1O2NA

Elaborate manifold of short hydrogen bond arrays mediating binding of active site-directed serine protease inhibitors
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Elaborate Manifold of Short Hydrogen Bond Arrays Mediating Binding of Active Site-Directed Serine Protease Inhibitors
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords BETA-TRYPSIN
total genus 54
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2003-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1o2nA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1o2nA02
1OP2A 1LPZB 2FP7B 5DG6A 3SV9A 1XUFA 3P8NA 4WH8A 4IMQA 3KEEA 1QJ7B 1OYTH 1MKXH 1NT1A 5AFYH 1MBMA 4TPIZ 2FM2A 4ISLA 2H9EH 3S9AA 2ESTE 3RXSA 1LKBA 1OX1A 3GDVA 1BA8B 4I8GA 4INHA 2ZTYA 1GJCB 4TYDA 1EQ9A 4Y8ZA 1W10U 1W12U 1QFKH 3MFJA 1F0TA 1F0SA 1K1MA 1MZAA 1VGCB 1O3OA 2D8WA 3GISB 3UIRA 2P93A 4NZLA 4XDEA 3RUOA 1LTOA 5T6GA 2H5CA 3M61U 1FXYA 1O2PA 1VCWA 1J9CH 3RXEA 1TRNA 1C1VH 5A09A 1FNIA 3M7UA 2VWNA 5EGMA 1GMHF 2ZIQH 5GWZA 5A8XA 2G52A 5GCHF 1WTGH 4YOGA 3PWBA 4WXIA 1UTJA 2IOTA 4X2VA 4R0IA 5E2PA 1SFIA 3VFEA 3GY6A 3MWIU 1A2CH 4I8LA 1AO5A 2TBSA 1TBRH 4JZDH 1FY3A 1WOFA 1GI2A 3IWMA 1S0RA 1QTFA 1ORFA 2YOLA 1GGDB 3ITIA 4E7RG 1IAUA 3DHKH 1TGTA 5JPMH 1EPTA 5FBEA 3MO9A 1DICA 1PPZA 2P59A 1UVPA 1DFPA 1TONA 2PGQB 2D26C 1S0QA 1SBWA 1SGIB 1LHCH 1AZZA 2W3KA 2NU2E 2AGEX 3E16B 1QL7A 3EA7A 2ULLA 4M7GA 3PMJA 4X8SH 3ZZ4A 2V3HH 4AX9H 3SJOA 1EXFA 1UCYK 2TIOA 1V2ST 3HGPA 1RRKA 2F9VA 2R2MB 2BTCE 1L1JA 3ZYDA 1GL1A 1C5TA 1DLEA 2AEIH 3TK9A 1GCTB 3PMHB 1KYNA 1TX6A 2OD3B 2O8MA 1ZYOA 4BAMB 1XM1A 1H4WA 2P8OC 4NIYA 1PPHE 4AFSA 1Y5UT 2FZZA 1IQIA 2ALPA 1SGNE 2C93B 3QZRA 1BJUA 1CHOF 3SI4H 1GJBB 1PPFE 3MOCA 5A0CA 1C2LA 1ZPBA 2FS9A 1HFDA 2BY5X 1FQ3A 4OGYA 4K3JA 3MU8A 2F3CE 1A3BH 1E35B 2FXRA 5FCKA 3GICB 1O3AA 3T25A 2WPLS 3U1JB 3RMOH 4HGCA 1JIMA 1O5AB 1WCZA 2GDDA 1IQGA 3RXIA 1MKWH 2O8UA 3OX7U 3ZYEA 3P6ZB 3RXFA 1C5PA 1KY9A 1ARCA 3E0NB 4AYYB 3GCHC 1XUKA 1DOJA 1P11E 2OXSA 4Y76A 2A0QB 2XC0A 1OPHB 2BLVA 1MKWK 1AU8A 1C5WB 1ZGVA 4ZKNU 1YPKH 3TNTA 4DG4A 3FP8E 4NCYA 1P09A 1UMAH 1SQOA 1T4VH 3FP7E 3MMGA 1HAZB 5A0BA 2PKSC 1H9IE 1O33A 3T27A 1GHBG 3S7KB 2FTMA 4U32A 1TGNA 2XCNA 2BXTH 2TGTA 1QNJA 1L2EA 2TPIZ 1UCYH 1YF4A 3QN7A 1P2QA 2ANWA 5TCAA 1S85A 2V35A 2XBWA 1B0EA 2WINI 1A0LA 2BQ7B 1SR5C 1G36A 2CHAC 4X1NU 1OWHA 3KQEA 1CA8B 1KXAA 3AAVA 3FZZA 5ABWA 3SNEA 4Y8XA 4BAKB 1MCTA 7LPRA 3U8RH 2GCHG 1TA6A 3GDUA 5A8YA 2ZFRH 1UTLM 1MTWA 1GI6A 2ZCHP 1HCGA 2ZDVH 1AVWA 4KTUA 3TITA 1O3KA 4CH8B 4CRCA 3GCTG 3O8BA 3LGYA 2Z94A 2HGTH 4GHTA 2XNIA 9LPRA 4FU9A 3MNXA 3RXDA 3RU4T 1MCVA 4YESB 1FIZA 4K1TA 2GMTC 5GXPA 1YGCH 3SUGA 1YPEH 1UHBA 1A5GH 1QJ1B 4BNRA 2G51A 3MH4A 1P2MA 4IC5A 2PFEA 4H42U 2EC9H 3SORA 2O8WA 3UOUA 1EASA 2GVFA 2XCFA 2BDGA 1C2EA 1GL0E 1GVZA 2Y81A 1NRRH 1BZXE 5F8TA 2BLQA 2VIQA 3A89A 3SU4A 1GHXH 1P10A 5I25A 4JYTA 4RN6A 1T7CA 1GHVH 2F9OA 3K6ZA 1EOJA 4DURA 1SMFE 4FUIA 1WV7H 3BG4C 4Q7ZA 2Y6TA 3RC5A 2JH5D 3SI3H 1AY6H 1A0HB 2B0FA 4Y11E 1NESE 3UTUH 1BTPA 2V0BA 4E05H 2KAIA 1JRTA 1XVMA 2JKHA 2Z7FE 1GBIA 2Z9LA 1QQ4A 1SVPA 3WY8A 1GBEA 1HJAB 2A2XH 3LPRA 3A7VA 2ODQA 4IN2A 1Y3WA 4ABIA 4IS5A 4X1PU 1T8NA 2B7DH 6GCHG 4MNVA 4Q80A 3E90B 2G55A 2A2QH 1GHBF 1ELTA 4BOHA 1L4DA 1TGBA 2KAIB 4H6SB 2ZGHA 2J34A 1C4U2 2AFQB 2DUCA 2P94A 1B5GH 2AMQA 2PWXA 9ESTA 1BDAA 1HGTH 2FOAA 5DKMA 3CS7A 2STBE 2A7HA 1BTUA 4TY6A 4YOJA 1FY8E 1O3CA 2BY6X 1UVTH 1TNLA 1CBWB 1Q2WA 2FOFA 3H5CB 4XSKU 1UCYE 2C8WB 3U8TH 5IDKA 5CE1A 1PJPA 1GI9B 1GPZA 3SNBA 2ZHDA 4MNYA 3ZZ8A 1WSSH 3ZZ5A 3KQDA 1MH0A 1SFQB 4ZAEA 1CHGA 2ZPQA 3QZQA 1VITF 1GJ9B 3U9AH 1TNGA 1TPOA 1UHBB 1MU6B 1O5GH 2GMTB 1B7XB 4J1YA 1O5DH 3UNRA 2VVVA 1UTQA 1EJMA 3A82A 4Q7YA 4XE4A 1NPMA 5EU8A 1FPCH 1HRTH 1TRYA 8LPRA 3LC3A 1TMTH 4K2YA 1OKXA 1DWBH 2EA3A 1V2PT 4XBCA 2B9LA 1B0FA 1EATA 3AW1A 3U98H 1A0JA 2WUBA 3F9EA 1GHZA 3BN9A 2XBYA 3SJKA 2ZU3A 4AZ2B 1F2SE 4KELA 3A86A 5EQSA 3GY4A 1ANEA 1BUIA 3SNCA 1O35A 4KKDA 1V2VT 2AIPA 3A85A 2ZFQH 2Z9IA 3M5MA 8GCHG 3PO1B 1GHAF 1EZUC 2VNTA 3FANA 1Z71A 2XC4A 2SGFE 1L0ZA 1SOZA 2ZI2H 3RC4A 2XWBI 2YNAA 1E34B 3SW2B 5JB8S 1KDQB 1PQ5A 4X1QU 3MYWA 3PLKA 4NWKA 1Z7KA 2VJ1A 1MTVA 1O3NA 4JK6A 2HLCA 1MTNC 2ZHWH 4ABGA 3K2UA 4FU7A 3A80A 1HJAC 5CHAB 3A7WA 3ATKA 4MPUA 4AGJA 2WPKS 2G8TA 3KCGH 1TFXA 4UONA 2PKAA 4ZXYH 2FOCA 4I8KA 1OS8A 3EGKH 1BMMH 4ZXXH 4AG1A 4OGXA 1QBOA 2BY9X 1WQSA 3E8LA 1A1RA 2H2ZA 3M7TA 3P17H 3M3TA 4THNH 2GZ8A 1O5CB 2R3YA 1SL3A 1O2ZA 1DT2A 1LVBA 2BD8A 2BD3A 1GI3A 5HM9A 2ZTZA 1C5XB 3RM2H 4Z0KA 3U8OH 1AIXH 1LQDB 1UVOA 1GDUA 3AW0A 3P8OA 5JB9S 4D7FA 3UWIA 4BXSA 5TJXA 1O3GA 4CBOA 1S82A 1TALA 3TH4H 3HK6B 3BEUA 5JDUB 1H8DH 1DWDH 1O2JA 1O31A 2HRVA 1C4V2 2IN2A 1THRH 1UVSH 1ZMJA 1VJ9U 3M37A 1C9TA 1ZTLA 3RXQA 1FN6A 1TPSA 3BF6H 1SLWB 4ZHAA 3SV8A 5C20A 4GHQA 1PPEE 1EZXC 1LQEA 1ZPZA 4ZHMU 1QQUA 1V2JT 3QTVH 3RMMH 3RXTA 2QYIA 3BEFB 2ZWLH 1ABJH 1EAUA 1H9LB 3SV6A 1YM0A 4Q2KA 1Z6JH 1RGQA 1EKBB 1BT7A 2QC2A 4K1SA 2A31A 2HNTE 1AI8H 4VGCC 3VXEH 3TVJB 1P3EA 3H7TA 3UNQA 3R3GB 1RIWB 1P05A 1P0SH 3LOXA 1G3BA 4NSYA 1O38A 2Y7XA 4MVNA 2UUKB 5FPYA 1O30A 2AMDA 1GI4A 1DUEA 2AGIX 1ZRBA 1OOKB 1G3EA 3ZZCA 5JBCS 2FI4E 3MU0A 1IOEA 1NFWA 1C5SA 2NU3E 2G4TA 1Y3XA 1BJVA 1DVAH 1P9SA 1W0ZU 3LJJA 3RXGA 2ZCKP 3BIUH 1C1UH 4AFQA 2PUXB 3MU5A 2ZO3H 2H6MA 4IN1A 5EQRA 1BQYA 3D23A 1GDQA 5FPSA 4PROA 2BVRH 4RKJB 1GI5A 1IQNA 4CRDA 4O3TA 3BTHE 1BTZA 1SSXA 5F8ZA 5K7RA 1XUHA 1LHDH 3F9HA 1EAWA 1C1WH 2BM2A 3Q77A 3ENSB 2ZC9H 4D76A 8GCHF 4BANB 2FDAA 1C2DA 1S6HA 5HXFA 3TJOA 1DY9A 1E36B 1PQ7A 3ZVAA 1TNKA 5BRRE 1O2GH 1S6FA 1EP6A 2FLRH 4O9VA 3A84A 1E0FD 1ELFA 1UO6A 1O2TA 1DWEH 3SJIA 1OP0A 5T6FA 3K9XB 4AOQA 4Y6DA 2G00A 1PYTD 4OS2A 4IMZA 3NXPA 4SGAE 4CHAB 3L6PA 3A8AA 4GCHF 5K0HA 5J4SA 3R0FA 5C67A 4BAHB 4Y0ZE 1O3HA 1KTTB 1YPLH 2BVXH 2Z6BD 1CA0C 2GTBA 1GMCG 1DXWA 1FMGA 1C2FA 4FUEA 2D1JA 1EB2A 1O2KA 3STJA 4AG2A 1V2MT 2LPRA 2VVCA 1VCQA 1FDPA 1W0YH 1MZDA 2VGCC 1A7SA 3HGNA 2FX6A 2XW9A 2HPPH 1SGTA 1QGFA 5DP7A 2CJIA 4ABHA 1W7XH 3TPIZ 1O2OA 1YCPK 1EZSC 2OUAA 4DOQA 2P3FH 1UK2A 1AQ7A 2VB0A 4U01A 2GCTB 2QCYA 2C8ZB 4GSOA 3TJUA 3QO6A 1SLXB 2QA9E 1CT4E 1F0UA 3RXLA 3NKKA 1DWCH 3V13A 3ZZAA 1ZR0A 2AMPA 1J15A 1W11U 2A1DB 4MTBA 5E0HA 2SGEE 5EXLA 3GY2A 1LO6A 1D9IA 1MTUA 2GDEH 1ETTH 2M5TA 5EQQA 5FCRA 2A4OA 3TK6A 3E0PB 2SGAA 3OSYA 2JETB 4MQAA 1Z8JB 1O2VA 1RIWC 2A5KA 1GJ4H 2EEKA 3D65E 5FHTA 4FUHA 3SHCH 2HOBA 3SQHE 1QY6A 2YNBA 2ZHEH 2XRCA 3QDZB 4D9QA 4ISNA 2Z9GA 1EJAA 1FONA 1SGCA 2OTVA 1QURH 1SQAA 4DGJA 1XUGA 3C1KA 3KQCA 1U6QA 1O3LA 2QAAA 1EJNA 4OS1A 3W94A 3HATH 2Q1JA 3DUXH 3G01A 1AWHB 1SGPE 1UTOA 2ZFSA 3ESTA 3KIDU 2J94A 3RXVA 4E7NA 2VIVA 2ZGJA 1GBCA 1C2JA 4A1VA 5E0JA 1V3XA 1HIAB 4INKA 4K1EA 3F68H 2RA0A 2Y5HA 4HZHA 1HV7A 1LHGH 2BDHA 1AE8H 1V2KT 1PPBH 1KXEA 4INLA 2ZGBH 4GAWA 5LPRA 3P70B 2F9BH 3P95A 3F1SB 2FYQA 4NSVA 1K22H 2THFB 1JOUB 1XX9A 3BTQE 3SUEA 3GY8A 3UUZA 5T3HA 3RP2A 1V6DA 5ESTE 1TGCA 3M7QA 7ESTE 5JBAS 3L3TA 4SGBE 3SV7A 4D7GA 1EUFA 3BTEE 1GBAA 2FYRA 1TPAE 1T31A 4D9RA 3M5NA 5GPIB 3I29A 1Q3XA 2OC1A 1Z1JA 5I46H 3F9FA 5C1XA 1QIXB 4UE7H 3RXJA 1Y3UA 4CRFA 2FI5E 3W95A 3S9BA 4LZ4B 1DSTA 3PTBA 2FWWA 3B9FH 1HPGA 3TK5A 2IPHA 2ANMH 2P3TB 5ETXA 1NN6A 1NROH 2ZKSA 5LGOA 2ODPA 4FUDA 2NU1E 1TNIA 1C5RA 2QV1A 3MNCA 3UFAA 1W2KH 3VGCB 2AYWA 1BB0B 3RXPA 3S69A 2BYAX 2VH6A 5A8ZA 2CGAA 4OS4A 1W13U 3LC5A 5A2MH 1K2I1 1BHXB 1G9IE 3A81A 4UFFH 2A4RA 1SGQE 4I8HA 1LHFH 3U69H 1W7GH 1A5HA 1ID5H 2BOKA 4BAQB 5FPTA 1G3DA 3RXKA 4KP0A 1WTHD 3LGUA 1XXDA 2PLXA 4UEHH 1SGEE 1D3DB 1N8OB 3O8RA 2JETC 1P2IA 4ZKSU 1KLIH 3LGWA 2PSXA 2FPZA 1UK3A 1GJ6A 1ELAA 2BD7A 2TRMA 1QHRB 3LKWA 3P8FA 3GDSA 2TGAA 1D3PB 2QF3A 2CF8H 2R0KA 1MQ5A 1YCPH 1SGRE 4IBLH 1ETRH 4FU8A 5EODA 3JZ1B 1BCUH 1SGDE 1TMBH 1JMOH 2BOHB 1ZJKA 1THSH 1YBWA 1BMNH 3LIWA 2ANKH 5HMAA 1N6XA 1GJ7B 3MNSA 1C5LH 1DDJA 4JYVH 2QIQA 1CO7E 1O32A 2BY7X 3A8BA 1YYY1 1AE5A 1TAWA 4X6NA 1EZQA 4F49A 1ZTKA 4FUFA 1J14A 2P3UB 2BDYA 1FAKH 4R8TB 3T26A 1KLTA 1O5BB 2Y7ZA 3BTWE 3A8CA 3UOPA 1C5QA 4D8NA 3PLPA 2STAE 1TQ0B 1KXFA 2FI3E 4I8JA 4X2XA 1O3IA 2WPMS 2EI8A 4FUGA 3OU0A 1SHYA 4ZMAH 1F7ZA 1EAIA 4ISHH 4GPGA 4RSPA 4MNWA 1S81A 4FUJA 1MMJN 2PKSB 2QXJA 1RTLA 1BTYA 2XYAA 2FO9A 2F9NA 3ZZ3A 1GVLA 1Z6EA 5E8EH 1SC8U 3SJ9A 1LVOA 4I33A 1AHTH 1OWIA 1V2OT 6LPRA 2BD4A 1GDNA 1HAVA 3AVZA 2Y5GA 3ZV8A 1NFUA 3PM3A 1C1NA 3KF2A 3BTTE 1HLTH 1QL9A 1NFXA 2ZG0H 8KME2 2ZDKA 3PB1E 3URCA 4ABEA 2H9HA 2ZTXA 4YZUA 2HNTC 2BB4A 3VXFH 1O2MA 3V7TA 3N7OA 3LDXH 2W5EA 2XBVA 2G5VA 3MTYA 1JXPA 1XMNB 2R2WU 2R0LA 1K21H 3T28A 2BZ6H 1XUIA 1OWKA 1GHYH 1SGFG 1RJXB 1P01A 2H9TH 1T32A 1BBRK 1NRSH 3A7TA 1BITA 3MH5A 1CE5A 3SU2A 3Q3XA 1RS0A 2PR3A 2FTLE 1DSUA 4ABBA 2A7JA 3S7HB 1O2UA 1HXFH 3CS0A 2OC0A 1GGDC 2Q6DA 3T5FH 1GI7B 2ZQ1A 3UPEA 1UJ1A 4Y10E 3ZV9A 1KLJH 2GV7A 4JCNA 4ABJA 1HDTH 3GCNA 3MO3A 3ZVDA 3RXRA 5JYIA 4UFGH 1J17T 2BDCA 2VWOA 1PPGE 1DPOA 4JZIA 1P2OA 1O36A 2UWLA 3GY3A 1SLVB 2ZEBA 4AYVB 5DP8A 3AAUA 1F5LA 4CRGA 1ESAA 1O3JA 4UFEH 5DP4A 1O34A 3ZVGA 8ESTE 4IGDA 3TH3H 1BRAA 1MAYA 3MU4A 1C1SA 2SNWA 1C1RA 2WYGA 3OYPA 5LPEA 3LH3A 2PGBB 3A87A 4NG9H 1HAHH 5J4QA 1C2KA 1ZLRA 3OY6U 7KMEH 4B1TA 1GHWH 1UVUH 2ZZUH 7GCHF 3GY7A 3SGBE 4A92A 3ATMA 3D62A 4QT8C 4MPWA 2BQ6B 2I6SA 1QB9A 1C1MA 1K1NA 5FX6A 4LXBH 4LOYH 1LCYA 2ZHQH 1MQ6A 3FFGA 1EAXA 3E1XB 3LT3A 1RFNA 1LVMA 2HALA 2QXGA 3T29A 1QB1A 1ETSH 1GMHG 4K8BA 2FLBH 1MBQA 1QCPA 4WF8A 3GCHB 1KXDA 2VIPA 2CXVA 3TU7H 3FZDA 1GCDA 3SO3A 3UQVA 1GBDA 1C5VA 4DT7B 2FOGA 1TBQH 2AH4X 3MH7A 2A45B 5IYTA 1CBWC 3ZVFA 2ANYA 1Y8TA 4BTIB 5ESBA 4IC6A 1YPHC 2C3SA 5DJ7A 2IJOB 4DJZB 2ZU1A 2PV9B 2O8TA 4NA8A 3NUMA 1XKAC 3RLWH 3KGPA 2ZNKH 1G30B 4Z6AH 1UTPA 2XTTB 1SGYE 4Y7AA 1AWFH 1FN8A 1L4ZA 3BTGE 1P06A 1HJ8A 1SGFA 2WUCA 1TRMA 2VIDA 4XFQA 2DE9A 4O03A 3TGIE 3EA8A 2SGQE 6CHAC 3RXUA 1FY5A 3SNDA 3ODFA 2PKAB 4LK4A 1VCPA 2A4QA 3VEQB 1O2RA 5HYOA 4DW2U 1PFXC 1AFQB 5C5NA 2CN0H 4WH6A 4MNXA 1P03A 1ZSLA 1JIRA 3BV9B 2BDAA 1UTKA 3NZIA 1XUJA 2SGDE 4AGKA 2VH0A 1VR1H 3SBKA 1BOQA 3ZZDA 3E6PH 5C3NA 2G4UA 1T8LA 7GCHG 1XVOA 3BTME 1PYTC 4U30A 5DK1A 4DCDA 4U2WA 3S9CA 1ELEE 4DIIH 1TOMH 3QGJA 3UQOA 1AVXA 3GY5A 3ODDA 1TX8A 1TA2A 1WYKA 2RG3A 4B2AA 1YLCA 3FP6E 1V2LT 2CF9H 3BG8A 3V0XA 1LHEH 1AFEH 4E06H 2F91A 1TE0A 3KN2A 3NPSA 1K28D 3MU1A 1O37A 3PMAB 1O5EH 1FY4A 2J4IA 2ZQ2A 1T8OA 2W3IA 2J92A 1DLKB 2UWOA 1A5IA 3H7OA 3A7XA 4ZKRU 1HUTH 3TH2H 1X7AC 1NRQH 1QBNA 5DP5A 2VWMA 1ZHRA 1DANH 1K1LA 1LPGB 3QK1A 2AIQA 4H4FA 4J2YB 1L1GA 3F9GA 3BG4B 1ZSJA 3HKJB 1XXFA 3RXCA 4ABDA 4ISOA 1HAXB 4GUXA 1C1TA 2BDBA 1GMCF 2PTNA 2FX4A 4HI3A 1LDTT 3RXHA 1O2IA 3RLYH 1FLEE 1K1PA 2CHAB 3SZNA 1KXCA 1VGCC 3RDZA 1P8VC 3SN8A 2A32A 4NIXA 3DT0H 3ATLA 2GX4A 1KXBA 3M5LA 6ESTA 4Y0YE 3TJNA 1PQ8A 3SU3A 2CV3A 1C1PA 5E2OA 1E38B 2P16A 3HK3B 2O9QA 3MHWU 5GCHG 1A46H 4X2YA 4CRAA 3UREA 3GCTF 3ATIA 1BBRH 3SQEE 2Z3CA 3RXBA 2BX4A 3TGKE 4AN7A 2PTCE 1TMUH 4ZHLU 2ZGCA 1V2NT 2ZFPH 3EYDA 4ABAA 1BBRE 2ZDNA 1C9PA 1P9UA 2GCHF 1ZPCA 3ZVEA 2AERH 4B75A 2GT8A 1RTFB 3EQ0H 1G32B 3ELAH 2F83A 4X6OA 2XBXA 3TIUA 3D49H 1QB6A 1VITG 2JH0D 1AUJA 4VGCB 1HJ9A 1YPHE 1AB9C 3LGTA 4AB9A 2J95A 4B74A 1OWEA 2TGDA 2OQ5A 2VINA 1TPPA 1TABE 1EB1H 1HB0B 1YPMH 4FUBA 4BTTB 2UUJB 3SGQE 2SGPE 2A4GA 1HAPH 2SFAA 1V2QT 1SG8B 1P2KA 2BD2A 3ZVBA 1GCTC 4CH2B 1WBGB 1ZHMA 4GVUA 5GDSH 3GCOA 5AFZH 1RTKA 3PLBA 4CR9A 4XBBA 1CGIE 1S83A 4X1RU 3A83A 4DY7B 1JWTA 2HWLB 1YC0A 5DO4H 3SU0A 3M35A 2BD5A 3LJOA 5L30H 1Y3YA 1INCA 2ZU5A 3STIA 3VPKA 1SOTA 5CMXH 1LPKB 5T6DA 3V12A 4WWYA 1ZGIA 5H4IB 5JBBS 2GZ9A 1F92A 4Y71A 3Q00A 3UNSA 3A88A 3LGIA 2ZP0H 3LU9B 5AVDA 3MNBA 1HBTH 5C1YA 1GG6B 3UWJH 1DE7H 2ODYB 3NK8A 1FZZA 1O3EA 2A5AA 1AD8H 1HAYB 1TQ7B 1GJ8B 2BMGB 1TBZH 4JK5A 1BHXF 1CQQA 3SGAE 4LZ1H 1S5SA 1K1OA 3LH1A 1PQAA 3V3MA 1ELGA 1DM4B 1A61H 1V2UT 2OC7A 2XWAA 1HAGE 1TX7A 3OY5U 1ANCA 1CGJE 2VGCB 1TB6H 3DA9B 1XKBC 4A6LA 4YLUA 1GBBA 1FJSA 2GV6A 3K6YA 2C8XB 4CBNA 3CENA 2QF0A 2H1UA 2FOHA 4X1SU 1DX5M 1BRBE 3EE0B 2GZ7A 2WV5A 2ZU4A 5FBIA 3HKIB 3QUMP 1BTHH 1WUNH 1IQKA 3MO6A 1DY8A 5C5OA 1QA7A 1QA0A 4KGAA 1AKSB 1AZ8A 4K8YA 2A7CA 4KTCA 3BIVH 1THPB 1P3CA 1CGHA 2SNVA 1WU1A 1NFYA 2BDIA 2OC8A 1GBTA 1GMDF 4BXWA 1QR3E 2LNCA 1HAIH 2QXIA 4ZROA 2ZGXH 4NFFA 1HNEE 1O39A 5DGJA 3PO1C 3KNXA 2BY8X 1GHAG 1O3FA 1HAVB 1O3PB 1K1JA 5L6NH 2EI6A 3VB5A 1SQTA 6CHAB 1GI0A 1AKSA 3NCLA 1IHTH 1O2HA 4WMEA 1IQEA 4AFUA 1IQHA 1G37A 5EW2H 2Z9JA 2XC5A 2ZFFH 5DP9A 4B71A 1BRCE 1GBMA 1T8MA 3IITA 3EA9A 1NRNH 3HPTB 3TJVA 5CHAC 1RXPA 2NU0E 5TCCA 1M9UA 4A5TS 2ZDMA 1VITH 1F5RA 1CT2E 4FVDA 1Z1IA 1JBUH 3A7ZA 4YOIA 2RCEA 1O2WA 3K65B 4I31A 1O2NA 3PROA 2OLGA 4MLFB 3ZZ7A 3UR9A 4CR5A 2Z3DA 1ZRKA 3PMBB 1O2QA 3SU1A 3BEIB 4NGAH 2QGRA 3SHAH 1NY22 3URDA 4AFZA 1EPTC 1UTMA 1MKXK 2ALVA 3QGNB 2K1QA 2PUQH 1OP8A 4WMDA 1T4UH 2HNTF 1NTPA 5GJ4B 1WAYB 3RMNH 3PV4A 1Z8GA 1UTNA 1DITH 1CU1A 4HFPB 4YLQH 1TOCB 4X6MA 2JH6D 1H1BA 3RC6A 3SJ8A 3VGCC 3PWCA 3FVFB 1Y3VA 2BXUH 3M3VA 3RXOA 5A0AE 4CHAC 1HIAA 4OS6A 1P57B 1ZOMA 3E3TA 1EX3A 3QLPH 1MD7A 1HYLA 1AN1E 2GKVE 1NU9A 2OP9A 4UFDH 1C1QA 2HVXA 1ESBA 3QTOH 3GYLB 2Y80A 3SV2H 4CRBA 1BMLA 5FAHA 2C4FH 5BPEA 2UUFB 4TWYA 1CT0E 1IQJA 1ELDE 1ACBE 4B73A 2Q6GA 1HXEH 1YCPM 3RXAA 4K69A 4OS7A 1D6WA 5PTPA 4Y79A 1GBKA 1TNJA 2UUYA 4NFEA 1K9OE 2ZDAH 3L33A 1J16A 3GOVB 3TGJE 3ZZ6A 1ELVA 1F0RA 4MG3A 3Q3KA 1D6RA 2D2DA 1SI5H 1CSOE 3SUFA 4NZQA 5FX5A 4I7YH 1P04A 1TLDA 1BMAA 1FY1A 4XBDA 5E0GA 3B23B 3OTJE 1OWDA 4FXGH 2W26A 5FXLA 1MUEB 1Q31A 2WYJA 1AB9B 3S0NA 3MH6A 4X2WA 2BLOA 3LONA 1DXPA 2UWPA 2W7SA 1QRXA 3ATWA 1IHSH 2ZU2A 1C5ZB 1C2HA 2V3OH 1FUJA 3QX5H 2GT7A 5C1UA 1HAOH 3C27B 3QWCH 4ISIH 1P2JA 2OBOA 5DPAA 1BRUP 3U1IB 2I6QA 1A4WH 1DS2E 1O0DH 5EW1H 4F4OC 1GBFA 4WVPE 6GCHF 3P8GA 1KDQA 1WQVH 2RA3A 4ESTE 1OSSA 1QJ6B 3LGVA 2GGVB 1CA0B 2B5TB 2ZPRA 1Y59T 1MTNB 1DUAA 1CHOG 4X6PA 3VB6A 1YPJH 1ARBA 2FODA 5AHGH 1O3BA 4NIWA 2GP9B 2ZA5A 2OINA 2WPIS 1O2SA 3P92A 4DVAU 3Q76A 1O2XA 1K1IA 1IQMA 3DFJA 1QRZA 2NWNA 1EP5A 4WY3A 2W7UA 5DP6A 1ELCA 4NIVA 4ZUHA 1GG6C 4RKOB 4O97A 2F9PA 3TLOA 1EOLA 2G5NA 1AUTC 4GCHG 1AGJA 3B8JA 1O2LA 4NA9H 1SB1H 3SU6A 1GBLA 2BHGA 1G3CA 2FOMB 2FEQH 1W14U 2J2UA 1KSNA 2AS9A 3I77A 1TIOA 4K60A 1A3EH 4TY7A 3RU4E 4XOJA 1NRPH 2V6NA 1C2MA 1FV9A 4MPXA 2QN5T 4TPYA 2PW8H 2F9UA 4X8VH 1GBJA 1YLDA 1PPCE 2Y82A 2O8LA 4BAOB 1L1NA 3RU4D 4YO9A 5EG4A 2WPJS 3VB3A 1VJAU 3M3SA 1SHHB 4NWLA 4DIHH 1NS3A 2ZDLA 1W3CA 3PTNA 2BLWA 2FOEA 2WPHS 1P02A 2H5DA 3M36A 1C1OA 1LVYA 1GWAA 1YKTA 2CMYA 2QY0B 1J8AA 1MD8A 1GVKB 1D4PB 2ZECA 4JYUH 1C4Y2 1QL8A 2B8OH 4KTSA 2ZFTA 3KQBA 2P8OB 5EOKA 1D3QB 1NM6A 4B2CA 4WMFA 2VVUA 4A7IB 5DP3A 3CP7A 2DE8A 2PSYA 3RXMA 4ZKOU 3PYHA 1AMHA 2ZF0H 1OXGA 1V2RT 1C5YB 5HGGA 4X0WU 1F5KU 4NA7A 3BSQA 1IQFA 1ABIH 5C2ZA 5F03A 1N8OC 1QRWA 1TWXB 3KHVA 4JZEH 4JMYA 4A1XA 5B6OA 4H6TA 4X8TH 1YPGH 2A5IA 5EPYA 5LH8A 1SLUB 1IQLA 1GI8B 1V2TT 2VIWA 2ZPSA 4K5ZA 4MDSA 5G4BA 2BQWB 4ABFA 5LPFA 1Z8IB 1ANBA 2C8YB 1LMWB 1FPHH 4Q7XA 3AASA 1GJ5H 2Y5FA 2ZCLP 2OBQA 4WXVA 4CREA 3IG6B 1ZMNA 3EDXB 3SNAA 2AGGX 1ZJDA 4O3UA 5L2ZH 3BTFE 5L2YH 5F8XA 3ZVCA 1GI1A 2VU8E 5GIBA 1P12E 3SU5A 1W8BH 4MPVA 4B76A 3FAOA 1V2WT 3VB4A 3O8CA 2Z9KA 1G2LA 1KIGH 1ZSKA 1JRSA 1ZMLA 2OCVB 3KL6A 4YT7H 4YTAA 5HM2A 1D3TB 3NWUA 4UD9H 1ESTA 1ZTJA 2FESH 1LKAA 1TNHA 4UDWH 4TWWA 3T2NA 2QXHA 1NC6A 2PHBA 3MI4A 3UY9A 3I78A 4ASHA 3BTKE 1C5UA 1FAXA 5EXNA 1O5FH 2ZHFH 2FS8A 2VIOA 1E37B 1EPTB 1CVWH 5EXMA 4YT6H 2FMJA 1OYQA 1ZZZA 3ZZ9A 1FI8A 5JBTA 1G2MA 2XXLA 4Y7BA 3UR6A 3JZ2B 1P2NA 1Y5AT 2C90B 1AVGH 1C2IA 4AORA 4OS5A 1QBVH 5F6MA 1N1LA 1YP9A 3E91A 1H9HE 2J38A 4A1TA 1N6YA 4B2BA 2OQUA 1C2GA 1FIWA 1BTXA 2ASUB 4BTUB 3ZZBA 1C5MD 1O3MA 1Z8RA 3O8DA 4FVBA 2GCTC 3RMLH 3A8DA 1ANDA 4WJG2 2TGPZ 1H8IH 2P95A 2VWLA 1OWJA 3T62A 4GLYA 4JZ1A 2EI7A 1GMDG 3RM0H 2BVSH 5SGAE 1SPJA 3TNSA 4AB8A 4JZFH 4IW4E 3DFLA 1NU7B 4ZH8A 2WV4A 3M5OA 1KTSB 1TYNA 2GD4B 2J9NA 1AFQC 1BTWA 1MU8B 2HPQH 3A7YA 1C5OH 1UK4A 3DD2H 4Y8YA 2BD9A 2R3UA 3F6UH 3GYMA 1ZHPA 3SUDA 4FUCA 3SOSA 2R9PA 1MTSA 3EAJA 1NZQH 1MAXA 2NU4E 1O2YA 4HTCH 1Y5BT 1O3DA 1C5NH 2FIRH 1S84A 2RDLA 4YM9A 4I32A 1GBHA 2FOBA 1NO9H 2ILNA 2BZAA 1BIOA 2BX3A 2Z3EA 1TGSZ 3Q3YA 3VB7A 5AF9H 2Q6FA 1GJAB 2G81E 1ELBA 4X8UH 1RD3B 3BTDE 1VZQH 1GJDB 5EPNA
chains in the Genus database with same CATH superfamily
1OP2A 1LPZB 2FP7B 5DG6A 3SV9A 1XUFA 3P8NA 4WH8A 4IMQA 3KEEA 1QJ7B 3KYGA 1OYTH 1MKXH 3F2FA 1NT1A 5AFYH 1MBMA 4TPIZ 1EFRD 2FM2A 4ISLA 2H9EH 3S9AA 2ESTE 3RXSA 1LKBA 1OX1A 3GDVA 1BA8B 4I8GA 4INHA 2ZTYA 1GJCB 4TYDA 1EQ9A 4Y8ZA 1W10U 1W12U 1QFKH 3MFJA 1F0TA 1F0SA 1K1MA 1MZAA 1VGCB 1O3OA 2D8WA 3GISB 3UIRA 2P93A 2HVYB 4NZLA 4ACAA 4XDEA 3RUOA 1LTOA 5T6GA 2H5CA 3M61U 1FXYA 1O2PA 1VCWA 1J9CH 2WV9A 3RXEA 1TRNA 1C1VH 5A09A 1FNIA 3M7UA 2VWNA 5EGMA 1GMHF 2ZIQH 4XRNA 5GWZA 5A8XA 2G52A 5GCHF 1WTGH 4YOGA 3PWBA 4WXIA 1UTJA 2IOTA 4X2VA 4R0IA 5E2PA 1SFIA 3VFEA 3GY6A 2YMSD 3MWIU 1A2CH 4I8LA 1AO5A 2TBSA 1TBRH 2WPDD 1FY3A 4JZDH 1WOFA 1GI2A 3IWMA 1S0RA 1QTFA 1ORFA 2YOLA 1GGDB 3ITIA 4E7RG 1IAUA 3DHKH 1TGTA 5JPMH 1EPTA 5FBEA 3MO9A 1DICA 1PPZA 2P59A 1UVPA 1DFPA 4RI0A 1TONA 2PGQB 2D26C 1S0QA 1SBWA 1SGIB 1LHCH 1AZZA 2W3KA 5C94A 3N99A 2NU2E 2AGEX 3E16B 1QL7A 1FX0B 3EA7A 2ULLA 4M7GA 3PMJA 4X8SH 3ZZ4A 2V3HH 4AX9H 3SJOA 1EXFA 1UCYK 2TIOA 1V2ST 3HGPA 1RRKA 2F9VA 2R2MB 2BTCE 1L1JA 3ZYDA 1GL1A 1C5TA 1DLEA 2AEIH 3TK9A 1GCTB 3PMHB 1KYNA 1TX6A 2OD3B 2O8MA 1ZYOA 4BAMB 1XM1A 1H4WA 2P8OC 4NIYA 1PPHE 4AFSA 1Y5UT 2FZZA 1IQIA 2ALPA 1SGNE 2C93B 3QZRA 1BJUA 1CHOF 3SI4H 1GJBB 1PPFE 3MOCA 5A0CA 1C2LA 1ZPBA 2FS9A 1HFDA 2BY5X 1FQ3A 4OGYA 4K3JA 3MU8A 2F3CE 1A3BH 1E35B 2FXRA 5FCKA 3GICB 1O3AA 3T25A 2WPLS 3U1JB 3RMOH 4HGCA 1JIMA 1O5AB 1WCZA 2GDDA 1IQGA 3RXIA 1MKWH 2O8UA 3OX7U 3ZYEA 3P6ZB 3RXFA 1C5PA 1KY9A 1ARCA 3E0NB 4AYYB 3GCHC 3PRBA 1XUKA 1DOJA 1P11E 2OXSA 4Y76A 2A0QB 2XC0A 1OPHB 2BLVA 1MKWK 1AU8A 1C5WB 1ZGVA 4ZKNU 1YPKH 3TNTA 4DG4A 3FP8E 4NCYA 1P09A 1UMAH 1SQOA 1T4VH 3FP7E 2F4LA 3MMGA 1HAZB 5A0BA 2PKSC 1H9IE 1O33A 3T27A 1GHBG 3S7KB 2FTMA 4U32A 1TGNA 2XCNA 2BXTH 2TGTA 1QNJA 1L2EA 2TPIZ 1UCYH 1YF4A 3QN7A 1P2QA 2ANWA 5TCAA 1S85A 2V35A 1B0EA 2WINI 1A0LA 2XBWA 2BQ7B 1SR5C 1G36A 3F3BA 2CHAC 4X1NU 1OWHA 3KQEA 1CA8B 1KXAA 3AAVA 3FZZA 5ABWA 3SNEA 4Y8XA 4BAKB 1MCTA 4F55A 7LPRA 3U8RH 5DN6D 2GCHG 1TA6A 3GDUA 5A8YA 2ZFRH 1UTLM 1MTWA 1GI6A 2ZCHP 1HCGA 2ZDVH 1AVWA 4KTUA 3TITA 1O3KA 4CH8B 4CRCA 3GCTG 3O8BA 3LGYA 2Z94A 2HGTH 4GHTA 2XNIA 9LPRA 4FU9A 3MNXA 3RXDA 3RU4T 1MCVA 1WDIA 4YESB 3OTPA 1FIZA 4K1TA 2GMTC 5GXPA 4ASUD 1YGCH 3SUGA 1YPEH 1UHBA 1A5GH 1QJ1B 4BNRA 2G51A 3MH4A 1P2MA 4IC5A 2PFEA 4H42U 2EC9H 3SORA 2O8WA 1SQRA 3UOUA 1EASA 2GVFA 2XCFA 2BDGA 1C2EA 1GL0E 1GVZA 2Y81A 1NRRH 1BZXE 5F8TA 2BLQA 2VIQA 3A89A 3SU4A 2KCAA 4HG6A 1GHXH 1P10A 5I25A 4JYTA 4RN6A 1T7CA 1GHVH 2F9OA 3K6ZA 1EOJA 4DURA 1SMFE 4FUIA 1WV7H 3BG4C 4Q7ZA 2Y6TA 3RC5A 4ACBA 2JH5D 3SI3H 1AY6H 1A0HB 2B0FA 4Y11E 1NESE 3UTUH 1BTPA 2V0BA 4E05H 2KAIA 1JRTA 1XVMA 2JKHA 2Z7FE 1GBIA 3OEED 2Z9LA 1QQ4A 1SVPA 3WY8A 1GBEA 1HJAB 2A2XH 3LPRA 3A7VA 2ODQA 4IN2A 1Y3WA 4ABIA 4IS5A 4X1PU 1T8NA 2B7DH 6GCHG 4MNVA 4Q80A 3E90B 2IJD1 2G55A 2A2QH 1GHBF 1ELTA 4BOHA 1L4DA 1TGBA 2KAIB 4H6SB 2ZGHA 2J34A 1C4U2 3AK5A 2AFQB 2DUCA 2P94A 1NBMD 1B5GH 2AMQA 2PWXA 9ESTA 1BDAA 1HGTH 2FOAA 5DKMA 3CS7A 2STBE 2A7HA 1BTUA 2XNDD 4TY6A 4YOJA 1FY8E 1O3CA 1NBME 2BY6X 1UVTH 4XD7D 1TNLA 1CBWB 1Q2WA 2FOFA 3H5CB 4XSKU 3F0OA 1UCYE 2C8WB 3U8TH 5IDKA 5CE1A 1PJPA 1GI9B 1GPZA 3SNBA 2ZHDA 3CNRA 4MNYA 3ZZ8A 1WSSH 3ZZ5A 3KQDA 1MH0A 1SFQB 4ZAEA 1CHGA 2ZPQA 3QZQA 1VITF 1GJ9B 3U9AH 1TNGA 1TPOA 3GS9A 1UHBB 1MU6B 1O5GH 4ZCNA 2GMTB 1B7XB 4J1YA 1O5DH 3UNRA 2VVVA 1UTQA 1EJMA 2PP6A 3A82A 4Q7YA 4XE4A 1NPMA 5EU8A 1FPCH 1HRTH 1TRYA 8LPRA 3LC3A 1TMTH 4K2YA 1OKXA 1DWBH 2EA3A 1V2PT 4XBCA 2B9LA 1B0FA 1EATA 3AW1A 5GNDA 1A0JA 2WUBA 3F9EA 3U98H 1GHZA 3BN9A 2XBYA 3SJKA 2ZU3A 4AZ2B 1F2SE 4KELA 3A86A 5EQSA 3GY4A 1ANEA 1BUIA 3SNCA 1O35A 4KKDA 1V2VT 2AIPA 3A85A 2ZFQH 2Z9IA 3M5MA 8GCHG 3PO1B 1GHAF 1EZUC 2VBCA 2VNTA 3FANA 1Z71A 2XC4A 2SGFE 1L0ZA 1SOZA 2ZI2H 1YLNA 1UW7A 3FOAA 3RC4A 2XWBI 3F0PA 2YNAA 1E34B 3SW2B 5JB8S 1KDQB 1PQ5A 4X1QU 4P02A 3MYWA 3PLKA 4NWKA 1Z7KA 2VJ1A 1MTVA 1O3NA 4JK6A 2HLCA 1MTNC 2ZHWH 4ABGA 3K2UA 4FU7A 3A80A 1HJAC 5CHAB 3A7WA 3ATKA 4MPUA 4AGJA 2WPKS 2G8TA 3KCGH 1TFXA 4UONA 2PKAA 4Q63A 4ZXYH 2FOCA 4I8KA 1OS8A 3EGKH 1BMMH 4ZXXH 1S6LA 4OGXA 1QBOA 2BY9X 4AG1A 1WQSA 3E8LA 1A1RA 2H2ZA 3M7TA 3P17H 3M3TA 4THNH 2GZ8A 4OM9A 1O5CB 2R3YA 1SL3A 1O2ZA 1DT2A 1LVBA 2BD8A 5T1VA 2BD3A 1GI3A 5HM9A 2ZTZA 1C5XB 3RM2H 4Z0KA 3U8OH 1AIXH 1LQDB 1UVOA 1GDUA 3DSPA 3AW0A 3P8OA 5JB9S 4D7FA 3UWIA 4BXSA 5TJXA 1O3GA 4CBOA 1S82A 1TALA 3TH4H 3HK6B 3BEUA 5JDUB 1H8DH 1DWDH 1O2JA 1O31A 2HRVA 1C4V2 2IN2A 1THRH 1UVSH 1ZMJA 1VJ9U 3M37A 1H8HD 1C9TA 1ZTLA 3RXQA 1FN6A 1TPSA 3BF6H 1SLWB 4ZHAA 3SV8A 5C20A 4GHQA 1PPEE 1EZXC 1LQEA 1ZPZA 4ZHMU 1QQUA 1V2JT 3QTVH 3RMMH 3RXTA 2QYIA 3BEFB 2ZWLH 1ABJH 1EAUA 1H9LB 3SV6A 1YM0A 4Q2KA 3OAAD 3FO8D 1Z6JH 1RGQA 1EKBB 2LELA 1BT7A 2QC2A 4K1SA 2A31A 2HNTE 1AI8H 4VGCC 3VXEH 3TVJB 1P3EA 3H7TA 3UNQA 3R3GB 1RIWB 1P05A 1P0SH 3LOXA 3WW7A 1G3BA 4NSYA 1O38A 5C0UA 2Y7XA 4MVNA 2UUKB 5FPYA 1O30A 2AMDA 1GI4A 1DUEA 2AGIX 1ZRBA 1OOKB 1G3EA 3ZZCA 4M9FA 5CDFE 5JBCS 2FI4E 3MU0A 1IOEA 1NFWA 4B6FA 1C5SA 2NU3E 2G4TA 1Y3XA 1BJVA 1DVAH 1P9SA 1W0ZU 3LJJA 3RXGA 2ZCKP 3BIUH 1C1UH 4AFQA 2PUXB 3MU5A 2ZO3H 2H6MA 4IN1A 5EQRA 1BQYA 3D23A 1GDQA 5FPSA 4PROA 2BVRH 4RKJB 1GI5A 1IQNA 4CRDA 4O3TA 3BTHE 1BTZA 1SSXA 5F8ZA 5K7RA 1XUHA 1LHDH 3F9HA 1EAWA 1C1WH 2BM2A 3Q77A 3ENSB 2ZC9H 4D76A 8GCHF 4BANB 2FDAA 1C2DA 1S6HA 5HXFA 3TJOA 1DY9A 1E36B 1PQ7A 3ZVAA 1TNKA 5BRRE 1O2GH 1S6FA 1EP6A 2FLRH 4O9VA 5KGOA 3A84A 1E0FD 1ELFA 1UO6A 1O2TA 1DWEH 4TSFD 3SJIA 1OP0A 5T6FA 3PRDA 3K9XB 4AOQA 4Y6DA 2G00A 1PYTD 4OS2A 4IMZA 3NXPA 4SGAE 4CHAB 3L6PA 3A8AA 4GCHF 5K0HA 5J4SA 3R0FA 5C67A 4BAHB 4Y0ZE 1O3HA 1KTTB 1YPLH 2BVXH 2Z6BD 1CA0C 2GTBA 1GMCG 1DXWA 1FMGA 1C2FA 4FUEA 2D1JA 1EB2A 1O2KA 3STJA 4AG2A 1V2MT 2LPRA 2VVCA 1VCQA 1FDPA 1W0YH 1MZDA 2VGCC 1A7SA 3HGNA 2FX6A 2XW9A 2HPPH 1SGTA 1QGFA 5DP7A 2CJIA 4ABHA 1W7XH 3TPIZ 1O2OA 1YCPK 4YXWD 1EZSC 2OUAA 4DOQA 2P3FH 1UK2A 1AQ7A 2VB0A 4U01A 2GCTB 2QCYA 2C8ZB 4GSOA 3TJUA 3QO6A 1SLXB 2QA9E 1CT4E 1F0UA 3RXLA 3NKKA 2JJ1D 1DWCH 3V13A 3ZZAA 1ZR0A 2AMPA 1J15A 1W11U 2A1DB 4MTBA 5E0HA 2SGEE 5EXLA 3GY2A 1LO6A 1D9IA 1MTUA 2GDEH 1ETTH 2M5TA 5EQQA 5FCRA 3UB0A 2A4OA 3TK6A 1H8ED 3E0PB 2SGAA 3OSYA 2JETB 4MQAA 1Z8JB 1O2VA 1RIWC 2A5KA 1GJ4H 2EEKA 3D65E 5FHTA 4FUHA 3SHCH 2HOBA 3SQHE 1QY6A 2YNBA 2ZHEH 2XRCA 3QDZB 4D9QA 4ISNA 2Z9GA 1EJAA 1FONA 1SGCA 2OTVA 1QURH 1SQAA 4DGJA 1XUGA 3C1KA 3KQCA 1U6QA 1O3LA 2QAAA 1EJNA 4OS1A 3W94A 3HATH 2Q1JA 3DUXH 3G01A 1AWHB 1SGPE 1UTOA 2J5UA 2J97A 2ZFSA 3ESTA 2J94A 3KIDU 3RXVA 4E7NA 2VIVA 2ZGJA 1GBCA 1C2JA 4A1VA 5E0JA 1V3XA 1HIAB 4INKA 4K1EA 3F68H 2RA0A 2Y5HA 4HZHA 1HV7A 1LHGH 2BDHA 1AE8H 1V2KT 1PPBH 1KXEA 4INLA 2ZGBH 4GAWA 5LPRA 4F48B 3P70B 2F9BH 3P95A 3F1SB 5EJLA 2FYQA 4NSVA 1K22H 2THFB 1JOUB 1XX9A 3BTQE 3SUEA 3GY8A 5EJZA 3UUZA 5T3HA 3RP2A 1V6DA 5ESTE 1TGCA 1W0KD 3M7QA 4Q4LA 7ESTE 5JBAS 3L3TA 4SGBE 3SV7A 4D7GA 1EUFA 3BTEE 1GBAA 2FYRA 1TPAE 1T31A 4D9RA 3M5NA 5GPIB 3I29A 1Q3XA 2OC1A 1Z1JA 5I46H 4RT1A 3OFND 3F9FA 5C1XA 1QIXB 4UE7H 3RXJA 1Y3UA 4CRFA 2FI5E 3W95A 3S9BA 4LZ4B 1DSTA 3PTBA 2FWWA 3B9FH 1HPGA 3TK5A 2IPHA 2ANMH 2P3TB 5ETXA 1NN6A 1NROH 2ZKSA 5LGOA 2ODPA 4FUDA 2NU1E 3SYJA 1TNIA 1C5RA 2AHME 2QV1A 3MNCA 3UFAA 1W2KH 3VGCB 2AYWA 1BB0B 3RXPA 3S69A 2BYAX 2YMSB 2VH6A 5A8ZA 2CGAA 4OS4A 1W13U 3LC5A 5A2MH 1K2I1 1BHXB 1G9IE 3A81A 4UFFH 2A4RA 1SGQE 4I8HA 1LHFH 3U69H 1W7GH 1A5HA 1ID5H 2BOKA 4BAQB 5FPTA 1G3DA 3RXKA 4KP0A 1WTHD 3LGUA 1XXDA 2PLXA 4UEHH 1SGEE 2KCPA 1D3DB 1N8OB 3O8RA 2JETC 1P2IA 4ZKSU 1KLIH 3LGWA 2PSXA 2W6JD 2FPZA 1UK3A 1GJ6A 1ELAA 2BD7A 2TRMA 1QHRB 3LKWA 3P8FA 3GDSA 2TGAA 1D3PB 2QF3A 2CF8H 2R0KA 1MQ5A 1YCPH 1SGRE 4IBLH 1ETRH 4FU8A 5DSFA 5EODA 3JZ1B 1BCUH 1SGDE 1TMBH 1JMOH 4AC9A 2JDID 2BOHB 1ZJKA 1THSH 1YBWA 1BMNH 3LIWA 2ANKH 5HMAA 1N6XA 1GJ7B 3MNSA 3EE7A 1C5LH 1DDJA 4JYVH 2QIQA 1CO7E 1O32A 2BY7X 3A8BA 1YYY1 1QZ8A 1AE5A 1TAWA 4X6NA 1EZQA 4F49A 1ZTKA 4FUFA 3FKSD 1J14A 2P3UB 2BDYA 1FAKH 3N7EA 4R8TB 3T26A 1KLTA 1O5BB 2Y7ZA 3BTWE 3A8CA 3UOPA 1C5QA 4D8NA 3PLPA 4TT3D 2STAE 1TQ0B 1KXFA 2FI3E 4I8JA 4X2XA 2XOKD 1O3IA 2WPMS 2EI8A 4FUGA 3OU0A 1SHYA 4ZMAH 1F7ZA 1EAIA 2JJ2D 4ISHH 4GPGA 4RSPA 4MNWA 1S81A 4FUJA 1MMJN 2PKSB 2QXJA 1RTLA 1BTYA 2QF5A 2XYAA 2FO9A 2F9NA 3ZZ3A 1GVLA 1Z6EA 5E8EH 1SC8U 3SJ9A 1LVOA 4I33A 1AHTH 1OWIA 2KX4A 1V2OT 6LPRA 2V3MA 2BD4A 1GDNA 1HAVA 3AVZA 2Y5GA 3ZV8A 2YMSC 1NFUA 4FETA 3PM3A 1C1NA 2M2AA 3KF2A 3BTTE 1HLTH 2K0QA 1QL9A 1NFXA 2ZG0H 8KME2 2ZDKA 3PB1E 3URCA 4ABEA 2H9HA 2ZTXA 4YZUA 2HNTC 2JIZD 2BB4A 3VXFH 1O2MA 3V7TA 3N7OA 3LDXH 2W5EA 2XBVA 2G5VA 3MTYA 1JXPA 1XMNB 2R2WU 2R0LA 4RT0A 1K21H 2HLDD 3T28A 2BZ6H 1XUIA 1OWKA 1GHYH 1SGFG 1RJXB 1P01A 2H9TH 1T32A 1BBRK 1NRSH 3A7TA 1BITA 5B6LA 3MH5A 1CE5A 3SU2A 3Q3XA 1RS0A 2PR3A 2FTLE 1DSUA 4ABBA 1SKYE 2A7JA 3S7HB 1O2UA 1HXFH 2QE7D 3CS0A 2OC0A 1GGDC 2Q6DA 3T5FH 1GI7B 2ZQ1A 3UPEA 1UJ1A 4Y10E 3ZV9A 1KLJH 2GV7A 4JCNA 4ABJA 1HDTH 3GCNA 3MO3A 3ZVDA 3N7DA 3RXRA 4UFGH 5JYIA 1J17T 2BDCA 2VWOA 1PPGE 1DPOA 4JZIA 1P2OA 1O36A 2UWLA 3MQKC 3GY3A 1SLVB 2ZEBA 4AYVB 5DP8A 3AAUA 1F5LA 3OEHD 4CRGA 1ESAA 1O3JA 4UFEH 5DP4A 1O34A 3ZVGA 8ESTE 4IGDA 3TH3H 1BRAA 1YY3A 1MAYA 3MU4A 1C1SA 2SNWA 1C1RA 2WYGA 3OYPA 5LPEA 3LH3A 2PGBB 3A87A 4NG9H 1HAHH 1E1RD 5J4QA 1C2KA 1ZLRA 3OY6U 7KMEH 5F53A 4B1TA 1GHWH 1UVUH 2ZZUH 7GCHF 3GY7A 3SGBE 4A92A 3ATMA 3D62A 4QT8C 4MPWA 2BQ6B 2I6SA 1QB9A 1C1MA 1K1NA 5FX6A 4LXBH 4LOYH 1LCYA 2ZHQH 1MQ6A 3FFGA 5CHBA 1EAXA 3E1XB 3LT3A 1RFNA 1LVMA 2HALA 2QXGA 3T29A 1QB1A 1ETSH 1GMHG 4K8BA 2FLBH 1MBQA 1QCPA 4WF8A 3GCHB 2GJGA 1KXDA 1OHHD 2VIPA 2CXVA 3TU7H 3FZDA 1GCDA 3SO3A 3UQVA 1GBDA 1C5VA 4DT7B 2FOGA 1TBQH 2AH4X 3MH7A 2A45B 5IYTA 1CBWC 3ZVFA 2ANYA 1Y8TA 4BTIB 5HIZA 5ESBA 4IC6A 1YPHC 2C3SA 5DJ7A 3PV2A 2IJOB 4DJZB 5IK2D 2ZU1A 2PV9B 2O8TA 4NA8A 3NUMA 1XKAC 3RLWH 3KGPA 2ZNKH 1G30B 4Z6AH 1UTPA 2XTTB 1SGYE 4Y7AA 1AWFH 1FN8A 1L4ZA 3BTGE 1P06A 1HJ8A 1SGFA 2WUCA 1TRMA 2VIDA 4XFQA 2DE9A 1E79D 3FN8A 4O03A 2EQNA 3TGIE 3EA8A 2SGQE 6CHAC 3RXUA 1FY5A 3SNDA 3ODFA 1W0JD 2PKAB 4LK4A 1VCPA 2A4QA 3VEQB 1O2RA 2KCYA 5HYOA 4DW2U 1PFXC 1KMHB 1AFQB 5C5NA 2CN0H 4WH6A 4MNXA 1P03A 1ZSLA 1JIRA 3BV9B 2BDAA 1UTKA 3NZIA 1XUJA 2SGDE 4AGKA 2VH0A 1VR1H 3SBKA 1BOQA 3ZZDA 3E6PH 5C3NA 2G4UA 1T8LA 7GCHG 1XVOA 3BTME 1PYTC 4U30A 5DK1A 4DCDA 4U2WA 3S9CA 1ELEE 4DIIH 1TOMH 3QGJA 3UQOA 1AVXA 2J98B 3GY5A 3ODDA 1TX8A 1TA2A 1WYKA 2RG3A 4B2AA 1YLCA 3FP6E 1V2LT 2CF9H 3BG8A 2RFKC 3V0XA 1LHEH 1AFEH 4E06H 2F91A 1TE0A 3KN2A 3NPSA 1K28D 3MU1A 1O37A 3PMAB 1O5EH 1FY4A 2J4IA 2ZQ2A 1T8OA 2W3IA 2J92A 1DLKB 2UWOA 1A5IA 3H7OA 3A7XA 4ZKRU 1HUTH 3TH2H 1X7AC 1NRQH 1QBNA 5DP5A 2VWMA 1ZHRA 1DANH 1K1LA 1LPGB 3QK1A 2AIQA 4H4FA 4J2YB 1L1GA 2W6ID 3F9GA 3BG4B 1ZSJA 3HKJB 1XXFA 3RXCA 4ABDA 4ISOA 1HAXB 4GUXA 1C1TA 2BDBA 1GMCF 2PTNA 2FX4A 4HI3A 1LDTT 3RXHA 1O2IA 3RLYH 2J98A 1FLEE 1K1PA 2CHAB 3SZNA 1KXCA 1VGCC 3RDZA 1P8VC 2L6OA 3SN8A 2A32A 4NIXA 3DT0H 3ATLA 2GX4A 1KXBA 3M5LA 6ESTA 4Y0YE 3TJNA 1PQ8A 3SU3A 2CV3A 1C1PA 5E2OA 1E38B 2P16A 3HK3B 2O9QA 3MHWU 5GCHG 1A46H 4X2YA 4CRAA 3UREA 3GCTF 3ATIA 1BBRH 3SQEE 2Z3CA 3RXBA 2BX4A 3TGKE 4AN7A 2PTCE 1TMUH 4ZHLU 2ZGCA 1V2NT 2ZFPH 3EYDA 4ABAA 1BBRE 2QF4A 1C9PA 1P9UA 2GCHF 1ZPCA 2ZDNA 3ZVEA 2AERH 4B75A 2GT8A 1RTFB 3EQ0H 1G32B 5KEDA 3ELAH 2F83A 4X6OA 2XBXA 3TIUA 3D49H 1QB6A 1VITG 2JH0D 1AUJA 4VGCB 1HJ9A 1YPHE 1AB9C 3LGTA 4AB9A 2J95A 4B74A 1OWEA 2TGDA 2OQ5A 2VINA 3DSGA 1TPPA 1TABE 1EB1H 1HB0B 1YPMH 4FUBA 4BTTB 2UUJB 3SGQE 2SGPE 2A4GA 1HAPH 2SFAA 1V2QT 5EIYA 1SG8B 1P2KA 2BD2A 3ZVBA 1GCTC 4CH2B 1WBGB 1ZHMA 4GVUA 5GDSH 3GCOA 5AFZH 1RTKA 3PLBA 4CR9A 4XBBA 1CGIE 1S83A 4X1RU 3A83A 4DY7B 1JWTA 2HWLB 1YC0A 5DO4H 3SU0A 3M35A 2BD5A 3KYFA 3LJOA 5L30H 1Y3YA 1INCA 2ZU5A 3STIA 3VPKA 1SOTA 5CMXH 1LPKB 5T6DA 3V12A 4WWYA 1ZGIA 5H4IB 5JBBS 2GZ9A 1F92A 4Y71A 3Q00A 3UNSA 3A88A 3LGIA 2ZP0H 3LU9B 5AVDA 3MNBA 1HBTH 5C1YA 1GG6B 5C0TA 3UWJH 3WWBA 1DE7H 2ODYB 3NK8A 1FZZA 1O3EA 2A5AA 1AD8H 1HAYB 1TQ7B 4DT4A 1GJ8B 5FL7D 2BMGB 1TBZH 4JK5A 1BHXF 1CQQA 3SGAE 4LZ1H 1S5SA 1K1OA 3LH1A 1PQAA 3V3MA 1ELGA 1DM4B 1A61H 1V2UT 2OC7A 3WWFA 2XWAA 1HAGE 1TX7A 3OY5U 1ANCA 1CGJE 1VKYA 2VGCB 1TB6H 3DA9B 1XKBC 4A6LA 4YLUA 1GBBA 1FJSA 2GV6A 3K6YA 2C8XB 4CBNA 3CENA 2QF0A 2H1UA 2FOHA 4X1SU 1DX5M 1BRBE 3EE0B 3KQ5A 2GZ7A 3DSOA 2WV5A 2ZU4A 5FBIA 3HKIB 3QUMP 5EJ1A 1BTHH 1WUNH 1IQKA 3MO6A 1DY8A 5C5OA 1QA7A 1QA0A 4KGAA 1AKSB 1AZ8A 2RDEA 4K8YA 4Z1MD 2A7CA 4KTCA 3BIVH 1THPB 1P3CA 1CGHA 2SNVA 1WU1A 1NFYA 2BDIA 2OC8A 1GBTA 1GMDF 4BXWA 1QR3E 2LNCA 1HAIH 2QXIA 4ZROA 2ZGXH 4NFFA 1HNEE 4FOUC 1O39A 5DGJA 3PO1C 3KNXA 2BY8X 1GHAG 1O3FA 1HAVB 1O3PB 1K1JA 5L6NH 4B6EA 2EI6A 3VB5A 1WXRA 1SQTA 6CHAB 1GI0A 1AKSA 2KZ4A 1IHTH 1O2HA 3NCLA 4WMEA 1IQEA 4AFUA 1IQHA 1G37A 5EW2H 2Z9JA 2XC5A 2ZFFH 5DP9A 4B71A 1BRCE 2KR7A 1GBMA 1T8MA 3IITA 3F2HA 3EA9A 1NRNH 3HPTB 3TJVA 5CHAC 1RXPA 2NU0E 5TCCA 1M9UA 4A5TS 2ZDMA 2KFWA 1VITH 1F5RA 1CT2E 4FVDA 1Z1IA 1JBUH 3A7ZA 4YOIA 2RCEA 1O2WA 3K65B 4I31A 1O2NA 3PROA 2OLGA 4MLFB 3ZZ7A 3UR9A 4CR5A 2Z3DA 1ZRKA 3PMBB 1O2QA 3SU1A 3BEIB 4NGAH 2QGRA 3SHAH 1NY22 3URDA 4AFZA 1EPTC 1UTMA 1MKXK 2ALVA 3QGNB 2K1QA 2PUQH 1OP8A 4WMDA 1T4UH 2HNTF 1NTPA 5GJ4B 1WAYB 3RMNH 3PV4A 1Z8GA 1UTNA 1DITH 1CU1A 4HFPB 4YLQH 1TOCB 4X6MA 2JH6D 1H1BA 3RC6A 3SJ8A 3VGCC 3PWCA 3FVFB 1Y3VA 2BXUH 3M3VA 3RXOA 5A0AE 4CHAC 1HIAA 2OK5A 4OS6A 1P57B 1ZOMA 3E3TA 1EX3A 3QLPH 1MD7A 1HYLA 1BMFD 1AN1E 2GKVE 1NU9A 2OP9A 4UFDH 1C1QA 2HVXA 1ESBA 3QTOH 3GYLB 2Y80A 3SV2H 4CRBA 1BMLA 5FAHA 2C4FH 5BPEA 2UUFB 2WHXA 4TWYA 1CT0E 1IQJA 1ELDE 1ACBE 4B73A 2Q6GA 1HXEH 1YCPM 3RXAA 4K69A 4OS7A 1D6WA 5PTPA 4Y79A 1GBKA 1TNJA 2UUYA 4NFEA 1K9OE 2ZDAH 3L33A 3VG8A 1J16A 3GOVB 5KECA 3TGJE 3ZZ6A 1ELVA 1F0RA 1YWUA 4MG3A 3Q3KA 1D6RA 2D2DA 1SI5H 2KM0A 1CSOE 3SUFA 4NZQA 5FX5A 4I7YH 1P04A 1TLDA 1BMAA 1FY1A 4XBDA 5E0GA 3B23B 3OTJE 1OWDA 4FXGH 2W26A 5FXLA 1MUEB 2IPQX 1Q31A 2WYJA 1AB9B 3S0NA 3MH6A 4X2WA 2BLOA 2WSSD 3LONA 1DXPA 2UWPA 2W7SA 1QRXA 2CK3D 3ATWA 1IHSH 2ZU2A 1C5ZB 1C2HA 2V3OH 1FUJA 3QX5H 2GT7A 5C1UA 1HAOH 3C27B 3QWCH 4ISIH 1P2JA 2OBOA 5DPAA 4P00A 1BRUP 3U1IB 2I6QA 1A4WH 1DS2E 1O0DH 2EY4C 5EW1H 4F4OC 1GBFA 4WVPE 6GCHF 3P8GA 1KDQA 1WQVH 2RA3A 4ESTE 1OSSA 1QJ6B 3LGVA 2GGVB 1CA0B 2B5TB 2ZPRA 1Y59T 1MTNB 1DUAA 1CHOG 4X6PA 3VB6A 1YPJH 1ARBA 2FODA 5AHGH 1O3BA 4NIWA 2GP9B 2WZQA 2ZA5A 3UAIC 2OINA 2WPIS 1O2SA 3P92A 4DVAU 3Q76A 1O2XA 1K1IA 1IQMA 3DFJA 1QRZA 2K8IA 1EP5A 2NWNA 4WY3A 2W7UA 5DP6A 1ELCA 4NIVA 4ZUHA 1GG6C 4RKOB 4O97A 2F9PA 3TLOA 1EOLA 2G5NA 1AUTC 4GCHG 1AGJA 3B8JA 1O2LA 4NA9H 1SB1H 2LP6A 3SU6A 1GBLA 2BHGA 1G3CA 2FOMB 2FEQH 1W14U 2J2UA 1KSNA 2AS9A 3I77A 1TIOA 4K60A 1A3EH 4TY7A 3RU4E 4XOJA 1NRPH 2V6NA 1C2MA 1FV9A 4MPXA 2QN5T 4TPYA 5C17A 2PW8H 2F9UA 4X8VH 1GBJA 1YLDA 1PPCE 2Y82A 2O8LA 4BAOB 1L1NA 3RU4D 4YO9A 5EG4A 2WPJS 3VB3A 1VJAU 3M3SA 1SHHB 4NWLA 4DIHH 3PV5A 1NS3A 2ZDLA 1W3CA 3PTNA 2BLWA 2FOEA 2WPHS 1P02A 2H5DA 3M36A 1C1OA 1LVYA 1GWAA 1YKTA 2CMYA 2QY0B 1J8AA 1MD8A 1GVKB 1D4PB 2ZECA 5HIYA 4JYUH 1C4Y2 1QL8A 2B8OH 4KTSA 2ZFTA 3KQBA 2P8OB 5EOKA 1D3QB 1NM6A 4B2CA 4WMFA 2VVUA 4A7IB 5DP3A 3CP7A 2DE8A 2PSYA 3RXMA 4ZKOU 3PYHA 1AMHA 2ZF0H 1OXGA 1V2RT 1C5YB 5HGGA 4X0WU 1F5KU 4NA7A 3ZIAD 3BSQA 1IQFA 5HKKD 1ABIH 5C2ZA 3H09A 5F03A 1N8OC 1QRWA 1TWXB 3KHVA 4JZEH 4JMYA 4A1XA 5B6OA 4H6TA 4X8TH 1YPGH 2A5IA 5EPYA 5LH8A 1SLUB 1IQLA 1GI8B 1V2TT 2VIWA 2ZPSA 4K5ZA 4MDSA 5G4BA 2BQWB 4ABFA 5LPFA 1Z8IB 1ANBA 2C8YB 1LMWB 1FPHH 4Q7XA 3AASA 1COWD 1GJ5H 2Y5FA 2ZCLP 2OBQA 4WXVA 4CREA 2KCOA 3IG6B 1ZMNA 3EDXB 3SNAA 2AGGX 1ZJDA 3F2GA 4O3UA 5L2ZH 3BTFE 5L2YH 5F8XA 3ZVCA 1GI1A 2VU8E 5GIBA 1P12E 3SU5A 1W8BH 4MPVA 4B76A 3FAOA 1V2WT 3VB4A 3O8CA 2Z9KA 1G2LA 1KIGH 1ZSKA 1JRSA 1ZMLA 2OCVB 3KL6A 4YT7H 4YTAA 5HM2A 1D3TB 3NWUA 4UD9H 1ESTA 1ZTJA 2FESH 1LKAA 1TNHA 4UDWH 4TWWA 3T2NA 2QXHA 1NC6A 2PHBA 3MI4A 3UY9A 3DCLA 3I78A 4ASHA 3BTKE 1C5UA 1FAXA 5EXNA 1O5FH 2ZHFH 2FS8A 4I86A 2VIOA 3OE7D 1MABB 1E37B 1EPTB 1CVWH 5EXMA 4YT6H 2FMJA 1OYQA 1ZZZA 3ZZ9A 1FI8A 5JBTA 1G2MA 2XXLA 4Y7BA 3UR6A 3JZ2B 1P2NA 1Y5AT 2C90B 1AVGH 1C2IA 2L74A 4AORA 4OS5A 1QBVH 5F6MA 1N1LA 1YP9A 3E91A 1H9HE 2J38A 4A1TA 1N6YA 4B2BA 2OQUA 1C2GA 1FIWA 1BTXA 2ASUB 4BTUB 3ZZBA 1C5MD 1O3MA 1Z8RA 3O8DA 4FVBA 2GCTC 3RMLH 3A8DA 1ANDA 4WJG2 2TGPZ 1H8IH 2P95A 2VWLA 1OWJA 3T62A 4GLYA 4JZ1A 2EI7A 1GMDG 3RM0H 2BVSH 5SGAE 1SPJA 3TNSA 4AB8A 4JZFH 4IW4E 3DFLA 1NU7B 4ZH8A 2WV4A 3M5OA 1KTSB 1TYNA 2GD4B 2J9NA 1AFQC 1BTWA 1MU8B 2HPQH 3A7YA 1C5OH 1UK4A 3DD2H 1K0HA 4Y8YA 2BD9A 2R3UA 3U28C 3F6UH 3NRLA 3GYMA 1ZHPA 3SUDA 4FUCA 3SOSA 2R9PA 1MTSA 3EAJA 1NZQH 3W1EA 1MAXA 2NU4E 1O2YA 2V7QD 4HTCH 2F43B 1Y5BT 1O3DA 1C5NH 2FIRH 1S84A 2RDLA 4YM9A 4I32A 1GBHA 2FOBA 1NO9H 2ILNA 2BZAA 3SZEA 1BIOA 2BX3A 2Z3EA 1TGSZ 3Q3YA 1E1QD 3VB7A 5AF9H 2Q6FA 1GJAB 2G81E 1ELBA 4X8UH 1RD3B 3BTDE 1VZQH 1GJDB 5EPNA
chains in the Genus database with same CATH topology
1OP2A 1LPZB 2FP7B 5DG6A 3SV9A 1XUFA 3P8NA 4WH8A 4IMQA 3KEEA 1QJ7B 1OYTH 1MKXH 1NT1A 5AFYH 1MBMA 4TPIZ 2FM2A 4ISLA 2H9EH 3S9AA 2ESTE 3RXSA 1LKBA 1OX1A 3GDVA 1BA8B 4I8GA 4INHA 2ZTYA 1GJCB 4TYDA 1EQ9A 4Y8ZA 1W10U 1W12U 1QFKH 3MFJA 1F0TA 1F0SA 1K1MA 1MZAA 1VGCB 1O3OA 2D8WA 3GISB 3UIRA 2P93A 4NZLA 4XDEA 3RUOA 1LTOA 5T6GA 2H5CA 3M61U 1FXYA 1O2PA 1VCWA 1J9CH 3RXEA 1TRNA 1C1VH 5A09A 1FNIA 3M7UA 2VWNA 5EGMA 1GMHF 2ZIQH 5GWZA 5A8XA 2G52A 5GCHF 1WTGH 4YOGA 3PWBA 4WXIA 1UTJA 2IOTA 4X2VA 4R0IA 5E2PA 1SFIA 3VFEA 3GY6A 3MWIU 1A2CH 4I8LA 1AO5A 2TBSA 1TBRH 4JZDH 1FY3A 1WOFA 1GI2A 3IWMA 1S0RA 1QTFA 1ORFA 2YOLA 1GGDB 3ITIA 4E7RG 1IAUA 3DHKH 1TGTA 5JPMH 1EPTA 5FBEA 3MO9A 1DICA 1PPZA 2P59A 1UVPA 1DFPA 1TONA 2PGQB 2D26C 1S0QA 1SBWA 1SGIB 1LHCH 1AZZA 2W3KA 2NU2E 2AGEX 3E16B 1QL7A 3EA7A 2ULLA 4M7GA 3PMJA 4X8SH 3ZZ4A 2V3HH 4AX9H 3SJOA 1EXFA 1UCYK 2TIOA 1V2ST 3HGPA 1RRKA 2F9VA 2R2MB 2BTCE 1L1JA 3ZYDA 1GL1A 1C5TA 1DLEA 2AEIH 3TK9A 1GCTB 3PMHB 1KYNA 1TX6A 2OD3B 2O8MA 1ZYOA 4BAMB 1XM1A 1H4WA 2P8OC 4NIYA 1PPHE 4AFSA 1Y5UT 2FZZA 1IQIA 2ALPA 1SGNE 2C93B 3QZRA 1BJUA 1CHOF 3SI4H 1GJBB 1PPFE 3MOCA 5A0CA 1C2LA 1ZPBA 2FS9A 1HFDA 2BY5X 1FQ3A 4OGYA 4K3JA 3MU8A 2F3CE 1A3BH 1E35B 2FXRA 5FCKA 3GICB 1O3AA 3T25A 2WPLS 3U1JB 3RMOH 4HGCA 1JIMA 1O5AB 1WCZA 2GDDA 1IQGA 3RXIA 1MKWH 2O8UA 3OX7U 3ZYEA 3P6ZB 3RXFA 1C5PA 1KY9A 1ARCA 3E0NB 4AYYB 3GCHC 1XUKA 1DOJA 1P11E 2OXSA 4Y76A 2A0QB 2XC0A 1OPHB 2BLVA 1MKWK 1AU8A 1C5WB 1ZGVA 4ZKNU 1YPKH 3TNTA 4DG4A 3FP8E 4NCYA 1P09A 1UMAH 1SQOA 1T4VH 3FP7E 3MMGA 1HAZB 5A0BA 2PKSC 1H9IE 1O33A 3T27A 1GHBG 3S7KB 2FTMA 4U32A 1TGNA 2XCNA 2BXTH 2TGTA 1QNJA 1L2EA 2TPIZ 1UCYH 1YF4A 3QN7A 1P2QA 2ANWA 5TCAA 1S85A 2V35A 2XBWA 1B0EA 2WINI 1A0LA 2BQ7B 1SR5C 1G36A 2CHAC 4X1NU 1OWHA 3KQEA 1CA8B 1KXAA 3AAVA 3FZZA 5ABWA 3SNEA 4Y8XA 4BAKB 1MCTA 7LPRA 3U8RH 2GCHG 1TA6A 3GDUA 5A8YA 2ZFRH 1UTLM 1MTWA 1GI6A 2ZCHP 1HCGA 2ZDVH 1AVWA 4KTUA 3TITA 1O3KA 4CH8B 4CRCA 3GCTG 3O8BA 3LGYA 2Z94A 2HGTH 4GHTA 2XNIA 9LPRA 4FU9A 3MNXA 3RXDA 3RU4T 1MCVA 4YESB 1FIZA 4K1TA 2GMTC 5GXPA 1YGCH 3SUGA 1YPEH 1UHBA 1A5GH 1QJ1B 4BNRA 2G51A 3MH4A 1P2MA 4IC5A 2PFEA 4H42U 2EC9H 3SORA 2O8WA 3UOUA 1EASA 2GVFA 2XCFA 2BDGA 1C2EA 1GL0E 1GVZA 2Y81A 1NRRH 1BZXE 5F8TA 2BLQA 2VIQA 3A89A 3SU4A 1GHXH 1P10A 5I25A 4JYTA 4RN6A 1T7CA 1GHVH 2F9OA 3K6ZA 1EOJA 4DURA 1SMFE 4FUIA 1WV7H 3BG4C 4Q7ZA 2Y6TA 3RC5A 2JH5D 3SI3H 1AY6H 1A0HB 2B0FA 4Y11E 1NESE 3UTUH 1BTPA 2V0BA 4E05H 2KAIA 1JRTA 1XVMA 2JKHA 2Z7FE 1GBIA 2Z9LA 1QQ4A 1SVPA 3WY8A 1GBEA 1HJAB 2A2XH 3LPRA 3A7VA 2ODQA 4IN2A 1Y3WA 4ABIA 4IS5A 4X1PU 1T8NA 2B7DH 6GCHG 4MNVA 4Q80A 3E90B 2G55A 2A2QH 1GHBF 1ELTA 4BOHA 1L4DA 1TGBA 2KAIB 4H6SB 2ZGHA 2J34A 1C4U2 2AFQB 2DUCA 2P94A 1B5GH 2AMQA 2PWXA 9ESTA 1BDAA 1HGTH 2FOAA 5DKMA 3CS7A 2STBE 2A7HA 1BTUA 4TY6A 4YOJA 1FY8E 1O3CA 2BY6X 1UVTH 1TNLA 1CBWB 1Q2WA 2FOFA 3H5CB 4XSKU 1UCYE 2C8WB 3U8TH 5IDKA 5CE1A 1PJPA 1GI9B 1GPZA 3SNBA 2ZHDA 4MNYA 3ZZ8A 1WSSH 3ZZ5A 3KQDA 1MH0A 1SFQB 4ZAEA 1CHGA 2ZPQA 3QZQA 1VITF 1GJ9B 3U9AH 1TNGA 1TPOA 1UHBB 1MU6B 1O5GH 2GMTB 1B7XB 4J1YA 1O5DH 3UNRA 2VVVA 1UTQA 1EJMA 3A82A 4Q7YA 4XE4A 1NPMA 5EU8A 1FPCH 1HRTH 1TRYA 8LPRA 3LC3A 1TMTH 4K2YA 1OKXA 1DWBH 2EA3A 1V2PT 4XBCA 2B9LA 1B0FA 1EATA 3AW1A 3U98H 1A0JA 2WUBA 3F9EA 1GHZA 3BN9A 2XBYA 3SJKA 2ZU3A 4AZ2B 1F2SE 4KELA 3A86A 5EQSA 3GY4A 1ANEA 1BUIA 3SNCA 1O35A 4KKDA 1V2VT 2AIPA 3A85A 2ZFQH 2Z9IA 3M5MA 8GCHG 3PO1B 1GHAF 1EZUC 2VNTA 3FANA 1Z71A 2XC4A 2SGFE 1L0ZA 1SOZA 2ZI2H 3RC4A 2XWBI 2YNAA 1E34B 3SW2B 5JB8S 1KDQB 1PQ5A 4X1QU 3MYWA 3PLKA 4NWKA 1Z7KA 2VJ1A 1MTVA 1O3NA 4JK6A 2HLCA 1MTNC 2ZHWH 4ABGA 3K2UA 4FU7A 3A80A 1HJAC 5CHAB 3A7WA 3ATKA 4MPUA 4AGJA 2WPKS 2G8TA 3KCGH 1TFXA 4UONA 2PKAA 4ZXYH 2FOCA 4I8KA 1OS8A 3EGKH 1BMMH 4ZXXH 4AG1A 4OGXA 1QBOA 2BY9X 1WQSA 3E8LA 1A1RA 2H2ZA 3M7TA 3P17H 3M3TA 4THNH 2GZ8A 1O5CB 2R3YA 1SL3A 1O2ZA 1DT2A 1LVBA 2BD8A 2BD3A 1GI3A 5HM9A 2ZTZA 1C5XB 3RM2H 4Z0KA 3U8OH 1AIXH 1LQDB 1UVOA 1GDUA 3AW0A 3P8OA 5JB9S 4D7FA 3UWIA 4BXSA 5TJXA 1O3GA 4CBOA 1S82A 1TALA 3TH4H 3HK6B 3BEUA 5JDUB 1H8DH 1DWDH 1O2JA 1O31A 2HRVA 1C4V2 2IN2A 1THRH 1UVSH 1ZMJA 1VJ9U 3M37A 1C9TA 1ZTLA 3RXQA 1FN6A 1TPSA 3BF6H 1SLWB 4ZHAA 3SV8A 5C20A 4GHQA 1PPEE 1EZXC 1LQEA 1ZPZA 4ZHMU 1QQUA 1V2JT 3QTVH 3RMMH 3RXTA 2QYIA 3BEFB 2ZWLH 1ABJH 1EAUA 1H9LB 3SV6A 1YM0A 4Q2KA 1Z6JH 1RGQA 1EKBB 1BT7A 2QC2A 4K1SA 2A31A 2HNTE 1AI8H 4VGCC 3VXEH 3TVJB 1P3EA 3H7TA 3UNQA 3R3GB 1RIWB 1P05A 1P0SH 3LOXA 1G3BA 4NSYA 1O38A 2Y7XA 4MVNA 2UUKB 5FPYA 1O30A 2AMDA 1GI4A 1DUEA 2AGIX 1ZRBA 1OOKB 1G3EA 3ZZCA 5JBCS 2FI4E 3MU0A 1IOEA 1NFWA 1C5SA 2NU3E 2G4TA 1Y3XA 1BJVA 1DVAH 1P9SA 1W0ZU 3LJJA 3RXGA 2ZCKP 3BIUH 1C1UH 4AFQA 2PUXB 3MU5A 2ZO3H 2H6MA 4IN1A 5EQRA 1BQYA 3D23A 1GDQA 5FPSA 4PROA 2BVRH 4RKJB 1GI5A 1IQNA 4CRDA 4O3TA 3BTHE 1BTZA 1SSXA 5F8ZA 5K7RA 1XUHA 1LHDH 3F9HA 1EAWA 1C1WH 2BM2A 3Q77A 3ENSB 2ZC9H 4D76A 8GCHF 4BANB 2FDAA 1C2DA 1S6HA 5HXFA 3TJOA 1DY9A 1E36B 1PQ7A 3ZVAA 1TNKA 5BRRE 1O2GH 1S6FA 1EP6A 2FLRH 4O9VA 3A84A 1E0FD 1ELFA 1UO6A 1O2TA 1DWEH 3SJIA 1OP0A 5T6FA 3K9XB 4AOQA 4Y6DA 2G00A 1PYTD 4OS2A 4IMZA 3NXPA 4SGAE 4CHAB 3L6PA 3A8AA 4GCHF 5K0HA 5J4SA 3R0FA 5C67A 4BAHB 4Y0ZE 1O3HA 1KTTB 1YPLH 2BVXH 2Z6BD 1CA0C 2GTBA 1GMCG 1DXWA 1FMGA 1C2FA 4FUEA 2D1JA 1EB2A 1O2KA 3STJA 4AG2A 1V2MT 2LPRA 2VVCA 1VCQA 1FDPA 1W0YH 1MZDA 2VGCC 1A7SA 3HGNA 2FX6A 2XW9A 2HPPH 1SGTA 1QGFA 5DP7A 2CJIA 4ABHA 1W7XH 3TPIZ 1O2OA 1YCPK 1EZSC 2OUAA 4DOQA 2P3FH 1UK2A 1AQ7A 2VB0A 4U01A 2GCTB 2QCYA 2C8ZB 4GSOA 3TJUA 3QO6A 1SLXB 2QA9E 1CT4E 1F0UA 3RXLA 3NKKA 1DWCH 3V13A 3ZZAA 1ZR0A 2AMPA 1J15A 1W11U 2A1DB 4MTBA 5E0HA 2SGEE 5EXLA 3GY2A 1LO6A 1D9IA 1MTUA 2GDEH 1ETTH 2M5TA 5EQQA 5FCRA 2A4OA 3TK6A 3E0PB 2SGAA 3OSYA 2JETB 4MQAA 1Z8JB 1O2VA 1RIWC 2A5KA 1GJ4H 2EEKA 3D65E 5FHTA 4FUHA 3SHCH 2HOBA 3SQHE 1QY6A 2YNBA 2ZHEH 2XRCA 3QDZB 4D9QA 4ISNA 2Z9GA 1EJAA 1FONA 1SGCA 2OTVA 1QURH 1SQAA 4DGJA 1XUGA 3C1KA 3KQCA 1U6QA 1O3LA 2QAAA 1EJNA 4OS1A 3W94A 3HATH 2Q1JA 3DUXH 3G01A 1AWHB 1SGPE 1UTOA 2ZFSA 3ESTA 3KIDU 2J94A 3RXVA 4E7NA 2VIVA 2ZGJA 1GBCA 1C2JA 4A1VA 5E0JA 1V3XA 1HIAB 4INKA 4K1EA 3F68H 2RA0A 2Y5HA 4HZHA 1HV7A 1LHGH 2BDHA 1AE8H 1V2KT 1PPBH 1KXEA 4INLA 2ZGBH 4GAWA 5LPRA 3P70B 2F9BH 3P95A 3F1SB 2FYQA 4NSVA 1K22H 2THFB 1JOUB 1XX9A 3BTQE 3SUEA 3GY8A 3UUZA 5T3HA 3RP2A 1V6DA 5ESTE 1TGCA 3M7QA 7ESTE 5JBAS 3L3TA 4SGBE 3SV7A 4D7GA 1EUFA 3BTEE 1GBAA 2FYRA 1TPAE 1T31A 4D9RA 3M5NA 5GPIB 3I29A 1Q3XA 2OC1A 1Z1JA 5I46H 3F9FA 5C1XA 1QIXB 4UE7H 3RXJA 1Y3UA 4CRFA 2FI5E 3W95A 3S9BA 4LZ4B 1DSTA 3PTBA 2FWWA 3B9FH 1HPGA 3TK5A 2IPHA 2ANMH 2P3TB 5ETXA 1NN6A 1NROH 2ZKSA 5LGOA 2ODPA 4FUDA 2NU1E 1TNIA 1C5RA 2QV1A 3MNCA 3UFAA 1W2KH 3VGCB 2AYWA 1BB0B 3RXPA 3S69A 2BYAX 2VH6A 5A8ZA 2CGAA 4OS4A 1W13U 3LC5A 5A2MH 1K2I1 1BHXB 1G9IE 3A81A 4UFFH 2A4RA 1SGQE 4I8HA 1LHFH 3U69H 1W7GH 1A5HA 1ID5H 2BOKA 4BAQB 5FPTA 1G3DA 3RXKA 4KP0A 1WTHD 3LGUA 1XXDA 2PLXA 4UEHH 1SGEE 1D3DB 1N8OB 3O8RA 2JETC 1P2IA 4ZKSU 1KLIH 3LGWA 2PSXA 2FPZA 1UK3A 1GJ6A 1ELAA 2BD7A 2TRMA 1QHRB 3LKWA 3P8FA 3GDSA 2TGAA 1D3PB 2QF3A 2CF8H 2R0KA 1MQ5A 1YCPH 1SGRE 4IBLH 1ETRH 4FU8A 5EODA 3JZ1B 1BCUH 1SGDE 1TMBH 1JMOH 2BOHB 1ZJKA 1THSH 1YBWA 1BMNH 3LIWA 2ANKH 5HMAA 1N6XA 1GJ7B 3MNSA 1C5LH 1DDJA 4JYVH 2QIQA 1CO7E 1O32A 2BY7X 3A8BA 1YYY1 1AE5A 1TAWA 4X6NA 1EZQA 4F49A 1ZTKA 4FUFA 1J14A 2P3UB 2BDYA 1FAKH 4R8TB 3T26A 1KLTA 1O5BB 2Y7ZA 3BTWE 3A8CA 3UOPA 1C5QA 4D8NA 3PLPA 2STAE 1TQ0B 1KXFA 2FI3E 4I8JA 4X2XA 1O3IA 2WPMS 2EI8A 4FUGA 3OU0A 1SHYA 4ZMAH 1F7ZA 1EAIA 4ISHH 4GPGA 4RSPA 4MNWA 1S81A 4FUJA 1MMJN 2PKSB 2QXJA 1RTLA 1BTYA 2XYAA 2FO9A 2F9NA 3ZZ3A 1GVLA 1Z6EA 5E8EH 1SC8U 3SJ9A 1LVOA 4I33A 1AHTH 1OWIA 1V2OT 6LPRA 2BD4A 1GDNA 1HAVA 3AVZA 2Y5GA 3ZV8A 1NFUA 3PM3A 1C1NA 3KF2A 3BTTE 1HLTH 1QL9A 1NFXA 2ZG0H 8KME2 2ZDKA 3PB1E 3URCA 4ABEA 2H9HA 2ZTXA 4YZUA 2HNTC 2BB4A 3VXFH 1O2MA 3V7TA 3N7OA 3LDXH 2W5EA 2XBVA 2G5VA 3MTYA 1JXPA 1XMNB 2R2WU 2R0LA 1K21H 3T28A 2BZ6H 1XUIA 1OWKA 1GHYH