4WMDA

Crystal structure of catalytically inactive mers-cov 3cl protease (c148a) in spacegroup c2221
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
301
structure length
301
Chain Sequence
SGLVKMSHPSGDVEACMVQVTCGSMTLNGLWLDNTVWCPRHVMCPADQLSDPNYDALLISMTNHSFSVQKHIGAPANLRVVGHAMQGTLLKLTVDVANPSTPAYTFTTVKPGAAFSVLACYNGRPTGTFTVVMRPNYTIKGSFLCGSAGSVGYTKEGSVINFCYMHQMELANGTHTGSAFDGTMYGAFMDKQVHQVQLTDKYCSVNVVAWLYAAILNGCAWFVKPNRTSVVSFNEWALANQFTEFVGTQSVDMLAVKTGVAIEQLLYAIQQLYTGFQGKQILGSTMLEDEFTPEDVNMQIM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords ORF1a
publication title Structures of the Middle East respiratory syndrome coronavirus 3C-like protease reveal insights into substrate specificity.
pubmed doi rcsb
source organism Middle east respiratory syndrome coronavirus
total genus 85
structure length 301
sequence length 301
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2014-10-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1840.10 Mainly Alpha Orthogonal Bundle main proteinase (3clpro) structure, domain 3 main proteinase (3clpro) structure, domain 3 4wmdA03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4wmdA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4wmdA02
1GDQA 3EA9A 1UTPA 2RDLA 1ZJKA 1O3GA 4AX9H 3HKJB 1D3QB 2QV1A 9ESTA 2SFAA 4GPGA 5H4IB 1SG8B 1G2MA 1GG6C 2XWAA 2TGPZ 3P70B 1BIOA 1ELFA 1BJVA 5C2ZA 5AF9H 2CN0H 3PMHB 4MPWA 1V2UT 1E34B 3L3TA 2GVFA 6CHAC 5F6MA 1AWHB 4CREA 3Q3KA 1O2HA 1V3XA 2KAIB 1UHBB 3E6PH 4BXSA 4WJG2 2BOHB 2ZHFH 3P8GA 3SUFA 4Z6AH 3ESTA 1Z8RA 3ZZAA 3P95A 1K1OA 5FCKA 1SL3A 1SHHB 1YP9A 1NT1A 1NFXA 5E2OA 2LIZA 3TNSA 3M3SA 1C1WH 1FXYA 1P57B 4O03A 1OWHA 2F9BH 1C5UA 2ZEBA 3A85A 1O2QA 1GI3A 3GCTF 2BY9X 1Y3WA 2SGFE 5DJ7A 2IOTA 3N7OA 1KDQB 2C8YB 1HAXB 1O35A 1O37A 1LPZB 7ESTE 3ZVBA 3U8RH 1O2YA 3SNBA 5A8YA 1O5FH 2BD2A 3TJNA 1WOFA 1C5MD 1HAIH 1O2OA 5A8ZA 3MU0A 2WPIS 2G51A 1FPCH 3ZZ5A 4X6MA 2AMQA 1DY9A 2Z94A 2BLVA 1FY1A 2SGEE 5ETXA 1N6XA 2WPHS 1GCDA 4WH8A 1EZSC 1LVMA 2AFQB 3HK3B 1ESBA 3PLKA 3BV9B 1N1LA 2BMGB 5DP4A 2ANMH 3A8BA 1MTUA 4ISOA 1P0SH 1GJ8B 2OC0A 1RTFB 3RXHA 4WMEA 1C1SA 2FO9A 3IG6B 1DDJA 2FWWA 1LO6A 3SOSA 1MKWK 2BDAA 2JETC 1SGTA 4CRCA 3M36A 4D76A 1LPKB 3F9FA 3CENA 1GBDA 5AFYH 4K8YA 2WYGA 1ANBA 1SR5C 4U32A 2TGAA 4DOQA 4MLFB 3CS0A 1ELEE 4R0IA 2XRCA 2OQ5A 3PWBA 3O8RA 1OYTH 3SJ8A 2D1JA 2JH0D 2XTTB 1ETTH 1AWFH 4OS7A 3BN9A 2HVXA 1ZRBA 1BCUH 1UO6A 1FY8E 1YBWA 1GDUA 1LDTT 4Q80A 5HM9A 1HAGE 4H6TA 7GCHG 1KTSB 1ANCA 2A7CA 5FHTA 3ZZ3A 2A7HA 2ODYB 1W0ZU 2OLGA 2NU1E 2JKHA 1J16A 1D3DB 1ZSKA 1PPEE 1TGNA 1QB1A 2ZU2A 1HAVB 1HAZB 1MZAA 3I29A 4AFZA 5ESTE 4DJZB 3O8BA 2ASUB 4JK5A 2GV6A 3TJVA 2AGGX 2FOCA 1GHAG 2NWNA 1JIRA 3BTFE 1C1PA 1MKXK 1ZJDA 1GI9B 2H5DA 5E0JA 4CRBA 1DE7H 3UFAA 2WYJA 1NY22 1KTTB 1GCTB 1QBOA 2GZ8A 3SW2B 2A7JA 2AIQA 3L6PA 3U1IB 5K0HA 1DWDH 4X8UH 6ESTA 1AZZA 4X1QU 3A80A 3JZ1B 3S9BA 4GHQA 2F3CE 4XDEA 3RP2A 1C9TA 4YOGA 1S6FA 2QCYA 1Z71A 4DW2U 1D4PB 3SJIA 1TPPA 1P12E 1A61H 4K5ZA 2ODPA 2ZGCA 4Y0ZE 1QB9A 3ATWA 3M3TA 2HNTC 4X1RU 3EAJA 1BUIA 3NXPA 5TCCA 1W11U 2VH6A 1O2ZA 2A0QB 1F0SA 1GHVH 4MNVA 2HRVA 1QL9A 1GHBF 4ABIA 3UUZA 4GAWA 2VGCC 1G3EA 1E0FD 1Z6JH 1TMBH 3LT3A 3EA7A 4U2WA 1TRNA 4XOJA 4ASHA 2EI7A 3K65B 3KQDA 5CMXH 1Z1JA 4I8LA 3SQHE 2OC7A 1UTMA 4I8HA 3SO3A 1T8MA 4YZUA 2R3UA 1FIWA 4NWKA 2QXIA 1NU9A 1NTPA 1TPAE 4ABGA 4FVDA 1BHXF 3E8LA 5EW1H 4CRFA 1T32A 3LC5A 2EI8A 4WF8A 3E91A 1CBWB 4OS4A 3PTNA 2QF3A 2FI4E 3CS7A 1ZHPA 1PPCE 1DWBH 3AW1A 1LPGB 5EGMA 2GX4A 1C5QA 1E37B 1H9HE 3QK1A 3STIA 1C5WB 5LGOA 2ZDVH 4I33A 3M7TA 1S84A 2H9HA 1OX1A 2FDAA 1SLUB 1MTWA 3MNSA 4K1SA 4K2YA 3MNBA 1ARBA 4H6SB 4AZ2B 3V3MA 3QO6A 1YCPK 3KHVA 5HGGA 3ODFA 1YCPM 3F68H 1YF4A 3GCHC 4Y8YA 1HYLA 3ZVCA 1SQOA 1OXGA 1C2MA 8KME2 2XXLA 2OD3B 3TNTA 1HJ8A 1YKTA 3BF6H 3PYHA 4DY7B 1K21H 1ZTJA 5C1XA 2HPPH 5C5OA 2BD5A 2ZDLA 1C5OH 1MH0A 3MU1A 8GCHF 3LGVA 1ABJH 3PLBA 2C3SA 1TWXB 2SNWA 1D6RA 2BLQA 4YTAA 1K1PA 1P3CA 1AD8H 2B7DH 2BVSH 2PGQB 4KELA 1C2DA 2BDIA 1QQUA 3BIUH 4U30A 4TPYA 4X0WU 1TQ7B 3T26A 1Q31A 1VCWA 2GCHG 2FOFA 1C1TA 3NK8A 1WCZA 4GCHF 5GPIB 5EXLA 1PYTC 1O3OA 4AG2A 3ATKA 2J34A 3VB4A 2Q6DA 1GCTC 2F9PA 3RXQA 2BD9A 1HPGA 5FBIA 1ELCA 2J2UA 1TABE 1V6DA 1O2RA 3UOUA 2A4QA 3E3TA 1N8OB 3MH7A 2ZU3A 1C1UH 1DLKB 1RFNA 3S9AA 4CHAC 1C2IA 3T28A 3GISB 1KLIH 2QXHA 3UR9A 3KNXA 4DT7B 3QZRA 1RIWB 1V2WT 3QN7A 1UVPA 5L6NH 1QTFA 1NFYA 3SGBE 3SNEA 1XMNB 2ESTE 1AZ8A 3RM2H 3RMMH 1AIXH 3JZ2B 2PLXA 2WPKS 1HJAC 4BAHB 1E35B 1CHOG 3C1KA 2A31A 1SGPE 2B5TB 2CXVA 1MZDA 3UWJH 3A83A 2ZO3H 3KIDU 2B8OH 1EPTA 1HCGA 4O3UA 2FX4A 2BY8X 5EXNA 1ZYOA 4MTBA 2QY0B 2XW9A 2Y6TA 1SGNE 3SGAE 4O9VA 1FAXA 1EAUA 2SGDE 3Q76A 1L1GA 3PLPA 2XYAA 1P04A 3FZZA 3SUDA 5C20A 2H5CA 2BQWB 1DY8A 3LGUA 4K1EA 1AGJA 1C1MA 5BRRE 3AAVA 1ANEA 1GBKA 1ELTA 3EGKH 1IAUA 1WQSA 1B5GH 1P9UA 2XC4A 1CBWC 1U6QA 2Y7ZA 3S69A 3FP6E 1IQNA 1D9IA 1O2XA 1WTHD 3FZDA 3I78A 3T62A 2Q1JA 1C5PA 1FIZA 4AN7A 1LHFH 4ABHA 2HGTH 1QB6A 1IQMA 3MO9A 1THSH 1SGFA 3UQVA 1A5HA 2FESH 2FOEA 3HGNA 2EI6A 2PKAA 3PMJA 2H9TH 3GDVA 1DS2E 2BLWA 4Y7AA 1KXDA 3SU5A 4PROA 1C5XB 2CHAC 1GVKB 1RRKA 4XE4A 1A0JA 1S81A 3ATMA 1SVPA 3MOCA 1O3HA 5FPSA 2I6QA 3M35A 5K7RA 2XNIA 1AI8H 1YC0A 3A82A 3RXLA 1G30B 3LIWA 2SGAA 3RU4D 2WPLS 3D49H 1E36B 3TLOA 1GG6B 1MTVA 5FPYA 5DO4H 3TGIE 1FV9A 1F92A 3TH4H 1O31A 1O3CA 1YPJH 4D8NA 1OWDA 2GDDA 2ZHEH 3LJOA 4A1XA 1ZHMA 3P92A 1O34A 2J38A 1A0LA 2FYRA 1EX3A 1CA8B 1HGTH 3H7OA 1FMGA 1GJ6A 2A4OA 1NO9H 4FUJA 3UOPA 2PR3A 2ZFTA 3V13A 4UD9H 1NFWA 4NZQA 5HM2A 3MH5A 1N8OC 1F0TA 5DP9A 1CGJE 4UDWH 1ELGA 2BQ7B 2BY6X 2RCEA 4XBBA 1JOUB 5DP6A 4XBDA 4Y6DA 4ZHMU 3Q3XA 4NA8A 2BX4A 1TGSZ 3U8TH 2Y81A 3RXCA 3T29A 2ZDAH 4FUCA 4OGYA 1C4V2 1OWIA 3FP7E 1HB0B 3LU9B 1SQAA 3A86A 4Y71A 4ZMAH 3TGKE 2GV7A 4DVAU 2ZA5A 4WMDA 1MTNC 5BPEA 3U98H 5JBAS 5LH8A 1O33A 3SNAA 1O3NA 1MBMA 4X8SH 1ELBA 1QGFA 1CT2E 1K1LA 4UFFH 3LONA 1BA8B 1J8AA 1FI8A 3RXAA 1YLCA 1DITH 1GHXH 3SN8A 1ELAA 1KXAA 3RC4A 1TAWA 2CF9H 2VIQA 3K6YA 1W13U 4NIXA 3V12A 1T8LA 2V3OH 1HNEE 4K8BA 1HFDA 4ZAEA 2FM2A 3BTTE 4UFEH 2F91A 4ZKSU 2FYQA 3FANA 4ABFA 2Y80A 3GCNA 4NGAH 3A7XA 3A8AA 1CU1A 2R0KA 3SV8A 3MH6A 4JK6A 1GBTA 1XVOA 1IQEA 3MO3A 4CR5A 3GDUA 1FAKH 2FI3E 5FX5A 3E1XB 3BEIB 7LPRA 1LHCH 3URCA 1Y5UT 2P3FH 1SI5H 1MBQA 1P9SA 1G9IE 1VITF 3IWMA 3SV7A 3T27A 1RS0A 2Y5FA 2GGVB 3AAUA 5HMAA 1AUTC 2XCNA 3DFLA 2WUCA 1H1BA 2BY7X 2GKVE 4UE7H 1BRUP 2VIPA 2ZF0H 3HPTB 1RXPA 5EPNA 3A8CA 1FN8A 1SMFE 2FLRH 3RDZA 1UK2A 1FZZA 4X1SU 2OTVA 2QA9E 1MMJN 4Q2KA 2VNTA 4Q7ZA 2C8XB 5A0BA 1J9CH 3K6ZA 1C2HA 1MCVA 1UCYE 2YNBA 3Q77A 1GHYH 1NRQH 3A81A 3S7KB 1OWEA 5EODA 2ZU4A 1UK4A 3FVFB 4AORA 4M7GA 5C1UA 4JYTA 1WV7H 3A89A 1GBBA 1WUNH 4I8GA 2F9OA 3WY8A 2OXSA 1P10A 1AN1E 1EOLA 2FOBA 3QGNB 3LGTA 4CH2B 1SFQB 1C5RA 2HNTF 3A7TA 4ZROA 3PROA 4JZDH 3MYWA 1IQIA 1YGCH 1GBLA 2M5TA 1AKSA 5HYOA 2CF8H 2NU4E 3RXUA 2AYWA 2PTCE 1ZLRA 3K2UA 1O2KA 1BBRH 1SGYE 1V2JT 2VVCA 1OP8A 4K69A 1HV7A 2BYAX 1ZZZA 3AW0A 4MNXA 1DT2A 1V2OT 3P6ZB 4BNRA 2QXJA 1QA0A 3MNCA 4OS5A 1Z1IA 2PWXA 1DWEH 3DT0H 2H2ZA 1HLTH 1ID5H 2WV4A 4INHA 3R0FA 4XSKU 2GCTB 1GI7B 1K22H 1MTSA 1THPB 5CHAB 1YPLH 2VGCB 1IOEA 2PGBB 1GJBB 2W7SA 2P16A 1LHEH 5F8ZA 4H4FA 2G4TA 1INCA 1QL8A 2ZFFH 2ANWA 1C1VH 1BJUA 1IQJA 4GSOA 1TNLA 1GL0E 1MQ6A 3GY7A 1DUEA 2BDCA 3AASA 2ZFRH 2YOLA 2BDHA 4JZ1A 2TRMA 3PWCA 1TA2A 1QBVH 2VWLA 2ZHQH 5E8EH 1HAHH 1GMDF 1W10U 1ZTKA 1KXEA 2Z3CA 5JBBS 1FDPA 2A2QH 2FOGA 1MAYA 3E0NB 1NU7B 1WYKA 1XUFA 3UNQA 5JBCS 1AE5A 1XM1A 3GCHB 2Z3EA 4ZKNU 4BXWA 4UFGH 3TH3H 1KLTA 4AFUA 1P03A 1EP5A 2OP9A 1SB1H 2STBE 1CSOE 1Z8JB 2GP9B 3NZIA 1ZPZA 5EXMA 3F9GA 1S5SA 4AFSA 2RG3A 1UMAH 1C2LA 4MPVA 8ESTE 3RXOA 1O5CB 4FXGH 4WMFA 1OOKB 3HATH 1XUJA 5AFZH 1UCYH 4AB9A 1EZXC 3ATLA 3DHKH 5EOKA 3RXTA 3RXKA 1P2JA 1UVSH 1ABIH 1O3MA 3LJJA 3GYMA 2WV5A 4K3JA 8LPRA 3KQCA 1GI6A 3MH4A 3EBNA 1BQYA 1SQTA 3ZZ7A 1G3CA 2O8UA 3BTKE 1C5ZB 1SGEE 3RU4E 1NPMA 3V7TA 2FI5E 1TPSA 5F8XA 5SGAE 1FPHH 1C5SA 1Y3XA 1TMTH 1UTKA 2W7UA 3GOVB 1HDTH 2AIPA 3RXMA 3RLYH 4CHAB 1G2LA 2UUJB 1C1QA 2A45B 5JPMH 2H6MA 3ZZ4A 1ACBE 3PO1B 1GBFA 1OYQA 4YESB 1F5KU 1P3EA 4HTCH 1MU6B 4X6NA 2GTBA 4O3TA 3PM3A 3ZVDA 4IBLH 1TRYA 2ZCLP 2ZQ1A 1BMAA 1OWKA 3LDXH 1F5LA 1HJAB 2ZPSA 2GCTC 2XBYA 2FS8A 1GMHF 1PYTD 4TY6A 1GI5A 5CHAC 5GCHF 4FU8A 2FX6A 5JDUB 4NIYA 1J15A 1TBZH 5GJ4B 4BAOB 1H4WA 2FPZA 2V35A 1M9UA 3ENSB 1ZMJA 2Z9GA 1O3KA 1AMHA 3SGQE 4NSYA 3A84A 1EPTB 1SFIA 3QTOH 9LPRA 3STJA 3AVZA 1CGHA 2J92A 4WXVA 1BMLA 4X2WA 3TJUA 1W7XH 5EW2H 3UTUH 6GCHG 4B73A 2D2DA 1C4U2 1V2RT 3VB3A 2ZFSA 1GJCB 3ZVAA 1QIXB 2BDYA 4JZFH 4TY7A 1TX7A 1GHZA 1L4ZA 1BTHH 1GJDB 1DANH 4MPXA 1TX6A 1GBHA 4D7GA 2ZZUH 1TMUH 2AS9A 4VGCC 2FOHA 3ELAH 1C5YB 1O3JA 4HGCA 1L1NA 2VIVA 3EYDA 1CT4E 3GY2A 1ZGIA 4NZLA 4ISNA 1YPGH 1ELVA 2PKAB 3TVJB 4B75A 1V2VT 2GT8A 3QX5H 2CHAB 1XVMA 2ZFPH 1O5DH 3VB7A 4Y8XA 2OC8A 1VJ9U 2QAAA 4A1VA 4UONA 1DXPA 3NCLA 3U8OH 4AG1A 3SU3A 1Z8IB 5GIBA 4NSVA 3UQOA 3ZZDA 4NCYA 4Q7YA 4HFPB 2ZDNA 1GBJA 1A3EH 1Y8TA 4XBCA 3RXIA 2PHBA 3M5OA 4MNWA 5LPRA 4TWWA 1EATA 1P05A 3GCTG 2QXGA 2A1DB 3PMBB 1O39A 1ETSH 4THNH 4TWYA 4YOJA 3O8CA 4AFQA 1BTPA 2RA3A 2FZZA 3VGCC 4AGKA 3MO6A 2IN2A 3MWIU 4YO9A 3LC3A 1MUEB 1C5LH 1DVAH 1KYNA 2FEQH 2WUBA 4LXBH 1A46H 3RXBA 1Q2WA 2SNVA 2P59A 3HK6B 5LPEA 1K28D 3VB5A 1BMMH 3B9FH 1GMCF 2GD4B 3LOXA 4DGJA 1ZSJA 1L1JA 4J1YA 1GL1A 1VR1H 2I6SA 1MCTA 2OC1A 1OP0A 3PO1C 3ZZBA 1C2GA 2FOMB 3SU4A 4YLUA 3SI4H 1S0QA 2TGDA 2A32A 3SHAH 1ZPCA 1W3CA 2PV9B 1BRBE 4ISHH 2NU2E 3RLWH 1QRXA 1Z8GA 1MTNB 3BTDE 3H5CB 2AH4X 2ZTYA 4I8JA 2ZECA 1ZMLA 4SGBE 4KTSA 2ZC9H 2HALA 1AFQC 1DM4B 1CO7E 1YM0A 3VXEH 1S85A 3SJ9A 1EB1H 1IQGA 3D62A 2ULLA 3C27B 3DD2H 2VIDA 4ZKOU 3M5LA 2Z7FE 1O30A 4IW4E 1C5NH 4Y11E 1F5RA 1EPTC 4A5TS 1P2IA 4X2XA 5EQSA 1Y5AT 1NROH 2OQUA 1P2MA 4GVUA 2WPJS 1ANDA 1HAPH 3QUMP 1YPKH 1TNIA 5DG6A 5E2PA 2R3YA 2G5NA 1A7SA 3BG4B 3LH3A 1O5BB 3ITIA 1NZQH 3PV4A 2PSXA 4MVNA 4SGAE 3LPRA 1TOMH 4NIWA 4I8KA 4DIHH 4DURA 4NFEA 1A0HB 1C2JA 2CMYA 1TNHA 1QRWA 1LHGH 4Y0YE 1FQ3A 4WXIA 1X7AC 1EJAA 1HXFH 1O5AB 2ZU1A 4ZXYH 1UTNA 1GI0A 2FTMA 4K60A 1MKWH 4GHTA 4ZKRU 1TALA 3SHCH 1L0ZA 1W14U 2P8OB 2GDEH 2YNAA 2EEKA 2PTNA 5F8TA 4Z0KA 1HXEH 1BT7A 2IPHA 2CV3A 1KXBA 3FP8E 2HNTE 2AERH 2ZQ2A 2OCVB 4JMYA 2ILNA 1EASA 1UCYK 2A4GA 1BZXE 1QNJA 3K9XB 1V2NT 1O2PA 3UY9A 2R0LA 3BTQE 1KXFA 4YT7H 1IQKA 3PMAB 3GY4A 2BZAA 3FAOA 1C1NA 2ZIQH 2ZGBH 1SC8U 4F4OC 4OS1A 1SGQE 5PTPA 5T6FA 3TK6A 1C2KA 1O2NA 1K2I1 3B23B 1YPHE 7KMEH 2BOKA 5GXPA 1NFUA 1SLXB 4YLQH 1UK3A 1HAOH 4LZ1H 1SGCA 2F83A 1FY4A 4IMZA 1YYY1 1N6YA 2A5IA 1BBRE 1GHBG 2ZGHA 1OKXA 3O8DA 2O9QA 1RJXB 2UWPA 3RMNH 5IDKA 2CJIA 7GCHF 4HZHA 1H8DH 2VIOA 1EJMA 1AKSB 3ZYEA 1LCYA 1IQFA 4B2BA 1GBAA 1BTUA 2R9PA 3MI4A 4CRGA 5IYTA 1LKBA 4BAKB 5LPFA 2BQ6B 2VU8E 3BSQA 1TNGA 3VXFH 1UTOA 1P2OA 4I32A 1ZOMA 1Z7KA 3I77A 3T5FH 3LH1A 2THFB 4JYVH 1PPFE 4IS5A 4X8TH 1O3LA 1AHTH 5CE1A 2BXUH 1QBNA 5DGJA 1WQVH 3M5MA 2BX3A 1GHAF 4FUDA 2LPRA 3VEQB 5JBTA 5L30H 1UVUH 1SGDE 2RA0A 1BMNH 2JH6D 4BANB 1AVWA 2OINA 1TX8A 4A6LA 3U69H 4IC5A 1V2ST 2A5AA 1ZHRA 3RXRA 1VITH 1GI2A 2C8ZB 5DP7A 3BG4C 1SPJA 1H9LB 2V3HH 1EUFA 3OSYA 1EAIA 4ABAA 6LPRA 1AB9C 4F49A 2Y82A 2QGRA 1B0EA 3BEFB 1TB6H 3M37A 4E7RG 1QHRB 2B9LA 4CBNA 2VJ1A 4NA9H 4K1TA 2GMTC 1XUGA 3F1SB 3RMLH 1A1RA 8GCHG 1XUHA 3PTBA 4NWLA 1IQHA 2ALVA 1AQ7A 1AUJA 3A7WA 4X8VH 1GHWH 2P3TB 3SV6A 3F6UH 2HOBA 3D23A 4KP0A 1VGCB 4Y8ZA 3H7TA 1CA0C 2P8OC 2FP7B 5DK1A 1WAYB 3SV2H 4A92A 2FODA 4GCHG 1EAXA 2QC2A 1PQ8A 4I31A 1RGQA 1O3FA 2BHGA 3BTEE 1V2MT 3BTHE 1F0UA 5B6OA 1GI8B 3SUGA 4E7NA 2PW8H 3TH2H 1NESE 4ZHAA 5FXLA 1CE5A 3KCGH 2XWBI 2UUYA 3EE0B 2Z9KA 2ZG0H 1QJ7B 2DUCA 1QL7A 1WU1A 3NPSA 3RXJA 1F2SE 3M61U 3F9EA 2QF0A 2R2WU 4FU7A 3SI3H 1EZUC 4D9RA 4R8TB 4BTTB 2HPQH 4CRDA 1YCPH 3ZV8A 1IQLA 1SGIB 5L2ZH 1TYNA 1BB0B 1O38A 3R3GB 1NM6A 1T4VH 3ZZ8A 1ZSLA 2K7XA 2O8WA 1V2QT 3ODDA 1AFEH 2G4UA 3L33A 4ZH8A 1DX5M 1O2UA 4ABJA 1QJ6B 3W94A 1Y3VA 3BTME 1A2CH 1IHTH 2FMJA 3OYPA 3ZZ9A 2ZKSA 3QDZB 3U1JB 5T6DA 1OPHB 1DLEA 4FUEA 3DA9B 1QA7A 3RM0H 2Q6FA 1SLVB 3FFGA 2AMDA 5FPTA 3SORA 1TBRH 1SSXA 4YT6H 3RU4T 1LVOA 3KEEA 1XUIA 3SBKA 3HGPA 1EB2A 4B2CA 2P93A 1G3BA 2ZHDA 1JRTA 4ABEA 2ANKH 1O3BA 3Q00A 1MU8B 2GCHF 2G8TA 1BITA 3SU2A 1MAXA 5EU8A 3E16B 1F7ZA 1C1OA 3UREA 3F9HA 5JB8S 3TITA 3P8OA 4X2YA 1CVWH 3LGWA 1EKBB 1C9PA 4JYUH 4YOIA 3QGJA 2BTCE 1HIAB 1LHDH 1YPEH 4BAQB 2EA3A 4FU9A 1DSTA 3UNRA 2ZDKA 1KLJH 4IC6A 3BG8A 4RSPA 1K1IA 2OUAA 5C67A 2EC9H 1GJ9B 1ESAA 4OGXA 4Y10E 3BIVH 4CRAA 4O97A 1W7GH 5TCAA 3GCOA 1FY3A 1UTJA 1LVBA 3SUEA 4I7YH 2STAE 1LTOA 2UUKB 2BD8A 2C8WB 1HBTH 1SOTA 2ZFQH 5JYIA 3M7QA 1CHOF 3NWUA 2BXTH 3MNXA 3NKKA 1VGCC 4VGCB 3CP7A 4TPIZ 4CR9A 2ZNKH 1O3DA 2FXRA 4FVBA 5ESBA 4AYYB 3QLPH 2XC0A 2P3UB 3LGYA 1O2LA 4ZXXH 1W0YH 1DOJA 4LOYH 1UVTH 4X1NU 1SBWA 4ISLA 3MHWU 1P2QA 1KSNA 5I25A 2VWOA 3A7VA 3SQEE 1HJ9A 4U01A 4YM9A 4ZHLU 1S82A 2W26A 1G3DA 1LKAA 1LMWB 3URDA 2ZWLH 1K1JA 3QWCH 2Z3DA 1EOJA 3U9AH 1A3BH 3ZZCA 2D26C 2AGEX 1XKAC 2P94A 1BOQA 1A5IA 3RMOH 1PJPA 3BTGE 3SZNA 1OSSA 3TJOA 4GUXA 4E06H 4E05H 1QR3E 1GVZA 1SGRE 4AB8A 3OY6U 3OTJE 2VINA 1FLEE 1QY6A 1W12U 3KN2A 3UR6A 3M3VA 3W95A 2J4IA 1O2SA 1C4Y2 2KAIA 1GJAB 1T31A 1UHBA 3VGCB 1WBGB 4RKJB 2HWLB 3SJKA 5A8XA 4D9QA 1TRMA 4JZIA 4ESTE 5G4BA 1QRZA 3UIRA 1V2KT 1NC6A 1V2TT 2QYIA 1O2VA 2PKSB 1B0FA 1TNKA 4FUHA 1UTLM 4CH8B 2AMPA 5EPYA 1P11E 1WSSH 4AOQA 3RXPA 2Z9IA 1GGDB 2SGPE 1RD3B 1H8IH 2BDGA 2VWNA 5AVDA 1K1NA 1WTGH 4MG3A 5T6GA 1E38B 2XBXA 5FAHA 1TBQH 2ZPRA 2BD3A 4J2YB 1KDQA 5FCRA 1TE0A 1NRPH 3BEUA 1GI1A 1PPGE 1CT0E 3RC5A 1FY5A 1O2JA 2ZCKP 3QTVH 5GDSH 1ELDE 1ARCA 3TPIZ 2Z6BD 1QJ1B 1AFQB 1L2EA 1HIAA 4AGJA 1T7CA 1OS8A 5DP8A 1AY6H 3SJOA 3S9CA 1FONA 1G32B 3GICB 3TU7H 4A1TA 1P01A 1EP6A 1HRTH 1VITG 1RTLA 4QT8C 4TYDA 1EJNA 1NN6A 5EQQA 3TGJE 2D8WA 3HKIB 1TA6A 2XBWA 3B8JA 1GDNA 4IN2A 1BTYA 3KF2A 1P2KA 1T4UH 1QQ4A 1TONA 2ANYA 1ZR0A 1S0RA 1C2FA 3RUOA 3UPEA 4OS6A 2OBOA 5FX6A 5A0AE 1FNIA 2W3KA 3GY6A 5E0GA 3P17H 1LQEA 1XXFA 2FIRH 1CHGA 1YPHC 5ABWA 4FUFA 2ZGJA 1BRAA 4INKA 2NU3E 2PFEA 3NUMA 3RXDA 2OBQA 1O32A 2ZTZA 3ZVGA 4FUGA 2W5EA 2VB0A 2BB4A 2W3IA 2Z9JA 2VVVA 3MFJA 2ZGXH 2ZU5A 1C1RA 4AYVB 1A4WH 1JMOH 5C1YA 2Y5GA 4JCNA 5TJXA 1EXFA 1AE8H 3A87A 3RXFA 3SV9A 1NS3A 1O5GH 1BRCE 1OWJA 2ALPA 2G00A 5J4SA 2C90B 3T25A 1D6WA 3IITA 1AO5A 4B1TA 3E0PB 1TNJA 3ATIA 2ZHWH 1XX9A 2XCFA 4LZ4B 4BTIB 1SLWB 3SNDA 2XC5A 3SU1A 1O2TA 2BVRH 1MD8A 1FN6A 5EQRA 3RXGA 3ZZ6A 1TQ0B 3A7ZA 1HAYB 1BHXB 1J14A 1O3IA 1Z6EA 4UEHH 5EG4A 1QFKH 1O2WA 1SOZA 2AEIH 1TGTA 2PUQH 2FLBH 1Y3UA 3ZV9A 5FBEA 4X2VA 4X6PA 3V0XA 1F0RA 1D3PB 2ZP0H 4IMQA 2DE8A 3MTYA 1GJ5H 1RTKA 1HAVA 1KY9A 3GDSA 2PKSC 3RXVA 1Y5BT 1V2PT 1S83A 2UWLA 2A4RA 1IHSH 1K1MA 4NIVA 4WH6A 2F9VA 1GGDC 4KTUA 1PQ5A 4XFQA 2NU0E 1UVOA 1BBRK 4KKDA 1PPZA 2G52A 5GWZA 1NRSH 1O2MA 3TK9A 4MNYA 1O3PB 3DUXH 1MQ5A 1XUKA 2Z9LA 1O5EH 2BDBA 1TIOA 1ZRKA 3A7YA 2BLOA 5I46H 1TGCA 1C2EA 1Y3YA 1CQQA 2O8TA 3LKWA 1BTWA 4IGDA 1TPOA 1K9OE 5C3NA 1AVGH 1D3TB 1QCPA 1BTZA 2BM2A 2FOAA 1DSUA 3T2NA 4B76A 5A2MH 3OY5U 3QZQA 2ZDMA 1DXWA 2TIOA 2IJOB 1VCPA 2VVUA 4BOHA 2ZTXA 5A09A 2CGAA 4RKOB 2O8MA 3VB6A 1GBEA 4B74A 4MQAA 3OU0A 2O8LA 1DFPA 5HXFA 3TIUA 1S6HA 2V6NA 2BVXH 3VPKA 1GMDG 2FTLE 4OS2A 1PPHE 2TPIZ 3SNCA 2GT7A 1H9IE 4Y79A 2HLCA 2H9EH 2P95A 3ZYDA 3MU4A 1UTQA 1O3EA 2TBSA 1DICA 1T8OA 2FS9A 2J95A 2ZPQA 1AB9B 4B2AA 1VCQA 1LVYA 1TLDA 3RXEA 1O0DH 3A8DA 2GZ7A 1QURH 1GVLA 4LK4A 2XBVA 1TFXA 2GMTB 2B0FA 3MMGA 4MDSA 4WWYA 3G01A 3KGPA 1LQDB 1GI4A 2VWMA 1VJAU 4DCDA 2K1QA 4BTUB 4CBOA 4NFFA 1NRRH 1VZQH 3BTWE 3KQEA 1CA0B 2Q6GA 3EQ0H 5DPAA 2ZI2H 2DE9A 1P09A 2G5VA 4ABDA 5DP3A 2BD4A 1Y59T 1BTXA 3SU0A 1FJSA 1P06A 1TGBA 3RC6A 5L2YH 2VH0A 3DFJA 2A5KA 1YLDA 5E0HA 4BAMB 1ZGVA 5AHGH 1ZPBA 1GWAA 1Q3XA 1TOCB 5J4QA 3MU5A 2TGTA 4Q7XA 4DIIH 3KL6A 2F9NA 1L4DA 2BD7A 1O36A 3OX7U 2AGIX 1FUJA 2J9NA 3D65E 2VIWA 1ETRH 4FUBA 2H1UA 5DP5A 5A0CA 4WY3A 1PPBH 2BZ6H 3PB1E 4FUIA 1KIGH 3E90B 1W8BH 6CHAB 2ZCHP 3P8FA 4ABBA 2F9UA 1GMHG 3UWIA 1O2GH 4Y76A 5GCHG 2WINI 1UJ1A 4D7FA 1XXDA 2JH5D 1PQAA 1HUTH 1XKBC 1OP2A 3GY8A 4KTCA 5JB9S 1O3AA 1PQ7A 2GZ9A 1ZTLA 1EZQA 2V0BA 1JXPA 3Q3YA 1DPOA 2Y7XA 1MD7A 1THRH 5DKMA 1P2NA 1GBIA 1SGFG 3S0NA 1MKXH 4JZEH 1W2KH 4MPUA 1GJ4H 1A5GH 1RIWC 1J17T 1JRSA 2J94A 1CGIE 3UNSA 3SU6A 1BDAA 2SGQE 4HI3A 1EQ9A 4B71A 1P8VC 3M5NA 1NRNH 4NA7A 3ZVFA 2ODQA 2QN5T 3EA8A 1C5TA 1JBUH 3S7HB 4A7IB 1DWCH 1JWTA 4KGAA 3KQBA 3GY5A 4X1PU 2Y5HA 1ZMNA 3LGIA 4NG9H 1JIMA 2C4FH 5C5NA 3MU8A 4ISIH 3ZVEA 1GBMA 2A2XH 2PUXB 2G55A 1B7XB 1AVXA 4ZUHA 3GY3A 1T8NA 4H42U 1C5VA 2WPMS 4RN6A 4INLA 2LNCA 1AU8A 1ORFA 4IN1A 2UWOA 1YPMH 4GLYA 3M7UA 2G81E 1SHYA 2PSYA 2JETB 4X6OA 1EAWA 1DUAA 3A88A 3P8NA 1KXCA 4Y7BA 3GYLB 1ESTA 1PFXC 2QIQA 3VFEA 1V2LT 2UUFB 1GBCA 1GJ7B 3TK5A 3EDXB 3RXSA 2R2MB 2BY5X 4UFDH 2C93B 1GMCG 4DG4A 1P02A 1G36A 6GCHF 4WVPE 5F03A 1O2IA 1G37A 5T3HA 1GPZA
chains in the Genus database with same CATH superfamily
1GDQA 3EA9A 1UTPA 2RDLA 1ZJKA 1O3GA 4AX9H 3HKJB 1D3QB 2QV1A 9ESTA 2SFAA 4GPGA 5H4IB 1SG8B 1G2MA 1GG6C 2XWAA 2TGPZ 3P70B 1BIOA 1ELFA 1BJVA 5C2ZA 5AF9H 2CN0H 5C0UA 3PMHB 4MPWA 1V2UT 1E34B 3L3TA 2J5UA 2GVFA 6CHAC 5F6MA 1AWHB 4CREA 3Q3KA 1O2HA 1V3XA 2KAIB 1UHBB 3E6PH 4BXSA 4WJG2 2BOHB 2ZHFH 3P8GA 3SUFA 4Z6AH 3ESTA 1Z8RA 3ZZAA 3P95A 1K1OA 5FCKA 1SL3A 1BMFD 1SHHB 1YP9A 1NT1A 1NFXA 5E2OA 2LIZA 3TNSA 3OE7D 3M3SA 1C1WH 1FXYA 1P57B 4O03A 1OWHA 2F9BH 1C5UA 2ZEBA 3A85A 1O2QA 1GI3A 3GCTF 2BY9X 1Y3WA 2SGFE 5DJ7A 3DSPA 2IOTA 3N7OA 1KDQB 2C8YB 1HAXB 1O35A 2KCOA 1O37A 1LPZB 7ESTE 3ZVBA 3U8RH 1O2YA 3SNBA 5A8YA 1O5FH 2BD2A 3TJNA 1WOFA 1C5MD 1HAIH 1O2OA 5A8ZA 3MU0A 2WPIS 2G51A 1FPCH 3ZZ5A 4X6MA 2AMQA 1DY9A 2Z94A 2BLVA 1FY1A 2SGEE 2W6JD 5ETXA 1N6XA 2WPHS 1GCDA 4WH8A 1EZSC 1LVMA 2AFQB 3HK3B 1ESBA 3PLKA 3BV9B 1N1LA 2BMGB 5DP4A 2ANMH 4P00A 3A8BA 1MTUA 3OFND 4ISOA 1P0SH 1GJ8B 2OC0A 3UB0A 1RTFB 3RXHA 4WMEA 1C1SA 2FO9A 3IG6B 4ACAA 1DDJA 2FWWA 1LO6A 3SOSA 1MKWK 2BDAA 1W0KD 1SGTA 2JETC 4CRCA 3M36A 4D76A 1LPKB 3F9FA 2KX4A 3CENA 1GBDA 5AFYH 4K8YA 2WYGA 4HG6A 1VKYA 1ANBA 1SR5C 4U32A 2TGAA 4DOQA 4MLFB 3CS0A 1ELEE 4R0IA 2XRCA 2OQ5A 3PWBA 3O8RA 1OYTH 3SJ8A 2D1JA 2JH0D 2XTTB 1ETTH 1AWFH 4OS7A 3BN9A 2HVXA 1ZRBA 1BCUH 1UO6A 1FY8E 1YBWA 2V7QD 1GDUA 2M2AA 1LDTT 4Q80A 5HM9A 1HAGE 4H6TA 7GCHG 1KTSB 1ANCA 2A7CA 2WPDD 3PV5A 5FHTA 3ZZ3A 2A7HA 2ODYB 1W0ZU 2OLGA 3OEED 2NU1E 2JKHA 1J16A 3UAIC 1D3DB 5EJ1A 1ZSKA 1PPEE 1TGNA 1QB1A 2ZU2A 1HAVB 1HAZB 1MZAA 3I29A 4AFZA 5ESTE 4DJZB 2QE7D 3O8BA 2ASUB 4JK5A 2GV6A 3TJVA 2AGGX 2FOCA 1GHAG 2NWNA 1JIRA 3BTFE 1C1PA 1MKXK 1ZJDA 1GI9B 2H5DA 3F3BA 5E0JA 4CRBA 1DE7H 3UFAA 2WYJA 1NY22 1KTTB 1GCTB 1QBOA 2GZ8A 3SW2B 5C0TA 2A7JA 2AIQA 3L6PA 3U1IB 3NRLA 5K0HA 1DWDH 4X8UH 6ESTA 1AZZA 4X1QU 3A80A 3JZ1B 3S9BA 2K0QA 4GHQA 2F3CE 4XDEA 3RP2A 1C9TA 4YOGA 1S6FA 2QCYA 1Z71A 4DW2U 1D4PB 3SJIA 1TPPA 1P12E 1A61H 4K5ZA 2ODPA 2ZGCA 2KCYA 4Y0ZE 1QB9A 3ATWA 3M3TA 2HNTC 4X1RU 3EAJA 1BUIA 3NXPA 5TCCA 1W11U 2VH6A 1O2ZA 2A0QB 1F0SA 1GHVH 4MNVA 2HRVA 1QL9A 1GHBF 4ABIA 3UUZA 4GAWA 2VGCC 1G3EA 1E0FD 1Z6JH 1TMBH 3LT3A 3EA7A 4U2WA 1TRNA 4XOJA 4ASHA 2EI7A 3K65B 3KQDA 5CMXH 1Z1JA 4I8LA 3SQHE 2OC7A 1UTMA 4I8HA 3SO3A 1T8MA 4YZUA 2R3UA 1FIWA 4NWKA 2QXIA 1NU9A 1NTPA 1TPAE 4ABGA 4FVDA 1BHXF 3E8LA 5EW1H 4CRFA 1T32A 3LC5A 2EI8A 4WF8A 3E91A 1CBWB 4OS4A 3PTNA 2QF3A 2FI4E 1NBMD 3CS7A 1ZHPA 1PPCE 1DWBH 3AW1A 1LPGB 5EGMA 2GX4A 1C5QA 1E37B 1H9HE 3QK1A 3STIA 5KEDA 1C5WB 5LGOA 2XNDD 2ZDVH 4I33A 3M7TA 4Z1MD 1S84A 2H9HA 1OX1A 2FDAA 1SLUB 1MTWA 3MNSA 4K1SA 2J98A 3MNBA 4K2YA 1ARBA 4H6SB 4AZ2B 3V3MA 3QO6A 1YCPK 3KHVA 5HGGA 3ODFA 1YCPM 3F68H 1YF4A 3GCHC 4Y8YA 1HYLA 3ZVCA 1SQOA 1OXGA 1C2MA 8KME2 2XXLA 2OD3B 3TNTA 1HJ8A 1YKTA 2YMSD 3BF6H 3PYHA 4DY7B 1K21H 1ZTJA 2HLDD 5C1XA 2HPPH 5C5OA 2BD5A 2ZDLA 1C5OH 1MH0A 3MU1A 8GCHF 3LGVA 1ABJH 3PLBA 2C3SA 1TWXB 2SNWA 1D6RA 2BLQA 4YTAA 1K1PA 1P3CA 1AD8H 2B7DH 2BVSH 2PGQB 2RDEA 4KELA 1C2DA 2BDIA 1QQUA 3BIUH 4U30A 4TPYA 1W0JD 4X0WU 1TQ7B 3T26A 1Q31A 1VCWA 2GCHG 2FOFA 1C1TA 3NK8A 1WCZA 4GCHF 5GPIB 5EXLA 1PYTC 1O3OA 4AG2A 3ATKA 2J34A 3FKSD 3VB4A 2Q6DA 1GCTC 2F9PA 3RXQA 2BD9A 1HPGA 5FBIA 1ELCA 2J2UA 1TABE 1V6DA 1O2RA 3UOUA 2A4QA 3E3TA 1N8OB 3MH7A 2ZU3A 1C1UH 1DLKB 1RFNA 3S9AA 4CHAC 1C2IA 4M9FA 2KZ4A 3T28A 3GISB 1KLIH 3KQ5A 2QXHA 3UR9A 3KNXA 4DT7B 4Q63A 3QZRA 3SZEA 1RIWB 1V2WT 3QN7A 1UVPA 5L6NH 1QTFA 1NFYA 3SGBE 3SNEA 1XMNB 2ESTE 1AZ8A 3RM2H 3RMMH 1AIXH 3JZ2B 2PLXA 2WPKS 1HJAC 4BAHB 1E35B 1CHOG 3C1KA 2A31A 1SGPE 2B5TB 2CXVA 4FETA 1MZDA 3UWJH 3A83A 2ZO3H 3KIDU 3PRBA 2B8OH 1EPTA 2LELA 1HCGA 4O3UA 2FX4A 2BY8X 5EXNA 1ZYOA 4MTBA 2QY0B 2XW9A 2Y6TA 5IK2D 1SGNE 3SGAE 4O9VA 1FAXA 1EAUA 2SGDE 3Q76A 1L1GA 3WWBA 3PLPA 2XYAA 1P04A 3FZZA 2KCAA 3SUDA 5C20A 2H5CA 2BQWB 1DY8A 3LGUA 4ZCNA 4K1EA 1AGJA 1C1MA 5BRRE 3AAVA 1ANEA 1GBKA 1ELTA 3EGKH 1IAUA 1WQSA 1B5GH 2EQNA 1P9UA 2XC4A 1CBWC 1U6QA 2Y7ZA 3S69A 3FP6E 1IQNA 2V3MA 1D9IA 1O2XA 1WTHD 3FZDA 3I78A 3T62A 2Q1JA 1C5PA 1FIZA 4Q4LA 4AN7A 1LHFH 4ABHA 2HGTH 1QB6A 2GJGA 1IQMA 3MO9A 1THSH 1SGFA 3UQVA 1A5HA 2FESH 2FOEA 3HGNA 2EI6A 2PKAA 3PMJA 2H9TH 3GDVA 1DS2E 2BLWA 4Y7AA 1KXDA 1OHHD 3SU5A 4PROA 1C5XB 2CHAC 1GVKB 1RRKA 4XE4A 1A0JA 1S81A 3ATMA 1SVPA 3MOCA 1O3HA 5FPSA 2I6QA 3M35A 5K7RA 2XNIA 1AI8H 1YC0A 3A82A 3RXLA 1G30B 3LIWA 2SGAA 3RU4D 2WPLS 3D49H 1E36B 3TLOA 1GG6B 1MTVA 5FPYA 5DO4H 3TGIE 1FV9A 1F92A 3TH4H 1O31A 1O3CA 1YPJH 4D8NA 1OWDA 2GDDA 2ZHEH 3LJOA 4A1XA 1ZHMA 3P92A 1O34A 2J38A 1A0LA 2FYRA 1EX3A 1CA8B 1HGTH 3H7OA 1FMGA 5F53A 1GJ6A 2A4OA 1NO9H 4FUJA 3UOPA 3U28C 2PR3A 2ZFTA 3V13A 4UD9H 1NFWA 4NZQA 5HM2A 3MH5A 1N8OC 1F0TA 5DP9A 1CGJE 5KECA 4UDWH 1ELGA 2BQ7B 2BY6X 2RCEA 4XBBA 1JOUB 5DP6A 4XBDA 4Y6DA 4ZHMU 3Q3XA 4NA8A 2BX4A 1TGSZ 3KYFA 3U8TH 2Y81A 3RXCA 3T29A 3SYJA 2KCPA 2ZDAH 4FUCA 4OGYA 1C4V2 1OWIA 3FP7E 1HB0B 3LU9B 1SQAA 3A86A 4Y71A 4ZMAH 3TGKE 2GV7A 4DVAU 2ZA5A 4WMDA 1MTNC 5BPEA 3F0PA 3U98H 5JBAS 5LH8A 1O33A 3SNAA 3VG8A 1O3NA 1MBMA 4X8SH 1ELBA 1QGFA 1S6LA 1CT2E 1K1LA 4UFFH 3LONA 1BA8B 1J8AA 1FI8A 3RXAA 1YLCA 1DITH 1GHXH 3SN8A 1ELAA 1KXAA 3RC4A 1TAWA 2CF9H 2VIQA 3K6YA 1W13U 4NIXA 3V12A 1T8LA 2V3OH 1HNEE 4K8BA 1HFDA 4ZAEA 3WW7A 2FM2A 3BTTE 4TT3D 3F2HA 4UFEH 2F91A 4ZKSU 2FYQA 3FANA 4ABFA 2Y80A 3GCNA 4NGAH 3A7XA 3A8AA 1CU1A 2R0KA 3SV8A 3MH6A 4JK6A 1GBTA 1XVOA 1IQEA 3MO3A 4CR5A 3GDUA 1FAKH 2FI3E 3H09A 5FX5A 3E1XB 3BEIB 7LPRA 1LHCH 3URCA 1Y5UT 2P3FH 1SI5H 1MBQA 1P9SA 1G9IE 1VITF 3IWMA 1WDIA 3SV7A 3T27A 1RS0A 2Y5FA 2GGVB 3AAUA 5HMAA 1AUTC 2XCNA 3DFLA 2WUCA 1H1BA 2BY7X 2GKVE 4UE7H 1BRUP 2VIPA 2ZF0H 3HPTB 1RXPA 5EPNA 3A8CA 1FN8A 1SMFE 2FLRH 3RDZA 1UK2A 1NBME 1FZZA 4X1SU 2OTVA 2QA9E 1MMJN 4Q2KA 3CNRA 2VNTA 4Q7ZA 2C8XB 5A0BA 1J9CH 3K6ZA 1C2HA 1MCVA 1UCYE 2YNBA 3Q77A 1GHYH 1NRQH 3A81A 3S7KB 1OWEA 5EODA 2ZU4A 1UK4A 3FVFB 4AORA 5CDFE 4M7GA 5C1UA 3EE7A 4JYTA 1WV7H 3A89A 1GBBA 1WUNH 4I8GA 2F9OA 3MQKC 3WY8A 2OXSA 1P10A 1AN1E 1EOLA 2FOBA 3QGNB 3LGTA 4CH2B 1SFQB 1C5RA 2HNTF 3A7TA 4ZROA 3PROA 4JZDH 3MYWA 1IQIA 1YGCH 1GBLA 2M5TA 1AKSA 5HYOA 2CF8H 2NU4E 3RXUA 2AYWA 2PTCE 1YLNA 1ZLRA 3K2UA 1O2KA 1BBRH 1SGYE 1V2JT 2VVCA 1OP8A 4K69A 1HV7A 2BYAX 1ZZZA 3AW0A 4MNXA 1DT2A 1V2OT 3P6ZB 4F55A 4BNRA 2QXJA 1QA0A 3MNCA 4OS5A 4B6EA 1Z1IA 2PWXA 1DWEH 3DT0H 2H2ZA 1HLTH 1ID5H 2WV4A 4INHA 3R0FA 4XSKU 2GCTB 1GI7B 1K22H 1MTSA 1THPB 5CHAB 1YPLH 2VGCB 1IOEA 2PGBB 1GJBB 2W7SA 2P16A 1LHEH 5F8ZA 4H4FA 2G4TA 1INCA 1QL8A 1KMHB 2ZFFH 2ANWA 1C1VH 1BJUA 1IQJA 4GSOA 1TNLA 1GL0E 1MQ6A 3GY7A 1DUEA 2BDCA 3AASA 2ZFRH 2YOLA 2BDHA 4JZ1A 2TRMA 3PWCA 1TA2A 1QBVH 2VWLA 2ZHQH 5E8EH 1HAHH 1GMDF 1W10U 1ZTKA 1KXEA 2Z3CA 5JBBS 1FDPA 2A2QH 2FOGA 4ACBA 1MAYA 3E0NB 1NU7B 1WYKA 1XUFA 3UNQA 4F48B 5JBCS 1AE5A 2J98B 1XM1A 3GCHB 2Z3EA 4ZKNU 4BXWA 4UFGH 3TH3H 1KLTA 5CHBA 4AFUA 1P03A 1EP5A 2OP9A 1SB1H 2STBE 1CSOE 1Z8JB 2GP9B 3NZIA 1ZPZA 5EXMA 3F9GA 1S5SA 4AFSA 2RG3A 1E79D 1UMAH 1C2LA 4MPVA 5GNDA 8ESTE 3RXOA 1O5CB 4FXGH 4WMFA 1OOKB 3HATH 1XUJA 5AFZH 1UCYH 4AB9A 1EZXC 3ATLA 3DHKH 5EOKA 3RXTA 3RXKA 1P2JA 1UVSH 1ABIH 1O3MA 3LJJA 3GYMA 2WV5A 4K3JA 8LPRA 3KQCA 1GI6A 3N7EA 3MH4A 3EBNA 1BQYA 1SQTA 3ZZ7A 1G3CA 2O8UA 3BTKE 1C5ZB 1SGEE 3RU4E 1NPMA 3V7TA 2FI5E 1TPSA 5F8XA 5SGAE 1FPHH 1C5SA 1Y3XA 1TMTH 1UTKA 2W7UA 3GOVB 1HDTH 2AIPA 3RXMA 3RLYH 4CHAB 1G2LA 2UUJB 1C1QA 2A45B 5JPMH 2H6MA 3ZZ4A 1ACBE 3PO1B 1GBFA 1OYQA 4YESB 1F5KU 1P3EA 4HTCH 1MU6B 4X6NA 2GTBA 4O3TA 3PM3A 1FX0B 3ZVDA 4IBLH 1TRYA 2ZCLP 2ZQ1A 1BMAA 1OWKA 3LDXH 1F5LA 1HJAB 2ZPSA 2GCTC 2L6OA 2XBYA 4DT4A 2FS8A 1GMHF 1PYTD 4TY6A 1GI5A 5CHAC 5GCHF 4FU8A 2FX6A 5JDUB 4NIYA 1J15A 1TBZH 5GJ4B 4BAOB 1H4WA 2FPZA 2V35A 1M9UA 3ENSB 1ZMJA 2Z9GA 1O3KA 1AMHA 3SGQE 4NSYA 3A84A 1EPTB 1SFIA 3QTOH 9LPRA 3STJA 3AVZA 1CGHA 2J92A 4WXVA 1BMLA 4X2WA 3TJUA 1W7XH 5EW2H 3UTUH 6GCHG 4B73A 2D2DA 1C4U2 1V2RT 3VB3A 2ZFSA 1GJCB 3ZVAA 1QIXB 2BDYA 4JZFH 4TY7A 1TX7A 1GHZA 1L4ZA 5EJLA 1BTHH 1GJDB 1DANH 4MPXA 1TX6A 1GBHA 4D7GA 2ZZUH 1TMUH 2AS9A 4VGCC 2FOHA 3ELAH 1C5YB 1O3JA 4HGCA 2QF5A 1L1NA 2VIVA 3EYDA 1CT4E 3GY2A 1ZGIA 2IPQX 3FOAA 5HIZA 4NZLA 4ISNA 5C94A 1YPGH 1ELVA 2PKAB 3TVJB 4B75A 1V2VT 2GT8A 3QX5H 2CHAB 1XVMA 2ZFPH 1O5DH 3VB7A 4Y8XA 2OC8A 1VJ9U 2QAAA 4A1VA 4UONA 1DXPA 3NCLA 3U8OH 4AG1A 3SU3A 1Z8IB 5GIBA 4NSVA 3UQOA 3ZZDA 4NCYA 4Q7YA 4HFPB 2ZDNA 1GBJA 1A3EH 1Y8TA 4XBCA 3RXIA 2PHBA 3M5OA 4MNWA 5LPRA 4TWWA 1EATA 1P05A 3GCTG 3KYGA 2QXGA 2A1DB 3PMBB 1O39A 1ETSH 4THNH 4TWYA 4YOJA 3O8CA 4AFQA 1BTPA 2RA3A 2FZZA 3VGCC 3DSOA 4AGKA 1MABB 3MO6A 5B6LA 2IN2A 3MWIU 2RFKC 4YO9A 3LC3A 1MUEB 1C5LH 1DVAH 1KYNA 5HKKD 2FEQH 2WUBA 4LXBH 1A46H 3RXBA 1Q2WA 2SNVA 2P59A 3HK6B 5LPEA 1K28D 3VB5A 1BMMH 3B9FH 1GMCF 2GD4B 3LOXA 4DGJA 1ZSJA 1L1JA 4J1YA 1GL1A 1VR1H 2I6SA 1MCTA 2OC1A 1OP0A 3PO1C 3OTPA 3ZZBA 1C2GA 2FOMB 3SU4A 4YLUA 3SI4H 1S0QA 2TGDA 2A32A 3SHAH 1ZPCA 4OM9A 1W3CA 2PV9B 1BRBE 4ISHH 4XD7D 2NU2E 3RLWH 1QRXA 1Z8GA 1MTNB 3BTDE 3H5CB 2AH4X 2ZTYA 4I8JA 2ZECA 1ZMLA 4SGBE 4KTSA 2ZC9H 2HALA 1AFQC 1DM4B 1CO7E 1YM0A 3VXEH 1S85A 3SJ9A 1EB1H 1IQGA 3D62A 2ULLA 3C27B 3DD2H 2VIDA 4ZKOU 3M5LA 2Z7FE 1O30A 4IW4E 1C5NH 4Y11E 5DSFA 1F5RA 1EPTC 4A5TS 1P2IA 4X2XA 5EQSA 1Y5AT 1NROH 2OQUA 1P2MA 4GVUA 2WPJS 3ZIAD 1ANDA 1HAPH 3QUMP 1YPKH 2AHME 1TNIA 5DG6A 5E2PA 2R3YA 2LP6A 2G5NA 1A7SA 3BG4B 3LH3A 1O5BB 3ITIA 1NZQH 3PV4A 2PSXA 4MVNA 4SGAE 3LPRA 1TOMH 4NIWA 4I8KA 2WV9A 3DSGA 4DIHH 4DURA 4NFEA 1A0HB 1C2JA 2CMYA 1TNHA 1QRWA 1LHGH 2WSSD 4Y0YE 1FQ3A 4WXIA 1X7AC 1EJAA 1HXFH 1O5AB 2ZU1A 4ZXYH 1UTNA 1GI0A 2FTMA 4K60A 1MKWH 4GHTA 4ZKRU 1TALA 3SHCH 1L0ZA 1W14U 2P8OB 2GDEH 2YNAA 2K8IA 2EEKA 2PTNA 5F8TA 4Z0KA 1HXEH 1BT7A 2IPHA 2CV3A 1KXBA 3FP8E 2HNTE 2AERH 2ZQ2A 2OCVB 4JMYA 2ILNA 1EASA 1UCYK 2A4GA 1BZXE 1QNJA 3K9XB 1V2NT 1O2PA 3UY9A 2R0LA 3BTQE 1KXFA 4YT7H 2KM0A 1IQKA 1QZ8A 3PMAB 3GY4A 2BZAA 3FAOA 1C1NA 2ZIQH 2ZGBH 1SC8U 4F4OC 4OS1A 1SGQE 5PTPA 5T6FA 4RT1A 3TK6A 1C2KA 1O2NA 1K2I1 3B23B 1YPHE 7KMEH 2BOKA 4P02A 4RI0A 5GXPA 1NFUA 1SLXB 3PV2A 3F0OA 4YLQH 1UK3A 1HAOH 4LZ1H 1SGCA 2F83A 1FY4A 4IMZA 1YYY1 1N6YA 2A5IA 2CK3D 1BBRE 1GHBG 2ZGHA 1OKXA 3O8DA 2O9QA 1RJXB 3FO8D 2UWPA 3RMNH 5IDKA 2CJIA 7GCHF 4HZHA 1H8DH 2VIOA 1EJMA 1AKSB 3ZYEA 1LCYA 1IQFA 1COWD 4B2BA 1GBAA 1BTUA 2R9PA 3MI4A 4CRGA 2QF4A 5IYTA 1LKBA 4BAKB 5LPFA 2BQ6B 2VU8E 3BSQA 1UW7A 1TNGA 3VXFH 1UTOA 1P2OA 4I32A 1ZOMA 1Z7KA 3I77A 3T5FH 3LH1A 2THFB 4JYVH 1PPFE 4IS5A 4X8TH 1O3LA 1AHTH 5CE1A 2BXUH 1QBNA 4I86A 5DGJA 1WQVH 3M5MA 2BX3A 1GHAF 4FUDA 2LPRA 3VEQB 5JBTA 1YWUA 5L30H 1UVUH 1SGDE 2RA0A 1BMNH 2JH6D 4BANB 1AVWA 2OINA 1TX8A 4A6LA 3U69H 4IC5A 1V2ST 2A5AA 1ZHRA 3RXRA 1VITH 1GI2A 2C8ZB 5DP7A 3BG4C 1SPJA 1H9LB 2V3HH 1EUFA 3OSYA 1EAIA 4ABAA 6LPRA 1AB9C 4F49A 2Y82A 2QGRA 1B0EA 3BEFB 1TB6H 3M37A 4E7RG 1QHRB 2B9LA 4CBNA 2VJ1A 4NA9H 4K1TA 2GMTC 1XUGA 3F1SB 3RMLH 1A1RA 4RT0A 1XUHA 8GCHG 3PTBA 4NWLA 1IQHA 2JJ1D 2ALVA 1AQ7A 1AUJA 3A7WA 3WWFA 4X8VH 1GHWH 2P3TB 3SV6A 3F6UH 2HOBA 3D23A 4KP0A 1VGCB 4Y8ZA 3H7TA 1CA0C 2P8OC 2FP7B 5DK1A 1WAYB 3SV2H 4A92A 2FODA 4GCHG 1EAXA 2QC2A 1PQ8A 4I31A 1RGQA 1O3FA 2BHGA 3BTEE 2WHXA 1V2MT 1K0HA 3BTHE 1F0UA 5B6OA 1GI8B 3SUGA 4E7NA 2PW8H 3TH2H 1NESE 4ZHAA 5FXLA 1CE5A 3KCGH 2XWBI 2UUYA 3EE0B 2Z9KA 2ZG0H 1QJ7B 2DUCA 1QL7A 1WU1A 3NPSA 3RXJA 1F2SE 3M61U 3F9EA 2QF0A 2R2WU 4FU7A 3SI3H 1EZUC 4D9RA 4R8TB 4BTTB 2HPQH 4CRDA 1YCPH 3ZV8A 1IQLA 1SGIB 5L2ZH 1TYNA 1BB0B 1O38A 3R3GB 1NM6A 1T4VH 3ZZ8A 1ZSLA 2K7XA 2O8WA 1V2QT 3ODDA 1AFEH 2G4UA 1H8ED 3L33A 4ZH8A 1DX5M 1O2UA 4ABJA 1QJ6B 3W94A 1Y3VA 3BTME 1A2CH 1IHTH 2FMJA 2J97A 3OYPA 3ZZ9A 2ZKSA 3QDZB 3U1JB 5T6DA 1OPHB 1DLEA 4FUEA 3DA9B 1QA7A 3RM0H 2Q6FA 5FL7D 1SLVB 3FFGA 2AMDA 5FPTA 3SORA 1TBRH 1SSXA 4YT6H 3RU4T 1LVOA 3KEEA 1XUIA 3SBKA 3HGPA 1EB2A 4B2CA 2P93A 1G3BA 2ZHDA 1JRTA 4ABEA 2ANKH 1O3BA 3Q00A 1MU8B 2GCHF 2G8TA 1BITA 2OK5A 3SU2A 1MAXA 5EU8A 3E16B 1F7ZA 1C1OA 3UREA 3F9HA 5JB8S 3TITA 1EFRD 2XOKD 3P8OA 4X2YA 2L74A 1CVWH 3LGWA 1EKBB 1C9PA 4JYUH 4YOIA 3QGJA 2BTCE 1HIAB 1LHDH 1YPEH 4BAQB 2EA3A 4FU9A 1DSTA 3UNRA 2ZDKA 1KLJH 2KFWA 4IC6A 3BG8A 4RSPA 1K1IA 2JJ2D 2OUAA 5C67A 2EC9H 1GJ9B 1ESAA 4OGXA 4Y10E 3BIVH 4CRAA 4O97A 1W7GH 5TCAA 3GCOA 1FY3A 1UTJA 1LVBA 3SUEA 4I7YH 2STAE 1LTOA 2UUKB 2BD8A 2C8WB 1HBTH 1SOTA 2ZFQH 5JYIA 3M7QA 1CHOF 3NWUA 2BXTH 3MNXA 3NKKA 1VGCC 4VGCB 3CP7A 4TPIZ 4CR9A 2ZNKH 1O3DA 2FXRA 4FVBA 5ESBA 4AYYB 3QLPH 2XC0A 2P3UB 3LGYA 1O2LA 4ZXXH 1W0YH 1DOJA 4LOYH 1UVTH 4X1NU 1SBWA 4ISLA 3MHWU 1P2QA 1KSNA 5I25A 2VWOA 3A7VA 3SQEE 1HJ9A 4U01A 4YM9A 4ZHLU 1S82A 2W26A 1G3DA 1LKAA 1LMWB 3URDA 2ZWLH 1K1JA 3QWCH 2Z3DA 1EOJA 3U9AH 1A3BH 3ZZCA 2D26C 2AGEX 1XKAC 2P94A 1BOQA 1A5IA 3RMOH 1PJPA 3BTGE 3SZNA 1OSSA 3TJOA 4GUXA 4E06H 4E05H 1QR3E 1GVZA 1SGRE 4AB8A 3OY6U 3OTJE 2VINA 1FLEE 1QY6A 1W12U 3KN2A 3UR6A 3M3VA 3W95A 2J4IA 1O2SA 1C4Y2 2KAIA 1GJAB 1T31A 1UHBA 3VGCB 1WBGB 4RKJB 2HWLB 3SJKA 4AC9A 4D9QA 1TRMA 5A8XA 4JZIA 4ESTE 5G4BA 1QRZA 3UIRA 1V2KT 1NC6A 1V2TT 2QYIA 1O2VA 2PKSB 1B0FA 1TNKA 4FUHA 1UTLM 4CH8B 2AMPA 5EPYA 1P11E 1WSSH 4AOQA 3RXPA 2Z9IA 1GGDB 2SGPE 1RD3B 2VBCA 1H8IH 2BDGA 2VWNA 5AVDA 1K1NA 1WTGH 4MG3A 5T6GA 4XRNA 1E38B 2XBXA 5FAHA 1TBQH 2ZPRA 2BD3A 4J2YB 1KDQA 5FCRA 1TE0A 3W1EA 1NRPH 3BEUA 1GI1A 1PPGE 3PRDA 1CT0E 3RC5A 4ASUD 1FY5A 1O2JA 2ZCKP 3QTVH 5GDSH 1ELDE 1ARCA 5KGOA 3TPIZ 2Z6BD 1QJ1B 1AFQB 1L2EA 1HIAA 4AGJA 1T7CA 1OS8A 5DP8A 1AY6H 3SJOA 3S9CA 1FONA 1G32B 3GICB 3TU7H 3N7DA 4A1TA 1P01A 1EP6A 1HRTH 1VITG 1RTLA 4QT8C 3F2GA 4TYDA 1EJNA 1NN6A 4B6FA 5EQQA 3TGJE 2D8WA 3HKIB 1TA6A 2XBWA 3B8JA 1GDNA 4IN2A 1BTYA 3KF2A 1P2KA 1T4UH 1QQ4A 1TONA 2ANYA 1ZR0A 1S0RA 1C2FA 3RUOA 3UPEA 4OS6A 5DN6D 2OBOA 5FX6A 5A0AE 1FNIA 2W3KA 3GY6A 5E0GA 3P17H 1LQEA 1XXFA 2FIRH 1CHGA 1YPHC 5ABWA 4FUFA 2ZGJA 1BRAA 4INKA 2NU3E 2PFEA 3NUMA 3RXDA 2OBQA 1O32A 2ZTZA 3ZVGA 4FUGA 2W5EA 2VB0A 2BB4A 2W3IA 2Z9JA 2VVVA 2YMSB 3MFJA 2ZGXH 2ZU5A 1C1RA 4AYVB 1A4WH 1JMOH 5C1YA 2Y5GA 4JCNA 5TJXA 1EXFA 1AE8H 3A87A 3RXFA 3SV9A 1YY3A 1NS3A 1O5GH 1BRCE 1OWJA 2ALPA 2G00A 1E1RD 2IJD1 5J4SA 2C90B 3T25A 1D6WA 3IITA 1AO5A 4B1TA 3E0PB 1TNJA 3ATIA 2ZHWH 1XX9A 2XCFA 4LZ4B 4BTIB 1SLWB 3SNDA 2XC5A 3SU1A 1O2TA 2BVRH 1MD8A 1FN6A 5EQRA 3RXGA 3ZZ6A 1TQ0B 3A7ZA 1HAYB 1BHXB 1J14A 1O3IA 1Z6EA 4UEHH 5EG4A 1QFKH 1O2WA 1SOZA 2AEIH 1TGTA 2PUQH 2FLBH 1Y3UA 3ZV9A 5FBEA 4X2VA 4X6PA 3V0XA 1F0RA 1D3PB 2ZP0H 4IMQA 2DE8A 3MTYA 1SQRA 1GJ5H 1RTKA 1HAVA 1KY9A 3GDSA 2PKSC 3RXVA 1Y5BT 1V2PT 1S83A 2UWLA 2A4RA 1IHSH 1K1MA 4NIVA 4WH6A 2F9VA 1GGDC 4KTUA 1PQ5A 4XFQA 1WXRA 2NU0E 1UVOA 1BBRK 4KKDA 1PPZA 2G52A 5GWZA 1NRSH 1O2MA 3TK9A 4MNYA 1O3PB 3DUXH 3FN8A 1MQ5A 1XUKA 2Z9LA 1O5EH 2BDBA 1TIOA 1ZRKA 3A7YA 2BLOA 5I46H 1TGCA 1C2EA 1Y3YA 1CQQA 2O8TA 3LKWA 1BTWA 4IGDA 1TPOA 5T1VA 1K9OE 5C3NA 1AVGH 1D3TB 1QCPA 1BTZA 2BM2A 5EJZA 2FOAA 1DSUA 3T2NA 4B76A 5A2MH 4YXWD 3OY5U 3QZQA 2ZDMA 1DXWA 2TIOA 2IJOB 1VCPA 2VVUA 4BOHA 2ZTXA 5A09A 2CGAA 5HIYA 4RKOB 2F43B 2O8MA 3VB6A 1GBEA 4B74A 4MQAA 3OU0A 2O8LA 1DFPA 5HXFA 3TIUA 1S6HA 2V6NA 2BVXH 3VPKA 1GMDG 2FTLE 4OS2A 3DCLA 1PPHE 2TPIZ 3SNCA 2GT7A 1H9IE 4Y79A 2WZQA 2HLCA 2H9EH 2P95A 3ZYDA 3MU4A 1UTQA 1O3EA 2TBSA 1E1QD 2JIZD 1DICA 1T8OA 2FS9A 2J95A 2ZPQA 1AB9B 2YMSC 1VCQA 1LVYA 1TLDA 4B2AA 3RXEA 1O0DH 3A8DA 2GZ7A 1QURH 1GVLA 4LK4A 2XBVA 1TFXA 2GMTB 2B0FA 3MMGA 4MDSA 4WWYA 3G01A 3KGPA 1LQDB 1GI4A 2VWMA 1VJAU 4DCDA 2K1QA 4BTUB 4CBOA 4NFFA 1NRRH 1VZQH 3BTWE 3KQEA 1CA0B 2Q6GA 3EQ0H 5DPAA 2ZI2H 2DE9A 1P09A 2G5VA 4ABDA 5DP3A 2BD4A 1Y59T 1BTXA 3AK5A 3GS9A 3SU0A 1FJSA 1P06A 1TGBA 3RC6A 5L2YH 2VH0A 3DFJA 2A5KA 1YLDA 3OEHD 5E0HA 4BAMB 5EIYA 1ZGVA 5AHGH 1ZPBA 1GWAA 1Q3XA 1TOCB 5J4QA 3MU5A 2TGTA 4Q7XA 4DIIH 3KL6A 2F9NA 1L4DA 2BD7A 1O36A 3OX7U 2AGIX 1FUJA 2J9NA 3D65E 2VIWA 1ETRH 2KR7A 4FUBA 2H1UA 5DP5A 5A0CA 4WY3A 1PPBH 2BZ6H 3PB1E 4FUIA 1KIGH 3E90B 1W8BH 2JDID 6CHAB 2W6ID 2F4LA 2ZCHP 3P8FA 4ABBA 2F9UA 1GMHG 3UWIA 1O2GH 4Y76A 5GCHG 2WINI 1UJ1A 4D7FA 5C17A 1XXDA 2JH5D 1PQAA 1HUTH 1XKBC 1OP2A 3GY8A 4KTCA 5JB9S 1O3AA 1PQ7A 2GZ9A 1ZTLA 1EZQA 2V0BA 1JXPA 3Q3YA 1DPOA 2Y7XA 1MD7A 1THRH 5DKMA 1P2NA 1GBIA 1SGFG 3S0NA 1MKXH 4JZEH 1W2KH 4MPUA 1GJ4H 1A5GH 1RIWC 1J17T 2EY4C 1JRSA 2J94A 1CGIE 3UNSA 2HVYB 3SU6A 1BDAA 2SGQE 4HI3A 1EQ9A 4B71A 1P8VC 3M5NA 4TSFD 1NRNH 4NA7A 3ZVFA 2ODQA 1SKYE 2QN5T 3N99A 3EA8A 1C5TA 1JBUH 3S7HB 4A7IB 1DWCH 1JWTA 4KGAA 3KQBA 3GY5A 4X1PU 2Y5HA 1ZMNA 3LGIA 4NG9H 1JIMA 2C4FH 5C5NA 3MU8A 4ISIH 3ZVEA 1GBMA 2A2XH 2PUXB 2G55A 1B7XB 1AVXA 4ZUHA 3GY3A 1T8NA 4H42U 1C5VA 2WPMS 4RN6A 4INLA 2LNCA 1AU8A 1ORFA 4IN1A 2UWOA 4FOUC 1YPMH 4GLYA 3M7UA 2G81E 1SHYA 2PSYA 2JETB 4X6OA 1EAWA 1DUAA 2PP6A 3A88A 3P8NA 1KXCA 4Y7BA 3GYLB 3OAAD 1ESTA 1PFXC 2QIQA 3VFEA 1V2LT 3F2FA 2UUFB 1GBCA 1GJ7B 3TK5A 3EDXB 3RXSA 2R2MB 2BY5X 4UFDH 2C93B 1GMCG 4DG4A 1P02A 1G36A 6GCHF 1H8HD 4WVPE 5F03A 1O2IA 1G37A 5T3HA 1GPZA
chains in the Genus database with same CATH topology
1GDQA 3EA9A 1UTPA 2RDLA 1ZJKA 1O3GA 4AX9H 3HKJB 1D3QB 2QV1A 9ESTA 2SFAA 4GPGA 5H4IB 1SG8B 1G2MA 1GG6C 2XWAA 2TGPZ 3P70B 1BIOA 1ELFA 1BJVA 5C2ZA 5AF9H 2CN0H 3PMHB 4MPWA 1V2UT 1E34B 3L3TA 2GVFA 6CHAC 5F6MA 1AWHB 4CREA 3Q3KA 1O2HA 1V3XA 2KAIB 1UHBB 3E6PH 4BXSA 4WJG2 2BOHB 2ZHFH 3P8GA 3SUFA 4Z6AH 3ESTA 1Z8RA 3ZZAA 3P95A 1K1OA 5FCKA 1SL3A 1SHHB 1YP9A 1NT1A 1NFXA 5E2OA 2LIZA 3TNSA 3M3SA 1C1WH 1FXYA 1P57B 4O03A 1OWHA 2F9BH 1C5UA 2ZEBA 3A85A 1O2QA 1GI3A 3GCTF 2BY9X 1Y3WA 2SGFE 5DJ7A 2IOTA 3N7OA 1KDQB 2C8YB 1HAXB 1O35A 1O37A 1LPZB 7ESTE 3ZVBA 3U8RH 1O2YA 3SNBA 5A8YA 1O5FH 2BD2A 3TJNA 1WOFA 1C5MD 1HAIH 1O2OA 5A8ZA 3MU0A 2WPIS 2G51A 1FPCH 3ZZ5A 4X6MA 2AMQA 1DY9A 2Z94A 2BLVA 1FY1A 2SGEE 5ETXA 1N6XA 2WPHS 1GCDA 4WH8A 1EZSC 1LVMA 2AFQB 3HK3B 1ESBA 3PLKA 3BV9B 1N1LA 2BMGB 5DP4A 2ANMH 3A8BA 1MTUA 4ISOA 1P0SH 1GJ8B 2OC0A 1RTFB 3RXHA 4WMEA 1C1SA 2FO9A 3IG6B 1DDJA 2FWWA 1LO6A 3SOSA 1MKWK 2BDAA 2JETC 1SGTA 4CRCA 3M36A 4D76A 1LPKB 3F9FA 3CENA 1GBDA 5AFYH 4K8YA 2WYGA 1ANBA 1SR5C 4U32A 2TGAA 4DOQA 4MLFB 3CS0A 1ELEE 4R0IA 2XRCA 2OQ5A 3PWBA 3O8RA 1OYTH 3SJ8A 2D1JA 2JH0D 2XTTB 1ETTH 1AWFH 4OS7A 3BN9A 2HVXA 1ZRBA 1BCUH 1UO6A 1FY8E 1YBWA 1GDUA 1LDTT 4Q80A 5HM9A 1HAGE 4H6TA 7GCHG 1KTSB 1ANCA 2A7CA 5FHTA 3ZZ3A 2A7HA 2ODYB 1W0ZU 2OLGA 2NU1E 2JKHA 1J16A 1D3DB 1ZSKA 1PPEE 1TGNA 1QB1A 2ZU2A 1HAVB 1HAZB 1MZAA 3I29A 4AFZA 5ESTE 4DJZB 3O8BA 2ASUB 4JK5A 2GV6A 3TJVA 2AGGX 2FOCA 1GHAG 2NWNA 1JIRA 3BTFE 1C1PA 1MKXK 1ZJDA 1GI9B 2H5DA 5E0JA 4CRBA 1DE7H 3UFAA 2WYJA 1NY22 1KTTB 1GCTB 1QBOA 2GZ8A 3SW2B 2A7JA 2AIQA 3L6PA 3U1IB 5K0HA 1DWDH 4X8UH 6ESTA 1AZZA 4X1QU 3A80A 3JZ1B 3S9BA 4GHQA 2F3CE 4XDEA 3RP2A 1C9TA 4YOGA 1S6FA 2QCYA 1Z71A 4DW2U 1D4PB 3SJIA 1TPPA 1P12E 1A61H 4K5ZA 2ODPA 2ZGCA 4Y0ZE 1QB9A 3ATWA 3M3TA 2HNTC 4X1RU 3EAJA 1BUIA 3NXPA 5TCCA 1W11U 2VH6A 1O2ZA 2A0QB 1F0SA 1GHVH 4MNVA 2HRVA 1QL9A 1GHBF 4ABIA 3UUZA 4GAWA 2VGCC 1G3EA 1E0FD 1Z6JH 1TMBH 3LT3A 3EA7A 4U2WA 1TRNA 4XOJA 4ASHA 2EI7A 3K65B 3KQDA 5CMXH 1Z1JA 4I8LA 3SQHE 2OC7A 1UTMA 4I8HA 3SO3A 1T8MA 4YZUA 2R3UA 1FIWA 4NWKA 2QXIA 1NU9A 1NTPA 1TPAE 4ABGA 4FVDA 1BHXF 3E8LA 5EW1H 4CRFA 1T32A 3LC5A 2EI8A 4WF8A 3E91A 1CBWB 4OS4A 3PTNA 2QF3A 2FI4E 3CS7A 1ZHPA 1PPCE 1DWBH 3AW1A 1LPGB 5EGMA 2GX4A 1C5QA 1E37B 1H9HE 3QK1A 3STIA 1C5WB 5LGOA 2ZDVH 4I33A 3M7TA 1S84A 2H9HA 1OX1A 2FDAA 1SLUB 1MTWA 3MNSA 4K1SA 4K2YA 3MNBA 1ARBA 4H6SB 4AZ2B 3V3MA 3QO6A 1YCPK 3KHVA 5HGGA 3ODFA 1YCPM 3F68H 1YF4A 3GCHC 4Y8YA 1HYLA 3ZVCA 1SQOA 1OXGA 1C2MA 8KME2 2XXLA 2OD3B 3TNTA 1HJ8A 1YKTA 3BF6H 3PYHA 4DY7B 1K21H 1ZTJA 5C1XA 2HPPH 5C5OA 2BD5A 2ZDLA 1C5OH 1MH0A 3MU1A 8GCHF 3LGVA 1ABJH 3PLBA 2C3SA 1TWXB 2SNWA 1D6RA 2BLQA 4YTAA 1K1PA 1P3CA 1AD8H 2B7DH 2BVSH 2PGQB 4KELA 1C2DA 2BDIA 1QQUA 3BIUH 4U30A 4TPYA 4X0WU 1TQ7B 3T26A 1Q31A 1VCWA 2GCHG 2FOFA 1C1TA 3NK8A 1WCZA 4GCHF 5GPIB 5EXLA 1PYTC 1O3OA 4AG2A 3ATKA 2J34A 3VB4A 2Q6DA 1GCTC 2F9PA 3RXQA 2BD9A 1HPGA 5FBIA 1ELCA 2J2UA 1TABE 1V6DA 1O2RA 3UOUA 2A4QA 3E3TA 1N8OB 3MH7A 2ZU3A 1C1UH 1DLKB 1RFNA 3S9AA 4CHAC 1C2IA 3T28A 3GISB 1KLIH 2QXHA 3UR9A 3KNXA 4DT7B 3QZRA 1RIWB 1V2WT 3QN7A 1UVPA 5L6NH 1QTFA 1NFYA 3SGBE 3SNEA 1XMNB 2ESTE 1AZ8A 3RM2H 3RMMH 1AIXH 3JZ2B 2PLXA 2WPKS 1HJAC 4BAHB 1E35B 1CHOG 3C1KA 2A31A 1SGPE 2B5TB 2CXVA 1MZDA 3UWJH 3A83A 2ZO3H 3KIDU 2B8OH 1EPTA 1HCGA 4O3UA 2FX4A 2BY8X 5EXNA 1ZYOA 4MTBA 2QY0B 2XW9A 2Y6TA 1SGNE 3SGAE 4O9VA 1FAXA 1EAUA 2SGDE 3Q76A 1L1GA 3PLPA 2XYAA 1P04A 3FZZA 3SUDA 5C20A 2H5CA 2BQWB 1DY8A 3LGUA 4K1EA 1AGJA 1C1MA 5BRRE 3AAVA 1ANEA 1GBKA 1ELTA 3EGKH 1IAUA 1WQSA 1B5GH 1P9UA 2XC4A 1CBWC 1U6QA 2Y7ZA 3S69A 3FP6E 1IQNA 1D9IA 1O2XA 1WTHD 3FZDA 3I78A 3T62A 2Q1JA 1C5PA 1FIZA 4AN7A 1LHFH 4ABHA 2HGTH 1QB6A 1IQMA 3MO9A 1THSH 1SGFA 3UQVA 1A5HA 2FESH 2FOEA 3HGNA 2EI6A 2PKAA 3PMJA 2H9TH 3GDVA 1DS2E 2BLWA 4Y7AA 1KXDA 3SU5A 4PROA 1C5XB 2CHAC 1GVKB 1RRKA 4XE4A 1A0JA 1S81A 3ATMA 1SVPA 3MOCA 1O3HA 5FPSA 2I6QA 3M35A 5K7RA 2XNIA 1AI8H 1YC0A 3A82A 3RXLA 1G30B 3LIWA 2SGAA 3RU4D 2WPLS 3D49H 1E36B 3TLOA 1GG6B 1MTVA 5FPYA 5DO4H 3TGIE 1FV9A 1F92A 3TH4H 1O31A 1O3CA 1YPJH 4D8NA 1OWDA 2GDDA 2ZHEH 3LJOA 4A1XA 1ZHMA 3P92A 1O34A 2J38A 1A0LA 2FYRA 1EX3A 1CA8B 1HGTH 3H7OA 1FMGA 1GJ6A 2A4OA 1NO9H 4FUJA 3UOPA 2PR3A 2ZFTA 3V13A 4UD9H 1NFWA 4NZQA 5HM2A 3MH5A 1N8OC 1F0TA 5DP9A 1CGJE 4UDWH 1ELGA 2BQ7B 2BY6X 2RCEA 4XBBA 1JOUB 5DP6A 4XBDA 4Y6DA 4ZHMU 3Q3XA 4NA8A 2BX4A 1TGSZ 3U8TH 2Y81A 3RXCA 3T29A 2ZDAH 4FUCA 4OGYA 1C4V2 1OWIA 3FP7E 1HB0B 3LU9B 1SQAA 3A86A 4Y71A 4ZMAH 3TGKE 2GV7A 4DVAU 2ZA5A 4WMDA 1MTNC 5BPEA 3U98H 5JBAS 5LH8A 1O33A 3SNAA 1O3NA 1MBMA 4X8SH 1ELBA 1QGFA 1CT2E 1K1LA 4UFFH 3LONA 1BA8B 1J8AA 1FI8A 3RXAA 1YLCA 1DITH 1GHXH 3SN8A 1ELAA 1KXAA 3RC4A 1TAWA 2CF9H 2VIQA 3K6YA 1W13U 4NIXA 3V12A 1T8LA 2V3OH 1HNEE 4K8BA 1HFDA 4ZAEA 2FM2A 3BTTE 4UFEH 2F91A 4ZKSU 2FYQA 3FANA 4ABFA 2Y80A 3GCNA 4NGAH 3A7XA 3A8AA 1CU1A 2R0KA 3SV8A 3MH6A 4JK6A 1GBTA 1XVOA 1IQEA 3MO3A 4CR5A 3GDUA 1FAKH 2FI3E 5FX5A 3E1XB 3BEIB 7LPRA 1LHCH 3URCA 1Y5UT 2P3FH 1SI5H 1MBQA 1P9SA 1G9IE 1VITF 3IWMA 3SV7A 3T27A 1RS0A 2Y5FA 2GGVB 3AAUA 5HMAA 1AUTC 2XCNA 3DFLA 2WUCA 1H1BA 2BY7X 2GKVE 4UE7H 1BRUP 2VIPA 2ZF0H 3HPTB 1RXPA 5EPNA 3A8CA 1FN8A 1SMFE 2FLRH 3RDZA 1UK2A 1FZZA 4X1SU 2OTVA 2QA9E 1MMJN 4Q2KA 2VNTA 4Q7ZA 2C8XB 5A0BA 1J9CH 3K6ZA 1C2HA 1MCVA 1UCYE 2YNBA 3Q77A 1GHYH 1NRQH 3A81A 3S7KB 1OWEA 5EODA 2ZU4A 1UK4A 3FVFB 4AORA 4M7GA 5C1UA 4JYTA 1WV7H 3A89A 1GBBA 1WUNH 4I8GA 2F9OA 3WY8A 2OXSA 1P10A 1AN1E 1EOLA 2FOBA 3QGNB 3LGTA 4CH2B 1SFQB 1C5RA 2HNTF 3A7TA 4ZROA 3PROA 4JZDH 3MYWA 1IQIA 1YGCH 1GBLA 2M5TA 1AKSA 5HYOA 2CF8H 2NU4E 3RXUA 2AYWA 2PTCE 1ZLRA 3K2UA 1O2KA 1BBRH 1SGYE 1V2JT 2VVCA 1OP8A 4K69A 1HV7A 2BYAX 1ZZZA 3AW0A 4MNXA 1DT2A 1V2OT 3P6ZB 4BNRA 2QXJA 1QA0A 3MNCA 4OS5A 1Z1IA 2PWXA 1DWEH 3DT0H 2H2ZA 1HLTH 1ID5H 2WV4A 4INHA 3R0FA 4XSKU 2GCTB 1GI7B 1K22H 1MTSA 1THPB 5CHAB 1YPLH 2VGCB 1IOEA 2PGBB 1GJBB 2W7SA 2P16A 1LHEH 5F8ZA 4H4FA 2G4TA 1INCA 1QL8A 2ZFFH 2ANWA 1C1VH 1BJUA 1IQJA 4GSOA 1TNLA 1GL0E 1MQ6A 3GY7A 1DUEA 2BDCA 3AASA 2ZFRH 2YOLA 2BDHA 4JZ1A 2TRMA 3PWCA 1TA2A 1QBVH 2VWLA 2ZHQH 5E8EH 1HAHH 1GMDF 1W10U 1ZTKA 1KXEA 2Z3CA 5JBBS 1FDPA 2A2QH 2FOGA 1MAYA 3E0NB 1NU7B 1WYKA 1XUFA 3UNQA 5JBCS 1AE5A 1XM1A 3GCHB 2Z3EA 4ZKNU 4BXWA 4UFGH 3TH3H 1KLTA 4AFUA 1P03A 1EP5A 2OP9A 1SB1H 2STBE 1CSOE 1Z8JB 2GP9B 3NZIA 1ZPZA 5EXMA 3F9GA 1S5SA 4AFSA 2RG3A 1UMAH 1C2LA 4MPVA 8ESTE 3RXOA 1O5CB 4FXGH 4WMFA 1OOKB 3HATH 1XUJA 5AFZH 1UCYH 4AB9A 1EZXC 3ATLA 3DHKH 5EOKA 3RXTA 3RXKA 1P2JA 1UVSH 1ABIH 1O3MA 3LJJA 3GYMA 2WV5A 4K3JA 8LPRA 3KQCA 1GI6A 3MH4A 3EBNA 1BQYA 1SQTA 3ZZ7A 1G3CA 2O8UA 3BTKE 1C5ZB 1SGEE 3RU4E 1NPMA 3V7TA 2FI5E 1TPSA 5F8XA 5SGAE 1FPHH 1C5SA 1Y3XA 1TMTH 1UTKA 2W7UA 3GOVB 1HDTH 2AIPA 3RXMA 3RLYH 4CHAB 1G2LA 2UUJB 1C1QA 2A45B 5JPMH 2H6MA 3ZZ4A 1ACBE 3PO1B 1GBFA 1OYQA 4YESB 1F5KU 1P3EA 4HTCH 1MU6B 4X6NA 2GTBA 4O3TA 3PM3A 3ZVDA 4IBLH 1TRYA 2ZCLP 2ZQ1A 1BMAA 1OWKA 3LDXH 1F5LA 1HJAB 2ZPSA 2GCTC 2XBYA 2FS8A 1GMHF 1PYTD 4TY6A 1GI5A 5CHAC 5GCHF 4FU8A 2FX6A 5JDUB 4NIYA 1J15A 1TBZH 5GJ4B 4BAOB 1H4WA 2FPZA 2V35A 1M9UA 3ENSB 1ZMJA 2Z9GA 1O3KA 1AMHA 3SGQE 4NSYA 3A84A 1EPTB 1SFIA 3QTOH 9LPRA 3STJA 3AVZA 1CGHA 2J92A 4WXVA 1BMLA 4X2WA 3TJUA 1W7XH 5EW2H 3UTUH 6GCHG 4B73A 2D2DA 1C4U2 1V2RT 3VB3A 2ZFSA 1GJCB 3ZVAA 1QIXB 2BDYA 4JZFH 4TY7A 1TX7A 1GHZA 1L4ZA 1BTHH 1GJDB 1DANH 4MPXA 1TX6A 1GBHA 4D7GA 2ZZUH 1TMUH 2AS9A 4VGCC 2FOHA 3ELAH 1C5YB 1O3JA 4HGCA 1L1NA 2VIVA 3EYDA 1CT4E 3GY2A 1ZGIA 4NZLA 4ISNA 1YPGH 1ELVA 2PKAB 3TVJB 4B75A 1V2VT 2GT8A 3QX5H 2CHAB 1XVMA 2ZFPH 1O5DH 3VB7A 4Y8XA 2OC8A 1VJ9U 2QAAA 4A1VA 4UONA 1DXPA 3NCLA 3U8OH 4AG1A 3SU3A 1Z8IB 5GIBA 4NSVA 3UQOA 3ZZDA 4NCYA 4Q7YA 4HFPB 2ZDNA 1GBJA 1A3EH 1Y8TA 4XBCA 3RXIA 2PHBA 3M5OA 4MNWA 5LPRA 4TWWA 1EATA 1P05A 3GCTG 2QXGA 2A1DB 3PMBB 1O39A 1ETSH 4THNH 4TWYA 4YOJA 3O8CA 4AFQA 1BTPA 2RA3A 2FZZA 3VGCC 4AGKA 3MO6A 2IN2A 3MWIU 4YO9A