3A81A

Crystal structure of trypsin complexed with (e)-4-((2-nicotinoylhydrazono)methyl)benzimidamide (soaking 8 hours)
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title In-Crystal Chemical Ligation for Drug Discovery
rcsb
molecule tags Hydrolase
molecule keywords Cationic trypsin
total genus 58
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2009-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3a81A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3a81A02
1HIAA 3E1XB 5A8ZA 1C1OA 2PTCE 2BYAX 1TOCB 1V2QT 2R9PA 3NUMA 3T25A 2TRMA 3DFJA 4UFDH 3SU4A 1OP8A 1XVMA 2G4UA 2OD3B 4IS5A 1A5IA 3LU9B 1YPJH 2UWLA 1P2KA 1AMHA 3RXMA 4FUDA 1C2KA 3PMHB 2RDLA 3ATLA 5DP8A 1GBMA 2XC0A 2VNTA 3ZV8A 1GVKB 5E2PA 2BB4A 1H8IH 1A4WH 4E06H 3A7YA 4ZAEA 1IQMA 1GMCF 2ZDKA 2ZHFH 2EA3A 4JCNA 2BOHB 2BDIA 4XDEA 1GGDB 1A5GH 3GY6A 3A8DA 1AZ8A 4ESTE 1PPFE 1S81A 1OS8A 1OWKA 1KLIH 2ZF0H 4B75A 2A5IA 3LONA 3MH7A 3MU4A 3Q76A 5E0HA 5FBEA 1N6XA 3MH6A 5EW2H 4NWKA 5HM2A 3S69A 4BAMB 1GBAA 5TJXA 1Y3UA 2BVXH 5ABWA 2W26A 1NRPH 3B8JA 8GCHF 1CHOF 1YLDA 2CGAA 3WY8A 1C2HA 3EDXB 4JZEH 3QWCH 4K8YA 1TPSA 1O2NA 2BY5X 3D23A 4GHQA 2J2UA 2OLGA 2BDCA 2C3SA 2FIRH 2OTVA 1OP0A 1TMBH 3HPTB 4X2YA 3S7HB 1UJ1A 1P2OA 1ZZZA 2I6QA 3ZZ9A 1AFEH 4NIVA 1V2PT 3TPIZ 3ZZBA 2B0FA 3NXPA 2H2ZA 3ATKA 7KMEH 6GCHG 5DP6A 4LK4A 1E37B 3ZV9A 1UK4A 1J15A 5H4IB 3LT3A 2G5VA 2JETC 3TNTA 1C1TA 3BF6H 1ACBE 1ZJDA 1TALA 2XBXA 2RA0A 5T3HA 4ZUHA 4BXSA 2GD4B 4OS1A 1GDQA 1GHAG 1TGTA 4FU7A 2PV9B 5AFZH 3FZDA 4ZKNU 3SNCA 1MZAA 1QJ6B 4AGJA 1GI7B 3MNSA 4X8TH 1A5HA 1A46H 3OYPA 4B73A 2XRCA 1LPGB 4NZLA 1Y59T 1O2GH 2GP9B 2QXJA 3BG4B 1ORFA 1NM6A 1O33A 3RU4T 1AD8H 3LJJA 3RXUA 1CSOE 3BN9A 1XUHA 4GPGA 1KXFA 4JYVH 1Y5AT 3PROA 4NG9H 3P92A 3FVFB 2AGEX 1DY8A 1LPKB 5EPYA 3RC4A 2PWXA 5HXFA 3SNEA 2Y5HA 4KTUA 3TGIE 3OU0A 1ZPCA 1XUKA 3T28A 1T32A 1DT2A 2VGCB 3ZVBA 3BTME 1K1LA 2GMTB 1YP9A 1GI3A 2ZCKP 4AYVB 3O8RA 2GV7A 3S9CA 1S82A 2FODA 1AVXA 4KTSA 2TIOA 2VU8E 4AORA 3M5NA 4FUJA 3MH5A 2BDGA 1TWXB 2BMGB 2ZWLH 3SZNA 3T29A 1C5YB 4NFEA 1O3NA 1O38A 1LPZB 2YNAA 3W94A 3C27B 3TJVA 2FS8A 4B2BA 1O5AB 2PSXA 1UTNA 1L0ZA 1AN1E 4BNRA 2GZ9A 1C2IA 2XBWA 2G00A 1GI6A 1QL8A 3ATWA 3QK1A 1UHBB 1O2JA 3D49H 2BLVA 1IHSH 1O2RA 1OP2A 1D6RA 1RTFB 3UR6A 5G4BA 5LPRA 2Z9KA 1DICA 3CS7A 3NWUA 4ABFA 1C2JA 1HFDA 1QRXA 4R0IA 2G5NA 7ESTE 1XUIA 3EGKH 1HAVA 2AMPA 2OP9A 3E0NB 1TNGA 3SNAA 4CH2B 1HJAC 1MKXK 1KXBA 1TRYA 1SGIB 1TNLA 3U8OH 4BAOB 2GZ7A 3SJ8A 1BDAA 3CS0A 2OCVB 1QCPA 1DSTA 6CHAC 3ATMA 3SUFA 4Y8YA 3TJUA 3HATH 1MKXH 2VWOA 2XBVA 1GBFA 1G3BA 2P16A 2WUCA 5GWZA 1LHDH 1LHFH 1OPHB 2JH5D 2ZDVH 3V0XA 3K6YA 1GMHG 7LPRA 3SOSA 2QXHA 1O0DH 1NU9A 2FOHA 3MNBA 3SQEE 4OS7A 3DHKH 1C5MD 2XCNA 5FBIA 4NIYA 1Q31A 2B7DH 1EAXA 3P8FA 2BLQA 1FUJA 3HKJB 2AERH 1YPHE 4JMYA 3U69H 1SGCA 2Y82A 2VIVA 5FPYA 3BTTE 1J14A 1XUGA 1K2I1 2HGTH 4X1NU 3RXHA 5AVDA 4B2CA 4TWYA 5GDSH 4DVAU 3NKKA 3DD2H 1LVBA 4MPWA 2ZGHA 3HK6B 2OC7A 2ZU2A 3QDZB 1L1JA 2FX6A 2O9QA 2QXGA 4CBNA 3SI4H 1V2UT 4NSVA 3GY4A 4JZ1A 2ZGXH 1GMDG 1B0EA 1Y3XA 4ABEA 1DWCH 2WPJS 2M5TA 1O3IA 1P11E 4YZUA 1HAPH 1C5TA 2PHBA 4AB9A 1H8DH 1ZMNA 3E0PB 2Z94A 1C1UH 1NS3A 1OYQA 2F9BH 3PTBA 5EQQA 1K1NA 4Y11E 4Y10E 5FCKA 1QB9A 2A5AA 4ISIH 3F9GA 2BVSH 4AGKA 1W7XH 2Q6GA 4CRBA 1TQ0B 2EI8A 2O8UA 2KAIB 1FNIA 3BG8A 1A3EH 3ZVCA 4ABJA 2G4TA 3LH3A 1E38B 1VCWA 4E05H 1ETRH 1XKAC 1KLJH 1C5LH 1W3CA 2QC2A 4O9VA 3SNDA 4WWYA 4ABAA 1P3EA 5JBCS 5F8TA 1KXDA 1Z8JB 1HYLA 3BTHE 1LO6A 2G55A 1GJCB 3ENSB 1DY9A 4ABDA 1QHRB 1HUTH 1C1WH 3E90B 5SGAE 1VGCB 1FN6A 1N8OB 4KP0A 4UFGH 1MBMA 2GMTC 2TGDA 1F0RA 4WY3A 4AN7A 1TX6A 3H7OA 1F5RA 1WTGH 1HJAB 1GL0E 2G8TA 2GZ8A 3GY5A 2Z7FE 2ZHDA 4K1SA 2D2DA 4A5TS 2HLCA 1SOZA 1C2MA 4E7NA 1SGPE 3BTGE 4ISHH 1Q2WA 3ZZDA 1G37A 1EAUA 4Q2KA 4YTAA 5LH8A 2SNWA 4B74A 5E0JA 1YCPM 5LGOA 1PPBH 1BRCE 3KN2A 1NFWA 2VVUA 1YC0A 2BD7A 1MKWH 1A0JA 1AY6H 2PKSB 1V2KT 4WXIA 1GJBB 1HJ8A 1S85A 4PROA 1QJ7B 1ZHRA 4B76A 1RTLA 4Y8XA 1TGCA 1ZTLA 3MYWA 1RGQA 2WYGA 1C5VA 1O5EH 4BTIB 1F2SE 4FUHA 1P2MA 4RN6A 2FTLE 8GCHG 1O32A 2FWWA 1O2TA 3SNBA 3STIA 1WSSH 3GDUA 4B71A 2FOFA 4YM9A 4I33A 1AQ7A 2Y7ZA 4Y0YE 4DG4A 1INCA 1DWEH 2FYRA 4ZROA 3SUEA 1Z6JH 1CA8B 1TMTH 2ANYA 3W95A 1KXAA 2ANMH 2FI4E 3U1JB 4GCHF 2BM2A 3BEUA 1Y5BT 1A0LA 2VGCC 1J16A 1XKBC 3MU8A 4UE7H 1PQ8A 1S84A 3MFJA 1ELTA 3LPRA 2ZDLA 1YLCA 1N6YA 5DO4H 5GPIB 4JZDH 4MG3A 1OWIA 2OC0A 1ZGVA 1NFYA 1W0ZU 3BEIB 1FN8A 2R3YA 1QBNA 2BVRH 4YOGA 1V2OT 2V3OH 3DUXH 2C8ZB 1G3EA 1Z7KA 2AS9A 2CN0H 4I32A 4MLFB 3L33A 4MNWA 1GHZA 4DCDA 3RXDA 1SL3A 1BJVA 1EAWA 1PQ7A 4IMQA 4FU8A 2FOMB 2RA3A 3TNSA 1A2CH 3GCHC 2Q1JA 1QURH 2HNTC 4UONA 2BTCE 2ZFRH 5A0CA 2P95A 3SV9A 1OWDA 1ANDA 3RMOH 3SJKA 1C2EA 4YESB 3Q3XA 4NSYA 2TPIZ 4WXVA 1DM4B 3EQ0H 2AFQB 2QY0B 4X1QU 5DP3A 5CMXH 1G2LA 1W10U 3U8TH 4FUFA 5ETXA 1T4UH 4A1VA 1V3XA 1JIMA 2PLXA 3HKIB 1IQEA 1EZSC 1BTYA 4TPIZ 2A31A 4A1XA 1GBKA 5FCRA 3G01A 3LOXA 1SC8U 2QAAA 3UOUA 1FV9A 1WAYB 1L1GA 1TNIA 1CO7E 2WPHS 3RXEA 1BMNH 2UUKB 4FXGH 2ANWA 1G30B 1EZQA 2I6SA 2O8TA 2XYAA 2TGTA 4NFFA 3PTNA 4K2YA 1P9SA 3RXQA 4INHA 3M7TA 3TVJB 4Y76A 5IDKA 2VIQA 4OS5A 2D8WA 1YPKH 1DLKB 4OGYA 4UD9H 3T5FH 2FOBA 1UTOA 1DSUA 1N1LA 1HCGA 1IQGA 2HPQH 1ZRKA 1BBRH 5DJ7A 1GJ7B 3P8GA 2OQUA 3UNQA 3AAUA 1K22H 1O3CA 5T6GA 4AFQA 2J95A 1GL1A 3LGIA 4NCYA 2R2WU 1YPMH 1TIOA 4GVUA 4D9QA 3EYDA 1WU1A 3BTKE 1FIWA 1Z71A 2F91A 2VIPA 3H7TA 2ZGCA 3VGCC 4CREA 5C1XA 2GGVB 2SGAA 2ZHWH 5AHGH 4YT7H 1F0TA 3F6UH 2XW9A 3LKWA 1SSXA 2ZDNA 1V2LT 1O3JA 1O2YA 1UHBA 2NU4E 1GI8B 1UVSH 1UTJA 2FLRH 1T8LA 2A4QA 4RKOB 2PTNA 4A92A 3ZZCA 3UWJH 1O3DA 1QA0A 1VZQH 4ASHA 1LHGH 1TA6A 3RM0H 4THNH 3VXFH 3SU6A 1ELEE 1EP5A 1W11U 3E16B 4UDWH 3SGQE 3ELAH 5A2MH 3E3TA 1V2VT 3Q00A 4H6TA 5C3NA 1FLEE 2GCTB 3DA9B 1JMOH 1TFXA 3A87A 1KTTB 1GJ9B 3QGNB 1HIAB 2ZCHP 2ZP0H 3KHVA 1GHBG 4TY6A 1ZMLA 1DOJA 4ZXYH 4H42U 2C4FH 3GCOA 2XTTB 5I46H 1P8VC 1X7AC 3OTJE 1O2SA 3ZYEA 5EXMA 1MD7A 3BTFE 1KYNA 4D76A 1GWAA 1AB9B 3ZZ7A 4D9RA 2AEIH 2EI7A 3M7UA 1NY22 3ZZAA 3BG4C 2BY7X 3RM2H 1FI8A 2Z3CA 2F9UA 5CHAC 3IWMA 1GDUA 1G36A 4OS2A 1EZXC 3D62A 1MTVA 1XX9A 2IOTA 2WPKS 5F03A 1TPAE 3LGTA 5GXPA 3RXKA 1AU8A 1QNJA 5A8YA 2O8LA 2ZPRA 2A7HA 1PPZA 1MCTA 1OSSA 1PQAA 5J4QA 5FAHA 5K0HA 3PLBA 1SMFE 2GT8A 1AE8H 3ZVDA 1NRRH 1LMWB 3SGBE 3GYMA 3GISB 3SJOA 1QIXB 1Z1IA 3KIDU 4O3UA 3UTUH 1P57B 3I77A 1P0SH 3BEFB 3TK9A 1C5RA 1YF4A 2C93B 1BIOA 4DIIH 3T27A 3U8RH 3TITA 1EP6A 1P03A 3A8AA 4Z0KA 4Q7YA 6LPRA 8LPRA 1IHTH 3M5LA 5E2OA 5JB8S 1THPB 4Q7XA 3KQCA 1NN6A 1L4DA 2D1JA 1ESBA 3M3VA 3P70B 3VXEH 1O3EA 1F5LA 2PKAA 2CF8H 1LDTT 2Y81A 3SHAH 2XC4A 4ZKRU 1GBBA 2BQ7B 3K6ZA 3FP6E 3GY2A 5C20A 4U30A 2PUXB 3RXSA 1LCYA 4ISOA 1D4PB 1ZPZA 1F0UA 5BPEA 2BD8A 1O30A 1UTQA 3TJNA 4MPVA 4ZKOU 1AFQC 2AGIX 4X1SU 1G3CA 2THFB 3KEEA 2BOKA 2W3IA 2AH4X 1ANCA 3T26A 1EOJA 3TH4H 2NU0E 2HPPH 1C1QA 4I31A 4DGJA 5EOKA 4SGAE 2VIOA 1A1RA 7GCHF 4K69A 4X8VH 4CHAB 1V6DA 3F9HA 2J4IA 1EKBB 2FI3E 2ZHEH 1YPEH 4TWWA 4LZ4B 4MDSA 2J34A 5JYIA 1LVOA 3A8CA 2OBOA 1C5QA 1V2MT 1TOMH 3PV4A 2H6MA 3A82A 1TGBA 1HLTH 3TU7H 2FOEA 2AYWA 5EXNA 4CH8B 1SBWA 4FU9A 4ISNA 2ZEBA 3IITA 2ZDMA 4HI3A 4X1RU 3OX7U 1K1IA 1IQJA 2XC5A 2DUCA 1D3PB 1FIZA 1AWHB 2R0KA 1AHTH 1XUFA 1EPTA 4WMDA 1KXCA 1MTUA 1FMGA 1P2QA 3FFGA 3QGJA 1O2ZA 1QTFA 1S0RA 1O5FH 1C1MA 4DJZB 3UNRA 3UNSA 3RXTA 3VB6A 3MH4A 1SOTA 4INKA 1MBQA 1C1RA 1BTWA 1GJ4H 4O03A 1SGNE 3QZQA 1ZR0A 3V13A 1AWFH 3ZZ8A 1V2JT 1UCYH 1GBIA 2PSYA 1GI4A 4JYUH 1H9LB 4VGCC 1EB1H 1SLVB 1QFKH 3M3TA 1RS0A 4E7RG 1ELAA 3KQDA 1XXFA 1TBQH 1Y3VA 2H9EH 5GJ4B 1MUEB 2CHAB 2F83A 3RXVA 4X6PA 4AFUA 1C1NA 1P2NA 2HOBA 1QB1A 1Y3WA 2XWBI 3ZVEA 2P94A 4F4OC 1MTNC 1SHYA 1HXFH 1GJ5H 3UIRA 8ESTE 3L3TA 4ZHMU 1GCTB 4K3JA 3UWIA 4I8KA 4HFPB 4Y7AA 3AAVA 2Z9IA 1TRMA 2A32A 3QLPH 2DE9A 2BD4A 1K9OE 4AFSA 2IN2A 3BTDE 1Q3XA 3MU1A 3GCTF 1HGTH 1IQFA 4WH8A 4GSOA 4X6NA 1WYKA 1C2FA 4K60A 1BRUP 2A2QH 4ZHAA 1Z8GA 4Z6AH 2R0LA 1RIWB 1Z6EA 1LVMA 1BTUA 3MU5A 4H6SB 2GV6A 4U2WA 4NIWA 2A1DB 1UCYK 1CGHA 5AF9H 4I8LA 1GI5A 4BANB 3VFEA 4NZQA 4D8NA 5JBTA 1W13U 1IQIA 3SU3A 2Y6TA 1GCTC 5E0GA 5K7RA 1F5KU 4TYDA 4CRAA 1CBWC 1EJMA 1MCVA 3TH2H 1BTPA 4MPXA 5T6FA 1CT2E 3Q77A 1EOLA 4DW2U 1ZGIA 4MNXA 5IYTA 3UY9A 4B2AA 1WQSA 2SGEE 3PWCA 1F0SA 4NA8A 3AVZA 1DE7H 1SFIA 1GHXH 2BD3A 1NROH 1AGJA 1SR5C 1H9HE 1RTKA 1THSH 1AB9C 4BAKB 4XFQA 1MD8A 1BMMH 4NA9H 4QT8C 3UQVA 1EPTC 1EASA 2Y7XA 3DFLA 1QB6A 1EJAA 3U1IB 1C1SA 2ZFFH 1MQ5A 1MAYA 1O2OA 3BIVH 2GTBA 3SO3A 1WQVH 2ODYB 3MOCA 5ESTE 7GCHG 1C5PA 5TCCA 1BMAA 2ZCLP 1ZHPA 3GDSA 4Q7ZA 1RD3B 1TX8A 3SN8A 1TPPA 3A7VA 2AGGX 2FZZA 2OQ5A 1O5CB 1ABJH 3AW1A 1P2JA 2XNIA 4GCHG 3SUDA 4ABIA 1TRNA 2EEKA 3P17H 2WV5A 3FP8E 3DT0H 2SGQE 4FUGA 1YM0A 1AUTC 2UWOA 3MWIU 1ELCA 2A45B 3RDZA 3GY3A 2BXTH 3QZRA 3AW0A 2NWNA 2FOCA 2AIPA 1O2MA 2P93A 2WV4A 1NO9H 3KQEA 1K1PA 3BV9B 1J9CH 4DT7B 2A4RA 2ZECA 1BT7A 5HYOA 5EW1H 2Z9GA 1MTWA 1SHHB 1S6FA 3EA8A 1DX5M 5DG6A 1FQ3A 4NGAH 4Y8ZA 2HNTF 1OKXA 3K65B 2ODQA 1FONA 1YKTA 2GKVE 5CHAB 1TBZH 3P8NA 3MHWU 1P2IA 1RFNA 2J9NA 3I78A 1NFXA 3A83A 3EA7A 5PTPA 4HGCA 1OYTH 3VB4A 3A80A 2ALPA 4WMEA 1ZJKA 2FX4A 1EUFA 1JOUB 1T8MA 3STJA 4YLUA 2FM2A 1NFUA 1SLUB 2ZTXA 1QL9A 1IQKA 1O2PA 1TQ7B 3RC6A 3QTVH 1SGRE 1ANEA 4GUXA 1VITG 1W7GH 4AZ2B 5EG4A 1D6WA 4HZHA 4U01A 4BAQB 1A61H 1OWEA 1AIXH 1GBEA 1QBOA 1AVWA 1A7SA 1THRH 1CT0E 1XXDA 3IG6B 1BRBE 2Y5GA 3SQHE 3NK8A 2BDAA 4AG2A 4CRGA 1O3LA 3SU5A 3SBKA 1SPJA 2FPZA 2FOAA 1L2EA 3UPEA 2V35A 5FX5A 2HWLB 1ZSJA 3VB7A 2CXVA 4IN2A 3MO9A 5FHTA 1HAOH 1D3QB 1CE5A 1O3BA 1DWDH 1MH0A 4FVDA 4TPYA 3GCNA 1KDQA 2ZPSA 3ODFA 3LC5A 1GGDC 1NC6A 4UFEH 1IQNA 1BTZA 2CMYA 3QN7A 3ITIA 1DPOA 2SFAA 3HGPA 1V2TT 4OS4A 3UREA 3RMLH 2W5EA 2BLWA 1T8OA 1QQ4A 2OBQA 1G32B 1UK3A 3TLOA 2ZKSA 4BAHB 1GI1A 4FUBA 3VB5A 1RJXB 2Z3EA 3LDXH 4X8UH 1E34B 2ZPQA 4J2YB 2A5KA 1NU7B 2ZO3H 2XWAA 4CRFA 5JDUB 4K1EA 1TABE 2EI6A 2HALA 3KNXA 5DPAA 5JPMH 1PPGE 3R0FA 5TCAA 1BMLA 3BTEE 4GLYA 1MKWK 4H4FA 1P01A 4ZHLU 4AYYB 4CBOA 3LGWA 4NIXA 1GJAB 2G52A 2Z9LA 1CQQA 5DP4A 1GMHF 1OXGA 2GDEH 1CA0B 1SLXB 4IGDA 3SUGA 5C5NA 4Y6DA 4LOYH 3OY6U 1HAYB 1T31A 3A7TA 3RXFA 1O36A 2QIQA 2WPLS 3H5CB 1UTMA 2QCYA 1EXFA 3RU4E 3QTOH 3A88A 3NPSA 1UK2A 2GCHG 2ZDAH 1DLEA 2ZIQH 4AG1A 2IPHA 4Q80A 1ZTKA 2F9OA 2ZG0H 4BXWA 5DK1A 2SGFE 1ELFA 1TYNA 4JZIA 5EGMA 2VB0A 4GHTA 1NPMA 1ZOMA 2FXRA 1XMNB 1P10A 3P95A 3U98H 3LGYA 4O3TA 2CV3A 1TNKA 1LKAA 2PW8H 1PYTC 1EPTB 1GHAF 2GX4A 1D3DB 1SGFA 2SGDE 4FUIA 1CT4E 1Z1JA 1GVLA 2ANKH 2QF0A 2ZZUH 2EC9H 1FY1A 1TNJA 1SFQB 1P09A 1C5OH 2OXSA 1K1OA 2IJOB 4M7GA 1W12U 2ZFQH 2P3UB 5EQSA 2VWLA 1C4V2 2SGPE 3T62A 3RLYH 2G81E 1JRSA 5ESBA 1DS2E 5HMAA 2F9PA 3ESTA 4A6LA 1C9TA 5L2YH 3A7XA 2QA9E 3KF2A 1ID5H 3QUMP 2BDBA 4YT6H 2RCEA 3SU1A 4KGAA 1TX7A 2HRVA 1B5GH 1MAXA 1W2KH 4ZH8A 1BTXA 5DP9A 2V0BA 1QY6A 1BBRE 2BY9X 2H1UA 1DFPA 1O3AA 2W3KA 3EA9A 2K1QA 3LC3A 1KLTA 3SV7A 1GMDF 5C67A 1H9IE 4XBBA 3S9BA 1ETSH 1MTSA 5A0BA 3RXRA 1C4U2 2FI5E 1HBTH 2PUQH 1HDTH 4Y0ZE 1UO6A 3KL6A 5AFYH 2A0QB 2J92A 1JRTA 4INLA 5FXLA 4X2XA 2FLBH 1C2GA 1O5BB 3CENA 3SW2B 1PPCE 1QR3E 3SHCH 4NA7A 3SJIA 4KTCA 1KTSB 1VJ9U 4A7IB 2WUBA 1KSNA 3HK3B 2JH0D 1QRZA 1O3HA 4MTBA 1GJ8B 2Y80A 3ODDA 3PMAB 1PYTD 1JXPA 2PKSC 3GY7A 4A1TA 1HRTH 1FY4A 4I8GA 2F9NA 5F6MA 1VJAU 3VEQB 2ZGJA 3GOVB 1BQYA 1LQEA 3UOPA 2VH0A 2VWNA 1O37A 3ATIA 1NTPA 1JWTA 2VVVA 1C5SA 1P12E 1UVUH 3GY8A 4JK6A 4XBDA 2G51A 1GI0A 4UFFH 1KDQB 2F9VA 4KKDA 2NU1E 2C8WB 2Y5FA 4MNVA 4TY7A 3O8CA 1A3BH 1T7CA 1HAXB 3NZIA 4X6OA 2BHGA 3KGPA 1EZUC 1ZMJA 3R3GB 1GCDA 1AO5A 2ZGBH 3M7QA 1GG6B 1CBWB 3RXJA 1O5DH 3A89A 1FDPA 1C5NH 1GBHA 1IOEA 1G9IE 1YPHC 4R8TB 2XXLA 1O3FA 3PYHA 4D7FA 2P3TB 1HAIH 1V2ST 1E35B 4F49A 3P8OA 1P3CA 1AUJA 5C1UA 5B6OA 1TGNA 2YOLA 1ARCA 2ZA5A 3V12A 2V3HH 3SV2H 1GBTA 2VJ1A 1CHGA 2BD5A 3RXAA 1E36B 3QX5H 2FTMA 1K21H 5JBAS 2Z9JA 2GCHF 1U6QA 2CJIA 1ZYOA 1ESTA 2GVFA 5JBBS 4BTUB 1AKSB 3FAOA 4CHAC 5T6DA 3RXPA 3ZZ6A 2A7JA 1FXYA 4JYTA 1JIRA 4OGXA 1PFXC 2QYIA 8KME2 2CHAC 5DKMA 3BIUH 3M61U 4MVNA 1IQLA 1HNEE 4FVBA 4DOQA 4SGBE 1O2WA 1DXPA 1C2LA 1EB2A 2ILNA 1HAGE 1H4WA 2BLOA 1P05A 1T8NA 3GICB 4ZKSU 1EATA 3SORA 2KAIA 1CA0C 2HNTE 3M3SA 1O3MA 4OS6A 5DGJA 3E8LA 5EQRA 3RUOA 5E8EH 1CVWH 1OWJA 3FP7E 1O3GA 1LTOA 1BOQA 3A85A 2WINI 1QQUA 2ZNKH 1P04A 1GDNA 3RU4D 2V6NA 1P06A 2SNVA 1O2QA 2A4GA 2OINA 5C1YA 5FPTA 3ZVFA 1YCPK 1DUAA 3B23B 5JB9S 2BY8X 2TGPZ 1ZLRA 3SV6A 1C5XB 1ELGA 1PPHE 1C2DA 3F9FA 2VIWA 1W14U 1DWBH 5HGGA 4XBCA 1PPEE 4FUEA 2BQWB 2FESH 4UEHH 1YPLH 1SGDE 3PO1C 1C4Y2 3SU2A 1SQTA 2ZTZA 1RXPA 3EAJA 1LHCH 1OX1A 3MU0A 2PFEA 3VGCB 3LJOA 1D3TB 1S5SA 2UWPA 1QJ1B 4IBLH 2ZFSA 3O8DA 4DIHH 2B5TB 2H5CA 1UTKA 1HAHH 2Q6DA 3B9FH 5BRRE 4RSPA 1DVAH 4VGCB 1LQDB 1J17T 4WVPE 4O97A 4LZ1H 3RMNH 3P6ZB 4ISLA 1QL7A 1SGYE 2WPMS 3Q3YA 3E91A 1PJPA 1HXEH 1EX3A 1TNHA 2ZU5A 2DE8A 3FZZA 6GCHF 2VINA 3ZZ3A 1UVOA 3RXBA 3MO6A 1VITH 2O8WA 1XUJA 3JZ1B 1WOFA 1SLWB 3TK6A 2C8YB 4B1TA 3PM3A 3C1KA 1B7XB 5HM9A 1O35A 1V2WT 1KY9A 1TE0A 1KIGH 2BDHA 3URCA 3MNXA 5LPFA 3VB3A 2AMQA 1W8BH 2FYQA 3OY5U 1BRAA 2LPRA 1L4ZA 1GG6C 1YCPH 2ZC9H 3ZZ4A 4ABHA 5C5OA 1UVPA 2WPIS 1RIWC 1AE5A 2ZFPH 3ZYDA 2XBYA 1TONA 2Z3DA 1HJ9A 1UMAH 4AFZA 3UQOA 1ABIH 3S0NA 3GCTG 2LNCA 1JBUH 2PKAB 4X2VA 1GJ6A 2A4OA 2VWMA 4X0WU 1GHYH 1KXEA 3A86A 1GBLA 2ZU1A 2STAE 3Q3KA 1P9UA 4WJG2 1HPGA 1LHEH 3E6PH 3TGKE 3F1SB 2FP7B 1FAXA 2BDYA 1NZQH 3MO3A 1HB0B 1VCQA 1ZTJA 4K8BA 4XOJA 1BHXB 4J1YA 1V2NT 9ESTA 2ZQ1A 1SI5H 3I29A 4DURA 1OOKB 1O3PB 1C1PA 2B8OH 2BX3A 3SJ9A 1UVTH 2A7CA 1NRQH 2B9LA 3PO1B 3L6PA 5EPNA 3S7KB 3AASA 1BCUH 4DY7B 3BSQA 3TGJE 5F8ZA 1FJSA 4XSKU 1VGCC 4IW4E 1RRKA 5L6NH 1BHXF 1HAZB 1TAWA 4KELA 3LGUA 1GMCG 2ZU3A 5GCHF 1NT1A 1M9UA 3MTYA 2D26C 1VITF 3URDA 1N8OC 3TK5A 1SGTA 3BTQE 4AX9H 1V2RT 1MQ6A 4MNYA 3A7WA 3GYLB 1CGIE 3LH1A 3EE0B 4YLQH 4AB8A 2TGAA 1ETTH 4CR9A 1FZZA 2QGRA 1BB0B 2ZHQH 1UCYE 1T4VH 1BBRK 3UFAA 2VH6A 3ZZ5A 1YGCH 2ZQ2A 3K2UA 4IC5A 5FPSA 5A0AE 2RG3A 1BZXE 1ZHMA 3T2NA 2PGBB 1WBGB 5C2ZA 3K9XB 4NWLA 1C5WB 1HV7A 1O39A 1Y3YA 1YBWA 1O31A 4K5ZA 1L1NA 2P8OB 2VVCA 5J4SA 4AOQA 1NRSH 1E0FD 3RXCA 4JK5A 2VIDA 1FY8E 1WCZA 4JZFH 1GBJA 2HVXA 1A0HB 2JH6D 1O5GH 2NU3E 3M5MA 1TA2A 2FDAA 5DP7A 1J8AA 3VPKA 3RMMH 1EJNA 1O2UA 1MZDA 3SGAE 3ZVGA 1DXWA 4IN1A 1GI9B 1S0QA 5L30H 3HGNA 2AIQA 3PMJA 2TBSA 1GHWH 1BUIA 1FPHH 2OC1A 1GBCA 1TB6H 3U9AH 1AFQB 1CU1A 1Z8RA 4CRDA 1ZPBA 5A8XA 5FX6A 3TIUA 3A81A 2ULLA 1GVZA 2ESTE 1SG8B 4CRCA 5LPEA 2C90B 1VR1H 3M37A 2GCTC 4MPUA 3BTWE 1ELVA 3LIWA 4I8HA 1QA7A 5GCHG 1H1BA 4Y79A 2P8OC 3F68H 1ANBA 1TPOA 2CF9H 1DANH 1YYY1 1ZRBA 3O8BA 1O34A 2QF3A 3MNCA 2ZI2H 2NU2E 2J38A 3CP7A 1DITH 1HAVB 1UTPA 1ARBA 2STBE 6CHAB 2OUAA 2R3UA 1G3DA 1EAIA 1G2MA 1O2KA 2F3CE 2QXIA 1WTHD 2FS9A 1ESAA 2QN5T 2BD9A 4WF8A 2BXUH 1NRNH 1CHOG 2Q6FA 2Z6BD 3KCGH 3MMGA 4ABGA 2UUYA 2UUFB 4U32A 4MQAA 1FPCH 3PWBA 4BOHA 3QO6A 1XVOA 4WMFA 1D9IA 4D7GA 1O3OA 2FO9A 1TMUH 1S6HA 3S9AA 2ZFTA 1MMJN 2R2MB 1W0YH 4HTCH 1O2IA 1S83A 1SGEE 2BX4A 1EQ9A 1O3KA 2H9TH 1GHVH 3LGVA 3OSYA 5A09A 1DUEA 9LPRA 5F8XA 4ZMAH 6ESTA 5EXLA 3RXGA 4I7YH 2O8MA 3UUZA 4I8JA 3RP2A 1SVPA 2XCFA 3M36A 1AKSA 1IQHA 1F7ZA 2BZ6H 1IAUA 1FY3A 1SGFG 4XE4A 1ZSKA 1XM1A 2QV1A 4IMZA 1ELDE 1AI8H 1WUNH 2FEQH 2JETB 2PGQB 2AMDA 3SV8A 2OC8A 2P59A 3D65E 1YPGH 3NCLA 1B0FA 5DP5A 5EU8A 1K1MA 1UTLM 3SI3H 4FUCA 3PLPA 3A8BA 3N7OA 2UUJB 1TBRH 4ABBA 1K1JA 2YNBA 1SB1H 2FOGA 3M5OA 1FY5A 1ELBA 5L2ZH 2BY6X 1TGSZ 1LKBA 2ODPA 3A7ZA 1MU8B 4CR5A 1GJDB 2W7UA 2GT7A 3GDVA 3PMBB 1O2HA 2H9HA 1SQOA 5GIBA 2J94A 4X1PU 5EODA 4YOJA 1TLDA 2H5DA 3RC5A 4RKJB 4X2WA 1SGQE 1GI2A 3M35A 1C5UA 4BTTB 1ZSLA 4K1TA 4Y71A 1SQAA 3ZVAA 5CE1A 3A84A 1LVYA 4Y7BA 1Y8TA 1GBDA 2P3FH 3RLWH 1BITA 3JZ2B 3KQBA 1MTNB 1GHBF 2ZU4A 3SU0A 2C8XB 1MU6B 1AZZA 1GPZA 1F92A 1NESE 1Y5UT 4X8SH 1QBVH 2BZAA 3GCHB 1C5ZB 1VCPA 2FMJA 4LXBH 4GAWA 4YO9A 1BJUA 2PR3A 3FANA 2GDDA 1AVGH 3F9EA 4IC6A 2BQ6B 1P02A 2WYJA 1QGFA 5I25A 3V7TA 2ASUB 1PQ5A 1FAKH 1C1VH 1WV7H 3RXLA 1K28D 4X6MA 2W7SA 3PB1E 1OWHA 1O2VA 3TJOA 2ALVA 4WH6A 3UR9A 3PLKA 1Z8IB 1O2XA 2ZTYA 1BA8B 4ZXXH 3RXOA 3V3MA 1DDJA 2A2XH 2JKHA 1C9PA 3MI4A 4YOIA 1QRWA 3RXIA 1CGJE 1O2LA 1BTHH 3TH3H 2BD2A
chains in the Genus database with same CATH superfamily
1HIAA 3E1XB 5A8ZA 1C1OA 2PTCE 2BYAX 1TOCB 1V2QT 2KFWA 2R9PA 3NUMA 3T25A 2TRMA 1YWUA 3DFJA 4UFDH 3SU4A 1OP8A 1XVMA 2G4UA 2OD3B 4IS5A 1A5IA 3LU9B 1YPJH 2UWLA 1P2KA 1AMHA 3RXMA 4FUDA 1C2KA 3PMHB 2RDLA 2WPDD 3PV5A 3ATLA 4XD7D 5DP8A 1GBMA 2XC0A 2VNTA 3ZV8A 1GVKB 5E2PA 2BB4A 1H8IH 3OAAD 2EQNA 1A4WH 4E06H 3A7YA 4ZAEA 1IQMA 1GMCF 2ZDKA 2ZHFH 2EA3A 4JCNA 2BOHB 2BDIA 4XDEA 1GGDB 1A5GH 2J5UA 3GY6A 3A8DA 1AZ8A 4ESTE 1PPFE 1S81A 1OS8A 1OWKA 1KLIH 2ZF0H 4B75A 2A5IA 3LONA 3MH7A 3MU4A 3Q76A 5E0HA 5FBEA 3WWBA 1N6XA 3MH6A 5EW2H 4NWKA 5HM2A 3S69A 4BAMB 1GBAA 5TJXA 1Y3UA 2BVXH 5ABWA 3WWFA 2W26A 1NRPH 3B8JA 8GCHF 1CHOF 1YLDA 2CGAA 3WY8A 1C2HA 3EDXB 4JZEH 3QWCH 4K8YA 1TPSA 1O2NA 1COWD 2BY5X 3D23A 4GHQA 2J2UA 2OLGA 1WDIA 2BDCA 2C3SA 2FIRH 2OTVA 1OP0A 1TMBH 3HPTB 4X2YA 3S7HB 1UJ1A 1P2OA 1ZZZA 2I6QA 3ZZ9A 1AFEH 4NIVA 1V2PT 3F3BA 3TPIZ 3ZZBA 2B0FA 4P00A 3NXPA 2H2ZA 3ATKA 7KMEH 5CDFE 6GCHG 5DP6A 4LK4A 1E37B 3ZV9A 1UK4A 5CHBA 1J15A 5H4IB 3LT3A 2G5VA 2JETC 3TNTA 1C1TA 3BF6H 1ACBE 1ZJDA 1TALA 4B6EA 2XBXA 2RA0A 5T3HA 4ZUHA 4BXSA 2GD4B 4OS1A 1GDQA 1GHAG 1TGTA 4FU7A 2PV9B 2V3MA 5AFZH 3FZDA 4ZKNU 3SNCA 1MZAA 1QJ6B 4AGJA 1GI7B 3MNSA 4X8TH 1A5HA 1A46H 3OYPA 4B73A 2XRCA 1LPGB 4NZLA 1Y59T 1O2GH 2GP9B 2QXJA 3BG4B 1ORFA 1NM6A 1O33A 3DSGA 3RU4T 1AD8H 3LJJA 3RXUA 1CSOE 3BN9A 1XUHA 4GPGA 1KXFA 4JYVH 1Y5AT 3PROA 4NG9H 3P92A 5EJZA 3FVFB 2AGEX 1DY8A 1LPKB 5EPYA 3RC4A 2PWXA 5HXFA 3SNEA 2Y5HA 4KTUA 3TGIE 3OU0A 1ZPCA 1XUKA 3T28A 1T32A 1DT2A 2VGCB 3ZVBA 3BTME 1K1LA 2GMTB 1YP9A 1GI3A 2ZCKP 4AYVB 3O8RA 2GV7A 3S9CA 1S82A 2FODA 1AVXA 4KTSA 2TIOA 2KX4A 2VU8E 4AORA 3M5NA 4FUJA 3MH5A 2BDGA 1TWXB 2BMGB 2ZWLH 3SZNA 3T29A 1C5YB 4NFEA 1O3NA 1O38A 1LPZB 2YNAA 3W94A 3C27B 3TJVA 2FS8A 4B2BA 1O5AB 2PSXA 1UTNA 1L0ZA 4ACAA 1AN1E 4BNRA 2GZ9A 1C2IA 2XBWA 2G00A 1GI6A 1QL8A 3ATWA 3QK1A 1UHBB 1O2JA 3D49H 2BLVA 1IHSH 1O2RA 1OP2A 1D6RA 1RTFB 3UR6A 5G4BA 5LPRA 2Z9KA 1DICA 3CS7A 3NWUA 4ABFA 1C2JA 1HFDA 1QRXA 4R0IA 2G5NA 7ESTE 1XUIA 3EGKH 1HAVA 2AMPA 2OP9A 3E0NB 1TNGA 4FETA 3SNAA 4CH2B 1HJAC 3FOAA 1MKXK 1KXBA 1TRYA 1SGIB 1TNLA 3U8OH 4BAOB 2GZ7A 3SJ8A 3SZEA 1BDAA 3CS0A 2OCVB 1QCPA 1DSTA 3FKSD 6CHAC 3ATMA 3SUFA 4Y8YA 3TJUA 3HATH 1MKXH 2VWOA 2XBVA 1GBFA 1G3BA 2P16A 2WUCA 5GWZA 1LHDH 1LHFH 1OPHB 2JH5D 2ZDVH 3V0XA 3K6YA 1GMHG 7LPRA 3SOSA 2QXHA 1O0DH 2JIZD 1NU9A 4DT4A 2FOHA 3FN8A 3MNBA 3SQEE 4OS7A 3DHKH 1C5MD 2XCNA 5FBIA 4NIYA 1Q31A 2B7DH 1EAXA 3P8FA 2BLQA 1FUJA 3HKJB 2AERH 1YPHE 4JMYA 3U69H 1SGCA 2Y82A 2VIVA 5FPYA 3BTTE 2KCAA 1J14A 1XUGA 1K2I1 2HGTH 4X1NU 3RXHA 5AVDA 4B2CA 4TWYA 2EY4C 5GDSH 4DVAU 3NKKA 2RFKC 3DD2H 1S6LA 2W6JD 1LVBA 4MPWA 2ZGHA 3HK6B 2OC7A 2ZU2A 3QDZB 1L1JA 2FX6A 3F2FA 2O9QA 2QXGA 4CBNA 3SI4H 1V2UT 4NSVA 3GY4A 4JZ1A 2ZGXH 1GMDG 1B0EA 1Y3XA 1NBMD 4ABEA 1DWCH 2WPJS 2M5TA 1O3IA 1P11E 4YZUA 1HAPH 1C5TA 2PHBA 4AB9A 1H8DH 1ZMNA 3E0PB 2Z94A 1C1UH 1NS3A 1OYQA 2F9BH 3PTBA 5EQQA 1K1NA 4Y11E 4Y10E 5FCKA 1QB9A 2A5AA 4ISIH 3F9GA 3F2GA 1YLNA 2BVSH 4AGKA 1W7XH 2Q6GA 4CRBA 1TQ0B 2EI8A 2O8UA 2KAIB 1FNIA 3BG8A 1A3EH 3ZVCA 4ABJA 2G4TA 3LH3A 1E38B 1VCWA 4E05H 1ETRH 1XKAC 1KLJH 1C5LH 1W3CA 2QC2A 4O9VA 3SNDA 4WWYA 4ABAA 1P3EA 5JBCS 5F8TA 1KXDA 1Z8JB 1HYLA 3BTHE 1LO6A 2G55A 1GJCB 3ENSB 1DY9A 4ABDA 2J98A 1QHRB 1HUTH 1C1WH 3E90B 5SGAE 1MABB 1VGCB 1FN6A 1N8OB 4KP0A 4UFGH 1MBMA 2GMTC 2TGDA 1F0RA 4WY3A 5F53A 1TX6A 3H7OA 1F5RA 1WTGH 4AN7A 1HJAB 1GL0E 2G8TA 2GZ8A 3GY5A 2Z7FE 2ZHDA 4K1SA 2D2DA 2J97A 4A5TS 2HLCA 2KZ4A 1SOZA 1C2MA 4E7NA 1SGPE 2IPQX 3BTGE 4ISHH 1Q2WA 3ZZDA 1G37A 1EAUA 4Q2KA 4YTAA 5LH8A 2SNWA 4B74A 3N7EA 5E0JA 1YCPM 5LGOA 1PPBH 1BRCE 3KN2A 1NFWA 2M2AA 2VVUA 1YC0A 2BD7A 1MKWH 1A0JA 1AY6H 2PKSB 1V2KT 4WXIA 1GJBB 1HJ8A 1S85A 4PROA 1QJ7B 1ZHRA 1QZ8A 4B76A 1RTLA 4Y8XA 1TGCA 1ZTLA 3MYWA 1RGQA 2WYGA 1C5VA 1O5EH 4BTIB 5DN6D 1F2SE 4FUHA 1P2MA 4RN6A 2FTLE 8GCHG 1O32A 2FWWA 1O2TA 3SNBA 3STIA 1WSSH 3GDUA 4B71A 2FOFA 4YM9A 4I33A 1AQ7A 2Y7ZA 4Y0YE 4DG4A 1INCA 1UW7A 1DWEH 2FYRA 4ZROA 3SUEA 1Z6JH 1CA8B 2CK3D 1TMTH 2ANYA 3W95A 1KXAA 2ANMH 2FI4E 3U1JB 4GCHF 2BM2A 2PP6A 3BEUA 1Y5BT 1A0LA 1J16A 2VGCC 1XKBC 3MU8A 4UE7H 1PQ8A 1S84A 3MFJA 1ELTA 3LPRA 2ZDLA 1YLCA 1N6YA 5DO4H 5GPIB 4JZDH 4MG3A 2WZQA 1OWIA 2OC0A 1ZGVA 1NFYA 1W0ZU 3BEIB 1FN8A 2R3YA 1QBNA 2BVRH 4YOGA 1V2OT 2V3OH 3DUXH 2C8ZB 1G3EA 1Z7KA 2AS9A 2CN0H 4I32A 4MLFB 3L33A 4MNWA 1GHZA 4DCDA 5HIYA 3RXDA 1SL3A 1BJVA 1EAWA 1PQ7A 4IMQA 4FU8A 2FOMB 2RA3A 2LP6A 3TNSA 1A2CH 3GCHC 2Q1JA 1QURH 2HNTC 4UONA 2BTCE 2ZFRH 5A0CA 1H8HD 2P95A 3SV9A 1OWDA 1ANDA 3RMOH 3SJKA 1C2EA 4YESB 3Q3XA 4NSYA 2TPIZ 4WXVA 1DM4B 3EQ0H 2AFQB 2QY0B 4X1QU 5DP3A 5CMXH 1G2LA 3H09A 1W10U 5HIZA 4RT0A 4FUFA 3U8TH 5ETXA 3N99A 1T4UH 4A1VA 1V3XA 1JIMA 2PLXA 3HKIB 1IQEA 3OTPA 1EZSC 1BTYA 4TPIZ 2A31A 4A1XA 1GBKA 5FCRA 3G01A 3LOXA 1SC8U 2QAAA 3UOUA 1FV9A 1WAYB 4ZCNA 1L1GA 2LELA 1TNIA 1CO7E 2WPHS 3RXEA 1BMNH 2UUKB 4FXGH 5C0TA 2ANWA 1G30B 1EZQA 2I6SA 2O8TA 2TGTA 2XYAA 4NFFA 3PTNA 4K2YA 2HVYB 1P9SA 3RXQA 4INHA 3M7TA 3TVJB 4Y76A 5IDKA 2VIQA 3WW7A 4OS5A 2D8WA 1YPKH 1DLKB 2W6ID 4OGYA 4UD9H 3T5FH 2FOBA 1UTOA 1DSUA 1N1LA 3F0OA 1HCGA 1IQGA 2HPQH 1ZRKA 1BBRH 5DJ7A 1GJ7B 3P8GA 2OQUA 3UNQA 3AAUA 1K22H 1O3CA 5T6GA 3VG8A 4AFQA 2J95A 1GL1A 3LGIA 4NCYA 2R2WU 1YPMH 1TIOA 4GVUA 4D9QA 3EYDA 1WU1A 3BTKE 1FIWA 1Z71A 2F91A 2VIPA 3H7TA 2ZGCA 3VGCC 4CREA 5C1XA 2GGVB 2SGAA 2ZHWH 5AHGH 2RDEA 4YT7H 1F0TA 3F6UH 2XW9A 3LKWA 1SSXA 2ZDNA 3MQKC 1V2LT 1O3JA 1O2YA 1UHBA 2NU4E 1GI8B 1UVSH 1UTJA 2FLRH 1T8LA 2A4QA 4RKOB 2PTNA 4A92A 3ZZCA 3UWJH 3DCLA 1O3DA 1QA0A 1VZQH 4ASHA 1LHGH 1TA6A 3RM0H 4THNH 3VXFH 3SU6A 1ELEE 1EP5A 1W11U 3E16B 4UDWH 3SGQE 3ELAH 5A2MH 3E3TA 1V2VT 3Q00A 4H6TA 5C3NA 1FLEE 2GCTB 3DA9B 1JMOH 1TFXA 3A87A 1KTTB 1GJ9B 3QGNB 1HIAB 2ZCHP 2ZP0H 3KHVA 1GHBG 4TY6A 1ZMLA 1DOJA 4ZXYH 4H42U 2C4FH 3GCOA 2XTTB 5I46H 1P8VC 1X7AC 3OTJE 1O2SA 3ZYEA 5EXMA 1MD7A 3BTFE 1KYNA 4D76A 1GWAA 1AB9B 2XNDD 3ZZ7A 1E79D 4D9RA 2AEIH 2EI7A 3M7UA 1NY22 3ZZAA 3BG4C 2BY7X 3F0PA 3W1EA 3RM2H 5B6LA 1W0KD 1FI8A 2Z3CA 2F9UA 5CHAC 3IWMA 1GDUA 1G36A 4OS2A 4ASUD 1EZXC 3D62A 1MTVA 1XX9A 2IOTA 2WPKS 5F03A 1TPAE 3LGTA 5GXPA 3RXKA 1AU8A 1QNJA 5A8YA 2O8LA 2ZPRA 2A7HA 1WXRA 3AK5A 1PPZA 1MCTA 1OSSA 1PQAA 5J4QA 5FAHA 2GJGA 5K0HA 3PLBA 1SMFE 2GT8A 1AE8H 3ZVDA 1NRRH 1LMWB 3SGBE 3GYMA 3GISB 3SJOA 1QIXB 1Z1IA 3KIDU 4O3UA 3UTUH 1P57B 3I77A 1P0SH 3BEFB 3TK9A 1C5RA 1YF4A 2C93B 5EIYA 1BIOA 4DIIH 3T27A 3U8RH 3TITA 1EP6A 1P03A 3A8AA 4Z0KA 4Q7YA 6LPRA 8LPRA 1IHTH 3M5LA 5E2OA 5JB8S 1THPB 4Q7XA 3KQCA 1NN6A 1L4DA 2D1JA 3OE7D 1ESBA 3M3VA 3P70B 3VXEH 1O3EA 1F5LA 2PKAA 2CF8H 1LDTT 2Y81A 3SHAH 2XC4A 4ZKRU 1GBBA 2BQ7B 3K6ZA 3FP6E 3GY2A 5C20A 4U30A 2PUXB 3RXSA 1LCYA 4ISOA 1D4PB 2WV9A 1ZPZA 1F0UA 5BPEA 2BD8A 1O30A 5C94A 1UTQA 3TJNA 4MPVA 4ZKOU 1AFQC 2AGIX 4X1SU 1G3CA 2THFB 3KEEA 2BOKA 5HKKD 2W3IA 4Z1MD 2AH4X 1ANCA 3T26A 1EOJA 3TH4H 2NU0E 2HPPH 1C1QA 4I31A 4DGJA 5EOKA 4SGAE 2VIOA 1A1RA 7GCHF 4K69A 4X8VH 4CHAB 1V6DA 3F9HA 2J4IA 1EKBB 2FI3E 2ZHEH 1YPEH 4TWWA 4LZ4B 3N7DA 4MDSA 2J34A 2QF5A 5JYIA 1LVOA 3A8CA 2OBOA 1C5QA 1V2MT 1TOMH 3PV4A 2H6MA 3A82A 1TGBA 1HLTH 3TU7H 2FOEA 2AYWA 2YMSB 5EXNA 4CH8B 1SBWA 4FU9A 4ISNA 2ZEBA 3IITA 2ZDMA 4HI3A 4X1RU 3OX7U 1K1IA 1IQJA 2XC5A 2DUCA 1D3PB 1FIZA 1AWHB 2R0KA 1AHTH 1XUFA 1EPTA 4WMDA 1KXCA 1MTUA 1FMGA 1P2QA 3FFGA 3QGJA 1O2ZA 1QTFA 1S0RA 1O5FH 1C1MA 4DJZB 3UNRA 3UNSA 3RXTA 3VB6A 3MH4A 1SOTA 4INKA 1MBQA 1C1RA 2KM0A 1BTWA 1GJ4H 4O03A 1SGNE 3QZQA 1ZR0A 3V13A 1AWFH 3ZZ8A 1V2JT 2JJ1D 1UCYH 1GBIA 2PSYA 1GI4A 4JYUH 1H9LB 4VGCC 1EB1H 1SLVB 1QFKH 3M3TA 1RS0A 4E7RG 1ELAA 3KQDA 5KEDA 1XXFA 1TBQH 1Y3VA 2H9EH 5GJ4B 1MUEB 2CHAB 2F83A 3RXVA 4X6PA 4AFUA 1C1NA 1P2NA 2HOBA 1QB1A 1Y3WA 2XWBI 3ZVEA 2F43B 2P94A 4F4OC 1MTNC 1SHYA 1HXFH 1GJ5H 3UIRA 8ESTE 3L3TA 4ZHMU 2KCYA 1GCTB 4K3JA 3UWIA 4I8KA 4HFPB 4Y7AA 3AAVA 2Z9IA 1TRMA 2A32A 3QLPH 2DE9A 2BD4A 1K9OE 4AFSA 2IN2A 2WHXA 3BTDE 1Q3XA 3MU1A 3NRLA 3GCTF 1HGTH 1IQFA 4WH8A 4GSOA 4X6NA 1WYKA 1C2FA 1KMHB 4K60A 3OEHD 1BRUP 2A2QH 4ZHAA 1Z8GA 4Z6AH 2R0LA 1RIWB 1Z6EA 1LVMA 1BTUA 3MU5A 4H6SB 2GV6A 4U2WA 1VKYA 4NIWA 2A1DB 1UCYK 1CGHA 5AF9H 4I8LA 1GI5A 4BANB 3VFEA 4NZQA 4D8NA 5JBTA 1W13U 1IQIA 3SU3A 1GCTC 2Y6TA 5E0GA 1FX0B 5K7RA 1F5KU 4TYDA 4CRAA 1CBWC 1EJMA 1MCVA 3TH2H 1BTPA 4MPXA 5T6FA 1CT2E 3Q77A 1EOLA 4DW2U 1ZGIA 4MNXA 5IYTA 3UY9A 4B2AA 1WQSA 2SGEE 3PWCA 1F0SA 4NA8A 3AVZA 1DE7H 1SFIA 1GHXH 5C17A 2BD3A 1NROH 1AGJA 1SR5C 1H9HE 1RTKA 1THSH 1AB9C 4BAKB 4XFQA 1MD8A 4I86A 1BMMH 4NA9H 4P02A 4QT8C 3UQVA 1EPTC 1EASA 2Y7XA 3DFLA 1QB6A 1EJAA 3U1IB 1C1SA 2ZFFH 1MQ5A 3PV2A 1MAYA 1O2OA 3BIVH 2GTBA 3SO3A 1WQVH 2ODYB 3MOCA 5ESTE 7GCHG 1C5PA 5TCCA 1BMAA 2ZCLP 1ZHPA 3GDSA 4Q7ZA 1RD3B 4ACBA 1TX8A 3SN8A 1TPPA 3A7VA 2AGGX 2FZZA 2OQ5A 1O5CB 1ABJH 3AW1A 1P2JA 2XNIA 4GCHG 2JJ2D 3SUDA 4ABIA 1TRNA 3PRDA 2EEKA 3P17H 2WV5A 3FP8E 3DT0H 2SGQE 4FUGA 1YM0A 1AUTC 2UWOA 3MWIU 1ELCA 2A45B 3RDZA 3GY3A 2BXTH 3UAIC 3QZRA 3AW0A 2NWNA 2FOCA 2AIPA 1O2MA 2P93A 2WV4A 1NO9H 3KQEA 1K1PA 3BV9B 1J9CH 4DT7B 2A4RA 2ZECA 1BT7A 5HYOA 5EW1H 2Z9GA 1MTWA 1SHHB 1S6FA 3EA8A 1DX5M 5DG6A 1FQ3A 4NGAH 4Y8ZA 2HNTF 1OKXA 3K65B 2ODQA 1FONA 2OK5A 1YKTA 2JDID 2GKVE 5CHAB 1TBZH 3P8NA 3MHWU 1P2IA 1RFNA 2J9NA 4F55A 3I78A 1NFXA 3A83A 3EA7A 5PTPA 4HGCA 1OYTH 3VB4A 3A80A 2ALPA 4WMEA 1ZJKA 2FX4A 1EUFA 1JOUB 1T8MA 3STJA 4YLUA 2FM2A 1NFUA 1SLUB 2ZTXA 1QL9A 1IQKA 1O2PA 1TQ7B 3RC6A 3QTVH 1SGRE 1ANEA 4GUXA 1VITG 1W7GH 4AZ2B 5EG4A 1D6WA 4HZHA 4U01A 4BAQB 1A61H 1OWEA 1AIXH 1GBEA 1QBOA 4F48B 1AVWA 1A7SA 1THRH 1CT0E 1XXDA 3IG6B 1BRBE 2Y5GA 3SQHE 3NK8A 2BDAA 1NBME 4AG2A 4CRGA 1O3LA 3SU5A 3SBKA 1SPJA 2FPZA 2FOAA 3PRBA 1L2EA 3UPEA 2V35A 5FX5A 1K0HA 2HWLB 1ZSJA 3EE7A 3VB7A 2CXVA 4IN2A 3MO9A 5FHTA 1HAOH 1D3QB 1CE5A 1O3BA 1DWDH 1MH0A 4FVDA 4TPYA 3GCNA 4XRNA 1KDQA 2ZPSA 3ODFA 3LC5A 1GGDC 1NC6A 4UFEH 1IQNA 4TSFD 1BTZA 1E1QD 2CMYA 3QN7A 3ITIA 1DPOA 2SFAA 3HGPA 1V2TT 4OS4A 3UREA 3RMLH 2W5EA 2BLWA 1T8OA 1QQ4A 2OBQA 1G32B 1UK3A 3TLOA 2ZKSA 4BAHB 1GI1A 4FUBA 3VB5A 1RJXB 2Z3EA 3LDXH 4X8UH 1E34B 2ZPQA 4J2YB 2A5KA 1NU7B 2ZO3H 2XWAA 4CRFA 5JDUB 4K1EA 1TABE 2EI6A 2HALA 3KNXA 5DPAA 5JPMH 1PPGE 3R0FA 3CNRA 5TCAA 1BMLA 3BTEE 4GLYA 1MKWK 4H4FA 1P01A 4ZHLU 4AYYB 4CBOA 3LGWA 4NIXA 1GJAB 2G52A 2Z9LA 1CQQA 5DP4A 1GMHF 1OXGA 2GDEH 1CA0B 1SLXB 1YY3A 4IGDA 3SUGA 5C5NA 4Y6DA 4LOYH 3OY6U 1HAYB 1T31A 2AHME 3A7TA 3RXFA 1O36A 2QIQA 2WPLS 2KR7A 3H5CB 1UTMA 2QCYA 1EXFA 3RU4E 3QTOH 3A88A 3NPSA 1UK2A 2GCHG 2ZDAH 1DLEA 2ZIQH 3UB0A 4AG1A 2IPHA 4Q80A 1ZTKA 2F9OA 2ZG0H 4BXWA 5DK1A 2SGFE 1ELFA 1TYNA 4JZIA 5EGMA 2VB0A 4GHTA 1NPMA 1ZOMA 2FXRA 4M9FA 1XMNB 1P10A 3P95A 3U98H 3LGYA 4O3TA 2YMSC 2CV3A 1TNKA 1LKAA 2PW8H 1PYTC 1EPTB 5KGOA 1GHAF 2GX4A 1D3DB 1SGFA 2SGDE 4FUIA 1CT4E 1Z1JA 1GVLA 2ANKH 2QF0A 2ZZUH 2EC9H 1FY1A 1TNJA 1SFQB 1P09A 1C5OH 2OXSA 1K1OA 1SKYE 2IJOB 4M7GA 1W12U 2ZFQH 2P3UB 5EQSA 2VWLA 1C4V2 2SGPE 3T62A 3RLYH 2G81E 1JRSA 5ESBA 1DS2E 5HMAA 2F9PA 3ESTA 4A6LA 1C9TA 5L2YH 3A7XA 2QA9E 3KF2A 1BMFD 1ID5H 3QUMP 2BDBA 4YT6H 2RCEA 3SU1A 4KGAA 1TX7A 2HRVA 1B5GH 1MAXA 1W2KH 4ZH8A 1BTXA 5C0UA 5DP9A 2V0BA 1QY6A 1BBRE 2BY9X 2H1UA 1DFPA 1O3AA 5FL7D 2W3KA 3EA9A 2K1QA 3LC3A 1KLTA 3SV7A 1GMDF 5C67A 1H9IE 4XBBA 3S9BA 1ETSH 1MTSA 5A0BA 3RXRA 1C4U2 2FI5E 1HBTH 1E1RD 2PUQH 1HDTH 4Y0ZE 1UO6A 3KL6A 5AFYH 2A0QB 2J92A 1JRTA 4INLA 3OFND 5FXLA 4X2XA 5KECA 2FLBH 1C2GA 1O5BB 3CENA 3SW2B 1PPCE 1QR3E 3SHCH 4NA7A 2KCPA 5GNDA 4KTCA 3SJIA 4YXWD 1KTSB 1VJ9U 4A7IB 2WUBA 1H8ED 1KSNA 3HK3B 2JH0D 1QRZA 1O3HA 4MTBA 1GJ8B 2Y80A 2YMSD 3ODDA 3DSOA 3PMAB 1PYTD 1JXPA 2PKSC 3GY7A 4A1TA 1HRTH 1FY4A 4I8GA 2F9NA 5F6MA 1VJAU 3VEQB 2ZGJA 3GOVB 1BQYA 1LQEA 3UOPA 2VH0A 2VWNA 1O37A 3ATIA 1NTPA 1JWTA 2VVVA 5T1VA 1C5SA 1P12E 1UVUH 3GY8A 4JK6A 4XBDA 2G51A 1GI0A 4UFFH 1KDQB 2F9VA 4KKDA 2NU1E 2C8WB 2Y5FA 4MNVA 4TY7A 3O8CA 1A3BH 1T7CA 1HAXB 3NZIA 2L6OA 4X6OA 2BHGA 3KGPA 1EZUC 1ZMJA 3R3GB 1GCDA 1AO5A 3DSPA 2ZGBH 3M7QA 1GG6B 1CBWB 3RXJA 1O5DH 3A89A 1FDPA 1C5NH 1GBHA 1IOEA 1G9IE 1YPHC 4R8TB 2XXLA 1O3FA 3PYHA 4D7FA 2P3TB 1HAIH 1V2ST 1E35B 4F49A 3P8OA 1P3CA 1AUJA 5C1UA 5B6OA 1TGNA 2YOLA 1ARCA 2ZA5A 3V12A 2KCOA 2V3HH 3SV2H 1GBTA 2VJ1A 1CHGA 2BD5A 3RXAA 1E36B 3QX5H 2FTMA 1K21H 5JBAS 2Z9JA 2GCHF 1U6QA 2CJIA 1ZYOA 1ESTA 2GVFA 5JBBS 4BTUB 4Q63A 1AKSB 3FAOA 4CHAC 5T6DA 3RXPA 3ZZ6A 2A7JA 1FXYA 4JYTA 1JIRA 4OGXA 1PFXC 2QYIA 8KME2 2CHAC 5DKMA 2V7QD 3BIUH 3M61U 4MVNA 1IQLA 1HNEE 4FVBA 4DOQA 4SGBE 1O2WA 1DXPA 1C2LA 1EB2A 2ILNA 1HAGE 1H4WA 2BLOA 1P05A 1T8NA 3GICB 4ZKSU 1EATA 3GS9A 3SORA 2KAIA 1CA0C 2HNTE 3M3SA 1O3MA 4OS6A 5DGJA 2QF4A 3E8LA 5EQRA 3RUOA 5E8EH 1CVWH 1OWJA 3FP7E 1O3GA 1LTOA 1BOQA 3A85A 2WINI 1QQUA 2ZNKH 1P04A 1GDNA 3RU4D 2V6NA 1P06A 2SNVA 1O2QA 2A4GA 2OINA 5C1YA 5FPTA 3ZVFA 1YCPK 2L74A 1DUAA 3B23B 5JB9S 4RI0A 2BY8X 2TGPZ 1ZLRA 3SV6A 1C5XB 1ELGA 1PPHE 1C2DA 3F9FA 2VIWA 1W14U 1DWBH 5HGGA 4XBCA 1PPEE 4FUEA 2BQWB 2FESH 4UEHH 1YPLH 1SGDE 2F4LA 3PO1C 1C4Y2 3SU2A 1SQTA 2ZTZA 1RXPA 3EAJA 1LHCH 1OX1A 3MU0A 2PFEA 4RT1A 3VGCB 3LJOA 1D3TB 1S5SA 2UWPA 1QJ1B 4IBLH 2ZFSA 3O8DA 3OEED 4DIHH 2B5TB 2H5CA 1UTKA 1HAHH 2Q6DA 3B9FH 5BRRE 4RSPA 1DVAH 4VGCB 1LQDB 1J17T 4WVPE 4O97A 3FO8D 4LZ1H 3RMNH 3P6ZB 4ISLA 1QL7A 1SGYE 2WPMS 3Q3YA 3E91A 1PJPA 1HXEH 1EX3A 1TNHA 2ZU5A 2DE8A 3FZZA 6GCHF 2VINA 3ZZ3A 1UVOA 3RXBA 3MO6A 1VITH 2O8WA 1XUJA 3JZ1B 1WOFA 1SLWB 3TK6A 2C8YB 4B1TA 3PM3A 3C1KA 1B7XB 5HM9A 1O35A 1V2WT 1KY9A 1TE0A 1KIGH 2BDHA 3URCA 3MNXA 5LPFA 3VB3A 2AMQA 1W8BH 2FYQA 3OY5U 1BRAA 2LPRA 1L4ZA 1GG6C 1YCPH 2ZC9H 3ZZ4A 4ABHA 5C5OA 1UVPA 2WPIS 1RIWC 1AE5A 2ZFPH 3ZYDA 2XBYA 1TONA 2Z3DA 1HJ9A 1UMAH 4AFZA 4TT3D 3UQOA 1ABIH 3S0NA 3GCTG 2LNCA 1JBUH 2PKAB 4X2VA 1GJ6A 2A4OA 2VWMA 4X0WU 4HG6A 1GHYH 1KXEA 3A86A 1GBLA 2ZU1A 2STAE 3Q3KA 1P9UA 2IJD1 4WJG2 1HPGA 1LHEH 3E6PH 3TGKE 3F1SB 4Q4LA 2FP7B 1FAXA 2BDYA 2XOKD 1EFRD 1NZQH 5DSFA 3MO3A 1HB0B 1VCQA 1ZTJA 4K8BA 4XOJA 1BHXB 4J1YA 1V2NT 9ESTA 2ZQ1A 1SI5H 3I29A 4DURA 1OOKB 1O3PB 2VBCA 1C1PA 2B8OH 2BX3A 3SJ9A 1UVTH 2A7CA 1NRQH 2B9LA 3PO1B 3L6PA 5EPNA 3KYFA 3S7KB 3AASA 1BCUH 4DY7B 3BSQA 3TGJE 5F8ZA 1FJSA 4XSKU 1VGCC 4IW4E 1RRKA 5L6NH 1BHXF 1HAZB 1TAWA 4KELA 3LGUA 1GMCG 2ZU3A 5GCHF 1NT1A 1M9UA 3MTYA 2D26C 1VITF 3URDA 1N8OC 3TK5A 1SGTA 3BTQE 2K0QA 4AX9H 1V2RT 1MQ6A 4MNYA 3A7WA 3GYLB 1CGIE 3LH1A 3EE0B 4YLQH 4AB8A 2TGAA 1ETTH 4CR9A 1FZZA 2QGRA 1BB0B 2ZHQH 1UCYE 1T4VH 1BBRK 3UFAA 2VH6A 3ZZ5A 5IK2D 1YGCH 2ZQ2A 3K2UA 4IC5A 5FPSA 5A0AE 2RG3A 1BZXE 1ZHMA 3T2NA 2PGBB 1WBGB 5C2ZA 3K9XB 4NWLA 1C5WB 1HV7A 1O39A 1Y3YA 1YBWA 1O31A 4K5ZA 1L1NA 2P8OB 2VVCA 5J4SA 4AOQA 1NRSH 1E0FD 3RXCA 2K8IA 2VIDA 4JK5A 1FY8E 1WCZA 4JZFH 1GBJA 2HVXA 3SYJA 1A0HB 2JH6D 1O5GH 2NU3E 3U28C 3M5MA 1TA2A 2FDAA 5DP7A 1J8AA 3VPKA 3RMMH 1EJNA 1O2UA 1MZDA 3SGAE 3ZVGA 4B6FA 1DXWA 4IN1A 1GI9B 1S0QA 5L30H 3HGNA 2AIQA 3PMJA 2TBSA 1GHWH 1BUIA 1FPHH 3KQ5A 2OC1A 1GBCA 1TB6H 3U9AH 1AFQB 1CU1A 1Z8RA 4CRDA 1ZPBA 5A8XA 5FX6A 3TIUA 3A81A 2ULLA 1GVZA 2ESTE 1SG8B 4AC9A 4CRCA 5LPEA 2C90B 1VR1H 3M37A 3ZIAD 2GCTC 4MPUA 3BTWE 1ELVA 3LIWA 4I8HA 1QA7A 5GCHG 1H1BA 4Y79A 2P8OC 3F68H 1ANBA 1TPOA 2CF9H 1DANH 1YYY1 1ZRBA 3O8BA 1O34A 1W0JD 2QF3A 3MNCA 5EJ1A 2ZI2H 2NU2E 2J38A 3CP7A 1DITH 1HAVB 1UTPA 1ARBA 2STBE 6CHAB 2OUAA 2R3UA 1G3DA 1EAIA 1G2MA 1O2KA 2F3CE 2QXIA 1WTHD 2FS9A 1ESAA 2QN5T 2BD9A 4WF8A 2BXUH 1NRNH 1CHOG 2Q6FA 2Z6BD 3KCGH 3MMGA 4ABGA 2UUYA 2UUFB 4U32A 4MQAA 1FPCH 3PWBA 4BOHA 3QO6A 1XVOA 4WMFA 1D9IA 4D7GA 1O3OA 2FO9A 1TMUH 1S6HA 3S9AA 2ZFTA 1MMJN 2R2MB 1W0YH 4HTCH 1O2IA 1S83A 1SGEE 2BX4A 1EQ9A 1O3KA 2H9TH 1GHVH 3LGVA 3OSYA 5A09A 1DUEA 9LPRA 5F8XA 4ZMAH 6ESTA 5EXLA 3RXGA 4I7YH 2O8MA 3UUZA 4I8JA 3RP2A 1SVPA 2XCFA 3M36A 1AKSA 1IQHA 4OM9A 1F7ZA 2BZ6H 1IAUA 1FY3A 1SGFG 4XE4A 1ZSKA 1XM1A 2QV1A 4IMZA 1ELDE 1AI8H 1WUNH 2FEQH 2JETB 2PGQB 2AMDA 3SV8A 2OC8A 2P59A 3D65E 1YPGH 3NCLA 1B0FA 5DP5A 5EU8A 1K1MA 1UTLM 3SI3H 4FUCA 3PLPA 3A8BA 3N7OA 2UUJB 1TBRH 4ABBA 1K1JA 2YNBA 1SB1H 2FOGA 1SQRA 3M5OA 1FY5A 1ELBA 5L2ZH 2BY6X 2ODPA 1LKBA 1TGSZ 3A7ZA 1MU8B 4CR5A 1GJDB 2W7UA 2GT7A 3GDVA 3PMBB 1O2HA 2H9HA 1SQOA 5GIBA 2J94A 4X1PU 5EODA 4YOJA 1TLDA 2H5DA 3RC5A 4RKJB 4X2WA 1SGQE 1GI2A 3M35A 1C5UA 2HLDD 4BTTB 1ZSLA 4K1TA 4Y71A 1SQAA 3ZVAA 5CE1A 3A84A 1LVYA 4Y7BA 1Y8TA 1GBDA 2P3FH 3RLWH 1BITA 3JZ2B 3KQBA 1MTNB 1GHBF 2ZU4A 3SU0A 2C8XB 1MU6B 1AZZA 1GPZA 1F92A 1NESE 1Y5UT 4X8SH 1QBVH 2BZAA 3GCHB 1C5ZB 1VCPA 2FMJA 4LXBH 4GAWA 4YO9A 3F2HA 1BJUA 2WSSD 2PR3A 3FANA 2GDDA 5EJLA 1AVGH 3F9EA 4IC6A 2BQ6B 1P02A 2QE7D 2WYJA 1OHHD 1QGFA 5I25A 3V7TA 2ASUB 1PQ5A 1FAKH 1C1VH 1WV7H 3RXLA 1K28D 4X6MA 2J98B 3KYGA 2W7SA 3PB1E 1OWHA 1O2VA 3TJOA 2ALVA 4WH6A 3UR9A 3PLKA 1Z8IB 1O2XA 2ZTYA 1BA8B 4ZXXH 3RXOA 3V3MA 1DDJA 2A2XH 2JKHA 1C9PA 3MI4A 4YOIA 1QRWA 3RXIA 1CGJE 4FOUC 1O2LA 1BTHH 3TH3H 2BD2A
chains in the Genus database with same CATH topology
1HIAA 3E1XB 5A8ZA 1C1OA 2PTCE 2BYAX 1TOCB 1V2QT 2R9PA 3NUMA 3T25A 2TRMA 3DFJA 4UFDH 3SU4A 1OP8A 1XVMA 2G4UA 2OD3B 4IS5A 1A5IA 3LU9B 1YPJH 2UWLA 1P2KA 1AMHA 3RXMA 4FUDA 1C2KA 3PMHB 2RDLA 3ATLA 5DP8A 1GBMA 2XC0A 2VNTA 3ZV8A 1GVKB 5E2PA 2BB4A 1H8IH 1A4WH 4E06H 3A7YA 4ZAEA 1IQMA 1GMCF 2ZDKA 2ZHFH 2EA3A 4JCNA 2BOHB 2BDIA 4XDEA 1GGDB 1A5GH 3GY6A 3A8DA 1AZ8A 4ESTE 1PPFE 1S81A 1OS8A 1OWKA 1KLIH 2ZF0H 4B75A 2A5IA 3LONA 3MH7A 3MU4A 3Q76A 5E0HA 5FBEA 1N6XA 3MH6A 5EW2H 4NWKA 5HM2A 3S69A 4BAMB 1GBAA 5TJXA 1Y3UA 2BVXH 5ABWA 2W26A 1NRPH 3B8JA 8GCHF 1CHOF 1YLDA 2CGAA 3WY8A 1C2HA 3EDXB 4JZEH 3QWCH 4K8YA 1TPSA 1O2NA 2BY5X 3D23A 4GHQA 2J2UA 2OLGA 2BDCA 2C3SA 2FIRH 2OTVA 1OP0A 1TMBH 3HPTB 4X2YA 3S7HB 1UJ1A 1P2OA 1ZZZA 2I6QA 3ZZ9A 1AFEH 4NIVA 1V2PT 3TPIZ 3ZZBA 2B0FA 3NXPA 2H2ZA 3ATKA 7KMEH 6GCHG 5DP6A 4LK4A 1E37B 3ZV9A 1UK4A 1J15A 5H4IB 3LT3A 2G5VA 2JETC 3TNTA 1C1TA 3BF6H 1ACBE 1ZJDA 1TALA 2XBXA 2RA0A 5T3HA 4ZUHA 4BXSA 2GD4B 4OS1A 1GDQA 1GHAG 1TGTA 4FU7A 2PV9B 5AFZH 3FZDA 4ZKNU 3SNCA 1MZAA 1QJ6B 4AGJA 1GI7B 3MNSA 4X8TH 1A5HA 1A46H 3OYPA 4B73A 2XRCA 1LPGB 4NZLA 1Y59T 1O2GH 2GP9B 2QXJA 3BG4B 1ORFA 1NM6A 1O33A 3RU4T 1AD8H 3LJJA 3RXUA 1CSOE 3BN9A 1XUHA 4GPGA 1KXFA 4JYVH 1Y5AT 3PROA 4NG9H 3P92A 3FVFB 2AGEX 1DY8A 1LPKB 5EPYA 3RC4A 2PWXA 5HXFA 3SNEA 2Y5HA 4KTUA 3TGIE 3OU0A 1ZPCA 1XUKA 3T28A 1T32A 1DT2A 2VGCB 3ZVBA 3BTME 1K1LA 2GMTB 1YP9A 1GI3A 2ZCKP 4AYVB 3O8RA 2GV7A 3S9CA 1S82A 2FODA 1AVXA 4KTSA 2TIOA 2VU8E 4AORA 3M5NA 4FUJA 3MH5A 2BDGA 1TWXB 2BMGB 2ZWLH 3SZNA 3T29A 1C5YB 4NFEA 1O3NA 1O38A 1LPZB 2YNAA 3W94A 3C27B 3TJVA 2FS8A 4B2BA 1O5AB 2PSXA 1UTNA 1L0ZA 1AN1E 4BNRA 2GZ9A 1C2IA 2XBWA 2G00A 1GI6A 1QL8A 3ATWA 3QK1A 1UHBB 1O2JA 3D49H 2BLVA 1IHSH 1O2RA 1OP2A 1D6RA 1RTFB 3UR6A 5G4BA 5LPRA 2Z9KA 1DICA 3CS7A 3NWUA 4ABFA 1C2JA 1HFDA 1QRXA 4R0IA 2G5NA 7ESTE 1XUIA 3EGKH 1HAVA 2AMPA 2OP9A 3E0NB 1TNGA 3SNAA 4CH2B 1HJAC 1MKXK 1KXBA 1TRYA 1SGIB 1TNLA 3U8OH 4BAOB 2GZ7A 3SJ8A 1BDAA 3CS0A 2OCVB 1QCPA 1DSTA 6CHAC 3ATMA 3SUFA 4Y8YA 3TJUA 3HATH 1MKXH 2VWOA 2XBVA 1GBFA 1G3BA 2P16A 2WUCA 5GWZA 1LHDH 1LHFH 1OPHB 2JH5D 2ZDVH 3V0XA 3K6YA 1GMHG 7LPRA 3SOSA 2QXHA 1O0DH 1NU9A 2FOHA 3MNBA 3SQEE 4OS7A 3DHKH 1C5MD 2XCNA 5FBIA 4NIYA 1Q31A 2B7DH 1EAXA 3P8FA 2BLQA 1FUJA 3HKJB 2AERH 1YPHE 4JMYA 3U69H 1SGCA 2Y82A 2VIVA 5FPYA 3BTTE 1J14A 1XUGA 1K2I1 2HGTH 4X1NU 3RXHA 5AVDA 4B2CA 4TWYA 5GDSH 4DVAU 3NKKA 3DD2H 1LVBA 4MPWA 2ZGHA 3HK6B 2OC7A 2ZU2A 3QDZB 1L1JA 2FX6A 2O9QA 2QXGA 4CBNA 3SI4H 1V2UT 4NSVA 3GY4A 4JZ1A 2ZGXH 1GMDG 1B0EA 1Y3XA 4ABEA 1DWCH 2WPJS 2M5TA 1O3IA 1P11E 4YZUA 1HAPH 1C5TA 2PHBA 4AB9A 1H8DH 1ZMNA 3E0PB 2Z94A 1C1UH 1NS3A 1OYQA 2F9BH 3PTBA 5EQQA 1K1NA 4Y11E 4Y10E 5FCKA 1QB9A 2A5AA 4ISIH 3F9GA 2BVSH 4AGKA 1W7XH 2Q6GA 4CRBA 1TQ0B 2EI8A 2O8UA 2KAIB 1FNIA 3BG8A 1A3EH 3ZVCA 4ABJA 2G4TA 3LH3A 1E38B 1VCWA 4E05H 1ETRH 1XKAC 1KLJH 1C5LH 1W3CA 2QC2A 4O9VA 3SNDA 4WWYA 4ABAA 1P3EA 5JBCS 5F8TA 1KXDA 1Z8JB 1HYLA 3BTHE 1LO6A 2G55A 1GJCB 3ENSB 1DY9A 4ABDA 1QHRB 1HUTH 1C1WH 3E90B 5SGAE 1VGCB 1FN6A 1N8OB 4KP0A 4UFGH 1MBMA 2GMTC 2TGDA 1F0RA 4WY3A 4AN7A 1TX6A 3H7OA 1F5RA 1WTGH 1HJAB 1GL0E 2G8TA 2GZ8A 3GY5A 2Z7FE 2ZHDA 4K1SA 2D2DA 4A5TS 2HLCA 1SOZA 1C2MA 4E7NA 1SGPE 3BTGE 4ISHH 1Q2WA 3ZZDA 1G37A 1EAUA 4Q2KA 4YTAA 5LH8A 2SNWA 4B74A 5E0JA 1YCPM 5LGOA 1PPBH 1BRCE 3KN2A 1NFWA 2VVUA 1YC0A 2BD7A 1MKWH 1A0JA 1AY6H 2PKSB 1V2KT 4WXIA 1GJBB 1HJ8A 1S85A 4PROA 1QJ7B 1ZHRA 4B76A 1RTLA 4Y8XA 1TGCA 1ZTLA 3MYWA 1RGQA 2WYGA 1C5VA 1O5EH 4BTIB 1F2SE 4FUHA 1P2MA 4RN6A 2FTLE 8GCHG 1O32A 2FWWA 1O2TA 3SNBA 3STIA 1WSSH 3GDUA 4B71A 2FOFA 4YM9A 4I33A 1AQ7A 2Y7ZA 4Y0YE 4DG4A 1INCA 1DWEH 2FYRA 4ZROA 3SUEA 1Z6JH 1CA8B 1TMTH 2ANYA 3W95A 1KXAA 2ANMH 2FI4E 3U1JB 4GCHF 2BM2A 3BEUA 1Y5BT 1A0LA 2VGCC 1J16A 1XKBC 3MU8A 4UE7H 1PQ8A 1S84A 3MFJA 1ELTA 3LPRA 2ZDLA 1YLCA 1N6YA 5DO4H 5GPIB 4JZDH 4MG3A 1OWIA 2OC0A 1ZGVA 1NFYA 1W0ZU 3BEIB 1FN8A 2R3YA 1QBNA 2BVRH 4YOGA 1V2OT 2V3OH 3DUXH 2C8ZB 1G3EA 1Z7KA 2AS9A 2CN0H 4I32A 4MLFB 3L33A 4MNWA 1GHZA 4DCDA 3RXDA 1SL3A 1BJVA 1EAWA 1PQ7A 4IMQA 4FU8A 2FOMB 2RA3A 3TNSA 1A2CH 3GCHC 2Q1JA 1QURH 2HNTC 4UONA 2BTCE 2ZFRH 5A0CA 2P95A 3SV9A 1OWDA 1ANDA 3RMOH 3SJKA 1C2EA 4YESB 3Q3XA 4NSYA 2TPIZ 4WXVA 1DM4B 3EQ0H 2AFQB 2QY0B 4X1QU 5DP3A 5CMXH 1G2LA 1W10U 3U8TH 4FUFA 5ETXA 1T4UH 4A1VA 1V3XA 1JIMA 2PLXA 3HKIB 1IQEA 1EZSC 1BTYA 4TPIZ 2A31A 4A1XA 1GBKA 5FCRA 3G01A 3LOXA 1SC8U 2QAAA 3UOUA 1FV9A 1WAYB 1L1GA 1TNIA 1CO7E 2WPHS 3RXEA 1BMNH 2UUKB 4FXGH 2ANWA 1G30B 1EZQA 2I6SA 2O8TA 2XYAA 2TGTA 4NFFA 3PTNA 4K2YA 1P9SA 3RXQA 4INHA 3M7TA 3TVJB 4Y76A 5IDKA 2VIQA 4OS5A 2D8WA 1YPKH 1DLKB 4OGYA 4UD9H 3T5FH 2FOBA 1UTOA 1DSUA 1N1LA 1HCGA 1IQGA 2HPQH 1ZRKA 1BBRH 5DJ7A 1GJ7B 3P8GA 2OQUA 3UNQA 3AAUA 1K22H 1O3CA 5T6GA 4AFQA 2J95A 1GL1A 3LGIA 4NCYA 2R2WU 1YPMH 1TIOA 4GVUA 4D9QA 3EYDA 1WU1A 3BTKE 1FIWA 1Z71A 2F91A 2VIPA 3H7TA 2ZGCA 3VGCC 4CREA 5C1XA 2GGVB 2SGAA 2ZHWH 5AHGH 4YT7H 1F0TA 3F6UH 2XW9A 3LKWA 1SSXA 2ZDNA 1V2LT 1O3JA 1O2YA 1UHBA 2NU4E 1GI8B 1UVSH 1UTJA 2FLRH 1T8LA 2A4QA 4RKOB 2PTNA 4A92A 3ZZCA 3UWJH 1O3DA 1QA0A 1VZQH 4ASHA 1LHGH 1TA6A 3RM0H 4THNH 3VXFH 3SU6A 1ELEE 1EP5A 1W11U 3E16B 4UDWH 3SGQE 3ELAH 5A2MH 3E3TA 1V2VT 3Q00A 4H6TA 5C3NA 1FLEE 2GCTB 3DA9B 1JMOH 1TFXA 3A87A 1KTTB 1GJ9B 3QGNB 1HIAB 2ZCHP 2ZP0H 3KHVA 1GHBG 4TY6A 1ZMLA 1DOJA 4ZXYH 4H42U 2C4FH 3GCOA 2XTTB 5I46H 1P8VC 1X7AC 3OTJE 1O2SA 3ZYEA 5EXMA 1MD7A 3BTFE 1KYNA 4D76A 1GWAA 1AB9B 3ZZ7A 4D9RA 2AEIH 2EI7A 3M7UA 1NY22 3ZZAA 3BG4C 2BY7X 3RM2H 1FI8A 2Z3CA 2F9UA 5CHAC 3IWMA 1GDUA 1G36A 4OS2A 1EZXC 3D62A 1MTVA 1XX9A 2IOTA 2WPKS 5F03A 1TPAE 3LGTA 5GXPA 3RXKA 1AU8A 1QNJA 5A8YA 2O8LA 2ZPRA 2A7HA 1PPZA 1MCTA 1OSSA 1PQAA 5J4QA 5FAHA 5K0HA 3PLBA 1SMFE 2GT8A 1AE8H 3ZVDA 1NRRH 1LMWB 3SGBE 3GYMA 3GISB 3SJOA 1QIXB 1Z1IA 3KIDU 4O3UA 3UTUH 1P57B 3I77A 1P0SH 3BEFB 3TK9A 1C5RA 1YF4A 2C93B 1BIOA 4DIIH 3T27A 3U8RH 3TITA 1EP6A 1P03A 3A8AA 4Z0KA 4Q7YA 6LPRA 8LPRA 1IHTH 3M5LA 5E2OA 5JB8S 1THPB 4Q7XA 3KQCA 1NN6A 1L4DA 2D1JA 1ESBA 3M3VA 3P70B 3VXEH 1O3EA 1F5LA 2PKAA 2CF8H 1LDTT 2Y81A 3SHAH 2XC4A 4ZKRU 1GBBA 2BQ7B 3K6ZA 3FP6E 3GY2A 5C20A 4U30A 2PUXB 3RXSA 1LCYA 4ISOA 1D4PB 1ZPZA 1F0UA 5BPEA 2BD8A 1O30A 1UTQA 3TJNA 4MPVA 4ZKOU 1AFQC 2AGIX 4X1SU 1G3CA 2THFB 3KEEA 2BOKA 2W3IA 2AH4X 1ANCA 3T26A 1EOJA 3TH4H 2NU0E 2HPPH 1C1QA 4I31A 4DGJA 5EOKA 4SGAE 2VIOA 1A1RA 7GCHF 4K69A 4X8VH 4CHAB 1V6DA 3F9HA 2J4IA 1EKBB 2FI3E 2ZHEH 1YPEH 4TWWA 4LZ4B 4MDSA 2J34A 5JYIA 1LVOA 3A8CA 2OBOA 1C5QA 1V2MT 1TOMH 3PV4A 2H6MA 3A82A 1TGBA 1HLTH 3TU7H 2FOEA 2AYWA 5EXNA 4CH8B 1SBWA 4FU9A 4ISNA 2ZEBA 3IITA 2ZDMA 4HI3A 4X1RU 3OX7U 1K1IA 1IQJA 2XC5A 2DUCA 1D3PB 1FIZA 1AWHB 2R0KA 1AHTH 1XUFA 1EPTA 4WMDA 1KXCA 1MTUA 1FMGA 1P2QA 3FFGA 3QGJA 1O2ZA 1QTFA 1S0RA 1O5FH 1C1MA 4DJZB 3UNRA 3UNSA 3RXTA 3VB6A 3MH4A 1SOTA 4INKA 1MBQA 1C1RA 1BTWA 1GJ4H 4O03A 1SGNE 3QZQA 1ZR0A 3V13A 1AWFH 3ZZ8A 1V2JT 1UCYH 1GBIA 2PSYA 1GI4A 4JYUH 1H9LB 4VGCC 1EB1H 1SLVB 1QFKH 3M3TA 1RS0A 4E7RG 1ELAA 3KQDA 1XXFA 1TBQH 1Y3VA 2H9EH 5GJ4B 1MUEB 2CHAB 2F83A 3RXVA 4X6PA 4AFUA 1C1NA 1P2NA 2HOBA 1QB1A 1Y3WA 2XWBI 3ZVEA 2P94A 4F4OC 1MTNC 1SHYA 1HXFH 1GJ5H 3UIRA 8ESTE 3L3TA 4ZHMU 1GCTB 4K3JA 3UWIA 4I8KA 4HFPB 4Y7AA 3AAVA 2Z9IA 1TRMA 2A32A 3QLPH 2DE9A 2BD4A 1K9OE 4AFSA 2IN2A 3BTDE 1Q3XA 3MU1A 3GCTF 1HGTH 1IQFA 4WH8A 4GSOA 4X6NA 1WYKA 1C2FA 4K60A 1BRUP 2A2QH 4ZHAA 1Z8GA 4Z6AH 2R0LA 1RIWB 1Z6EA 1LVMA 1BTUA 3MU5A 4H6SB 2GV6A 4U2WA 4NIWA 2A1DB 1UCYK 1CGHA 5AF9H 4I8LA 1GI5A 4BANB 3VFEA 4NZQA 4D8NA 5JBTA 1W13U 1IQIA 3SU3A 2Y6TA 1GCTC 5E0GA 5K7RA 1F5KU 4TYDA 4CRAA 1CBWC 1EJMA 1MCVA 3TH2H 1BTPA 4MPXA 5T6FA 1CT2E 3Q77A 1EOLA 4DW2U 1ZGIA 4MNXA 5IYTA 3UY9A 4B2AA 1WQSA 2SGEE 3PWCA 1F0SA 4NA8A 3AVZA 1DE7H 1SFIA 1GHXH 2BD3A 1NROH 1AGJA 1SR5C 1H9HE 1RTKA 1THSH 1AB9C 4BAKB 4XFQA 1MD8A 1BMMH 4NA9H 4QT8C 3UQVA 1EPTC 1EASA 2Y7XA 3DFLA 1QB6A 1EJAA 3U1IB 1C1SA 2ZFFH 1MQ5A 1MAYA 1O2OA 3BIVH 2GTBA 3SO3A 1WQVH 2ODYB 3MOCA 5ESTE 7GCHG 1C5PA 5TCCA 1BMAA