3TJUA

Crystal structure of human granzyme h with an inhibitor
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
225
structure length
225
Chain Sequence
IIGGHEAKPHSRPYMAFVQFLQEKSRKRCGGILVRKDFVLTAAHCQGSSINVTLGAHNIKEQERTQQFIPVKRPIPHPAYNPKNFSNNIMLLQLERKAKWTTAVRPLRLPSSKAQVKPGQLCSVAGWGYVSMSTLATTLQEVLLTVQKDCQCERLFHGNYSRATEICVGDPKKTQTGFKGDSGGPLVCKDVAQGILSYGNKKGTPPGVYIKVSHFLPWIKRTMKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Granzyme H
publication title Structural insights into the substrate specificity of human granzyme H: the functional roles of a novel RKR motif
pubmed doi rcsb
source organism Homo sapiens
total genus 46
structure length 225
sequence length 225
ec nomenclature ec 3.4.21.-:
pdb deposition date 2011-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3tjuA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3tjuA02
1FDPA 1V2RT 2STBE 1TBZH 2W7UA 1O35A 1NPMA 2BY9X 2Y81A 1FY4A 1ID5H 4UONA 1SG8B 1SGTA 1GMCF 2D2DA 3GY4A 1LQEA 2BY8X 1FXYA 2HALA 2HVXA 1Y8TA 2P8OC 2AMQA 1AFQC 3RLYH 1W14U 1AU8A 1TGTA 1H4WA 1IOEA 2ZKSA 1ABJH 3SU1A 1FN6A 3P8NA 1FY5A 2UUYA 1ELDE 4HGCA 3DFJA 2ALVA 4ZUHA 3PO1B 4ABIA 1ZSJA 2ZP0H 5L6NH 2J2UA 3G01A 4UEHH 1QNJA 1ZMLA 1BA8B 1TX7A 2ZDNA 3RXVA 3UWJH 1GBKA 1VJAU 2J9NA 5JBAS 4MVNA 2BX3A 1P09A 3DHKH 3RC4A 2IPHA 2BB4A 4Y79A 1YPLH 4O9VA 2PW8H 3P8OA 5H4IB 4MPVA 1Z71A 1GI7B 3P70B 1KTTB 4CRBA 4DG4A 4XFQA 3EA8A 1O5GH 2BQ7B 2EI8A 4WF8A 1DPOA 1EUFA 1EKBB 2FOGA 4TPYA 4NSVA 1PQ5A 4CR9A 1ESBA 1NZQH 3M5LA 1GJ5H 5EU8A 1LPKB 2CMYA 4Y11E 3SUDA 1AE5A 4NIYA 1TB6H 2TGDA 2PTNA 2R2MB 5AHGH 1FAXA 4Y8XA 1AGJA 4FU8A 4CH2B 4D8NA 1MU8B 4WMDA 1O3OA 2ZF0H 1TPPA 1PYTD 1BIOA 2VGCC 4NIWA 4FVDA 2ZA5A 3A7VA 3MU1A 4B2AA 3JZ1B 2Z7FE 2WPHS 3A8CA 1TMUH 1TOMH 3KHVA 3HK6B 1EZXC 1DT2A 4K1EA 2F9OA 3PYHA 2WV4A 3EA7A 4AG2A 1O3FA 3RXOA 2Y82A 5A8YA 3QLPH 2Y5FA 3V12A 5K0HA 1TIOA 2F9PA 2ODYB 1EAXA 4U01A 4GVUA 3K6YA 4U2WA 2CF8H 1ELVA 3TJNA 4YESB 4I32A 4B2CA 1GBIA 5LPFA 2EEKA 2XTTB 2ZEBA 1TE0A 4YTAA 3V3MA 1O3GA 3LIWA 1QA7A 1ELTA 2ZDLA 1AWFH 3VXFH 2FX6A 2FTLE 2PGQB 1H8DH 1D6WA 3BF6H 1TX6A 3D49H 1QA0A 2ILNA 2BHGA 2FI3E 4NZQA 3P92A 1HAXB 5K7RA 4KTSA 4ISNA 1C4V2 2V6NA 3RXGA 3ZVFA 1NRPH 4CBNA 2W26A 3TGIE 1Z8GA 1VCPA 1AZ8A 3LGYA 1IQMA 1Y3WA 2Y80A 5FX5A 3M35A 8KME2 1ZYOA 2VH6A 2GKVE 2B8OH 4BAHB 1G3BA 2FPZA 1TBRH 5JB8S 3K65B 1D3QB 4FXGH 1NESE 1TNHA 1O2VA 1IAUA 5T6GA 1KXCA 2A5AA 2B9LA 1DS2E 2OUAA 4YT7H 3M3TA 3PLKA 3BTWE 1DY8A 1THRH 2HLCA 1YPGH 1NU7B 2A7JA 1UCYK 3VB4A 3MNCA 3E0NB 3GY3A 4MNXA 3RXUA 4FUCA 4RSPA 3NWUA 3MNBA 1A0HB 2WPKS 3MYWA 2G5VA 2H5CA 2PKAB 1BHXB 1JRTA 4FU7A 1C2FA 1SFIA 3SJOA 1GMCG 1TPAE 4I8LA 1N8OC 3S9CA 2P93A 1SHHB 5B6OA 1ZTJA 3A82A 4AN7A 4AGKA 1MZAA 5T6DA 1BRBE 1LVYA 3SUFA 2PUQH 3TNTA 1QL7A 3F9FA 1BBRE 1LTOA 3ZZ7A 1AMHA 5F8TA 3IWMA 3DUXH 5HYOA 1OWJA 1E0FD 1HYLA 3OU0A 3TNSA 1TGSZ 4AOQA 1DM4B 1DVAH 3B23B 1JIRA 1L1NA 1O2OA 4MPUA 4NA7A 3KGPA 2GTBA 1BOQA 4BOHA 1SQOA 1W0YH 4X8VH 2EI6A 1NROH 2ZFQH 1LVOA 1BTUA 1F0SA 3BTME 3TJVA 4D76A 1HFDA 1Z6JH 2NU4E 4K5ZA 3T25A 4Y6DA 1FJSA 5C5OA 8GCHF 1O30A 2UWPA 1MAXA 1F5LA 2WPIS 1UVSH 3A8DA 1VITF 2J34A 1GJ4H 2AIQA 1T8LA 3PTNA 4X8SH 3T29A 1OWEA 3W95A 3BTKE 2ZU4A 3RU4T 2RA3A 1W8BH 5A2MH 3RXKA 2PGBB 1A7SA 1CVWH 1PPEE 1WAYB 1WV7H 3SO3A 1QJ6B 1J8AA 3IG6B 3U69H 3PTBA 1MMJN 2GMTC 3A7WA 3FP8E 4Y71A 2BZAA 1C5OH 1GI2A 1H1BA 1OP0A 2SGDE 5C2ZA 2XBWA 1K9OE 3MH7A 2QN5T 1DICA 1RGQA 1YC0A 3UREA 4AYVB 3GOVB 1RIWC 2O8TA 2WINI 2XNIA 4FUIA 5E0HA 1EASA 1OX1A 1AKSB 5I46H 2ANKH 4CR5A 3ZZCA 1TAWA 1P57B 1HDTH 2K1QA 1C1VH 1VZQH 4UFDH 1ZPBA 2VIDA 1AUJA 1O2GH 4GLYA 1BJUA 2G52A 2J4IA 2TPIZ 2XYAA 5FBIA 1HLTH 1AWHB 1QBNA 2O8MA 1AI8H 4WY3A 3UPEA 2W5EA 2KAIA 1EX3A 4XOJA 1O3CA 3ATLA 3QTVH 1ELCA 4BAKB 3SNDA 3LH1A 3SV6A 1V6DA 3ZVBA 4K8YA 1GBCA 3KNXA 2OBOA 1OS8A 2JH6D 1ANBA 4GAWA 5AF9H 3LDXH 3QTOH 4HZHA 4LZ1H 4X6NA 3CS7A 2BLOA 1FY8E 1DOJA 2Z9LA 4A1VA 2GT7A 3PV4A 4ZAEA 5EODA 1AE8H 2HPPH 1JMOH 2LNCA 3AVZA 2P59A 4U30A 2OXSA 2NU3E 3QZRA 1GMHF 1WOFA 2O8UA 5HGGA 1AVWA 1J9CH 2FOFA 2Y7ZA 2PKSC 4AFSA 1DDJA 1ZLRA 2Z9KA 3MHWU 4NIVA 1LDTT 3UFAA 1ORFA 3RMMH 9LPRA 2ODQA 1WU1A 4CRDA 1RRKA 1ZPZA 4A5TS 3ATMA 1LO6A 6LPRA 1QB1A 2Q1JA 2FX4A 1O3MA 4CH8B 3KQDA 3H7TA 2AFQB 3RLWH 1CHGA 5ESBA 1SLUB 1O3NA 2O8LA 4X8UH 1P2JA 1DXWA 1YCPM 1MTNC 3GISB 5F8ZA 2GV6A 2QAAA 1HRTH 1W3CA 1BTHH 3HATH 4INLA 4CRCA 1D6RA 2BY5X 1GJ8B 3SJIA 1TNIA 5FCRA 2FOEA 1EQ9A 1LVMA 2BDIA 1FPHH 5DP5A 1EXFA 2ZCHP 1FPCH 3LH3A 2ZFRH 1CA0B 1SGCA 4A1XA 2BVRH 3TITA 1P2KA 1T8NA 1O32A 3AW1A 5DKMA 2C8YB 1GHBF 3GCOA 2EA3A 1UCYE 3SNEA 5GWZA 4Q7XA 2GT8A 3LOXA 1WBGB 2ALPA 2FOMB 5EQRA 4JYTA 3AAVA 1C5ZB 3VPKA 1SVPA 3R0FA 1AQ7A 2PV9B 2Y6TA 4HI3A 3CP7A 1D3PB 3Q00A 1NFUA 2A1DB 3KL6A 3NXPA 1HAZB 1O2XA 4VGCB 3RXCA 4Q7ZA 1TOCB 1O2LA 1LCYA 1VITG 4JZ1A 1EJNA 1YF4A 2ZHWH 2VH0A 5JBCS 4X6PA 2GP9B 1F5RA 1TALA 1V2UT 2PLXA 1JXPA 2ZZUH 1Q3XA 3TGJE 1SGQE 1O34A 1QIXB 2G00A 4X1NU 1YPJH 2D26C 1KLTA 4YOIA 3ZVAA 4WMEA 2ZGCA 2G81E 5EW1H 4DJZB 4Y8YA 5CHAC 2VVVA 2BD2A 3M7TA 4OGYA 1O3LA 2FEQH 2SGQE 5TCAA 3A7YA 2F9VA 1JOUB 3Q77A 1AD8H 4ZKSU 1O3PB 5J4QA 1GDQA 1ARCA 2HNTC 4X2WA 1WCZA 4X6MA 5EXNA 1ZRKA 2VU8E 4ABJA 2V0BA 1AFEH 5A0CA 4I8HA 4AYYB 1TWXB 2XW9A 1P11E 4Y10E 2FXRA 1TQ7B 2ZGHA 5IYTA 1HJAB 2OCVB 1HAVB 3C1KA 3F6UH 3VB7A 2UUKB 1EZSC 1F5KU 1GI0A 4OS6A 1GG6B 1V2ST 4JYVH 1L1GA 1O3KA 2PSXA 1SGEE 6CHAB 1KIGH 1CU1A 1C1RA 1C1MA 1P10A 1FI8A 1HAOH 3EGKH 4YO9A 1YBWA 2BDBA 2BY6X 2W3IA 1H9IE 2BDCA 2ESTE 2CHAC 2WYJA 1C1SA 4FUGA 2XC0A 2VWOA 2UUFB 1O2SA 2PHBA 2CXVA 1O36A 1WYKA 3SJ8A 1A1RA 1IHSH 3SU2A 1GMHG 1BRAA 2XC5A 4A7IB 3T27A 1TLDA 3VGCB 3O8CA 2SGAA 1HGTH 1C5MD 1SGRE 1MUEB 3BEIB 1S85A 4WH8A 1VITH 1C5TA 1JRSA 1FIZA 3TK9A 3M3SA 3KQBA 3T62A 5E0JA 2M5TA 1IQGA 2A32A 2O8WA 1GHXH 4LOYH 1O3DA 1XUJA 1SQTA 2VWNA 3MO6A 4YZUA 2A4OA 1T8OA 2VIOA 3KCGH 1MKWH 1PPZA 5GJ4B 2A7HA 1V2WT 3T5FH 1SGYE 4R8TB 2GCHG 3PO1C 4CHAB 2PWXA 1LHGH 4NSYA 1AN1E 5HXFA 3GCTG 2Q6DA 3Q76A 4HFPB 3RXFA 1CHOF 3KF2A 3QX5H 4AFQA 2G5NA 9ESTA 1K21H 1XUGA 3E1XB 2XCFA 2BD8A 1WTGH 1C1PA 1SLVB 1GHBG 1V2TT 3DD2H 2WPLS 1P05A 3C27B 2LPRA 5C67A 3SZNA 4GSOA 4INHA 1CT2E 1BRCE 3OY6U 2FS8A 1TRYA 1SGIB 5AFZH 3ZZ6A 1FQ3A 1ZHMA 1GGDB 3SBKA 2VJ1A 1QR3E 3RM2H 3T28A 1P06A 1C5PA 1T8MA 1K2I1 2H9EH 1G32B 1U6QA 2A4QA 1Q2WA 2F9NA 3F9GA 4UFFH 3LPRA 3UNQA 1TNJA 3TJOA 2P95A 4Q80A 3RMLH 1HV7A 1DWEH 1WTHD 2F9BH 2BDAA 2D1JA 3DA9B 3R3GB 1P2NA 2XBVA 1HAYB 1OOKB 1ZRBA 4A6LA 3TJUA 1IQFA 3I77A 2A0QB 2AH4X 2ZWLH 5L2YH 1DWBH 4OS1A 1GJDB 1Y3UA 4OGXA 1W2KH 5EPNA 2J95A 3QN7A 1A4WH 4D9QA 4Z6AH 2G8TA 2BXUH 2C8ZB 1GDUA 1O2MA 4LK4A 3Q3KA 6GCHF 3V0XA 3M7QA 2BD3A 2PSYA 1P8VC 3KQCA 1O2IA 3SHCH 3S7KB 3QGJA 1A2CH 3RU4E 2WYGA 1KYNA 4ZKNU 3TH3H 4IS5A 1F7ZA 2HNTF 1Z8RA 3A87A 1O33A 4NCYA 4GPGA 1WUNH 2BLVA 1ZTLA 2Y5HA 1FNIA 3M5NA 1VGCB 1KDQA 2OINA 1MCTA 4DURA 2WV5A 2BYAX 7KMEH 2QF0A 2Z6BD 1UHBA 2ZHFH 3UNRA 1O3EA 5DK1A 1SGDE 1Y3YA 1EZUC 4CRFA 1DLEA 3E91A 1XXDA 1NFXA 1S81A 3GDUA 2BM2A 1UTLM 1O5BB 3RXDA 3SQHE 1K1PA 1O3BA 4R0IA 2TRMA 1N6YA 3BTEE 2FIRH 3BTDE 1NU9A 3EAJA 2Z9GA 1MCVA 2QV1A 4B2BA 2OTVA 4TWYA 1GHVH 1TQ0B 1QCPA 3SUEA 3ESTA 4BAMB 1GHWH 4XBCA 2PUXB 5DJ7A 3FAOA 1O39A 2C3SA 3GY7A 3RXSA 3A7TA 1C5VA 1N6XA 2JETB 4NGAH 3SHAH 1SGNE 1C2GA 4MTBA 4NIXA 2BZ6H 2ZU2A 1C2DA 3VB6A 5DP3A 2P8OB 4GCHG 2HGTH 5DG6A 5L30H 3ATKA 4YLQH 3ZV9A 1A46H 1FUJA 1SL3A 2QXIA 1BUIA 2GZ9A 1G30B 5EOKA 4YOJA 1C2MA 3CS0A 2GCTB 2D8WA 1ZGIA 2BY7X 2ZTYA 3T26A 1J15A 1ZJDA 2FS9A 1OWHA 1BMLA 1J16A 5EQQA 2ODPA 5LH8A 2FOAA 1ZMNA 1O2JA 1ZJKA 2A2QH 4K3JA 1XUFA 3A8AA 2R3UA 2SGPE 4XBDA 1CHOG 2UUJB 3P95A 2DUCA 3M5OA 5FCKA 1B0FA 4I7YH 2ZIQH 3U8TH 1NM6A 2G4TA 1YLDA 1SFQB 2Y5GA 3LKWA 1XXFA 4UE7H 1C1TA 3ZV8A 4IN2A 1EB1H 3MNXA 1P0SH 2ZDVH 2FOBA 3UUZA 1BT7A 2P3FH 2TGAA 3PROA 3U1IB 1HB0B 4A92A 1BTPA 3HKIB 2VIWA 3U8OH 1AY6H 5I25A 1AB9B 2PFEA 4CREA 2YNAA 3VXEH 2ZTXA 2KAIB 1S6HA 4KELA 3BTGE 3TPIZ 1E37B 2F3CE 1V2OT 1IQEA 3D65E 3NKKA 2H6MA 3A89A 1CGJE 1UTJA 1ZHRA 2BTCE 3URCA 3GCHC 1BQYA 1FY3A 2CJIA 4X1RU 1C1OA 1ETSH 3RXJA 4GUXA 2QCYA 1E36B 5LPRA 5EG4A 4AG1A 1SR5C 1C5RA 1O31A 2B0FA 1G3EA 1NC6A 1VR1H 4JZDH 1JBUH 2J92A 1MKXH 1C5NH 6GCHG 1P3EA 1Y5UT 1YGCH 3GCNA 1ELGA 3UQOA 4KGAA 3SJ9A 3V13A 3NK8A 2BQWB 4BAOB 1MKWK 4E7NA 5C3NA 5ABWA 2CV3A 5AVDA 4IC5A 4BTTB 3GICB 3PMJA 1GBEA 4CRAA 3SGAE 4IMZA 5PTPA 3K6ZA 3ATWA 5E2OA 1SB1H 5A0AE 3P8GA 1O38A 1P04A 1Z8JB 2VIVA 1WQVH 1C2IA 2AYWA 1QQ4A 1GJ7B 1O5AB 4X2YA 3RMOH 3T2NA 2ZU1A 1NFWA 4J2YB 3V7TA 1Y3XA 6ESTA 1CBWC 1NFYA 4NA8A 3FZDA 4ABHA 3SI3H 5GPIB 1GJ9B 1W7GH 4WWYA 1OP8A 1CT4E 1ETTH 1THPB 4RKJB 5T3HA 1F0TA 4ISOA 3HKJB 1P2IA 4I31A 4BAQB 3ZVEA 1UTKA 1WQSA 1W13U 2HPQH 1C1QA 1HXFH 1C5WB 2FP7B 1P9UA 2FMJA 3A88A 4TPIZ 3RXTA 1DANH 1RD3B 3ODDA 1N8OB 1AVGH 3A84A 3RXEA 4MDSA 2IJOB 3TGKE 8LPRA 2F91A 3PB1E 3PWCA 2QXGA 1DSUA 2GZ7A 4ZHAA 1GVZA 2ZC9H 3RXQA 4CRGA 4I8GA 1Y5AT 1TPSA 3E3TA 1QRWA 4TWWA 1C5QA 1HAIH 3M36A 3WY8A 3OY5U 4JZIA 1EAWA 4INKA 2R2WU 4K2YA 1CA0C 4LZ4B 1K28D 4YOGA 1TONA 1YM0A 1UTNA 3ATIA 3DFLA 3OSYA 3NPSA 4B71A 3GY2A 1IQJA 2VB0A 5J4SA 2BD9A 2PKAA 3PMAB 3ZZ3A 1BTYA 3CENA 1TNLA 2F9UA 1YLCA 2THFB 1NRNH 3SGQE 1E38B 2ZGBH 2W7SA 3BN9A 3UQVA 3NCLA 4BXSA 3MO3A 2SGEE 5JDUB 2Z9JA 1IQNA 1ELAA 1LMWB 2CF9H 4H4FA 2V3HH 2AEIH 1BTXA 3A8BA 4WXVA 3UWIA 4YM9A 2GMTB 3Q3XA 1YPKH 4X6OA 4MQAA 3RXHA 1O2NA 2FOHA 3VEQB 2FESH 1S5SA 3BTFE 3MU5A 3L33A 1D3DB 1GPZA 4ZXXH 4B73A 4Y7BA 1BB0B 3LGUA 1FZZA 3UNSA 1LHFH 1A3EH 1GI4A 3GY8A 2GCHF 3S7HB 1L4DA 4K60A 1KSNA 3GCTF 1G3CA 4D7FA 5GCHG 5ETXA 7LPRA 1XVOA 1BMNH 3ZZ8A 2R9PA 4RN6A 1XKBC 1YPHE 1J17T 1K1JA 1RFNA 1S6FA 4H6SB 1TNKA 1EPTB 3QO6A 4I8JA 3ZVCA 1ESTA 1A0JA 1KXAA 1MTWA 5DPAA 1GJ6A 2B7DH 1LHEH 2C90B 4UDWH 1HIAA 1KTSB 5AFYH 1O2YA 5DP6A 1C2KA 2ZU5A 1C4Y2 1DXPA 3BIVH 3N7OA 2QA9E 1L0ZA 4OS4A 1GG6C 3EQ0H 4KTCA 1T4VH 3SORA 1SGFA 4AFUA 5DP9A 2XWAA 4ZKOU 3U8RH 1DSTA 4DT7B 1HXEH 1TMBH 3P8FA 5A09A 5BRRE 4IW4E 1S83A 2ZDKA 1LKAA 3FFGA 1PJPA 1XVMA 3A86A 1DUEA 1GBTA 2DE8A 1E35B 3RXPA 4JYUH 3TK6A 1SOZA 4X1QU 2QXHA 4PROA 1MD7A 3STJA 4A1TA 1QGFA 2G55A 3PM3A 3RUOA 3QK1A 4WXIA 2ANYA 2FI4E 1G9IE 5CMXH 5LGOA 1MTNB 3MU4A 1F2SE 1K1LA 1GBDA 2ZG0H 3RXRA 2ZGXH 1TABE 1DWDH 3S0NA 1P2OA 4MPWA 4M7GA 1TRNA 5F03A 3FP7E 5A8XA 1DE7H 1P2MA 4Y0ZE 1ZMJA 1EP5A 4NFFA 4DGJA 5T6FA 2A4RA 1C5XB 1O2QA 1YKTA 1EAUA 1SBWA 2I6SA 5JPMH 3S69A 1O2KA 1HAGE 2XCNA 1IQIA 2HRVA 1DWCH 1MKXK 3A7XA 4X1PU 5FXLA 3GDVA 1GI8B 3SU3A 2A4GA 3O8DA 3GY5A 2HWLB 3QGNB 1SI5H 4JZEH 2GDEH 4ZH8A 1GWAA 2G4UA 1UTQA 4BNRA 2VIQA 3VFEA 2FDAA 1P12E 1IHTH 1T4UH 2XRCA 5IDKA 3SU5A 4DCDA 1WSSH 3LGVA 1T7CA 4GCHF 3PMHB 2ZFPH 1KY9A 5FPTA 1NY22 3UY9A 1GI1A 4BTUB 2WPMS 1QQUA 1C5UA 2FO9A 1KXEA 2SGFE 1ELEE 2XXLA 3PLPA 2XBXA 5C5NA 3MH5A 2JKHA 1RS0A 2STAE 5TCCA 1S0RA 1UO6A 5C20A 2ZDAH 4ZXYH 4O3TA 2QXJA 3PWBA 1IQHA 2OP9A 1W7XH 1QFKH 3EDXB 1F0UA 2EC9H 1INCA 1S0QA 4NFEA 1EP6A 4Y76A 1C1WH 1SGFG 4JZFH 2BD7A 1GI6A 2VINA 4U32A 4ABFA 2QYIA 5L2ZH 3UIRA 2AMPA 1XMNB 2FLBH 3MFJA 3SI4H 3UR6A 3OTJE 3H7OA 1YYY1 4MLFB 4DVAU 1VGCC 1YPEH 1PPHE 3BTQE 5HM2A 4F4OC 1YP9A 1P3CA 1TFXA 1MTSA 5JBTA 3L6PA 3S9BA 1CSOE 2EI7A 5FPSA 4NG9H 4ZHMU 1OP2A 1V3XA 2QIQA 3EYDA 4AFZA 2PR3A 3RMNH 1Z1IA 3ZZ4A 2HOBA 1LPGB 4IGDA 1LKBA 5HMAA 1ETRH 4IN1A 1YCPH 3SU6A 2Q6GA 4ZHLU 1HAPH 2XBYA 4MNVA 3O8RA 3M37A 1UVTH 5DP4A 3STIA 1G37A 3BG4B 3RXIA 2SNVA 2ZCKP 1P02A 1SHYA 2AIPA 2A5KA 3ITIA 1XX9A 1ZZZA 1UVUH 1O2PA 2ULLA 5EQSA 1T32A 4FU9A 3AASA 2ZDMA 1GI3A 1GCTB 4X8TH 1RTKA 1BZXE 3ZVGA 2OC0A 1HAVA 2JETC 3LC5A 3EE0B 3KIDU 1TGCA 3E90B 4BANB 5TJXA 1W11U 4ESTE 3BV9B 4UFEH 3E6PH 1PPCE 1GBAA 2H1UA 3KEEA 7GCHF 3H5CB 1O5DH 1YPHC 2GZ8A 1BITA 2ZPRA 2NU1E 2GCTC 2BD5A 1V2PT 3SN8A 4KP0A 1RXPA 2A5IA 1MU6B 1P01A 5DO4H 1BMMH 3RP2A 1Q31A 1GHAF 3RU4D 3S9AA 4E05H 3MO9A 4ABDA 2NU2E 2W3KA 2BQ6B 1TRMA 2NU0E 4E7RG 3LJJA 1TPOA 1PQ8A 2AGGX 2WUCA 4MNYA 3A80A 1A0LA 1C1NA 1TBQH 4K8BA 1UJ1A 4WH6A 2ZQ1A 3GDSA 1XKAC 4QT8C 1H8IH 5JYIA 2P3UB 7ESTE 1GBHA 3BEFB 4B76A 4WVPE 1AB9C 2ZI2H 1AFQB 4ASHA 3LT3A 5LPEA 1CGIE 2JH0D 1BJVA 1ZHPA 4KKDA 5EXLA 5ESTE 4ZKRU 2ZECA 3LONA 2C8XB 4FVBA 1VJ9U 1JIMA 5JBBS 4D7GA 3TIUA 2VNTA 1BMAA 1GBLA 3TH2H 1BTZA 2OQUA 2ZHEH 2JH5D 1OWKA 5DP7A 3M7UA 3D62A 2R0KA 3ZYDA 2OC7A 1O2TA 2BVXH 1MZDA 2P16A 3ZYEA 4O3UA 3URDA 1GL0E 3ELAH 3QDZB 1DX5M 1V2JT 3BG8A 4WMFA 3M3VA 1M9UA 2ZFFH 2ZPQA 3BTHE 1ANDA 1G36A 1MH0A 2OQ5A 1S84A 4JCNA 5G4BA 3MH4A 1NN6A 5DP8A 2J94A 2RG3A 1QL8A 1S82A 1H9HE 3AW0A 3KQEA 4Q7YA 5GXPA 1LQDB 4FUEA 4ISLA 2VVUA 4DIIH 1MTVA 4MG3A 2GX4A 1QBVH 3OYPA 1GCDA 4FUFA 1C2JA 1EOJA 1C5LH 3A81A 1TGBA 2BLQA 3LGIA 1FN8A 1CGHA 3BIUH 4BXWA 1PPFE 1AZZA 3SJKA 2GGVB 1HPGA 3TK5A 1GI5A 2IN2A 2QY0B 3SNBA 2A31A 1MD8A 2VGCB 3K2UA 1BDAA 1TGNA 1QHRB 5JB9S 1SLWB 1ACBE 3ODFA 3QUMP 3MWIU 2B5TB 3DT0H 4TY7A 3A7ZA 1Z6EA 2QF3A 4TY6A 3FVFB 3P17H 4DW2U 1KLJH 5GCHF 1C4U2 5F6MA 4HTCH 4LXBH 1A5HA 5F8XA 2Z3DA 1F92A 2V35A 1ABIH 3RXAA 1V2LT 3HPTB 3HK3B 3FZZA 4SGAE 1EJMA 1L1JA 1O2UA 2VIPA 2H9HA 1OWIA 3SW2B 3IITA 3A83A 4K69A 4NWLA 2BDHA 4ZROA 2BOKA 1OPHB 2TGPZ 1GI9B 3HGNA 7GCHG 1W10U 8ESTE 3M5MA 1EAIA 4H42U 3LGTA 2FTMA 4B75A 1NRQH 2OC1A 2HNTE 1X7AC 1FMGA 5SGAE 4FUHA 3BEUA 5FX6A 1GJBB 3RXMA 3E8LA 1DITH 4MNWA 3RC6A 1HAHH 4OS7A 5FPYA 1T31A 1MTUA 4AORA 4UD9H 1K22H 1GHAG 2BDGA 1IQLA 2BDYA 2TGTA 3A85A 4ABGA 1XUKA 1GL1A 2UWOA 2GDDA 4RKOB 4Y0YE 1ZSKA 2OLGA 1UK2A 2FODA 1TMTH 2C4FH 1ARBA 4KTUA 3TVJB 1V2NT 1Z7KA 3SU0A 1SMFE 3MU0A 4BTIB 5E0GA 4ABBA 3NZIA 3B8JA 3SUGA 2I6QA 1MQ5A 1A5GH 1YCPK 1TNGA 2Z3EA 1MQ6A 4DY7B 3GCHB 3I29A 2F83A 1V2QT 2QC2A 4UFGH 4XBBA 3KN2A 2NWNA 1HIAB 3MNSA 2SNWA 4K1SA 5E8EH 1W12U 3ZZDA 3U1JB 2YNBA 3W94A 2CN0H 1BHXF 1UVPA 1SGPE 1QRZA 2XC4A 1K1OA 1O2ZA 1HCGA 1AUTC 1Z1JA 2ZPSA 5HM9A 2ZTZA 2R0LA 3RC5A 1HUTH 1Z8IB 3SGBE 1QBOA 2XWBI 4JK5A 3GYLB 2OC8A 3ZZAA 4XSKU 4Z0KA 4ZMAH 1SPJA 4O97A 5A8ZA 1ZTKA 1EPTC 1TYNA 3SV7A 5FAHA 1O3JA 4OS5A 1UK4A 1L2EA 2BOHB 1G2LA 2OD3B 2ZFTA 5FBEA 1C5SA 1GBFA 1K1IA 4OS2A 2ZQ2A 4YT6H 1EZQA 4XE4A 1PFXC 1BBRH 1QL9A 5C1UA 3SV9A 4THNH 1ANEA 1ELBA 1DLKB 4AX9H 2C8WB 2TBSA 1K1NA 1BTWA 1PYTC 2DE9A 2Q6FA 2Z3CA 2AGEX 4E06H 4VGCC 5GIBA 4FUJA 2RDLA 1CBWB 3TH4H 1UK3A 2C93B 1GBMA 3ZZ9A 4AB9A 2ZHDA 2IOTA 2A7CA 1RIWB 1P03A 3E0PB 1W0ZU 1DY9A 4NWKA 3F68H 4AGJA 1LVBA 1DUAA 1QRXA 1SQAA 3OX7U 4FUDA 1KXBA 1QURH 1HBTH 2BX4A 1CO7E 1V2VT 1O5FH 1EJAA 1D4PB 1GHZA 5EW2H 1JWTA 5DGJA 4NZLA 1DFPA 3TLOA 3AAUA 4X0WU 4X2XA 1D9IA 1BCUH 1MBQA 1H9LB 1ZSLA 1P2QA 2RA0A 2RCEA 1THSH 4JK6A 1HNEE 1AHTH 5C1YA 1O5EH 2FYRA 3M61U 1NO9H 2ZGJA 1HJAC 1AKSA 3SV8A 1VCWA 4D9RA 3SU4A 2BMGB 1OYQA 1ELFA 2TIOA 3SNAA 2BVSH 4Q2KA 5GDSH 6CHAC 1CQQA 1O3AA 1C1UH 1SOTA 4SGBE 3VB5A 1B5GH 2A45B 1V2MT 4J1YA 1GMDF 3SQEE 2WPJS 2PKSB 1GHYH 1B0EA 1FONA 1UTMA 3TU7H 2G51A 3RXLA 2GVFA 1CT0E 8GCHG 4IC6A 3U98H 2PTCE 2GV7A 2V3OH 3ENSB 3VGCC 4GHQA 1N1LA 1TX8A 1O37A 1NS3A 1QJ1B 1FLEE 1UMAH 1OWDA 3UR9A 1PQAA 1UTOA 3JZ2B 3LC3A 2SFAA 3LJOA 1C5YB 1O0DH 1XM1A 1KLIH 2ANMH 1HJ8A 1KXDA 3UOUA 1TA6A 1RTFB 1K1MA 3ZZ5A 1A61H 1TA2A 3P6ZB 4IBLH 3SV2H 1MBMA 3F9HA 2AERH 1O2HA 1O5CB 2Z94A 3D23A 3SOSA 2H5DA 1O2WA 4AZ2B 1QB9A 4ABEA 1C9TA 4ISIH 1NRRH 1B7XB 4CHAC 3QZQA 2BLWA 2FLRH 4X1SU 2FYQA 1O2RA 1F0RA 4YLUA 1RTLA 3SNCA 3L3TA 2A2XH 1MAYA 4DOQA 1QTFA 3VB3A 1Y5BT 1ZR0A 2BXTH 3LGWA 1OYTH 1GJCB 4H6TA 3E16B 4WJG2 4NA9H 4ABAA 4JMYA 3GYMA 3F1SB 3BSQA 4Y8ZA 1KXFA 2Z9IA 2FZZA 2BD4A 4GHTA 3K9XB 2CGAA 1D3TB 1RJXB 4AB8A 2FI5E 3B9FH 3FP6E 5C1XA 2QGRA 1SSXA 5CE1A 3MI4A 1QJ7B 1Y59T 1GGDC 1C2HA 1GJAB 4DIHH 1UCYH 2OBQA 4F49A 5FHTA 4K1TA 3F9EA 2FM2A 1GBJA 1PPBH 2P94A 1OKXA 4I33A 3PMBB 2O9QA 1LPZB 2VWLA 1CA8B 1YPMH 5A0BA 1SLXB 1L4ZA 2GD4B 1KDQB 2ZO3H 3PLBA 5EPYA 1EPTA 1UHBB 3BG4C 1FAKH 2VVCA 5CHAB 1UVOA 1C2LA 1O3HA 1XUHA 3O8BA 1QB6A 1ZPCA 4B1TA 1GCTC 3Q3YA 1HJ9A 3UTUH 1OXGA 1XUIA 2H9TH 3BTTE 3I78A 4ISHH 1UTPA 1V2KT 5EXMA 1ZGVA 1A3BH 1GVKB 4MPXA 2UWLA 3MTYA 2ZNKH 1OSSA 1AIXH 2P3TB 1FV9A 3GY6A 1GDNA 1O3IA 2AS9A 2J38A 1J14A 1GBBA 1P9SA 3RM0H 1LHCH 3MMGA 1C9PA 2ASUB 1ANCA 2FWWA 1EOLA 2ZFSA 3FANA 1SC8U 4IMQA 4O03A 5E2PA 1LHDH 2ZU3A 4B74A 1QY6A 3MOCA 2ZCLP 1FY1A 1AO5A 3LU9B 4I8KA 2ANWA 3ZVDA 1NTPA 2FOCA 3RDZA 3U9AH 1PQ7A 2R3YA 2Y7XA 1GVLA 5EGMA 5BPEA 3UOPA 2CHAB 4CBOA 1NRSH 1G3DA 3HGPA 1G2MA 1ESAA 1PPGE 2AMDA 2H2ZA 3ZZBA 3MU8A 4TYDA 1E34B 1ZOMA 1C2EA 1IQKA 1Y3VA 4Y7AA 3RXBA 4FUBA 1NT1A 3NUMA 1VCQA 1EB2A 3MH6A 1AVXA 4X2VA 2ZHQH 2YOLA 1BRUP 1CE5A 1GMDG 2AGIX 3EA9A 1EATA 1BBRK 1FIWA 1A5IA 2VWMA 4XDEA 2WUBA 3QWCH
chains in the Genus database with same CATH superfamily
1FDPA 1V2RT 2STBE 1TBZH 2W7UA 1O35A 1NPMA 2BY9X 2Y81A 1FY4A 1ID5H 4UONA 1SG8B 1SGTA 1GMCF 2D2DA 3GY4A 1LQEA 2BY8X 1FXYA 2HALA 2HVXA 1Y8TA 2P8OC 2AMQA 1AFQC 3RLYH 1W14U 1AU8A 2KZ4A 1TGTA 3AK5A 1H4WA 1IOEA 2ZKSA 1ABJH 3SU1A 1FN6A 3FOAA 3P8NA 1FY5A 2UUYA 1ELDE 4HGCA 3DFJA 2ALVA 4ZUHA 3PO1B 4ABIA 4XD7D 1ZSJA 2ZP0H 2JDID 5L6NH 2J2UA 3G01A 4UEHH 1QNJA 1ZMLA 1BA8B 1TX7A 2ZDNA 3H09A 3RXVA 3UWJH 1GBKA 1VJAU 2J9NA 5JBAS 4MVNA 2BX3A 1P09A 3DHKH 3RC4A 2IPHA 2BB4A 4Y79A 1YPLH 4O9VA 1W0JD 2PW8H 3P8OA 5H4IB 4MPVA 1Z71A 1GI7B 3P70B 1KTTB 4CRBA 4DG4A 2J98A 4XFQA 3EA8A 1O5GH 2BQ7B 2EI8A 4WF8A 1DPOA 1EUFA 1EKBB 2FOGA 4TPYA 4NSVA 1PQ5A 1WDIA 4CR9A 1ESBA 1NZQH 3M5LA 1GJ5H 5EU8A 1LPKB 2CMYA 4Y11E 3SUDA 5C0TA 1AE5A 4NIYA 1TB6H 2TGDA 2PTNA 2R2MB 5AHGH 1FAXA 4Y8XA 3OEED 1AGJA 4FU8A 4CH2B 1YY3A 4D8NA 1MU8B 4WMDA 2HVYB 1O3OA 2ZF0H 1TPPA 1PYTD 1BIOA 2VGCC 4NIWA 4FVDA 2ZA5A 3A7VA 3MU1A 4B2AA 2JJ2D 2Z7FE 2WPHS 3A8CA 3JZ1B 1TMUH 1TOMH 3KHVA 3HK6B 1EZXC 1DT2A 4K1EA 2F9OA 3PYHA 2WV4A 3EA7A 4AG2A 1O3FA 3RXOA 2Y82A 5A8YA 3QLPH 2Y5FA 4HG6A 3V12A 5K0HA 1TIOA 2F9PA 2ODYB 1EAXA 4U01A 4GVUA 3K6YA 4U2WA 2CF8H 1ELVA 3TJNA 4YESB 4I32A 4B2CA 1GBIA 5LPFA 2EEKA 2XTTB 2ZEBA 1TE0A 4YTAA 3V3MA 1O3GA 3LIWA 1QA7A 1ELTA 2ZDLA 1AWFH 3VXFH 2FX6A 2FTLE 2PGQB 1H8DH 1D6WA 3BF6H 3DSOA 1TX6A 3D49H 1QA0A 2ILNA 2BHGA 2FI3E 4NZQA 3P92A 1HAXB 5K7RA 4KTSA 4ISNA 1C4V2 2V6NA 3RXGA 4I86A 3ZVFA 1NRPH 4CBNA 2W26A 4RT0A 3TGIE 1Z8GA 1VCPA 1AZ8A 3LGYA 1IQMA 1Y3WA 2Y80A 2RDEA 5FX5A 3M35A 8KME2 1ZYOA 2VH6A 2GKVE 2B8OH 4BAHB 1G3BA 2FPZA 1TBRH 5JB8S 3K65B 1D3QB 4FXGH 1NESE 1TNHA 1O2VA 1IAUA 5T6GA 1KXCA 2A5AA 2B9LA 1DS2E 2OUAA 4YT7H 3M3TA 3PLKA 3BTWE 1DY8A 1THRH 3GS9A 2HLCA 1YPGH 1NU7B 2A7JA 1UCYK 3VB4A 3MNCA 3E0NB 3GY3A 4MNXA 3RXUA 4FUCA 4RSPA 3NWUA 3MNBA 1A0HB 2WPKS 3MYWA 2G5VA 2H5CA 2PKAB 1BHXB 1JRTA 4FU7A 1C2FA 1SFIA 3SJOA 1GMCG 1TPAE 4I8LA 1N8OC 3S9CA 2P93A 2K8IA 1SHHB 5B6OA 1ZTJA 3A82A 4AN7A 4AGKA 2WSSD 1MZAA 3F0OA 5T6DA 1BRBE 1LVYA 3SUFA 2PUQH 3TNTA 1QL7A 3F9FA 1BBRE 1LTOA 3ZZ7A 1AMHA 5F8TA 3IWMA 3DUXH 5HYOA 1OWJA 1E0FD 1HYLA 3OU0A 3TNSA 1TGSZ 4AOQA 1DM4B 1FX0B 1DVAH 3B23B 1JIRA 1L1NA 1O2OA 4MPUA 4NA7A 3KGPA 2GTBA 1BOQA 4BOHA 1SQOA 1W0YH 3ZIAD 4X8VH 2EI6A 1NROH 2ZFQH 1LVOA 1BTUA 1F0SA 3BTME 3TJVA 4D76A 1HFDA 1Z6JH 2NU4E 4K5ZA 3T25A 4Y6DA 1FJSA 5C5OA 8GCHF 1O30A 2UWPA 1MAXA 1F5LA 2WPIS 1UVSH 3A8DA 1VITF 2J34A 1GJ4H 2AIQA 1T8LA 3PTNA 4X8SH 3T29A 1OWEA 3W95A 3BTKE 2ZU4A 3RU4T 2RA3A 1W8BH 5A2MH 3RXKA 2PGBB 1A7SA 1CVWH 1PPEE 1WAYB 1WV7H 3SO3A 1QJ6B 3PV2A 1J8AA 3IG6B 3U69H 3PTBA 1MMJN 2GMTC 3A7WA 3FP8E 1YWUA 4Y71A 1EFRD 2BZAA 1C5OH 1GI2A 1H1BA 1OP0A 2SGDE 5C2ZA 2XBWA 1K9OE 3MH7A 2QN5T 1DICA 1RGQA 1YC0A 3UREA 4AYVB 3GOVB 1RIWC 2O8TA 2WINI 2XNIA 4FUIA 5E0HA 1EASA 1OX1A 1AKSB 5I46H 2ANKH 4CR5A 3ZZCA 1TAWA 4F55A 1P57B 2V7QD 1HDTH 2K1QA 2YMSD 1C1VH 2EY4C 1VZQH 3PRBA 1ZPBA 2VIDA 4UFDH 1AUJA 1O2GH 4GLYA 2XNDD 1BJUA 2G52A 2J4IA 2TPIZ 2XYAA 5FBIA 1HLTH 2M2AA 1AWHB 1QBNA 2O8MA 1AI8H 4WY3A 3UAIC 2W5EA 3UPEA 2KX4A 2KAIA 1EX3A 2F4LA 1O3CA 4XOJA 3ATLA 3QTVH 1ELCA 4BAKB 2LELA 2OK5A 3SNDA 3LH1A 3SV6A 1V6DA 3ZVBA 4K8YA 1GBCA 3KNXA 2OBOA 1OS8A 2JH6D 1ANBA 4GAWA 5AF9H 3LDXH 3QTOH 4HZHA 4LZ1H 4X6NA 3CS7A 2BLOA 1FY8E 1DOJA 2Z9LA 4Q63A 2GT7A 3PV4A 4ZAEA 4A1VA 2RFKC 5EODA 1AE8H 2HPPH 1JMOH 2LNCA 3AVZA 2P59A 4U30A 2OXSA 2NU3E 3QZRA 1GMHF 1WOFA 2O8UA 5HGGA 1AVWA 1J9CH 2FOFA 2Y7ZA 2PKSC 4AFSA 1DDJA 1ZLRA 2Z9KA 3MHWU 4NIVA 1LDTT 3UFAA 2V3MA 1ORFA 3RMMH 9LPRA 2ODQA 1WU1A 4CRDA 1RRKA 2KCYA 1ZPZA 4A5TS 3ATMA 1LO6A 4YXWD 6LPRA 1QB1A 2Q1JA 2FX4A 1O3MA 4CH8B 3KQDA 3H7TA 2AFQB 3RLWH 1CHGA 5ESBA 1SLUB 1O3NA 2O8LA 4X8UH 1P2JA 1DXWA 1YCPM 1MTNC 3GISB 5F8ZA 2GV6A 2QAAA 1HRTH 1W3CA 1BTHH 3HATH 4INLA 4CRCA 1D6RA 2BY5X 1GJ8B 3SJIA 1TNIA 5FCRA 2FOEA 1EQ9A 1LVMA 2BDIA 1FPHH 5DP5A 1EXFA 2ZCHP 1FPCH 3LH3A 2ZFRH 1CA0B 1SGCA 4A1XA 2BVRH 3TITA 5C0UA 1P2KA 2AHME 1T8NA 1O32A 3AW1A 5DKMA 2C8YB 1GHBF 3GCOA 2EA3A 1UCYE 3SNEA 5GWZA 4Q7XA 2WZQA 2GT8A 3LOXA 1WBGB 2ALPA 2FOMB 5EQRA 4JYTA 1E1RD 3AAVA 1C5ZB 3VPKA 1SVPA 3R0FA 1AQ7A 2PV9B 2Y6TA 4HI3A 3CP7A 1D3PB 3Q00A 1NFUA 2A1DB 3KL6A 3NXPA 1HAZB 1S6LA 1O2XA 4VGCB 3RXCA 4Q7ZA 1TOCB 1O2LA 1LCYA 1VITG 4JZ1A 2KCPA 1EJNA 1YF4A 2ZHWH 2VH0A 5JBCS 4X6PA 2GP9B 1F5RA 1TALA 1V2UT 2PLXA 5C17A 1JXPA 2ZZUH 1Q3XA 3TGJE 1SGQE 1O34A 1QIXB 4TT3D 2G00A 4X1NU 1YPJH 1BMFD 2D26C 1KLTA 4YOIA 3ZVAA 4WMEA 2ZGCA 5EJZA 2G81E 5EW1H 4DJZB 4Y8YA 5CHAC 2VVVA 2BD2A 3M7TA 4OGYA 1O3LA 2FEQH 2SGQE 5TCAA 3A7YA 2F9VA 3N7EA 1JOUB 3Q77A 1AD8H 4ZKSU 1O3PB 5J4QA 1GDQA 1ARCA 2HNTC 4X2WA 1WCZA 4X6MA 5EXNA 1ZRKA 2VU8E 4ABJA 2V0BA 1AFEH 5A0CA 4I8HA 4AYYB 1TWXB 2XW9A 1P11E 4Y10E 5HIYA 3PRDA 2FXRA 1TQ7B 2ZGHA 5IYTA 1HJAB 2OCVB 1HAVB 3C1KA 3F6UH 3VB7A 2UUKB 1E79D 1EZSC 1F5KU 1GI0A 4OS6A 1GG6B 1V2ST 4JYVH 1L1GA 1O3KA 2PSXA 1SGEE 6CHAB 1KIGH 1CU1A 1C1RA 1C1MA 1P10A 1FI8A 1HAOH 3EGKH 4YO9A 1YBWA 2BDBA 2BY6X 2W3IA 1H9IE 2BDCA 2ESTE 2CHAC 2WYJA 1C1SA 4FUGA 2XC0A 2VWOA 2UUFB 1O2SA 2PHBA 2YMSC 2CXVA 1O36A 1WYKA 3SJ8A 1A1RA 3KYGA 1IHSH 3SU2A 1GMHG 1BRAA 2XC5A 4A7IB 3T27A 1TLDA 3VGCB 3O8CA 2SGAA 1HGTH 1C5MD 1SGRE 1MUEB 3BEIB 1S85A 4WH8A 1VITH 1C5TA 1JRSA 1FIZA 2W6ID 3TK9A 3M3SA 3KQBA 3T62A 2GJGA 1COWD 5E0JA 2M5TA 1IQGA 2A32A 2O8WA 1GHXH 4LOYH 1O3DA 1XUJA 1SQTA 2VWNA 3MO6A 4YZUA 2A4OA 1T8OA 2VIOA 3KCGH 1MKWH 1PPZA 5GJ4B 2A7HA 1V2WT 3T5FH 5HKKD 1SGYE 4R8TB 2GCHG 3PO1C 4CHAB 2PWXA 1LHGH 2WHXA 4NSYA 1AN1E 5HXFA 3GCTG 2Q6DA 3Q76A 4HFPB 3RXFA 1CHOF 3KF2A 3QX5H 4AFQA 2G5NA 9ESTA 1K21H 1XUGA 3E1XB 2XCFA 2BD8A 1WTGH 1C1PA 1SLVB 1GHBG 1V2TT 3DD2H 2WPLS 1P05A 3C27B 2LPRA 5C67A 3SZNA 4GSOA 4INHA 1CT2E 5GNDA 1BRCE 3OY6U 2FS8A 1TRYA 1SGIB 5AFZH 3ZZ6A 1FQ3A 1ZHMA 1GGDB 3SBKA 2VJ1A 1QR3E 3RM2H 3T28A 1P06A 1C5PA 1T8MA 1K2I1 2H9EH 1G32B 1U6QA 2A4QA 1Q2WA 2F9NA 3F9GA 4UFFH 3LPRA 3UNQA 4XRNA 1TNJA 3TJOA 2P95A 4Q80A 3RMLH 1HV7A 1DWEH 1WTHD 2F9BH 2BDAA 2D1JA 3DA9B 3R3GB 3F0PA 1P2NA 1H8ED 2XBVA 1HAYB 1OOKB 1ZRBA 4A6LA 3TJUA 1IQFA 3I77A 2A0QB 2AH4X 2ZWLH 5L2YH 1DWBH 4OS1A 1GJDB 1Y3UA 4OGXA 5CHBA 1W2KH 5EPNA 2J95A 3QN7A 1A4WH 4D9QA 4Z6AH 2G8TA 2BXUH 2C8ZB 1GDUA 1O2MA 4LK4A 3Q3KA 6GCHF 3V0XA 3M7QA 1SKYE 2BD3A 2PSYA 1P8VC 3KQCA 1O2IA 4RT1A 3S7KB 3QGJA 1A2CH 3RU4E 2WYGA 3SHCH 1KYNA 4ZKNU 3TH3H 4IS5A 1F7ZA 2KFWA 2HNTF 1Z8RA 3A87A 1O33A 4NCYA 4GPGA 1WUNH 2BLVA 1ZTLA 2Y5HA 1FNIA 3M5NA 1VGCB 1KDQA 2OINA 1MCTA 4DURA 2WV5A 2BYAX 7KMEH 2QF0A 2Z6BD 1UHBA 2ZHFH 3UNRA 1O3EA 5DK1A 1VKYA 4ZCNA 1SGDE 1Y3YA 1EZUC 4CRFA 1DLEA 3E91A 1XXDA 1NFXA 1S81A 3WWFA 3GDUA 2BM2A 1UTLM 1O5BB 3RXDA 3SQHE 1K1PA 1O3BA 4R0IA 2TRMA 1N6YA 3BTEE 2FIRH 4P02A 3BTDE 1NU9A 3EAJA 2Z9GA 1MCVA 2QV1A 4RI0A 4B2BA 2OTVA 4TWYA 1GHVH 1TQ0B 1QCPA 3SUEA 3ESTA 4BAMB 1GHWH 4XBCA 2PUXB 5DJ7A 3FAOA 1O39A 2C3SA 3GY7A 3RXSA 3A7TA 1C5VA 1N6XA 2JETB 4NGAH 3SHAH 1SGNE 1C2GA 4MTBA 4NIXA 2BZ6H 2ZU2A 1C2DA 3VB6A 5DP3A 2P8OB 2IJD1 4GCHG 2HGTH 5DG6A 5L30H 3ATKA 4YLQH 5F53A 3ZV9A 1A46H 1FUJA 1SL3A 2QXIA 1BUIA 2GZ9A 1G30B 5EOKA 4YOJA 1C2MA 3CS0A 2GCTB 2D8WA 1ZGIA 2BY7X 2ZTYA 3T26A 1J15A 3EE7A 1ZJDA 2FS9A 1OWHA 1BMLA 1J16A 5EQQA 2ODPA 5LH8A 2FOAA 1ZMNA 1O2JA 2QF4A 1ZJKA 2A2QH 4K3JA 1XUFA 3A8AA 2R3UA 5DSFA 2SGPE 4XBDA 1CHOG 2UUJB 3P95A 3KYFA 2DUCA 3M5OA 5FCKA 1B0FA 4I7YH 2ZIQH 3U8TH 1NM6A 2G4TA 2VBCA 1YLDA 1SFQB 2Y5GA 3LKWA 1XXFA 4UE7H 1C1TA 3ZV8A 4IN2A 1EB1H 3MNXA 1P0SH 2ZDVH 2FOBA 3UUZA 1BT7A 2P3FH 2TGAA 3PROA 3U1IB 1HB0B 4A92A 1BTPA 3HKIB 2VIWA 3U8OH 1AY6H 5I25A 1AB9B 2PFEA 4CREA 2YNAA 3VXEH 2ZTXA 2KAIB 1S6HA 4KELA 3BTGE 3TPIZ 1E37B 2F3CE 1V2OT 1IQEA 3D65E 4ASUD 3NKKA 2H6MA 3A89A 1CGJE 1UTJA 1ZHRA 2BTCE 3URCA 3GCHC 1BQYA 1FY3A 2CJIA 4X1RU 1C1OA 1ETSH 3RXJA 4GUXA 2QCYA 1E36B 5LPRA 5EG4A 4AG1A 1SR5C 1C5RA 1O31A 2B0FA 1G3EA 1NC6A 1VR1H 4JZDH 1JBUH 2J92A 1MKXH 1C5NH 6GCHG 1P3EA 1Y5UT 4FOUC 1E1QD 1YGCH 3GCNA 1ELGA 3UQOA 4KGAA 3SJ9A 3V13A 5T1VA 3NK8A 2BQWB 4BAOB 1MKWK 4E7NA 5C3NA 5ABWA 2CV3A 5AVDA 1NBME 4IC5A 4BTTB 2LP6A 3GICB 3PMJA 1GBEA 4CRAA 3SGAE 4IMZA 5PTPA 3K6ZA 3ATWA 5E2OA 1SB1H 5A0AE 3P8GA 1O38A 1P04A 1Z8JB 2VIVA 1WQVH 1C2IA 2AYWA 1QQ4A 1GJ7B 1O5AB 4X2YA 3RMOH 3T2NA 2ZU1A 1NFWA 4J2YB 3V7TA 1Y3XA 6ESTA 1CBWC 1NFYA 4NA8A 3FZDA 4ABHA 3SI3H 5GPIB 1GJ9B 1W7GH 4WWYA 5IK2D 1OP8A 1CT4E 1ETTH 1THPB 4RKJB 5T3HA 1F0TA 4ISOA 3HKJB 1P2IA 4I31A 4BAQB 3ZVEA 1UTKA 5FL7D 1WQSA 1W13U 2HPQH 1C1QA 1HXFH 1C5WB 2FP7B 1P9UA 2FMJA 3A88A 4TPIZ 3RXTA 1DANH 1RD3B 3ODDA 1N8OB 1AVGH 3A84A 3RXEA 4MDSA 2IJOB 3TGKE 8LPRA 2F91A 3PB1E 3PWCA 2QXGA 1DSUA 2GZ7A 4ZHAA 2CK3D 1GVZA 2ZC9H 3RXQA 4CRGA 4I8GA 1Y5AT 1TPSA 3E3TA 1QRWA 4TWWA 1C5QA 2WV9A 1HAIH 3M36A 3WY8A 3OY5U 4JZIA 1EAWA 4INKA 2R2WU 4K2YA 1CA0C 3OE7D 4LZ4B 1K28D 4YOGA 1TONA 1H8HD 1YM0A 1UTNA 2L6OA 3ATIA 3DFLA 3OSYA 3NPSA 4B71A 3GY2A 1IQJA 2VB0A 2EQNA 5J4SA 2BD9A 2PKAA 3PMAB 3OEHD 3ZZ3A 3OTPA 1BTYA 3CENA 1TNLA 2F9UA 1YLCA 2THFB 1YLNA 1NRNH 3SGQE 1E38B 2ZGBH 2W7SA 3BN9A 3UQVA 3NCLA 4BXSA 3MO3A 2SGEE 5JDUB 2Z9JA 1IQNA 1ELAA 1LMWB 2CF9H 4H4FA 2V3HH 2AEIH 1BTXA 3A8BA 4WXVA 3UWIA 4YM9A 2GMTB 3Q3XA 1YPKH 4X6OA 4MQAA 3RXHA 1O2NA 2FOHA 3VEQB 2FESH 1S5SA 3BTFE 2F43B 3MU5A 3L33A 1D3DB 1GPZA 4ZXXH 4B73A 4Y7BA 1BB0B 3LGUA 1FZZA 3UNSA 1LHFH 1A3EH 1GI4A 3GY8A 2GCHF 3S7HB 1L4DA 4K60A 1KSNA 3GCTF 1G3CA 4D7FA 5GCHG 5ETXA 7LPRA 1XVOA 1BMNH 3ZZ8A 2R9PA 4RN6A 1XKBC 1YPHE 1J17T 1K1JA 1RFNA 1S6FA 4H6SB 1TNKA 1EPTB 3QO6A 4I8JA 3ZVCA 2KCOA 1ESTA 1A0JA 1KXAA 1MTWA 5DPAA 1GJ6A 2B7DH 1LHEH 2C90B 3WWBA 4UDWH 1HIAA 1OHHD 1KTSB 5AFYH 1O2YA 5DP6A 1C2KA 2ZU5A 1C4Y2 1DXPA 3BIVH 3N7OA 2KCAA 2QA9E 1L0ZA 4OS4A 1GG6C 3EQ0H 4KTCA 1KMHB 1T4VH 3SORA 1SGFA 4AFUA 5DP9A 2XWAA 4ZKOU 3U8RH 1DSTA 4DT7B 1HXEH 1TMBH 3P8FA 5A09A 5BRRE 4IW4E 1S83A 2ZDKA 1LKAA 3FFGA 1PJPA 1XVMA 3A86A 1DUEA 1GBTA 2DE8A 1E35B 4M9FA 4JYUH 3RXPA 3TK6A 1SOZA 4X1QU 2QXHA 4PROA 3UB0A 2JJ1D 1MD7A 3STJA 4A1TA 1QGFA 2G55A 3PM3A 3RUOA 3QK1A 4WXIA 2ANYA 2FI4E 1G9IE 5CMXH 5LGOA 1MTNB 3MU4A 1F2SE 1K1LA 1GBDA 2ZG0H 3RXRA 2ZGXH 1SQRA 1TABE 1DWDH 3S0NA 1P2OA 4MPWA 4M7GA 1TRNA 5F03A 3FP7E 5A8XA 1DE7H 1P2MA 4Y0ZE 1ZMJA 3OFND 1EP5A 4NFFA 4DGJA 4P00A 5T6FA 2A4RA 1C5XB 1O2QA 1YKTA 3FO8D 1EAUA 1SBWA 2I6SA 5JPMH 3S69A 1O2KA 1HAGE 2XCNA 1IQIA 2HRVA 1DWCH 1MKXK 3A7XA 4X1PU 5FXLA 3GDVA 1GI8B 3SU3A 2A4GA 3O8DA 3GY5A 2HWLB 3QGNB 1SI5H 4JZEH 2GDEH 4ZH8A 1GWAA 2G4UA 1UTQA 3F2FA 4BNRA 3N99A 2VIQA 3VFEA 2FDAA 1P12E 1IHTH 1T4UH 2QE7D 2XRCA 5IDKA 3SU5A 4DCDA 1WSSH 3LGVA 1T7CA 4GCHF 3PMHB 3SYJA 2ZFPH 1KY9A 5FPTA 1NY22 2J98B 3UY9A 1GI1A 4BTUB 2WPMS 1QQUA 5C94A 1C5UA 2FO9A 1KXEA 2SGFE 1ELEE 2XXLA 3PLPA 2XBXA 1MABB 5C5NA 3MH5A 2JKHA 1RS0A 2STAE 5TCCA 1S0RA 1UO6A 4ACAA 2ZDAH 5C20A 4ZXYH 4O3TA 2QXJA 3PWBA 1IQHA 2OP9A 1W7XH 1QFKH 3EDXB 1F0UA 2EC9H 1INCA 1S0QA 4NFEA 1EP6A 4Y76A 1C1WH 1SGFG 4JZFH 2BD7A 1GI6A 2VINA 4U32A 4ABFA 2QYIA 5L2ZH 3UIRA 2AMPA 1XMNB 2FLBH 3MFJA 3SI4H 3UR6A 3OTJE 3H7OA 1YYY1 4MLFB 4DVAU 1VGCC 1YPEH 2PP6A 1PPHE 3BTQE 5HM2A 4F4OC 1YP9A 1P3CA 1TFXA 1MTSA 5JBTA 3L6PA 3S9BA 1CSOE 2EI7A 5FPSA 4NG9H 4ZHMU 1OP2A 1V3XA 2QIQA 3EYDA 4AFZA 2PR3A 3RMNH 1Z1IA 3ZZ4A 2HOBA 1LPGB 4IGDA 1LKBA 5HMAA 1ETRH 4IN1A 1YCPH 3SU6A 2Q6GA 3VG8A 4ZHLU 1HAPH 2YMSB 2XBYA 4MNVA 3O8RA 3M37A 1UVTH 5DP4A 3STIA 1G37A 3BG4B 3RXIA 2SNVA 2ZCKP 1P02A 1SHYA 2AIPA 2A5KA 3ITIA 1XX9A 1ZZZA 1UVUH 1O2PA 2ULLA 5EQSA 1T32A 4FU9A 3AASA 2ZDMA 1GI3A 1GCTB 4X8TH 1RTKA 1BZXE 3ZVGA 2OC0A 1HAVA 2JETC 3LC5A 3EE0B 3KIDU 3SZEA 4DT4A 1TGCA 3E90B 4BANB 5TJXA 1W11U 4ESTE 3BV9B 4UFEH 1K0HA 3E6PH 1PPCE 1GBAA 2H1UA 3KEEA 7GCHF 3H5CB 1O5DH 3OAAD 1YPHC 2GZ8A 1BITA 2ZPRA 2NU1E 2GCTC 2BD5A 1V2PT 3SN8A 4KP0A 1RXPA 2A5IA 1MU6B 1P01A 5DO4H 1BMMH 3RP2A 1Q31A 1GHAF 3RU4D 3S9AA 4E05H 3MO9A 4ACBA 4ABDA 2NU2E 2W3KA 2BQ6B 1TRMA 2NU0E 4E7RG 3LJJA 1TPOA 1PQ8A 2AGGX 1QZ8A 4Z1MD 2WUCA 2J97A 4MNYA 3A80A 1A0LA 1C1NA 3NRLA 1TBQH 4K8BA 1UJ1A 4WH6A 2ZQ1A 3GDSA 1XKAC 4QT8C 1H8IH 5JYIA 2P3UB 7ESTE 1GBHA 3BEFB 4B76A 3F2HA 4WVPE 1AB9C 3DSPA 2ZI2H 1AFQB 4ASHA 3LT3A 5LPEA 1CGIE 2JH0D 1BJVA 1ZHPA 4KKDA 5EXLA 5ESTE 4ZKRU 2ZECA 3LONA 2C8XB 4FVBA 1VJ9U 1JIMA 4TSFD 5CDFE 5JBBS 4D7GA 3TIUA 2VNTA 1BMAA 1GBLA 3TH2H 1BTZA 2OQUA 2ZHEH 2JH5D 1OWKA 5DP7A 3M7UA 3D62A 2R0KA 3ZYDA 3CNRA 2KM0A 2OC7A 1O2TA 2BVXH 1MZDA 2P16A 3ZYEA 4O3UA 3URDA 1GL0E 3ELAH 3QDZB 1DX5M 1V2JT 3BG8A 2QF5A 4WMFA 3M3VA 1M9UA 2ZFFH 2ZPQA 3BTHE 1ANDA 1G36A 1MH0A 5HIZA 2OQ5A 1S84A 4JCNA 5G4BA 3MH4A 1NN6A 5DP8A 2J94A 2RG3A 1QL8A 1S82A 1H9HE 3AW0A 3KQEA 4Q7YA 5GXPA 1LQDB 4FUEA 4ISLA 2VVUA 4DIIH 1MTVA 4MG3A 2GX4A 1QBVH 3OYPA 1GCDA 4FUFA 1C2JA 1EOJA 1C5LH 3A81A 1TGBA 2BLQA 3LGIA 1FN8A 1CGHA 3BIUH 4BXWA 1PPFE 1AZZA 3SJKA 2GGVB 1HPGA 3TK5A 1GI5A 2IN2A 2QY0B 3SNBA 2A31A 1MD8A 2VGCB 3K2UA 1BDAA 1TGNA 3PV5A 1QHRB 5JB9S 1SLWB 1ACBE 3ODFA 3QUMP 3MWIU 2B5TB 3DT0H 4TY7A 2J5UA 3A7ZA 1Z6EA 2QF3A 1W0KD 3F2GA 4TY6A 3FVFB 3P17H 4DW2U 1KLJH 5GCHF 1C4U2 5F6MA 4HTCH 4LXBH 1A5HA 5F8XA 2Z3DA 1F92A 2V35A 1ABIH 3RXAA 1V2LT 3HPTB 3HK3B 3FZZA 4SGAE 1EJMA 1L1JA 1O2UA 2VIPA 2H9HA 1OWIA 3SW2B 3IITA 4OM9A 2IPQX 3A83A 4K69A 4NWLA 2BDHA 4ZROA 2BOKA 5KEDA 1OPHB 2TGPZ 1GI9B 3HGNA 7GCHG 1W10U 8ESTE 3M5MA 1EAIA 4H42U 3LGTA 5B6LA 2FTMA 4B75A 1NRQH 2OC1A 2HNTE 1X7AC 1FMGA 5SGAE 4FUHA 3BEUA 5FX6A 1GJBB 3RXMA 3E8LA 1DITH 4MNWA 3RC6A 5EJ1A 1HAHH 4OS7A 5FPYA 1T31A 1MTUA 4AORA 4UD9H 1K22H 1GHAG 2BDGA 1IQLA 2BDYA 3N7DA 2TGTA 3A85A 4ABGA 1XUKA 1GL1A 2UWOA 2GDDA 4RKOB 4Y0YE 1ZSKA 2OLGA 1NBMD 1UK2A 2FODA 1TMTH 2C4FH 1ARBA 4KTUA 3TVJB 1V2NT 1Z7KA 3SU0A 1SMFE 3MU0A 4BTIB 5E0GA 3DSGA 3F3BA 4ABBA 3NZIA 3B8JA 3SUGA 2I6QA 1MQ5A 1A5GH 1YCPK 1TNGA 2Z3EA 1MQ6A 4DY7B 3GCHB 3I29A 2F83A 1V2QT 2QC2A 4UFGH 4XBBA 3KN2A 2NWNA 1HIAB 3MNSA 2SNWA 4K1SA 5E8EH 5KECA 1W12U 3ZZDA 3U1JB 2YNBA 3W94A 2CN0H 1BHXF 5EJLA 1UVPA 1SGPE 1QRZA 2XC4A 3W1EA 2JIZD 1K1OA 1O2ZA 1HCGA 1AUTC 1Z1JA 2ZPSA 5HM9A 2L74A 2ZTZA 2R0LA 3RC5A 1HUTH 1Z8IB 2WPDD 3SGBE 1QBOA 2XWBI 3KQ5A 4JK5A 3GYLB 2OC8A 3ZZAA 4XSKU 4Z0KA 4ZMAH 1SPJA 4O97A 5A8ZA 1ZTKA 1EPTC 1TYNA 3SV7A 5FAHA 1O3JA 1UW7A 4OS5A 1UK4A 1L2EA 2BOHB 1G2LA 2OD3B 2ZFTA 5FBEA 1C5SA 1GBFA 1K1IA 4OS2A 2ZQ2A 4YT6H 1EZQA 4XE4A 1PFXC 1BBRH 1QL9A 5C1UA 3SV9A 4THNH 1ANEA 1ELBA 1DLKB 4AX9H 2C8WB 3DCLA 2TBSA 1K1NA 1BTWA 1PYTC 2DE9A 2Q6FA 2Z3CA 2AGEX 4E06H 4VGCC 5GIBA 4FUJA 2RDLA 1CBWB 3TH4H 1UK3A 2C93B 1GBMA 3ZZ9A 4AB9A 2ZHDA 2IOTA 2A7CA 1RIWB 4AC9A 1P03A 3E0PB 1W0ZU 1DY9A 4NWKA 3F68H 4AGJA 3U28C 1LVBA 1DUAA 1QRXA 1SQAA 3OX7U 4FUDA 1KXBA 1QURH 1HBTH 2BX4A 1CO7E 1V2VT 1O5FH 1EJAA 1D4PB 1GHZA 5EW2H 1JWTA 5DGJA 4NZLA 1DFPA 3TLOA 3AAUA 4X0WU 4X2XA 1D9IA 1BCUH 1MBQA 1H9LB 1ZSLA 1P2QA 2RA0A 2RCEA 1THSH 4JK6A 1HNEE 1AHTH 5C1YA 1O5EH 2FYRA 3M61U 1NO9H 2HLDD 2ZGJA 1HJAC 1AKSA 3SV8A 1VCWA 4D9RA 3SU4A 2BMGB 1OYQA 2W6JD 1ELFA 2TIOA 3SNAA 2BVSH 4Q2KA 5GDSH 6CHAC 1CQQA 1O3AA 1C1UH 1SOTA 4SGBE 3VB5A 1B5GH 2A45B 5EIYA 1V2MT 4J1YA 1GMDF 3SQEE 2WPJS 2PKSB 1GHYH 1B0EA 1FONA 1UTMA 3TU7H 2G51A 3RXLA 2GVFA 1CT0E 8GCHG 4IC6A 3U98H 2PTCE 2GV7A 2V3OH 3ENSB 3FN8A 4FETA 3VGCC 4GHQA 1N1LA 5DN6D 1TX8A 2KR7A 1O37A 1NS3A 4F48B 1QJ1B 1FLEE 1UMAH 1OWDA 3UR9A 1PQAA 1UTOA 3JZ2B 3LC3A 2SFAA 3LJOA 1C5YB 1O0DH 1XM1A 1KLIH 2ANMH 1HJ8A 1KXDA 3UOUA 1TA6A 1RTFB 1K1MA 3ZZ5A 1A61H 1TA2A 3P6ZB 4IBLH 3SV2H 1MBMA 3F9HA 2AERH 1O2HA 1O5CB 2Z94A 3D23A 3SOSA 2H5DA 1O2WA 3WW7A 4AZ2B 1QB9A 4ABEA 1C9TA 4ISIH 1NRRH 1B7XB 4CHAC 3QZQA 2BLWA 2FLRH 4X1SU 2FYQA 1O2RA 1F0RA 4YLUA 1RTLA 3SNCA 3L3TA 2A2XH 1MAYA 4DOQA 1QTFA 3VB3A 1Y5BT 1ZR0A 2BXTH 3LGWA 1OYTH 1GJCB 4H6TA 3E16B 4WJG2 4NA9H 4ABAA 4JMYA 3GYMA 3F1SB 3BSQA 4Y8ZA 1KXFA 2Z9IA 2FZZA 2BD4A 4GHTA 3K9XB 2CGAA 1D3TB 1RJXB 1WXRA 4AB8A 2FI5E 3B9FH 3FP6E 5C1XA 2QGRA 1SSXA 5CE1A 3MI4A 1QJ7B 1Y59T 1GGDC 1C2HA 1GJAB 4DIHH 1UCYH 2OBQA 4F49A 5FHTA 4K1TA 3F9EA 2FM2A 1GBJA 1PPBH 2P94A 1OKXA 4I33A 3PMBB 2O9QA 1LPZB 2VWLA 1CA8B 1YPMH 5A0BA 2XOKD 1SLXB 1L4ZA 2GD4B 1KDQB 2ZO3H 3PLBA 5EPYA 1EPTA 1UHBB 3BG4C 1FAKH 2VVCA 5CHAB 1UVOA 1C2LA 1O3HA 1XUHA 3O8BA 3MQKC 1QB6A 4Q4LA 5KGOA 1ZPCA 4B1TA 1GCTC 3Q3YA 1HJ9A 3UTUH 1OXGA 1XUIA 2H9TH 3BTTE 3I78A 4ISHH 1UTPA 1V2KT 5EXMA 1ZGVA 1A3BH 1GVKB 4MPXA 2UWLA 3MTYA 2ZNKH 1OSSA 1AIXH 2P3TB 1FV9A 3GY6A 1GDNA 1O3IA 2AS9A 3FKSD 2J38A 1J14A 1GBBA 1P9SA 3RM0H 1LHCH 3MMGA 1C9PA 2ASUB 4B6EA 1ANCA 2FWWA 1EOLA 2ZFSA 3FANA 1SC8U 4IMQA 4O03A 2K0QA 5E2PA 1LHDH 2ZU3A 4B74A 1QY6A 3MOCA 2ZCLP 1FY1A 1AO5A 3LU9B 4I8KA 2ANWA 3ZVDA 1NTPA 2FOCA 3RDZA 3U9AH 1PQ7A 2R3YA 2Y7XA 1GVLA 5EGMA 5BPEA 3UOPA 2CHAB 4CBOA 1NRSH 1G3DA 3HGPA 1G2MA 1ESAA 1PPGE 2AMDA 2H2ZA 3ZZBA 3MU8A 4TYDA 1E34B 1ZOMA 1C2EA 1IQKA 1Y3VA 4Y7AA 3RXBA 4FUBA 1NT1A 3NUMA 1VCQA 1EB2A 3MH6A 1AVXA 4X2VA 2ZHQH 2YOLA 1BRUP 1CE5A 1GMDG 2AGIX 3EA9A 1EATA 1BBRK 1FIWA 1A5IA 2VWMA 4XDEA 4B6FA 2WUBA 3QWCH
chains in the Genus database with same CATH topology
1FDPA 1V2RT 2STBE 1TBZH 2W7UA 1O35A 1NPMA 2BY9X 2Y81A 1FY4A 1ID5H 4UONA 1SG8B 1SGTA 1GMCF 2D2DA 3GY4A 1LQEA 2BY8X 1FXYA 2HALA 2HVXA 1Y8TA 2P8OC 2AMQA 1AFQC 3RLYH 1W14U 1AU8A 1TGTA 1H4WA 1IOEA 2ZKSA 1ABJH 3SU1A 1FN6A 3P8NA 1FY5A 2UUYA 1ELDE 4HGCA 3DFJA 2ALVA 4ZUHA 3PO1B 4ABIA 1ZSJA 2ZP0H 5L6NH 2J2UA 3G01A 4UEHH 1QNJA 1ZMLA 1BA8B 1TX7A 2ZDNA 3RXVA 3UWJH 1GBKA 1VJAU 2J9NA 5JBAS 4MVNA 2BX3A 1P09A 3DHKH 3RC4A 2IPHA 2BB4A 4Y79A 1YPLH 4O9VA 2PW8H 3P8OA 5H4IB 4MPVA 1Z71A 1GI7B 3P70B 1KTTB 4CRBA 4DG4A 4XFQA 3EA8A 1O5GH 2BQ7B 2EI8A 4WF8A 1DPOA 1EUFA 1EKBB 2FOGA 4TPYA 4NSVA 1PQ5A 4CR9A 1ESBA 1NZQH 3M5LA 1GJ5H 5EU8A 1LPKB 2CMYA 4Y11E 3SUDA 1AE5A 4NIYA 1TB6H 2TGDA 2PTNA 2R2MB 5AHGH 1FAXA 4Y8XA 1AGJA 4FU8A 4CH2B 4D8NA 1MU8B 4WMDA 1O3OA 2ZF0H 1TPPA 1PYTD 1BIOA 2VGCC 4NIWA 4FVDA 2ZA5A 3A7VA 3MU1A 4B2AA 3JZ1B 2Z7FE 2WPHS 3A8CA 1TMUH 1TOMH 3KHVA 3HK6B 1EZXC 1DT2A 4K1EA 2F9OA 3PYHA 2WV4A 3EA7A 4AG2A 1O3FA 3RXOA 2Y82A 5A8YA 3QLPH 2Y5FA 3V12A 5K0HA 1TIOA 2F9PA 2ODYB 1EAXA 4U01A 4GVUA 3K6YA 4U2WA 2CF8H 1ELVA 3TJNA 4YESB 4I32A 4B2CA 1GBIA 5LPFA 2EEKA 2XTTB 2ZEBA 1TE0A 4YTAA 3V3MA 1O3GA 3LIWA 1QA7A 1ELTA 2ZDLA 1AWFH 3VXFH 2FX6A 2FTLE 2PGQB 1H8DH 1D6WA 3BF6H 1TX6A 3D49H 1QA0A 2ILNA 2BHGA 2FI3E 4NZQA 3P92A 1HAXB 5K7RA 4KTSA 4ISNA 1C4V2 2V6NA 3RXGA 3ZVFA 1NRPH 4CBNA 2W26A 3TGIE 1Z8GA 1VCPA 1AZ8A 3LGYA 1IQMA 1Y3WA 2Y80A 5FX5A 3M35A 8KME2 1ZYOA 2VH6A 2GKVE 2B8OH 4BAHB 1G3BA 2FPZA 1TBRH 5JB8S 3K65B 1D3QB 4FXGH 1NESE 1TNHA 1O2VA 1IAUA 5T6GA 1KXCA 2A5AA 2B9LA 1DS2E 2OUAA 4YT7H 3M3TA 3PLKA 3BTWE 1DY8A 1THRH 2HLCA 1YPGH 1NU7B 2A7JA 1UCYK 3VB4A 3MNCA 3E0NB 3GY3A 4MNXA 3RXUA 4FUCA 4RSPA 3NWUA 3MNBA 1A0HB 2WPKS 3MYWA 2G5VA 2H5CA 2PKAB 1BHXB 1JRTA 4FU7A 1C2FA 1SFIA 3SJOA 1GMCG 1TPAE 4I8LA 1N8OC 3S9CA 2P93A 1SHHB 5B6OA 1ZTJA 3A82A 4AN7A 4AGKA 1MZAA 5T6DA 1BRBE 1LVYA 3SUFA 2PUQH 3TNTA 1QL7A 3F9FA 1BBRE 1LTOA 3ZZ7A 1AMHA 5F8TA 3IWMA 3DUXH 5HYOA 1OWJA 1E0FD 1HYLA 3OU0A 3TNSA 1TGSZ 4AOQA 1DM4B 1DVAH 3B23B 1JIRA 1L1NA 1O2OA 4MPUA 4NA7A 3KGPA 2GTBA 1BOQA 4BOHA 1SQOA 1W0YH 4X8VH 2EI6A 1NROH 2ZFQH 1LVOA 1BTUA 1F0SA 3BTME 3TJVA 4D76A 1HFDA 1Z6JH 2NU4E 4K5ZA 3T25A 4Y6DA 1FJSA 5C5OA 8GCHF 1O30A 2UWPA 1MAXA 1F5LA 2WPIS 1UVSH 3A8DA 1VITF 2J34A 1GJ4H 2AIQA 1T8LA 3PTNA 4X8SH 3T29A 1OWEA 3W95A 3BTKE 2ZU4A 3RU4T 2RA3A 1W8BH 5A2MH 3RXKA 2PGBB 1A7SA 1CVWH 1PPEE 1WAYB 1WV7H 3SO3A 1QJ6B 1J8AA 3IG6B 3U69H 3PTBA 1MMJN 2GMTC 3A7WA 3FP8E 4Y71A 2BZAA 1C5OH 1GI2A 1H1BA 1OP0A 2SGDE 5C2ZA 2XBWA 1K9OE 3MH7A 2QN5T 1DICA 1RGQA 1YC0A 3UREA 4AYVB 3GOVB 1RIWC 2O8TA 2WINI 2XNIA 4FUIA 5E0HA 1EASA 1OX1A 1AKSB 5I46H 2ANKH 4CR5A 3ZZCA 1TAWA 1P57B 1HDTH 2K1QA 1C1VH 1VZQH 4UFDH 1ZPBA 2VIDA 1AUJA 1O2GH 4GLYA 1BJUA 2G52A 2J4IA 2TPIZ 2XYAA 5FBIA 1HLTH 1AWHB 1QBNA 2O8MA 1AI8H 4WY3A 3UPEA 2W5EA 2KAIA 1EX3A 4XOJA 1O3CA 3ATLA 3QTVH 1ELCA 4BAKB 3SNDA 3LH1A 3SV6A 1V6DA 3ZVBA 4K8YA 1GBCA 3KNXA 2OBOA 1OS8A 2JH6D 1ANBA 4GAWA 5AF9H 3LDXH 3QTOH 4HZHA 4LZ1H 4X6NA 3CS7A 2BLOA 1FY8E 1DOJA 2Z9LA 4A1VA 2GT7A 3PV4A 4ZAEA 5EODA 1AE8H 2HPPH 1JMOH 2LNCA 3AVZA 2P59A 4U30A 2OXSA 2NU3E 3QZRA 1GMHF 1WOFA 2O8UA 5HGGA 1AVWA 1J9CH 2FOFA 2Y7ZA 2PKSC 4AFSA 1DDJA 1ZLRA 2Z9KA 3MHWU 4NIVA 1LDTT 3UFAA 1ORFA 3RMMH 9LPRA 2ODQA 1WU1A 4CRDA 1RRKA 1ZPZA 4A5TS 3ATMA 1LO6A 6LPRA 1QB1A 2Q1JA 2FX4A 1O3MA 4CH8B 3KQDA 3H7TA 2AFQB 3RLWH 1CHGA 5ESBA 1SLUB 1O3NA 2O8LA 4X8UH 1P2JA 1DXWA 1YCPM 1MTNC 3GISB 5F8ZA 2GV6A 2QAAA 1HRTH 1W3CA 1BTHH 3HATH 4INLA 4CRCA 1D6RA 2BY5X 1GJ8B 3SJIA 1TNIA 5FCRA 2FOEA 1EQ9A 1LVMA 2BDIA 1FPHH 5DP5A 1EXFA 2ZCHP 1FPCH 3LH3A 2ZFRH 1CA0B 1SGCA 4A1XA 2BVRH 3TITA 1P2KA 1T8NA 1O32A 3AW1A 5DKMA 2C8YB 1GHBF 3GCOA 2EA3A 1UCYE 3SNEA 5GWZA 4Q7XA 2GT8A 3LOXA 1WBGB 2ALPA 2FOMB 5EQRA 4JYTA 3AAVA 1C5ZB 3VPKA 1SVPA 3R0FA 1AQ7A 2PV9B 2Y6TA 4HI3A 3CP7A 1D3PB 3Q00A 1NFUA 2A1DB 3KL6A 3NXPA 1HAZB 1O2XA 4VGCB 3RXCA 4Q7ZA 1TOCB 1O2LA 1LCYA 1VITG 4JZ1A 1EJNA 1YF4A 2ZHWH 2VH0A 5JBCS 4X6PA 2GP9B 1F5RA 1TALA 1V2UT 2PLXA 1JXPA 2ZZUH 1Q3XA 3TGJE 1SGQE 1O34A 1QIXB 2G00A 4X1NU 1YPJH 2D26C 1KLTA 4YOIA 3ZVAA 4WMEA 2ZGCA 2G81E 5EW1H 4DJZB 4Y8YA 5CHAC 2VVVA 2BD2A 3M7TA 4OGYA 1O3LA 2FEQH 2SGQE 5TCAA 3A7YA 2F9VA 1JOUB 3Q77A 1AD8H 4ZKSU 1O3PB 5J4QA 1GDQA 1ARCA 2HNTC 4X2WA 1WCZA 4X6MA 5EXNA 1ZRKA 2VU8E 4ABJA 2V0BA 1AFEH 5A0CA 4I8HA 4AYYB 1TWXB 2XW9A 1P11E 4Y10E 2FXRA 1TQ7B 2ZGHA 5IYTA 1HJAB 2OCVB 1HAVB 3C1KA 3F6UH 3VB7A 2UUKB 1EZSC 1F5KU 1GI0A 4OS6A 1GG6B 1V2ST 4JYVH 1L1GA 1O3KA 2PSXA 1SGEE 6CHAB 1KIGH 1CU1A 1C1RA 1C1MA 1P10A 1FI8A 1HAOH 3EGKH 4YO9A 1YBWA 2BDBA 2BY6X 2W3IA 1H9IE 2BDCA 2ESTE 2CHAC 2WYJA 1C1SA 4FUGA 2XC0A 2VWOA 2UUFB 1O2SA 2PHBA 2CXVA 1O36A 1WYKA 3SJ8A 1A1RA 1IHSH 3SU2A 1GMHG 1BRAA 2XC5A 4A7IB 3T27A 1TLDA 3VGCB 3O8CA 2SGAA 1HGTH 1C5MD 1SGRE 1MUEB 3BEIB 1S85A 4WH8A 1VITH 1C5TA 1JRSA 1FIZA 3TK9A 3M3SA 3KQBA 3T62A 5E0JA 2M5TA 1IQGA 2A32A 2O8WA 1GHXH 4LOYH 1O3DA 1XUJA 1SQTA 2VWNA 3MO6A 4YZUA 2A4OA 1T8OA 2VIOA 3KCGH 1MKWH 1PPZA 5GJ4B 2A7HA 1V2WT 3T5FH 1SGYE 4R8TB 2GCHG 3PO1C 4CHAB 2PWXA 1LHGH 4NSYA 1AN1E 5HXFA 3GCTG 2Q6DA 3Q76A 4HFPB 3RXFA 1CHOF 3KF2A 3QX5H 4AFQA 2G5NA 9ESTA 1K21H 1XUGA 3E1XB 2XCFA 2BD8A 1WTGH 1C1PA 1SLVB 1GHBG 1V2TT 3DD2H 2WPLS 1P05A 3C27B 2LPRA 5C67A 3SZNA 4GSOA 4INHA 1CT2E 1BRCE 3OY6U 2FS8A 1TRYA 1SGIB 5AFZH 3ZZ6A 1FQ3A 1ZHMA 1GGDB 3SBKA 2VJ1A 1QR3E 3RM2H 3T28A 1P06A 1C5PA 1T8MA 1K2I1 2H9EH 1G32B 1U6QA 2A4QA 1Q2WA 2F9NA 3F9GA 4UFFH 3LPRA 3UNQA 1TNJA 3TJOA 2P95A 4Q80A 3RMLH 1HV7A 1DWEH 1WTHD 2F9BH 2BDAA 2D1JA 3DA9B 3R3GB 1P2NA 2XBVA 1HAYB 1OOKB 1ZRBA 4A6LA 3TJUA 1IQFA 3I77A 2A0QB 2AH4X 2ZWLH 5L2YH 1DWBH 4OS1A 1GJDB 1Y3UA 4OGXA 1W2KH 5EPNA 2J95A 3QN7A 1A4WH 4D9QA 4Z6AH 2G8TA 2BXUH 2C8ZB 1GDUA 1O2MA 4LK4A 3Q3KA 6GCHF 3V0XA 3M7QA 2BD3A 2PSYA 1P8VC 3KQCA 1O2IA 3SHCH 3S7KB 3QGJA 1A2CH 3RU4E 2WYGA 1KYNA 4ZKNU 3TH3H 4IS5A 1F7ZA 2HNTF 1Z8RA 3A87A 1O33A 4NCYA 4GPGA 1WUNH 2BLVA 1ZTLA 2Y5HA 1FNIA 3M5NA 1VGCB 1KDQA 2OINA 1MCTA 4DURA 2WV5A 2BYAX 7KMEH 2QF0A 2Z6BD 1UHBA 2ZHFH 3UNRA 1O3EA 5DK1A 1SGDE 1Y3YA 1EZUC 4CRFA 1DLEA 3E91A 1XXDA 1NFXA 1S81A 3GDUA 2BM2A 1UTLM 1O5BB 3RXDA 3SQHE 1K1PA 1O3BA 4R0IA 2TRMA 1N6YA 3BTEE 2FIRH 3BTDE 1NU9A 3EAJA 2Z9GA 1MCVA 2QV1A 4B2BA 2OTVA 4TWYA 1GHVH 1TQ0B 1QCPA 3SUEA 3ESTA 4BAMB 1GHWH 4XBCA 2PUXB 5DJ7A 3FAOA 1O39A 2C3SA 3GY7A 3RXSA 3A7TA 1C5VA 1N6XA 2JETB 4NGAH 3SHAH 1SGNE 1C2GA 4MTBA 4NIXA 2BZ6H 2ZU2A 1C2DA 3VB6A 5DP3A 2P8OB 4GCHG 2HGTH 5DG6A 5L30H 3ATKA 4YLQH 3ZV9A 1A46H 1FUJA 1SL3A 2QXIA 1BUIA 2GZ9A 1G30B 5EOKA 4YOJA 1C2MA 3CS0A 2GCTB 2D8WA 1ZGIA 2BY7X 2ZTYA 3T26A 1J15A 1ZJDA 2FS9A 1OWHA 1BMLA 1J16A 5EQQA 2ODPA 5LH8A 2FOAA 1ZMNA 1O2JA 1ZJKA 2A2QH 4K3JA 1XUFA 3A8AA 2R3UA 2SGPE 4XBDA 1CHOG 2UUJB 3P95A 2DUCA 3M5OA 5FCKA 1B0FA 4I7YH 2ZIQH 3U8TH 1NM6A 2G4TA 1YLDA 1SFQB 2Y5GA 3LKWA 1XXFA 4UE7H 1C1TA 3ZV8A 4IN2A 1EB1H 3MNXA 1P0SH 2ZDVH 2FOBA 3UUZA 1BT7A 2P3FH 2TGAA 3PROA 3U1IB 1HB0B 4A92A 1BTPA 3HKIB 2VIWA 3U8OH 1AY6H 5I25A 1AB9B 2PFEA 4CREA 2YNAA 3VXEH 2ZTXA 2KAIB 1S6HA 4KELA 3BTGE 3TPIZ 1E37B 2F3CE 1V2OT 1IQEA 3D65E 3NKKA 2H6MA 3A89A 1CGJE 1UTJA 1ZHRA 2BTCE 3URCA 3GCHC 1BQYA 1FY3A 2CJIA 4X1RU 1C1OA 1ETSH 3RXJA 4GUXA 2QCYA 1E36B 5LPRA 5EG4A 4AG1A 1SR5C 1C5RA 1O31A 2B0FA 1G3EA 1NC6A 1VR1H 4JZDH 1JBUH 2J92A 1MKXH 1C5NH 6GCHG 1P3EA 1Y5UT 1YGCH 3GCNA 1ELGA 3UQOA 4KGAA 3SJ9A 3V13A 3NK8A 2BQWB 4BAOB 1MKWK 4E7NA 5C3NA 5ABWA 2CV3A 5AVDA 4IC5A 4BTTB 3GICB 3PMJA 1GBEA 4CRAA 3SGAE 4IMZA 5PTPA 3K6ZA 3ATWA 5E2OA 1SB1H 5A0AE 3P8GA 1O38A 1P04A 1Z8JB 2VIVA 1WQVH 1C2IA 2AYWA 1QQ4A 1GJ7B 1O5AB 4X2YA 3RMOH 3T2NA 2ZU1A 1NFWA 4J2YB 3V7TA 1Y3XA 6ESTA 1CBWC 1NFYA 4NA8A 3FZDA 4ABHA 3SI3H 5GPIB 1GJ9B 1W7GH 4WWYA 1OP8A 1CT4E 1ETTH 1THPB 4RKJB 5T3HA 1F0TA 4ISOA 3HKJB 1P2IA 4I31A 4BAQB 3ZVEA 1UTKA 1WQSA 1W13U 2HPQH 1C1QA 1HXFH 1C5WB 2FP7B 1P9UA 2FMJA 3A88A 4TPIZ 3RXTA 1DANH 1RD3B 3ODDA 1N8OB 1AVGH 3A84A 3RXEA 4MDSA 2IJOB 3TGKE 8LPRA 2F91A 3PB1E 3PWCA 2QXGA 1DSUA 2GZ7A