3A7WA

Crystal structure of trypsin complexed with (e)-4-((tetrahydro-2h-pyran-2-yloxyimino)methyl)benzimidamide (soaking 4hours)
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Cationic trypsin
publication title In-Crystal Chemical Ligation for Drug Discovery
rcsb
total genus 57
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2009-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3a7wA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3a7wA02
1J8AA 1G3EA 2BD8A 3RXSA 2GVFA 4ESTE 2FOCA 1BBRH 1FPHH 1EB1H 4H4FA 3MI4A 3RXVA 3LIWA 5C20A 1O34A 2TGDA 2W3KA 1D3DB 1BJVA 1QA7A 2O9QA 1MD7A 4FUBA 1KLIH 1O2PA 3A7ZA 2PKAA 7GCHF 1C1VH 2ZWLH 1TRNA 1SFIA 1Z7KA 2CF8H 2HNTC 3I78A 4DURA 2BLWA 1C5NH 1CVWH 3RM0H 1NROH 2PKSC 1GL1A 5EQRA 1DITH 1UHBB 3ZVAA 5E0JA 5BRRE 2EA3A 2Z9KA 1F5LA 1Q2WA 3FVFB 4DT7B 2WPLS 3SI3H 1D3PB 2GDDA 3IG6B 2C8ZB 3S0NA 2R0KA 2BDHA 4JZIA 4Y7AA 3MNBA 4ZMAH 1P04A 4NZLA 9LPRA 1KY9A 2G51A 3MOCA 5F03A 2QIQA 2VINA 3M3VA 4KGAA 1VJ9U 3HKJB 1H8IH 3C27B 1AVGH 3PMAB 4D7FA 4GCHF 1Y3UA 2HRVA 4YOIA 4OGXA 3GDSA 1K2I1 1HAOH 1VR1H 5ESTE 1CGHA 1TMTH 2NU1E 2QV1A 1PPEE 2VIVA 1BTPA 5DP4A 1GI9B 4JZDH 1JIRA 2ZHFH 1EJAA 2ODQA 4WMEA 1C5OH 4FUFA 3RXEA 2BLOA 4LOYH 2LPRA 1GCTC 2Q1JA 1XVMA 4JYVH 1EPTC 3ZYEA 1MKXK 4NA8A 1FY1A 2FTMA 3SU1A 4BTUB 8GCHG 1W12U 4WMDA 1Y3VA 2F9VA 3K9XB 3SU4A 2C90B 4K3JA 3S7HB 1C4V2 1F5KU 1Y3XA 2ZU1A 1HLTH 3BN9A 1C2GA 3MNCA 4KTSA 5LH8A 3RXLA 3ZZCA 1DUEA 3QLPH 5EG4A 1FAKH 1EZUC 1C5RA 2GMTB 1O3KA 1IQMA 4X2VA 2BB4A 2XCNA 4TWWA 3MO9A 1JWTA 1HAHH 1S0QA 1KLJH 1SOZA 5ETXA 1C5WB 2Z3EA 2A5AA 2QA9E 1S6FA 2XBWA 1Y3YA 1FY4A 2G81E 1OWKA 1YGCH 4CRDA 5TCCA 5JBBS 2AMQA 2GD4B 1TGTA 4TY7A 3M3TA 2VVUA 1B0FA 1O2ZA 1NZQH 3A7XA 4BOHA 3SN8A 2B7DH 4ISLA 1QBNA 2WYGA 1XKAC 2G4UA 1LQDB 3DUXH 2QCYA 1ELTA 2B5TB 4ZHLU 4ABGA 2H5DA 1A46H 1CSOE 3RXMA 1SR5C 4Y0YE 5DK1A 2J4IA 2VH0A 1TFXA 2FOEA 4DVAU 4B2AA 1DWCH 3F9GA 3KQDA 1J9CH 5DP7A 1WUNH 4GVUA 1G2LA 4XFQA 2BZ6H 1GMHF 1MAYA 1SGFA 4U2WA 2BDBA 1P12E 1TGNA 1G32B 1P2KA 1HXFH 2ZHQH 3MFJA 1PPBH 1HCGA 2A7CA 3P17H 2WV4A 4ZROA 1HJAB 8LPRA 5DGJA 2BYAX 1NFWA 4Y71A 2F91A 3KGPA 3ZZ3A 4FVDA 2WYJA 3CENA 1G37A 2NWNA 4E05H 2FI5E 3RC4A 4B73A 2UUFB 2BDGA 2J34A 2ZU4A 2BY8X 1GHBF 1CT2E 2FO9A 4OS7A 3BTME 2G5VA 3NUMA 3A8BA 1AUTC 1YPHC 4UD9H 1AU8A 2G4TA 3F9FA 4K60A 4R8TB 1U6QA 2AS9A 5FX6A 3LH1A 1AY6H 2W26A 4CRAA 1SLVB 4WWYA 1ANBA 3STJA 5C5NA 3AW0A 3GYMA 1C5UA 3DHKH 4ZAEA 3TU7H 5GDSH 5IYTA 2CJIA 2GMTC 2P95A 3ZZ8A 2OLGA 4HTCH 4DCDA 3FANA 3RXTA 4CBOA 1GHXH 3SU6A 4NSYA 1YCPK 1P8VC 3B8JA 3TK6A 2BQWB 1SBWA 1H4WA 1O2QA 1UTLM 4LZ1H 3ODDA 1N8OB 3UOPA 1L1GA 5E2OA 3IWMA 1QB6A 1S85A 4CREA 2G8TA 2BD4A 1BRUP 3HATH 2G55A 1C1QA 1O2IA 1YBWA 1GI3A 4O97A 1GMDF 3LONA 1BMAA 2FOAA 3U1IB 1HJ9A 2BX3A 1V2UT 1O3JA 5HMAA 3TITA 1BTUA 1V3XA 4PROA 3EGKH 5A0CA 4WY3A 2R3YA 1O5CB 3GY7A 1C2EA 3RLWH 3UWIA 1GG6B 1EASA 3OU0A 1FIWA 1W7XH 1C1NA 1S5SA 3RXGA 3RXIA 2ZP0H 2PV9B 3UTUH 1TYNA 3SU5A 1UCYK 4NGAH 1Z71A 4X1SU 4TWYA 4AOQA 1EZQA 1GBCA 1BTXA 3BTKE 2FXRA 3SGAE 2GT8A 3PLKA 1UTPA 5EU8A 4X8UH 3BV9B 4IBLH 1K21H 3T5FH 1P2MA 3QO6A 1TX7A 1YPMH 3R0FA 3UWJH 3N7OA 1ZRBA 4U30A 3MNXA 2ODYB 3ATLA 1C1UH 1O2UA 3SNEA 1G36A 1G9IE 1O5FH 1FV9A 1GI8B 1OP2A 2AGGX 2VIDA 1CO7E 1AWFH 5BPEA 1V2PT 2DUCA 4FUCA 5HM2A 4FUDA 4X8TH 4X6NA 1Z6JH 4NIVA 1PYTC 2ZFFH 1P9UA 2FWWA 1J16A 4I8JA 1IQHA 1B5GH 3ZVBA 1W14U 3SU2A 1SGNE 1BTHH 3LKWA 3FZZA 4MPXA 4HI3A 1BRCE 3B23B 1AWHB 1N8OC 2GV6A 4HFPB 1Z8JB 2PW8H 1S0RA 5L2ZH 3SUEA 1T8OA 2C4FH 4IGDA 2J38A 3MH4A 4ISOA 5A8XA 1O2WA 1Y3WA 3SJOA 1SB1H 1ZTLA 1UVSH 2NU0E 3AASA 1P06A 1UK3A 1DOJA 2VGCB 2ZZUH 4RN6A 1YPLH 4X8VH 2FOMB 2BDAA 4UDWH 2ZQ1A 4GSOA 2VWNA 1SLUB 1OWHA 3TNTA 4AFZA 4KKDA 1B7XB 1QJ1B 1XX9A 5JBAS 1GG6C 2ALVA 1XUKA 2FYQA 2FOHA 3PTNA 1NN6A 1ZMJA 1XM1A 1Y59T 2A5KA 2NU4E 5AFYH 2Y6TA 1OWDA 3UY9A 1J14A 5HYOA 1KDQA 4JYUH 2ZU2A 1GJDB 4NA9H 4RSPA 1O5EH 1SSXA 2BLQA 1C2MA 1SPJA 3EA8A 1KXCA 1IAUA 3DD2H 5T6DA 1GHZA 1GBDA 1SGEE 1ZGIA 5FCRA 1A2CH 3RLYH 2O8MA 1FAXA 2AERH 3EDXB 1YP9A 1D6RA 1BBRK 1BITA 1NFYA 2AFQB 1FNIA 1LHEH 2BOKA 1YYY1 4THNH 2OCVB 2JH0D 1Z1IA 4INHA 3UOUA 2BD3A 1RJXB 4NA7A 3P8OA 2VB0A 4OS2A 2Z9LA 4GLYA 5DJ7A 2P16A 3S7KB 2Y7XA 1A5GH 1FI8A 3QTVH 1LVOA 2NU2E 1CT4E 1ETTH 3FP8E 4AG1A 3MU4A 2ZPQA 1AKSB 1RFNA 1TNKA 2A0QB 2OXSA 3DA9B 1G3CA 1IQEA 3RXDA 1TBZH 2H5CA 2XTTB 5EW1H 1A7SA 1WCZA 1ELVA 1NESE 3V3MA 3PO1B 1QRZA 2I6SA 2JETB 1BMMH 3F68H 1TE0A 1L4ZA 1L1JA 3PROA 1BHXB 3GCTF 3BF6H 3O8DA 3UNSA 4DW2U 1VZQH 1THPB 2VGCC 3OTJE 2PUXB 1ZTJA 2BD7A 4E7NA 1P11E 1TMBH 3M5OA 2VH6A 2ZTYA 2VWOA 6GCHG 1C5LH 2FLBH 1W13U 1GPZA 4YT7H 1HPGA 1SHHB 2BY6X 5C1UA 4AB9A 1UCYH 1UTMA 2YOLA 1YM0A 1T31A 1DWBH 1GBFA 2BDYA 1EATA 1BT7A 2GCHG 3RXBA 1GBTA 1EAXA 2FIRH 2TIOA 1WQSA 1H8DH 1G2MA 1UO6A 1YC0A 4WJG2 1O3IA 1ZJDA 5F8ZA 4A1XA 3MNSA 3O8BA 2QXIA 2WINI 1VCPA 3PYHA 3MH5A 4Q7YA 4I33A 3QDZB 1GHVH 5JB8S 4B75A 2ZPSA 1Z8RA 3KIDU 4NG9H 2ZA5A 1C4U2 2P59A 2ZG0H 5E0HA 3STIA 1EXFA 1M9UA 4U01A 3SNDA 1K1IA 4J1YA 1NT1A 1XUIA 1DSUA 1TABE 1LTOA 1EZXC 1D4PB 1LHCH 3H7OA 4DY7B 3ZVCA 3T28A 1Z8IB 3L33A 3GYLB 1ZPZA 3UUZA 2ZGJA 1C2HA 1TONA 5LPEA 3JZ2B 1C1PA 1NO9H 1LKBA 3OYPA 1RGQA 2FMJA 3NKKA 5F8XA 2VJ1A 4KELA 2JETC 4OS1A 1QL7A 1W0YH 3OSYA 2KAIB 3S69A 3PWCA 3SV2H 1ZZZA 1A0HB 5A8ZA 1O37A 4GUXA 1DDJA 1GJAB 2VIQA 2JH6D 4ZHMU 4BAMB 2ZF0H 3T2NA 4CRCA 5JBTA 1UTOA 5LPRA 1L2EA 1ZYOA 5ESBA 1WSSH 1JXPA 2ZU3A 4MNXA 1FDPA 1OSSA 4OGYA 1Y5UT 4ABDA 1OOKB 4UFDH 2ANKH 2WUBA 1ZMLA 3MU5A 1OS8A 2CF9H 1ELEE 3SNCA 2XW9A 3GOVB 2FESH 1DPOA 1QJ6B 1N6XA 1P9SA 2ZECA 3ZZ4A 1QR3E 3RXAA 2QAAA 2XCFA 1GHYH 1WAYB 2PR3A 2SFAA 1RIWB 5F6MA 5FBIA 5FPYA 3T26A 3W94A 5T3HA 4VGCB 1AB9B 2A1DB 3GY2A 3TVJB 3V12A 3E3TA 1QCPA 1V2KT 1UVOA 2OC1A 4Y79A 4O3TA 4JK6A 3V13A 4K69A 4NSVA 4MG3A 2Z7FE 2BD2A 4AFUA 2Y5HA 1HDTH 1O2KA 3U8TH 1AFEH 3ELAH 1AN1E 3EA9A 3V0XA 3SU3A 4A92A 3DT0H 1DICA 3U69H 3ENSB 4XBBA 5A0BA 2A2XH 3RMMH 3ZV9A 2WPJS 1CHGA 1TGSZ 1GBLA 4Q80A 2ZIQH 4YESB 2JKHA 3Q3XA 2TBSA 1MU8B 2FX4A 3BIUH 4TPIZ 2FODA 4AFQA 1FJSA 3QGNB 4K1SA 1TRMA 3ZZ9A 1O33A 1FMGA 4YOGA 3VB3A 5FCKA 3P92A 5AFZH 1MMJN 2FM2A 2R2MB 3MWIU 1DX5M 1T7CA 2BY9X 1ELBA 1RD3B 3BTDE 1L1NA 1P2IA 3OX7U 5E2PA 3T29A 2ZEBA 1GVLA 4OS5A 2F9PA 2P3TB 4HZHA 1O3NA 3AAVA 4NCYA 2ALPA 3QN7A 1O5DH 1O3MA 3ZVEA 4BNRA 8GCHF 3MYWA 1SL3A 1EQ9A 1Z1JA 4KTCA 5EQSA 3TH3H 3MO6A 5EPYA 2XYAA 3A7VA 3E0PB 4K2YA 3LDXH 3G01A 1LPKB 1AE8H 4UFEH 3P95A 1C5SA 1SLWB 2GTBA 1NRRH 1QTFA 1V2OT 1ABIH 1FN8A 1HGTH 1O32A 1RIWC 3ZZBA 3EA7A 5L2YH 1JRTA 3UNQA 3LT3A 1CT0E 1BHXF 1AB9C 4VGCC 1WTHD 2K1QA 2BVSH 1UK2A 1TNGA 1ZTKA 2CV3A 1BOQA 3HKIB 1W8BH 2A7JA 1Y8TA 2OTVA 2RA0A 1GJ4H 2FPZA 1FN6A 2IN2A 4X8SH 3A87A 3QWCH 5J4SA 1KLTA 1VGCB 1W2KH 1SHYA 1P05A 5T6GA 3NK8A 1S82A 2A31A 3QZQA 1UMAH 2SNVA 2UUYA 2GCTB 2AH4X 4GHQA 1ZSLA 3PM3A 2P93A 3PLPA 3RC5A 1UJ1A 1SGIB 1QQUA 1GDQA 1SGPE 1ELFA 1P2JA 2ZDVH 3A86A 3TK5A 2V3HH 3H5CB 1GI6A 1O2SA 4I8GA 1HAVA 1ZGVA 4MTBA 3SJKA 4SGBE 2O8UA 2FOBA 4IMZA 5CE1A 5K7RA 5EOKA 1A0JA 3P8FA 4DIHH 1WOFA 1EB2A 3URCA 1GI7B 1FLEE 1O2NA 4ZKNU 3KF2A 1UCYE 3BEUA 2TGPZ 1OKXA 1MUEB 1OWJA 3ZV8A 1RTFB 4GAWA 2PTCE 4GPGA 2W3IA 2WV5A 1MBMA 3S9AA 3MH6A 2OBQA 2HNTF 4RKOB 4FU7A 1ARCA 3ESTA 1XUHA 2BVRH 3TGKE 1GMCG 4H42U 3QTOH 2W7UA 2W7SA 2BHGA 3M5MA 1P09A 1K1JA 2EC9H 1TNLA 1HAGE 1O36A 4QT8C 1PPZA 1B0EA 4MNWA 3M5LA 2H2ZA 1YLDA 4XOJA 1TRYA 1OYQA 4B2BA 1C5MD 1EPTA 2OC7A 2ZDMA 4FXGH 3TJNA 1FPCH 4XBCA 5DP8A 2HVXA 1ZRKA 2XC5A 1QL8A 3TH2H 1O2RA 3F6UH 3PLBA 1FXYA 1MZDA 5I46H 3SV7A 3RMNH 1VGCC 2IPHA 5FAHA 4MPUA 4FVBA 3ZVFA 1SGTA 2FTLE 1ZPBA 2GCTC 1TPAE 4FU9A 4BXWA 3HPTB 1GBHA 2STBE 1SGCA 2TRMA 3E1XB 4BAHB 5DO4H 4Y0ZE 5C1XA 2Z94A 1SGFG 2WUCA 2Z6BD 1K1PA 1OX1A 3EQ0H 1O39A 3MMGA 2ZHEH 3VB4A 1C2DA 1E0FD 2UWOA 3BTQE 4ZHAA 1ARBA 2QF0A 3RMLH 4UONA 1C1MA 1TGCA 3RC6A 3E91A 1IQIA 2J9NA 1H9LB 1TOMH 2GKVE 3RXJA 1IQJA 1D9IA 2V3OH 2A4QA 4MNYA 1GJ7B 2F3CE 3BEIB 3MHWU 3OY6U 1P2QA 3VEQB 1DVAH 3BEFB 5AHGH 4X2XA 1KXFA 3A7WA 3VGCB 4YZUA 2ASUB 2R2WU 4CHAB 1E38B 4BAKB 4X1QU 4YO9A 2SGPE 3D62A 4IW4E 1K1LA 2V35A 2JH5D 2PSXA 4MPVA 2GP9B 3E16B 1LVYA 3RXRA 1MTWA 2ZGXH 4ISHH 2OBOA 2OUAA 3PMBB 1UTNA 4MVNA 3M35A 1C1TA 3MO3A 1RXPA 3ZZ6A 1TX6A 5FPSA 1V2JT 5FBEA 5GJ4B 4M7GA 2A7HA 1D6WA 1BBRE 1QRXA 1E34B 4I8HA 5A8YA 1PPGE 2ZQ2A 1V2TT 1AZZA 1A3EH 1O2MA 1SMFE 1P01A 3VXFH 2J92A 4KP0A 4MDSA 1MQ5A 1ZOMA 4ISIH 1GI4A 1HFDA 1TB6H 3UQVA 1YPGH 1QA0A 2A5IA 1WTGH 1MAXA 1ZSKA 4Q7XA 1K28D 1F0RA 1NFUA 4Y76A 1EOLA 3CS0A 3ATKA 3TJUA 3K65B 4NZQA 2I6QA 1YKTA 2SNWA 1OWEA 3A89A 3CP7A 4TY6A 2R0LA 1P57B 2FZZA 2ZPRA 5FXLA 1XXDA 2FS8A 2UWPA 1BTYA 1C9TA 1T8MA 1W10U 3IITA 1C5ZB 1Q31A 2WPIS 4NIYA 6CHAB 7KMEH 2B0FA 1GI1A 3A85A 3D65E 1C1RA 3SQHE 1LVMA 4U32A 3RXPA 3U9AH 2YNAA 4DGJA 1BTZA 3GDVA 3GY8A 1TBRH 3SORA 3URDA 2ANYA 5PTPA 2PGBB 3E90B 4ZXYH 1O35A 4IC5A 3UFAA 4AX9H 1HXEH 1SGDE 4AN7A 3LGYA 4FUEA 3SO3A 3A82A 1QJ7B 2UUKB 4D76A 1O5AB 1T4UH 2ZGCA 2AMDA 1CA8B 1O3HA 5L6NH 3VGCC 1MQ6A 1SG8B 1CHOG 1V2RT 4CHAC 1AUJA 5JB9S 3SV9A 5E8EH 1NTPA 1YF4A 4BTIB 2GZ7A 3B9FH 1TNIA 1ELDE 1GHAG 5DKMA 1HRTH 4MLFB 2C8XB 3SV8A 3NPSA 1GI5A 1SQOA 2XWAA 2SGFE 3KN2A 1QL9A 1HIAA 3SU0A 3LGVA 4WMFA 5EODA 1AZ8A 2FOGA 3PV4A 1THSH 3QK1A 3GISB 3KEEA 1ZMNA 1FONA 3ZZAA 2G52A 4AZ2B 4IN2A 4Y10E 2HNTE 5EQQA 1BB0B 8KME2 2GGVB 2XWBI 1GCDA 1PJPA 4LZ4B 1X7AC 1EP6A 5GWZA 5G4BA 2XNIA 1GBEA 1SVPA 2Y82A 1QRWA 5A09A 1TIOA 2HWLB 3L6PA 5SGAE 1TOCB 2M5TA 2PKAB 2UUJB 1ETSH 3UR9A 3BTEE 5B6OA 3SJ8A 5JBCS 2VVCA 5TCAA 1ZHPA 5A0AE 1QNJA 1O3BA 1GI0A 1UTKA 2P94A 4D8NA 1MTVA 3VB6A 1Y5BT 2VNTA 4XSKU 3ZZDA 1T8LA 4I8KA 1XXFA 6CHAC 5L30H 5C3NA 3TGIE 3PMHB 1F0UA 1O2VA 3E0NB 1O0DH 1GBKA 1G3DA 1TLDA 6GCHF 4NFEA 1F2SE 2B9LA 1SQAA 2FDAA 1EJMA 1SLXB 3SQEE 1AFQB 2B8OH 3WY8A 5K0HA 3F9EA 1O2LA 4LXBH 1QFKH 1RS0A 2AEIH 2OD3B 1DM4B 1HYLA 4WXVA 1GGDB 5HGGA 3BIVH 3K6YA 1S84A 3L3TA 4INKA 1ACBE 3D23A 3RUOA 1TNHA 3VFEA 1FY8E 1LPGB 2GCHF 4K5ZA 4R0IA 2SGDE 2BLVA 4J2YB 3I77A 3F1SB 1C2JA 3BSQA 2TGAA 1E37B 1D3TB 2BOHB 1O5GH 3TPIZ 3A7YA 5DP9A 1ZPCA 2C93B 1LHDH 1QGFA 2BXUH 4NIWA 2ZTZA 1QHRB 2QXJA 1TALA 2RA3A 4B1TA 2HLCA 4Z0KA 5FX5A 2Q6FA 1F92A 1KTTB 5C1YA 3ODFA 2SGEE 2IOTA 1ANEA 3PMJA 1T32A 4SGAE 3ZZ7A 1A1RA 3LPRA 4FUHA 2Y81A 4CBNA 1NRSH 1W7GH 4F49A 1XUGA 3ZYDA 3AW1A 1O3DA 3MU1A 3TK9A 5FHTA 4K1TA 1O3FA 1O3GA 1CE5A 1DANH 1KXEA 2Q6DA 2FI4E 4X6PA 1C9PA 3NWUA 4ISNA 4X1RU 1DE7H 1HAZB 1V2QT 2EEKA 1XMNB 3E6PH 2RDLA 4YLQH 1ZR0A 1YPKH 1HAVB 4AG2A 1VITG 1IOEA 3T62A 1UVUH 3NZIA 2PHBA 3VXEH 1O30A 1GWAA 4LK4A 1GJ9B 1C1SA 2J95A 4ZKOU 1TGBA 3GDUA 1DWDH 3RXUA 2VIWA 4UE7H 1AFQC 3TJOA 1FUJA 3AVZA 5JDUB 1GHWH 2WPKS 2EI6A 3A81A 4O03A 3M7QA 5AVDA 1FIZA 1TQ0B 3RXOA 1GGDC 1BJUA 1Z6EA 2Q6GA 1A5HA 2GZ9A 4BTTB 3KL6A 2Z3DA 1O2XA 5HM9A 5GCHG 3LJJA 3GCNA 4DOQA 1C5TA 1TQ7B 1YPHE 3LC3A 4TPYA 2VWMA 3TH4H 4A1TA 1AGJA 4D7GA 5EXLA 2Z9IA 1P3EA 3A8CA 1J17T 3GY4A 1C5XB 3F9HA 3RP2A 5DP5A 3T27A 2TGTA 2YNBA 2XC0A 1QURH 2BQ6B 2W5EA 1WBGB 2Y5FA 2QF3A 1O3LA 3RU4E 2F9OA 4ZKRU 4ABBA 1F5RA 1GDNA 2RCEA 5T6FA 2A32A 1AI8H 3A8AA 1HBTH 2F9UA 1WV7H 1AHTH 3R3GB 3U8RH 2D8WA 4Y8XA 1O3EA 1H9IE 1FY5A 1QB1A 4I32A 4JYTA 1LHGH 1K1NA 1ZHRA 2ZHDA 3FP7E 4I31A 1VCQA 3LGTA 5GIBA 5IDKA 2P8OB 1GJBB 1S81A 2BY7X 1MZAA 3RXQA 3UREA 2BDCA 2ZNKH 2BZAA 1K9OE 1C5YB 1QBOA 4IS5A 4AGKA 1O3PB 4HGCA 2H9HA 1HUTH 2XBVA 2BM2A 1TX8A 2GX4A 3QUMP 1TPOA 1C1OA 1AKSA 1PPHE 4CR5A 4CRBA 1K22H 1O2HA 4K8BA 1ELCA 7GCHG 1CBWB 3PWBA 1DXWA 3LU9B 1W3CA 1XUFA 1YPJH 4AB8A 1HAIH 1V2WT 1IQKA 4WVPE 3LJOA 4WF8A 4CRGA 2QGRA 1ELAA 3JZ1B 3P8GA 4AFSA 2OC8A 1BMLA 2AGEX 1XKBC 1PQ7A 1LMWB 3TGJE 1G30B 2ZI2H 1A61H 1MTNB 2CMYA 2O8LA 1KIGH 1V2NT 4UFGH 5DP3A 3EYDA 1JRSA 3V7TA 3RXFA 7ESTE 4UEHH 1SOTA 4JMYA 4AORA 3M36A 3TJVA 4D9RA 3HGPA 4YT6H 2Y5GA 2ZDAH 1NS3A 1Q3XA 2DE8A 3FP6E 4GCHG 1NY22 1QBVH 1T4VH 1GJ8B 2P3UB 1C2KA 1W0ZU 1UTQA 1THRH 3ZVGA 5HXFA 2WPMS 2CN0H 4NWKA 3GY3A 4F4OC 2XRCA 3O8RA 3P6ZB 1C5QA 1O2GH 5CMXH 3ATMA 3LGUA 1TA2A 1PQ8A 1IHTH 3HK6B 3FZDA 3RU4D 2ZTXA 2P8OC 2C8WB 3TLOA 1BA8B 2XBYA 2ZCKP 3BTFE 1IQNA 3A8DA 3VB7A 4IC6A 3RMOH 1DLEA 4WH8A 1V6DA 4MNVA 1LKAA 3Q76A 3CS7A 4XE4A 1MKWH 4A1VA 1AE5A 4ABEA 1NC6A 4MPWA 3EAJA 1SGRE 1CBWC 2F83A 3M61U 2ZDLA 1BDAA 5JPMH 1KXDA 2GV7A 4X0WU 3GICB 1KSNA 4Y11E 3BG4B 3M3SA 4K8YA 4YOJA 1AVXA 2ZGHA 2NU3E 1WQVH 1MBQA 2V0BA 2KAIA 2F9BH 2H9EH 2ULLA 1GMCF 3A83A 3K2UA 1F0TA 1ANDA 3LH3A 1DLKB 2QYIA 2QC2A 1MTSA 2QY0B 4JZ1A 1CGIE 4A7IB 1MTNC 1KDQB 1NU7B 3SUDA 1IQGA 6LPRA 1V2ST 2CXVA 2OINA 2BXTH 1CGJE 3KQEA 1TPPA 2XXLA 4A5TS 3LOXA 2ODPA 1HIAB 3SGBE 1O3CA 1BCUH 1KXAA 3RXCA 1K1MA 3RXKA 3A7TA 2ZFSA 1JOUB 1GMHG 2PFEA 4TYDA 2D2DA 2ZHWH 1O31A 1PYTD 1C2FA 5GPIB 2J2UA 1MD8A 4FUJA 2AIPA 2FYRA 3BG8A 4X2WA 1NFXA 1RRKA 2F9NA 1ELGA 4OS4A 1AIXH 1QQ4A 1A3BH 3MU8A 4NIXA 2HGTH 4DIIH 3Q3KA 1NM6A 4CRFA 1YPEH 4B76A 1Z8GA 1S6HA 1QIXB 3M37A 4CH2B 4DJZB 4Q7ZA 4FUIA 1A4WH 1GHBG 3LGWA 4JCNA 4ZXXH 1S83A 1LPZB 2ZDNA 1ZHMA 1VCWA 2OQ5A 3OY5U 2ZFPH 1EJNA 1OP0A 1GJCB 3SNAA 1O3AA 2BD5A 5FPTA 1BUIA 4O9VA 1FY3A 1TBQH 4NFFA 1UVPA 3KQCA 3RDZA 1ESTA 1UHBA 2HPPH 3GY5A 1NRPH 4H6TA 2FS9A 3BTTE 2ZCHP 4CR9A 3UQOA 3BG4C 4BANB 2TPIZ 1NU9A 1BZXE 1PQAA 1IQFA 3SGQE 2IJOB 3MH7A 1SGYE 1EAWA 2D26C 3S9BA 1DS2E 2Y80A 3HK3B 1NRNH 3UNRA 2FLRH 1C2IA 1SC8U 5C5OA 1GBJA 1C5VA 1GMDG 5E0GA 1P02A 1H9HE 1P2OA 2Z9GA 2A4RA 3U98H 8ESTE 4Y6DA 3SW2B 1HJ8A 1EKBB 2ZGBH 4DG4A 1JIMA 1PQ5A 2ILNA 2OC0A 1HJAC 1TPSA 2THFB 3SHCH 1BMNH 3A88A 4INLA 2Z9JA 1XVOA 1MKXH 1GDUA 1HB0B 3TIUA 5EXNA 4UFFH 1XUJA 2ZU5A 1V2LT 1IHSH 4BXSA 2H1UA 3M5NA 2AMPA 1KXBA 5EPNA 3MU0A 3U8OH 2BTCE 1TMUH 1DFPA 3SV6A 1DWEH 2Y7ZA 5EW2H 1O2JA 3M7UA 2OQUA 1LCYA 3KNXA 5J4QA 4IN1A 3K6ZA 4I7YH 1O2TA 3FFGA 4Y8YA 1G3BA 2BX4A 2O8WA 4KTUA 5LGOA 2EI8A 2EI7A 1DY8A 2FP7B 3SBKA 1MCTA 4ABFA 1ETRH 5JYIA 2PSYA 1EAUA 1BRBE 3M7TA 2PGQB 1DUAA 1SI5H 1ZJKA 1CHOF 2C8YB 1C5PA 3T25A 1MH0A 1NPMA 1N1LA 4BAOB 4Q2KA 1MCVA 1RTLA 5TJXA 5H4IB 2HPQH 4IMQA 2PWXA 1ZSJA 1GHAF 2R9PA 1LVBA 5ABWA 4YLUA 1WYKA 1TNJA 4ABHA 1INCA 2OP9A 2VWLA 4ASHA 2H9TH 1UTJA 2QXHA 5C67A 4JZEH 2LNCA 3O8CA 1PFXC 4K1EA 4Y8ZA 3SI4H 4RKJB 2BVXH 1K1OA 3ATWA 1KTSB 3BTHE 3QX5H 1PPFE 1LHFH 5C2ZA 1AQ7A 1FZZA 1LO6A 4X6MA 1O38A 2FI3E 1JBUH 5DP6A 1UK4A 5CHAB 1AD8H 2PLXA 3Q77A 1SGQE 4E7RG 5F8TA 1GVKB 2ZFRH 4BAQB 2ZFTA 4ZH8A 1SQTA 5DPAA 3UIRA 3HGNA 3SJ9A 1ABJH 1AMHA 1WU1A 3I29A 3A80A 2BD9A 3SNBA 3UR6A 2A45B 4ZKSU 1IQLA 3MTYA 2D1JA 2GT7A 1CA0B 2GDEH 1P10A 2J94A 2AYWA 9ESTA 6ESTA 3DFLA 3Q3YA 4B71A 1PPCE 4WH6A 2SGAA 3LC5A 1QY6A 4B2CA 1CQQA 1O5BB 1GBMA 1ZLRA 1DT2A 3ITIA 4Z6AH 4ZUHA 1EP5A 3VPKA 4NWLA 2SGQE 4FUGA 1C4Y2 1GBIA 1HAXB 3A84A 4YM9A 1YCPH 1N6YA 1L0ZA 2C3SA 1A5IA 2HOBA 3Q00A 1D3QB 1HV7A 2BQ7B 1YCPM 3NCLA 1VITH 1T8NA 3P8NA 2CGAA 3SHAH 3FAOA 2Z3CA 3ATIA 1QB9A 2BDIA 1DY9A 1P03A 1EUFA 1L4DA 2GZ8A 4WXIA 5AF9H 2VIOA 3W95A 4B74A 4X1PU 1OYTH 1AVWA 1BRAA 1CU1A 2ZFQH 3GCTG 2A4GA 4YTAA 2FEQH 1O2YA 4X1NU 2ZCLP 1OWIA 3KQBA 2FOFA 1LQEA 1EOJA 4ABAA 1P2NA 2ESTE 5CHAC 4MQAA 4AYVB 4X6OA 2ANMH 2CHAB 3D49H 3TNSA 2BY5X 3ZZ5A 1MU6B 3PB1E 5LPFA 7LPRA 5EXMA 1SFQB 4AYYB 2A4OA 3QZRA 2PTNA 1ESBA 2DE9A 2UWLA 2XBXA 3QGJA 1E36B 3GCHB 4OS6A 1AO5A 1O2OA 3RXHA 2WPHS 5I25A 2A2QH 1F0SA 1GL0E 1W11U 3AAUA 3VB5A 3BTGE 3KCGH 1EX3A 2STAE 1GI2A 1CA0C 1KYNA 2BMGB 4O3UA 4CH8B 1EZSC 2ZO3H 1VITF 3EE0B 4A6LA 1BTWA 1ID5H 4I8LA 1H1BA 2R3UA 3RU4T 1ESAA 1ORFA 1BQYA 2QN5T 3UPEA 2VVVA 1NRQH 3RM2H 1OP8A 2AGIX 1MKWK 2QXGA 5EGMA 1GJ6A 4FU8A 3SUGA 3E8LA 4JK5A 1JMOH 2PKSB 3SUFA 4AGJA 4H6SB 3NXPA 1P0SH 1DXPA 2VIPA 1HNEE 1O3OA 2VU8E 1GBAA 3ZVDA 5GCHF 1C2LA 3PO1C 2RG3A 1TWXB 1OPHB 1V2MT 2PUQH 1RTKA 2HALA 1GVZA 4JZFH 1V2VT 3GCOA 3S9CA 3SOSA 3LGIA 1VJAU 1YLCA 2ANWA 4XBDA 3P70B 1C1WH 1Y5AT 2AIQA 1LDTT 2ZDKA 2G00A 1HAYB 4GHTA 2V6NA 1DSTA 1GBBA 4ABIA 3H7TA 2XC4A 3GY6A 1EAIA 5DG6A 1P3CA 2H6MA 2ZKSA 4ABJA 1F7ZA 1E35B 5GXPA 1OXGA 1TA6A 4X2YA 3C1KA 4D9QA 1HAPH 3DFJA 4E06H 3U1JB 2CHAC 2FX6A 1GCTB 1BIOA 1TAWA 3SZNA 1GJ5H 1EPTB 1J15A 3KHVA 2ZC9H 1FQ3A 1MTUA 2G5NA 3GCHC 3SJIA 5A2MH 1A0LA 1ANCA 3PTBA 2O8TA 1UVTH 3BTWE 4Y7BA 2P3FH 4XDEA
chains in the Genus database with same CATH superfamily
1J8AA 1G3EA 2BD8A 3RXSA 2GVFA 4ESTE 2FOCA 1BBRH 1FPHH 1EB1H 4H4FA 3MI4A 3RXVA 1MABB 3LIWA 5C20A 1O34A 2TGDA 2W3KA 1D3DB 1BJVA 1QA7A 2O9QA 1MD7A 4FUBA 1KLIH 1O2PA 3A7ZA 2PKAA 7GCHF 2F43B 1C1VH 2ZWLH 1TRNA 1SFIA 1Z7KA 2CF8H 2HNTC 3I78A 5C94A 4DURA 2BLWA 1C5NH 1CVWH 3RM0H 1NROH 2PKSC 1GL1A 5EQRA 1DITH 1UHBB 3ZVAA 5E0JA 5BRRE 2EA3A 3OTPA 2Z9KA 1F5LA 3MQKC 1Q2WA 3FVFB 3PRBA 3W1EA 4DT7B 2WPLS 3SI3H 1D3PB 2GDDA 3IG6B 2YMSC 2C8ZB 3S0NA 2R0KA 2BDHA 4JZIA 4Y7AA 3MNBA 4F55A 4ZMAH 1P04A 4NZLA 4Q4LA 1KY9A 9LPRA 2G51A 3MOCA 5F03A 2QIQA 2VINA 3M3VA 4KGAA 1VJ9U 3HKJB 1H8IH 3C27B 1AVGH 3PMAB 4D7FA 4GCHF 1Y3UA 2HRVA 4YOIA 4OGXA 3GDSA 1K2I1 1HAOH 1VR1H 5ESTE 1CGHA 1TMTH 2NU1E 2QV1A 1PPEE 2VIVA 1BTPA 5DP4A 1GI9B 4JZDH 1JIRA 3OAAD 2ZHFH 1EJAA 2ODQA 4Q63A 4WMEA 1C5OH 4FUFA 3RXEA 2BLOA 4LOYH 2LPRA 1GCTC 3CNRA 2Q1JA 1XVMA 4JYVH 1EPTC 3ZYEA 1MKXK 4AC9A 4NA8A 1FY1A 2FTMA 3SU1A 4BTUB 8GCHG 1W12U 4WMDA 1Y3VA 2F9VA 3K9XB 3SU4A 2C90B 4K3JA 3S7HB 1C4V2 4RT0A 1F5KU 1Y3XA 1BMFD 2ZU1A 1HLTH 3BN9A 1C2GA 3MNCA 3OEED 4KTSA 2L6OA 5LH8A 3RXLA 3ZZCA 1DUEA 3QLPH 5EG4A 1FAKH 1EZUC 1C5RA 2GMTB 1O3KA 1IQMA 1K0HA 4X2VA 2BB4A 2XCNA 4TWWA 3MO9A 1JWTA 2WZQA 1HAHH 1S0QA 1KLJH 1SOZA 5ETXA 3SZEA 1C5WB 2Z3EA 2A5AA 2QA9E 1S6FA 2XBWA 1Y3YA 1FY4A 2G81E 1OWKA 1YGCH 4CRDA 5TCCA 3UB0A 5JBBS 2AMQA 2GD4B 1TGTA 4TY7A 3M3TA 2VVUA 1B0FA 1O2ZA 1NZQH 3A7XA 4BOHA 3SN8A 2B7DH 4ISLA 1QBNA 2WYGA 1KMHB 1XKAC 2G4UA 1LQDB 3DUXH 2QCYA 1ELTA 2B5TB 4ZHLU 4ABGA 2H5DA 1A46H 1CSOE 3RXMA 1SR5C 4Y0YE 5DK1A 2J4IA 2VH0A 1TFXA 2FOEA 4DVAU 4B2AA 1DWCH 3F9GA 3KQDA 1J9CH 5DP7A 1WUNH 4GVUA 1G2LA 4XFQA 2BZ6H 1GMHF 1MAYA 1SGFA 4U2WA 2BDBA 1P12E 1TGNA 1G32B 1P2KA 1HXFH 2ZHQH 3MFJA 1PPBH 1HCGA 2A7CA 3P17H 2WV4A 4ZROA 1HJAB 8LPRA 3KYFA 5DGJA 2BYAX 1NFWA 4Y71A 2F91A 3KGPA 3ZZ3A 4FVDA 2WYJA 3CENA 1G37A 2NWNA 4E05H 2FI5E 1SKYE 3RC4A 4B73A 2UUFB 2WV9A 2BDGA 2J34A 2ZU4A 2BY8X 1GHBF 1CT2E 2FO9A 4OS7A 3BTME 2G5VA 3NUMA 3A8BA 1AUTC 1YPHC 4UD9H 1AU8A 2G4TA 3F9FA 2M2AA 4K60A 4R8TB 1U6QA 2AS9A 5FX6A 3LH1A 1AY6H 2W26A 4CRAA 1SLVB 4WWYA 1ANBA 3STJA 5C5NA 3AW0A 3GYMA 1C5UA 2WSSD 3DHKH 4ZAEA 3TU7H 5GDSH 5IYTA 2CJIA 2GMTC 2P95A 3ZZ8A 2OLGA 4HTCH 4DCDA 3FANA 3RXTA 4CBOA 1GHXH 3SU6A 4NSYA 1YCPK 1P8VC 3B8JA 3TK6A 2BQWB 1SBWA 1H4WA 1O2QA 1UTLM 4LZ1H 3ODDA 1N8OB 3UOPA 1L1GA 5E2OA 3IWMA 1QB6A 1S85A 4CREA 2G8TA 2BD4A 1BRUP 3HATH 2G55A 1C1QA 1O2IA 1YBWA 1GI3A 1YLNA 4O97A 1GMDF 3LONA 1BMAA 2FOAA 3U1IB 1HJ9A 2BX3A 1V2UT 1O3JA 5HMAA 3TITA 1BTUA 1V3XA 4PROA 3EGKH 5A0CA 4WY3A 2R3YA 1O5CB 3GY7A 1C2EA 3RLWH 3UWIA 1GG6B 1EASA 3OU0A 1FIWA 1W7XH 1C1NA 1S5SA 3RXGA 3RXIA 2ZP0H 2PV9B 3UTUH 1TYNA 3SU5A 1UCYK 4NGAH 1Z71A 4X1SU 4TWYA 4AOQA 1EZQA 1GBCA 1BTXA 3BTKE 2FXRA 3SGAE 2GT8A 3PLKA 1UTPA 5EU8A 4X8UH 3BV9B 4IBLH 1K21H 3T5FH 1P2MA 3QO6A 1TX7A 1YPMH 3R0FA 3UWJH 3N7OA 2KCAA 1ZRBA 4U30A 3MNXA 2ODYB 3ATLA 1C1UH 1O2UA 3SNEA 1G36A 5IK2D 1G9IE 1O5FH 2AHME 1FV9A 1GI8B 1OP2A 2AGGX 2VIDA 1CO7E 1AWFH 5BPEA 1V2PT 2DUCA 3FO8D 4FUCA 5HM2A 4FUDA 4X8TH 4X6NA 1Z6JH 4NIVA 1PYTC 2ZFFH 1P9UA 2FWWA 1J16A 4I8JA 1IQHA 1B5GH 3ZVBA 1W14U 1OHHD 3SU2A 1SGNE 1BTHH 3LKWA 3FZZA 4MPXA 4HI3A 2KR7A 1BRCE 1NBME 3B23B 5CDFE 1AWHB 1N8OC 2GV6A 4HFPB 1Z8JB 2PW8H 1S0RA 2W6JD 5L2ZH 3SUEA 1T8OA 2C4FH 4IGDA 2J38A 3MH4A 4ISOA 5A8XA 1O2WA 4B6FA 1Y3WA 3SJOA 1SB1H 1ZTLA 1UVSH 2NU0E 3AASA 1P06A 1UK3A 1DOJA 2VGCB 2ZZUH 4RN6A 1YPLH 4X8VH 2FOMB 2BDAA 4UDWH 2ZQ1A 4GSOA 2VWNA 1SLUB 1OWHA 3TNTA 4AFZA 4KKDA 1B7XB 1QJ1B 1XX9A 5JBAS 2KFWA 1GG6C 2ALVA 1XUKA 2FYQA 2FOHA 3PTNA 1NN6A 1ZMJA 1XM1A 1Y59T 2A5KA 2NU4E 5AFYH 2Y6TA 1OWDA 3UY9A 2KX4A 1J14A 5HYOA 1KDQA 4JYUH 2ZU2A 1GJDB 4NA9H 4RSPA 1O5EH 1SSXA 2BLQA 1C2MA 1SPJA 3EA8A 1KXCA 3DSGA 1IAUA 3DD2H 5T6DA 1GHZA 1GBDA 1SGEE 1ZGIA 2J98A 5FCRA 1A2CH 3RLYH 2O8MA 1FAXA 2AERH 3EDXB 1YP9A 1D6RA 1BBRK 1BITA 1NFYA 2AFQB 1FNIA 1LHEH 2BOKA 1YYY1 4THNH 2OCVB 2JH0D 1Z1IA 4INHA 3UOUA 2BD3A 1RJXB 4NA7A 3P8OA 2VB0A 4OS2A 2Z9LA 4GLYA 5DJ7A 2P16A 3S7KB 2Y7XA 1A5GH 1FI8A 3QTVH 1LVOA 2NU2E 1CT4E 1ETTH 3FP8E 4AG1A 3MU4A 2ZPQA 1AKSB 1RFNA 1TNKA 2A0QB 2OXSA 3DA9B 1G3CA 1IQEA 3RXDA 1TBZH 2H5CA 2XTTB 5EW1H 1A7SA 1WCZA 4HG6A 1ELVA 1NESE 3V3MA 3PO1B 1QRZA 2I6SA 2JETB 1BMMH 3F68H 1TE0A 1L4ZA 1L1JA 3PROA 1BHXB 3GCTF 3BF6H 3O8DA 3UNSA 4DW2U 2J97A 1VZQH 1THPB 2VGCC 3OTJE 2PUXB 1ZTJA 2BD7A 4E7NA 1P11E 1TMBH 3M5OA 2VH6A 2ZTYA 2VWOA 6GCHG 1C5LH 4ACAA 2FLBH 1W13U 1GPZA 4YT7H 1HPGA 1SHHB 2BY6X 5C1UA 4AB9A 1UCYH 1UTMA 2YOLA 1YM0A 1T31A 1DWBH 1GBFA 2BDYA 1EATA 1BT7A 2GCHG 3N7EA 1GBTA 3RXBA 1EAXA 2FIRH 2TIOA 1WQSA 1H8DH 1G2MA 1UO6A 1YC0A 4WJG2 2RDEA 1O3IA 1ZJDA 5F8ZA 4A1XA 3MNSA 3O8BA 2QXIA 2WINI 1VCPA 3PYHA 3MH5A 4Q7YA 4I33A 3QDZB 1GHVH 5JB8S 4B75A 2ZPSA 1Z8RA 3KIDU 4NG9H 2ZA5A 1C4U2 2P59A 2ZG0H 5E0HA 3STIA 1EXFA 1M9UA 4U01A 3SNDA 1K1IA 4J1YA 1NT1A 1XUIA 1DSUA 1TABE 1LTOA 1EZXC 1D4PB 1LHCH 3H7OA 4DY7B 3ZVCA 3T28A 2F4LA 1Z8IB 3L33A 3GYLB 2OK5A 1ZPZA 3UUZA 2ZGJA 1C2HA 1TONA 5LPEA 3JZ2B 1C1PA 1NO9H 1LKBA 3OYPA 1RGQA 2FMJA 4F48B 3NKKA 5F8XA 2VJ1A 4KELA 2JETC 4OS1A 3KQ5A 1QL7A 1W0YH 3OSYA 2KAIB 3S69A 4Z1MD 3PWCA 3SV2H 1ZZZA 1A0HB 5A8ZA 1O37A 4GUXA 1DDJA 1GJAB 2VIQA 2JH6D 4ZHMU 4BAMB 2ZF0H 3T2NA 4CRCA 5JBTA 4OM9A 1UTOA 5LPRA 1L2EA 1ZYOA 3GS9A 5ESBA 1WSSH 1JXPA 2ZU3A 4MNXA 1FDPA 1OSSA 4OGYA 1Y5UT 4ABDA 1OOKB 4UFDH 2ANKH 2WUBA 1ZMLA 3MU5A 1OS8A 2CF9H 1ELEE 3SNCA 2XW9A 3GOVB 2FESH 1DPOA 1QJ6B 1N6XA 1P9SA 2ZECA 2WPDD 3ZZ4A 1QR3E 3RXAA 2QAAA 2XCFA 1GHYH 1WAYB 2PR3A 2SFAA 1RIWB 5F6MA 5FBIA 5FPYA 3T26A 3W94A 3H09A 5T3HA 4VGCB 5KECA 1AB9B 2A1DB 3GY2A 3TVJB 3V12A 3E3TA 1QCPA 1V2KT 1UVOA 2OC1A 4Y79A 4O3TA 4JK6A 3V13A 4K69A 4NSVA 4MG3A 2Z7FE 2BD2A 4AFUA 2Y5HA 1HDTH 1O2KA 3U8TH 1AFEH 2K0QA 1E1QD 3ELAH 1AN1E 3EA9A 3V0XA 3SU3A 4A92A 3DT0H 1DICA 3U69H 3ENSB 4XBBA 5A0BA 2A2XH 3RMMH 3ZV9A 2EY4C 2WPJS 1CHGA 1TGSZ 3DSPA 1GBLA 4Q80A 2QE7D 2ZIQH 4YESB 2JKHA 3Q3XA 2TBSA 1MU8B 2FX4A 2JJ1D 3BIUH 4TPIZ 2FODA 4AFQA 1FJSA 3QGNB 4K1SA 1TRMA 3ZZ9A 1O33A 1FMGA 4YOGA 3VB3A 5FCKA 3DCLA 4DT4A 3P92A 3OE7D 5AFZH 1MMJN 2FM2A 2R2MB 3MWIU 1DX5M 1T7CA 2BY9X 1ELBA 1RD3B 3BTDE 1L1NA 3WWFA 1P2IA 3OX7U 5E2PA 3T29A 2ZEBA 1GVLA 4OS5A 2KCPA 2F9PA 2P3TB 4HZHA 1O3NA 3AAVA 4NCYA 2ALPA 3QN7A 1O5DH 1O3MA 3ZVEA 4BNRA 8GCHF 3MYWA 1SL3A 1EQ9A 1Z1JA 2L74A 4KTCA 5EQSA 3TH3H 3MO6A 5EPYA 2XYAA 3A7VA 3E0PB 4K2YA 3LDXH 3G01A 1LPKB 3OEHD 1AE8H 4UFEH 3P95A 3NRLA 4B6EA 1C5SA 1SLWB 2GTBA 1NRRH 1QTFA 1V2OT 1ABIH 1FN8A 1HGTH 1O32A 1RIWC 3ZZBA 3EA7A 5L2YH 1JRTA 2CK3D 3UNQA 3LT3A 1CT0E 1BHXF 1AB9C 4VGCC 1WTHD 2K1QA 2BVSH 1UK2A 1TNGA 1ZTKA 2CV3A 1BOQA 3HKIB 1W8BH 2A7JA 1Y8TA 2OTVA 2RA0A 1GJ4H 5F53A 2FPZA 1FN6A 2IN2A 4X8SH 3A87A 3QWCH 4ZCNA 5J4SA 1KLTA 1VGCB 1W2KH 1SHYA 1P05A 5T6GA 3NK8A 1S82A 2A31A 3QZQA 1UMAH 2SNVA 2UUYA 2GCTB 2AH4X 4GHQA 1ZSLA 3PM3A 2P93A 3PLPA 3RC5A 1QZ8A 1UJ1A 1SGIB 1QQUA 1GDQA 1SGPE 1ELFA 1P2JA 2ZDVH 3A86A 3TK5A 2V3HH 3H5CB 1GI6A 1O2SA 4I8GA 1HAVA 1ZGVA 4MTBA 3SJKA 4SGBE 2O8UA 2FOBA 4IMZA 5CE1A 5K7RA 5EOKA 3VG8A 2IPQX 1A0JA 3P8FA 4DIHH 1WOFA 1EB2A 3URCA 1GI7B 1FLEE 1O2NA 4ZKNU 3KF2A 1UCYE 1VKYA 2TGPZ 1OKXA 1MUEB 3BEUA 1OWJA 3ZV8A 1RTFB 4GAWA 2PTCE 4GPGA 2W3IA 2WV5A 1MBMA 3S9AA 3MH6A 2OBQA 2HNTF 4RKOB 4FU7A 1ARCA 3ESTA 1XUHA 2BVRH 3TGKE 1GMCG 4H42U 3QTOH 2W7UA 2W7SA 2BHGA 3M5MA 1P09A 1K1JA 2EC9H 1TNLA 1HAGE 1O36A 4QT8C 1PPZA 1B0EA 4MNWA 3M5LA 2H2ZA 1YLDA 4XOJA 1TRYA 1OYQA 4B2BA 1C5MD 1EPTA 2OC7A 2ZDMA 4FXGH 3TJNA 1FPCH 4XBCA 5DP8A 2HVXA 1ZRKA 2XC5A 1QL8A 3TH2H 1O2RA 3F6UH 3PLBA 1FXYA 1MZDA 5I46H 3SV7A 3RMNH 1VGCC 2IPHA 5FAHA 4MPUA 4FVBA 3ZVFA 1SGTA 2FTLE 1ZPBA 2GCTC 1TPAE 4FU9A 4BXWA 3HPTB 1GBHA 2STBE 1SGCA 2TRMA 3E1XB 4BAHB 5DO4H 4Y0ZE 5C1XA 2Z94A 1SGFG 2WUCA 2Z6BD 1K1PA 1OX1A 3EQ0H 1O39A 3MMGA 2ZHEH 3VB4A 1C2DA 1E0FD 2UWOA 3BTQE 4ZHAA 1ARBA 2QF0A 3RMLH 4UONA 5EIYA 1C1MA 1TGCA 3RC6A 3E91A 1IQIA 2J9NA 1H9LB 1TOMH 2GKVE 3RXJA 1IQJA 1D9IA 2V3OH 2A4QA 4MNYA 1GJ7B 2F3CE 3BEIB 3MHWU 3OY6U 1P2QA 3VEQB 1DVAH 3BEFB 5AHGH 4X2XA 3AK5A 1KXFA 3A7WA 3VGCB 4YZUA 2ASUB 2R2WU 4CHAB 1E38B 4BAKB 4X1QU 4YO9A 2SGPE 3D62A 4IW4E 1K1LA 4M9FA 2V35A 2JH5D 2PSXA 4MPVA 2GP9B 3E16B 1LVYA 3RXRA 1MTWA 2ZGXH 4ISHH 2OBOA 2OUAA 3PMBB 1UTNA 4MVNA 3M35A 1C1TA 3MO3A 1RXPA 3ZZ6A 1TX6A 5FPSA 1V2JT 5FBEA 5GJ4B 4M7GA 2A7HA 1D6WA 1BBRE 1QRXA 1E34B 4I8HA 5A8YA 1PPGE 2ZQ2A 1V2TT 1AZZA 1A3EH 1O2MA 1SMFE 1P01A 3VXFH 2J92A 4KP0A 4MDSA 1MQ5A 1ZOMA 4ISIH 1GI4A 1HFDA 1TB6H 3UQVA 1YPGH 1QA0A 2A5IA 1WTGH 1MAXA 1ZSKA 4Q7XA 1K28D 1F0RA 1NFUA 4Y76A 1EOLA 3CS0A 3ATKA 3TJUA 3K65B 4NZQA 2I6QA 1YKTA 2SNWA 1OWEA 3A89A 3CP7A 4TY6A 2R0LA 1P57B 2FZZA 2ZPRA 5FXLA 1XXDA 2KZ4A 2FS8A 2UWPA 1BTYA 1C9TA 1T8MA 1W10U 3IITA 1C5ZB 1Q31A 2WPIS 4NIYA 2HVYB 6CHAB 7KMEH 2B0FA 1GI1A 3A85A 3D65E 3F2HA 1C1RA 3SQHE 1LVMA 4U32A 3RXPA 3U9AH 2YNAA 4DGJA 1BTZA 3GDVA 3GY8A 4P00A 1TBRH 3SORA 3URDA 2ANYA 5CHBA 5PTPA 2PGBB 3E90B 4ZXYH 1O35A 4IC5A 3UFAA 4AX9H 1HXEH 1SGDE 4AN7A 3LGYA 4FUEA 3SO3A 3A82A 1QJ7B 2UUKB 4D76A 1O5AB 1T4UH 2ZGCA 1YWUA 2AMDA 1CA8B 1O3HA 5L6NH 3VGCC 1MQ6A 1SG8B 1CHOG 1V2RT 4CHAC 1AUJA 5JB9S 3SV9A 5E8EH 1NTPA 4XD7D 1YF4A 4BTIB 2GZ7A 1W0KD 3B9FH 1TNIA 1ELDE 5KEDA 1GHAG 5DKMA 1HRTH 4MLFB 2C8XB 3SV8A 3DSOA 3NPSA 1GI5A 1SQOA 2XWAA 3PV2A 2SGFE 3KN2A 1QL9A 2K8IA 1HIAA 3SU0A 3LGVA 4WMFA 5EODA 1AZ8A 2FOGA 3PV4A 1THSH 3QK1A 3GISB 3KEEA 1ZMNA 1FONA 3ZZAA 2G52A 4AZ2B 4IN2A 5C0TA 4Y10E 2HNTE 5EQQA 1BB0B 8KME2 2GGVB 2XWBI 1GCDA 1PJPA 4LZ4B 1X7AC 1EP6A 5GWZA 5G4BA 2XNIA 1GBEA 1SVPA 2Y82A 1QRWA 5A09A 1TIOA 2HWLB 3L6PA 5SGAE 1TOCB 2M5TA 2PKAB 2UUJB 1ETSH 3UR9A 2XOKD 3BTEE 5B6OA 3SJ8A 5JBCS 2VVCA 5TCAA 1ZHPA 5A0AE 1QNJA 1O3BA 1GI0A 1UTKA 2P94A 4D8NA 1MTVA 3VB6A 1Y5BT 2VNTA 4XSKU 3ZZDA 1T8LA 4I8KA 1XXFA 3N99A 5C0UA 6CHAC 5L30H 5C3NA 3TGIE 3PMHB 1F0UA 1O2VA 3E0NB 1O0DH 1GBKA 1G3DA 1TLDA 6GCHF 1NBMD 4NFEA 1F2SE 2B9LA 1SQAA 2FDAA 1EJMA 1SLXB 3SQEE 1AFQB 2B8OH 3WY8A 5K0HA 3F9EA 1O2LA 4LXBH 1QFKH 4TT3D 1RS0A 2AEIH 2OD3B 1DM4B 1HYLA 4WXVA 1GGDB 2KCYA 5HGGA 3BIVH 3K6YA 1S84A 3L3TA 4INKA 1ACBE 3D23A 3RUOA 1TNHA 3VFEA 1FY8E 1LPGB 2GCHF 4K5ZA 4R0IA 2SGDE 2BLVA 4J2YB 3I77A 3F1SB 1C2JA 3BSQA 2TGAA 1E37B 1D3TB 2BOHB 1O5GH 3TPIZ 3A7YA 5DP9A 1ZPCA 2C93B 1LHDH 1QGFA 2BXUH 4NIWA 2ZTZA 1QHRB 2QXJA 2JIZD 1TALA 2RA3A 4B1TA 2HLCA 4Z0KA 5FX5A 2Q6FA 3F2FA 1F92A 1KTTB 5C1YA 3ODFA 2SGEE 2IOTA 1ANEA 3PMJA 1T32A 4SGAE 3ZZ7A 1A1RA 3LPRA 4FUHA 2Y81A 4CBNA 1NRSH 1W7GH 4F49A 1XUGA 3ZYDA 3AW1A 1O3DA 3MU1A 3TK9A 5FHTA 4K1TA 1O3FA 1O3GA 1CE5A 1DANH 1KXEA 2Q6DA 2FI4E 4X6PA 1H8ED 1C9PA 3NWUA 4ISNA 4X1RU 1DE7H 1HAZB 1V2QT 1S6LA 2EEKA 1XMNB 2YMSD 3E6PH 2RDLA 4YLQH 5GNDA 1ZR0A 1YPKH 5HKKD 1HAVB 4AG2A 1VITG 1IOEA 3T62A 1UVUH 3NZIA 2PHBA 3VXEH 1O30A 1GWAA 4LK4A 1GJ9B 1C1SA 2J95A 4ZKOU 2EQNA 1TGBA 3GDUA 1DWDH 3RXUA 2VIWA 4UE7H 1AFQC 3TJOA 1FUJA 3AVZA 5JDUB 1GHWH 2WPKS 2EI6A 3A81A 4O03A 3M7QA 5AVDA 1FIZA 1TQ0B 3RXOA 1GGDC 1BJUA 1Z6EA 5T1VA 2Q6GA 1A5HA 2GZ9A 4BTTB 3KL6A 2Z3DA 1O2XA 5HM9A 5KGOA 5GCHG 3LJJA 3GCNA 4DOQA 1C5TA 1TQ7B 1YPHE 3LC3A 4TPYA 2VWMA 3TH4H 4A1TA 1AGJA 4D7GA 5EXLA 5HIZA 2Z9IA 1P3EA 3A8CA 1J17T 3GY4A 1C5XB 3F9HA 3RP2A 5DP5A 3T27A 2TGTA 2YNBA 2XC0A 1QURH 2BQ6B 2W5EA 1WBGB 2Y5FA 2QF3A 1O3LA 3RU4E 2F9OA 2V3MA 4ZKRU 4RT1A 4ABBA 1F5RA 1GDNA 2RCEA 5T6FA 2A32A 1AI8H 2XNDD 3A8AA 1HBTH 4P02A 2F9UA 1WV7H 1AHTH 3R3GB 3U8RH 2D8WA 4Y8XA 1O3EA 1H9IE 1FY5A 1QB1A 4I32A 4JYTA 3FN8A 1LHGH 1K1NA 1ZHRA 2ZHDA 3FP7E 4I31A 1VCQA 3LGTA 5GIBA 5IDKA 2P8OB 1GJBB 1S81A 2BY7X 1MZAA 3RXQA 3UREA 2V7QD 2BDCA 2HLDD 2PP6A 2LP6A 2ZNKH 2BZAA 1K9OE 3F0PA 1C5YB 1QBOA 4IS5A 4AGKA 1O3PB 4HGCA 2H9HA 1HUTH 2XBVA 2BM2A 1TX8A 2GX4A 3QUMP 1TPOA 1C1OA 1AKSA 1PPHE 4CR5A 4CRBA 1K22H 1O2HA 4K8BA 1ELCA 7GCHG 1CBWB 3PWBA 1DXWA 4RI0A 3LU9B 1W3CA 1XUFA 1YPJH 4AB8A 1HAIH 1V2WT 1IQKA 4WVPE 3LJOA 4WF8A 4CRGA 2QGRA 1ELAA 3JZ1B 3P8GA 4AFSA 2OC8A 1BMLA 2AGEX 1XKBC 3OFND 1PQ7A 1LMWB 3TGJE 1G30B 2ZI2H 1A61H 1MTNB 2CMYA 2O8LA 1KIGH 3N7DA 1V2NT 4UFGH 5DP3A 3EYDA 1JRSA 3V7TA 3RXFA 7ESTE 4UEHH 1SOTA 4JMYA 4AORA 3M36A 3TJVA 1SQRA 4D9RA 3HGPA 4YT6H 2Y5GA 2ZDAH 1NS3A 1Q3XA 2DE8A 3FP6E 4GCHG 1NY22 1QBVH 1T4VH 1GJ8B 2P3UB 1C2KA 1W0ZU 4ACBA 1UTQA 1THRH 3ZVGA 5HXFA 2WPMS 2CN0H 4NWKA 3GY3A 4F4OC 2XRCA 3O8RA 3P6ZB 2W6ID 1C5QA 1O2GH 5CMXH 1H8HD 3ATMA 3LGUA 1TA2A 1PQ8A 1IHTH 3HK6B 3FZDA 3RU4D 1FX0B 2ZTXA 2P8OC 2C8WB 3TLOA 1BA8B 2XBYA 2ZCKP 3BTFE 1IQNA 3A8DA 3PRDA 3VB7A 4IC6A 3RMOH 1DLEA 4WH8A 1V6DA 4MNVA 1LKAA 3Q76A 3EE7A 3CS7A 4XE4A 1MKWH 4A1VA 2LELA 1AE5A 4ABEA 1NC6A 4MPWA 3EAJA 1SGRE 1CBWC 2F83A 3M61U 2ZDLA 1BDAA 1EFRD 5JPMH 1KXDA 2WHXA 2GV7A 4X0WU 3GICB 1KSNA 4Y11E 3BG4B 3M3SA 4K8YA 4YOJA 1AVXA 2ZGHA 2NU3E 1WQVH 1MBQA 2V0BA 2KAIA 2F9BH 2H9EH 2ULLA 1GMCF 3A83A 3K2UA 1F0TA 1ANDA 3LH3A 1DLKB 2QYIA 2QC2A 1MTSA 2JJ2D 2QY0B 4JZ1A 1CGIE 4A7IB 5EJ1A 1MTNC 1KDQB 1NU7B 3SUDA 1IQGA 6LPRA 1V2ST 2CXVA 2OINA 2BXTH 1CGJE 3KQEA 1TPPA 2XXLA 4A5TS 3LOXA 1COWD 2ODPA 1HIAB 3SGBE 1O3CA 1BCUH 1KXAA 3RXCA 3FKSD 1K1MA 2J98B 2JDID 3RXKA 3A7TA 2ZFSA 1JOUB 1GMHG 2PFEA 4TYDA 2D2DA 2ZHWH 1O31A 1PYTD 3F2GA 1C2FA 5GPIB 2J2UA 3WW7A 1MD8A 4FUJA 2AIPA 2FYRA 3BG8A 4FETA 4X2WA 2GJGA 1NFXA 1RRKA 2F9NA 1ELGA 4OS4A 1AIXH 1QQ4A 1A3BH 3MU8A 4NIXA 2HGTH 4DIIH 3Q3KA 1NM6A 4CRFA 1YPEH 4B76A 1Z8GA 1S6HA 1QIXB 3M37A 4CH2B 4DJZB 4Q7ZA 4FUIA 1A4WH 1GHBG 3LGWA 4JCNA 4ZXXH 1S83A 1LPZB 2ZDNA 1ZHMA 1VCWA 2OQ5A 3OY5U 2ZFPH 1EJNA 3PV5A 1OP0A 1GJCB 3SNAA 1O3AA 2BD5A 5FPTA 1BUIA 4O9VA 1FY3A 1TBQH 4NFFA 1UVPA 3KQCA 3RDZA 2QF4A 1ESTA 1UHBA 2HPPH 3GY5A 1NRPH 2IJD1 3F3BA 4H6TA 1WDIA 2FS9A 3BTTE 2ZCHP 4CR9A 3UQOA 3BG4C 4BANB 2TPIZ 1NU9A 1BZXE 1PQAA 1IQFA 3SGQE 2IJOB 3MH7A 1SGYE 1EAWA 2D26C 3S9BA 1DS2E 2Y80A 3HK3B 1NRNH 3UNRA 5DSFA 2FLRH 1C2IA 1SC8U 5C5OA 1GBJA 5FL7D 1C5VA 1GMDG 5E0GA 1P02A 1H9HE 1P2OA 2Z9GA 2A4RA 3U98H 8ESTE 3KYGA 4Y6DA 3SW2B 1HJ8A 1EKBB 2ZGBH 4DG4A 1JIMA 1PQ5A 2ILNA 2OC0A 1HJAC 1TPSA 2THFB 3SHCH 1BMNH 3A88A 4INLA 2Z9JA 1XVOA 5EJZA 1MKXH 1GDUA 1HB0B 1WXRA 3TIUA 5EXNA 4UFFH 1XUJA 2ZU5A 1V2LT 1IHSH 4BXSA 2H1UA 3M5NA 2AMPA 1E1RD 1KXBA 5EPNA 3MU0A 3U8OH 4I86A 2BTCE 1TMUH 1DFPA 3FOAA 3SV6A 1DWEH 2Y7ZA 5EW2H 1O2JA 5HIYA 3M7UA 2OQUA 1LCYA 3KNXA 5J4QA 4IN1A 3K6ZA 2J5UA 4I7YH 1O2TA 3FFGA 4Y8YA 1G3BA 2BX4A 2O8WA 4KTUA 4TSFD 5LGOA 2EI8A 2EI7A 1DY8A 2FP7B 3SBKA 1MCTA 4ABFA 1ETRH 3F0OA 5JYIA 2PSYA 1EAUA 1BRBE 3M7TA 2PGQB 1DUAA 1SI5H 1ZJKA 1CHOF 2C8YB 1C5PA 4FOUC 3T25A 1MH0A 4ASUD 1NPMA 1N1LA 4BAOB 1E79D 4Q2KA 1MCVA 1RTLA 5DN6D 5TJXA 5H4IB 2HPQH 4IMQA 2PWXA 1ZSJA 1GHAF 2R9PA 1LVBA 1W0JD 5ABWA 4YLUA 1WYKA 1TNJA 4ABHA 1INCA 2OP9A 2VWLA 4ASHA 2H9TH 1UTJA 2QXHA 4YXWD 5C67A 4JZEH 2LNCA 3O8CA 1PFXC 4K1EA 4Y8ZA 3SI4H 4RKJB 2BVXH 1K1OA 3ATWA 1KTSB 3BTHE 3QX5H 1PPFE 1LHFH 5C2ZA 1AQ7A 2RFKC 1FZZA 1LO6A 4X6MA 1O38A 2FI3E 1JBUH 5DP6A 3U28C 1UK4A 5CHAB 1AD8H 2PLXA 3Q77A 1SGQE 4E7RG 1YY3A 5F8TA 1GVKB 2ZFRH 4BAQB 2ZFTA 4ZH8A 1SQTA 5DPAA 3UIRA 3HGNA 3SJ9A 1ABJH 1AMHA 1WU1A 3I29A 3A80A 2BD9A 3SNBA 3UR6A 2A45B 4ZKSU 1IQLA 3MTYA 2D1JA 2GT7A 1CA0B 2GDEH 1P10A 2J94A 2AYWA 9ESTA 6ESTA 1UW7A 2VBCA 3DFLA 3Q3YA 4B71A 1PPCE 4WH6A 2SGAA 2KCOA 3LC5A 1QY6A 4B2CA 1CQQA 1O5BB 1GBMA 1ZLRA 3WWBA 1DT2A 3ITIA 4Z6AH 4ZUHA 1EP5A 3VPKA 4NWLA 2SGQE 4FUGA 1C4Y2 1GBIA 1HAXB 3A84A 4YM9A 1YCPH 1N6YA 1L0ZA 2C3SA 1A5IA 2HOBA 3Q00A 1D3QB 1HV7A 2BQ7B 1YCPM 3NCLA 1VITH 1T8NA 3P8NA 2CGAA 3SHAH 3FAOA 2Z3CA 5C17A 3ATIA 1QB9A 2BDIA 1DY9A 1P03A 1EUFA 1L4DA 2GZ8A 4WXIA 5AF9H 2VIOA 3W95A 4B74A 4X1PU 1OYTH 1AVWA 1BRAA 1CU1A 2ZFQH 3GCTG 2A4GA 4YTAA 2FEQH 1O2YA 4X1NU 2ZCLP 4XRNA 1OWIA 3KQBA 2QF5A 2FOFA 2KM0A 3UAIC 1LQEA 1EOJA 4ABAA 1P2NA 2ESTE 5CHAC 4MQAA 4AYVB 4X6OA 2ANMH 2CHAB 3D49H 3TNSA 2BY5X 3ZZ5A 1MU6B 3PB1E 5LPFA 7LPRA 5EXMA 1SFQB 4AYYB 2A4OA 3QZRA 2PTNA 1ESBA 2DE9A 2UWLA 2XBXA 3QGJA 1E36B 3GCHB 4OS6A 1AO5A 1O2OA 3RXHA 2WPHS 5I25A 2A2QH 1F0SA 1GL0E 1W11U 3AAUA 3VB5A 3BTGE 3KCGH 1EX3A 2STAE 1GI2A 1CA0C 1KYNA 2BMGB 4O3UA 4CH8B 1EZSC 2ZO3H 1VITF 3EE0B 4A6LA 1BTWA 1ID5H 4I8LA 1H1BA 2R3UA 3RU4T 1ESAA 1ORFA 1BQYA 2QN5T 3UPEA 2VVVA 1NRQH 3RM2H 1OP8A 2AGIX 3ZIAD 1MKWK 2QXGA 5EGMA 1GJ6A 4FU8A 3SUGA 3E8LA 4JK5A 1JMOH 2PKSB 3SUFA 4AGJA 4H6SB 3NXPA 1P0SH 1DXPA 2VIPA 1HNEE 5B6LA 1O3OA 2VU8E 3SYJA 1GBAA 3ZVDA 5GCHF 1C2LA 2YMSB 3PO1C 2RG3A 1TWXB 1OPHB 1V2MT 2PUQH 1RTKA 2HALA 1GVZA 4JZFH 1V2VT 3GCOA 3S9CA 3SOSA 3LGIA 1VJAU 1YLCA 2ANWA 4XBDA 3P70B 1C1WH 1Y5AT 2AIQA 1LDTT 2ZDKA 2G00A 1HAYB 4GHTA 2V6NA 1DSTA 1GBBA 4ABIA 3H7TA 2XC4A 3GY6A 1EAIA 5DG6A 1P3CA 2H6MA 2ZKSA 4ABJA 1F7ZA 1E35B 5GXPA 1OXGA 1TA6A 4X2YA 3C1KA 4D9QA 1HAPH 3DFJA 4E06H 3U1JB 2CHAC 2FX6A 1GCTB 5EJLA 1BIOA 1TAWA 3SZNA 1GJ5H 1EPTB 1J15A 3KHVA 2ZC9H 1FQ3A 1MTUA 2G5NA 3GCHC 3SJIA 5A2MH 1A0LA 1ANCA 3PTBA 2O8TA 1UVTH 3BTWE 4Y7BA 2P3FH 4XDEA
chains in the Genus database with same CATH topology
1J8AA 1G3EA 2BD8A 3RXSA 2GVFA 4ESTE 2FOCA 1BBRH 1FPHH 1EB1H 4H4FA 3MI4A 3RXVA 3LIWA 5C20A 1O34A 2TGDA 2W3KA 1D3DB 1BJVA 1QA7A 2O9QA 1MD7A 4FUBA 1KLIH 1O2PA 3A7ZA 2PKAA 7GCHF 1C1VH 2ZWLH 1TRNA 1SFIA 1Z7KA 2CF8H 2HNTC 3I78A 4DURA 2BLWA 1C5NH 1CVWH 3RM0H 1NROH 2PKSC 1GL1A 5EQRA 1DITH 1UHBB 3ZVAA 5E0JA 5BRRE 2EA3A 2Z9KA 1F5LA 1Q2WA 3FVFB 4DT7B 2WPLS 3SI3H 1D3PB 2GDDA 3IG6B 2C8ZB 3S0NA 2R0KA 2BDHA 4JZIA 4Y7AA 3MNBA 4ZMAH 1P04A 4NZLA 9LPRA 1KY9A 2G51A 3MOCA 5F03A 2QIQA 2VINA 3M3VA 4KGAA 1VJ9U 3HKJB 1H8IH 3C27B 1AVGH 3PMAB 4D7FA 4GCHF 1Y3UA 2HRVA 4YOIA 4OGXA 3GDSA 1K2I1 1HAOH 1VR1H 5ESTE 1CGHA 1TMTH 2NU1E 2QV1A 1PPEE 2VIVA 1BTPA 5DP4A 1GI9B 4JZDH 1JIRA 2ZHFH 1EJAA 2ODQA 4WMEA 1C5OH 4FUFA 3RXEA 2BLOA 4LOYH 2LPRA 1GCTC 2Q1JA 1XVMA 4JYVH 1EPTC 3ZYEA 1MKXK 4NA8A 1FY1A 2FTMA 3SU1A 4BTUB 8GCHG 1W12U 4WMDA 1Y3VA 2F9VA 3K9XB 3SU4A 2C90B 4K3JA 3S7HB 1C4V2 1F5KU 1Y3XA 2ZU1A 1HLTH 3BN9A 1C2GA 3MNCA 4KTSA 5LH8A 3RXLA 3ZZCA 1DUEA 3QLPH 5EG4A 1FAKH 1EZUC 1C5RA 2GMTB 1O3KA 1IQMA 4X2VA 2BB4A 2XCNA 4TWWA 3MO9A 1JWTA 1HAHH 1S0QA 1KLJH 1SOZA 5ETXA 1C5WB 2Z3EA 2A5AA 2QA9E 1S6FA 2XBWA 1Y3YA 1FY4A 2G81E 1OWKA 1YGCH 4CRDA 5TCCA 5JBBS 2AMQA 2GD4B 1TGTA 4TY7A 3M3TA 2VVUA 1B0FA 1O2ZA 1NZQH 3A7XA 4BOHA 3SN8A 2B7DH 4ISLA 1QBNA 2WYGA 1XKAC 2G4UA 1LQDB 3DUXH 2QCYA 1ELTA 2B5TB 4ZHLU 4ABGA 2H5DA 1A46H 1CSOE 3RXMA 1SR5C 4Y0YE 5DK1A 2J4IA 2VH0A 1TFXA 2FOEA 4DVAU 4B2AA 1DWCH 3F9GA 3KQDA 1J9CH 5DP7A 1WUNH 4GVUA 1G2LA 4XFQA 2BZ6H 1GMHF 1MAYA 1SGFA 4U2WA 2BDBA 1P12E 1TGNA 1G32B 1P2KA 1HXFH 2ZHQH 3MFJA 1PPBH 1HCGA 2A7CA 3P17H 2WV4A 4ZROA 1HJAB 8LPRA 5DGJA 2BYAX 1NFWA 4Y71A 2F91A 3KGPA 3ZZ3A 4FVDA 2WYJA 3CENA 1G37A 2NWNA 4E05H 2FI5E 3RC4A 4B73A 2UUFB 2BDGA 2J34A 2ZU4A 2BY8X 1GHBF 1CT2E 2FO9A 4OS7A 3BTME 2G5VA 3NUMA 3A8BA 1AUTC 1YPHC 4UD9H 1AU8A 2G4TA 3F9FA 4K60A 4R8TB 1U6QA 2AS9A 5FX6A 3LH1A 1AY6H 2W26A 4CRAA 1SLVB 4WWYA 1ANBA 3STJA 5C5NA 3AW0A 3GYMA 1C5UA 3DHKH 4ZAEA 3TU7H 5GDSH 5IYTA 2CJIA 2GMTC 2P95A 3ZZ8A 2OLGA 4HTCH 4DCDA 3FANA 3RXTA 4CBOA 1GHXH 3SU6A 4NSYA 1YCPK 1P8VC 3B8JA 3TK6A 2BQWB 1SBWA 1H4WA 1O2QA 1UTLM 4LZ1H 3ODDA 1N8OB 3UOPA 1L1GA 5E2OA 3IWMA 1QB6A 1S85A 4CREA 2G8TA 2BD4A 1BRUP 3HATH 2G55A 1C1QA 1O2IA 1YBWA 1GI3A 4O97A 1GMDF 3LONA 1BMAA 2FOAA 3U1IB 1HJ9A 2BX3A 1V2UT 1O3JA 5HMAA 3TITA 1BTUA 1V3XA 4PROA 3EGKH 5A0CA 4WY3A 2R3YA 1O5CB 3GY7A 1C2EA 3RLWH 3UWIA 1GG6B 1EASA 3OU0A 1FIWA 1W7XH 1C1NA 1S5SA 3RXGA 3RXIA 2ZP0H 2PV9B 3UTUH 1TYNA 3SU5A 1UCYK 4NGAH 1Z71A 4X1SU 4TWYA 4AOQA 1EZQA 1GBCA 1BTXA 3BTKE 2FXRA 3SGAE 2GT8A 3PLKA 1UTPA 5EU8A 4X8UH 3BV9B 4IBLH 1K21H 3T5FH 1P2MA 3QO6A 1TX7A 1YPMH 3R0FA 3UWJH 3N7OA 1ZRBA 4U30A 3MNXA 2ODYB 3ATLA 1C1UH 1O2UA 3SNEA 1G36A 1G9IE 1O5FH 1FV9A 1GI8B 1OP2A 2AGGX 2VIDA 1CO7E 1AWFH 5BPEA 1V2PT 2DUCA 4FUCA 5HM2A 4FUDA 4X8TH 4X6NA 1Z6JH 4NIVA 1PYTC 2ZFFH 1P9UA 2FWWA 1J16A 4I8JA 1IQHA 1B5GH 3ZVBA 1W14U 3SU2A 1SGNE 1BTHH 3LKWA 3FZZA 4MPXA 4HI3A 1BRCE 3B23B 1AWHB 1N8OC 2GV6A 4HFPB 1Z8JB 2PW8H 1S0RA 5L2ZH 3SUEA 1T8OA 2C4FH 4IGDA 2J38A 3MH4A 4ISOA 5A8XA 1O2WA 1Y3WA 3SJOA 1SB1H 1ZTLA 1UVSH 2NU0E 3AASA 1P06A 1UK3A 1DOJA 2VGCB 2ZZUH 4RN6A 1YPLH 4X8VH 2FOMB 2BDAA 4UDWH 2ZQ1A 4GSOA 2VWNA 1SLUB 1OWHA 3TNTA 4AFZA 4KKDA 1B7XB 1QJ1B 1XX9A 5JBAS 1GG6C 2ALVA 1XUKA 2FYQA 2FOHA 3PTNA 1NN6A 1ZMJA 1XM1A 1Y59T 2A5KA 2NU4E 5AFYH 2Y6TA 1OWDA 3UY9A 1J14A 5HYOA 1KDQA 4JYUH 2ZU2A 1GJDB 4NA9H 4RSPA 1O5EH 1SSXA 2BLQA 1C2MA 1SPJA 3EA8A 1KXCA 1IAUA 3DD2H 5T6DA 1GHZA 1GBDA 1SGEE 1ZGIA 5FCRA 1A2CH 3RLYH 2O8MA 1FAXA 2AERH 3EDXB 1YP9A 1D6RA 1BBRK 1BITA 1NFYA 2AFQB 1FNIA 1LHEH 2BOKA 1YYY1 4THNH 2OCVB 2JH0D 1Z1IA 4INHA 3UOUA 2BD3A 1RJXB 4NA7A 3P8OA 2VB0A 4OS2A 2Z9LA 4GLYA 5DJ7A 2P16A 3S7KB 2Y7XA 1A5GH 1FI8A 3QTVH 1LVOA 2NU2E 1CT4E 1ETTH 3FP8E 4AG1A 3MU4A 2ZPQA 1AKSB 1RFNA 1TNKA 2A0QB 2OXSA 3DA9B 1G3CA 1IQEA 3RXDA 1TBZH 2H5CA 2XTTB 5EW1H 1A7SA 1WCZA 1ELVA 1NESE 3V3MA 3PO1B 1QRZA 2I6SA 2JETB 1BMMH 3F68H 1TE0A 1L4ZA 1L1JA 3PROA 1BHXB 3GCTF 3BF6H 3O8DA 3UNSA 4DW2U 1VZQH 1THPB 2VGCC 3OTJE 2PUXB 1ZTJA 2BD7A 4E7NA 1P11E 1TMBH 3M5OA 2VH6A 2ZTYA 2VWOA 6GCHG 1C5LH 2FLBH 1W13U 1GPZA 4YT7H 1HPGA 1SHHB 2BY6X 5C1UA 4AB9A 1UCYH 1UTMA 2YOLA 1YM0A 1T31A 1DWBH 1GBFA 2BDYA 1EATA 1BT7A 2GCHG 3RXBA 1GBTA 1EAXA 2FIRH 2TIOA 1WQSA 1H8DH 1G2MA 1UO6A 1YC0A 4WJG2 1O3IA 1ZJDA 5F8ZA 4A1XA 3MNSA 3O8BA 2QXIA 2WINI 1VCPA 3PYHA 3MH5A 4Q7YA 4I33A 3QDZB 1GHVH 5JB8S 4B75A 2ZPSA 1Z8RA 3KIDU 4NG9H 2ZA5A 1C4U2 2P59A 2ZG0H 5E0HA 3STIA 1EXFA 1M9UA 4U01A 3SNDA 1K1IA 4J1YA 1NT1A 1XUIA 1DSUA 1TABE 1LTOA 1EZXC 1D4PB 1LHCH 3H7OA 4DY7B 3ZVCA 3T28A 1Z8IB 3L33A 3GYLB 1ZPZA 3UUZA 2ZGJA 1C2HA 1TONA 5LPEA 3JZ2B 1C1PA 1NO9H 1LKBA 3OYPA 1RGQA 2FMJA 3NKKA 5F8XA 2VJ1A 4KELA 2JETC 4OS1A 1QL7A 1W0YH 3OSYA 2KAIB 3S69A 3PWCA 3SV2H 1ZZZA 1A0HB 5A8ZA 1O37A 4GUXA 1DDJA 1GJAB 2VIQA 2JH6D 4ZHMU 4BAMB 2ZF0H 3T2NA 4CRCA 5JBTA 1UTOA 5LPRA 1L2EA 1ZYOA 5ESBA 1WSSH 1JXPA 2ZU3A 4MNXA 1FDPA 1OSSA 4OGYA 1Y5UT 4ABDA 1OOKB 4UFDH 2ANKH 2WUBA 1ZMLA 3MU5A 1OS8A 2CF9H 1ELEE 3SNCA 2XW9A 3GOVB 2FESH 1DPOA 1QJ6B 1N6XA 1P9SA 2ZECA 3ZZ4A 1QR3E 3RXAA 2QAAA 2XCFA 1GHYH 1WAYB 2PR3A 2SFAA 1RIWB 5F6MA 5FBIA 5FPYA 3T26A 3W94A 5T3HA 4VGCB 1AB9B 2A1DB 3GY2A 3TVJB 3V12A 3E3TA 1QCPA 1V2KT 1UVOA 2OC1A 4Y79A 4O3TA 4JK6A 3V13A 4K69A 4NSVA 4MG3A 2Z7FE 2BD2A 4AFUA 2Y5HA 1HDTH 1O2KA 3U8TH 1AFEH 3ELAH 1AN1E 3EA9A 3V0XA 3SU3A 4A92A 3DT0H 1DICA 3U69H 3ENSB 4XBBA 5A0BA 2A2XH 3RMMH 3ZV9A 2WPJS 1CHGA 1TGSZ 1GBLA 4Q80A 2ZIQH 4YESB 2JKHA 3Q3XA 2TBSA 1MU8B 2FX4A 3BIUH 4TPIZ 2FODA 4AFQA 1FJSA 3QGNB 4K1SA 1TRMA 3ZZ9A 1O33A 1FMGA 4YOGA 3VB3A 5FCKA 3P92A 5AFZH 1MMJN 2FM2A 2R2MB 3MWIU 1DX5M 1T7CA 2BY9X 1ELBA 1RD3B 3BTDE 1L1NA 1P2IA 3OX7U 5E2PA 3T29A 2ZEBA 1GVLA 4OS5A 2F9PA 2P3TB 4HZHA 1O3NA 3AAVA 4NCYA 2ALPA 3QN7A 1O5DH 1O3MA 3ZVEA 4BNRA 8GCHF 3MYWA 1SL3A 1EQ9A 1Z1JA 4KTCA 5EQSA 3TH3H 3MO6A 5EPYA 2XYAA 3A7VA 3E0PB 4K2YA 3LDXH 3G01A 1LPKB 1AE8H 4UFEH 3P95A 1C5SA 1SLWB 2GTBA 1NRRH 1QTFA 1V2OT 1ABIH 1FN8A 1HGTH 1O32A 1RIWC 3ZZBA 3EA7A 5L2YH 1JRTA 3UNQA 3LT3A 1CT0E 1BHXF 1AB9C 4VGCC 1WTHD 2K1QA 2BVSH 1UK2A 1TNGA 1ZTKA 2CV3A 1BOQA 3HKIB 1W8BH 2A7JA 1Y8TA 2OTVA 2RA0A 1GJ4H 2FPZA 1FN6A 2IN2A 4X8SH 3A87A 3QWCH 5J4SA 1KLTA 1VGCB 1W2KH 1SHYA 1P05A 5T6GA 3NK8A 1S82A 2A31A 3QZQA 1UMAH 2SNVA 2UUYA 2GCTB 2AH4X 4GHQA 1ZSLA 3PM3A 2P93A 3PLPA 3RC5A 1UJ1A 1SGIB 1QQUA 1GDQA 1SGPE 1ELFA 1P2JA 2ZDVH 3A86A 3TK5A 2V3HH 3H5CB 1GI6A 1O2SA 4I8GA 1HAVA 1ZGVA 4MTBA 3SJKA 4SGBE 2O8UA 2FOBA 4IMZA 5CE1A 5K7RA 5EOKA 1A0JA 3P8FA 4DIHH 1WOFA 1EB2A 3URCA 1GI7B 1FLEE 1O2NA 4ZKNU 3KF2A 1UCYE 3BEUA 2TGPZ 1OKXA 1MUEB 1OWJA 3ZV8A 1RTFB 4GAWA 2PTCE 4GPGA 2W3IA 2WV5A 1MBMA 3S9AA 3MH6A 2OBQA 2HNTF 4RKOB 4FU7A 1ARCA 3ESTA 1XUHA 2BVRH 3TGKE 1GMCG 4H42U 3QTOH 2W7UA 2W7SA 2BHGA 3M5MA 1P09A 1K1JA 2EC9H 1TNLA 1HAGE 1O36A 4QT8C 1PPZA 1B0EA 4MNWA 3M5LA 2H2ZA 1YLDA 4XOJA 1TRYA 1OYQA 4B2BA 1C5MD 1EPTA 2OC7A 2ZDMA 4FXGH 3TJNA 1FPCH 4XBCA 5DP8A 2HVXA 1ZRKA 2XC5A 1QL8A 3TH2H 1O2RA 3F6UH 3PLBA 1FXYA 1MZDA 5I46H 3SV7A 3RMNH 1VGCC 2IPHA 5FAHA 4MPUA 4FVBA 3ZVFA 1SGTA 2FTLE 1ZPBA 2GCTC 1TPAE 4FU9A 4BXWA 3HPTB 1GBHA 2STBE 1SGCA 2TRMA 3E1XB 4BAHB 5DO4H 4Y0ZE 5C1XA 2Z94A 1SGFG 2WUCA 2Z6BD 1K1PA 1OX1A 3EQ0H 1O39A 3MMGA 2ZHEH 3VB4A 1C2DA 1E0FD 2UWOA 3BTQE 4ZHAA 1ARBA 2QF0A 3RMLH 4UONA 1C1MA 1TGCA 3RC6A 3E91A 1IQIA 2J9NA 1H9LB 1TOMH 2GKVE 3RXJA 1IQJA 1D9IA 2V3OH 2A4QA 4MNYA 1GJ7B 2F3CE 3BEIB 3MHWU 3OY6U 1P2QA 3VEQB 1DVAH 3BEFB 5AHGH 4X2XA 1KXFA 3A7WA 3VGCB 4YZUA 2ASUB 2R2WU 4CHAB 1E38B 4BAKB 4X1QU 4YO9A 2SGPE 3D62A 4IW4E 1K1LA 2V35A 2JH5D 2PSXA 4MPVA 2GP9B 3E16B 1LVYA 3RXRA 1MTWA 2ZGXH 4ISHH 2OBOA 2OUAA 3PMBB 1UTNA 4MVNA 3M35A 1C1TA 3MO3A 1RXPA 3ZZ6A 1TX6A 5FPSA 1V2JT 5FBEA 5GJ4B 4M7GA 2A7HA 1D6WA 1BBRE 1QRXA 1E34B 4I8HA 5A8YA 1PPGE 2ZQ2A 1V2TT 1AZZA 1A3EH 1O2MA 1SMFE 1P01A 3VXFH 2J92A 4KP0A 4MDSA 1MQ5A 1ZOMA 4ISIH 1GI4A 1HFDA 1TB6H 3UQVA 1YPGH 1QA0A 2A5IA 1WTGH 1MAXA 1ZSKA 4Q7XA 1K28D 1F0RA 1NFUA 4Y76A