2G5VA

Indole-amidine complexes with bovine trypsin
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cationic trypsin
publication title Ligand Epitoping By Proton NMR Chemical Shift Differences
rcsb
molecule tags Hydrolase
total genus 59
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2006-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2g5vA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2g5vA02
1K28D 4DGJA 4JZDH 1UVUH 5HXFA 1MCTA 1DX5M 2P94A 3LC5A 5FBIA 3TLOA 2KAIA 5FCKA 4UD9H 1O2YA 1UVPA 4VGCC 1SI5H 3GDVA 3W94A 1NU7B 1GL0E 2AERH 1M9UA 1GL1A 1O2UA 3TJNA 1HXFH 1AE5A 2HOBA 3ATWA 1V3XA 2WINI 1C5MD 2OD3B 4KKDA 6CHAC 1D3PB 3JZ2B 1CHGA 1GBMA 1C2LA 1CGJE 1QBVH 4ABIA 2ANWA 1GJBB 4M7GA 4CRDA 1W7GH 1B0FA 1HAGE 1FDPA 2D8WA 3BEFB 1AE8H 1C5NH 1TGSZ 4X6MA 1IHSH 2GZ7A 1HGTH 3STJA 4X1QU 1EQ9A 1O3NA 1UJ1A 3VPKA 1IQNA 3GY4A 1CE5A 2BY9X 1O2OA 3MHWU 1DSUA 1H4WA 1YM0A 2BD3A 2NU4E 1DWEH 1JOUB 3M7UA 5L30H 1ETTH 4I8JA 2GVFA 1F5LA 5E0HA 1NFUA 4YESB 3KL6A 3M61U 4H4FA 1FY1A 3OSYA 1EZXC 1BTYA 2FODA 1S5SA 1O2SA 1LKBA 4FU8A 1YP9A 1T8MA 4ZXXH 1GCTB 1V2NT 3DHKH 3EYDA 4Z6AH 4WVPE 1MTWA 2FTLE 1TALA 2VNTA 1QL9A 3ATKA 3SJIA 4KTSA 4I7YH 2R3UA 1ZPZA 4AN7A 2ZEBA 1P03A 4ABJA 3RXLA 4TPYA 3EGKH 3STIA 5CE1A 1AVXA 3RLWH 2A7CA 1O3OA 1KXCA 2EI7A 2VH6A 1N8OB 1MKXK 4O3TA 1KXFA 3WY8A 2PTCE 2AIPA 1W14U 3S9AA 1AFQB 3UWIA 5F8XA 3D49H 1O3JA 1Y5BT 3HGPA 1OXGA 3TGIE 2PTNA 2ZPSA 1C9PA 4UDWH 3H7TA 4RKOB 1YF4A 5A8XA 2BQWB 5EU8A 3PM3A 4X6OA 1MQ6A 3A7XA 1THRH 5JPMH 1BBRK 1GHVH 3NK8A 2AIQA 3Q3YA 1XKAC 1DPOA 1HAHH 2WPJS 4AFUA 5BRRE 3VFEA 1KXEA 5F03A 2TGPZ 2PWXA 2WPMS 1PJPA 2FS9A 3SV9A 1T4VH 2C8WB 2SGPE 1MH0A 1PQAA 1C5YB 3VB3A 2OQ5A 1O37A 1KDQA 2XBVA 4O9VA 1PPFE 1A61H 1TONA 1Z8GA 4ZAEA 4ABFA 1CGHA 1CBWB 1MTNB 4I31A 1GVLA 2H9TH 5K0HA 1TNHA 1UK2A 2A4QA 1LVOA 1EAIA 1GHAG 4NSYA 1C5QA 5LH8A 1HJ9A 2HGTH 1UTJA 5TCCA 3GCHB 4ZKRU 4HGCA 1BRUP 1XXDA 3QDZB 5FCRA 4MTBA 1AKSA 1XKBC 3F68H 2PKAA 3TU7H 3UOPA 1EXFA 1HNEE 1C1SA 1C2HA 1ANBA 2BOHB 2PKSB 1C4Y2 5T6DA 3RC4A 1LO6A 3E8LA 4KGAA 1ELVA 3QZRA 1HRTH 2GT7A 2ODQA 3BTFE 1QBNA 4KP0A 1DT2A 3RMLH 4NZLA 4LZ1H 1UCYH 2ZGCA 3KCGH 1AZZA 1HV7A 5GCHF 1Q3XA 4Q7XA 1SGIB 4A6LA 2CF9H 4DIHH 5EOKA 1GMHG 1C2MA 1BHXB 4WY3A 2Y80A 3P95A 1UTPA 1SLUB 3T29A 1BIOA 2GDEH 1O3IA 4JMYA 3DFLA 5G4BA 1FZZA 2P59A 3SUDA 1T8OA 1ACBE 2ANMH 4A7IB 3RXMA 2ZCHP 1VCPA 3HPTB 1ZJDA 5FX6A 4GCHG 1YPHE 1OWEA 4X2VA 3S7HB 3TH3H 2ZFFH 1NO9H 4NCYA 2TRMA 2AFQB 4CR9A 4Y0ZE 1J16A 2GX4A 3LGYA 1Y3WA 1RIWC 2QXIA 4DVAU 2ZGJA 4GHTA 4MDSA 1C2JA 1VGCC 3SORA 1HBTH 1D4PB 1W0YH 3RMOH 3AAVA 2STBE 4Y0YE 1O5CB 3H7OA 5CHAC 1LVBA 1K2I1 1FY4A 1UHBB 3KEEA 2AMQA 4OS1A 3A86A 1ANEA 1N6YA 4DT7B 3A8DA 1GDNA 1GHXH 4D7GA 1WTGH 1A4WH 2OXSA 4GLYA 2QA9E 1ZJKA 4U01A 1GHZA 5E0GA 1YYY1 1K21H 1MAYA 4X1SU 4JK5A 2TBSA 2YOLA 4Y7BA 5EQSA 3SGQE 3SV8A 1ZOMA 3T28A 1G36A 3DT0H 4RN6A 2WPIS 1DWCH 2CXVA 4B2BA 4XFQA 3VGCB 3RXCA 4SGBE 5B6OA 1ZR0A 1EJNA 2QY0B 2WPHS 1W2KH 1YLCA 3M5MA 3QTOH 4XOJA 2ZO3H 1MKXH 1C5TA 1F5KU 1RTLA 1Z1JA 2ZDVH 1EAXA 2ZC9H 1OWDA 4I8LA 1GBJA 4D7FA 3UFAA 2F9NA 2OINA 2QXJA 1TGNA 1O3FA 4BANB 3U98H 3AVZA 3ESTA 2ZDNA 1CSOE 1V2OT 2Z3DA 5JBBS 3GDSA 2P8OC 3KQEA 4AG1A 1CT0E 1BRBE 4J1YA 3RXTA 1C5SA 2QCYA 1ZMJA 4MNXA 3SU5A 1DANH 3F9EA 2WUCA 3SI4H 1FONA 3DA9B 5A0CA 5JB8S 2A45B 1RXPA 2BTCE 3UUZA 1BRAA 1QA0A 4ABHA 4MPVA 2BDCA 1ZLRA 1QIXB 3UQOA 1VR1H 1A3EH 1IQMA 3PTBA 2SNWA 4ISHH 1EPTB 4IGDA 4K2YA 3E90B 1BDAA 1O35A 3O8RA 1J17T 4MPUA 3VB5A 4CR5A 2OLGA 4YT7H 4TY6A 1UTQA 3S9BA 3B8JA 1S6FA 1V2QT 4JYTA 4CRCA 2G81E 3F9HA 1O3GA 3RXUA 3K65B 2RG3A 4I8HA 1YCPM 4AFZA 1IHTH 1XUKA 1S0QA 3M36A 1NESE 4CBNA 1P57B 3BF6H 1GBEA 5EQQA 1GG6B 2UWOA 4Q7YA 4NIYA 3RXAA 1HAVB 8ESTE 1CHOG 1EAWA 2ZU5A 2ASUB 4TYDA 1MMJN 4CHAB 4NZQA 2D1JA 2V35A 5T6FA 5FXLA 4LK4A 3G01A 2BZ6H 2PUXB 2Z9JA 2G00A 3UNQA 2ZHFH 2BQ7B 3BEUA 3BTGE 1SC8U 4AOQA 1B0EA 5C2ZA 1FIWA 5EPNA 5F8ZA 2NWNA 1J8AA 1IAUA 5ESTE 1UTNA 2K1QA 3C27B 4MNYA 2A7HA 1CQQA 5A8YA 3QUMP 3EA9A 1MU8B 1EKBB 2Y7XA 2BDBA 1GBKA 4WMEA 4Q80A 1K1IA 3O8DA 1O2JA 2GMTB 3ZVBA 1PPGE 1AUJA 2BVRH 1SQOA 3M37A 4JZFH 4DURA 4UFEH 2R0LA 3ZZ5A 2VINA 1C1TA 1PPCE 3PO1B 5H4IB 1VJAU 4CH2B 4WF8A 5DP8A 3RM2H 2Y81A 1Q31A 3M7TA 4I33A 4H6SB 2JKHA 1IQHA 2BVSH 3Q3XA 4WJG2 3M3TA 4CREA 2HRVA 1JIRA 2PSXA 2PW8H 1A3BH 1ZRBA 1J14A 5HMAA 1TB6H 2XRCA 5IYTA 4CRGA 2BDAA 2SGEE 2J34A 3TVJB 2FZZA 3BG4B 3T27A 2F9VA 1HJ8A 2HNTC 1O2WA 2OC1A 1BQYA 4ABGA 5ABWA 2UWLA 4A1TA 2YNAA 3PROA 4X1PU 1G3EA 3ZZBA 2B5TB 3NZIA 1HIAA 2A5AA 5C67A 1DY9A 2XC4A 4JYVH 3U8OH 1UTMA 3GYLB 6LPRA 1SMFE 2FOFA 2ESTE 4WXVA 4X1NU 3PB1E 4B2CA 1MUEB 3F6UH 4O97A 1G32B 1SHYA 5FPTA 4X6PA 4X8TH 3ELAH 3D65E 3SUFA 3IWMA 2GZ9A 3ZZDA 2P3FH 2ALVA 3MNXA 4Y8XA 3SU6A 4Y71A 1RFNA 5FPSA 4K1SA 1VCQA 1QQUA 2BDIA 1OP0A 1EUFA 3U8RH 1F0UA 4I8KA 1O3EA 1BOQA 3PYHA 4AG2A 1A46H 2M5TA 3A7WA 3B9FH 1PQ7A 3SNDA 3GOVB 4AORA 1Y5UT 1WCZA 1X7AC 4WXIA 3LGIA 3I77A 1TQ0B 1ZMLA 2FLRH 2W7UA 3MYWA 1LHGH 1YPJH 3A82A 5DO4H 1C5OH 1GI0A 3EDXB 1T32A 1EJAA 3QGNB 1OWIA 3UIRA 2QF3A 3QTVH 2XBYA 2AMDA 5GPIB 7ESTE 3MNBA 2VVUA 1UO6A 1LHEH 2P95A 3RXGA 1TA6A 1N1LA 4R0IA 3Q00A 1SGTA 1TWXB 1O2LA 2Y6TA 3URCA 1ABJH 4JZ1A 1DWDH 3SV7A 3BTQE 4K5ZA 4Q2KA 3T62A 1JRSA 3L33A 3FFGA 4X0WU 3SU1A 3GCTG 3KQCA 3IG6B 1C2IA 4OS5A 2VB0A 3ZZ6A 3A7YA 1O2QA 2ZG0H 1ETSH 4NA7A 1JRTA 5C1UA 3TGKE 1QCPA 2A2QH 2FDAA 5DP4A 3DD2H 4YO9A 3FVFB 2CJIA 1VITH 3MNSA 3RXEA 1KTTB 5HYOA 1Y5AT 3A8CA 1O5DH 3ZVFA 2J94A 3ZVEA 4MPXA 2Z9IA 3PMJA 3V3MA 3BG8A 5L2ZH 2F9PA 1GGDB 2FEQH 1SGQE 1P11E 3T26A 3FANA 3LGUA 2DUCA 5EXLA 4A92A 4MLFB 1EJMA 3ODDA 1CO7E 1ZSJA 3A88A 1ZTLA 1H1BA 3TPIZ 3M5OA 1KIGH 9LPRA 1C5XB 3RXKA 3BIVH 3QX5H 2Y82A 1D9IA 1TBRH 2G55A 2ZQ2A 2AGIX 3E0PB 1NROH 5TJXA 6ESTA 1EOJA 1O2ZA 1LVYA 3IITA 3RXVA 3RUOA 1W8BH 1L4ZA 5EXMA 4TWYA 1GJ5H 1V2LT 2GCHG 4BNRA 1P0SH 5DP3A 1Z8RA 3ZYEA 3EAJA 1DVAH 4NIVA 1FI8A 2HPQH 5F8TA 1LQDB 1A0JA 1ANDA 3A8AA 4D9QA 2FOEA 2BX4A 2HNTE 5C1XA 1AVGH 1GHWH 2BOKA 1MBQA 3MU0A 3T25A 1NC6A 4WH8A 1Z71A 4X8VH 1F5RA 1GCDA 1ZYOA 3LONA 2ZQ1A 3RM0H 4FUEA 2UUKB 3SHCH 2XC0A 2A2XH 1L1GA 1O38A 3GY7A 2BDGA 1MAXA 2HPPH 1AO5A 2BY5X 1TLDA 1GCTC 1GJAB 3MMGA 2ZNKH 4FXGH 2F9BH 3UNRA 2ZA5A 4LOYH 1UK4A 1ZHRA 2BLWA 1AWFH 2Y5FA 3VB4A 3VB7A 4CBOA 4ISIH 2OBQA 1ESBA 3M7QA 1GI2A 3T5FH 1BTZA 4YZUA 1N8OC 1G3BA 3TNTA 2ZGBH 1AFQC 1OWJA 3UWJH 3EA8A 4ASHA 1GDQA 1P01A 4AYYB 3SZNA 1NRPH 1YGCH 1GJ9B 1Z8IB 1DFPA 2C8ZB 2ZI2H 2AH4X 1SQTA 1V2RT 5DK1A 1DSTA 1FIZA 1P9SA 2CHAB 4IC6A 4HI3A 4MNVA 5A0AE 2ZGXH 5AF9H 1O34A 2A5IA 3BSQA 1FQ3A 1HPGA 3MH7A 1AIXH 4RSPA 4BAKB 4LZ4B 1RTFB 1ZRKA 1S0RA 1AN1E 1MBMA 3SQHE 1MQ5A 2ZIQH 1HAXB 1O3MA 2VIWA 4IN2A 1QRWA 3TH4H 5A09A 1CA0B 4GHQA 2GT8A 4O03A 4R8TB 3QZQA 5J4QA 1HYLA 1G9IE 1CT4E 1TBQH 2Q6GA 3BN9A 7KMEH 3M3VA 3SGBE 3P92A 2ZHWH 1CBWC 1MTNC 2G5NA 2XBWA 1NS3A 4MNWA 1DM4B 1W11U 2WYJA 2ZHQH 5EW2H 2BY8X 2NU1E 1QBOA 6GCHF 3P8GA 1O5FH 3GCHC 4IC5A 1O3HA 3M5NA 4D9RA 5GJ4B 4AX9H 1D3QB 2R2MB 4FUDA 1RD3B 4KTUA 6GCHG 1OWKA 1MZDA 1O3BA 1PPBH 1MTUA 2PGQB 3SNAA 1GBTA 1GI8B 3GYMA 2PKSC 1GHAF 1P10A 2H6MA 1K1PA 1FPCH 2BHGA 1EP6A 1AB9B 5BPEA 2VU8E 1A2CH 1ZSLA 2I6SA 1UCYE 1TX6A 1EZUC 2V0BA 1Z6EA 2TGDA 1ELAA 1TRYA 1AHTH 1O36A 3D23A 1YPLH 3E1XB 1KLJH 2EI8A 4BXSA 3A83A 2STAE 2D2DA 1DE7H 1SLXB 3GY3A 1C1WH 2FPZA 1T4UH 5EODA 1GVKB 1EAUA 1Z6JH 3ZZ3A 1PYTD 4YOGA 2Z94A 1DUAA 5FPYA 1KY9A 5GIBA 1MD7A 1O2TA 1AWHB 1L1JA 1KXAA 1GMHF 3MO6A 1YBWA 4NGAH 1A1RA 1XUHA 4AGJA 2ZPRA 2YNBA 1AD8H 3HKIB 5DP7A 1SGCA 1GI4A 1XVMA 2F9OA 2R2WU 2ZTYA 3A89A 2DE9A 1C1NA 2C8YB 2ZZUH 1S85A 2Q6FA 4U30A 3URDA 1P06A 2WYGA 4E7NA 3LJJA 2ZFRH 4GCHF 3CS0A 3RC5A 4DJZB 1ZHPA 3A80A 2SNVA 4INLA 2FIRH 1O39A 2EA3A 3MOCA 4YM9A 2SGFE 2ZGHA 1BUIA 2XXLA 3R0FA 1HJAB 1B5GH 1XUIA 2SGAA 1TOCB 4XBCA 3UOUA 2G4TA 2A32A 2GKVE 4INKA 5IDKA 3ZVGA 1FN6A 3PMAB 2BDHA 3PWCA 2GGVB 2JH0D 4ZHLU 2BD8A 3MU8A 1QURH 4XE4A 4MQAA 1NY22 3LJOA 1B7XB 1TFXA 4Y79A 1LQEA 8LPRA 2PHBA 1EP5A 2VGCB 5C1YA 1OS8A 1IQJA 3FZDA 2TPIZ 1C4V2 3VGCC 1S6HA 2B9LA 5A8ZA 2IN2A 3OTJE 1SGFG 1JBUH 1W12U 2Z9LA 4BTIB 3ITIA 3SQEE 4D76A 2AYWA 2FP7B 3ODFA 5C20A 4OGXA 3MO9A 2GZ8A 1FPHH 4ZKOU 1WUNH 5AVDA 1MTSA 1QFKH 3BIUH 2ZDAH 5GDSH 1BTXA 2C93B 2A4RA 4MPWA 2A4OA 1F2SE 1TGCA 4H6TA 1A5IA 5SGAE 2FO9A 2ZP0H 1P2IA 1YLDA 1WYKA 2BM2A 1EZSC 1UTLM 3GY5A 3ZV9A 4YOJA 1THPB 3RU4T 5E0JA 3ZYDA 1P12E 1G2MA 3A7VA 3I78A 1LPGB 2G8TA 3A8BA 2OP9A 4ZKNU 2Z3CA 1HB0B 1KDQB 1P2NA 4NFEA 8GCHG 1EPTC 4GSOA 1FMGA 4NWKA 1GMDG 5DKMA 1AVWA 4ISNA 2CMYA 3PTNA 1ELGA 1LHCH 4FUCA 1WQVH 1OWHA 2SGDE 3SUGA 1O5EH 1BT7A 4ZUHA 1BBRH 2RCEA 3TJVA 1QA7A 2UUYA 3LDXH 1OYTH 1H8DH 1BZXE 1TNGA 1AKSB 1GG6C 2ZF0H 1VJ9U 2PKAB 4YT6H 2NU0E 1ZSKA 2XYAA 4CHAC 1Z8JB 1V2ST 4Y76A 1VITF 3OX7U 1V2PT 3M35A 1AU8A 1T7CA 2BYAX 2H5CA 1SGPE 4A1VA 4IMZA 3T2NA 1BCUH 1EZQA 2PUQH 4ISOA 2XCFA 3UNSA 4NFFA 1GHYH 3SOSA 1CHOF 1VITG 1C2DA 1L1NA 2JETB 1V2MT 3MI4A 4DIIH 1WBGB 3P8NA 3PLBA 3GICB 1UK3A 2VVCA 4YLUA 2RA3A 1E37B 3QO6A 1ELCA 3SNBA 2BQ6B 2O8LA 2F83A 3AASA 3PWBA 1A5GH 1W13U 1ELTA 3OY6U 4GPGA 4B71A 2Z6BD 4I8GA 1NT1A 2G4UA 5JBAS 3E0NB 1P3CA 2GMTC 1TGTA 1ARCA 2J2UA 3K6ZA 1NZQH 2FM2A 1HXEH 3PO1C 5DPAA 4TPIZ 3P17H 1O31A 5GWZA 3GY2A 3TJOA 2BMGB 2BZAA 4INHA 2AEIH 1TNIA 4IW4E 1W0ZU 1ZZZA 1ID5H 1ZPBA 3LC3A 3CS7A 3SN8A 2HWLB 3P8FA 2GP9B 5DP6A 2TGTA 3BG4C 3HKJB 3UREA 1TIOA 1SGEE 4IN1A 1CGIE 2BD4A 1V2JT 5ESBA 5EQRA 2XBXA 1HCGA 1WSSH 4YOIA 1P05A 1A0HB 2C8XB 2VIVA 2ZU4A 1U6QA 2GTBA 2LNCA 4GVUA 2RA0A 1OYQA 1N6XA 3E6PH 1QJ1B 3TNSA 4ZHAA 1Z7KA 2HNTF 3ZZCA 1IQEA 1GI7B 1YPMH 3SO3A 2PLXA 1GI5A 1OP2A 2ANKH 3UR6A 3Q77A 1QL8A 1H9LB 2B7DH 1IQIA 4BAMB 5E2PA 1QNJA 5DJ7A 1AFEH 1E35B 1V2WT 1O5AB 1HAOH 1ANCA 1O32A 4KELA 1T8LA 1DDJA 5T6GA 1GPZA 5EGMA 3TK6A 1QB1A 1V2VT 1H9HE 3BTHE 3KNXA 3GDUA 1PQ8A 1DY8A 3S7KB 1LPKB 1XUJA 3DFJA 1MU6B 5A2MH 2QAAA 4FVBA 1KLTA 1GHBG 5JB9S 5FX5A 1ELDE 2J38A 3RXJA 2P93A 1BTPA 2H5DA 3E3TA 3PMHB 2FTMA 3C1KA 1C1UH 1NRNH 2FOGA 1VZQH 4X2XA 1HAYB 2G52A 3SGAE 2XNIA 2XTTB 1FY8E 3SW2B 2BX3A 2W26A 3GISB 1GBLA 2QF0A 3SI3H 3RMMH 2C3SA 3SV6A 1QB6A 1P09A 3TK9A 1HAZB 3TH2H 1O30A 1SR5C 1MD8A 4FUIA 1GMCG 1TGBA 4HZHA 4XBDA 1SGYE 1CVWH 2J9NA 2P3TB 4OS7A 4B75A 1O5BB 4NIXA 3S69A 2VVVA 1NFXA 2Q6DA 1E0FD 2QYIA 1QY6A 1WU1A 3LH1A 2UWPA 3OU0A 4DG4A 3FP6E 5I46H 1NN6A 3GCTF 4ZH8A 4F49A 1O3AA 2GD4B 2OTVA 2IOTA 2ZU1A 1JMOH 1NRQH 1GGDC 1AY6H 2ULLA 3ZVAA 1G30B 2Y7ZA 2A7JA 5JYIA 3EE0B 1SLWB 1MZAA 2CN0H 1BTHH 1DLEA 3L3TA 4E06H 5J4SA 4X1RU 2QV1A 1L0ZA 3VXEH 1V6DA 3K2UA 2FLBH 3KHVA 1T8NA 3MO3A 5DGJA 1HAPH 1WQSA 4CRAA 4UFDH 3RXBA 3FP8E 2BLVA 5HM2A 1G3CA 3KQBA 3NXPA 4JZIA 1SPJA 1Y3UA 1XM1A 4NG9H 3SHAH 3Q3KA 1GJ4H 2Z3EA 4HFPB 1F0TA 1AUTC 4JCNA 1RS0A 2FX6A 5C3NA 9ESTA 1FJSA 2WPLS 3QWCH 1SQAA 2CF8H 3UTUH 2THFB 1V2TT 3SJKA 2FXRA 1GBBA 2HALA 1P8VC 2GCHF 1C2KA 2QXHA 1H9IE 3EA7A 3Q76A 3PV4A 2ODYB 1C9TA 1Y3XA 2ALPA 2BXUH 1D6WA 3MU5A 5F6MA 2WUBA 3MNCA 4Y7AA 1W3CA 1TRNA 2SGQE 2ZCLP 4X6NA 1VCWA 2G5VA 1ESAA 3M3SA 1L2EA 2FOAA 1K1MA 1BITA 1C5LH 4GAWA 2EI6A 4ISLA 1HIAB 2BDYA 2JH5D 3UR9A 4B2AA 2CV3A 1UCYK 2FYQA 1P2OA 4K60A 2ZTZA 3KGPA 1C5WB 1QL7A 1PPEE 2QGRA 1BMNH 1O2RA 1RRKA 1QRZA 2O8UA 1HLTH 1ZMNA 4FU7A 1O3CA 1G2LA 4BAQB 4RKJB 2V3OH 4AZ2B 1O2XA 5I25A 4A5TS 4JZEH 5LPFA 2GCTB 2CHAC 4K8BA 2P16A 1FY3A 1L4DA 4GUXA 1KXDA 1WTHD 3B23B 2D26C 1AQ7A 3P6ZB 2BY6X 1G3DA 2GV6A 2BD7A 1GBFA 1FNIA 4Y11E 1SHHB 3SJOA 3ZVDA 5EPYA 4CH8B 3NPSA 4ABDA 1Z1IA 1DLKB 3FP7E 4BTTB 4NA9H 1KLIH 3FAOA 1CA0C 1YPKH 2F91A 4BXWA 3U1JB 1ORFA 2FYRA 4B73A 5LPEA 4X8UH 3FZZA 2ZWLH 5HM9A 1OP8A 2BD2A 4Z0KA 1J9CH 4VGCB 4BOHA 1TBZH 1TMTH 1YPHC 2J95A 3LGTA 1TYNA 3EQ0H 4H42U 2PV9B 1C2GA 1AMHA 5FHTA 2ZECA 1C5RA 1TPAE 4E05H 4DOQA 1ARBA 4I32A 4K1TA 6CHAB 3TGJE 3RXFA 5L2YH 1IOEA 2BD9A 3SNCA 3ZZ8A 2ZU3A 2B8OH 3RMNH 1NU9A 2ZFQH 1XX9A 4FUHA 1BJVA 3RC6A 1TNKA 3K9XB 1TX7A 3NCLA 4F4OC 4Y10E 1P04A 1C1OA 4K1EA 1GVZA 1AB9C 2NU2E 2AMPA 1YCPK 3A85A 1BMAA 1K1JA 1EATA 2TIOA 4KTCA 1K22H 1P9UA 2AS9A 1UHBA 3RU4E 1C5UA 1OX1A 3UQVA 3HGNA 1ELEE 1G37A 1P2KA 1Y8TA 4BTUB 1C2EA 1DXPA 1O33A 1K1NA 1DUEA 3BTKE 1P2QA 4AB8A 2VIOA 8KME2 2QN5T 2VWOA 3ATIA 3ATMA 1BMLA 1W10U 1XVOA 1C5VA 1V2KT 2I6QA 3K6YA 3H5CB 3F9GA 3NKKA 1PYTC 2V3HH 1SGFA 2ZHDA 1O2NA 1ZGVA 3NUMA 1S83A 2H1UA 1LKAA 3O8CA 1O5GH 1D3DB 3ZVCA 4B1TA 1O3LA 3U1IB 1BHXF 1EOLA 1AI8H 1GI1A 1A0LA 2PGBB 1DICA 1K1OA 1NTPA 3LGWA 1F92A 1KYNA 4IBLH 2H2ZA 2KAIB 1TX8A 2DE8A 5DP5A 5JBTA 1FXYA 1GBDA 1UVSH 1ZTKA 4Y6DA 3SUEA 4FVDA 1PPZA 3PMBB 1HJAC 2ZDMA 1O2HA 3TIUA 1LTOA 1P02A 5FAHA 4NIWA 1TMBH 5GXPA 2BY7X 4OS6A 2ZHEH 2GV7A 2R3YA 2ZKSA 1LCYA 3A7TA 3SJ8A 2VGCC 4A1XA 1EPTA 3QN7A 3SU4A 2A31A 3L6PA 1UVOA 3MWIU 7LPRA 1O2MA 1YPEH 3A81A 1EB2A 1D6RA 2G51A 3SU3A 4UONA 1TABE 4NA8A 2FMJA 1GJ7B 1OSSA 4WMDA 4CRFA 1MTVA 2BVXH 4K3JA 4UFGH 1C5ZB 3VXFH 1GBCA 5GCHG 1SLVB 2OUAA 1HAVA 2XWBI 4B74A 2W3IA 2EEKA 1GI9B 1KSNA 3ZZ9A 3A84A 4FUJA 2AGGX 1OOKB 3OY5U 2WPKS 4AB9A 1PPHE 5ETXA 2FESH 2XCNA 1BTUA 2JH6D 4WMFA 1RGQA 1C1MA 3LPRA 1BB0B 1LMWB 3RXOA 1SGRE 1BTWA 1K9OE 3GY6A 3RP2A 4ABAA 3VB6A 4ZXYH 3SNEA 1GI3A 1E34B 3LH3A 3N7OA 2OCVB 2FI4E 1RTKA 3D62A 2J92A 1F7ZA 1W7XH 4AYVB 5AHGH 2ZTXA 1O2IA 2ZU2A 1FY5A 5C5OA 3F1SB 1BBRE 3UY9A 2BD5A 1C1VH 8GCHF 1CT2E 1GBHA 3PLPA 2A0QB 3OYPA 1GMDF 1NM6A 1FAXA 1TPPA 4K8YA 1DITH 3BTEE 1GJCB 3ZZ4A 3MTYA 1UMAH 1DS2E 3LU9B 1RIWB 2A5KA 1CU1A 1VGCB 1O2PA 3TK5A 1TPOA 1TNLA 3MFJA 3MH4A 2H9HA 5T3HA 3CENA 4LXBH 4THNH 2B0FA 1QR3E 2VWMA 3PLKA 1O2GH 2UUFB 5CHAB 1S84A 3ZZAA 1XUGA 2ZDLA 2BLQA 1YCPH 2V6NA 2JETC 2O8TA 1BJUA 2OBOA 1A7SA 1PFXC 5A0BA 4X2WA 1EASA 1TAWA 3QGJA 1D3TB 2QXGA 5HGGA 3BTME 1DXWA 3KQDA 4OS4A 1O3KA 1JXPA 1SGNE 4MVNA 1SG8B 2ZCKP 1JIMA 2Z9KA 2VWNA 3BEIB 2VJ1A 3E16B 3RXRA 2ODPA 1KXBA 3S9CA 1S81A 1NPMA 3U8TH 1DOJA 1QRXA 2OC7A 4B76A 2NU3E 3RXHA 4OS2A 3MH5A 1ABIH 2W7SA 2PSYA 1K1LA 1GBIA 1O3DA 1ELBA 2W5EA 1O2VA 4O3UA 4J2YB 1QB9A 2F3CE 2FI3E 4Q7ZA 3RXDA 1AZ8A 5EW1H 2ZDKA 5L6NH 3UPEA 3DUXH 5DP9A 1ETRH 2ZFTA 4XSKU 1TMUH 5FBEA 1E38B 1OKXA 2P8OB 2Y5HA 3BTTE 4JYUH 3KIDU 1E36B 4PROA 2Y5GA 1HFDA 3U69H 1C5PA 2O8MA 1C2FA 3SU0A 4UEHH 2R9PA 3V7TA 1LVMA 1SBWA 2VIQA 4U2WA 4K69A 1SFIA 1ZGIA 3P70B 1ZHMA 2AGEX 3I29A 1WAYB 2OC0A 5JDUB 1GJ8B 2C4FH 1QHRB 1NRSH 4BAHB 2ZFSA 2QC2A 1TE0A 3W95A 5CMXH 4AGKA 2R0KA 3S0NA 1T31A 3RLYH 1MKWK 2BLOA 3MU4A 4IS5A 1BA8B 4TY7A 1TNJA 4JK6A 2F9UA 4YTAA 2ANYA 1F0SA 5DG6A 1SFQB 1IQKA 5JBCS 4IMQA 2LPRA 3M5LA 1IQFA 3HATH 3R3GB 3BTWE 1JWTA 1F0RA 2VH0A 4CRBA 1OPHB 4XDEA 3BV9B 2PR3A 1WV7H 1SSXA 1TOMH 3KN2A 3V0XA 5LGOA 1KTSB 3LOXA 3AAUA 1C1RA 2RDLA 5EXNA 3GY8A 4WH6A 4D8NA 3AW1A 4FU9A 1YC0A 1GBAA 3SU2A 1HDTH 1UTKA 2VIDA 1A5HA 1GHBF 2QIQA 4OGYA 4X8SH 4NSVA 3SBKA 5C5NA 4ZHMU 2OC8A 1DWBH 3LIWA 1ELFA 1GJ6A 1EB1H 3MH6A 2GDDA 2FX4A 4FUBA 1C4U2 1ESTA 1LHFH 4QT8C 4FUFA 2FI5E 3QK1A 4AFQA 1IQLA 2A4GA 3TJUA 1UTOA 3U9AH 1QJ7B 3LKWA 4DW2U 1FUJA 2O9QA 1BMMH 2FWWA 4U32A 2VWLA 1LPZB 2FOBA 3RXSA 4ZKSU 1O3PB 1V2UT 5EG4A 2IPHA 1GJDB 1GMCF 1YPGH 3SJ9A 2VIPA 1RJXB 3HK6B 1PQ5A 1FV9A 4XBBA 4ABBA 3A7ZA 5E2OA 3TITA 2BXTH 4ESTE 1SGDE 1IQGA 4HTCH 1QGFA 2Q1JA 4YLQH 3LT3A 2WV4A 3VEQB 5AFZH 1S82A 1UVTH 5K7RA 3RDZA 1SOTA 1P2MA 3F9FA 4ABEA 2SFAA 4UE7H 1P2JA 3RXPA 3GCOA 4DCDA 4DY7B 2ZPQA 4BAOB 2WV5A 1SL3A 1FAKH 4WWYA 1CA8B 4UFFH 1LHDH 4X2YA 5E8EH 2BB4A 4TWWA 2IJOB 3V12A 1WOFA 2TGAA 1GWAA 1Y3YA 5AFYH 3E91A 1NRRH 3ZV8A 4E7RG 1TPSA 1XUFA 1BRCE 3ENSB 1SOZA 3ATLA 2C90B 2FOMB 2HLCA 2XWAA 3JZ1B 1HAIH 2ILNA 2J4IA 1XMNB 1H8IH 3ZZ7A 2UUJB 3HK3B 5TCAA 1GI6A 2Z9GA 1FN8A 2W3KA 1HUTH 1AGJA 3LGVA 1GDUA 4NWLA 1QJ6B 2H9EH 1XXFA 3KF2A 1YKTA 1J15A 4SGAE 4ZMAH 3RXQA 5LPRA 2FS8A 1SB1H 4Y8YA 1C1PA 3O8BA 2P3UB 1NFWA 2A1DB 2HVXA 1P3EA 1O0DH 3BTDE 1Y59T 1INCA 2CGAA 3GCNA 1MCVA 3SV2H 3QLPH 1FLEE 1Q2WA 4AFSA 3A87A 1TQ7B 4ZROA 1TA2A 2FOHA 3RXIA 2OQUA 1Y3VA 1THSH 3MU1A 7GCHF 1ZPCA 1TRMA 4FUGA 2XC5A 3V13A 5PTPA 2O8WA 3CP7A 1O2KA 2PFEA 3AW0A 2XW9A 2GCTC 1ZTJA 1NFYA 3RU4D 7GCHG 1QQ4A 1LDTT 1MKWH 4Y8ZA 3NWUA 1QTFA 2FOCA 3P8OA 2Z7FE 1C1QA 2ZFPH 4MG3A 1EX3A 2EC9H 1SVPA
chains in the Genus database with same CATH superfamily
1K28D 4DGJA 4JZDH 1UVUH 5HXFA 1MCTA 1DX5M 1E1QD 2P94A 3LC5A 5FBIA 3TLOA 2KAIA 4ACAA 5FCKA 4UD9H 1O2YA 1UVPA 4VGCC 1SI5H 3GDVA 3W94A 1NU7B 1GL0E 2AERH 1M9UA 1GL1A 1O2UA 3TJNA 1HXFH 1AE5A 2HOBA 3ATWA 1V3XA 2WINI 1C5MD 2OD3B 4KKDA 6CHAC 1D3PB 3JZ2B 1CHGA 1GBMA 1C2LA 1CGJE 1QBVH 4ABIA 2ANWA 3OAAD 1GJBB 4M7GA 4CRDA 1W7GH 1B0FA 1HAGE 1FDPA 2D8WA 3BEFB 1AE8H 1C5NH 1TGSZ 4X6MA 1IHSH 2GZ7A 1HGTH 3STJA 4X1QU 1EQ9A 5C0UA 1O3NA 1UJ1A 3VPKA 2J97A 1IQNA 3GY4A 1CE5A 2BY9X 1O2OA 3MHWU 1DSUA 1YWUA 1H4WA 1YM0A 2BD3A 2NU4E 1DWEH 1JOUB 3M7UA 5L30H 1ETTH 4I8JA 2GVFA 1F5LA 5E0HA 1NFUA 4YESB 3KL6A 3M61U 4H4FA 1FY1A 2K0QA 2W6ID 3OSYA 1EZXC 1BTYA 2FODA 1S5SA 1O2SA 1LKBA 4FU8A 1YP9A 1T8MA 4ZXXH 1GCTB 1V2NT 3DHKH 3EYDA 4Z6AH 4WVPE 1MTWA 2FTLE 1TALA 2VNTA 1QL9A 3ATKA 3SJIA 4KTSA 4I7YH 2R3UA 1ZPZA 4AN7A 2ZEBA 1P03A 4ABJA 3RXLA 4TPYA 3EGKH 3STIA 5CE1A 1AVXA 3RLWH 2A7CA 1O3OA 1KXCA 2EI7A 2VH6A 1N8OB 1MKXK 4O3TA 1KXFA 2EQNA 2PTCE 3WY8A 2AIPA 3UAIC 1W14U 3S9AA 1AFQB 3UWIA 5F8XA 5DN6D 3D49H 1O3JA 1Y5BT 3HGPA 1OXGA 3TGIE 2PTNA 2ZPSA 1C9PA 4UDWH 3H7TA 4RKOB 1YF4A 5A8XA 2BQWB 5EU8A 3PM3A 4X6OA 1MQ6A 3A7XA 1THRH 5JPMH 1BBRK 2RDEA 1GHVH 3NK8A 2AIQA 3Q3YA 1XKAC 1DPOA 1HAHH 2WPJS 4AFUA 5BRRE 3VFEA 1KXEA 5F03A 2TGPZ 2PWXA 2WPMS 1PJPA 2FS9A 3SV9A 1T4VH 2C8WB 2SGPE 1MH0A 1PQAA 1C5YB 3VB3A 2OQ5A 1O37A 1KDQA 2XBVA 4O9VA 1PPFE 5F53A 1A61H 1TONA 1Z8GA 4ZAEA 4ABFA 1CGHA 1CBWB 1MTNB 4I31A 1GVLA 2H9TH 5K0HA 1TNHA 1UK2A 2A4QA 1LVOA 1EAIA 1GHAG 4NSYA 1C5QA 4XRNA 1HJ9A 2HGTH 5LH8A 2WSSD 1UTJA 5TCCA 3GCHB 4ZKRU 4HGCA 1BRUP 1XXDA 3QDZB 5FCRA 4MTBA 1AKSA 1XKBC 3F68H 2PKAA 3TU7H 3UOPA 1EXFA 1HNEE 3F2FA 1C1SA 1C2HA 1ANBA 2BOHB 2PKSB 1C4Y2 5T6DA 3RC4A 1LO6A 3E8LA 4KGAA 1ELVA 3QZRA 1HRTH 2GT7A 2ODQA 3BTFE 1QBNA 4KP0A 1DT2A 3RMLH 4NZLA 4LZ1H 1UCYH 2ZGCA 3KCGH 1AZZA 1HV7A 5GCHF 1Q3XA 4Q7XA 1SGIB 4A6LA 2CF9H 4DIHH 5EOKA 1GMHG 1C2MA 1BHXB 4WY3A 2Y80A 3P95A 1UTPA 1SLUB 3T29A 1BIOA 2GDEH 1O3IA 4JMYA 3DFLA 5G4BA 1FZZA 2P59A 3SUDA 1T8OA 1ACBE 2ANMH 4A7IB 3RXMA 2ZCHP 1VCPA 3F3BA 1ZJDA 3HPTB 5FX6A 4GCHG 1YPHE 1OWEA 4X2VA 2AHME 3S7HB 3TH3H 2ZFFH 1NO9H 4NCYA 2TRMA 2AFQB 4CR9A 4F48B 4Y0ZE 1J16A 2GX4A 3LGYA 1Y3WA 1RIWC 2QXIA 4DVAU 2ZGJA 4GHTA 4MDSA 1C2JA 1VGCC 3SORA 1HBTH 1D4PB 1W0YH 3RMOH 3AAVA 2STBE 4Y0YE 1O5CB 3H7OA 5CHAC 1LVBA 1K2I1 1FY4A 1UHBB 3KEEA 2AMQA 4OS1A 3A86A 3VG8A 1ANEA 1N6YA 4DT7B 3A8DA 1GDNA 1GHXH 4D7GA 1WTGH 1A4WH 2OXSA 4GLYA 2QA9E 4Q4LA 1ZJKA 4U01A 1GHZA 5E0GA 1YYY1 1K21H 1MAYA 4X1SU 4JK5A 2TBSA 2YOLA 4Y7BA 5EQSA 3SGQE 3SV8A 1ZOMA 3T28A 1G36A 3DT0H 4RN6A 2WPIS 1DWCH 1H8ED 2CXVA 4B2BA 4XFQA 3VGCB 3RXCA 4SGBE 5B6OA 1ZR0A 1EJNA 2QY0B 2WPHS 1W2KH 1YLCA 3M5MA 3QTOH 4XOJA 2ZO3H 1MKXH 1W0JD 1C5TA 1F5KU 1RTLA 1Z1JA 2ZDVH 1EAXA 2ZC9H 1OWDA 4I8LA 1GBJA 5DSFA 4D7FA 3UFAA 2F9NA 2OINA 2QXJA 1TGNA 1O3FA 4BANB 3U98H 3AVZA 3ESTA 2ZDNA 1CSOE 1V2OT 2Z3DA 5JBBS 3GDSA 2P8OC 3KQEA 4AG1A 1CT0E 1BRBE 4J1YA 3RXTA 1C5SA 2QCYA 1ZMJA 4MNXA 3SU5A 1DANH 3F9EA 2WUCA 3SI4H 1FONA 3DA9B 5A0CA 5JB8S 2A45B 1RXPA 2BTCE 3UUZA 1BRAA 1QA0A 4ABHA 4MPVA 2BDCA 1ZLRA 2IJD1 1QIXB 3UQOA 1VR1H 1OHHD 1A3EH 1IQMA 3PTBA 2SNWA 4ISHH 1EPTB 4IGDA 4K2YA 2L6OA 3E90B 1BDAA 1O35A 5HKKD 3O8RA 1J17T 4MPUA 3VB5A 4CR5A 2OLGA 4YT7H 4TY6A 1UTQA 3S9BA 3B8JA 1S6FA 1V2QT 4JYTA 4CRCA 2G81E 3F9HA 1O3GA 3RXUA 3K65B 2RG3A 4I8HA 1YCPM 4AFZA 1IHTH 1XUKA 1S0QA 3M36A 1NESE 4CBNA 1P57B 3BF6H 1GBEA 5EQQA 1GG6B 2UWOA 4Q7YA 4NIYA 3RXAA 1HAVB 8ESTE 1CHOG 1EAWA 2ZU5A 2ASUB 3OFND 4TYDA 1MMJN 4CHAB 4NZQA 2D1JA 2V35A 5T6FA 5FXLA 4LK4A 3G01A 2BZ6H 2PUXB 2Z9JA 2G00A 3UNQA 2ZHFH 2BQ7B 3BEUA 3UB0A 3BTGE 1SC8U 4AOQA 1B0EA 5C2ZA 1FIWA 5EPNA 5F8ZA 2NWNA 1J8AA 1IAUA 5ESTE 1UTNA 2K1QA 3C27B 4MNYA 2A7HA 1CQQA 5A8YA 3QUMP 3EA9A 1MU8B 1EKBB 2Y7XA 2BDBA 1GBKA 4WMEA 4Q80A 1K1IA 3O8DA 1O2JA 2GMTB 3ZVBA 1PPGE 1AUJA 2BVRH 1SQOA 3M37A 4JZFH 4DURA 4UFEH 2R0LA 4RT0A 3ZZ5A 2VINA 1C1TA 2WPDD 1PPCE 3PO1B 5H4IB 1VJAU 4CH2B 4WF8A 5DP8A 3RM2H 2Y81A 1Q31A 3M7TA 4I33A 4H6SB 2JKHA 1IQHA 2BVSH 3Q3XA 4WJG2 3M3TA 4CREA 2HRVA 1JIRA 2PSXA 2PW8H 1A3BH 1ZRBA 1J14A 5HMAA 1TB6H 2XRCA 5IYTA 4CRGA 2BDAA 2SGEE 2J34A 3TVJB 2FZZA 3BG4B 3FN8A 2KZ4A 2F9VA 1HJ8A 3T27A 4YXWD 2HNTC 1O2WA 2OC1A 1BQYA 4ABGA 5ABWA 2UWLA 2YMSC 4A1TA 2YNAA 3PROA 4X1PU 1G3EA 3ZZBA 5CHBA 2B5TB 3NZIA 1HIAA 2A5AA 5C67A 1DY9A 2XC4A 4JYVH 3U8OH 1UTMA 3GYLB 6LPRA 1SMFE 2FOFA 2ESTE 3FOAA 4WXVA 4X1NU 3PB1E 4B2CA 1MUEB 3F6UH 4O97A 1G32B 1SHYA 5FPTA 4X6PA 4X8TH 3ELAH 3D65E 3SUFA 3IWMA 3ZIAD 2GZ9A 3ZZDA 2P3FH 2ALVA 3MNXA 4Y8XA 3SU6A 4Y71A 1RFNA 5FPSA 4K1SA 1VCQA 1QQUA 2BDIA 1OP0A 1EUFA 3U8RH 1F0UA 4I8KA 1O3EA 1BOQA 3PYHA 4AG2A 1A46H 2M5TA 3A7WA 3B9FH 1PQ7A 3SNDA 3GOVB 1FX0B 4AORA 1Y5UT 1WCZA 1X7AC 4WXIA 3LGIA 3I77A 1TQ0B 1ZMLA 2FLRH 2W7UA 3MYWA 1LHGH 1YPJH 3A82A 5DO4H 1C5OH 1GI0A 3EDXB 3F0OA 1T32A 1EJAA 3QGNB 1OWIA 3UIRA 2QF3A 3QTVH 2XBYA 2AMDA 3N99A 5GPIB 7ESTE 3MNBA 1KMHB 2VVUA 1UO6A 1LHEH 2P95A 3RXGA 1TA6A 1N1LA 4R0IA 3Q00A 1SGTA 1TWXB 1O2LA 2Y6TA 3URCA 1ABJH 4JZ1A 1DWDH 3SV7A 3BTQE 4K5ZA 4Q2KA 3T62A 1JRSA 3L33A 3FFGA 4X0WU 3SU1A 3GCTG 3KQCA 3IG6B 1C2IA 4OS5A 2VB0A 3ZZ6A 3A7YA 1O2QA 2ZG0H 1ETSH 4NA7A 1JRTA 5C1UA 3TGKE 1QCPA 2A2QH 2FDAA 5DP4A 3DD2H 4YO9A 3FVFB 2CJIA 1VITH 3MNSA 3RXEA 1KTTB 5HYOA 1Y5AT 3A8CA 1O5DH 3ZVFA 2J94A 3ZVEA 4MPXA 2Z9IA 3PMJA 3V3MA 3BG8A 5L2ZH 2F9PA 1GGDB 2FEQH 1SGQE 1P11E 3T26A 3FANA 3LGUA 2DUCA 5EXLA 4A92A 4MLFB 1EJMA 3ODDA 1CO7E 1SQRA 1ZSJA 3A88A 1ZTLA 1H1BA 3TPIZ 3M5OA 1KIGH 9LPRA 1C5XB 3RXKA 3BIVH 3QX5H 2Y82A 1D9IA 1TBRH 2G55A 2ZQ2A 2AGIX 3E0PB 1NROH 5TJXA 6ESTA 1EOJA 1O2ZA 1LVYA 3IITA 3RXVA 3RUOA 1W8BH 1L4ZA 5EXMA 4TWYA 1GJ5H 1V2LT 5T1VA 4F55A 2GCHG 4BNRA 1P0SH 5DP3A 1Z8RA 3ZYEA 3EAJA 1DVAH 4NIVA 1FI8A 2HPQH 5F8TA 1LQDB 1A0JA 1ANDA 2JJ1D 3A8AA 4D9QA 2FOEA 2BX4A 2HNTE 5C1XA 1AVGH 1GHWH 2BOKA 1MBQA 3MU0A 3T25A 1NC6A 4WH8A 1Z71A 4X8VH 1F5RA 1GCDA 1ZYOA 3LONA 2ZQ1A 3RM0H 4FUEA 2UUKB 3SHCH 2XC0A 2A2XH 1L1GA 1O38A 3GY7A 2BDGA 1MAXA 2HPPH 1AO5A 2BY5X 1TLDA 1GCTC 1GJAB 3MMGA 2ZNKH 3KQ5A 4FXGH 2F9BH 3UNRA 2ZA5A 4LOYH 1UK4A 3WW7A 3PRDA 1ZHRA 2BLWA 1AWFH 2Y5FA 3VB4A 3VB7A 4CBOA 4ISIH 2OBQA 1ESBA 3M7QA 1GI2A 3T5FH 1BTZA 4YZUA 1N8OC 1G3BA 3TNTA 2ZGBH 1AFQC 1OWJA 4OM9A 3PRBA 3EA8A 3UWJH 4ASHA 1GDQA 1P01A 4AYYB 3SZNA 1NRPH 1YGCH 1GJ9B 1Z8IB 1DFPA 2C8ZB 2ZI2H 2AH4X 1SQTA 1V2RT 5DK1A 1DSTA 1FIZA 1P9SA 2CHAB 4IC6A 4HI3A 4MNVA 5A0AE 2ZGXH 5AF9H 1O34A 2A5IA 3BSQA 4FOUC 1FQ3A 1HPGA 3MH7A 1AIXH 3N7DA 4RSPA 4BAKB 4LZ4B 1RTFB 1ZRKA 1S0RA 4RI0A 1AN1E 1MBMA 3SQHE 1MQ5A 2ZIQH 1HAXB 1O3MA 2VIWA 4IN2A 1QRWA 3TH4H 1YLNA 1CA0B 4GHQA 5A09A 2GT8A 4O03A 2KCYA 4R8TB 3QZQA 5J4QA 1HYLA 1G9IE 1CT4E 1TBQH 2Q6GA 3BN9A 7KMEH 3M3VA 3SGBE 3P92A 1K0HA 2ZHWH 1CBWC 1MTNC 2G5NA 2XBWA 1NS3A 4MNWA 1DM4B 1W11U 2WYJA 2ZHQH 5EW2H 2BY8X 2NU1E 1QBOA 6GCHF 3P8GA 1SKYE 1O5FH 3GCHC 3FKSD 4IC5A 1O3HA 3M5NA 4FETA 4D9RA 5GJ4B 4AX9H 1D3QB 2R2MB 4FUDA 1RD3B 4KTUA 6GCHG 1OWKA 1MZDA 2J98B 1O3BA 1PPBH 1MTUA 2PGQB 3SNAA 1GBTA 1GI8B 3GYMA 1GHAF 1P10A 2H6MA 2PKSC 1K1PA 1FPCH 2BHGA 1EP6A 1AB9B 5BPEA 2VU8E 1A2CH 1ZSLA 2I6SA 1UCYE 1TX6A 1EZUC 2V0BA 1Z6EA 2TGDA 1ELAA 1TRYA 1AHTH 1O36A 3D23A 1YPLH 3E1XB 1KLJH 2EI8A 4BXSA 3A83A 2STAE 2D2DA 1DE7H 1SLXB 3GY3A 1C1WH 2FPZA 1T4UH 5EODA 1GVKB 1EAUA 1Z6JH 3ZZ3A 1PYTD 4YOGA 2Z94A 1DUAA 5FPYA 1KY9A 2HLDD 5GIBA 1MD7A 1O2TA 1AWHB 1L1JA 1KXAA 1GMHF 3MO6A 1YBWA 4NGAH 1A1RA 1XUHA 4AGJA 3F2HA 2ZPRA 2YNBA 1AD8H 3HKIB 5DP7A 1SGCA 1GI4A 1XVMA 2F9OA 2R2WU 2ZTYA 3A89A 2DE9A 1C1NA 2C8YB 2ZZUH 1S85A 2Q6FA 4U30A 3URDA 1P06A 1MABB 2WYGA 4E7NA 3LJJA 2ZFRH 4GCHF 3CS0A 3SZEA 3RC5A 4TSFD 4DJZB 1ZHPA 3A80A 2SNVA 4INLA 2FIRH 1O39A 2EA3A 3MOCA 2F43B 4YM9A 2SGFE 2ZGHA 1BUIA 2XXLA 3R0FA 1HJAB 1B5GH 1XUIA 2SGAA 1TOCB 4XBCA 3UOUA 3KYFA 2G4TA 2A32A 2GKVE 4INKA 5IDKA 2V7QD 1FN6A 3PMAB 2BDHA 3PWCA 2GGVB 2JH0D 3ZVGA 4ZHLU 2BD8A 3MU8A 1QURH 4XE4A 4MQAA 1NY22 3LJOA 1B7XB 1TFXA 4Y79A 1LQEA 5C94A 8LPRA 2PHBA 1EP5A 2VGCB 5C1YA 1OS8A 1IQJA 3FZDA 2TPIZ 1C4V2 3VGCC 1S6HA 2B9LA 5A8ZA 2IN2A 3OTJE 1SGFG 1JBUH 1W12U 2Z9LA 3DSPA 4BTIB 3ITIA 3SQEE 2KCAA 3WWBA 4D76A 2AYWA 2FP7B 3ODFA 5IK2D 5C20A 4OGXA 3MO9A 2RFKC 2GZ8A 1FPHH 4ZKOU 1WUNH 5AVDA 1MTSA 1QFKH 3BIUH 2ZDAH 5GDSH 1BTXA 2C93B 2A4RA 4MPWA 2A4OA 1F2SE 1TGCA 4H6TA 1A5IA 5SGAE 2FO9A 2ZP0H 1P2IA 1YLDA 5B6LA 1WYKA 2BM2A 1EZSC 1UTLM 3GY5A 3ZV9A 4YOJA 1THPB 3RU4T 5E0JA 3DCLA 3ZYDA 1P12E 1G2MA 3A7VA 3I78A 1LPGB 2G8TA 1YY3A 5HIZA 3A8BA 2OP9A 4ZKNU 2Z3CA 1HB0B 1KDQB 1P2NA 4NFEA 8GCHG 1EPTC 4GSOA 1FMGA 4NWKA 1GMDG 5DKMA 1AVWA 4ISNA 2CMYA 3PTNA 1ELGA 1LHCH 4FUCA 1WQVH 1OWHA 2SGDE 3SUGA 1O5EH 5HIYA 5EJ1A 1BT7A 4ZUHA 1BBRH 2RCEA 3TJVA 1QA7A 2UUYA 3LDXH 1OYTH 1H8DH 1BZXE 1TNGA 1AKSB 1GG6C 2ZF0H 1VJ9U 2PKAB 1E1RD 4YT6H 2NU0E 1ZSKA 2XYAA 5CDFE 4CHAC 1Z8JB 1V2ST 4Y76A 1VITF 3OX7U 1V2PT 3M35A 1AU8A 1T7CA 2BYAX 2H5CA 1SGPE 4A1VA 4IMZA 3T2NA 1BCUH 4B6EA 1EZQA 2CK3D 2PUQH 4ISOA 2XCFA 3UNSA 4NFFA 1GHYH 3SOSA 1CHOF 1VITG 1C2DA 1L1NA 2JETB 1V2MT 3MI4A 2M2AA 4DIIH 1WBGB 3P8NA 3PLBA 3GICB 1UK3A 2VVCA 4YLUA 2RA3A 5GNDA 1E37B 3QO6A 1ELCA 2V3MA 3SNBA 2BQ6B 2O8LA 2F83A 3AASA 3PWBA 1A5GH 1W13U 1ELTA 3OY6U 4GPGA 4B71A 2Z6BD 4I8GA 1NT1A 2G4UA 5JBAS 3E0NB 1P3CA 2GMTC 1TGTA 1ARCA 2J2UA 2J5UA 3K6ZA 1NZQH 2FM2A 1HXEH 3PO1C 5DPAA 4TPIZ 3P17H 1O31A 5GWZA 3GY2A 3TJOA 2BMGB 2BZAA 4INHA 5KECA 2AEIH 1TNIA 4IW4E 1W0ZU 1ZZZA 1ID5H 1ZPBA 3LC3A 3CS7A 2LELA 1H8HD 3SN8A 2HWLB 3P8FA 2GP9B 5DP6A 2TGTA 3BG4C 3HKJB 3UREA 1TIOA 3SYJA 1SGEE 4IN1A 1CGIE 2BD4A 1V2JT 5ESBA 5EQRA 2XBXA 1HCGA 1WSSH 4YOIA 1P05A 1A0HB 2KCOA 2C8XB 2VIVA 2ZU4A 1U6QA 2GTBA 2LNCA 4GVUA 2JJ2D 2RA0A 1OYQA 2HVYB 1N6XA 3E6PH 1QJ1B 3TNSA 4ZHAA 3DSOA 1Z7KA 2HNTF 3ZZCA 1IQEA 1GI7B 1YPMH 3SO3A 2PLXA 1GI5A 2LP6A 1OP2A 2ANKH 3UR6A 3Q77A 1QL8A 1H9LB 2B7DH 1IQIA 1WXRA 4BAMB 5E2PA 1QNJA 5DJ7A 1AFEH 1E35B 1V2WT 1O5AB 1HAOH 1ANCA 1O32A 4KELA 1T8LA 1DDJA 5T6GA 1GPZA 5EGMA 3TK6A 1QB1A 2WV9A 1V2VT 1H9HE 3BTHE 3KNXA 3GDUA 1PQ8A 1DY8A 3S7KB 1LPKB 1XUJA 3DFJA 1MU6B 5A2MH 2QAAA 4FVBA 1NBME 1KLTA 1GHBG 5JB9S 4DT4A 5FX5A 1ELDE 2J38A 3RXJA 5EJLA 2P93A 1BTPA 2H5DA 3E3TA 3PMHB 2FTMA 2W6JD 3C1KA 2L74A 1C1UH 1NRNH 2FOGA 1VZQH 3W1EA 4X2XA 1HAYB 2G52A 3SGAE 2XNIA 2XTTB 1FY8E 3SW2B 2BX3A 4M9FA 2W26A 3GISB 1GBLA 2QF0A 3SI3H 3RMMH 2C3SA 3SV6A 1QB6A 1P09A 3TK9A 1HAZB 3TH2H 1O30A 1SR5C 1MD8A 4FUIA 1GMCG 1TGBA 4HZHA 4XBDA 1SGYE 1CVWH 2J9NA 2P3TB 4OS7A 4B75A 1O5BB 4NIXA 3S69A 2VVVA 1COWD 1NFXA 2Q6DA 1E0FD 2QYIA 1QY6A 3MQKC 1WU1A 3LH1A 2UWPA 3OU0A 4DG4A 3FP6E 5I46H 1NN6A 3GCTF 4ZH8A 4F49A 1O3AA 3OEHD 2GD4B 2OTVA 2IOTA 2ZU1A 1JMOH 1NRQH 5EIYA 1GGDC 1AY6H 2ULLA 3ZVAA 1G30B 2Y7ZA 2A7JA 5JYIA 3EE0B 1SLWB 1MZAA 2CN0H 1BTHH 1DLEA 3L3TA 4E06H 4TT3D 5J4SA 4X1RU 2QV1A 1L0ZA 3VXEH 1V6DA 3K2UA 4P00A 2FLBH 3KHVA 1T8NA 3MO3A 5DGJA 1HAPH 1WQSA 4CRAA 4UFDH 3RXBA 3FP8E 2BLVA 5HM2A 1G3CA 3KQBA 3NXPA 4JZIA 1SPJA 1Y3UA 1XM1A 4NG9H 3SHAH 3Q3KA 1GJ4H 2Z3EA 4HFPB 1F0TA 1AUTC 4JCNA 1RS0A 2FX6A 5C3NA 9ESTA 1FJSA 2WPLS 2KFWA 3QWCH 1SQAA 2CF8H 3UTUH 2THFB 1V2TT 3SJKA 2FXRA 1GBBA 2HALA 1P8VC 2GCHF 1C2KA 2QXHA 1H9IE 3EA7A 3Q76A 3F0PA 3PV4A 1C9TA 1Y3XA 2ALPA 2BXUH 2ODYB 1D6WA 3MU5A 5F6MA 2WUBA 3MNCA 4Y7AA 1W3CA 1TRNA 2SGQE 2ZCLP 4X6NA 1VCWA 2G5VA 1ESAA 3M3SA 1L2EA 2FOAA 1K1MA 1BITA 1C5LH 2PP6A 4GAWA 2EI6A 4ISLA 1HIAB 2BDYA 2JH5D 3UR9A 4B2AA 2CV3A 1UCYK 2FYQA 1P2OA 4K60A 2ZTZA 3KGPA 2OK5A 1C5WB 1QL7A 1PPEE 2QGRA 2KCPA 1BMNH 1O2RA 1RRKA 1QRZA 2O8UA 1HLTH 1ZMNA 4FU7A 1O3CA 1G2LA 4BAQB 2IPQX 4RKJB 2V3OH 4AZ2B 1O2XA 5I25A 4A5TS 2WZQA 1VKYA 4JZEH 5LPFA 2GCTB 2CHAC 4K8BA 2P16A 1FY3A 1L4DA 4GUXA 1KXDA 1WTHD 3B23B 2D26C 1AQ7A 3P6ZB 2BY6X 1G3DA 3OEED 2GV6A 2BD7A 1GBFA 1FNIA 4Y11E 1SHHB 3SJOA 4I86A 3ZVDA 5EPYA 4P02A 4CH8B 3NPSA 4ABDA 1Z1IA 1DLKB 3FP7E 4BTTB 4NA9H 1KLIH 3FAOA 1CA0C 1YPKH 2F91A 4BXWA 3U1JB 1ORFA 1UW7A 2FYRA 4B73A 5LPEA 4X8UH 3FZZA 3PV2A 2ZWLH 5HM9A 1OP8A 2BD2A 4Z0KA 1J9CH 4VGCB 4BOHA 1WDIA 1TBZH 1TMTH 1YPHC 2J95A 3LGTA 1TYNA 3EQ0H 4H42U 2PV9B 1C2GA 1AMHA 5FHTA 2ZECA 1C5RA 1QZ8A 1TPAE 4E05H 4DOQA 1ARBA 4I32A 4K1TA 6CHAB 3TGJE 2EY4C 3RXFA 5L2YH 1IOEA 2BD9A 3SNCA 3ZZ8A 2ZU3A 2B8OH 2GJGA 3RMNH 1NU9A 2ZFQH 1XX9A 4FUHA 1BJVA 3PV5A 3RC6A 1TNKA 3K9XB 1TX7A 3NCLA 4F4OC 4Y10E 1P04A 1C1OA 4K1EA 1GVZA 1AB9C 2NU2E 2AMPA 1YCPK 3A85A 1BMAA 1K1JA 1EATA 2TIOA 3OE7D 4KTCA 1K22H 1P9UA 2AS9A 1UHBA 3RU4E 1C5UA 1OX1A 3UQVA 3HGNA 1ELEE 1G37A 1P2KA 1Y8TA 4BTUB 1C2EA 1DXPA 1O33A 1K1NA 1DUEA 3BTKE 1P2QA 4AB8A 2VIOA 3KYGA 8KME2 2QN5T 2VWOA 3ATIA 3ATMA 1BMLA 1W10U 1XVOA 1C5VA 1V2KT 2I6QA 3K6YA 3H5CB 2WHXA 3F9GA 3NKKA 1PYTC 2V3HH 1SGFA 2ZHDA 1O2NA 1ZGVA 3NUMA 1S83A 2H1UA 1LKAA 3O8CA 1O5GH 1D3DB 3ZVCA 4B1TA 1O3LA 3U1IB 1BHXF 1EOLA 1AI8H 1GI1A 1A0LA 2PGBB 1DICA 1K1OA 1NTPA 3LGWA 1F92A 1KYNA 4IBLH 2H2ZA 2KAIB 1TX8A 2DE8A 5DP5A 5JBTA 1FXYA 1GBDA 1UVSH 2QF5A 3AK5A 1ZTKA 4Y6DA 3SUEA 4FVDA 1PPZA 3FO8D 3PMBB 1HJAC 2ZDMA 1O2HA 3TIUA 1LTOA 5EJZA 1P02A 5FAHA 4NIWA 1TMBH 5C0TA 5GXPA 2BY7X 4OS6A 2ZHEH 2GV7A 2R3YA 3OTPA 2ZKSA 1LCYA 4RT1A 3A7TA 3SJ8A 2VGCC 4A1XA 1EPTA 3QN7A 3SU4A 2A31A 3L6PA 1UVOA 3MWIU 7LPRA 2F4LA 1O2MA 1YPEH 3A81A 1EB2A 2KR7A 1D6RA 2G51A 5KEDA 3SU3A 4UONA 1TABE 4NA8A 2FMJA 1GJ7B 1OSSA 4WMDA 4CRFA 1MTVA 2BVXH 4K3JA 4ACBA 4UFGH 1C5ZB 3VXFH 1GBCA 5GCHG 1SLVB 2OUAA 1HAVA 2XWBI 4B74A 2KM0A 2XNDD 2JDID 2W3IA 2EEKA 1GI9B 1KSNA 3ZZ9A 3A84A 3U28C 4FUJA 2AGGX 4ZCNA 1OOKB 3OY5U 2WPKS 4AB9A 1PPHE 5ETXA 2FESH 2XCNA 1S6LA 1BTUA 2JH6D 4WMFA 1RGQA 1C1MA 3LPRA 1BB0B 1LMWB 3RXOA 1SGRE 1BTWA 1K9OE 3GY6A 3RP2A 4ABAA 3VB6A 4ZXYH 3SNEA 1GI3A 1E34B 3LH3A 3N7OA 2OCVB 2FI4E 1RTKA 3D62A 2J92A 1F7ZA 1W7XH 4AYVB 5AHGH 2ZTXA 1O2IA 2ZU2A 1FY5A 5C5OA 3F1SB 1BBRE 3UY9A 2BD5A 1C1VH 8GCHF 1CT2E 1GBHA 3PLPA 2A0QB 3OYPA 1GMDF 1NM6A 1FAXA 1TPPA 4K8YA 1DITH 3BTEE 1GJCB 3ZZ4A 3MTYA 1UMAH 1DS2E 3LU9B 1RIWB 2A5KA 1CU1A 1VGCB 1O2PA 3TK5A 1TPOA 1TNLA 3H09A 3MFJA 3MH4A 2H9HA 5T3HA 3CENA 4LXBH 4THNH 2B0FA 1QR3E 2VWMA 3PLKA 1O2GH 2UUFB 5CHAB 1S84A 3ZZAA 1XUGA 2ZDLA 3CNRA 2BLQA 1YCPH 2V6NA 2JETC 2O8TA 1BJUA 2OBOA 1A7SA 1PFXC 5A0BA 4X2WA 1EASA 1TAWA 3QGJA 1D3TB 2QXGA 5HGGA 3BTME 1DXWA 3KQDA 4OS4A 1O3KA 5C17A 1JXPA 1SGNE 4MVNA 1SG8B 2ZCKP 1JIMA 2Z9KA 2VWNA 3BEIB 2VJ1A 4Q63A 3E16B 3RXRA 2ODPA 1KXBA 3S9CA 1S81A 1NPMA 3U8TH 1DOJA 1QRXA 2OC7A 4B76A 2NU3E 2K8IA 3RXHA 4OS2A 3MH5A 4Z1MD 1ABIH 2W7SA 2PSYA 1K1LA 1GBIA 1O3DA 1ELBA 2W5EA 1O2VA 4O3UA 4J2YB 1QB9A 1NBMD 2F3CE 2VBCA 2FI3E 4Q7ZA 3RXDA 1AZ8A 5EW1H 2ZDKA 5L6NH 3UPEA 3DUXH 5DP9A 1ETRH 2ZFTA 4XSKU 1TMUH 5FBEA 1E38B 1OKXA 2P8OB 2QF4A 2Y5HA 4B6FA 3BTTE 4JYUH 3KIDU 1E36B 4PROA 2Y5GA 1HFDA 3U69H 1C5PA 2O8MA 1C2FA 3SU0A 4UEHH 2R9PA 3V7TA 1LVMA 1SBWA 3NRLA 2VIQA 4U2WA 4K69A 1SFIA 1ZGIA 3P70B 1ZHMA 2AGEX 3I29A 1WAYB 2OC0A 5JDUB 1GJ8B 2C4FH 1QHRB 1NRSH 4BAHB 2ZFSA 2QC2A 1TE0A 3W95A 5FL7D 4HG6A 5CMXH 4AGKA 2R0KA 3S0NA 1T31A 3N7EA 3RLYH 1MKWK 2BLOA 3MU4A 4IS5A 1BA8B 4TY7A 1TNJA 4JK6A 2F9UA 4YTAA 2ANYA 1F0SA 5DG6A 3EE7A 1SFQB 1IQKA 5JBCS 4IMQA 1W0KD 3DSGA 2LPRA 3M5LA 1IQFA 3HATH 3R3GB 3BTWE 1JWTA 1F0RA 2VH0A 4CRBA 1OPHB 4XDEA 3BV9B 2PR3A 4ASUD 1WV7H 1SSXA 1TOMH 3KN2A 3V0XA 5LGOA 1KTSB 3LOXA 4AC9A 3AAUA 1C1RA 2RDLA 5EXNA 3GY8A 4WH6A 4D8NA 3AW1A 4FU9A 1YC0A 1GBAA 3SU2A 1HDTH 1UTKA 2VIDA 1A5HA 1GHBF 2QIQA 4OGYA 4X8SH 4NSVA 3SBKA 5C5NA 4ZHMU 2OC8A 1DWBH 3LIWA 1ELFA 1GJ6A 1EB1H 3MH6A 2GDDA 2FX4A 4FUBA 1C4U2 1ESTA 1LHFH 4QT8C 4FUFA 2FI5E 3QK1A 4AFQA 1IQLA 2A4GA 3TJUA 1UTOA 3U9AH 1QJ7B 3LKWA 4DW2U 1FUJA 2O9QA 1BMMH 2FWWA 4U32A 2VWLA 1LPZB 2FOBA 3RXSA 4ZKSU 1O3PB 1V2UT 5EG4A 2IPHA 1GJDB 3GS9A 1GMCF 1YPGH 5KGOA 3SJ9A 2VIPA 1RJXB 3HK6B 1PQ5A 1FV9A 4XBBA 4ABBA 2YMSD 3A7ZA 5E2OA 3TITA 2BXTH 4ESTE 1SGDE 2XOKD 1IQGA 2KX4A 4HTCH 1QGFA 2Q1JA 4YLQH 3LT3A 2YMSB 2WV4A 3VEQB 5AFZH 1S82A 1UVTH 5K7RA 3RDZA 1SOTA 1P2MA 3F9FA 4ABEA 2SFAA 4UE7H 1EFRD 1P2JA 3RXPA 3GCOA 3WWFA 4DCDA 4DY7B 2ZPQA 4BAOB 2WV5A 1SL3A 1FAKH 4WWYA 1CA8B 4UFFH 1LHDH 4X2YA 5E8EH 1E79D 2BB4A 4TWWA 2JIZD 2IJOB 3V12A 1WOFA 2TGAA 1GWAA 1Y3YA 5AFYH 3E91A 3F2GA 1NRRH 3ZV8A 4E7RG 1TPSA 1XUFA 1BRCE 3ENSB 1SOZA 3ATLA 2C90B 2FOMB 2HLCA 2XWAA 3JZ1B 1HAIH 2ILNA 2J4IA 1XMNB 1H8IH 3ZZ7A 2UUJB 3HK3B 5TCAA 1GI6A 2Z9GA 1FN8A 2W3KA 1HUTH 1AGJA 3LGVA 1GDUA 4NWLA 1QJ6B 2H9EH 1XXFA 3KF2A 1YKTA 1J15A 4SGAE 4ZMAH 3RXQA 1BMFD 5LPRA 2FS8A 1SB1H 4Y8YA 1C1PA 3O8BA 1NFWA 2A1DB 2P3UB 2HVXA 1P3EA 1O0DH 3BTDE 1Y59T 1INCA 2CGAA 3GCNA 1MCVA 3SV2H 3QLPH 1FLEE 1Q2WA 4AFSA 3A87A 1TQ7B 4ZROA 1TA2A 2FOHA 3RXIA 1Y3VA 2OQUA 1THSH 2QE7D 3MU1A 7GCHF 1ZPCA 1TRMA 4FUGA 2XC5A 3V13A 5PTPA 2O8WA 3CP7A 1O2KA 2PFEA 3AW0A 2XW9A 2J98A 2GCTC 1ZTJA 1NFYA 3RU4D 7GCHG 1QQ4A 1LDTT 1MKWH 4Y8ZA 3NWUA 1QTFA 2FOCA 3P8OA 2Z7FE 1C1QA 2ZFPH 4XD7D 4MG3A 1EX3A 2EC9H 1SVPA
chains in the Genus database with same CATH topology
1K28D 4DGJA 4JZDH 1UVUH 5HXFA 1MCTA 1DX5M 2P94A 3LC5A 5FBIA 3TLOA 2KAIA 5FCKA 4UD9H 1O2YA 1UVPA 4VGCC 1SI5H 3GDVA 3W94A 1NU7B 1GL0E 2AERH 1M9UA 1GL1A 1O2UA 3TJNA 1HXFH 1AE5A 2HOBA 3ATWA 1V3XA 2WINI 1C5MD 2OD3B 4KKDA 6CHAC 1D3PB 3JZ2B 1CHGA 1GBMA 1C2LA 1CGJE 1QBVH 4ABIA 2ANWA 1GJBB 4M7GA 4CRDA 1W7GH 1B0FA 1HAGE 1FDPA 2D8WA 3BEFB 1AE8H 1C5NH 1TGSZ 4X6MA 1IHSH 2GZ7A 1HGTH 3STJA 4X1QU 1EQ9A 1O3NA 1UJ1A 3VPKA 1IQNA 3GY4A 1CE5A 2BY9X 1O2OA 3MHWU 1DSUA 1H4WA 1YM0A 2BD3A 2NU4E 1DWEH 1JOUB 3M7UA 5L30H 1ETTH 4I8JA 2GVFA 1F5LA 5E0HA 1NFUA 4YESB 3KL6A 3M61U 4H4FA 1FY1A 3OSYA 1EZXC 1BTYA 2FODA 1S5SA 1O2SA 1LKBA 4FU8A 1YP9A 1T8MA 4ZXXH 1GCTB 1V2NT 3DHKH 3EYDA 4Z6AH 4WVPE 1MTWA 2FTLE 1TALA 2VNTA 1QL9A 3ATKA 3SJIA 4KTSA 4I7YH 2R3UA 1ZPZA 4AN7A 2ZEBA 1P03A 4ABJA 3RXLA 4TPYA 3EGKH 3STIA 5CE1A 1AVXA 3RLWH 2A7CA 1O3OA 1KXCA 2EI7A 2VH6A 1N8OB 1MKXK 4O3TA 1KXFA 3WY8A 2PTCE 2AIPA 1W14U 3S9AA 1AFQB 3UWIA 5F8XA 3D49H 1O3JA 1Y5BT 3HGPA 1OXGA 3TGIE 2PTNA 2ZPSA 1C9PA 4UDWH 3H7TA 4RKOB 1YF4A 5A8XA 2BQWB 5EU8A 3PM3A 4X6OA 1MQ6A 3A7XA 1THRH 5JPMH 1BBRK 1GHVH 3NK8A 2AIQA 3Q3YA 1XKAC 1DPOA 1HAHH 2WPJS 4AFUA 5BRRE 3VFEA 1KXEA 5F03A 2TGPZ 2PWXA 2WPMS 1PJPA 2FS9A 3SV9A 1T4VH 2C8WB 2SGPE 1MH0A 1PQAA 1C5YB 3VB3A 2OQ5A 1O37A 1KDQA 2XBVA 4O9VA 1PPFE 1A61H 1TONA 1Z8GA 4ZAEA 4ABFA 1CGHA 1CBWB 1MTNB 4I31A 1GVLA 2H9TH 5K0HA 1TNHA 1UK2A 2A4QA 1LVOA 1EAIA 1GHAG 4NSYA 1C5QA 5LH8A 1HJ9A 2HGTH 1UTJA 5TCCA 3GCHB 4ZKRU 4HGCA 1BRUP 1XXDA 3QDZB 5FCRA 4MTBA 1AKSA 1XKBC 3F68H 2PKAA 3TU7H 3UOPA 1EXFA 1HNEE 1C1SA 1C2HA 1ANBA 2BOHB 2PKSB 1C4Y2 5T6DA 3RC4A 1LO6A 3E8LA 4KGAA 1ELVA 3QZRA 1HRTH 2GT7A 2ODQA 3BTFE 1QBNA 4KP0A 1DT2A 3RMLH 4NZLA 4LZ1H 1UCYH 2ZGCA 3KCGH 1AZZA 1HV7A 5GCHF 1Q3XA 4Q7XA 1SGIB 4A6LA 2CF9H 4DIHH 5EOKA 1GMHG 1C2MA 1BHXB 4WY3A 2Y80A 3P95A 1UTPA 1SLUB 3T29A 1BIOA 2GDEH 1O3IA 4JMYA 3DFLA 5G4BA 1FZZA 2P59A 3SUDA 1T8OA 1ACBE 2ANMH 4A7IB 3RXMA 2ZCHP 1VCPA 3HPTB 1ZJDA 5FX6A 4GCHG 1YPHE 1OWEA 4X2VA 3S7HB 3TH3H 2ZFFH 1NO9H 4NCYA 2TRMA 2AFQB 4CR9A 4Y0ZE 1J16A 2GX4A 3LGYA 1Y3WA 1RIWC 2QXIA 4DVAU 2ZGJA 4GHTA 4MDSA 1C2JA 1VGCC 3SORA 1HBTH 1D4PB 1W0YH 3RMOH 3AAVA 2STBE 4Y0YE 1O5CB 3H7OA 5CHAC 1LVBA 1K2I1 1FY4A 1UHBB 3KEEA 2AMQA 4OS1A 3A86A 1ANEA 1N6YA 4DT7B 3A8DA 1GDNA 1GHXH 4D7GA 1WTGH 1A4WH 2OXSA 4GLYA 2QA9E 1ZJKA 4U01A 1GHZA 5E0GA 1YYY1 1K21H 1MAYA 4X1SU 4JK5A 2TBSA 2YOLA 4Y7BA 5EQSA 3SGQE 3SV8A 1ZOMA 3T28A 1G36A 3DT0H 4RN6A 2WPIS 1DWCH 2CXVA 4B2BA 4XFQA 3VGCB 3RXCA 4SGBE 5B6OA 1ZR0A 1EJNA 2QY0B 2WPHS 1W2KH 1YLCA 3M5MA 3QTOH 4XOJA 2ZO3H 1MKXH 1C5TA 1F5KU 1RTLA 1Z1JA 2ZDVH 1EAXA 2ZC9H 1OWDA 4I8LA 1GBJA 4D7FA 3UFAA 2F9NA 2OINA 2QXJA 1TGNA 1O3FA 4BANB 3U98H 3AVZA 3ESTA 2ZDNA 1CSOE 1V2OT 2Z3DA 5JBBS 3GDSA 2P8OC 3KQEA 4AG1A 1CT0E 1BRBE 4J1YA 3RXTA 1C5SA 2QCYA 1ZMJA 4MNXA 3SU5A 1DANH 3F9EA 2WUCA 3SI4H 1FONA 3DA9B 5A0CA 5JB8S 2A45B 1RXPA 2BTCE 3UUZA 1BRAA 1QA0A 4ABHA 4MPVA 2BDCA 1ZLRA 1QIXB 3UQOA 1VR1H 1A3EH 1IQMA 3PTBA 2SNWA 4ISHH 1EPTB 4IGDA 4K2YA 3E90B 1BDAA 1O35A 3O8RA 1J17T 4MPUA 3VB5A 4CR5A 2OLGA 4YT7H 4TY6A 1UTQA 3S9BA 3B8JA 1S6FA 1V2QT 4JYTA 4CRCA 2G81E 3F9HA 1O3GA 3RXUA 3K65B 2RG3A 4I8HA 1YCPM 4AFZA 1IHTH 1XUKA 1S0QA 3M36A 1NESE 4CBNA 1P57B 3BF6H 1GBEA 5EQQA 1GG6B 2UWOA 4Q7YA 4NIYA 3RXAA 1HAVB 8ESTE 1CHOG 1EAWA 2ZU5A 2ASUB 4TYDA 1MMJN 4CHAB 4NZQA 2D1JA 2V35A 5T6FA 5FXLA 4LK4A 3G01A 2BZ6H 2PUXB 2Z9JA 2G00A 3UNQA 2ZHFH 2BQ7B 3BEUA 3BTGE 1SC8U 4AOQA 1B0EA 5C2ZA 1FIWA 5EPNA 5F8ZA 2NWNA 1J8AA 1IAUA 5ESTE 1UTNA 2K1QA 3C27B 4MNYA 2A7HA 1CQQA 5A8YA 3QUMP 3EA9A 1MU8B 1EKBB 2Y7XA 2BDBA 1GBKA 4WMEA 4Q80A 1K1IA 3O8DA 1O2JA 2GMTB 3ZVBA 1PPGE 1AUJA 2BVRH 1SQOA 3M37A 4JZFH 4DURA 4UFEH 2R0LA 3ZZ5A 2VINA 1C1TA 1PPCE 3PO1B 5H4IB 1VJAU 4CH2B 4WF8A 5DP8A 3RM2H 2Y81A 1Q31A 3M7TA 4I33A 4H6SB 2JKHA 1IQHA 2BVSH 3Q3XA 4WJG2 3M3TA 4CREA 2HRVA 1JIRA 2PSXA 2PW8H 1A3BH 1ZRBA 1J14A 5HMAA 1TB6H 2XRCA 5IYTA 4CRGA 2BDAA 2SGEE 2J34A 3TVJB 2FZZA 3BG4B 3T27A 2F9VA 1HJ8A 2HNTC 1O2WA 2OC1A 1BQYA 4ABGA 5ABWA 2UWLA 4A1TA 2YNAA 3PROA 4X1PU 1G3EA 3ZZBA 2B5TB 3NZIA 1HIAA 2A5AA 5C67A 1DY9A 2XC4A 4JYVH 3U8OH 1UTMA 3GYLB 6LPRA 1SMFE 2FOFA 2ESTE 4WXVA 4X1NU 3PB1E 4B2CA 1MUEB 3F6UH 4O97A 1G32B 1SHYA 5FPTA 4X6PA 4X8TH 3ELAH 3D65E 3SUFA 3IWMA 2GZ9A 3ZZDA 2P3FH 2ALVA 3MNXA 4Y8XA 3SU6A 4Y71A 1RFNA 5FPSA 4K1SA 1VCQA 1QQUA 2BDIA 1OP0A 1EUFA 3U8RH 1F0UA 4I8KA 1O3EA 1BOQA 3PYHA 4AG2A 1A46H 2M5TA 3A7WA 3B9FH 1PQ7A 3SNDA 3GOVB 4AORA 1Y5UT 1WCZA 1X7AC 4WXIA 3LGIA 3I77A 1TQ0B 1ZMLA 2FLRH 2W7UA 3MYWA 1LHGH 1YPJH 3A82A 5DO4H 1C5OH 1GI0A 3EDXB 1T32A 1EJAA 3QGNB 1OWIA 3UIRA 2QF3A 3QTVH 2XBYA 2AMDA 5GPIB 7ESTE 3MNBA 2VVUA 1UO6A 1LHEH 2P95A 3RXGA 1TA6A 1N1LA 4R0IA 3Q00A 1SGTA 1TWXB 1O2LA 2Y6TA 3URCA 1ABJH 4JZ1A 1DWDH 3SV7A 3BTQE 4K5ZA 4Q2KA 3T62A 1JRSA 3L33A 3FFGA 4X0WU 3SU1A 3GCTG 3KQCA 3IG6B 1C2IA 4OS5A 2VB0A 3ZZ6A 3A7YA 1O2QA 2ZG0H 1ETSH 4NA7A 1JRTA 5C1UA 3TGKE 1QCPA 2A2QH 2FDAA 5DP4A 3DD2H 4YO9A 3FVFB 2CJIA 1VITH 3MNSA 3RXEA 1KTTB 5HYOA 1Y5AT 3A8CA 1O5DH 3ZVFA 2J94A 3ZVEA 4MPXA 2Z9IA 3PMJA 3V3MA 3BG8A 5L2ZH 2F9PA 1GGDB 2FEQH 1SGQE 1P11E 3T26A 3FANA 3LGUA 2DUCA 5EXLA 4A92A 4MLFB 1EJMA 3ODDA 1CO7E 1ZSJA 3A88A 1ZTLA 1H1BA 3TPIZ 3M5OA 1KIGH 9LPRA 1C5XB 3RXKA 3BIVH 3QX5H 2Y82A 1D9IA 1TBRH 2G55A 2ZQ2A 2AGIX 3E0PB 1NROH 5TJXA 6ESTA 1EOJA 1O2ZA 1LVYA 3IITA 3RXVA 3RUOA 1W8BH 1L4ZA 5EXMA 4TWYA 1GJ5H 1V2LT 2GCHG 4BNRA 1P0SH 5DP3A 1Z8RA 3ZYEA 3EAJA 1DVAH 4NIVA 1FI8A 2HPQH 5F8TA 1LQDB 1A0JA 1ANDA 3A8AA 4D9QA 2FOEA 2BX4A 2HNTE 5C1XA 1AVGH 1GHWH 2BOKA 1MBQA 3MU0A 3T25A 1NC6A 4WH8A 1Z71A 4X8VH 1F5RA 1GCDA 1ZYOA 3LONA 2ZQ1A 3RM0H 4FUEA 2UUKB 3SHCH 2XC0A 2A2XH 1L1GA 1O38A 3GY7A 2BDGA 1MAXA 2HPPH 1AO5A 2BY5X 1TLDA 1GCTC 1GJAB 3MMGA 2ZNKH 4FXGH 2F9BH 3UNRA 2ZA5A 4LOYH 1UK4A 1ZHRA 2BLWA 1AWFH 2Y5FA 3VB4A 3VB7A 4CBOA 4ISIH 2OBQA 1ESBA 3M7QA 1GI2A 3T5FH 1BTZA 4YZUA 1N8OC 1G3BA 3TNTA 2ZGBH 1AFQC 1OWJA 3UWJH 3EA8A 4ASHA 1GDQA 1P01A 4AYYB 3SZNA 1NRPH 1YGCH 1GJ9B 1Z8IB 1DFPA 2C8ZB 2ZI2H 2AH4X 1SQTA 1V2RT 5DK1A 1DSTA 1FIZA 1P9SA 2CHAB 4IC6A 4HI3A 4MNVA 5A0AE 2ZGXH 5AF9H 1O34A 2A5IA 3BSQA 1FQ3A 1HPGA 3MH7A 1AIXH 4RSPA 4BAKB 4LZ4B 1RTFB 1ZRKA 1S0RA 1AN1E 1MBMA 3SQHE 1MQ5A 2ZIQH 1HAXB 1O3MA 2VIWA 4IN2A 1QRWA 3TH4H 5A09A 1CA0B 4GHQA 2GT8A 4O03A 4R8TB 3QZQA 5J4QA 1HYLA 1G9IE 1CT4E 1TBQH 2Q6GA 3BN9A 7KMEH 3M3VA 3SGBE 3P92A 2ZHWH 1CBWC 1MTNC 2G5NA 2XBWA 1NS3A 4MNWA 1DM4B 1W11U 2WYJA 2ZHQH 5EW2H 2BY8X 2NU1E 1QBOA 6GCHF 3P8GA 1O5FH 3GCHC 4IC5A 1O3HA 3M5NA 4D9RA 5GJ4B 4AX9H 1D3QB 2R2MB 4FUDA 1RD3B 4KTUA 6GCHG 1OWKA 1MZDA 1O3BA 1PPBH 1MTUA 2PGQB 3SNAA 1GBTA 1GI8B 3GYMA 2PKSC 1GHAF 1P10A 2H6MA 1K1PA 1FPCH 2BHGA 1EP6A 1AB9B 5BPEA 2VU8E 1A2CH 1ZSLA 2I6SA 1UCYE 1TX6A 1EZUC 2V0BA 1Z6EA 2TGDA 1ELAA 1TRYA 1AHTH 1O36A 3D23A 1YPLH 3E1XB 1KLJH 2EI8A 4BXSA 3A83A 2STAE 2D2DA 1DE7H 1SLXB 3GY3A 1C1WH 2FPZA 1T4UH 5EODA 1GVKB 1EAUA 1Z6JH 3ZZ3A 1PYTD 4YOGA 2Z94A 1DUAA 5FPYA 1KY9A 5GIBA 1MD7A 1O2TA 1AWHB 1L1JA 1KXAA 1GMHF 3MO6A 1YBWA 4NGAH 1A1RA 1XUHA 4AGJA 2ZPRA 2YNBA 1AD8H 3HKIB 5DP7A 1SGCA 1GI4A 1XVMA 2F9OA 2R2WU 2ZTYA 3A89A 2DE9A 1C1NA 2C8YB 2ZZUH 1S85A 2Q6FA 4U30A 3URDA 1P06A 2WYGA 4E7NA 3LJJA 2ZFRH 4GCHF 3CS0A 3RC5A 4DJZB 1ZHPA 3A80A 2SNVA 4INLA 2FIRH 1O39A 2EA3A 3MOCA 4YM9A 2SGFE 2ZGHA 1BUIA 2XXLA 3R0FA 1HJAB 1B5GH 1XUIA 2SGAA 1TOCB 4XBCA 3UOUA 2G4TA 2A32A 2GKVE 4INKA 5IDKA 3ZVGA 1FN6A 3PMAB 2BDHA 3PWCA 2GGVB 2JH0D 4ZHLU 2BD8A 3MU8A 1QURH 4XE4A 4MQAA 1NY22 3LJOA 1B7XB 1TFXA 4Y79A 1LQEA 8LPRA 2PHBA 1EP5A 2VGCB 5C1YA 1OS8A 1IQJA 3FZDA 2TPIZ 1C4V2 3VGCC 1S6HA 2B9LA 5A8ZA 2IN2A 3OTJE 1SGFG 1JBUH 1W12U 2Z9LA 4BTIB 3ITIA 3SQEE 4D76A 2AYWA 2FP7B 3ODFA 5C20A 4OGXA 3MO9A 2GZ8A 1FPHH 4ZKOU 1WUNH 5AVDA 1MTSA 1QFKH 3BIUH 2ZDAH 5GDSH 1BTXA 2C93B 2A4RA 4MPWA 2A4OA 1F2SE 1TGCA 4H6TA 1A5IA 5SGAE 2FO9A 2ZP0H 1P2IA 1YLDA 1WYKA 2BM2A 1EZSC 1UTLM 3GY5A 3ZV9A 4YOJA 1THPB 3RU4T 5E0JA 3ZYDA 1P12E 1G2MA 3A7VA 3I78A 1LPGB 2G8TA 3A8BA 2OP9A 4ZKNU 2Z3CA 1HB0B 1KDQB