 4WMEA 1GBAA 2ZEBA 2BY5X 5GWZA 3W94A 1E0FD 1PYTC 3PV4A 3ZZCA 4TWWA 2W3KA 4A92A 4AYVB 7ESTE 3STIA 4Y8YA 4DCDA 3QGJA 1DWBH 1FPCH 1TBRH 1AFQB 4Y10E 4CRGA 4CBOA 5FBIA 1QIXB 1DFPA 1QGFA 3BTFE 2SFAA 2EA3A 3P70B 1TA2A 2EI8A 3ZVFA 1RTLA 2BD3A 2P16A 2VVUA 5H4IB 5FBEA 3SV9A 1Y3UA 1JBUH 2BVSH 2FOMB 5AVDA 4U01A 1D3TB 3M3VA 1JOUB 1LVMA 2ZDVH 1GHWH 2OTVA 3MU8A 1IQJA 1A3BH 2FOBA 3VB3A 2AMPA 5CE1A 2VGCB 4NIWA 8KME2 4X6NA 1B7XB 3TK5A 7GCHG 2VINA 1ARCA 4I8KA 3SHAH 4UEHH 3C1KA 3AAUA 4GCHG 2ESTE 1GBCA 2IOTA 1SLUB 1CGIE 4LZ4B 1GL1A 3SUEA 2QXJA 4ZUHA 1C9PA 4LXBH 3TH3H 3DFLA 4NZLA 1TWXB 1VR1H 2BDYA 4YESB 1CE5A 1W11U 2GKVE 3GDVA 3EA9A 2C8ZB 3VGCB 1ANBA 2QN5T 4XDEA 1O2SA 3MH7A 3ZZ8A 1E34B 2A31A 3A7ZA 5DGJA 5JB8S 4GHQA 1SQOA 3EA8A 1AWFH 1LMWB 1IQHA 3KQBA 4RKJB 2R9PA 2UUYA 3FAOA 1FPHH 1TNKA 3TGJE 3ATWA 1GJ5H 4K8YA 2O8WA 3BTKE 3BV9B 1P2NA 3BEUA 1O3AA 3MH4A 4X1NU 4YO9A 1ABIH 1GBJA 1F5RA 1UVUH 2UWOA 3UNRA 1TMTH 4SGAE 3ZYEA 2VB0A 2VJ1A 1O38A 1XUHA 4I7YH 1C4U2 2EI7A 2A7JA 3LC5A 4ZXYH 1MBMA 2VWNA 2J4IA 3E0PB 3SQEE 1W8BH 4MDSA 3NCLA 2FI5E 5ETXA 1UTNA 2HNTF 1AUTC 3T29A 2FXRA 1P9UA 2BD4A 1AE8H 1P06A 3HKIB 1SQTA 4K2YA 3NUMA 1PPBH 1G36A 3K6ZA 3S9AA 2ZGJA 4MPVA 3PYHA 1O5EH 5LH8A 3V12A 1MQ6A 3GY5A 1C5XB 2TGDA 3TVJB 1CT0E 1TLDA 1UVOA 4I8HA 4NWKA 3RU4E 1LCYA 1MAYA 4FUEA 2OXSA 3QX5H 1FDPA 4ISLA 2ODYB 1A1RA 3PLBA 1VGCB 3AVZA 1HAHH 1EZUC 2M5TA 1BIOA 1S0QA 1BRUP 3KHVA 4CRCA 1QNJA 1V2JT 2PHBA 1GI7B 5EW2H 1A4WH 1XKAC 1CHGA 4U30A 1TX6A 1JMOH 2ZG0H 1QJ7B 1O3EA 1UTKA 3MFJA 1TYNA 2WV4A 2Y5HA 1GG6C 2Y82A 2ZDKA 2AS9A 3A8CA 2JETB 4SGBE 2XC0A 1AZ8A 1GDQA 2ZTYA 1O30A 2P8OB 3ATIA 2AMQA 1EQ9A 5C5NA 1TNIA 1XUKA 3RXIA 4X6OA 1BMNH 1W7XH 3CS7A 1EASA 1NS3A 1JXPA 2A2XH 1GVLA 3KQEA 4UFFH 2ZWLH 1L1JA 1TFXA 4B2CA 2G52A 1GJ8B 2W7SA 1MKXH 4K60A 3QTOH 1GHZA 2HWLB 1LQDB 1GJ4H 4DW2U 2CF9H 2OC1A 3SHCH 1CA0C 2VH6A 3KNXA 3IITA 3E91A 3LGUA 1ANEA 5C2ZA 1EAIA 2A4RA 5DP4A 5C67A 5FXLA 4I31A 1KDQA 1GI2A 4D76A 1VITH 1BBRK 3UOUA 7GCHF 2R0KA 3RLYH 2ZHDA 5FX6A 5DP7A 2W7UA 4GCHF 1OYTH 1QBOA 2C3SA 5L2YH 1PQ5A 2BQWB 3MU5A 4F4OC 2HALA 5EQSA 3GCNA 4IMQA 2WV5A 3A8BA 3EGKH 1XUFA 2V3HH 3GDUA 2G5VA 1HDTH 5F6MA 1KXDA 3NXPA 3TJVA 1ZHMA 1EAWA 1N8OB 4FUFA 4O9VA 2TBSA 2CHAB 1ZJKA 1GBDA 1CBWB 3A8DA 4OS2A 1OP8A 1O5FH 5I25A 3MU0A 1BTHH 3RXTA 1C1TA 3M5LA 1O2QA 4YOJA 1XUIA 1K1OA 1TALA 4GPGA 5E0JA 3UFAA 1C1WH 3RC5A 1SBWA 1F0SA 2F9PA 2FTMA 3GY7A 1GBLA 4ESTE 5JYIA 1JRTA 1LHGH 1V2ST 1NROH 3BIVH 3Q77A 2ZTZA 4A1VA 3UQVA 1P11E 2SNWA 3U8OH 2V35A 1UHBB 1SPJA 1BMLA 1P05A 3ZZBA 4I8LA 2ODQA 3QK1A 1BTXA 4YT6H 1ELEE 2B8OH 2FOFA 3KN2A 4AG1A 1J8AA 2C8XB 2BDIA 1UCYH 4ZKSU 1QR3E 5T3HA 2O8MA 1QRZA 3VFEA 4YOIA 2GP9B 1H9HE 2CMYA 3ESTA 1AZZA 4Y71A 4BAHB 3PO1B 1TGTA 1O2KA 1AI8H 1JIMA 2YOLA 2C8WB 1O2OA 1TX7A 4D9QA 3RMMH 3R0FA 3S7KB 5F8TA 5FPYA 3SJ9A 4DY7B 1E36B 3A83A 1SOTA 4CHAC 2O9QA 3MH5A 2BHGA 1LVBA 1F92A 1ZRKA 4ABBA 4ISHH 4WF8A 4DGJA 2VIDA 5FCRA 4UFGH 1G30B 4FUIA 1ZMLA 1IQGA 2P3UB 1DT2A 4KTUA 2XCFA 3A8AA 5C20A 2QF0A 1YPHE 1EUFA 2VIOA 3VB5A 4DURA 1C5WB 3DT0H 1BMAA 2GCTB 3P95A 4YOGA 1QBNA 5LGOA 2ANWA 3T25A 1O3MA 1SC8U 1C2JA 2ZFTA 1C5ZB 4F49A 2BY8X 2ZDMA 3GY8A 1RGQA 5E2OA 2QXGA 3PMJA 4TPIZ 4I32A 2A4QA 1O0DH 3SZNA 3T2NA 1ZMNA 3M5NA 1WU1A 4IS5A 1SGRE 1GDNA 3OYPA 3Q76A 1S85A 4B2AA 1W12U 3M7QA 2BY6X 2CJIA 2F3CE 1BRBE 8ESTE 1O2WA 4A5TS 2QIQA 2STAE 2RDLA 1UTPA 1G37A 1AWHB 3P8GA 3E3TA 3M35A 1CT4E 2Z9KA 5BRRE 5DJ7A 2B9LA 1O5DH 2I6SA 3KQDA 4O97A 1CGJE 2GMTC 2OCVB 3LONA 1SGFA 2HVXA 3RXUA 2Z9LA 4DOQA 3GOVB 1GVZA 4AFZA 3M61U 2OD3B 1BT7A 2ZA5A 3RXBA 5T6FA 3URDA 3A7WA 1AQ7A 3LKWA 6ESTA 2BM2A 3SNBA 1EX3A 2UUFB 4INLA 5GCHG 1VJ9U 1U6QA 1WSSH 1C1SA 3B8JA 1L2EA 5ESBA 3MHWU 1Y59T 1W3CA 4IGDA 2VIQA 2Y7ZA 4CH8B 5EXMA 1YPHC 1NRQH 2ILNA 2PKAB 4UONA 1IQKA 2FOEA 5EU8A 1YP9A 4X8SH 3F9FA 4AN7A 3UNQA 2XTTB 1GI0A 2R3UA 4MNXA 2WPMS 4I33A 3GYLB 3BTWE 3P8NA 2A4OA 1UHBA 1DX5M 3RXLA 4FVBA 5EXNA 2XCNA 2OBQA 4Q7XA 1TQ7B 3MYWA 1ZPCA 3LH3A 1Z1JA 1HYLA 3A80A 1UK3A 3RC4A 2GTBA 3TJUA 1Z8GA 3GCTG 2BLQA 1HAOH 1K1PA 2FMJA 1A5HA 1IOEA 1SGPE 2A5IA 4BTUB 4NSYA 2ZO3H 3M3SA 1NRPH 1TPPA 3A89A 5CHAC 4YTAA 4R8TB 1QRWA 4O03A 2SGFE 4B74A 4B71A 1C1VH 3E1XB 2ANMH 4JK5A 4RKOB 3L33A 1NZQH 2FX4A 5TJXA 1OWDA 2BMGB 5PTPA 1VCQA 3AASA 4ZXXH 1NPMA 6GCHG 3FFGA 3Q3XA 1QB9A 2XBXA 3B9FH 1P01A 2VIVA 2FO9A 1AIXH 1O2LA 2ZCKP 3UQOA 1DUAA 1DSTA 1OWIA 1SLVB 1TPSA 2TGTA 3LJJA 1SGDE 1OOKB 2GVFA 1CO7E 1Y3WA 3KEEA 2GGVB 5J4SA 4K1TA 2C93B 4NA9H 3VB6A 1KLTA 5I46H 2A2QH 5JBAS 1KSNA 5C1YA 1SHHB 4YT7H 3ATLA 1BTYA 4JZEH 1QL7A 4DIIH 2PSYA 1S82A 2Y6TA 5L6NH 1C5VA 1EB1H 1YGCH 2TGAA 1S81A 4D7FA 3H7OA 2PTCE 3GISB 2ZDAH 1D4PB 3D62A 3MOCA 2VNTA 3RMNH 3SNEA 4BNRA 1IQNA 1Y5AT 4YLUA 4X2VA 5A8XA 5E0HA 1O2GH 2VWOA 4A6LA 2ASUB 5GPIB 2IPHA 1GBEA 4ABEA 1OWEA 1YM0A 1QA7A 3SQHE 1FN8A 1EB2A 2SGAA 3BTTE 4GSOA 1K2I1 1V2PT 2Y5FA 3BG4B 4D9RA 1LTOA 1RJXB 1INCA 2F91A 3TNTA 5K0HA 2TGPZ 1NY22 1AFEH 5C1XA 1BJUA 1O3KA 3HK6B 1Y3YA 1GHVH 2ZNKH 1V3XA 3VB4A 1P2QA 1UJ1A 2PWXA 3VXEH 3TIUA 3N7OA 2A7CA 4JZFH 3KCGH 3U98H 1BZXE 1K21H 3SV6A 1HGTH 3A7XA 2GDDA 2D2DA 1O3IA 1QB1A 1G2MA 3ATMA 4JK6A 1P2MA 2K1QA 4NWLA 2GDEH 1A2CH 1UK2A 2P94A 1DITH 1MAXA 1WCZA 5DP3A 4B76A 1TNLA 1SHYA 1Y5UT 2BLWA 4NG9H 1TIOA 3QWCH 2UUKB 2BD8A 2SGQE 2B5TB 2SNVA 1BBRH 2PKAA 2HLCA 1C5PA 2Q6DA 4IW4E 2JH5D 4HFPB 6CHAC 1ZRBA 4IN2A 5GCHF 1BCUH 1C5QA 3T27A 1MTUA 2PKSC 3BSQA 1GJAB 1OWKA 4DIHH 1GL0E 1KLJH 1LPZB 1O2UA 2ZHQH 2GZ8A 1PPHE 4GHTA 1AB9B 2PUXB 2WPIS 1GMCG 4Y8XA 5FPSA 3V3MA 3A85A 3PROA 3OU0A 1P10A 3RM2H 4BAKB 4B1TA 1T8NA 4XBBA 4PROA 3BG8A 1ZGVA 1CU1A 1DLKB 2P3TB 3BTHE 2FX6A 2A5AA 3KF2A 3LJOA 1XVOA 4RN6A 1FZZA 1EZXC 4ZMAH 1V2UT 1O2TA 1MBQA 1XUJA 1HLTH 1FI8A 2QAAA 2FOGA 3F1SB 3QDZB 3QN7A 3GCTF 3HGPA 1OKXA 3SO3A 2WPJS 3U8RH 3TH4H 1HNEE 1GHYH 4THNH 1GCTB 4X6MA 2DUCA 5E2PA 1D9IA 1ELBA 2V0BA 2H2ZA 1IQFA 1H1BA 4E05H 1H8DH 2FI3E 3NKKA 2A7HA 4A1TA 3ZVCA 4X1QU 3ZZ3A 3ZVGA 3SUDA 1PPZA 4AB9A 1HUTH 1H8IH 1NRRH 2H9TH 1Z8JB 1YPLH 6GCHF 1C1OA 1O35A 4ISIH 3P92A 4Y8ZA 3DD2H 1A7SA 1ZTKA 2VWLA 2FDAA 4XSKU 1SB1H 3M36A 3MO3A 4I8JA 1AFQC 1AN1E 3T5FH 1HAVB 2FPZA 1KY9A 1RIWC 2A0QB 2HGTH 1D6WA 1UVPA 4FU7A 3S69A 1DXWA 2FOAA 3IWMA 3RU4D 2PW8H 5JDUB 1HIAA 1LKAA 3U8TH 4NFEA 1V2TT 1DDJA 5GXPA 3TITA 1GJ6A 2YNBA 1QA0A 5K7RA 2ZGHA 1SI5H 2ANYA 2WINI 2BDCA 2PFEA 2VGCC 4H42U 4UFEH 1YLCA 4TWYA 1WUNH 2CN0H 1DY9A 1N1LA 1S6HA 1TRNA 2F9NA 4B2BA 2ZGCA 1ZJDA 4MLFB 1O33A 1K1MA 2BD5A 1FLEE 2R3YA 1TONA 1C4V2 4FUHA 1WQSA 1F7ZA 2ALVA 2LNCA 1ID5H 5JPMH 1ZSJA 3ENSB 1E35B 2R2WU 5EOKA 2ALPA 4FVDA 3VGCC 1AGJA 3OX7U 4ISNA 2A1DB 4ZHMU 1NU7B 3GDSA 3LDXH 1TBZH 4H6SB 2OUAA 2QXHA 1LVYA 1SLXB 2H9EH 5G4BA 3EE0B 3PMBB 1NFXA 5E0GA 3ZYDA 2RA0A 1GWAA 3MU4A 4TY6A 4FUCA 3QZQA 4JYVH 2J95A 2BY7X 2WUBA 1NTPA 5EODA 4ABFA 5A8YA 1TNJA 5ABWA 1TOCB 4E7NA 1G9IE 1RS0A 1QL8A 2BY9X 2O8TA 3WY8A 3U9AH 5TCCA 1HJ9A 5SGAE 2TIOA 3ODFA 3ELAH 2XWAA 1RFNA 4INKA 1O3JA 1ELFA 4OGXA 2VIWA 5EGMA 1X7AC 3F9EA 5F03A 1QY6A 2BVRH 3DA9B 1P02A 4WY3A 2GZ7A 1LQEA 4KP0A 1O2PA 2OC0A 3MI4A 4AG2A 4NA8A 3NPSA 2QF3A 1K1JA 1O2RA 1ETTH 1C1QA 1HJAC 1OSSA 1BHXF 1GMCF 4Y0ZE 1F5LA 1F2SE 2AGIX 3PLKA 3VXFH 1P2KA 1MH0A 2ZPSA 1C4Y2 3EAJA 5A0AE 2AGGX 3ODDA 4QT8C 3IG6B 1IQEA 1C9TA 1Q31A 2Y5GA 3OY6U 5FHTA 1Z8IB 3S9CA 1WAYB 5DKMA 1NFWA 1VGCC 1YCPH 3MO6A 1QHRB 3SUFA 5JBCS 1S6FA 3SW2B 4MQAA 1D3PB 2JH0D 1EPTB 3LH1A 1SFQB 2FS9A 1L1GA 3A7TA 5FX5A 2J38A 3UREA 1HXEH 3SV2H 3TK9A 3MNXA 4WVPE 4XBCA 2ZQ1A 3SI4H 1A0JA 3D65E 2GT8A 3JZ2B 5E8EH 1E38B 1LHDH 3RXVA 2ZCHP 1THRH 1MKWH 3FP7E 1TPOA 1G2LA 3ZVEA 1W13U 2BDHA 4X6PA 1MCVA 2H5DA 3BTGE 1KXEA 3ZZ5A 1SGCA 4Y7AA 1V2MT 2Z3EA