2G5VA

Indole-amidine complexes with bovine trypsin
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cationic trypsin
publication title Ligand Epitoping By Proton NMR Chemical Shift Differences
rcsb
molecule tags Hydrolase
total genus 59
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2006-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2g5vA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2g5vA02
2P16A 3EA8A 4FU7A 5HXFA 1K21H 3T28A 3P8OA 1LKBA 3ENSB 1NY22 5EQRA 1FQ3A 4CR5A 1J9CH 2UUKB 1CHGA 3I29A 4U2WA 1DWBH 4Q7YA 5TCAA 2EI7A 3RXPA 1ZTJA 1LPZB 1GBKA 4GAWA 1KXAA 2SGDE 1O32A 1O5GH 3S9BA 3BTTE 2ZZUH 2G81E 1DDJA 5FX6A 1A61H 3E0PB 1HPGA 1GI6A 1RD3B 2GCTC 1DUEA 2BD5A 5ABWA 1YKTA 3HPTB 2LPRA 1K1IA 1MD8A 2ZP0H 5JDUB 1KY9A 2IOTA 4U01A 1D6WA 3HK6B 9LPRA 4GPGA 3PV4A 3PTBA 3T29A 5A2MH 1BT7A 4GUXA 2OD3B 5C3NA 2AERH 1PQ5A 1ELCA 3DT0H 2F83A 1VITH 5H4IB 1T32A 1CBWC 3M7TA 1GHZA 1QJ1B 2FI3E 4I8KA 3TGJE 1QNJA 3KGPA 1YM0A 1SGTA 4Y71A 1O2UA 3GY7A 3BSQA 5EOKA 1SOZA 1PPBH 3BG4B 1O36A 5C5OA 1H1BA 3EA7A 3E6PH 1PJPA 1MAYA 2BDGA 2A7HA 1HXFH 3Q3YA 1S82A 1Y5AT 1SMFE 3RXCA 1GI7B 1IQEA 1HNEE 2Y5GA 2JH0D 1IOEA 2B9LA 3SV2H 1V2WT 3TH4H 1RTLA 2OUAA 1G32B 3SOSA 1CA8B 1O3OA 1O2WA 3UWIA 1C2DA 4ABIA 1BRBE 2G5NA 2Y82A 1PPFE 1MKXK 5EGMA 3B8JA 1DANH 1SVPA 3SNBA 3M7QA 1AE8H 1AFQB 1MCTA 1T8NA 3SHCH 3E3TA 5TJXA 1AWHB 4YT6H 2GGVB 1MQ5A 1E37B 3EYDA 4FVBA 4XBDA 1O3CA 1T31A 1ZR0A 2HPPH 2FOGA 1SGFG 3GOVB 1FUJA 2C3SA 1GHWH 2GCHG 1L4DA 2XW9A 3BG4C 1E0FD 1XXFA 1PPZA 1AUJA 1OOKB 1MZAA 4ABJA 2A2QH 3RXMA 4BXSA 3PLKA 4Y10E 1O2YA 1E34B 3RMOH 2TIOA 4IGDA 2FP7B 2TGAA 5DJ7A 4X1PU 1MUEB 3RXRA 1BRAA 1EOLA 2A1DB 1EUFA 4LZ4B 2QN5T 4BTIB 2WINI 1ABJH 3VFEA 2GDDA 2FOEA 1C5NH 3PMBB 1NFUA 2J4IA 2OTVA 3UPEA 1TPOA 1TWXB 1OWDA 1C1NA 1ZSLA 1AFQC 2BY9X 1LHEH 3A7YA 1WOFA 1UTLM 1YYY1 1YCPH 4DIHH 1BBRE 4MPVA 4B73A 4ABEA 1QQ4A 3FP8E 3LIWA 1KLJH 1S6FA 1CU1A 1C5WB 4I33A 3GCNA 1AY6H 2TBSA 1V2KT 1P0SH 3ZZ4A 1DSTA 5LPEA 2F9NA 2NU3E 1IQLA 2W7UA 3STJA 1HBTH 3Q00A 3MWIU 4CBNA 5I46H 2CV3A 2QF3A 2BD2A 4Y8ZA 3L3TA 4I8LA 1C5XB 1SFQB 3A85A 2J94A 5FCRA 3AVZA 2VH0A 3MNSA 3MMGA 5DP3A 1V2PT 5EQQA 3A7TA 4I8GA 4X8TH 2H9EH 3HK3B 3BEIB 2BD4A 1TGSZ 5T6GA 2G4TA 1GMCG 1CQQA 3C27B 1AVXA 3P8FA 1N8OB 1EB2A 5FPTA 2EI8A 3PB1E 2SGAA 1P2KA 3F68H 3BN9A 3MO6A 2IJOB 1YF4A 2I6QA 2G00A 1HJ8A 3A7XA 2EC9H 2J38A 3U1IB 5EG4A 1W0YH 1GBAA 1N6XA 2ALVA 1S85A 1JBUH 1UCYK 4X8UH 1C4Y2 1C4U2 4TWYA 2AMDA 3P95A 2QXIA 1HGTH 1Z71A 4ABAA 4CBOA 3RMMH 1NFYA 2ZDVH 3T27A 1V3XA 4X2YA 4BXWA 1GBHA 4FUFA 4FUGA 1SHHB 3M5MA 1MTSA 1UVTH 3PWBA 3SNAA 3I77A 1NFXA 2XXLA 3UNRA 2Z9JA 1O3HA 3M5LA 3MNBA 4ZKSU 1O5FH 1ETSH 3SUFA 1C1TA 1KTSB 4TPIZ 1O38A 1AKSA 1KDQB 1BBRH 2HNTE 1AHTH 1H9HE 1BJUA 4AYVB 5JB8S 1N8OC 4DGJA 3KCGH 3PYHA 1O2OA 1HV7A 2AMPA 2VVUA 1LDTT 3TNTA 4J1YA 4WWYA 2ZU1A 3RXAA 2P3UB 1Z7KA 1TNLA 4OGYA 1QRZA 2Q6DA 3ELAH 1O2KA 2C4FH 2O8UA 4E06H 3QTOH 1KXBA 1W2KH 1ZZZA 5EODA 4AX9H 3RXQA 1FNIA 4FU9A 3VXEH 1SGPE 2G5VA 4MNYA 1VGCB 3SJIA 1OWEA 3ZZ6A 4Z6AH 1W8BH 2BM2A 1EAWA 2ZDAH 4VGCB 1FPCH 3WY8A 3TK5A 3V3MA 2YNAA 1EJNA 2FOMB 4AN7A 3GCTG 1O3BA 3Q76A 3A7ZA 2PUXB 3SNDA 4LZ1H 2BTCE 4WXVA 1P12E 2VB0A 4CR9A 1MTNB 1Y59T 1CT4E 4ZHLU 2XBYA 4I8JA 4U30A 4XBCA 3GICB 1TAWA 3R0FA 2PHBA 1BTUA 1BTZA 1J8AA 2HPQH 2BD3A 4JZDH 1NTPA 3GDVA 4OS7A 1V2UT 4ABBA 1DWCH 3DD2H 2TRMA 1BMNH 3ODDA 5BPEA 1TOCB 1ZPBA 1F92A 4AFSA 2RA3A 1TABE 2GT8A 4CRDA 1ZOMA 2C8ZB 1QHRB 3RP2A 1AD8H 1XUIA 4B1TA 4XBBA 2Y5HA 2FLRH 1MMJN 4LOYH 5A0CA 4Y76A 3RXGA 3SBKA 4VGCC 1UCYE 3UR9A 3RC4A 3KEEA 4KKDA 4IC6A 3QGJA 5EPNA 3U9AH 3K9XB 4IN1A 2AS9A 4AYYB 1W7GH 3ATIA 3P92A 5DP5A 2ZWLH 1MTNC 2FYRA 1LQEA 2QGRA 4JZFH 2XTTB 1MU8B 3BTFE 1YC0A 3B23B 2Q1JA 3EGKH 1GMHF 3N7OA 4KTSA 4R8TB 5A0BA 1XVMA 5DGJA 4X6PA 2FEQH 5IDKA 3RU4T 2BLOA 1KSNA 4H6TA 1DXPA 4MTBA 5SGAE 3RUOA 1WQSA 3ZZBA 3M3VA 3OX7U 1LHFH 1O5BB 1JIRA 1L1JA 3RU4E 1C1VH 1D3TB 1YLCA 4ZHMU 3JZ1B 3U1JB 1O5DH 1MKWK 3QO6A 3QWCH 3VEQB 4BTTB 3F6UH 4YOGA 1PYTC 1YPHE 2ODPA 2FXRA 4YLQH 1C1RA 3H7OA 3SHAH 2FX6A 2A5KA 1O3LA 1IAUA 1O2JA 1O3KA 1ESBA 3F9GA 1PQ8A 2RDLA 5JBBS 4DCDA 3ZV9A 4ZXYH 1GVKB 3EE0B 1JRTA 1JWTA 2F9OA 1F5KU 1GBEA 1HAVA 1GBFA 5L6NH 2GD4B 3RM2H 1SGNE 1CGIE 4Y8XA 1Q3XA 1SQTA 3LPRA 1Z1JA 1AKSB 4UFFH 2ZDLA 1VITF 4ESTE 4B2AA 4BOHA 5L2ZH 2BLQA 3V13A 1TMTH 1EAXA 5F6MA 2P3TB 3UIRA 1A5IA 2BX4A 2Y5FA 1SLVB 3BIVH 5PTPA 2WPJS 1DX5M 5EW2H 4K5ZA 1GMDF 1C2EA 2H9TH 4JCNA 2ZIQH 3LGTA 3PMHB 4NA9H 2AGEX 5F8ZA 4B71A 2W5EA 1QGFA 4H6SB 2AGGX 2XYAA 1BTXA 1VJ9U 5CHAB 1HAZB 1GJ5H 4RSPA 1K22H 3Q77A 2TGDA 5C2ZA 1O3PB 1FN6A 2BYAX 3GISB 5FCKA 4E7RG 1LHGH 1GWAA 1HAIH 2SNWA 1YLDA 5T6FA 1GHVH 1A0LA 1C5YB 1WU1A 3S7HB 4OS5A 3M5OA 1DUAA 3VB4A 1EB1H 1A5GH 1SGEE 3VPKA 5DPAA 3TK6A 3SU3A 3HKIB 1GI1A 1TE0A 1YPLH 3TLOA 2BQWB 3CENA 1A0JA 1HAHH 3ZZ3A 1UJ1A 1TMBH 1C9TA 5A09A 3SJKA 2W3KA 1SR5C 3U98H 6LPRA 2V6NA 1X7AC 5HGGA 1KLTA 3B9FH 3U8TH 4AFUA 3BV9B 1GVLA 2ANKH 4OS2A 1CHOG 3MYWA 5E8EH 1ANEA 2NU1E 5CHAC 4CRFA 1THRH 4A7IB 1GJ8B 1QTFA 4HGCA 4A92A 1KTTB 1ZHPA 5JYIA 1FN8A 1WTGH 2VIQA 1BMMH 3L6PA 1TBRH 1WYKA 1SG8B 2Z9KA 2FOFA 3A89A 2BY5X 1EKBB 4FUDA 4UEHH 1KXFA 1W13U 2F9BH 4O97A 2FIRH 3MFJA 2BB4A 1EJAA 1NO9H 4RKOB 1GJBB 1Y3YA 4GHTA 1OWHA 2ZKSA 1F0TA 4O3TA 5HM9A 1K9OE 2FMJA 2ZFTA 3BTWE 4AG1A 1F0SA 4NIXA 1AUTC 4DT7B 1O2VA 3T2NA 4TWWA 4UD9H 1ETRH 1THSH 4Y11E 3DFLA 4FUCA 4CRGA 4WVPE 1O3NA 1TQ7B 3GY3A 4OS4A 2ZPQA 1QCPA 4HFPB 2PSYA 5DO4H 1GJDB 1TFXA 1HYLA 2B8OH 1KYNA 5JBCS 2ASUB 2ZECA 1TGTA 1HAVB 1GJ7B 2CN0H 4K1TA 2ODQA 2Y7ZA 4IC5A 1ZPCA 2Z3EA 4WY3A 1CT0E 4CRAA 3SV7A 1EAUA 1J14A 2A5IA 3AAUA 1BB0B 2PTNA 3UQVA 1ELVA 2C8XB 4K3JA 5FXLA 4HZHA 1S84A 1BTYA 2R0KA 1GBMA 2Y80A 3UWJH 3A87A 1Z8JB 2OC1A 3H7TA 2PGQB 1EPTA 3MTYA 4FXGH 3TIUA 1EZUC 1A46H 4GCHF 1GI5A 4X6MA 1A4WH 1MKWH 2OP9A 2A2XH 2Z6BD 1HAOH 1DLEA 4OS1A 4BTUB 1RXPA 3BTME 1O2GH 3PMAB 1UVOA 1BITA 4ZH8A 4YLUA 1GI9B 3OY6U 4ZKNU 2ZU5A 2WV4A 5GWZA 1XX9A 1TNHA 3FP7E 1B0FA 2BDIA 1GL0E 3TPIZ 2FPZA 3BIUH 2ZGHA 2DUCA 3MNCA 4MNXA 1QBOA 2HWLB 3H5CB 4B2BA 1AU8A 1ZJKA 2VWLA 3RXDA 1EZXC 2ZNKH 1FPHH 5DP4A 5TCCA 1GBTA 1PQAA 3LOXA 2CGAA 3VB6A 3A82A 2OC7A 4JK5A 4JYVH 2OQUA 3LU9B 3MU8A 1GJ9B 2ZG0H 2P8OB 1LVYA 1FIZA 5ESTE 1ELFA 2PKSB 3RXOA 1NRPH 3ATWA 4GHQA 2A4OA 2ZGJA 5K0HA 2VIWA 1E38B 2ZFRH 7GCHF 2A4QA 1N6YA 3NUMA 1GGDB 1YCPM 2ZU2A 3JZ2B 1P2NA 1EATA 1TYNA 5DG6A 2O8LA 5AFZH 1P06A 3GCHB 5F8TA 3U8RH 1W3CA 3NWUA 3SQEE 1NPMA 2H6MA 1ZRBA 3M5NA 4WH8A 2VVCA 3CS0A 2FI4E 2QCYA 1GPZA 1SGRE 1N1LA 1SLWB 1L1GA 4ZHAA 3STIA 3A8DA 3F1SB 1KXDA 3M37A 1GBLA 1SC8U 2D26C 1LPKB 4D7GA 2BY7X 1GJ6A 2P8OC 1NRRH 1C5OH 4FVDA 1GBCA 5CE1A 1QQUA 2HVXA 1O2RA 2PKSC 3A8AA 3BTGE 1UO6A 4E7NA 1J17T 5A0AE 2Z9LA 2WPLS 3SQHE 3FZDA 2G55A 1GGDC 1K28D 1TX7A 3UFAA 2IPHA 2NU2E 4ISHH 3BG8A 3K2UA 1WCZA 3D23A 1XMNB 7ESTE 1FY1A 4X0WU 1UHBA 3BF6H 1ACBE 3GCHC 4X1RU 1Z6JH 2CXVA 1ZHRA 1AZ8A 2FM2A 4MG3A 1IQHA 1W10U 5EPYA 1M9UA 1DY9A 1ZRKA 1XUFA 2F9VA 1PQ7A 1MD7A 1EP6A 1O39A 1Z6EA 3SNEA 1GHAF 2HNTF 4YM9A 1XUHA 4XOJA 1HJAC 1TA6A 2AGIX 2ZHWH 1GBIA 5E2OA 1OKXA 2AMQA 2BOKA 3GY2A 1O2XA 7KMEH 3TGKE 4BAQB 5LPRA 1P9SA 1FONA 2XBXA 4K2YA 1C5LH 1GL1A 3LJJA 1P2QA 4INLA 2GT7A 3RXTA 1FLEE 1EPTB 1V2JT 1OWJA 1TX8A 1A2CH 4KGAA 1WTHD 2GCHF 5E0HA 1QY6A 1UVPA 3VB3A 5J4SA 1KIGH 1VCQA 1CO7E 1BHXF 1LKAA 2C8YB 1BTWA 3SW2B 3O8BA 1ID5H 1BA8B 1G3BA 1MCVA 3QGNB 1D9IA 4Y8YA 5AF9H 2EI6A 3MO3A 1O35A 2CMYA 1ZJDA 1TBQH 2BLVA 3HKJB 2UUJB 1UTMA 1XKAC 1B0EA 5E2PA 1FJSA 1ELTA 1MQ6A 3MOCA 2GP9B 4YO9A 3G01A 2ANYA 4YOIA 1MTVA 4E05H 1CSOE 4X2XA 2IN2A 3RXVA 2A4RA 1UVUH 3RXLA 8GCHF 4GLYA 4IMZA 2VH6A 1MAXA 2BDBA 3NCLA 1NN6A 1EPTC 4X1SU 4AB8A 1Z8IB 1RIWB 3A7VA 3RXIA 1IQFA 2ZGBH 1RFNA 1GBJA 4DVAU 2B5TB 2CF9H 1QA0A 3UNQA 4Q7ZA 1AWFH 1C1QA 2Z94A 1EQ9A 1H8IH 1MTUA 3UOUA 1C5UA 4KP0A 1DWDH 2ZHFH 3LH1A 3NZIA 2XC4A 5JBTA 1F2SE 2V3OH 1NFWA 2KAIA 2A0QB 4Y0YE 1RTKA 3NXPA 2STAE 1XVOA 3EAJA 3K6ZA 2J2UA 1G2LA 1V2RT 4ZUHA 2V3HH 4F49A 1V2NT 3HATH 3K65B 1IQIA 5G4BA 3LONA 3ZZ7A 2BD8A 5T6DA 2ZPSA 1LMWB 1GMCF 5FX5A 1O31A 1SLXB 4X2VA 1K1MA 2VU8E 4I32A 4WJG2 2Q6GA 1RIWC 4NWLA 1OP8A 5BRRE 1DSUA 2GDEH 4FUIA 4NFFA 4Y7AA 1P01A 1QL9A 3S0NA 4DOQA 1RGQA 1UHBB 2HGTH 3D49H 3R3GB 1C1OA 3ODFA 4INKA 3ZZAA 2B7DH 4DURA 1IQMA 4Q80A 1L2EA 1O2HA 1GHBG 1MKXH 3SJOA 1EAIA 4MNWA 5A8XA 4FUJA 1Z8RA 1JIMA 3ZZ5A 2ZHQH 1P9UA 2FTLE 2SGEE 1F0UA 4AGKA 1Y3WA 3CP7A 2R3UA 3TJOA 1ZPZA 3GYLB 1LVMA 2A5AA 3A7WA 3RXJA 5GXPA 3P6ZB 5ESBA 1AFEH 4MLFB 2ZC9H 2OBQA 3NKKA 2WPMS 1BCUH 1O3JA 4HTCH 3V7TA 1UK2A 3LKWA 1NESE 2VVVA 1HB0B 2GZ7A 3RDZA 4LK4A 1QJ6B 1QFKH 1UMAH 1W7XH 1P57B 2Z3CA 1O3EA 1SGQE 4J2YB 1NS3A 1HJ9A 1C5QA 1SI5H 2VIPA 4CRCA 5C1XA 3ZVCA 1V6DA 2ZU4A 3HGPA 4KTUA 4A1VA 4KELA 2O8WA 1ZHMA 3BTKE 1TNJA 1C2GA 4ISOA 4O9VA 1ELAA 6GCHF 1TPPA 1EOJA 3ZYEA 2FS9A 2ULLA 3GYMA 1P2JA 1ZSKA 2BVRH 2ZFSA 4AORA 1LHDH 2Y81A 4WF8A 3LGIA 5GIBA 5JBAS 3LH3A 1VITG 4ISLA 3AW0A 2AYWA 4Z0KA 2PKAA 4CRBA 4CH2B 3GCTF 1CT2E 2STBE 1INCA 1CVWH 1PPCE 3RC6A 2FO9A 5A8ZA 3UTUH 1OS8A 1EXFA 3OY5U 3RM0H 3P70B 1FAKH 1GMDG 1MBMA 1TNIA 1UTJA 3LGWA 2GMTB 4NZQA 2FYQA 1T4VH 1ANCA 1BTPA 1XUKA 1O2TA 1C5TA 1NU7B 1FMGA 2R2MB 1G2MA 3KQBA 2O9QA 1HCGA 3A84A 1JOUB 2AIQA 4FUHA 4Y79A 5DKMA 1A7SA 2WUCA 4TY6A 2TGPZ 5EXNA 1TA2A 4X8SH 2C90B 2WYJA 3SI3H 4BANB 4JYUH 1W12U 5EW1H 3OYPA 3LC5A 3SU0A 3L33A 1PYTD 2BD9A 1MZDA 8KME2 4ZKOU 1O3DA 1AB9B 1ORFA 2ZDKA 1C5PA 3RMLH 3VB5A 3A88A 1SGCA 1Z1IA 3W94A 3QK1A 2GZ9A 2KAIB 4AG2A 4ASHA 5GCHF 3GY5A 4WXIA 2SNVA 3T25A 1SBWA 3U8OH 5AVDA 9ESTA 4GSOA 4K69A 1H9LB 1O0DH 2ZEBA 2GMTC 3SGQE 2F9UA 3ATKA 2QXHA 4JZIA 3KHVA 4IS5A 3IG6B 2PR3A 2JH6D 4TY7A 4B2CA 2FOBA 2V0BA 1UCYH 1XKBC 3KQEA 2QIQA 5JB9S 4D76A 1V2MT 4FU8A 1XM1A 5EXMA 1BIOA 1O37A 1BQYA 1C2FA 1GJAB 2ODYB 2ANMH 3GDUA 1RTFB 1GI3A 1IHSH 1DFPA 1Z8GA 2PSXA 1H8DH 2P95A 2V35A 1HIAA 3QX5H 1AB9C 1BMAA 5DP9A 4X2WA 3P8NA 1P04A 3TJNA 2R3YA 2FESH 3PWCA 1O2NA 1YPMH 1TALA 5J4QA 5AHGH 1ANBA 3ZVDA 2VIOA 1QURH 1ARCA 2BZ6H 5C67A 1NRQH 2C93B 3Q3KA 2XBWA 2GZ8A 4MPWA 3VGCB 1S81A 3RXFA 3RXKA 4YESB 3RMNH 3PO1C 2BZAA 3D62A 5FPYA 3T62A 2D2DA 1TQ0B 1K1PA 1HDTH 1CE5A 1YPJH 1V2OT 3CS7A 3TJUA 3MI4A 1F5LA 1G9IE 1AN1E 2VGCB 2F9PA 2FWWA 6ESTA 2A31A 3TNSA 2QXGA 2FI5E 1BJVA 2D8WA 1HAXB 2H5CA 1DVAH 3PMJA 3M35A 1TB6H 4AFQA 1ZTLA 1C1MA 1AMHA 3ATMA 2ZF0H 3MU4A 4RN6A 2EA3A 1LVBA 2PKAB 2Z9GA 1ZLRA 1YCPK 3TJVA 4OS6A 5GJ4B 1W11U 4I7YH 1UTOA 4MPXA 1A5HA 2VIDA 3LJOA 2OC0A 1KXEA 1QIXB 3KN2A 2OBOA 2WPHS 1UVSH 3VGCC 2JH5D 1O5CB 2ZHDA 4Y6DA 1DT2A 5A8YA 1ARBA 4NIYA 3E1XB 2SGQE 1O5EH 1LPGB 3TH2H 1XUJA 1P05A 1QBVH 3RC5A 2OC8A 2QA9E 1ELDE 1NU9A 1HAPH 1TGCA 2VGCC 4WH6A 1TRYA 1A0HB 4HI3A 3RXHA 1P10A 3P8GA 3SU4A 5HMAA 4DY7B 2HLCA 2BDCA 2A45B 2BVXH 2XC0A 3MO9A 2SGFE 2CJIA 3U69H 2FLBH 3F9EA 3GCOA 4NSYA 3BEUA 3AW1A 1GI4A 1HLTH 1GG6B 1O2LA 3GY6A 2GTBA 2ESTE 2OCVB 3BTDE 2BLWA 1GHXH 3S69A 1C5ZB 5L30H 2FS8A 3SO3A 2Y7XA 2CHAB 1BRCE 5JPMH 1D3QB 3URDA 2VINA 1SOTA 1U6QA 2H9HA 3SV8A 2BQ7B 1OX1A 1NC6A 1J15A 3IITA 2WPIS 3ZVGA 3SUDA 3S7KB 1T8LA 5T3HA 2P93A 4MQAA 2ZFFH 5HYOA 1ESTA 4Q7XA 2J9NA 1GDQA 4INHA 4K1SA 1AVWA 5DP7A 2FODA 1PPEE 1MTWA 1AVGH 1L0ZA 3M61U 2ZGXH 3M3SA 1HXEH 1LCYA 2J92A 2GV7A 1LTOA 2D1JA 1DXWA 1V2LT 1DWEH 1HIAB 4OGXA 1FI8A 3LGYA 2FOCA 4UDWH 5CMXH 1BZXE 1P3EA 2UUFB 1BBRK 1GG6C 1V2VT 1AI8H 1KLIH 1TGBA 1W0ZU 1FY3A 4NSVA 2ZPRA 2Q6FA 1A1RA 1SGFA 5FAHA 4XDEA 1C1UH 1QRWA 2CHAC 3MH6A 1LHCH 1SSXA 1OSSA 3KF2A 1D6RA 3PLBA 1VR1H 1P8VC 4Y7BA 1GI0A 1PFXC 1Y5UT 2WPKS 2AFQB 1O30A 1HUTH 3DHKH 3DA9B 3FP6E 5EU8A 4D8NA 1FDPA 1WAYB 3NPSA 1OYQA 1VCPA 1CGHA 3UY9A 1RRKA 3EDXB 2PTCE 4PROA 5AFYH 8LPRA 1C9PA 1UTKA 2R2WU 1C2KA 2W7SA 1GHAG 3LDXH 3FANA 1DS2E 1HJAB 1QJ7B 1GCTB 3SGAE 3ZV8A 4CHAB 2Y6TA 2TGTA 1G36A 5DK1A 1C1WH 1KDQA 2ZDNA 1DLKB 2ZCKP 1YPGH 3A81A 4TPYA 4ZAEA 2G52A 1SB1H 1TX6A 7LPRA 5I25A 4R0IA 1TPAE 3RXBA 1H9IE 5IYTA 1O2SA 3E91A 1AE5A 2PFEA 2A7JA 4DW2U 4YT7H 1ZTKA 1DM4B 2F3CE 3K6YA 1O3MA 3SORA 1WBGB 2FZZA 2XWBI 1V2QT 4AB9A 2J34A 4WMDA 2AEIH 1WSSH 1GHYH 3RXSA 3TITA 2JETB 1ZGVA 2PW8H 1AQ7A 4X6OA 4X8VH 3ZVAA 1P2IA 2ZGCA 1RS0A 2WUBA 3TK9A 1DE7H 1GI8B 2XCNA 2UUYA 1TGNA 2Z7FE 1OWKA 2RA0A 4NFEA 2GVFA 1K1OA 1C5VA 1GCTC 3SGBE 2O8TA 4CHAC 3BTQE 3D65E 2P94A 2QYIA 1FIWA 4D9QA 3SU5A 2PWXA 3W95A 2K1QA 1THPB 4O03A 5FPSA 4O3UA 3ZYDA 8GCHG 3Q3XA 1C5RA 1P11E 1BUIA 4X1NU 3ZVFA 2M5TA 5E0JA 3IWMA 1FV9A 1TRMA 2SFAA 4UONA 1B7XB 1GI2A 3UR6A 4DIIH 1QL7A 1DY8A 2PUQH 1JXPA 1AZZA 4YTAA 1EZQA 4IMQA 3MNXA 1TONA 4DJZB 2ZO3H 2JETC 1D3PB 1FY8E 2QY0B 3A8CA 3QN7A 3A8BA 4UFEH 2A32A 1CA0B 2EEKA 2FX4A 2WV5A 1TPSA 3ZZDA 2ZFQH 3MH7A 4JMYA 2BX3A 2ZU3A 1IQNA 3QZRA 1UTNA 1O2IA 5K7RA 1V2ST 1BDAA 2THFB 1O3AA 4AFZA 4NIVA 3UQOA 2GX4A 1JRSA 1LVOA 1P2MA 1UTQA 4ISIH 3O8CA 5C20A 1EASA 2FOAA 2BMGB 3MU0A 1ZYOA 3QZQA 3RLYH 1ETTH 1OP0A 1UK3A 4YOJA 3SV9A 1UTPA 1K2I1 4QT8C 3OTJE 3FVFB 4NGAH 3T26A 1O2ZA 1YPKH 2C8WB 2QAAA 1BHXB 1TBZH 3MH4A 1C2LA 1Y3UA 3ATLA 2W3IA 2QC2A 4AZ2B 4RKJB 1NT1A 5F03A 5GDSH 1T8MA 1CA0C 4NA7A 4DG4A 1YP9A 5E0GA 2HNTC 4YZUA 1FZZA 2ZCLP 1O2MA 2XC5A 2ZI2H 4D9RA 1Q31A 2ZDMA 5FBEA 2HRVA 3DFJA 2XCFA 1L4ZA 3KQCA 1QL8A 1UK4A 4M7GA 1QB9A 1E36B 3QTVH 3MU5A 2RCEA 1ZMLA 1WV7H 2XNIA 3UREA 3AASA 1NRNH 1EX3A 5EXLA 4K8BA 3ZVBA 3O8DA 1GJCB 5HM2A 2ZHEH 3SV6A 2UWLA 8ESTE 4NZLA 2CF8H 6GCHG 3UOPA 4B75A 1V2TT 2QV1A 1HFDA 3ZZ8A 1J16A 4NA8A 3EA9A 3KL6A 1QB6A 1G37A 1K1JA 4IN2A 4TYDA 3UNSA 2BOHB 2AH4X 1SL3A 1BOQA 1GMHG 3RXUA 3F9FA 1HAGE 3M3TA 2YOLA 4I31A 2ZTXA 3SU6A 2UWPA 2BDYA 3NK8A 2ZA5A 1F7ZA 1SPJA 2GV6A 3A83A 1SHYA 3TVJB 2W26A 4B76A 4MPUA 3BTEE 1S83A 3UUZA 1TNKA 2AIPA 2BDHA 2YNBA 2O8MA 2VWNA 4SGBE 4K60A 3GY4A 4Q2KA 1A3EH 1L1NA 1VJAU 4CREA 2Z9IA 3M36A 4WMFA 3VXFH 4H42U 3S9AA 4A6LA 1AO5A 5C1UA 4ZMAH 3S9CA 4X1QU 1G3EA 5EQSA 2ZQ2A 3PM3A 2SGPE 3F9HA 1K1LA 1Y8TA 2H5DA 1TLDA 1VGCC 3PTNA 2OQ5A 2BVSH 5DP8A 5GPIB 1S0QA 1MBQA 2HOBA 2ILNA 4I8HA 5GCHG 4ABDA 2XRCA 1P02A 4CH8B 1XXDA 1G30B 1TIOA 1Y5BT 1OPHB 5L2YH 2ALPA 2QF0A 1C4V2 2H2ZA 4A1TA 1NZQH 2BXTH 3RXEA 3ZZCA 4BAHB 3HGNA 1GHBF 5LH8A 1FXYA 4NCYA 2P59A 1YPHC 3ESTA 4WMEA 2OLGA 3URCA 1SQAA 2BY8X 1DPOA 4D7FA 1O2PA 1C2JA 1OP2A 1ZMNA 4JK6A 3QLPH 1B5GH 1HRTH 1D4PB 3SJ9A 1FY5A 3RU4D 3P17H 2A7CA 4H4FA 3E90B 1IHTH 2QXJA 3V0XA 1RJXB 6CHAB 3ZZ9A 2B0FA 2VJ1A 1SLUB 3LGVA 3A86A 3SU2A 1D3DB 1T8OA 3TU7H 1LQDB 3ZVEA 1ZGIA 1IQJA 2FDAA 1C1SA 1ELBA 4XSKU 1NRSH 4IBLH 2BY6X 3BEFB 3QDZB 3VB7A 4JYTA 4K8YA 3E0NB 1AIXH 4NIWA 4AGJA 3TGIE 2NWNA 1YPEH 3SUGA 1ANDA 1QR3E 4F4OC 1EJMA 4A1XA 1O5AB 1JMOH 4MDSA 1O33A 2A4GA 1G3CA 1S0RA 1YBWA 3FZZA 1P09A 1F0RA 3PO1B 4ABGA 4KTCA 1MU6B 2PLXA 1MH0A 1O3GA 1WUNH 1QRXA 3PLPA 2H1UA 2HALA 4THNH 1S5SA 1K1NA 2OINA 3OSYA 4X6NA 3FAOA 3FFGA 1LO6A 1FAXA 3EQ0H 5FBIA 4K1EA 1P3CA 4SGAE 4FUEA 2TPIZ 5C5NA 6CHAC 1OXGA 2PV9B 1GVZA 3SUEA 1QB1A 1SQOA 4NWKA 1TRNA 5LPFA 1BRUP 1GDNA 2LNCA 1SFIA 4BNRA 2UWOA 4UFDH 1NM6A 1SGIB 1Q2WA 1C2MA 3DUXH 2Z3DA 1IQKA 4ABHA 2VIVA 2VWMA 1G3DA 2XBVA 3OU0A 1QBNA 4ISNA 4MNVA 4ZKRU 2P3FH 3A80A 3SJ8A 3TH3H 1P2OA 4BAMB 1BMLA 3E16B 4ZROA 3GDSA 1E35B 3BTHE 1DICA 2G51A 3LT3A 2DE9A 1A3BH 1O2QA 1ZSJA 3GY8A 4GVUA 3SN8A 3KIDU 1CGJE 3SZNA 1DITH 4LXBH 4AOQA 2G4UA 1S6HA 3MH5A 4A5TS 2VWOA 2OXSA 4IW4E 2NU0E 1O3IA 3QUMP 2BQ6B 2WYGA 4JZEH 1SGDE 4XE4A 3T5FH 2BDAA 1C1PA 3LGUA 4ABFA 4FUBA 1GBBA 2G8TA 1OYTH 2ZCHP 1ELGA 2DE8A 2ANWA 2NU4E 1ESAA 3ITIA 5DP6A 3I78A 4UFGH 3E8LA 1P03A 1SGYE 1GCDA 2R9PA 1QA7A 4NG9H 1VZQH 2RG3A 4JZ1A 1C5SA 1IQGA 1ZMJA 4BAKB 2FTMA 1Y3VA 1C5MD 1PPHE 2R0LA 1AGJA 2ZTYA 1XUGA 4U32A 1TOMH 3KQDA 4GCHG 1GBDA 3MHWU 1TNGA 3SI4H 3LC3A 1DOJA 5FHTA 3C1KA 4XFQA 1TMUH 1GJ4H 3SU1A 1C2IA 4BAOB 2I6SA 2FOHA 1WQVH 2JKHA 1EP5A 4MVNA 2PGBB 1VCWA 3AAVA 4UE7H 2BHGA 1C2HA 2BD7A 1T7CA 2ZTZA 1YGCH 5C1YA 1PPGE 5F8XA 1ELEE 3KNXA 2VNTA 3V12A 3M7UA 5ETXA 1T4UH 5LGOA 1BTHH 3RLWH 2GCTB 2GKVE 1HAYB 2BXUH 1F5RA 1H4WA 2ZQ1A 1GDUA 3O8RA 1CHOF 1OWIA 1O34A 1Y3XA 3PROA 2ZFPH 1KXCA 1NROH 2F91A 4Y0ZE 4B74A 1ABIH 1EZSC 2J95A 1FY4A 2XWAA 1CBWB 5B6OA 1O3FA 3SNCA 3MU1A 7GCHG 1W14U 4ZXXH
chains in the Genus database with same CATH superfamily
2P16A 3EA8A 4FU7A 5HXFA 1K21H 3T28A 3P8OA 1LKBA 3ENSB 1NY22 5EQRA 1FQ3A 4CR5A 1J9CH 2UUKB 1CHGA 3I29A 4U2WA 1DWBH 4Q7YA 5TCAA 2EI7A 3WWBA 3RXPA 1ZTJA 1LPZB 1GBKA 4GAWA 1KXAA 2SGDE 1O32A 1O5GH 3S9BA 3BTTE 2ZZUH 2G81E 1DDJA 5FX6A 1A61H 3E0PB 1HPGA 1GI6A 1RD3B 2GCTC 1DUEA 5C17A 2BD5A 5ABWA 1YKTA 3HPTB 2LPRA 1K1IA 1MD8A 2ZP0H 5JDUB 1KY9A 2IOTA 4U01A 1D6WA 3HK6B 9LPRA 4GPGA 3PV4A 3PTBA 3T29A 5A2MH 1BT7A 4GUXA 2OD3B 5C3NA 2AERH 1NBME 1PQ5A 1ELCA 3DT0H 5HKKD 2F83A 1VITH 5H4IB 1T32A 1CBWC 3M7TA 1GHZA 1QJ1B 2FI3E 4I8KA 3TGJE 1QNJA 2V7QD 3KGPA 1YM0A 1SGTA 4Y71A 1O2UA 3GY7A 3BSQA 5EOKA 1SOZA 1PPBH 3BG4B 1O36A 5C5OA 1H1BA 3EA7A 3E6PH 1PJPA 1MAYA 2BDGA 2A7HA 3ZIAD 1HXFH 3Q3YA 1S82A 1Y5AT 1SMFE 1YLNA 3RXCA 1GI7B 2QF5A 1IQEA 1HNEE 2Y5GA 2JH0D 1IOEA 2B9LA 3SV2H 1V2WT 3TH4H 1RTLA 2OUAA 1G32B 3SOSA 1CA8B 1O3OA 1O2WA 3UWIA 1C2DA 4ABIA 1BRBE 2G5NA 2Y82A 1PPFE 1MKXK 5EGMA 3B8JA 1DANH 1SVPA 3SNBA 3M7QA 1H8HD 1AE8H 1AFQB 1MCTA 2KR7A 1T8NA 3SHCH 3E3TA 5TJXA 1AWHB 4YT6H 2GGVB 1MQ5A 1E37B 3EYDA 4FVBA 4XBDA 1O3CA 1T31A 1ZR0A 2HPPH 2FOGA 1SGFG 3GOVB 4YXWD 1FUJA 2HVYB 2C3SA 1GHWH 2GCHG 1L4DA 2XW9A 3BG4C 1E0FD 1XXFA 1PPZA 1AUJA 1OOKB 2HLDD 1MZAA 4ABJA 2A2QH 3RXMA 4BXSA 3PLKA 4Y10E 1O2YA 1E34B 3RMOH 2TIOA 4IGDA 2WPDD 2FP7B 2TGAA 5DJ7A 1WXRA 4X1PU 1MUEB 3RXRA 1BRAA 1EOLA 2A1DB 1EUFA 4LZ4B 2QN5T 4BTIB 2WINI 1ABJH 3VFEA 3FKSD 2GDDA 2FOEA 1C5NH 3PMBB 3SZEA 1NFUA 2J4IA 2OTVA 3UPEA 1TPOA 1TWXB 1OWDA 1C1NA 1ZSLA 1AFQC 2BY9X 5EJ1A 1LHEH 3A7YA 1WOFA 1UTLM 1YYY1 1YCPH 4DIHH 1BBRE 4MPVA 4B73A 2V3MA 4ABEA 1QQ4A 3FP8E 3LIWA 1KLJH 1S6FA 1CU1A 1C5WB 4I33A 3GCNA 1AY6H 2TBSA 4OM9A 1V2KT 1P0SH 3ZZ4A 1DSTA 5LPEA 1W0JD 2F9NA 2NU3E 1IQLA 2W7UA 3STJA 3N7EA 1HBTH 3Q00A 3MWIU 4CBNA 5I46H 2CV3A 2QF3A 2BD2A 4Y8ZA 3L3TA 4I8LA 1C5XB 1SFQB 3A85A 2J94A 5FCRA 3AVZA 2VH0A 3MNSA 3MMGA 5DP3A 1V2PT 5EQQA 3A7TA 4I8GA 4X8TH 2H9EH 3HK3B 3BEIB 2BD4A 1TGSZ 1SQRA 5T6GA 2G4TA 3FOAA 1GMCG 1CQQA 3C27B 2WHXA 1AVXA 3P8FA 1N8OB 1EB2A 5FPTA 2EI8A 3PB1E 3PRDA 2SGAA 1P2KA 3F68H 2KFWA 3BN9A 3MO6A 2IJOB 1YF4A 2I6QA 2G00A 1HJ8A 3A7XA 2EC9H 2J38A 3U1IB 3NRLA 5EG4A 1W0YH 1GBAA 1N6XA 2ALVA 1S85A 1JBUH 1UCYK 4X8UH 1C4Y2 1C4U2 4TWYA 2AMDA 2JJ1D 3P95A 2QXIA 1HGTH 1Z71A 4ABAA 4CBOA 3RMMH 1NFYA 2ZDVH 3T27A 1V3XA 4X2YA 1YWUA 1GBHA 4BXWA 4FUFA 4FUGA 1SHHB 3M5MA 1MTSA 1UVTH 3PWBA 3SNAA 3I77A 3GS9A 1NFXA 2XXLA 3UNRA 2Z9JA 1O3HA 3M5LA 3MNBA 4ZKSU 1O5FH 1ETSH 3SUFA 1C1TA 1KTSB 2IJD1 4TPIZ 1O38A 1AKSA 1KDQB 1BBRH 2HNTE 1AHTH 1H9HE 1BJUA 4AYVB 5JB8S 1N8OC 4DGJA 3KCGH 3PYHA 1O2OA 1HV7A 2AMPA 2VVUA 1LDTT 3TNTA 4J1YA 4WWYA 2ZU1A 3F3BA 3RXAA 2P3UB 1Z7KA 1TNLA 4OGYA 1QRZA 2Q6DA 3ELAH 1O2KA 2C4FH 2O8UA 4E06H 3QTOH 1KXBA 1W2KH 1ZZZA 5EODA 4AX9H 5IK2D 3RXQA 1FNIA 4FU9A 3VXEH 1SGPE 2G5VA 4MNYA 1VGCB 3SJIA 1OWEA 3ZZ6A 4Z6AH 1W8BH 2BM2A 1EAWA 2ZDAH 4VGCB 1FPCH 3WY8A 3TK5A 3V3MA 2YNAA 1EJNA 2FOMB 4AN7A 1FX0B 3GCTG 1O3BA 3Q76A 3A7ZA 2PUXB 3SNDA 4LZ1H 2BTCE 4WXVA 1P12E 2VB0A 4CR9A 1MTNB 1Y59T 1CT4E 4ZHLU 2XBYA 4I8JA 4U30A 4XBCA 3GICB 1TAWA 3R0FA 2PHBA 1BTUA 1BTZA 1J8AA 2HPQH 4ZCNA 2BD3A 4JZDH 1NTPA 3GDVA 4OS7A 1V2UT 4ABBA 1DWCH 3DD2H 2TRMA 1BMNH 4Q4LA 3ODDA 5BPEA 1TOCB 1ZPBA 2JDID 1F92A 4AFSA 2RA3A 1TABE 2GT8A 4CRDA 1ZOMA 2C8ZB 1QHRB 3RP2A 1AD8H 1XUIA 4B1TA 4XBBA 2Y5HA 2FLRH 1MMJN 4LOYH 5A0CA 4Y76A 4XRNA 3RXGA 3SBKA 4VGCC 1UCYE 3UR9A 3RC4A 3KEEA 4KKDA 4IC6A 3DSGA 2VBCA 3QGJA 5EPNA 3U9AH 3K9XB 4IN1A 2AS9A 4AYYB 1W7GH 3ATIA 3P92A 5DP5A 2ZWLH 1MTNC 2FYRA 1LQEA 2QGRA 4JZFH 2XTTB 1MU8B 3BTFE 1YC0A 3B23B 2Q1JA 3EGKH 1GMHF 3N7OA 4KTSA 4R8TB 5A0BA 1XVMA 5DGJA 4X6PA 2FEQH 5IDKA 3RU4T 2BLOA 1KSNA 4H6TA 2L74A 1DXPA 4MTBA 5SGAE 3RUOA 1WQSA 3ZZBA 2KM0A 3M3VA 3OX7U 1LHFH 1O5BB 1JIRA 1L1JA 3RU4E 1C1VH 1D3TB 1YLCA 4ZHMU 3JZ1B 3U1JB 1O5DH 1MKWK 3QO6A 3QWCH 3VEQB 4BTTB 3F6UH 4YOGA 1PYTC 1YPHE 2ODPA 2FXRA 3DCLA 4YLQH 1C1RA 3H7OA 3SHAH 1WDIA 2FX6A 2A5KA 1O3LA 1IAUA 1O2JA 1O3KA 1ESBA 3F9GA 1PQ8A 2IPQX 2RDLA 5JBBS 4DCDA 3ZV9A 4ZXYH 1GVKB 3EE0B 1JRTA 1JWTA 2F9OA 1F5KU 1GBEA 1HAVA 1GBFA 2KZ4A 5L6NH 2GD4B 3RM2H 1SGNE 1CGIE 4Y8XA 1Q3XA 1SQTA 3LPRA 1Z1JA 1AKSB 4UFFH 2ZDLA 1VITF 4ESTE 1E1QD 4B2AA 4BOHA 5L2ZH 2BLQA 3V13A 1TMTH 1EAXA 5F6MA 4DT4A 2P3TB 3UIRA 1A5IA 2BX4A 2Y5FA 1SLVB 3BIVH 5PTPA 2WPJS 1DX5M 2EQNA 5EW2H 4K5ZA 1GMDF 1C2EA 2K8IA 2H9TH 4JCNA 2ZIQH 3LGTA 3PMHB 4NA9H 2AGEX 5F8ZA 4B71A 2W5EA 1QGFA 4H6SB 2AGGX 2XYAA 3UB0A 1BTXA 1VJ9U 2W6ID 5CHAB 1HAZB 1GJ5H 4RSPA 1W0KD 1K22H 3Q77A 2TGDA 5C2ZA 1O3PB 1FN6A 2BYAX 3GISB 2WZQA 5FCKA 4I86A 1LHGH 4E7RG 1GWAA 1HAIH 2YMSB 2SNWA 3FN8A 1YLDA 5T6FA 1GHVH 1A0LA 1C5YB 1WU1A 3S7HB 4OS5A 3M5OA 1DUAA 3VB4A 1EB1H 1A5GH 1SGEE 3VPKA 5DPAA 3TK6A 3SU3A 3HKIB 1GI1A 1TE0A 1YPLH 3TLOA 2BQWB 3CENA 3KQ5A 1A0JA 1HAHH 3ZZ3A 1S6LA 1UJ1A 1TMBH 1C9TA 5A09A 3SJKA 2W3KA 1SR5C 3U98H 6LPRA 2V6NA 1X7AC 5HGGA 1KLTA 3B9FH 3U8TH 4AFUA 3BV9B 1GVLA 2ANKH 4OS2A 1CHOG 3MYWA 5E8EH 1ANEA 2NU1E 5CHAC 4CRFA 1THRH 4A7IB 1GJ8B 1QTFA 4HGCA 5GNDA 4A92A 1KTTB 2F4LA 1ZHPA 2LELA 2YMSC 5JYIA 1FN8A 1WTGH 2VIQA 1BMMH 3L6PA 1TBRH 1WYKA 1SG8B 2Z9KA 2FOFA 3A89A 2BY5X 1EKBB 3F0OA 4FUDA 4UEHH 1KXFA 1W13U 2F9BH 4O97A 2J97A 2FIRH 3MFJA 3VG8A 2YMSD 2BB4A 5CDFE 1EJAA 1NO9H 4RKOB 1GJBB 1Y3YA 4GHTA 1OWHA 2ZKSA 1F0TA 4O3TA 5HM9A 1K9OE 2FMJA 2ZFTA 3BTWE 4AG1A 1F0SA 4NIXA 1AUTC 4DT7B 1O2VA 3T2NA 4TWWA 4UD9H 1ETRH 1THSH 3N99A 4Y11E 3DFLA 4FUCA 4CRGA 4WVPE 1O3NA 1TQ7B 3GY3A 4OS4A 2ZPQA 1QCPA 4HFPB 2PSYA 5DO4H 1GJDB 1TFXA 1HYLA 2B8OH 1KYNA 5JBCS 2ASUB 2ZECA 1TGTA 1HAVB 1GJ7B 2CN0H 4K1TA 2ODQA 2Y7ZA 4IC5A 1ZPCA 2Z3EA 4WY3A 1CT0E 4CRAA 3SV7A 1EAUA 1J14A 2A5IA 3AAUA 1BB0B 2PTNA 2AHME 3UQVA 1ELVA 2C8XB 4K3JA 5FXLA 4HZHA 1S84A 1BTYA 2R0KA 1GBMA 2Y80A 3UWJH 3A87A 1Z8JB 2OC1A 3H7TA 2PGQB 1EPTA 3MTYA 4FXGH 3TIUA 1EZUC 1A46H 4GCHF 1GI5A 4X6MA 1A4WH 1MKWH 2OP9A 2A2XH 2Z6BD 1HAOH 1DLEA 2KCAA 4OS1A 4BTUB 1RXPA 4B6EA 3BTME 1O2GH 3PMAB 1UVOA 1BITA 4ZH8A 4YLUA 1GI9B 3OY6U 4ZKNU 2ZU5A 2WV4A 5GWZA 1XX9A 1TNHA 3FP7E 1B0FA 2BDIA 1GL0E 3TPIZ 3DSOA 2FPZA 3BIUH 2ZGHA 2DUCA 3MNCA 4MNXA 1QBOA 2HWLB 3H5CB 4B2BA 1AU8A 1ZJKA 2VWLA 3RXDA 1EZXC 2ZNKH 1FPHH 5DP4A 5TCCA 1GBTA 1PQAA 3LOXA 2CGAA 3VB6A 3A82A 2OC7A 4JK5A 4JYVH 2OQUA 3LU9B 3MU8A 4RT0A 1GJ9B 2ZG0H 2P8OB 4FOUC 1LVYA 1FIZA 5ESTE 1ELFA 2PKSB 3RXOA 1NRPH 3ATWA 4GHQA 2A4OA 2ZGJA 5K0HA 2VIWA 1E38B 2ZFRH 7GCHF 2A4QA 1N6YA 3NUMA 1GGDB 1YCPM 2ZU2A 3JZ2B 4RT1A 1P2NA 1EATA 2GJGA 1TYNA 5DG6A 2O8LA 5AFZH 1P06A 3GCHB 5F8TA 3U8RH 1W3CA 3NWUA 3SQEE 1NPMA 2H6MA 1ZRBA 2RDEA 3M5NA 4WH8A 2VVCA 3CS0A 2FI4E 4B6FA 2QCYA 1GPZA 1SGRE 1N1LA 1SLWB 1L1GA 4ZHAA 3STIA 3A8DA 3F1SB 1KXDA 3M37A 1GBLA 1SC8U 2D26C 1LPKB 4D7GA 2BY7X 1GJ6A 2P8OC 1NRRH 1C5OH 4FVDA 1GBCA 5CE1A 1QQUA 2HVXA 1O2RA 2PKSC 3A8AA 3BTGE 1UO6A 4E7NA 1J17T 5A0AE 2Z9LA 2WPLS 3SQHE 3FZDA 2G55A 1GGDC 1K28D 1TX7A 3UFAA 2IPHA 3F2FA 2NU2E 4ISHH 3BG8A 3K2UA 1WCZA 3D23A 1XMNB 7ESTE 1FY1A 4X0WU 1UHBA 3BF6H 1ACBE 3GCHC 4X1RU 1Z6JH 2CXVA 1ZHRA 1AZ8A 2FM2A 4MG3A 1IQHA 1W10U 5EPYA 1M9UA 1DY9A 1ZRKA 1XUFA 2F9VA 3SYJA 1PQ7A 1MD7A 1EP6A 2JIZD 1O39A 5F53A 1Z6EA 3SNEA 1GHAF 2HNTF 4YM9A 1XUHA 4XOJA 1HJAC 1TA6A 2AGIX 2ZHWH 1GBIA 5E2OA 1OKXA 2AMQA 2BOKA 3GY2A 1K0HA 1O2XA 7KMEH 3TGKE 4BAQB 5LPRA 1P9SA 1FONA 2XBXA 4K2YA 1C5LH 1GL1A 3LJJA 1P2QA 4INLA 2GT7A 3RXTA 1FLEE 1EPTB 1V2JT 1OWJA 1TX8A 1A2CH 4KGAA 1WTHD 2GCHF 5E0HA 1QY6A 1UVPA 3VB3A 5J4SA 1KIGH 1VCQA 4M9FA 1CO7E 1BHXF 1LKAA 2C8YB 1BTWA 3SW2B 3O8BA 1ID5H 1BA8B 1G3BA 1MCVA 3QGNB 1D9IA 4Y8YA 5AF9H 4TT3D 2EI6A 3MO3A 1O35A 2CMYA 1ZJDA 1TBQH 2BLVA 3HKJB 2UUJB 1UTMA 1XKAC 1B0EA 3FO8D 5E2PA 1FJSA 1ELTA 1MQ6A 3MOCA 2GP9B 4YO9A 4ASUD 3G01A 2ANYA 4YOIA 1MTVA 4E05H 1CSOE 4X2XA 2IN2A 3RXVA 2A4RA 1UVUH 3RXLA 8GCHF 4GLYA 4IMZA 2VH6A 1MAXA 2BDBA 3NCLA 1NN6A 1EPTC 5EJZA 4X1SU 4AB8A 1Z8IB 1RIWB 3A7VA 3RXIA 1IQFA 2ZGBH 1RFNA 1GBJA 1E79D 4DVAU 2B5TB 2CF9H 1QA0A 3UNQA 4Q7ZA 1AWFH 1C1QA 2KX4A 2Z94A 1EQ9A 1H8IH 1MTUA 3UOUA 1C5UA 4KP0A 1DWDH 2ZHFH 3LH1A 3NZIA 2XC4A 3WWFA 5JBTA 1F2SE 2V3OH 5CHBA 1NFWA 3OE7D 2KAIA 2A0QB 4Y0YE 1RTKA 3NXPA 4ACBA 2STAE 1XVOA 3EAJA 3K6ZA 2J2UA 1G2LA 1V2RT 3OTPA 4ZUHA 2V3HH 4F49A 1V2NT 3HATH 3K65B 1IQIA 5G4BA 3LONA 3ZZ7A 2BD8A 5T6DA 2M2AA 2ZPSA 1LMWB 1GMCF 5FX5A 1O31A 1SLXB 4X2VA 3PV5A 1K1MA 2VU8E 4I32A 4WJG2 2Q6GA 1RIWC 4NWLA 1OP8A 5KECA 3OAAD 5BRRE 1DSUA 2GDEH 4FUIA 4NFFA 1MABB 4Y7AA 1P01A 1QL9A 3S0NA 4DOQA 1RGQA 1UHBB 2HGTH 3D49H 5FL7D 3R3GB 1C1OA 3ODFA 4INKA 3ZZAA 2B7DH 4DURA 1IQMA 4Q80A 1L2EA 1O2HA 1GHBG 1MKXH 3SJOA 1EAIA 4MNWA 1QZ8A 5A8XA 4FUJA 1Z8RA 1JIMA 3ZZ5A 2ZHQH 4Q63A 1P9UA 2FTLE 2SGEE 1F0UA 4AGKA 1Y3WA 3CP7A 2R3UA 3TJOA 1ZPZA 4RI0A 3GYLB 1LVMA 2A5AA 3A7WA 3RXJA 5GXPA 3P6ZB 5ESBA 1AFEH 4MLFB 2ZC9H 2OBQA 3NKKA 2WPMS 1BCUH 1O3JA 3OEHD 4HTCH 3V7TA 1UK2A 3LKWA 1NESE 2VVVA 1HB0B 2GZ7A 1YY3A 3RDZA 4LK4A 1QJ6B 1QFKH 1UMAH 1W7XH 1P57B 2Z3CA 1O3EA 1SGQE 4J2YB 1NS3A 1HJ9A 1C5QA 1SI5H 2VIPA 4CRCA 5C1XA 3ZVCA 1V6DA 2ZU4A 3HGPA 1KMHB 4KTUA 4A1VA 4KELA 2O8WA 1ZHMA 3BTKE 1TNJA 1C2GA 4ISOA 4O9VA 1ELAA 6GCHF 1TPPA 1EOJA 3ZYEA 2FS9A 2ULLA 3GYMA 1P2JA 1ZSKA 2BVRH 2ZFSA 4AORA 1LHDH 2Y81A 4WF8A 3LGIA 5GIBA 5JBAS 3LH3A 3F2GA 1VITG 1OHHD 4ISLA 4F48B 3AW0A 2AYWA 4Z0KA 2PKAA 4CRBA 4CH2B 5KEDA 3GCTF 1CT2E 2STBE 1INCA 1CVWH 1PPCE 3RC6A 2FO9A 5A8ZA 3UTUH 1OS8A 1EXFA 3OY5U 3RM0H 3P70B 1FAKH 1GMDG 1MBMA 1TNIA 1UTJA 3LGWA 2GMTB 4NZQA 2FYQA 1T4VH 1ANCA 1BTPA 1XUKA 1O2TA 1C5TA 1NU7B 1FMGA 2R2MB 1G2MA 3KQBA 2O9QA 1HCGA 3WW7A 3A84A 1JOUB 2LP6A 2AIQA 4FUHA 4Y79A 5DKMA 1A7SA 2WUCA 4TY6A 2TGPZ 5EXNA 1TA2A 4X8SH 2C90B 2WYJA 3SI3H 4BANB 4JYUH 1W12U 5EW1H 3OYPA 3LC5A 3SU0A 3L33A 3KYFA 1PYTD 2BD9A 1MZDA 8KME2 4ZKOU 1O3DA 1AB9B 1ORFA 2XNDD 2ZDKA 1C5PA 3RMLH 3VB5A 3A88A 1SGCA 4Z1MD 1Z1IA 3W94A 3QK1A 2GZ9A 2KAIB 4AG2A 4ASHA 5GCHF 3GY5A 4WXIA 2SNVA 3T25A 1SBWA 3U8OH 5AVDA 9ESTA 4GSOA 4K69A 1H9LB 1O0DH 1UW7A 2ZEBA 2GMTC 3SGQE 2F9UA 3ATKA 2QXHA 4JZIA 3KHVA 1H8ED 4IS5A 3IG6B 2PR3A 2JH6D 4TY7A 4B2CA 2FOBA 2V0BA 1UCYH 1XKBC 3U28C 3KQEA 2QIQA 5JB9S 3W1EA 4D76A 1V2MT 4FU8A 1XM1A 5EXMA 1BIOA 1O37A 1BQYA 1C2FA 1GJAB 2ODYB 2ANMH 3GDUA 1RTFB 1GI3A 1IHSH 1DFPA 1Z8GA 2PSXA 1H8DH 2P95A 2V35A 1HIAA 3QX5H 1AB9C 1BMAA 5DP9A 4X2WA 3P8NA 1P04A 3TJNA 2R3YA 2FESH 3PWCA 1O2NA 1YPMH 1TALA 5J4QA 5AHGH 5HIYA 1ANBA 5KGOA 3ZVDA 4F55A 2VIOA 1QURH 1ARCA 2BZ6H 5C67A 1NRQH 2C93B 3Q3KA 2XBWA 2GZ8A 4MPWA 3VGCB 1S81A 3RXFA 3RXKA 4YESB 3RMNH 3PO1C 2BZAA 3D62A 5FPYA 3T62A 2D2DA 1TQ0B 3F0PA 1K1PA 1HDTH 1CE5A 1YPJH 1V2OT 3CS7A 3TJUA 3MI4A 1F5LA 1G9IE 1AN1E 2VGCB 2F9PA 2FWWA 6ESTA 2A31A 3TNSA 2QXGA 2FI5E 1BJVA 2D8WA 1HAXB 2H5CA 1DVAH 3PMJA 3M35A 2QF4A 1TB6H 4AFQA 1ZTLA 1C1MA 1AMHA 3ATMA 2ZF0H 3MU4A 4RN6A 2EA3A 1LVBA 2PKAB 2Z9GA 1ZLRA 1YCPK 3TJVA 4OS6A 3KYGA 5GJ4B 1W11U 4I7YH 1UTOA 4MPXA 1A5HA 2VIDA 3LJOA 2OC0A 1KXEA 1QIXB 3KN2A 2OBOA 2WPHS 1UVSH 3VGCC 2JH5D 1O5CB 2ZHDA 4Y6DA 1DT2A 5A8YA 1ARBA 4NIYA 3E1XB 2SGQE 1O5EH 1LPGB 3TH2H 1XUJA 1P05A 4P00A 1QBVH 3RC5A 2OK5A 2OC8A 2QA9E 1ELDE 1NU9A 1HAPH 1TGCA 5EJLA 2VGCC 4WH6A 1TRYA 1A0HB 4HI3A 3RXHA 1P10A 3P8GA 3SU4A 2JJ2D 5HMAA 4DY7B 2HLCA 2BDCA 2A45B 2BVXH 2J98A 2XC0A 3MO9A 2SGFE 2CJIA 2EY4C 3U69H 2FLBH 3F9EA 3GCOA 4NSYA 3BEUA 3AW1A 1GI4A 1HLTH 1GG6B 1O2LA 3GY6A 2XOKD 2GTBA 2ESTE 2OCVB 3BTDE 2BLWA 1GHXH 3S69A 1C5ZB 5L30H 2FS8A 3SO3A 2Y7XA 2CHAB 1BRCE 1BMFD 5JPMH 1D3QB 3URDA 2VINA 1SOTA 1U6QA 2H9HA 3SV8A 2BQ7B 1OX1A 1NC6A 1J15A 3IITA 2WPIS 3ZVGA 3SUDA 3S7KB 1T8LA 5T3HA 2P93A 4MQAA 2ZFFH 5HYOA 1ESTA 3PV2A 4Q7XA 2J9NA 1GDQA 4INHA 4K1SA 1AVWA 5DP7A 2FODA 1PPEE 1MTWA 1AVGH 1L0ZA 3M61U 2ZGXH 3M3SA 1HXEH 1LCYA 2J92A 2GV7A 1LTOA 2D1JA 1DXWA 1V2LT 1DWEH 1HIAB 4OGXA 1FI8A 3LGYA 2FOCA 4UDWH 5CMXH 1BZXE 1P3EA 2UUFB 1BBRK 1GG6C 5DSFA 1V2VT 1AI8H 1KLIH 1TGBA 1W0ZU 1FY3A 4XD7D 4NSVA 1NBMD 2ZPRA 2Q6FA 1A1RA 1SGFA 5FAHA 4XDEA 1C1UH 1QRWA 2CHAC 3MH6A 1LHCH 1SSXA 1OSSA 3KF2A 1D6RA 3PLBA 4FETA 1VR1H 1P8VC 4Y7BA 1GI0A 1PFXC 1Y5UT 2WPKS 2AFQB 1O30A 5HIZA 1HUTH 3DHKH 3DA9B 3FP6E 5EU8A 4D8NA 1FDPA 1WAYB 3NPSA 1OYQA 1VCPA 1CGHA 3UY9A 1RRKA 3EDXB 2PTCE 4PROA 5AFYH 8LPRA 1C9PA 1UTKA 2R2WU 1C2KA 2W7SA 1GHAG 3LDXH 3FANA 2KCPA 1DS2E 1HJAB 1QJ7B 1GCTB 3SGAE 3ZV8A 4CHAB 2Y6TA 2TGTA 1G36A 5DK1A 1C1WH 1KDQA 2ZDNA 1DLKB 2ZCKP 1YPGH 3A81A 4TPYA 4AC9A 4ZAEA 2G52A 1SB1H 1TX6A 7LPRA 5I25A 4R0IA 1TPAE 3RXBA 1H9IE 5IYTA 1O2SA 3E91A 1AE5A 2A7JA 2PFEA 4DW2U 4YT7H 1ZTKA 1DM4B 2F3CE 3K6YA 1O3MA 3SORA 1WBGB 2FZZA 4P02A 2XWBI 1V2QT 4AB9A 2J34A 4WMDA 2AEIH 1WSSH 1GHYH 3RXSA 3TITA 2JETB 1ZGVA 2PW8H 1AQ7A 4X6OA 4X8VH 3ZVAA 1P2IA 2W6JD 2ZGCA 5T1VA 1RS0A 2WUBA 3TK9A 1DE7H 1GI8B 2XCNA 2UUYA 1TGNA 2Z7FE 1OWKA 2RA0A 4NFEA 2GVFA 1K1OA 1C5VA 1GCTC 2J98B 3SGBE 2O8TA 4CHAC 3BTQE 2KCYA 3D65E 2P94A 2QYIA 1FIWA 4D9QA 2PP6A 3SU5A 2PWXA 3W95A 2K1QA 1THPB 4O03A 5FPSA 4O3UA 3ZYDA 8GCHG 2CK3D 3Q3XA 1C5RA 1P11E 1BUIA 4X1NU 3ZVFA 2M5TA 5E0JA 3IWMA 1FV9A 1TRMA 2SFAA 4UONA 1B7XB 1GI2A 3UR6A 4DIIH 1QL7A 1DY8A 2PUQH 1JXPA 1AZZA 3CNRA 1EZQA 4YTAA 4IMQA 3MNXA 1TONA 4DJZB 2ZO3H 2JETC 1D3PB 1FY8E 2QY0B 3A8CA 3QN7A 3A8BA 4UFEH 2A32A 1CA0B 2EEKA 2FX4A 2WV5A 2RFKC 1TPSA 3ZZDA 2ZFQH 3MH7A 4JMYA 2BX3A 2ZU3A 1IQNA 3QZRA 1UTNA 1O2IA 5K7RA 1V2ST 1BDAA 2THFB 3AK5A 1O3AA 4AFZA 4NIVA 3UQOA 2GX4A 1JRSA 1LVOA 1P2MA 1UTQA 4ISIH 3O8CA 5C20A 1EASA 2FOAA 2BMGB 3MU0A 1ZYOA 3QZQA 3RLYH 1ETTH 1OP0A 1UK3A 2QE7D 4YOJA 3SV9A 1UTPA 3DSPA 1K2I1 4QT8C 3OTJE 3FVFB 4NGAH 3T26A 1O2ZA 1YPKH 2C8WB 2QAAA 1BHXB 1TBZH 3MH4A 1C2LA 1Y3UA 3ATLA 2W3IA 2QC2A 4AZ2B 4RKJB 1NT1A 5F03A 4HG6A 5GDSH 1T8MA 1CA0C 4NA7A 4DG4A 1YP9A 5E0GA 2HNTC 4YZUA 1FZZA 2ZCLP 1O2MA 2XC5A 2ZI2H 4D9RA 1Q31A 2ZDMA 5FBEA 2HRVA 3DFJA 2XCFA 1L4ZA 3KQCA 1QL8A 1UK4A 4M7GA 1QB9A 1E36B 3QTVH 3MU5A 2RCEA 1ZMLA 1WV7H 2XNIA 3UREA 2WSSD 3AASA 1NRNH 3N7DA 1EX3A 5EXLA 4K8BA 3ZVBA 3O8DA 1GJCB 5HM2A 2ZHEH 3SV6A 2UWLA 2F43B 8ESTE 4NZLA 2CF8H 6GCHG 3UOPA 4B75A 1V2TT 2QV1A 1HFDA 3ZZ8A 1J16A 4NA8A 3EA9A 3KL6A 1QB6A 1G37A 1K1JA 4IN2A 4TYDA 3UNSA 2BOHB 5B6LA 2AH4X 4TSFD 1SL3A 1BOQA 1GMHG 3RXUA 3F9FA 3H09A 1HAGE 3M3TA 2YOLA 4I31A 2ZTXA 3SU6A 2UWPA 2BDYA 3PRBA 3NK8A 2ZA5A 1F7ZA 1SPJA 2GV6A 3A83A 4ACAA 1SHYA 3TVJB 2W26A 4B76A 4MPUA 3BTEE 1S83A 3UUZA 1TNKA 2AIPA 2BDHA 2YNBA 2O8MA 2VWNA 4SGBE 4K60A 3GY4A 4Q2KA 1A3EH 1L1NA 1VJAU 4CREA 2Z9IA 3M36A 4WMFA 3VXFH 4H42U 1SKYE 3S9AA 4A6LA 1AO5A 5C1UA 4ZMAH 3S9CA 4X1QU 1G3EA 5EQSA 2ZQ2A 3PM3A 2SGPE 3F9HA 1K1LA 1Y8TA 2H5DA 1TLDA 1VGCC 3PTNA 2OQ5A 2BVSH 5DP8A 5GPIB 1S0QA 1MBQA 1E1RD 2HOBA 2ILNA 4I8HA 3EE7A 5GCHG 4ABDA 2XRCA 1P02A 4CH8B 1XXDA 1G30B 1TIOA 1Y5BT 1OPHB 5L2YH 2ALPA 2QF0A 1C4V2 2H2ZA 4A1TA 1NZQH 2BXTH 3RXEA 3ZZCA 4BAHB 3HGNA 1GHBF 5LH8A 1FXYA 4NCYA 2P59A 1YPHC 3ESTA 4WMEA 2OLGA 3URCA 1SQAA 5C0UA 2BY8X 1DPOA 4D7FA 1O2PA 1C2JA 1OP2A 1ZMNA 4JK6A 3QLPH 1B5GH 1HRTH 1D4PB 3SJ9A 1FY5A 3RU4D 3P17H 2A7CA 4H4FA 5C94A 3E90B 1IHTH 2QXJA 3V0XA 1RJXB 6CHAB 3ZZ9A 2B0FA 2VJ1A 1SLUB 3LGVA 3A86A 3SU2A 1D3DB 1T8OA 3TU7H 1LQDB 3ZVEA 1ZGIA 1IQJA 2FDAA 1C1SA 1ELBA 2J5UA 4XSKU 1NRSH 4IBLH 2BY6X 3BEFB 3QDZB 3VB7A 4JYTA 4K8YA 3E0NB 1AIXH 4NIWA 4AGJA 3TGIE 3OEED 2NWNA 3UAIC 1YPEH 3SUGA 1ANDA 1QR3E 4F4OC 1EJMA 4A1XA 1O5AB 1JMOH 4MDSA 1O33A 2A4GA 1G3CA 1S0RA 1YBWA 3FZZA 1P09A 1F0RA 3PO1B 4ABGA 4KTCA 1MU6B 2PLXA 1MH0A 1O3GA 1WUNH 1QRXA 5EIYA 3PLPA 2H1UA 2HALA 4THNH 1S5SA 1K1NA 2OINA 3OSYA 4X6NA 3FAOA 3FFGA 1LO6A 1FAXA 3EQ0H 5FBIA 4K1EA 1P3CA 4SGAE 4FUEA 2TPIZ 5C5NA 6CHAC 1OXGA 2PV9B 1GVZA 3SUEA 1QB1A 1SQOA 4NWKA 1TRNA 5LPFA 1BRUP 1GDNA 2LNCA 1SFIA 4BNRA 2UWOA 4UFDH 1NM6A 1SGIB 1Q2WA 1C2MA 3DUXH 2Z3DA 1IQKA 4ABHA 2VIVA 2VWMA 3F2HA 5DN6D 1G3DA 2XBVA 3OU0A 1QBNA 4ISNA 4MNVA 4ZKRU 2P3FH 3A80A 3SJ8A 3TH3H 1P2OA 4BAMB 1BMLA 3E16B 2KCOA 3GDSA 4ZROA 1E35B 3BTHE 1DICA 2G51A 3LT3A 2DE9A 1A3BH 1O2QA 1ZSJA 3GY8A 4GVUA 3SN8A 3KIDU 1CGJE 3OFND 3SZNA 1DITH 4LXBH 4AOQA 2G4UA 1S6HA 3MH5A 4A5TS 2VWOA 2OXSA 4IW4E 2NU0E 3MQKC 1O3IA 3QUMP 2BQ6B 2WYGA 4JZEH 1SGDE 4XE4A 3T5FH 2BDAA 1C1PA 3LGUA 4ABFA 1EFRD 4FUBA 1GBBA 2G8TA 1OYTH 2ZCHP 1ELGA 2DE8A 2ANWA 2NU4E 1ESAA 3ITIA 5DP6A 3I78A 4UFGH 3E8LA 1P03A 1SGYE 1GCDA 2R9PA 1QA7A 4NG9H 1VZQH 2RG3A 4JZ1A 1C5SA 1IQGA 1ZMJA 4BAKB 2FTMA 1Y3VA 1C5MD 1PPHE 2R0LA 1AGJA 2ZTYA 1XUGA 4U32A 1TOMH 3KQDA 4GCHG 1GBDA 2K0QA 3MHWU 1TNGA 3SI4H 3LC3A 1DOJA 5FHTA 3C1KA 4XFQA 1TMUH 1GJ4H 3SU1A 1C2IA 4BAOB 2I6SA 2FOHA 1WQVH 2JKHA 1EP5A 4MVNA 2PGBB 1VCWA 2L6OA 3AAVA 4UE7H 2BHGA 1C2HA 2BD7A 1T7CA 2ZTZA 1YGCH 5C1YA 5C0TA 1PPGE 1VKYA 5F8XA 1ELEE 3KNXA 2VNTA 3V12A 3M7UA 5ETXA 1T4UH 5LGOA 1BTHH 3RLWH 2GCTB 2GKVE 1HAYB 2BXUH 1F5RA 1H4WA 2ZQ1A 1GDUA 2WV9A 3O8RA 1CHOF 1OWIA 1O34A 1Y3XA 3PROA 2ZFPH 1KXCA 1NROH 2F91A 4Y0ZE 4B74A 1ABIH 1EZSC 2J95A 1FY4A 2XWAA 1CBWB 5B6OA 1O3FA 3SNCA 3MU1A 1COWD 7GCHG 1W14U 4ZXXH
chains in the Genus database with same CATH topology
2P16A 3EA8A 4FU7A 5HXFA 1K21H 3T28A 3P8OA 1LKBA 3ENSB 1NY22 5EQRA 1FQ3A 4CR5A 1J9CH 2UUKB 1CHGA 3I29A 4U2WA 1DWBH 4Q7YA 5TCAA 2EI7A 3RXPA 1ZTJA 1LPZB 1GBKA 4GAWA 1KXAA 2SGDE 1O32A 1O5GH 3S9BA 3BTTE 2ZZUH 2G81E 1DDJA 5FX6A 1A61H 3E0PB 1HPGA 1GI6A 1RD3B 2GCTC 1DUEA 2BD5A 5ABWA 1YKTA 3HPTB 2LPRA 1K1IA 1MD8A 2ZP0H 5JDUB 1KY9A 2IOTA 4U01A 1D6WA 3HK6B 9LPRA 4GPGA 3PV4A 3PTBA 3T29A 5A2MH 1BT7A 4GUXA 2OD3B 5C3NA 2AERH 1PQ5A 1ELCA 3DT0H 2F83A 1VITH 5H4IB 1T32A 1CBWC 3M7TA 1GHZA 1QJ1B 2FI3E 4I8KA 3TGJE 1QNJA 3KGPA 1YM0A 1SGTA 4Y71A 1O2UA 3GY7A 3BSQA 5EOKA 1SOZA 1PPBH 3BG4B 1O36A 5C5OA 1H1BA 3EA7A 3E6PH 1PJPA 1MAYA 2BDGA 2A7HA 1HXFH 3Q3YA 1S82A 1Y5AT 1SMFE 3RXCA 1GI7B 1IQEA 1HNEE 2Y5GA 2JH0D 1IOEA 2B9LA 3SV2H 1V2WT 3TH4H 1RTLA 2OUAA 1G32B 3SOSA 1CA8B 1O3OA 1O2WA 3UWIA 1C2DA 4ABIA 1BRBE 2G5NA 2Y82A 1PPFE 1MKXK 5EGMA 3B8JA 1DANH 1SVPA 3SNBA 3M7QA 1AE8H 1AFQB 1MCTA 1T8NA 3SHCH 3E3TA 5TJXA 1AWHB 4YT6H 2GGVB 1MQ5A 1E37B 3EYDA 4FVBA 4XBDA 1O3CA 1T31A 1ZR0A 2HPPH 2FOGA 1SGFG 3GOVB 1FUJA 2C3SA 1GHWH 2GCHG 1L4DA 2XW9A 3BG4C 1E0FD 1XXFA 1PPZA 1AUJA 1OOKB 1MZAA 4ABJA 2A2QH 3RXMA 4BXSA 3PLKA 4Y10E 1O2YA 1E34B 3RMOH 2TIOA 4IGDA 2FP7B 2TGAA 5DJ7A 4X1PU 1MUEB 3RXRA 1BRAA 1EOLA 2A1DB 1EUFA 4LZ4B 2QN5T 4BTIB 2WINI 1ABJH 3VFEA 2GDDA 2FOEA 1C5NH 3PMBB 1NFUA 2J4IA 2OTVA 3UPEA 1TPOA 1TWXB 1OWDA 1C1NA 1ZSLA 1AFQC 2BY9X 1LHEH 3A7YA 1WOFA 1UTLM 1YYY1 1YCPH 4DIHH 1BBRE 4MPVA 4B73A 4ABEA 1QQ4A 3FP8E 3LIWA 1KLJH 1S6FA 1CU1A 1C5WB 4I33A 3GCNA 1AY6H 2TBSA 1V2KT 1P0SH 3ZZ4A 1DSTA 5LPEA 2F9NA 2NU3E 1IQLA 2W7UA 3STJA 1HBTH 3Q00A 3MWIU 4CBNA 5I46H 2CV3A 2QF3A 2BD2A 4Y8ZA 3L3TA 4I8LA 1C5XB 1SFQB 3A85A 2J94A 5FCRA 3AVZA 2VH0A 3MNSA 3MMGA 5DP3A 1V2PT 5EQQA 3A7TA 4I8GA 4X8TH 2H9EH 3HK3B 3BEIB 2BD4A 1TGSZ 5T6GA 2G4TA 1GMCG 1CQQA 3C27B 1AVXA 3P8FA 1N8OB 1EB2A 5FPTA 2EI8A 3PB1E 2SGAA 1P2KA 3F68H 3BN9A 3MO6A 2IJOB 1YF4A 2I6QA 2G00A 1HJ8A 3A7XA 2EC9H 2J38A 3U1IB 5EG4A 1W0YH 1GBAA 1N6XA 2ALVA 1S85A 1JBUH 1UCYK 4X8UH 1C4Y2 1C4U2 4TWYA 2AMDA 3P95A 2QXIA 1HGTH 1Z71A 4ABAA 4CBOA 3RMMH 1NFYA 2ZDVH 3T27A 1V3XA 4X2YA 4BXWA 1GBHA 4FUFA 4FUGA 1SHHB 3M5MA 1MTSA 1UVTH 3PWBA 3SNAA 3I77A 1NFXA 2XXLA 3UNRA 2Z9JA 1O3HA 3M5LA 3MNBA 4ZKSU 1O5FH 1ETSH 3SUFA 1C1TA 1KTSB 4TPIZ 1O38A 1AKSA 1KDQB 1BBRH 2HNTE 1AHTH 1H9HE 1BJUA 4AYVB 5JB8S 1N8OC 4DGJA 3KCGH 3PYHA 1O2OA 1HV7A 2AMPA 2VVUA 1LDTT 3TNTA 4J1YA 4WWYA 2ZU1A 3RXAA 2P3UB 1Z7KA 1TNLA 4OGYA 1QRZA 2Q6DA 3ELAH 1O2KA 2C4FH 2O8UA 4E06H 3QTOH 1KXBA 1W2KH 1ZZZA 5EODA 4AX9H 3RXQA 1FNIA 4FU9A 3VXEH 1SGPE 2G5VA 4MNYA 1VGCB 3SJIA 1OWEA 3ZZ6A 4Z6AH 1W8BH 2BM2A 1EAWA 2ZDAH 4VGCB 1FPCH 3WY8A 3TK5A 3V3MA 2YNAA 1EJNA 2FOMB 4AN7A 3GCTG 1O3BA 3Q76A 3A7ZA 2PUXB 3SNDA 4LZ1H 2BTCE 4WXVA 1P12E 2VB0A 4CR9A 1MTNB 1Y59T 1CT4E 4ZHLU 2XBYA 4I8JA 4U30A 4XBCA 3GICB 1TAWA 3R0FA 2PHBA 1BTUA 1BTZA 1J8AA 2HPQH 2BD3A 4JZDH 1NTPA 3GDVA 4OS7A 1V2UT 4ABBA 1DWCH 3DD2H 2TRMA 1BMNH 3ODDA 5BPEA 1TOCB 1ZPBA 1F92A 4AFSA 2RA3A 1TABE 2GT8A 4CRDA 1ZOMA 2C8ZB 1QHRB 3RP2A 1AD8H 1XUIA 4B1TA 4XBBA 2Y5HA 2FLRH 1MMJN 4LOYH 5A0CA 4Y76A 3RXGA 3SBKA 4VGCC 1UCYE 3UR9A 3RC4A 3KEEA 4KKDA 4IC6A 3QGJA 5EPNA 3U9AH 3K9XB 4IN1A 2AS9A 4AYYB 1W7GH 3ATIA 3P92A 5DP5A 2ZWLH 1MTNC 2FYRA 1LQEA 2QGRA 4JZFH 2XTTB 1MU8B 3BTFE 1YC0A 3B23B 2Q1JA 3EGKH 1GMHF 3N7OA 4KTSA 4R8TB 5A0BA 1XVMA 5DGJA 4X6PA 2FEQH 5IDKA 3RU4T 2BLOA 1KSNA 4H6TA 1DXPA 4MTBA 5SGAE 3RUOA 1WQSA 3ZZBA 3M3VA 3OX7U 1LHFH 1O5BB 1JIRA 1L1JA 3RU4E 1C1VH 1D3TB 1YLCA 4ZHMU 3JZ1B 3U1JB 1O5DH 1MKWK 3QO6A 3QWCH 3VEQB 4BTTB 3F6UH 4YOGA 1PYTC 1YPHE 2ODPA 2FXRA 4YLQH 1C1RA 3H7OA 3SHAH 2FX6A 2A5KA 1O3LA 1IAUA 1O2JA 1O3KA 1ESBA 3F9GA 1PQ8A 2RDLA 5JBBS 4DCDA 3ZV9A 4ZXYH 1GVKB 3EE0B 1JRTA 1JWTA 2F9OA 1F5KU 1GBEA 1HAVA 1GBFA 5L6NH 2GD4B 3RM2H 1SGNE 1CGIE 4Y8XA 1Q3XA 1SQTA 3LPRA 1Z1JA 1AKSB 4UFFH 2ZDLA 1VITF 4ESTE 4B2AA 4BOHA 5L2ZH 2BLQA 3V13A 1TMTH 1EAXA 5F6MA 2P3TB 3UIRA 1A5IA 2BX4A 2Y5FA 1SLVB 3BIVH 5PTPA 2WPJS 1DX5M 5EW2H 4K5ZA 1GMDF 1C2EA 2H9TH 4JCNA 2ZIQH 3LGTA 3PMHB 4NA9H 2AGEX 5F8ZA 4B71A 2W5EA 1QGFA 4H6SB 2AGGX 2XYAA 1BTXA 1VJ9U 5CHAB 1HAZB 1GJ5H 4RSPA 1K22H 3Q77A 2TGDA 5C2ZA 1O3PB 1FN6A 2BYAX 3GISB 5FCKA 4E7RG 1LHGH 1GWAA 1HAIH 2SNWA 1YLDA 5T6FA 1GHVH 1A0LA 1C5YB 1WU1A 3S7HB 4OS5A 3M5OA 1DUAA 3VB4A 1EB1H 1A5GH 1SGEE 3VPKA 5DPAA 3TK6A 3SU3A 3HKIB 1GI1A 1TE0A 1YPLH 3TLOA 2BQWB 3CENA 1A0JA 1HAHH 3ZZ3A 1UJ1A 1TMBH 1C9TA 5A09A 3SJKA 2W3KA 1SR5C 3U98H 6LPRA 2V6NA 1X7AC 5HGGA 1KLTA 3B9FH 3U8TH 4AFUA 3BV9B 1GVLA 2ANKH 4OS2A 1CHOG 3MYWA 5E8EH 1ANEA 2NU1E 5CHAC 4CRFA 1THRH 4A7IB 1GJ8B 1QTFA 4HGCA 4A92A 1KTTB 1ZHPA 5JYIA 1FN8A 1WTGH 2VIQA 1BMMH 3L6PA 1TBRH 1WYKA 1SG8B 2Z9KA 2FOFA 3A89A 2BY5X 1EKBB 4FUDA 4UEHH 1KXFA 1W13U 2F9BH 4O97A 2FIRH 3MFJA 2BB4A 1EJAA 1NO9H 4RKOB 1GJBB 1Y3YA 4GHTA 1OWHA 2ZKSA 1F0TA 4O3TA 5HM9A 1K9OE 2FMJA 2ZFTA 3BTWE 4AG1A 1F0SA 4NIXA 1AUTC 4DT7B 1O2VA 3T2NA 4TWWA 4UD9H 1ETRH 1THSH 4Y11E 3DFLA 4FUCA 4CRGA 4WVPE 1O3NA 1TQ7B 3GY3A 4OS4A 2ZPQA 1QCPA 4HFPB 2PSYA 5DO4H 1GJDB 1TFXA 1HYLA 2B8OH 1KYNA 5JBCS 2ASUB 2ZECA 1TGTA 1HAVB 1GJ7B 2CN0H 4K1TA 2ODQA 2Y7ZA 4IC5A 1ZPCA 2Z3EA 4WY3A 1CT0E 4CRAA 3SV7A 1EAUA 1J14A 2A5IA 3AAUA 1BB0B 2PTNA 3UQVA 1ELVA 2C8XB 4K3JA 5FXLA 4HZHA 1S84A 1BTYA 2R0KA 1GBMA 2Y80A 3UWJH 3A87A 1Z8JB 2OC1A 3H7TA 2PGQB 1EPTA 3MTYA 4FXGH 3TIUA 1EZUC 1A46H 4GCHF 1GI5A 4X6MA 1A4WH 1MKWH 2OP9A 2A2XH 2Z6BD 1HAOH 1DLEA 4OS1A 4BTUB 1RXPA 3BTME 1O2GH 3PMAB 1UVOA 1BITA 4ZH8A 4YLUA 1GI9B 3OY6U 4ZKNU 2ZU5A 2WV4A 5GWZA 1XX9A 1TNHA 3FP7E 1B0FA 2BDIA 1GL0E 3TPIZ 2FPZA 3BIUH 2ZGHA 2DUCA 3MNCA 4MNXA 1QBOA 2HWLB 3H5CB 4B2BA 1AU8A 1ZJKA 2VWLA 3RXDA 1EZXC 2ZNKH 1FPHH 5DP4A 5TCCA 1GBTA 1PQAA 3LOXA 2CGAA 3VB6A 3A82A 2OC7A 4JK5A 4JYVH 2OQUA 3LU9B 3MU8A 1GJ9B 2ZG0H 2P8OB 1LVYA 1FIZA 5ESTE 1ELFA 2PKSB 3RXOA 1NRPH 3ATWA 4GHQA 2A4OA 2ZGJA 5K0HA 2VIWA 1E38B 2ZFRH 7GCHF 2A4QA 1N6YA 3NUMA 1GGDB 1YCPM 2ZU2A 3JZ2B 1P2NA 1EATA 1TYNA 5DG6A 2O8LA 5AFZH 1P06A 3GCHB 5F8TA 3U8RH 1W3CA 3NWUA 3SQEE 1NPMA 2H6MA 1ZRBA 3M5NA 4WH8A 2VVCA 3CS0A 2FI4E 2QCYA 1GPZA 1SGRE 1N1LA 1SLWB 1L1GA 4ZHAA 3STIA 3A8DA 3F1SB 1KXDA 3M37A 1GBLA 1SC8U 2D26C 1LPKB 4D7GA 2BY7X 1GJ6A 2P8OC 1NRRH 1C5OH 4FVDA 1GBCA 5CE1A 1QQUA 2HVXA 1O2RA 2PKSC 3A8AA 3BTGE 1UO6A 4E7NA 1J17T 5A0AE 2Z9LA 2WPLS 3SQHE 3FZDA 2G55A 1GGDC 1K28D 1TX7A 3UFAA 2IPHA 2NU2E 4ISHH 3BG8A 3K2UA 1WCZA 3D23A 1XMNB 7ESTE 1FY1A 4X0WU 1UHBA 3BF6H 1ACBE 3GCHC 4X1RU 1Z6JH 2CXVA 1ZHRA 1AZ8A 2FM2A 4MG3A 1IQHA 1W10U 5EPYA 1M9UA 1DY9A 1ZRKA 1XUFA 2F9VA 1PQ7A 1MD7A 1EP6A 1O39A 1Z6EA 3SNEA 1GHAF 2HNTF 4YM9A 1XUHA 4XOJA 1HJAC 1TA6A 2AGIX 2ZHWH 1GBIA 5E2OA 1OKXA 2AMQA 2BOKA 3GY2A 1O2XA 7KMEH 3TGKE 4BAQB 5LPRA 1P9SA 1FONA 2XBXA 4K2YA 1C5LH 1GL1A 3LJJA 1P2QA 4INLA 2GT7A 3RXTA 1FLEE 1EPTB 1V2JT 1OWJA 1TX8A 1A2CH 4KGAA 1WTHD 2GCHF 5E0HA 1QY6A 1UVPA 3VB3A 5J4SA 1KIGH 1VCQA 1CO7E 1BHXF 1LKAA 2C8YB 1BTWA 3SW2B 3O8BA 1ID5H 1BA8B 1G3BA 1MCVA 3QGNB 1D9IA 4Y8YA 5AF9H 2EI6A 3MO3A 1O35A 2CMYA 1ZJDA 1TBQH 2BLVA 3HKJB 2UUJB 1UTMA 1XKAC 1B0EA 5E2PA 1FJSA 1ELTA 1MQ6A 3MOCA 2GP9B 4YO9A 3G01A 2ANYA 4YOIA 1MTVA 4E05H 1CSOE 4X2XA 2IN2A 3RXVA 2A4RA 1UVUH 3RXLA 8GCHF 4GLYA 4IMZA 2VH6A 1MAXA 2BDBA 3NCLA 1NN6A 1EPTC 4X1SU 4AB8A 1Z8IB 1RIWB 3A7VA 3RXIA 1IQFA 2ZGBH 1RFNA 1GBJA 4DVAU 2B5TB 2CF9H 1QA0A 3UNQA 4Q7ZA 1AWFH 1C1QA 2Z94A 1EQ9A 1H8IH 1MTUA 3UOUA 1C5UA 4KP0A 1DWDH 2ZHFH 3LH1A 3NZIA 2XC4A 5JBTA 1F2SE 2V3OH 1NFWA 2KAIA 2A0QB 4Y0YE 1RTKA 3NXPA 2STAE 1XVOA 3EAJA 3K6ZA 2J2UA 1G2LA 1V2RT 4ZUHA 2V3HH 4F49A 1V2NT 3HATH 3K65B 1IQIA 5G4BA 3LONA 3ZZ7A 2BD8A 5T6DA 2ZPSA 1LMWB 1GMCF 5FX5A 1O31A 1SLXB 4X2VA 1K1MA 2VU8E 4I32A 4WJG2 2Q6GA 1RIWC 4NWLA 1OP8A 5BRRE 1DSUA 2GDEH 4FUIA 4NFFA 4Y7AA 1P01A 1QL9A 3S0NA 4DOQA 1RGQA 1UHBB 2HGTH 3D49H 3R3GB 1C1OA 3ODFA 4INKA 3ZZAA 2B7DH 4DURA 1IQMA 4Q80A 1L2EA 1O2HA 1GHBG 1MKXH 3SJOA 1EAIA 4MNWA 5A8XA 4FUJA 1Z8RA 1JIMA 3ZZ5A 2ZHQH 1P9UA 2FTLE 2SGEE 1F0UA 4AGKA 1Y3WA 3CP7A 2R3UA 3TJOA 1ZPZA 3GYLB 1LVMA 2A5AA