2G5VA

Indole-amidine complexes with bovine trypsin
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Cationic trypsin
publication title Ligand Epitoping By Proton NMR Chemical Shift Differences
rcsb
total genus 59
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2006-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2g5vA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2g5vA02
1AMHA 1KTSB 2BY5X 3RXHA 2A45B 2BX3A 5AF9H 4FXGH 3ZZ7A 1O3EA 4UONA 2V6NA 1DOJA 5JBTA 1C1WH 4X0WU 1DY9A 2XXLA 3A83A 1ZPBA 1CO7E 3SNCA 1THRH 3BTGE 3BG4C 4X2XA 4IN2A 2GP9B 1RTLA 4CH2B 1S6HA 2ZFQH 3U1JB 4JZFH 3ATIA 4UFDH 1MCVA 3BN9A 1NFUA 2Z9IA 4WWYA 3PV4A 3IWMA 4YLUA 4K5ZA 2AGEX 1SOZA 1O2TA 3SV9A 1DT2A 2FOGA 3BG4B 4Q7ZA 2UWOA 3H7TA 3ZZAA 4GVUA 1O5DH 1FUJA 2A4QA 1NT1A 1GMCF 1ZSKA 2NWNA 2ZC9H 1W7XH 3LDXH 2I6SA 2Y5GA 1QTFA 3KEEA 1P06A 1DWDH 3PMBB 4BNRA 5JDUB 1GI8B 1ESBA 1C1RA 5A8XA 1GPZA 4NSVA 1SLXB 1GVZA 3GY7A 2PKSC 3FP6E 3GCTG 1NN6A 5EXLA 4D9RA 2VINA 3M3VA 3V12A 5IDKA 1V2PT 3KCGH 2A5AA 3CS7A 3M36A 3RXTA 1HAGE 1Q31A 1IQFA 1XUFA 4HI3A 4ZAEA 1G32B 5FAHA 1D3QB 1EZQA 2PKSB 3SGAE 3SN8A 3RU4D 6LPRA 1ESTA 1GBFA 1C2LA 1PPBH 3HPTB 1ETSH 2D1JA 5DP5A 1SGRE 1G2LA 1QB1A 2VIWA 4DCDA 2O9QA 1AIXH 1DANH 1ELBA 2FXRA 2ZHFH 3MNXA 1TNGA 3KQDA 4JZDH 3SGBE 3UOUA 1NTPA 2OQ5A 3GCNA 3T29A 1MAYA 2IPHA 3RM0H 3W95A 1C1PA 1JWTA 1C1QA 4RSPA 5GCHG 2PSXA 3MNCA 1EAIA 3RC5A 3EGKH 1WCZA 1O3HA 2Z9LA 1C1MA 2ZU2A 3P17H 4GAWA 2XTTB 3SQHE 1GBEA 3M5NA 2GMTC 4GHTA 4X2WA 1HAZB 4U30A 1C4U2 3ZZ9A 2BOHB 3AW1A 2FOAA 1RTFB 1TWXB 4ESTE 1TGTA 4AG1A 2SNWA 1E0FD 2O8LA 1BA8B 2XC4A 1H9LB 1HGTH 4AFUA 2GMTB 1LPZB 3FVFB 4X8VH 5FCRA 4O9VA 4ABJA 1WUNH 4I8LA 1BTUA 1ZHRA 1BRAA 1ETRH 1UTOA 5DP8A 3S7KB 1FIWA 3T26A 4E06H 4Z6AH 3PYHA 1P9UA 4I7YH 4BAMB 1TE0A 1OP2A 4YO9A 1LHGH 4ZKOU 4KGAA 2CN0H 4DGJA 1FONA 4XBDA 4A6LA 1LKBA 1S82A 3U8RH 2ZPRA 2G4TA 1BTHH 2Q6FA 3A86A 3FAOA 4I33A 1QURH 4BOHA 1IQLA 4X1RU 1MMJN 1BTPA 4INKA 1B0EA 1JRSA 1P02A 4Y76A 5E2PA 2WV5A 2BHGA 3W94A 1ZTKA 2FOCA 2P3FH 3MTYA 1ZMNA 4Q80A 3PTBA 1A3EH 3Q3XA 2OC1A 3ITIA 3MO3A 1N1LA 3RXCA 2BDCA 1W13U 1TX6A 3A82A 3K65B 2ZDKA 2WINI 2ZFSA 3VB6A 2ZFFH 2ZTZA 3AASA 3S0NA 1WTHD 1DWCH 3TVJB 1QQUA 3LH1A 5DO4H 1CU1A 1O2GH 3EA8A 4CR9A 1GI3A 4X6PA 1H9HE 1KLIH 4K1TA 4Q2KA 4XBBA 5GJ4B 2GX4A 1TONA 3OX7U 1SPJA 3SU1A 5EXMA 1PYTC 5K7RA 2ODYB 1BHXB 3L6PA 4DT7B 5F6MA 3KGPA 4NA9H 1S83A 1PPEE 1YF4A 1GGDC 1Y5AT 4THNH 4ABIA 5F8ZA 1TNHA 4YESB 1OP8A 1Y3VA 4FUHA 1O2PA 2FESH 4IW4E 4Y10E 4DOQA 1D6RA 1WQSA 7GCHG 2SGPE 1W0YH 3ZZ5A 4K1SA 3BG8A 1O5CB 4Y7AA 2EI8A 3H7OA 4WJG2 1GGDB 1FJSA 2FO9A 3C27B 2ZDAH 1ZHMA 1TMBH 3ODFA 1C5RA 2BTCE 4JCNA 1MQ6A 1TPSA 1ZRKA 3QK1A 1MH0A 1U6QA 2A4RA 2FIRH 1CT2E 4IMQA 2WUCA 3RXAA 4DIHH 5DG6A 2ZHDA 3NUMA 4CRDA 2BZAA 4AYYB 1TX8A 4Q7XA 3OTJE 1HXEH 2RA0A 2NU4E 4X1PU 4JZ1A 3BTQE 3M37A 4AX9H 4JZEH 2RA3A 3CENA 3UPEA 1F7ZA 1AUJA 4I8HA 2A4GA 5TJXA 2FLRH 1GI6A 3LGVA 3PMAB 5FPYA 3O8CA 4CBOA 5JBAS 1WOFA 1XUIA 2VIQA 1IAUA 1EAUA 1GHAG 4KKDA 1CT4E 3GY8A 2OXSA 1C5UA 1N6YA 1HIAB 1VITG 2BY9X 1KYNA 2O8TA 3JZ1B 2QAAA 1IQGA 3AW0A 1L4ZA 3SUFA 3ZVCA 3RXMA 1SFQB 8GCHF 1GJ6A 1GG6C 2SGDE 2C8ZB 3SJ9A 3U98H 1EB1H 1T8MA 2RDLA 1G30B 4U2WA 4UDWH 3SHAH 3A8BA 1O38A 1YKTA 4UD9H 3VPKA 1TYNA 1QBOA 3P8FA 8LPRA 3MH5A 2VH6A 2ANWA 1GI0A 1AVGH 4ABHA 1GG6B 1GJ5H 1P2NA 2XC0A 2CF9H 3BF6H 3BTWE 2BQWB 4A92A 1B5GH 1SSXA 1SQTA 2RG3A 1FN6A 5T6DA 3TH3H 5JBBS 3ODDA 1W3CA 4WH6A 4AORA 1LVMA 1FY3A 2BDIA 2IJOB 1PQ8A 3HK3B 2C93B 2AMDA 2TGTA 4ZKSU 1XUHA 1W12U 3A89A 1EP5A 1O2NA 4JK6A 2JH0D 2PUXB 1P04A 3GY6A 3Q77A 1O5EH 4BANB 1V2QT 3A80A 1FV9A 3P95A 2ODQA 5L6NH 2TBSA 1BRUP 4AYVB 2FX6A 4WMEA 5EPNA 1IOEA 2QV1A 3RXRA 2HPPH 4B71A 3DHKH 1E36B 1DSUA 3I78A 3NK8A 1FPHH 2ZEBA 1OPHB 3K9XB 3U8OH 1C2FA 1BZXE 4UFFH 1C5XB 1F0UA 1O2XA 1FAKH 1XMNB 3F6UH 2ZU5A 1TNIA 3PLBA 1HDTH 2AGIX 2ULLA 5EU8A 2BD8A 3A7YA 2A0QB 3HKIB 1IQKA 1HJ9A 1ZMLA 2BY8X 3SHCH 1UVSH 2FP7B 4B74A 1GCTC 3LH3A 1DDJA 1MTUA 4K69A 2V3HH 1QGFA 4ISLA 4ABEA 3DA9B 5BRRE 1EKBB 2Z94A 2SGFE 1K22H 2PFEA 3LGIA 1S81A 1C5SA 9LPRA 2OQUA 1PPZA 4MPXA 1QB9A 3LKWA 1P10A 1AVWA 1GCTB 4TY6A 2VU8E 1CT0E 1V6DA 2XYAA 1DM4B 5A8YA 4IC6A 2ANYA 3P8GA 4OS7A 3TGIE 1BQYA 2D26C 1O3IA 2GDDA 2TGPZ 2ZF0H 1V2WT 4GLYA 3SV8A 1L1GA 1AFEH 4NZLA 2BY7X 1YC0A 1A2CH 4NIWA 3BEIB 1LPGB 1XKBC 3M7QA 3PLKA 4Y8YA 2G4UA 3MU1A 5G4BA 3NZIA 1PQAA 4D7FA 1N6XA 3NKKA 2A4OA 3EE0B 4INLA 3VB7A 1VCPA 2BDBA 3MYWA 1NPMA 1O3BA 3RLWH 1P57B 2J92A 2FLBH 8KME2 1C1VH 2NU1E 2ZGXH 3KQEA 1O2WA 1QFKH 3ZZ8A 1RFNA 3D62A 2GTBA 1SR5C 1HAPH 1V2ST 1P2KA 3TH2H 4OS5A 5LGOA 3TU7H 1BMMH 1D9IA 4KTSA 1GL0E 5FPTA 1BTYA 2J4IA 1GWAA 1EASA 3FANA 3HK6B 3KN2A 2OINA 1BDAA 1Y5BT 4B2CA 4CHAC 1QB6A 2Z7FE 5K0HA 2OLGA 1YPLH 3BTTE 2R3YA 3RXGA 1K9OE 1SGYE 4K1EA 4K2YA 1Y59T 3Q3KA 1ELFA 3VB5A 3SU6A 5CE1A 1C2HA 1C4Y2 1GI1A 2LNCA 3KIDU 2D2DA 1HV7A 4CHAB 6GCHG 1GMDG 1SOTA 1Z6JH 1SBWA 1XVOA 1O3KA 1ABIH 2ZFRH 1O3MA 1V2JT 1Y3YA 3A8AA 4NFFA 2FTLE 5ABWA 1C5YB 1VJAU 1B0FA 1JOUB 1ZZZA 2QYIA 2BXTH 1D3DB 3M61U 4XDEA 4J1YA 5HGGA 1QL9A 3MMGA 2QGRA 3UY9A 4DIIH 5ETXA 2R2MB 2EI7A 4ABAA 1O5FH 5E0JA 1RD3B 1TGCA 3TIUA 3DT0H 3TK5A 3SV2H 1A5IA 1X7AC 2ALPA 5F8TA 2TGAA 1PYTD 3RXFA 1YCPH 1P05A 1INCA 2QA9E 3P92A 1CA8B 3DUXH 1V2OT 2Y82A 3TGKE 1F5RA 1Z1JA 4X1NU 1NFXA 1RRKA 4R0IA 2YNBA 1O30A 3MH6A 3MHWU 1GBCA 3A7XA 3PB1E 1DE7H 2C8WB 1O0DH 2Q1JA 1MTVA 1Y3WA 2BLWA 2BD7A 1GMHG 7LPRA 1LQDB 4IGDA 2GV6A 5H4IB 1BITA 4Y0YE 5A09A 4MPUA 1EP6A 1XUKA 2G00A 2FPZA 2PTCE 3AAVA 2GDEH 5DP6A 1GJ8B 2PUQH 1S5SA 3EAJA 2ANKH 4O3TA 3GCTF 3T5FH 2WPIS 4ZHLU 5GIBA 3RC4A 1Z8JB 2HRVA 3MNBA 2BLVA 1O31A 3AVZA 2CGAA 2FEQH 3A7WA 3TK6A 1AUTC 2BD3A 1HAXB 2FWWA 5E2OA 5TCCA 1O37A 1V2UT 2FI4E 1VCWA 4NWLA 1C2IA 1KXBA 3OY6U 2AMQA 1QNJA 4SGBE 1MD7A 1TGSZ 2AS9A 2AERH 4MNYA 1MBQA 4BTIB 2VB0A 1F2SE 3O8DA 1AFQB 3IITA 1CVWH 3LOXA 5E0GA 4ABFA 4OS2A 4OS4A 1TIOA 2Y80A 3T27A 2EEKA 8ESTE 5DJ7A 2W3KA 1CGHA 1FZZA 4DJZB 1NS3A 4ZROA 2P8OC 1GHXH 1GVKB 2EC9H 5GCHF 3SOSA 4TPYA 2C4FH 1MD8A 2JETC 1GBJA 1LDTT 2ZP0H 3F68H 3KNXA 5I25A 2BD9A 1JIMA 3MO9A 1FQ3A 1NU9A 1DLKB 1QY6A 4YT7H 3L3TA 2J34A 1C2EA 1ELGA 3A8CA 3E0PB 3ZZ4A 1GBIA 2P8OB 2ZHQH 1TBZH 1W10U 4JYTA 5AHGH 1CHGA 4MQAA 1G3BA 2XC5A 2JETB 5GXPA 2G5VA 2R0KA 1VJ9U 1NFYA 1L0ZA 2O8UA 3B8JA 4JMYA 1AWHB 2J38A 2B5TB 2ZU4A 5TCAA 1T8LA 1A5GH 4NSYA 2KAIB 5J4SA 1DLEA 2WPMS 1LVOA 1GBBA 2PSYA 3F9HA 3ZZ6A 1HRTH 1LVBA 2NU0E 2QF3A 4PROA 3FZZA 2JH6D 3RXQA 2F9NA 4XSKU 3T2NA 2GZ9A 2CJIA 2SGAA 1ZPZA 1W0ZU 5FX6A 2XCNA 1OP0A 3MOCA 3RLYH 3SBKA 1SGPE 2F3CE 4OS1A 1S6FA 4FU7A 2H9TH 1SI5H 1V2TT 1UCYK 1KIGH 3S7HB 2BDHA 2NU3E 3BEUA 1ELCA 4ASHA 4BTTB 2J94A 5EQRA 2HVXA 2Q6GA 1F0TA 1C1OA 1SGCA 3M5MA 4A1XA 1OSSA 1J9CH 2ZZUH 3QN7A 2BB4A 1RTKA 1MKWK 1EQ9A 2FS8A 3ZZBA 3H5CB 1TMTH 3F9GA 2BD4A 1JIRA 1O2HA 4AFZA 1GBDA 2BZ6H 1TA2A 1H9IE 5HM9A 4LK4A 1K2I1 4JYUH 1MBMA 1YPMH 4LZ1H 3K6YA 1DXPA 3DFJA 3KL6A 4IS5A 1YYY1 1H8IH 4UE7H 4RKOB 1NFWA 4CREA 3Q3YA 1LHEH 3MH7A 1KXFA 1TNLA 2A1DB 4K8YA 7GCHF 1E34B 2OBOA 5FXLA 2FDAA 4CH8B 2QXJA 5FBIA 2OBQA 5JB9S 1YLDA 4BAQB 1ZTJA 1G3EA 4FUDA 2J2UA 3N7OA 3BTDE 3P8OA 4BXWA 3A87A 1DWBH 5AFZH 2FM2A 2LPRA 4WH8A 1EAWA 2J95A 5HXFA 3FP8E 1ZSLA 2ZWLH 3LT3A 1KXCA 3K6ZA 1SG8B 3U1IB 2SGEE 4NIXA 4E7RG 2ODPA 3QX5H 1IHTH 3UOPA 1THPB 2AYWA 1HFDA 2A7CA 4GCHG 2XBWA 2TGDA 3LJJA 3UR9A 2P94A 1A5HA 1P11E 2TPIZ 3RC6A 1SGNE 1OX1A 1GJCB 1GHAF 2BQ7B 1F0RA 2H6MA 1HAYB 3S9AA 3TNTA 4JZIA 2HLCA 3S9CA 2ZHEH 1VITF 1XUGA 1NO9H 2C8YB 2PR3A 2VWLA 1MU6B 1JXPA 1UTQA 5A2MH 1QL7A 4IMZA 1EZSC 4MLFB 4Y6DA 2ZGJA 1O2JA 4H42U 4BXSA 1TA6A 3RMNH 2FMJA 3EYDA 1QJ6B 3G01A 2WPLS 3PMHB 3MU0A 1H4WA 2UUFB 4AFSA 5JB8S 1A3BH 2KAIA 3U8TH 1IQMA 2OC7A 4BAOB 1EX3A 1J17T 2QXHA 3TJUA 5C1UA 3PROA 1D3PB 3EQ0H 1CGJE 1MZAA 1P12E 1SGFG 3RXSA 2HNTF 4MPWA 1BJVA 2FI5E 1H1BA 3GISB 5AFYH 3SORA 4D76A 1L1NA 1SGEE 1SLVB 2BLOA 3URCA 2R2WU 2V3OH 2PHBA 4TWYA 3UWIA 2VVVA 1GHZA 2VIPA 2HPQH 3GICB 2ZCLP 3MI4A 2WUBA 5EXNA 2ESTE 3P70B 1FXYA 1GHVH 3CP7A 2FODA 4BAKB 2B9LA 1O3AA 3V13A 1C1UH 5EGMA 4Y8XA 3ZVBA 3VB4A 1O3FA 1ZYOA 5EODA 2G8TA 1GI4A 3LU9B 1BBRK 1ABJH 1D3TB 4F49A 1C5QA 1C2JA 1MTWA 1A0JA 2QXIA 1OWDA 2O8WA 1V2RT 1KLTA 3DFLA 3S9BA 2QIQA 1VGCC 1WYKA 1C2GA 1O2MA 2A2XH 2OP9A 1C1TA 2F91A 2G52A 2HWLB 1TBQH 4AZ2B 3SW2B 3A7ZA 1ID5H 2ZTYA 5DPAA 2W7UA 1O2SA 5JYIA 1O2QA 3BTKE 1VGCB 1NRNH 2SFAA 1P3EA 1QCPA 4HTCH 2UUJB 1QJ1B 2B7DH 2R3UA 4B1TA 3LGYA 1BMAA 1GL1A 2AEIH 1CGIE 3M35A 2QXGA 3ZVDA 1G3DA 1PPHE 1W8BH 1GI9B 2VH0A 1O3DA 3GY5A 1K1MA 1DWEH 3QZQA 2QF0A 2V35A 1B7XB 4CBNA 1UTKA 2GKVE 1UK3A 2FOHA 4U32A 1QBVH 5LH8A 1QJ7B 2BMGB 1PPCE 3LC5A 4DURA 4OS6A 5EW1H 1P2MA 3RUOA 5C1XA 1K1OA 5EPYA 3ZZDA 1ANDA 1VCQA 2VGCC 1ZJKA 2FOFA 2G55A 1GI5A 3UWJH 1O2LA 2Z6BD 1EJMA 1HAVB 1YGCH 1J15A 1NC6A 3M3SA 2Z9JA 4ZMAH 3P6ZB 2H2ZA 2ZPSA 4B2BA 2VIVA 5EOKA 4NIVA 3E8LA 1WU1A 2VGCB 5FPSA 2Z9GA 3D23A 2XRCA 4VGCC 1LMWB 1F5LA 4X8SH 1KXAA 4U01A 1PPGE 5F8XA 3UR6A 1DXWA 1XM1A 3RXUA 1N8OC 1O3GA 3QLPH 4K8BA 1T8NA 3ZV9A 4VGCB 1GMDF 3GYMA 3NWUA 3R3GB 4K60A 4OGYA 1C1NA 1MKXK 1O2KA 3QWCH 1V2KT 1CE5A 1DX5M 3A85A 4I32A 5ESBA 1C2MA 1XX9A 5CHAB 1N8OB 3SNDA 1W11U 4UFEH 1BB0B 3KQBA 4YT6H 1V3XA 4XBCA 1UTNA 2BVRH 1BRBE 6ESTA 3TPIZ 3FFGA 1XXFA 4YM9A 1LHDH 1RGQA 2CMYA 1O36A 1ZMJA 3UNSA 2GCTB 5A8ZA 3SJKA 2STBE 3TH4H 1OOKB 4CRCA 4KTUA 1YPJH 3ATMA 3UNRA 2A2QH 3RXDA 1UTMA 3GYLB 2IOTA 2AIPA 2Y6TA 2ZU3A 3SI3H 2AH4X 3C1KA 1OWJA 1GDQA 1AY6H 1LPKB 3ZV8A 1LHFH 1GMHF 4RN6A 4AB9A 1OWEA 1RIWC 1TRYA 1CHOG 1HCGA 1YPHC 1HIAA 3RXIA 2H1UA 5EQSA 3OYPA 1UVUH 2FOEA 2HGTH 1O3NA 4MVNA 4TWWA 1NM6A 1O5AB 3HGNA 1AZZA 2VVCA 1TABE 3I29A 3SNEA 4FUJA 4DG4A 1MTSA 1Y3UA 1C5PA 3URDA 5A0BA 3GDVA 1RIWB 3RMMH 1O35A 4FU9A 3HGPA 1Y3XA 4Y7BA 1HLTH 3HKJB 5T6FA 2QY0B 2GCHG 2PTNA 1UK4A 1RXPA 5DK1A 3PMJA 5F03A 1ZGVA 4JYVH 1Z8IB 2ZTXA 1ZOMA 1IQNA 2VWNA 1W14U 4NFEA 1V2VT 2VIDA 4Y8ZA 4ZH8A 2UWLA 2AFQB 2P16A 3QTVH 4I8GA 4ISIH 1BTXA 2W26A 1AHTH 4NG9H 1SGIB 1Z6EA 2K1QA 3ZVFA 2CF8H 4NA7A 3VXFH 1AGJA 2Y81A 4LZ4B 1G2MA 3ATWA 2XBYA 3NPSA 4UEHH 3BIVH 3A81A 4I8JA 1F92A 1OWKA 1ZR0A 1S0RA 4NCYA 1HAVA 1BHXF 3EA9A 1SVPA 3QDZB 1O3OA 1WTGH 2ZU1A 1GHBG 2WYGA 2ZA5A 4MPVA 1PPFE 1K1LA 1GBTA 2BDYA 2UUYA 1YPHE 3VB3A 2A7JA 3PLPA 1KY9A 5DP4A 2SNVA 2BLQA 3KHVA 1EJAA 1OYQA 2OUAA 2Z3CA 4IBLH 5HM2A 3RXPA 1ELVA 1O33A 2Q6DA 1IHSH 1C5NH 4X6MA 4WVPE 4FUIA 3DD2H 2VJ1A 1FY4A 1ZRBA 1OKXA 1OXGA 4AOQA 4Q7YA 3SNAA 3LJOA 4XFQA 1A0LA 2H9EH 3QGNB 3B9FH 4NA8A 1YPKH 1TPPA 1YLCA 5FBEA 3F9EA 4TY7A 1KTTB 3SI4H 3BSQA 1QIXB 2F83A 1C2DA 1TNKA 1EB2A 2A7HA 1AFQC 1AE5A 3E91A 4LXBH 2YOLA 3SUEA 4FU8A 1SGFA 1O3PB 2C90B 5HMAA 1GBKA 3TJOA 1V2MT 9ESTA 2PWXA 4DVAU 2P59A 3STJA 4DW2U 1GJAB 1QR3E 3M3TA 2OCVB 3V7TA 3V0XA 4TYDA 4WXIA 2IN2A 1DUEA 1GVLA 2UUKB 2F9BH 3B23B 5JPMH 1O2UA 5DKMA 4CRBA 4AG2A 1HYLA 1L2EA 1XKAC 2OD3B 1O32A 2G81E 4ZHMU 1SQAA 4ZXYH 2AMPA 1GJ9B 1P2QA 1QQ4A 1UK2A 5DGJA 2GT7A 2FYQA 1HUTH 2ZQ1A 2UWPA 1S85A 2H5CA 2BD2A 1EZXC 4CRAA 5ESTE 1BRCE 5HYOA 4XOJA 3RXBA 3SO3A 1M9UA 3ATLA 1UCYH 1GJBB 1WBGB 2OC0A 5FX5A 4H6SB 2RCEA 1W2KH 4B73A 1FY5A 3E16B 1ZTLA 1PJPA 1HAIH 1IQHA 4M7GA 4NGAH 1TNJA 1KXDA 1MKWH 1O2YA 2XNIA 1NZQH 1GBAA 1F0SA 4GCHF 2H5DA 4Y79A 1C5MD 3GOVB 1Z8GA 3D65E 4K3JA 3FP7E 1HNEE 4O03A 3UIRA 1P0SH 2BD5A 3TK9A 2HOBA 1BIOA 4D9QA 2TRMA 1DY8A 1E37B 3RDZA 7ESTE 1KDQB 1HJ8A 1TPAE 1UJ1A 3TNSA 2F9VA 1TQ0B 1NRSH 2XWAA 1AKSB 4A5TS 2WPKS 2BYAX 2YNAA 4X8TH 1C5OH 4FUEA 1P01A 1BOQA 4RKJB 5E8EH 1FY1A 1MZDA 2P95A 3SU5A 1O3JA 4AFQA 1SFIA 2FOBA 4E05H 2ZDMA 4X8UH 1DSTA 4MTBA 1NESE 1OYTH 1OWHA 5B6OA 2STAE 5DP7A 1TRMA 1SC8U 1HAHH 1SMFE 2FX4A 5L2ZH 2OTVA 1J8AA 3A8DA 3ESTA 2Y5FA 4CRGA 3U69H 2VNTA 4X1SU 5C3NA 1F5KU 1O34A 1YPEH 1P09A 3MU5A 1C5ZB 3SU0A 4GUXA 1HAOH 3ZVGA 3GY3A 3P8NA 1TMUH 1V2NT 1LO6A 3HATH 1HXFH 1TFXA 4X2VA 4KTCA 1FLEE 3LC3A 2WPJS 4YTAA 4WMDA 4X1QU 1ZJDA 3F1SB 3FZDA 3GCHC 3E0NB 4TPIZ 3T25A 2ZECA 3GDSA 5FHTA 3RMLH 1UHBB 1EJNA 1T7CA 4AB8A 4I31A 1QA7A 1UTPA 3RXOA 2BX4A 1O2RA 4FUCA 1KSNA 1UCYE 2VWOA 3EA7A 3GCHB 1K1PA 1EZUC 1V2LT 1GMCG 3ZVEA 4MNWA 1ELAA 1EPTC 1K21H 2BOKA 2BY6X 3ATKA 1MQ5A 2XW9A 3ENSB 1AE8H 1E35B 2VWMA 4MDSA 3ZYEA 2A32A 2F9OA 1O3LA 4UFGH 2F9PA 4CR5A 1UVPA 4NWKA 1EPTB 4YZUA 2FYRA 3LGWA 3WY8A 2Z9KA 1DVAH 1J16A 3BTEE 1TB6H 4HGCA 1TGNA 4YOGA 1C5WB 1Z71A 2ZDNA 2O8MA 1FAXA 1W7GH 2J9NA 5EW2H 2PGBB 1EATA 2Z3EA 4DY7B 1TX7A 4ABGA 3K2UA 1FI8A 4GSOA 4BAHB 4ABBA 5A0CA 3JZ2B 4D7GA 1FPCH 3UUZA 3UNQA 4FUGA 3LONA 4QT8C 4NIYA 4X6NA 2ZIQH 3ZVAA 2W3IA 1FIZA 1E38B 1G3CA 1SL3A 5LPFA 2Y7ZA 2PKAB 1BBRH 4YOIA 1C9TA 2PGQB 1THSH 4ZUHA 2BM2A 2G51A 2WV4A 3NXPA 1QA0A 4Y71A 5GWZA 1NY22 3PTNA 3PWBA 2B8OH 3E6PH 1NROH 1QHRB 1TOCB 3Q00A 2ZHWH 2CHAC 1ZHPA 1BUIA 1NRRH 4R8TB 2PV9B 3SJOA 5DP9A 1VR1H 1L1JA 1KDQA 2ZKSA 1O3CA 1O5GH 3F9FA 1CSOE 1QRWA 3RXJA 2ZCKP 4WXVA 1AKSA 2P3UB 1IQIA 5C5NA 2AGGX 2CHAB 3GCOA 1PFXC 3M5OA 3OY5U 2VIOA 5EQQA 5C1YA 1JRTA 2XWBI 2DE9A 4JK5A 2GT8A 1FY8E 3TLOA 4B75A 2R9PA 1KXEA 1RJXB 4A1TA 1EUFA 4AGKA 2AIQA 3V3MA 1Q3XA 2C8XB 3UQVA 1LVYA 5PTPA 3KQCA 1K1JA 1ZSJA 2ZQ2A 3MO6A 1Q2WA 3M7UA 3S69A 3OSYA 1EOLA 1AO5A 1G37A 1XVMA 5AVDA 1SLUB 1DUAA 4XE4A 1T8OA 3SU2A 1GBHA 2GGVB 1ANCA 1SQOA 4ZXXH 1UHBA 1GDNA 4GHQA 1BT7A 4WY3A 2ZI2H 4IC5A 3SUDA 2DUCA 2EA3A 2ZO3H 1ESAA 1AB9C 1OWIA 3UREA 3QZRA 1FNIA 4IN1A 5BPEA 1S84A 3KF2A 3MU8A 1BTZA 3I77A 3VGCC 3VFEA 1MU8B 1CQQA 2ZPQA 1GI7B 2Y7XA 1YBWA 4O97A 2JKHA 1EOJA 1GI2A 4A1VA 1AB9B 2PW8H 1RS0A 1DPOA 2PLXA 2ILNA 2R0LA 1IQJA 2BVSH 2ZCHP 5C67A 1CHOF 1XXDA 1JBUH 4I8KA 3VGCB 1Y5UT 3LGUA 1A4WH 1BBRE 3IG6B 2TIOA 5GDSH 1EPTA 1MKXH 1P8VC 1C5VA 1MTNC 5C2ZA 3PM3A 1GBLA 1UTJA 1FN8A 1ARCA 1K1IA 4Z0KA 3VEQB 1ZPCA 1GJDB 5C20A 1J14A 1WAYB 5J4QA 4D8NA 2NU2E 1IQEA 1QBNA 1QRXA 3SNBA 1AVXA 1MTNB 2GCHF 3STIA 1C5TA 1YPGH 4YLQH 4CRFA 3CS0A 2B0FA 3TJNA 4NZQA 5FCKA 1GCDA 3RXKA 5CHAC 3BEFB 3Q76A 4INHA 1SGDE 4FUBA 6GCHF 1CA0C 1L4DA 1K1NA 1D4PB 3SU4A 2PKAA 1Z1IA 1TGBA 1SGQE 3MWIU 2BXUH 2JH5D 3U9AH 2Y5HA 3PO1C 2A31A 2GCTC 2FOMB 1ZGIA 1LQEA 1CA0B 3BIUH 4ISNA 2FTMA 2GV7A 1O39A 2BDAA 1T4UH 1P03A 1UTLM 3RP2A 3SGQE 3PO1B 1Z8RA 1AI8H 4H4FA 2ZG0H 1GBMA 3EDXB 3TITA 1DICA 2XBXA 1GHBF 4OGXA 8GCHG 2CXVA 3UFAA 3BTHE 4LOYH 2GZ8A 1Z7KA 2XBVA 2GD4B 1D6WA 1ORFA 2W5EA 3LPRA 3RM2H 1TLDA 1LHCH 3LGTA 3ZYDA 1QRZA 1DFPA 3A88A 3RXLA 3E1XB 2W7SA 3OU0A 4H6TA 4X6OA 4BTUB 1LTOA 4HZHA 4E7NA 5T6GA 3NCLA 3RMOH 3R0FA 1BMLA 1JMOH 4FVDA 2M5TA 2A5IA 1C2KA 3TJVA 1VITH 1HPGA 2H9HA 1ZLRA 1C9PA 2SGQE 3GY2A 1SLWB 1SHHB 2ASUB 1NRPH 4WF8A 4GPGA 3SQEE 2V0BA 5A0AE 1YM0A 1GHYH 3O8RA 1LKAA 1A7SA 1TOMH 2FS9A 1ELTA 1TQ7B 1MAXA 3ELAH 1ANBA 1TRNA 1MUEB 3GY4A 4MNVA 2Z3DA 3O8BA 4KP0A 1ETTH 4HFPB 1HB0B 3RU4T 1NRQH 3RU4E 2WYJA 3SV6A 2ANMH 1SGTA 5GPIB 4ZKRU 3MU4A 3QUMP 1AD8H 1SHYA 2ZNKH 1UO6A 2THFB 2F9UA 1UVTH 1TBRH 1GDUA 5EG4A 4YOJA 3SUGA 2ZFPH 2ALVA 1A1RA 1S0QA 3TGJE 3GDUA 2P93A 1EXFA 1AQ7A 3BTME 1P2JA 2HALA 4WMFA 1ELDE 1EAXA 1OS8A 5T3HA 1O2ZA 1LCYA 1T31A 5I46H 1ACBE 1C5LH 1P9SA 2WPHS 3QO6A 4MNXA 1WQVH 1YP9A 3T62A 1G36A 4B76A 2ZDLA 1DITH 1AZ8A 2XCFA 1H8DH 4J2YB 2FI3E 4KELA 3RXVA 5JBCS 2BQ6B 2EI6A 4FUFA 3A7VA 1T4VH 1O2OA 2GZ7A 1TPOA 1KLJH 1CBWC 2HNTC 2ZFTA 1GHWH 3M5LA 1TALA 1ELEE 3MFJA 4A7IB 3BTFE 1PQ7A 2G5NA 2VVUA 5E0HA 3A84A 3UTUH 2I6QA 5LPEA 1FMGA 3T28A 1A0HB 4SGAE 1FDPA 4AGJA 4FVBA 4MG3A 3A7TA 2QN5T 5L2YH 2ZGHA 1UMAH 1XUJA 1CBWB 1HBTH 1AWFH 3QTOH 3SZNA 3LIWA 4ISOA 1YCPM 3E90B 2BVXH 5IYTA 3MH4A 3ZZCA 1HJAC 2C3SA 2DE8A 3SU3A 1WSSH 1GJ7B 1BMNH 3ZZ3A 2FZZA 1DS2E 1G9IE 1ARBA 3D49H 1O2VA 5DP3A 1C1SA 4AN7A 1C4V2 1AN1E 1T32A 1HJAB 2ZGCA 1WV7H 4ZKNU 6CHAC 1O2IA 4ABDA 2ZDVH 1QL8A 3SV7A 1ANEA 2QCYA 1TAWA 1Y8TA 2D8WA 1P2OA 2ZGBH 1YCPK 3RXEA 4O3UA 1A61H 4X2YA 2CV3A 5SGAE 4Y0ZE 6CHAB 2A5KA 1BCUH 3AAUA 3VXEH 1NU7B 4Y11E 1K28D 4B2AA 2OC8A 1BJUA 3SJ8A 7KMEH 4F4OC 1SB1H 3E3TA 1UVOA 2P3TB 1AU8A 1MCTA 3UQOA 2QC2A 4ISHH 3BV9B 1GJ4H 1A46H 3QGJA 1VZQH 2HNTE 4ZHAA 5LPRA 3L33A 3MNSA 1P3CA 3SJIA 1BTWA 2BDGA 5L30H 1PQ5A 2GVFA 3PWCA 1O5BB 5C5OA 5CMXH 1P2IA 3M7TA
chains in the Genus database with same CATH superfamily
1AMHA 1KTSB 2BY5X 3RXHA 2A45B 2BX3A 5AF9H 4FXGH 3ZZ7A 1O3EA 4UONA 2V6NA 1DOJA 5JBTA 1C1WH 4X0WU 1DY9A 2XXLA 3A83A 1ZPBA 1CO7E 3SNCA 1THRH 3BTGE 3BG4C 4X2XA 1KMHB 4IN2A 2GP9B 1RTLA 4CH2B 1S6HA 2ZFQH 3U1JB 4JZFH 3DSGA 3ATIA 4UFDH 1MCVA 3BN9A 1NFUA 2L74A 2Z9IA 4WWYA 3PV4A 3IWMA 4YLUA 4K5ZA 2AGEX 1SOZA 1O2TA 3SV9A 1DT2A 2FOGA 3BG4B 4Q7ZA 2UWOA 3H7TA 3ZZAA 4GVUA 1O5DH 1FUJA 2A4QA 1NT1A 1GMCF 1ZSKA 2NWNA 2ZC9H 1W7XH 3LDXH 2I6SA 2Y5GA 1QTFA 3KEEA 1P06A 1DWDH 3PMBB 4BNRA 5JDUB 1GI8B 1ESBA 3WWBA 5HIZA 1C1RA 5A8XA 1GPZA 4NSVA 1SLXB 1GVZA 3GY7A 2PKSC 3FP6E 3GCTG 1NN6A 5EXLA 4D9RA 5EIYA 2VINA 3M3VA 4TSFD 3V12A 1V2PT 5IDKA 3KCGH 2A5AA 3CS7A 3M36A 3RXTA 1HAGE 1Q31A 1IQFA 2V7QD 1XUFA 4HI3A 5EJLA 4ZAEA 1G32B 5FAHA 1D3QB 1EZQA 2PKSB 3SGAE 3SN8A 3RU4D 6LPRA 1ESTA 1GBFA 1C2LA 1PPBH 3HPTB 1ETSH 2D1JA 5DP5A 1SGRE 1G2LA 1QB1A 2VIWA 4DCDA 2O9QA 1AIXH 3DCLA 1DANH 1ELBA 2FXRA 2ZHFH 3MNXA 1TNGA 3KQDA 4JZDH 3SGBE 3KYGA 3UOUA 1NTPA 3UB0A 2OQ5A 3GCNA 3T29A 1MAYA 2IPHA 3RM0H 3W95A 1C1PA 1JWTA 1C1QA 4RSPA 5GCHG 2PSXA 3MNCA 4I86A 1EAIA 3RC5A 3EGKH 1WCZA 1O3HA 2Z9LA 1C1MA 2ZU2A 3P17H 4GAWA 2XTTB 3SQHE 1GBEA 3M5NA 2GMTC 4GHTA 4X2WA 1HAZB 2J98A 4U30A 1C4U2 3ZZ9A 2BOHB 3AW1A 2FOAA 1RTFB 1TWXB 4ESTE 1TGTA 1E79D 4AG1A 2SNWA 1E0FD 2KM0A 2O8LA 3AK5A 1BA8B 2XC4A 1H9LB 1HGTH 4AFUA 2GMTB 1LPZB 3FVFB 4X8VH 5FCRA 4O9VA 4ABJA 1WUNH 4I8LA 1BTUA 1ZHRA 1BRAA 1ETRH 1UTOA 5DP8A 3S7KB 1FIWA 3T26A 3N7DA 4E06H 4Z6AH 3PYHA 3PRDA 1P9UA 4I7YH 4BAMB 1TE0A 1OP2A 4YO9A 1LHGH 4ZKOU 4KGAA 2CN0H 4DGJA 1FONA 4XBDA 4A6LA 1LKBA 1S82A 3U8RH 2ZPRA 2G4TA 1BTHH 2Q6FA 3A86A 3FAOA 4I33A 1QURH 4BOHA 1IQLA 4X1RU 1MMJN 1BTPA 4INKA 1B0EA 1JRSA 1P02A 4Y76A 5E2PA 2WV5A 2BHGA 3W94A 4RT1A 1ZTKA 2FOCA 2P3FH 3MTYA 1ZMNA 4Q80A 3PTBA 1A3EH 3Q3XA 2OC1A 3ITIA 3MO3A 1N1LA 4FETA 3RXCA 2W6ID 2BDCA 1W13U 1TX6A 3A82A 3K65B 2ZDKA 2WINI 2ZFSA 3VB6A 2ZFFH 2KCYA 2ZTZA 3AASA 3S0NA 1WTHD 1DWCH 5C0UA 3TVJB 1QQUA 3LH1A 5DO4H 1CU1A 1O2GH 3EA8A 4CR9A 1GI3A 4X6PA 1H9HE 1KLIH 4K1TA 4Q2KA 4XBBA 5GJ4B 2GX4A 1TONA 3OX7U 1SPJA 3SU1A 5EXMA 1PYTC 5K7RA 2ODYB 1BHXB 3L6PA 2WHXA 4DT7B 3KGPA 5F6MA 4NA9H 1S83A 1PPEE 1YF4A 1GGDC 1Y5AT 2AHME 4THNH 5CHBA 4ABIA 5F8ZA 1TNHA 2J5UA 4YESB 2QE7D 1OP8A 1Y3VA 4FUHA 1O2PA 2FESH 4IW4E 4Y10E 4DOQA 1D6RA 1WQSA 7GCHG 2SGPE 1W0YH 3ZZ5A 4K1SA 3BG8A 1O5CB 4Y7AA 2EI8A 3H7OA 4WJG2 1GGDB 1FJSA 2FO9A 3C27B 2ZDAH 1ZHMA 1TMBH 3ODFA 1C5RA 2BTCE 4JCNA 1MQ6A 1TPSA 1ZRKA 3QK1A 4DT4A 1MH0A 1U6QA 2A4RA 2FIRH 1CT2E 4IMQA 2WUCA 3RXAA 4DIHH 5DG6A 2ZHDA 3NUMA 4CRDA 2BZAA 4AYYB 1TX8A 4RT0A 4Q7XA 3OTJE 1HXEH 2RA0A 2NU4E 4X1PU 4JZ1A 3BTQE 3M37A 4AX9H 4JZEH 2RA3A 3CENA 3UPEA 1F7ZA 1AUJA 4I8HA 2A4GA 5TJXA 2FLRH 1GI6A 3LGVA 3PMAB 5FPYA 3O8CA 4CBOA 5JBAS 1WOFA 1XUIA 2VIQA 1IAUA 1EAUA 2OK5A 1GHAG 4KKDA 1CT4E 3GY8A 2OXSA 1C5UA 1N6YA 1HIAB 1VITG 2BY9X 1KYNA 2O8TA 3JZ1B 2QAAA 1IQGA 3AW0A 1L4ZA 3SUFA 3ZVCA 3RXMA 1SFQB 8GCHF 1GJ6A 1GG6C 2SGDE 2C8ZB 3SJ9A 3U98H 1EB1H 1T8MA 2RDLA 1G30B 4U2WA 4UDWH 3SHAH 3A8BA 1O38A 1YKTA 4UD9H 3VPKA 1TYNA 1QBOA 3P8FA 8LPRA 3MH5A 2VH6A 2ANWA 1GI0A 1AVGH 4P00A 1GG6B 1GJ5H 1P2NA 4ABHA 2XC0A 2CF9H 3BF6H 5DSFA 3BTWE 2BQWB 4A92A 1B5GH 2XNDD 1SSXA 1SQTA 2RG3A 1FN6A 3OE7D 5T6DA 3TH3H 5JBBS 3ODDA 4Z1MD 1W3CA 4WH6A 4AORA 1LVMA 1FY3A 4ASUD 2BDIA 2IJOB 1PQ8A 3HK3B 2C93B 2AMDA 2TGTA 4ZKSU 1XUHA 1W12U 4Q63A 3A89A 1EP5A 1O2NA 4JK6A 2JH0D 2PUXB 1P04A 3GY6A 3Q77A 1O5EH 4BANB 1V2QT 3A80A 1FV9A 3P95A 2ODQA 5L6NH 2TBSA 3ZIAD 1BRUP 5DN6D 4AYVB 2FX6A 4WMEA 5EPNA 1IOEA 2QV1A 3RXRA 2HPPH 4B71A 3DHKH 1E36B 1DSUA 3I78A 3NK8A 1FPHH 2ZEBA 1OPHB 3K9XB 3U8OH 1C2FA 1BZXE 4UFFH 1C5XB 1F0UA 1O2XA 1FAKH 1XMNB 3F6UH 2ZU5A 1TNIA 2HLDD 5T1VA 3PLBA 1HDTH 2AGIX 2ULLA 5EU8A 2BD8A 3A7YA 2A0QB 3HKIB 3F3BA 1IQKA 1HJ9A 1ZMLA 2BY8X 3SHCH 1UVSH 2FP7B 4B74A 1GCTC 3LH3A 1DDJA 1MTUA 4K69A 2V3HH 1QGFA 4ISLA 4ABEA 3DA9B 5BRRE 1EKBB 2Z94A 2SGFE 1K22H 2PFEA 3LGIA 1S81A 1C5SA 9LPRA 2OQUA 1PPZA 4MPXA 1QB9A 3LKWA 1P10A 1AVWA 1GCTB 4TY6A 2VU8E 1CT0E 1V6DA 2XYAA 1DM4B 5A8YA 4IC6A 2ANYA 3P8GA 4OS7A 3TGIE 1BQYA 2D26C 1O3IA 2GDDA 2TGPZ 2ZF0H 1V2WT 4GLYA 3SV8A 1L1GA 1AFEH 4NZLA 2BY7X 3PRBA 1YC0A 1A2CH 4NIWA 3BEIB 1LPGB 1XKBC 3M7QA 3PLKA 4Y8YA 2G4UA 3MU1A 5G4BA 3NZIA 1PQAA 4D7FA 1N6XA 3NKKA 1BMFD 2A4OA 3F2HA 3EE0B 4INLA 3VB7A 1VCPA 2BDBA 3MYWA 1NPMA 1O3BA 3RLWH 1P57B 2J92A 2FLBH 8KME2 1C1VH 2NU1E 2ZGXH 3KQEA 1O2WA 1QFKH 3ZZ8A 1RFNA 3D62A 2GTBA 1SR5C 1HAPH 1V2ST 1P2KA 3TH2H 4OS5A 5LGOA 3TU7H 1UW7A 1BMMH 1D9IA 4KTSA 1GL0E 5FPTA 1BTYA 2J4IA 1GWAA 1EASA 3FANA 3HK6B 3KN2A 2OINA 1BDAA 1Y5BT 4B2CA 4CHAC 1QB6A 2Z7FE 5K0HA 2OLGA 1YPLH 3BTTE 2R3YA 3RXGA 1K9OE 1SGYE 4K1EA 4K2YA 1SQRA 1Y59T 3Q3KA 1ELFA 3VB5A 3SU6A 5CE1A 1C2HA 1C4Y2 1GI1A 2LNCA 3KIDU 2D2DA 1HV7A 4CHAB 6GCHG 1GMDG 1SOTA 1Z6JH 1SBWA 1XVOA 1O3KA 1ABIH 2ZFRH 1O3MA 1V2JT 1Y3YA 3A8AA 4NFFA 2FTLE 5ABWA 1C5YB 1VJAU 1B0FA 1JOUB 1ZZZA 2QYIA 2BXTH 1D3DB 3M61U 4XDEA 4J1YA 5HGGA 1QL9A 3MMGA 2QGRA 3UY9A 4DIIH 5ETXA 2R2MB 2EI7A 4ABAA 1O5FH 5E0JA 1RD3B 1TGCA 3TIUA 3DT0H 3TK5A 3PV2A 3SV2H 1A5IA 1X7AC 2ALPA 5F8TA 2TGAA 1PYTD 3RXFA 1YCPH 1P05A 1INCA 2QA9E 2RFKC 3P92A 1CA8B 3DUXH 1V2OT 2Y82A 3TGKE 1F5RA 1Z1JA 4X1NU 4YXWD 1NFXA 1RRKA 4R0IA 2YNBA 1O30A 3MH6A 3MHWU 1GBCA 3A7XA 3PB1E 1EFRD 1DE7H 2C8WB 1O0DH 2Q1JA 1MTVA 1Y3WA 2BLWA 2BD7A 1GMHG 7LPRA 1LQDB 4IGDA 2GV6A 5H4IB 1BITA 4Y0YE 5A09A 4MPUA 1EP6A 2QF4A 4HG6A 1XUKA 2G00A 2FPZA 2PTCE 3AAVA 2GDEH 5DP6A 1GJ8B 2PUQH 1S5SA 3EAJA 2ANKH 4O3TA 3GCTF 3T5FH 2WPIS 4ZHLU 5GIBA 3RC4A 1Z8JB 2HRVA 3MNBA 2BLVA 1O31A 3AVZA 2CGAA 2FEQH 3A7WA 3TK6A 1AUTC 4B6FA 2BD3A 2K0QA 1HAXB 2FWWA 5E2OA 5TCCA 1O37A 1V2UT 2FI4E 1VCWA 4NWLA 1C2IA 1KXBA 3OY6U 2AMQA 1QNJA 1K0HA 4SGBE 1MD7A 1TGSZ 2AS9A 2AERH 4MNYA 1MBQA 4BTIB 1MABB 2VB0A 1F2SE 4RI0A 3O8DA 1AFQB 1H8HD 1CVWH 3IITA 3LOXA 5E0GA 4OS2A 4OS4A 1TIOA 2Y80A 3T27A 3F2FA 2EEKA 8ESTE 5DJ7A 2W3KA 1CGHA 1FZZA 4DJZB 1NS3A 4ZROA 2P8OC 1GHXH 1GVKB 2EC9H 5GCHF 3SOSA 1WXRA 4TPYA 2C4FH 1MD8A 2JETC 1GBJA 1LDTT 2ZP0H 3F68H 3KNXA 5I25A 2BD9A 1JIMA 3MO9A 1FQ3A 1NU9A 1DLKB 1QY6A 4YT7H 3L3TA 2J34A 1C2EA 1ELGA 3A8CA 3E0PB 3ZZ4A 1GBIA 2P8OB 2ZHQH 1TBZH 1W10U 4JYTA 5AHGH 1CHGA 4MQAA 1G3BA 2XC5A 2JETB 5GXPA 2G5VA 3OEED 2R0KA 1VJ9U 1NFYA 1L0ZA 2O8UA 3B8JA 4JMYA 1AWHB 2J38A 2B5TB 2ZU4A 5TCAA 2KZ4A 1T8LA 1A5GH 4NSYA 2KAIB 5J4SA 1DLEA 2KR7A 2WPMS 1LVOA 1GBBA 2PSYA 3F9HA 3ZZ6A 1HRTH 1LVBA 2NU0E 2QF3A 4PROA 3FZZA 2JH6D 3RXQA 2GJGA 2F9NA 4XSKU 1NBME 3F0PA 3T2NA 2GZ9A 2CJIA 2SGAA 1ZPZA 1W0ZU 5FX6A 2XCNA 1OP0A 3MOCA 3RLYH 3SBKA 1SGPE 2F3CE 4OS1A 1S6FA 4FU7A 2H9TH 1SI5H 1V2TT 4XRNA 1UCYK 1KIGH 3S7HB 2BDHA 2NU3E 3BEUA 5IK2D 1ELCA 4ASHA 4BTTB 2J94A 5EQRA 2HVXA 2Q6GA 1F0TA 1C1OA 1SGCA 3M5MA 4A1XA 1OSSA 1J9CH 2ZZUH 2WZQA 3QN7A 2BB4A 1RTKA 1MKWK 1EQ9A 2FS8A 3ZZBA 3H5CB 1TMTH 3F9GA 2BD4A 1JIRA 1O2HA 4AFZA 1GBDA 2BZ6H 1TA2A 1H9IE 5HM9A 4LK4A 1K2I1 4JYUH 1MBMA 1YPMH 4LZ1H 3K6YA 1DXPA 3DFJA 3KL6A 4IS5A 1YYY1 1H8IH 1OHHD 4UE7H 4RKOB 1NFWA 4CREA 3Q3YA 1LHEH 4ACAA 3MH7A 1KXFA 1TNLA 2A1DB 4K8YA 7GCHF 1E34B 2OBOA 5FXLA 2FDAA 4CH8B 2QXJA 5FBIA 2OBQA 5JB9S 1YLDA 4BAQB 1ZTJA 1G3EA 4FUDA 2J2UA 3N7OA 3BTDE 3P8OA 4BXWA 3A87A 1DWBH 5AFZH 2FM2A 2LPRA 4WH8A 1EAWA 2J95A 5HXFA 3FP8E 1ZSLA 2ZWLH 3LT3A 1KXCA 3K6ZA 1SG8B 3U1IB 2SGEE 4NIXA 4E7RG 2ODPA 3QX5H 1IHTH 3UOPA 1THPB 2AYWA 1HFDA 2A7CA 4GCHG 2XBWA 5KEDA 2TGDA 3LJJA 3UR9A 2P94A 1A5HA 1YLNA 1P11E 2KCOA 2TPIZ 3RC6A 1SGNE 1OX1A 1GJCB 1GHAF 2BQ7B 1F0RA 2H6MA 1HAYB 3S9AA 3TNTA 4JZIA 2HLCA 3S9CA 2ZHEH 1VITF 1XUGA 1NO9H 2C8YB 2PR3A 2VWLA 1MU6B 1JXPA 1UTQA 5A2MH 1QL7A 5F53A 4IMZA 1EZSC 4MLFB 4Y6DA 2ZGJA 1O2JA 4H42U 3DSOA 4BXSA 1TA6A 3RMNH 2EQNA 2FMJA 3EYDA 1QJ6B 3G01A 2WPLS 3PMHB 3MU0A 1H4WA 2UUFB 4AFSA 5JB8S 1A3BH 2KAIA 3U8TH 1IQMA 4F48B 2OC7A 4BAOB 1EX3A 1J17T 2QXHA 3TJUA 5C1UA 3PROA 1D3PB 3EQ0H 1CGJE 1MZAA 1P12E 1SGFG 3RXSA 2HNTF 4MPWA 1BJVA 2FI5E 4ZCNA 1H1BA 3GISB 5AFYH 3SORA 4D76A 1L1NA 1SGEE 1SLVB 2BLOA 3URCA 2R2WU 2V3OH 2PHBA 1W0KD 4TWYA 2VVVA 1GHZA 3UWIA 2VIPA 2HPQH 3GICB 2ZCLP 3MI4A 2WUBA 5EXNA 2ESTE 3P70B 1FXYA 1GHVH 3CP7A 2FODA 4BAKB 2B9LA 1O3AA 3V13A 1C1UH 5EGMA 4Y8XA 3ZVBA 3VB4A 1O3FA 1ZYOA 5EODA 2G8TA 1GI4A 3FKSD 3LU9B 1BBRK 1ABJH 1D3TB 4F49A 1C5QA 1C2JA 1MTWA 1A0JA 2QXIA 1OWDA 2WPDD 2O8WA 1V2RT 1KLTA 3DFLA 3S9BA 2QIQA 1VGCC 1WYKA 1C2GA 1O2MA 2A2XH 2OP9A 1C1TA 2F91A 2G52A 2HWLB 1TBQH 4AZ2B 3SW2B 3A7ZA 1ID5H 2ZTYA 4M9FA 5DPAA 2W7UA 1O2SA 5JYIA 1O2QA 3BTKE 1VGCB 1NRNH 2SFAA 1P3EA 1QCPA 4HTCH 2UUJB 3SZEA 1QJ1B 2B7DH 2R3UA 4B1TA 3FOAA 3LGYA 1BMAA 1GL1A 2AEIH 1CGIE 3M35A 2QXGA 3ZVDA 1G3DA 1PPHE 1W8BH 1GI9B 2VH0A 1O3DA 3GY5A 1K1MA 1DWEH 3OEHD 3QZQA 2QF0A 2V35A 1B7XB 5B6LA 4CBNA 1UTKA 2GKVE 1UK3A 2FOHA 4U32A 1QBVH 2LELA 5LH8A 1QJ7B 2BMGB 1PPCE 3LC5A 4DURA 4OS6A 5EW1H 1P2MA 3RUOA 5C1XA 1K1OA 3SYJA 5EPYA 3ZZDA 1ANDA 1VCQA 2V3MA 2VGCC 1ZJKA 2FOFA 2G55A 1GI5A 3UWJH 1O2LA 2Z6BD 1EJMA 1HAVB 1YGCH 1J15A 1W0JD 1NC6A 3M3SA 2Z9JA 4ZMAH 3P6ZB 2H2ZA 2ZPSA 4B2BA 2VIVA 5EOKA 4NIVA 3E8LA 1WU1A 2VGCB 5FPSA 2Z9GA 3D23A 2XRCA 4VGCC 1LMWB 1F5LA 4X8SH 1KXAA 4U01A 1PPGE 5F8XA 3UR6A 1DXWA 1XM1A 3RXUA 2JIZD 1N8OC 1O3GA 3QLPH 4K8BA 1T8NA 3ZV9A 5C94A 4VGCB 1GMDF 3GYMA 3NWUA 3R3GB 4K60A 4OGYA 1C1NA 1MKXK 1O2KA 3QWCH 1V2KT 2QF5A 1CE5A 1DX5M 3A85A 4I32A 5ESBA 1C2MA 1XX9A 5CHAB 1N8OB 3SNDA 1W11U 4UFEH 1BB0B 3KQBA 4YT6H 1V3XA 4XBCA 1UTNA 2BVRH 4XD7D 1BRBE 6ESTA 3TPIZ 3FFGA 1XXFA 4YM9A 1LHDH 1RGQA 2CMYA 1O36A 1ZMJA 3UNSA 2GCTB 5A8ZA 3SJKA 2STBE 3TH4H 1OOKB 4CRCA 4KTUA 1YPJH 2L6OA 3ATMA 3UNRA 2A2QH 3F0OA 3RXDA 1UTMA 3GYLB 2IOTA 2AIPA 2Y6TA 2ZU3A 3SI3H 2AH4X 3C1KA 1OWJA 1GDQA 1AY6H 3KQ5A 2RDEA 1LPKB 3ZV8A 1LHFH 1GMHF 4RN6A 4AB9A 1OWEA 1RIWC 1TRYA 1CHOG 1HCGA 2CK3D 1YPHC 1HIAA 3RXIA 2H1UA 5EQSA 3OYPA 1UVUH 2FOEA 2KX4A 3W1EA 2HGTH 1O3NA 4MVNA 4TWWA 1NM6A 1O5AB 3HGNA 1AZZA 2VVCA 1TABE 3I29A 3SNEA 4FUJA 4DG4A 1MTSA 1Y3UA 1C5PA 3URDA 5A0BA 3GDVA 1RIWB 3RMMH 1O35A 4FU9A 3HGPA 1Y3XA 4Y7BA 1FX0B 1HLTH 3HKJB 5T6FA 2QY0B 2GCHG 2PTNA 1UK4A 1RXPA 5DK1A 3MQKC 3PMJA 1QZ8A 5F03A 1ZGVA 4JYVH 1Z8IB 2ZTXA 1ZOMA 1IQNA 2VWNA 1W14U 4NFEA 1V2VT 2VIDA 4Y8ZA 4ZH8A 2UWLA 2AFQB 2P16A 3QTVH 2KCPA 4I8GA 4ISIH 1BTXA 2W26A 1AHTH 4NG9H 1SGIB 1Z6EA 2K1QA 3ZVFA 2CF8H 4NA7A 3VXFH 3KYFA 1AGJA 2Y81A 4LZ4B 1G2MA 3ATWA 2F43B 2XBYA 3NPSA 4UEHH 3BIVH 3A81A 4I8JA 1F92A 1OWKA 1ZR0A 5GNDA 1S0RA 5HKKD 5EJZA 4NCYA 1HAVA 1BHXF 3EA9A 1SVPA 2JDID 3QDZB 1O3OA 1WTGH 2ZU1A 1GHBG 2W6JD 2WYGA 2ZA5A 4MPVA 1PPFE 1K1LA 1GBTA 2BDYA 2UUYA 1YPHE 3VB3A 2A7JA 3PLPA 1KY9A 5DP4A 2SNVA 4ABFA 2BLQA 3KHVA 1EJAA 1OYQA 2XOKD 2OUAA 2Z3CA 4IBLH 5HM2A 3RXPA 1ELVA 1O33A 2Q6DA 1IHSH 1C5NH 4X6MA 4WVPE 4FUIA 3DD2H 2VJ1A 1FY4A 1ZRBA 1OKXA 1OXGA 4AOQA 4Q7YA 3SNAA 3LJOA 4XFQA 1A0LA 2H9EH 3OAAD 3QGNB 3B9FH 4NA8A 1YPKH 1TPPA 1YLCA 5FBEA 3F9EA 4TY7A 1KTTB 3SI4H 3BSQA 1QIXB 2F83A 1C2DA 1TNKA 2J97A 1EB2A 2A7HA 1AFQC 3OTPA 1AE5A 3E91A 4LXBH 2YOLA 3SUEA 3NRLA 4FU8A 1SGFA 1O3PB 2C90B 5HMAA 1GBKA 3TJOA 1V2MT 9ESTA 2PWXA 4DVAU 2P59A 3STJA 4DW2U 1GJAB 1QR3E 3M3TA 2OCVB 3V7TA 3V0XA 3N7EA 4TYDA 4WXIA 2IN2A 3WW7A 1DUEA 1GVLA 2UUKB 2F9BH 3B23B 5JPMH 1O2UA 5DKMA 4CRBA 4AG2A 1HYLA 1L2EA 1XKAC 2OD3B 1O32A 2G81E 4ZHMU 1SQAA 4ZXYH 2AMPA 1GJ9B 1P2QA 1QQ4A 1UK2A 5DGJA 2GT7A 2FYQA 1HUTH 5HIYA 2ZQ1A 2UWPA 1S85A 2H5CA 2BD2A 1EZXC 4CRAA 5ESTE 1BRCE 5HYOA 4XOJA 3RXBA 3SO3A 1M9UA 3ATLA 1UCYH 1GJBB 1WBGB 2OC0A 5FX5A 4H6SB 2RCEA 1W2KH 4B73A 1FY5A 3E16B 4P02A 1ZTLA 1PJPA 1HAIH 1IQHA 4M7GA 4NGAH 1TNJA 1KXDA 1MKWH 1O2YA 4F55A 2XNIA 1NZQH 1GBAA 1F0SA 5KECA 4GCHF 2H5DA 4Y79A 1C5MD 3GOVB 1Z8GA 3D65E 4K3JA 1H8ED 3FP7E 1HNEE 4O03A 3UIRA 1P0SH 2BD5A 3TK9A 2HOBA 1BIOA 4D9QA 2TRMA 1DY8A 1E37B 3RDZA 7ESTE 1KDQB 1HJ8A 1TPAE 1UJ1A 3TNSA 2F9VA 1TQ0B 1NRSH 2XWAA 1AKSB 4A5TS 2EY4C 2WPKS 2BYAX 2YNAA 4X8TH 1C5OH 4FUEA 1P01A 1BOQA 4RKJB 5E8EH 1FY1A 1MZDA 2P95A 3SU5A 1O3JA 4AFQA 1SFIA 2FOBA 4E05H 2ZDMA 4X8UH 1DSTA 4MTBA 1NESE 1OYTH 3WWFA 1OWHA 5B6OA 2STAE 5DP7A 1TRMA 1YY3A 1SC8U 1HAHH 1SMFE 2FX4A 5L2ZH 2OTVA 1J8AA 3A8DA 3ESTA 2Y5FA 4CRGA 3U69H 2PP6A 2JJ1D 2VNTA 4X1SU 5C3NA 1F5KU 1O34A 1YPEH 1P09A 2M2AA 3MU5A 1C5ZB 3SU0A 4GUXA 3FO8D 4AC9A 1HAOH 3ZVGA 3GY3A 3P8NA 1TMUH 1V2NT 1LO6A 3HATH 1HXFH 1TFXA 4X2VA 4KTCA 1FLEE 3LC3A 2WPJS 4YTAA 4WMDA 4X1QU 1ZJDA 3F1SB 3FZDA 3GCHC 3E0NB 4TPIZ 3T25A 2ZECA 3GDSA 5FHTA 3RMLH 1UHBB 1EJNA 1T7CA 5KGOA 4AB8A 4I31A 1QA7A 1UTPA 3RXOA 2BX4A 1O2RA 4FUCA 1KSNA 1UCYE 2VWOA 3EA7A 3GCHB 1K1PA 1EZUC 1V2LT 1GMCG 3ZVEA 4MNWA 1ELAA 1EPTC 1K21H 2BOKA 2BY6X 3ATKA 1MQ5A 2XW9A 3ENSB 1AE8H 1E35B 2VWMA 4MDSA 3ZYEA 2A32A 2F9OA 1O3LA 4UFGH 2F9PA 4CR5A 1UVPA 4NWKA 1EPTB 4YZUA 2FYRA 3LGWA 3WY8A 2Z9KA 1DVAH 1J16A 3BTEE 1TB6H 4HGCA 1TGNA 4YOGA 1C5WB 1Z71A 2ZDNA 2O8MA 1FAXA 1W7GH 2J9NA 5EW2H 2PGBB 1EATA 2Z3EA 4DY7B 1TX7A 4ABGA 3K2UA 1FI8A 4GSOA 4BAHB 4ABBA 5A0CA 3JZ2B 4D7GA 1FPCH 3UUZA 3UNQA 4FUGA 3LONA 4QT8C 2VBCA 4NIYA 4X6NA 2ZIQH 3ZVAA 2W3IA 1FIZA 1E38B 1G3CA 1SL3A 5LPFA 2Y7ZA 2PKAB 3DSPA 1BBRH 4YOIA 1C9TA 2PGQB 1THSH 4ZUHA 2BM2A 2G51A 2WV4A 3NXPA 1QA0A 4Y71A 5GWZA 1NY22 3PTNA 3PWBA 2B8OH 3E6PH 1NROH 1QHRB 1TOCB 3Q00A 2ZHWH 2CHAC 1ZHPA 1BUIA 1NRRH 4R8TB 2PV9B 3SJOA 5DP9A 1VR1H 1L1JA 1KDQA 2ZKSA 1O3CA 1O5GH 3F9FA 1CSOE 1QRWA 3RXJA 2ZCKP 4WXVA 1AKSA 2P3UB 2YMSC 1IQIA 5C5NA 2AGGX 2CHAB 3GCOA 1PFXC 3M5OA 3OY5U 2VIOA 5EQQA 5C1YA 1JRTA 2XWBI 4FOUC 2DE9A 4JK5A 2GT8A 1FY8E 3TLOA 2YMSB 4B75A 2R9PA 4ACBA 1KXEA 2K8IA 1RJXB 1NBMD 4A1TA 1EUFA 4AGKA 1E1RD 2AIQA 3V3MA 1Q3XA 2C8XB 3UQVA 1LVYA 5PTPA 3KQCA 1K1JA 1ZSJA 2ZQ2A 3MO6A 1Q2WA 3M7UA 3S69A 3OSYA 1EOLA 2F4LA 1AO5A 1G37A 1XVMA 5AVDA 5C17A 1SLUB 3F2GA 1DUAA 2JJ2D 4XE4A 1T8OA 3SU2A 1GBHA 2HVYB 2GGVB 1ANCA 1SQOA 4ZXXH 1UHBA 1E1QD 1GDNA 4GHQA 1BT7A 4WY3A 2ZI2H 4IC5A 3SUDA 2DUCA 2EA3A 2ZO3H 1ESAA 1AB9C 1OWIA 3PV5A 3UREA 3QZRA 1FNIA 4IN1A 5BPEA 4TT3D 1S84A 3KF2A 3MU8A 1BTZA 3I77A 3VGCC 3VFEA 1MU8B 1CQQA 2ZPQA 1GI7B 2Y7XA 1YBWA 4O97A 2JKHA 1EOJA 1GI2A 4A1VA 1AB9B 2PW8H 1RS0A 1DPOA 2PLXA 2ILNA 2R0LA 3OFND 1IQJA 2BVSH 2ZCHP 5C67A 1CHOF 1XXDA 1JBUH 4I8KA 3VGCB 1Y5UT 3LGUA 1A4WH 1BBRE 3IG6B 5CDFE 2TIOA 3GS9A 1EPTA 5GDSH 1MKXH 1P8VC 1C5VA 1MTNC 5C2ZA 3PM3A 1GBLA 1UTJA 1FN8A 3FN8A 1ARCA 1K1IA 4Z0KA 3VEQB 1ZPCA 2KFWA 1GJDB 5C20A 1SKYE 1J14A 1WAYB 5J4QA 4D8NA 2NU2E 1IQEA 1QBNA 1QRXA 3SNBA 1AVXA 1MTNB 2GCHF 3STIA 1S6LA 1C5TA 1YPGH 4YLQH 4CRFA 3CS0A 2B0FA 3TJNA 4NZQA 5FCKA 1GCDA 3RXKA 5CHAC 3BEFB 3Q76A 3EE7A 4INHA 1SGDE 4FUBA 6GCHF 1CA0C 1L4DA 1K1NA 1D4PB 3SU4A 2PKAA 1Z1IA 1TGBA 1SGQE 3MWIU 2BXUH 2JH5D 3U9AH 4Q4LA 2Y5HA 3PO1C 2A31A 2GCTC 2FOMB 1ZGIA 1LQEA 1CA0B 3BIUH 4ISNA 2FTMA 5C0TA 2GV7A 1O39A 2BDAA 1T4UH 2WSSD 1P03A 1UTLM 3RP2A 3SGQE 3PO1B 1Z8RA 5EJ1A 1AI8H 4H4FA 2ZG0H 1GBMA 3EDXB 3TITA 1DICA 2XBXA 1GHBF 4OGXA 8GCHG 2CXVA 3UFAA 3BTHE 4LOYH 2GZ8A 1Z7KA 2XBVA 2GD4B 1D6WA 1ORFA 2W5EA 3LPRA 3RM2H 1TLDA 1LHCH 3LGTA 3ZYDA 1QRZA 1DFPA 3A88A 3RXLA 3E1XB 2W7SA 3OU0A 4H6TA 2LP6A 4X6OA 4BTUB 1LTOA 4HZHA 4E7NA 5T6GA 3NCLA 3RMOH 3R0FA 1BMLA 1JMOH 4FVDA 2M5TA 2A5IA 1C2KA 3TJVA 1VITH 1HPGA 2H9HA 1ZLRA 1YWUA 1C9PA 2SGQE 3GY2A 1SLWB 1SHHB 2ASUB 1NRPH 4WF8A 4GPGA 3SQEE 2V0BA 5A0AE 1YM0A 1GHYH 3O8RA 1LKAA 1WDIA 1A7SA 1TOMH 2FS9A 1ELTA 1TQ7B 1MAXA 3ELAH 1ANBA 1TRNA 1MUEB 3GY4A 4MNVA 2Z3DA 3O8BA 4KP0A 1ETTH 4HFPB 1HB0B 3RU4T 1NRQH 3RU4E 2WYJA 3SV6A 2ANMH 1SGTA 5GPIB 4ZKRU 3MU4A 3QUMP 1AD8H 1SHYA 2ZNKH 1UO6A 2THFB 3VG8A 2F9UA 1COWD 1UVTH 2IJD1 1TBRH 1GDUA 5EG4A 4YOJA 3SUGA 2ZFPH 2ALVA 1A1RA 1S0QA 3TGJE 3GDUA 2P93A 1EXFA 1AQ7A 3BTME 1P2JA 2HALA 4WMFA 4OM9A 1ELDE 1EAXA 1OS8A 5T3HA 1O2ZA 1LCYA 1T31A 5I46H 1ACBE 1C5LH 1P9SA 2WPHS 3QO6A 4MNXA 1WQVH 1YP9A 2KCAA 3T62A 1G36A 4B76A 2ZDLA 1DITH 1AZ8A 1VKYA 2XCFA 1H8DH 3CNRA 4J2YB 2FI3E 4KELA 3RXVA 5JBCS 2BQ6B 2EI6A 4FUFA 3A7VA 3U28C 1T4VH 1O2OA 2GZ7A 1TPOA 1KLJH 1CBWC 2HNTC 2ZFTA 1GHWH 3M5LA 1TALA 1ELEE 3MFJA 4A7IB 3BTFE 1PQ7A 2G5NA 2VVUA 5E0HA 3A84A 3UTUH 2I6QA 5LPEA 1FMGA 3T28A 1A0HB 4SGAE 1FDPA 2WV9A 4AGJA 4FVBA 4MG3A 3A7TA 2QN5T 5L2YH 2ZGHA 1UMAH 1XUJA 1CBWB 1HBTH 1AWFH 3QTOH 3SZNA 3LIWA 4ISOA 1YCPM 3E90B 2BVXH 5IYTA 3MH4A 3ZZCA 1HJAC 2C3SA 4B6EA 2DE8A 3SU3A 1WSSH 1GJ7B 3N99A 1BMNH 3ZZ3A 2YMSD 2FZZA 1DS2E 1G9IE 1ARBA 3D49H 1O2VA 5DP3A 1C1SA 4AN7A 1C4V2 1AN1E 1T32A 1HJAB 2ZGCA 1WV7H 4ZKNU 6CHAC 1O2IA 4ABDA 2ZDVH 1QL8A 3SV7A 1ANEA 2QCYA 1TAWA 1Y8TA 2D8WA 1P2OA 2ZGBH 1YCPK 3RXEA 4O3UA 1A61H 2J98B 4X2YA 5FL7D 2CV3A 5SGAE 4Y0ZE 6CHAB 2A5KA 1BCUH 3AAUA 3VXEH 1NU7B 4Y11E 1K28D 4B2AA 2OC8A 1BJUA 3SJ8A 7KMEH 4F4OC 1SB1H 3E3TA 3UAIC 1UVOA 2P3TB 1AU8A 1MCTA 2IPQX 3H09A 3UQOA 2QC2A 4ISHH 3BV9B 1GJ4H 1A46H 3QGJA 1VZQH 2HNTE 4ZHAA 5LPRA 3L33A 3MNSA 1P3CA 3SJIA 1BTWA 2BDGA 5L30H 1PQ5A 2GVFA 3PWCA 1O5BB 5C5OA 5CMXH 1P2IA 3M7TA
chains in the Genus database with same CATH topology
1AMHA 1KTSB 2BY5X 3RXHA 2A45B 2BX3A 5AF9H 4FXGH 3ZZ7A 1O3EA 4UONA 2V6NA 1DOJA 5JBTA 1C1WH 4X0WU 1DY9A 2XXLA 3A83A 1ZPBA 1CO7E 3SNCA 1THRH 3BTGE 3BG4C 4X2XA 4IN2A 2GP9B 1RTLA 4CH2B 1S6HA 2ZFQH 3U1JB 4JZFH 3ATIA 4UFDH 1MCVA 3BN9A 1NFUA 2Z9IA 4WWYA 3PV4A 3IWMA 4YLUA 4K5ZA 2AGEX 1SOZA 1O2TA 3SV9A 1DT2A 2FOGA 3BG4B 4Q7ZA 2UWOA 3H7TA 3ZZAA 4GVUA 1O5DH 1FUJA 2A4QA 1NT1A 1GMCF 1ZSKA 2NWNA 2ZC9H 1W7XH 3LDXH 2I6SA 2Y5GA 1QTFA 3KEEA 1P06A 1DWDH 3PMBB 4BNRA 5JDUB 1GI8B 1ESBA 1C1RA 5A8XA 1GPZA 4NSVA 1SLXB 1GVZA 3GY7A 2PKSC 3FP6E 3GCTG 1NN6A 5EXLA 4D9RA 2VINA 3M3VA 3V12A 5IDKA 1V2PT 3KCGH 2A5AA 3CS7A 3M36A 3RXTA 1HAGE 1Q31A 1IQFA 1XUFA 4HI3A 4ZAEA 1G32B 5FAHA 1D3QB 1EZQA 2PKSB 3SGAE 3SN8A 3RU4D 6LPRA 1ESTA 1GBFA 1C2LA 1PPBH 3HPTB 1ETSH 2D1JA 5DP5A 1SGRE 1G2LA 1QB1A 2VIWA 4DCDA 2O9QA 1AIXH 1DANH 1ELBA 2FXRA 2ZHFH 3MNXA 1TNGA 3KQDA 4JZDH 3SGBE 3UOUA 1NTPA 2OQ5A 3GCNA 3T29A 1MAYA 2IPHA 3RM0H 3W95A 1C1PA 1JWTA 1C1QA 4RSPA 5GCHG 2PSXA 3MNCA 1EAIA 3RC5A 3EGKH 1WCZA 1O3HA 2Z9LA 1C1MA 2ZU2A 3P17H 4GAWA 2XTTB 3SQHE 1GBEA 3M5NA 2GMTC 4GHTA 4X2WA 1HAZB 4U30A 1C4U2 3ZZ9A 2BOHB 3AW1A 2FOAA 1RTFB 1TWXB 4ESTE 1TGTA 4AG1A 2SNWA 1E0FD 2O8LA 1BA8B 2XC4A 1H9LB 1HGTH 4AFUA 2GMTB 1LPZB 3FVFB 4X8VH 5FCRA 4O9VA 4ABJA 1WUNH 4I8LA 1BTUA 1ZHRA 1BRAA 1ETRH 1UTOA 5DP8A 3S7KB 1FIWA 3T26A 4E06H 4Z6AH 3PYHA 1P9UA 4I7YH 4BAMB 1TE0A 1OP2A 4YO9A 1LHGH 4ZKOU 4KGAA 2CN0H 4DGJA 1FONA 4XBDA 4A6LA 1LKBA 1S82A 3U8RH 2ZPRA 2G4TA 1BTHH 2Q6FA 3A86A 3FAOA 4I33A 1QURH 4BOHA 1IQLA 4X1RU 1MMJN 1BTPA 4INKA 1B0EA 1JRSA 1P02A 4Y76A 5E2PA 2WV5A 2BHGA 3W94A 1ZTKA 2FOCA 2P3FH 3MTYA 1ZMNA 4Q80A 3PTBA 1A3EH 3Q3XA 2OC1A 3ITIA 3MO3A 1N1LA 3RXCA 2BDCA 1W13U 1TX6A 3A82A 3K65B 2ZDKA 2WINI 2ZFSA 3VB6A 2ZFFH 2ZTZA 3AASA 3S0NA 1WTHD 1DWCH 3TVJB 1QQUA 3LH1A 5DO4H 1CU1A 1O2GH 3EA8A 4CR9A 1GI3A 4X6PA 1H9HE 1KLIH 4K1TA 4Q2KA 4XBBA 5GJ4B 2GX4A 1TONA 3OX7U 1SPJA 3SU1A 5EXMA 1PYTC 5K7RA 2ODYB 1BHXB 3L6PA 4DT7B 5F6MA 3KGPA 4NA9H 1S83A 1PPEE 1YF4A 1GGDC 1Y5AT 4THNH 4ABIA 5F8ZA 1TNHA 4YESB 1OP8A 1Y3VA 4FUHA 1O2PA 2FESH 4IW4E 4Y10E 4DOQA 1D6RA 1WQSA 7GCHG 2SGPE 1W0YH 3ZZ5A 4K1SA 3BG8A 1O5CB 4Y7AA 2EI8A 3H7OA 4WJG2 1GGDB 1FJSA 2FO9A 3C27B 2ZDAH 1ZHMA 1TMBH 3ODFA 1C5RA 2BTCE 4JCNA 1MQ6A 1TPSA 1ZRKA 3QK1A 1MH0A 1U6QA 2A4RA 2FIRH 1CT2E 4IMQA 2WUCA 3RXAA 4DIHH 5DG6A 2ZHDA 3NUMA 4CRDA 2BZAA 4AYYB 1TX8A 4Q7XA 3OTJE 1HXEH 2RA0A 2NU4E 4X1PU 4JZ1A 3BTQE 3M37A 4AX9H 4JZEH 2RA3A 3CENA 3UPEA 1F7ZA 1AUJA 4I8HA 2A4GA 5TJXA 2FLRH 1GI6A 3LGVA 3PMAB 5FPYA 3O8CA 4CBOA 5JBAS 1WOFA 1XUIA 2VIQA 1IAUA 1EAUA 1GHAG 4KKDA 1CT4E 3GY8A 2OXSA 1C5UA 1N6YA 1HIAB 1VITG 2BY9X 1KYNA 2O8TA 3JZ1B 2QAAA 1IQGA 3AW0A 1L4ZA 3SUFA 3ZVCA 3RXMA 1SFQB 8GCHF 1GJ6A 1GG6C 2SGDE 2C8ZB 3SJ9A 3U98H 1EB1H 1T8MA 2RDLA 1G30B 4U2WA 4UDWH 3SHAH 3A8BA 1O38A 1YKTA 4UD9H 3VPKA 1TYNA 1QBOA 3P8FA 8LPRA 3MH5A 2VH6A 2ANWA 1GI0A 1AVGH 4ABHA 1GG6B 1GJ5H 1P2NA 2XC0A 2CF9H 3BF6H 3BTWE 2BQWB 4A92A 1B5GH 1SSXA 1SQTA 2RG3A 1FN6A 5T6DA 3TH3H 5JBBS 3ODDA 1W3CA 4WH6A 4AORA 1LVMA 1FY3A 2BDIA 2IJOB 1PQ8A 3HK3B 2C93B 2AMDA 2TGTA 4ZKSU 1XUHA 1W12U 3A89A 1EP5A 1O2NA 4JK6A 2JH0D 2PUXB 1P04A 3GY6A 3Q77A 1O5EH 4BANB 1V2QT 3A80A 1FV9A 3P95A 2ODQA 5L6NH 2TBSA 1BRUP 4AYVB 2FX6A 4WMEA 5EPNA 1IOEA 2QV1A 3RXRA 2HPPH 4B71A 3DHKH 1E36B 1DSUA 3I78A 3NK8A 1FPHH 2ZEBA 1OPHB 3K9XB 3U8OH 1C2FA 1BZXE 4UFFH 1C5XB 1F0UA 1O2XA 1FAKH 1XMNB 3F6UH 2ZU5A 1TNIA 3PLBA 1HDTH 2AGIX 2ULLA 5EU8A 2BD8A 3A7YA 2A0QB 3HKIB 1IQKA 1HJ9A 1ZMLA 2BY8X 3SHCH 1UVSH 2FP7B 4B74A 1GCTC 3LH3A 1DDJA 1MTUA 4K69A 2V3HH 1QGFA 4ISLA 4ABEA 3DA9B 5BRRE 1EKBB 2Z94A 2SGFE 1K22H 2PFEA 3LGIA 1S81A 1C5SA 9LPRA 2OQUA 1PPZA 4MPXA 1QB9A 3LKWA 1P10A 1AVWA 1GCTB 4TY6A 2VU8E 1CT0E 1V6DA 2XYAA 1DM4B 5A8YA 4IC6A 2ANYA 3P8GA 4OS7A 3TGIE 1BQYA 2D26C 1O3IA 2GDDA 2TGPZ 2ZF0H 1V2WT 4GLYA 3SV8A 1L1GA 1AFEH 4NZLA 2BY7X 1YC0A 1A2CH 4NIWA 3BEIB 1LPGB 1XKBC 3M7QA 3PLKA 4Y8YA 2G4UA 3MU1A 5G4BA 3NZIA 1PQAA 4D7FA 1N6XA 3NKKA 2A4OA 3EE0B 4INLA 3VB7A 1VCPA 2BDBA 3MYWA 1NPMA 1O3BA 3RLWH 1P57B 2J92A 2FLBH 8KME2 1C1VH 2NU1E 2ZGXH 3KQEA 1O2WA 1QFKH 3ZZ8A 1RFNA 3D62A 2GTBA 1SR5C 1HAPH 1V2ST 1P2KA 3TH2H 4OS5A 5LGOA 3TU7H 1BMMH 1D9IA 4KTSA 1GL0E 5FPTA 1BTYA 2J4IA 1GWAA 1EASA 3FANA 3HK6B 3KN2A 2OINA 1BDAA 1Y5BT 4B2CA 4CHAC 1QB6A 2Z7FE 5K0HA 2OLGA 1YPLH 3BTTE 2R3YA 3RXGA 1K9OE 1SGYE 4K1EA 4K2YA 1Y59T 3Q3KA 1ELFA 3VB5A 3SU6A 5CE1A 1C2HA 1C4Y2 1GI1A 2LNCA 3KIDU 2D2DA 1HV7A 4CHAB 6GCHG 1GMDG 1SOTA 1Z6JH 1SBWA 1XVOA 1O3KA 1ABIH 2ZFRH 1O3MA 1V2JT 1Y3YA 3A8AA 4NFFA 2FTLE 5ABWA 1C5YB 1VJAU 1B0FA 1JOUB 1ZZZA 2QYIA 2BXTH 1D3DB 3M61U 4XDEA 4J1YA 5HGGA 1QL9A 3MMGA 2QGRA 3UY9A 4DIIH 5ETXA 2R2MB 2EI7A 4ABAA 1O5FH 5E0JA 1RD3B 1TGCA 3TIUA 3DT0H 3TK5A 3SV2H 1A5IA 1X7AC 2ALPA 5F8TA 2TGAA 1PYTD 3RXFA 1YCPH 1P05A 1INCA 2QA9E 3P92A 1CA8B 3DUXH 1V2OT 2Y82A 3TGKE 1F5RA 1Z1JA 4X1NU 1NFXA 1RRKA 4R0IA 2YNBA 1O30A 3MH6A 3MHWU 1GBCA 3A7XA 3PB1E 1DE7H 2C8WB 1O0DH 2Q1JA 1MTVA 1Y3WA 2BLWA 2BD7A 1GMHG 7LPRA 1LQDB 4IGDA 2GV6A 5H4IB 1BITA 4Y0YE 5A09A 4MPUA 1EP6A 1XUKA 2G00A 2FPZA 2PTCE 3AAVA 2GDEH 5DP6A 1GJ8B 2PUQH 1S5SA 3EAJA 2ANKH 4O3TA 3GCTF 3T5FH 2WPIS 4ZHLU 5GIBA 3RC4A 1Z8JB 2HRVA 3MNBA 2BLVA 1O31A 3AVZA 2CGAA 2FEQH 3A7WA 3TK6A 1AUTC 2BD3A 1HAXB 2FWWA 5E2OA 5TCCA 1O37A 1V2UT 2FI4E 1VCWA 4NWLA 1C2IA 1KXBA 3OY6U 2AMQA 1QNJA 4SGBE 1MD7A 1TGSZ 2AS9A 2AERH 4MNYA 1MBQA 4BTIB 2VB0A 1F2SE 3O8DA 1AFQB 3IITA 1CVWH 3LOXA 5E0GA 4ABFA 4OS2A 4OS4A 1TIOA 2Y80A 3T27A 2EEKA 8ESTE 5DJ7A 2W3KA 1CGHA 1FZZA 4DJZB 1NS3A 4ZROA 2P8OC 1GHXH 1GVKB 2EC9H 5GCHF 3SOSA 4TPYA 2C4FH 1MD8A 2JETC 1GBJA 1LDTT 2ZP0H 3F68H 3KNXA 5I25A 2BD9A 1JIMA 3MO9A 1FQ3A 1NU9A 1DLKB 1QY6A 4YT7H 3L3TA 2J34A 1C2EA 1ELGA 3A8CA 3E0PB 3ZZ4A 1GBIA 2P8OB 2ZHQH 1TBZH 1W10U 4JYTA 5AHGH 1CHGA 4MQAA 1G3BA 2XC5A 2JETB 5GXPA 2G5VA 2R0KA 1VJ9U 1NFYA 1L0ZA 2O8UA 3B8JA 4JMYA 1AWHB 2J38A 2B5TB 2ZU4A 5TCAA 1T8LA 1A5GH 4NSYA 2KAIB 5J4SA 1DLEA 2WPMS 1LVOA 1GBBA 2PSYA 3F9HA 3ZZ6A 1HRTH 1LVBA 2NU0E 2QF3A 4PROA 3FZZA 2JH6D 3RXQA 2F9NA 4XSKU 3T2NA 2GZ9A 2CJIA 2SGAA 1ZPZA 1W0ZU 5FX6A 2XCNA 1OP0A 3MOCA 3RLYH 3SBKA 1SGPE 2F3CE 4OS1A 1S6FA 4FU7A 2H9TH 1SI5H 1V2TT 1UCYK 1KIGH 3S7HB 2BDHA 2NU3E 3BEUA 1ELCA 4ASHA 4BTTB 2J94A 5EQRA 2HVXA 2Q6GA 1F0TA 1C1OA 1SGCA 3M5MA 4A1XA 1OSSA 1J9CH 2ZZUH 3QN7A 2BB4A 1RTKA 1MKWK 1EQ9A 2FS8A 3ZZBA 3H5CB 1TMTH 3F9GA 2BD4A 1JIRA 1O2HA 4AFZA 1GBDA 2BZ6H 1TA2A 1H9IE 5HM9A 4LK4A 1K2I1 4JYUH 1MBMA 1YPMH 4LZ1H 3K6YA 1DXPA 3DFJA 3KL6A 4IS5A 1YYY1 1H8IH 4UE7H 4RKOB 1NFWA 4CREA 3Q3YA 1LHEH 3MH7A 1KXFA 1TNLA 2A1DB 4K8YA 7GCHF 1E34B 2OBOA 5FXLA 2FDAA 4CH8B 2QXJA 5FBIA 2OBQA 5JB9S 1YLDA 4BAQB 1ZTJA 1G3EA 4FUDA 2J2UA 3N7OA 3BTDE 3P8OA 4BXWA 3A87A 1DWBH 5AFZH 2FM2A 2LPRA 4WH8A 1EAWA 2J95A 5HXFA 3FP8E 1ZSLA 2ZWLH 3LT3A 1KXCA 3K6ZA 1SG8B 3U1IB 2SGEE 4NIXA 4E7RG 2ODPA 3QX5H 1IHTH 3UOPA 1THPB 2AYWA 1HFDA 2A7CA 4GCHG 2XBWA 2TGDA 3LJJA 3UR9A 2P94A 1A5HA 1P11E 2TPIZ 3RC6A 1SGNE 1OX1A 1GJCB 1GHAF 2BQ7B 1F0RA 2H6MA 1HAYB 3S9AA 3TNTA 4JZIA 2HLCA 3S9CA 2ZHEH 1VITF 1XUGA 1NO9H 2C8YB 2PR3A 2VWLA 1MU6B 1JXPA 1UTQA 5A2MH 1QL7A 4IMZA 1EZSC 4MLFB 4Y6DA 2ZGJA 1O2JA 4H42U 4BXSA 1TA6A 3RMNH 2FMJA 3EYDA 1QJ6B 3G01A 2WPLS 3PMHB 3MU0A 1H4WA 2UUFB 4AFSA 5JB8S 1A3BH 2KAIA 3U8TH 1IQMA 2OC7A 4BAOB 1EX3A 1J17T 2QXHA 3TJUA 5C1UA 3PROA 1D3PB 3EQ0H 1CGJE 1MZAA 1P12E 1SGFG 3RXSA 2HNTF 4MPWA 1BJVA 2FI5E 1H1BA 3GISB 5AFYH 3SORA 4D76A 1L1NA 1SGEE 1SLVB 2BLOA 3URCA 2R2WU 2V3OH 2PHBA 4TWYA 3UWIA 2VVVA 1GHZA 2VIPA 2HPQH 3GICB 2ZCLP 3MI4A 2WUBA 5EXNA 2ESTE 3P70B 1FXYA 1GHVH 3CP7A 2FODA 4BAKB 2B9LA 1O3AA 3V13A 1C1UH 5EGMA 4Y8XA 3ZVBA 3VB4A 1O3FA 1ZYOA 5EODA 2G8TA 1GI4A 3LU9B 1BBRK 1ABJH 1D3TB 4F49A 1C5QA 1C2JA 1MTWA 1A0JA 2QXIA 1OWDA 2O8WA 1V2RT 1KLTA 3DFLA 3S9BA 2QIQA 1VGCC 1WYKA 1C2GA 1O2MA 2A2XH 2OP9A 1C1TA 2F91A 2G52A 2HWLB 1TBQH 4AZ2B 3SW2B 3A7ZA 1ID5H 2ZTYA 5DPAA 2W7UA 1O2SA 5JYIA 1O2QA 3BTKE 1VGCB 1NRNH 2SFAA 1P3EA 1QCPA 4HTCH 2UUJB 1QJ1B 2B7DH 2R3UA