3A81A

Crystal structure of trypsin complexed with (e)-4-((2-nicotinoylhydrazono)methyl)benzimidamide (soaking 8 hours)
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Cationic trypsin
publication title In-Crystal Chemical Ligation for Drug Discovery
rcsb
total genus 58
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2009-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3a81A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3a81A02
3ZVDA 1C2MA 2TBSA 2QA9E 5JBTA 1C2HA 3SU1A 1K1MA 1ZPBA 2W3IA 1GG6C 1P05A 1H9HE 1VITG 1L0ZA 3RUOA 3T25A 5A2MH 3TLOA 1UMAH 1C5SA 1MQ5A 1TPAE 2Y5HA 1AVWA 3QO6A 1MZAA 3H7TA 5DK1A 1V2MT 2KAIA 3UIRA 2HNTE 1Z1JA 1MTUA 1UK3A 2VVVA 3SNAA 2WPMS 3A7YA 2PLXA 3EQ0H 4NFFA 3L3TA 1N8OC 5K7RA 1A5HA 1UTQA 1FPHH 2VWMA 1GPZA 5EODA 5L6NH 3BTHE 3BEUA 4OGYA 1AO5A 2XRCA 1HAGE 2STBE 4Y71A 5F03A 3A7XA 6ESTA 4FU8A 1VCPA 3ZV8A 3GY5A 1Y5AT 2FI3E 2WPKS 1SR5C 3Q77A 1MH0A 1O34A 4K69A 3LGTA 2FOEA 2A5IA 3MYWA 4WWYA 5ESBA 1OP2A 2ZFFH 1P9SA 3QZRA 1GVZA 3U8TH 2Z9JA 1SGCA 4WY3A 1WV7H 3SUFA 1YC0A 4ZKSU 5L30H 3BTDE 1P9UA 2QAAA 4K1TA 1A4WH 1MAXA 1W8BH 2SGEE 2ALPA 2Y80A 4YZUA 5FBEA 1GWAA 1DS2E 4DJZB 1AWHB 4MPVA 4FUIA 2F9VA 5E2OA 4A1VA 3VGCB 4KTSA 4YM9A 1ZHMA 8KME2 2ZU2A 1TE0A 1GGDC 4X1PU 1E38B 3GOVB 4YO9A 1V2JT 1MD7A 4BTTB 1RJXB 4ABEA 1ZJKA 2Q6FA 1Z8RA 1DXPA 3RXVA 2VU8E 1F0UA 1FIZA 2ZHEH 1BBRE 2W7UA 3E1XB 3PV4A 3OU0A 3LIWA 1CE5A 2UUFB 4LZ4B 7GCHF 3SV9A 3PROA 2CHAB 1TRYA 4XDEA 1AN1E 2XCNA 3RU4E 5E0GA 1ZTJA 1GI1A 3RMNH 2AMDA 1TNIA 1TNLA 2XBWA 5GCHF 1O2YA 1UCYK 3A8AA 3HGPA 1UTPA 5HMAA 2P59A 4BNRA 4NCYA 1KTSB 2GGVB 1YPLH 4ABBA 2ZPRA 2Q6GA 1LMWB 3KNXA 1BA8B 4X2VA 4B1TA 4FUEA 1NFYA 2PTNA 1PYTD 1FZZA 3RXQA 1WBGB 1GHWH 1D3TB 2F9PA 1C1SA 2OBOA 3PO1B 2C93B 2JH5D 4XE4A 3GYMA 4FVBA 3RXBA 3AW0A 4UDWH 1HJAC 1QQUA 1BBRH 4DOQA 4CHAB 2R2MB 1YPKH 1IQLA 4AZ2B 1C5OH 1NT1A 1ZTKA 4Y6DA 1BCUH 1NTPA 3KL6A 4BTUB 1RTLA 3S69A 2ZU4A 2ZCKP 4TPYA 2Q6DA 1EJMA 1QB6A 4NWLA 4Y8XA 1S6HA 2C8YB 1YCPK 4H6SB 1LVYA 1ZPCA 3BF6H 4GLYA 4ABJA 4OS6A 1C9PA 1D3DB 1MTVA 4UFFH 4TY7A 4Y11E 3UWJH 4A1XA 3SJIA 1LDTT 2HPQH 2FI4E 3C1KA 1BZXE 1CBWC 1P3EA 2P8OC 4INKA 3BIUH 1GMDG 1XX9A 4AB9A 5C1XA 2K1QA 1O36A 2QXGA 1O30A 2SGDE 4DG4A 4MDSA 1AFQC 3QLPH 4BAOB 3M35A 4U2WA 4A5TS 5SGAE 1OWKA 1AFEH 1NO9H 1P11E 2H5DA 1D4PB 2BD4A 3PWCA 4K5ZA 2J38A 3D49H 3A88A 3U1IB 1Q2WA 4CRBA 5DJ7A 2ZNKH 3DT0H 3LJOA 2ESTE 3P6ZB 4MPWA 1AB9B 2O8WA 4OS2A 2C8WB 2R0LA 3OY5U 1TALA 3SOSA 2ASUB 4A92A 1AZ8A 2NU4E 5EG4A 1W14U 2VVCA 2AFQB 3DFLA 1QL8A 2XTTB 1XKAC 2ZFTA 1OWJA 1C1VH 1SQOA 2CN0H 3MH7A 3PLPA 1P10A 1O3HA 1NRSH 1MCVA 3B8JA 1G2MA 3D62A 4O3TA 1GBCA 3I78A 3AW1A 1O2TA 3TK5A 3P17H 3FAOA 4AGKA 1HIAB 2AMPA 4FUHA 1SQAA 1GJDB 1F0RA 1IQKA 4ISHH 1JBUH 1LVBA 2ZIQH 1XUGA 2BOHB 1ZSKA 1K1JA 2FP7B 1E34B 1GJ9B 4IN2A 1DWEH 4YTAA 4ZUHA 1C1MA 4DW2U 1ELEE 1NC6A 3RXSA 1C5UA 2FOGA 3PTNA 3TH3H 2BDBA 4AOQA 5JYIA 2OC7A 2CJIA 4FU9A 2HWLB 1ELGA 2ZDKA 1DFPA 3GCHC 1O5EH 4BXSA 4VGCB 2WUBA 1DANH 2HLCA 2QGRA 1SSXA 5PTPA 3ZYEA 4NA8A 3M61U 1OWDA 3MU4A 4ZAEA 5DPAA 2VWLA 1BQYA 5FX5A 5FXLA 3E16B 1J8AA 3RXMA 4ZHLU 3SJOA 3UOUA 2ANYA 1QRWA 1Y59T 1FIWA 3VPKA 4XBDA 4XBBA 1P2QA 1Y3YA 1MTSA 3QK1A 1SGNE 3KQDA 2FOFA 3KHVA 2HPPH 3UR6A 2ZFQH 4THNH 1SLVB 1TGCA 3TGKE 1KY9A 1YKTA 4YESB 3MNBA 2A4RA 1F5RA 1MQ6A 4IGDA 3E8LA 1T31A 5DP8A 3V0XA 3L6PA 1MBQA 1NPMA 1BTWA 1S81A 1CHGA 1TPSA 1GHVH 2PR3A 9ESTA 5EW2H 4MTBA 3ZZ3A 5C20A 5L2YH 4GVUA 1NN6A 3SUGA 3T5FH 1V2PT 3ATMA 2FYQA 2STAE 4Q2KA 3RXFA 2F9OA 1NFUA 2ODYB 2XXLA 2ZTXA 4PROA 2CHAC 4UFEH 2A0QB 4KTUA 1L1NA 4BXWA 3TVJB 1G3BA 2FLRH 3TIUA 2AH4X 1TBRH 1HBTH 1ELBA 4YT7H 1SPJA 2ZDLA 4J2YB 4GSOA 2FODA 2GZ8A 3EGKH 1G9IE 3M36A 1MKWH 2WPIS 2BVXH 3I77A 1SGDE 5CHAC 1GBJA 2A4OA 1EAWA 3QWCH 3PO1C 1INCA 3QDZB 1FLEE 3RXAA 3BTEE 1O2IA 4GHQA 3T27A 1DY8A 1PPCE 3FZZA 1RFNA 1C5WB 2A7HA 3D23A 1PPBH 1Y5UT 3VB7A 3SQEE 3F9EA 1QBNA 1RD3B 2OC8A 1T8LA 3RC4A 1PJPA 3UWIA 4GCHG 1TQ0B 2XBYA 7GCHG 4E05H 3AASA 1ZHRA 3D65E 1MKXK 5FPSA 1FY5A 1BIOA 1JOUB 2TGDA 1O2ZA 5GCHG 5LH8A 3M3TA 1HRTH 4BANB 2Z3EA 1EOJA 2ZCLP 1XM1A 1E36B 3LT3A 4K3JA 2XBXA 2PGQB 1A0HB 3OX7U 1AVXA 1A0LA 1C5NH 3RXGA 2BXTH 1SHHB 1UJ1A 2PWXA 2A5KA 2VGCB 1H8DH 1XUFA 1ZMJA 1A61H 2G5NA 2AMQA 2ZTYA 1O2GH 3SU4A 4K1EA 2WV4A 1O31A 1GBFA 2ZWLH 4X1SU 2FZZA 2UWLA 2EI6A 1UTNA 4DGJA 3T62A 1FAXA 1GI8B 2G5VA 1OYQA 4WMEA 1N1LA 3NXPA 1P09A 4SGBE 1E0FD 1V2VT 3NCLA 1UHBB 3T26A 3SV6A 4ABAA 1DWCH 1SGIB 4NA9H 1AB9C 1IQNA 4M7GA 3T2NA 4WJG2 3WY8A 3CP7A 5G4BA 2RA0A 3PMHB 1WTHD 2O8UA 2Y81A 1EB1H 1RXPA 2BD7A 1H8IH 1TLDA 2WV5A 3SORA 1FUJA 3OSYA 5E8EH 5EOKA 1O35A 1GI9B 1GMDF 2Y5GA 1O3MA 1WCZA 2G4TA 1VITH 1V2UT 1EAXA 5E0HA 2NU0E 2B7DH 1C2FA 1P2OA 2QF3A 1QB9A 2OD3B 3VB6A 4I8HA 1C5RA 3E0PB 1PPFE 1O3EA 4JZFH 2ZECA 2FX4A 1TA6A 2HOBA 1ZYOA 3RLYH 2SGFE 2ZDMA 2BQWB 1P02A 1ZOMA 1D6WA 5CE1A 4FUGA 2FLBH 2SNVA 3K2UA 1P12E 3LGUA 1P03A 4E7RG 4INHA 2PUQH 5K0HA 1EP6A 1C1RA 2BQ6B 4AYVB 2HRVA 3Q3YA 1F5LA 3HK6B 1PQ8A 4VGCC 7KMEH 2A7JA 1VJAU 3FVFB 1K1NA 1AKSB 1D3PB 2OUAA 1GBHA 3ZVAA 4I33A 5JBAS 2Z94A 1LKAA 2A7CA 5JBBS 2Y6TA 1QBOA 1HAYB 2ZHDA 2PFEA 3MU5A 1PYTC 4X2WA 2G51A 3MMGA 2G4UA 4AN7A 3A84A 3EA9A 1BRUP 1G36A 1GJCB 1PPGE 2W5EA 2BZAA 1ZTLA 1LCYA 2W3KA 1HLTH 1O2HA 3A7VA 2BLWA 2BY7X 4QT8C 2OINA 1ABIH 4ESTE 4NG9H 2AS9A 3ENSB 5DP7A 1LHCH 1DVAH 3HATH 1P2KA 1FV9A 2BDIA 3MOCA 3KQBA 2UWPA 1YPEH 4YOIA 3TNTA 4Y0YE 1O39A 3DA9B 5FPYA 4O97A 4Q7XA 4I31A 1W0ZU 1TGTA 2ZGHA 2ZCHP 2ZHQH 1F92A 2FS8A 5FBIA 2OQUA 4LK4A 1V2ST 1JXPA 5TCCA 2BHGA 3O8DA 1VJ9U 3BG8A 3BTTE 1BTUA 2IN2A 1KLJH 1QB1A 5C1UA 1F5KU 1NU7B 1C5MD 1IAUA 1UO6A 5I46H 1KLTA 7ESTE 3RXJA 5EU8A 1HAVB 3VB5A 1ZGIA 5FCKA 2GP9B 1CU1A 1KIGH 4DIIH 2C8XB 3N7OA 1GJ7B 1BRCE 2A32A 3I29A 3A89A 2VIQA 1AUJA 1GJAB 3RXCA 3B23B 3O8RA 4HGCA 1PPZA 2FEQH 4CRCA 1N6XA 1EAUA 1GI7B 1EJAA 2ZDAH 1BT7A 1TPPA 4Y76A 2GMTC 1SGQE 5LPRA 5T6GA 5I25A 2ZPQA 3SJKA 1XUJA 3VXEH 4AFUA 5JDUB 1KXDA 2VJ1A 1QIXB 1JRTA 4TYDA 3UNRA 1O3PB 4B74A 5E0JA 3F9HA 4ZH8A 1SGFG 1KDQB 2O8TA 1YBWA 3PLKA 4J1YA 1QFKH 1EZQA 1YM0A 2RDLA 4BAKB 1EAIA 3U69H 2PKAA 3SI3H 4I8GA 2A2QH 3W95A 1P06A 1E37B 3ATLA 1KXBA 1TX6A 2P94A 1SHYA 2FTLE 3M5MA 4ZXXH 3RM0H 4B71A 1NY22 1DWDH 1WQVH 3MI4A 4MNXA 1TABE 1LO6A 1NU9A 1O2WA 1O3OA 3TU7H 1TWXB 9LPRA 3MU0A 2UUKB 2VGCC 1WUNH 4MNYA 1YF4A 2FYRA 3M37A 1HAPH 3U8RH 4Z6AH 1CT0E 1S85A 4IC5A 4NZLA 3RP2A 3O8CA 1KXAA 3A87A 3KN2A 5FAHA 2J9NA 1GBKA 2G8TA 4GCHF 1EATA 1HV7A 2A4QA 3RMMH 1ZLRA 1GJ8B 3SGAE 5EGMA 2AIPA 1O2OA 1EZSC 3GISB 1S82A 3BTKE 1E35B 1O5CB 1K1OA 1SBWA 3NZIA 5IDKA 2GV7A 1EASA 3RXKA 1GDQA 1OYTH 2XNIA 1FAKH 1VGCB 3A7WA 1EZXC 1SI5H 5JB8S 5EW1H 1BTHH 1SC8U 1UCYE 1Y3WA 1GVKB 2P16A 1O0DH 2XCFA 3SUEA 2ZA5A 2ZI2H 3BIVH 5C5NA 1CQQA 3CENA 4HZHA 1O2LA 3STIA 2GD4B 1KLIH 2JETB 1Z71A 2O8MA 1O5DH 3SV2H 1EJNA 4GAWA 2KAIB 1ZPZA 3Q00A 4CBNA 1B7XB 2BYAX 5CMXH 4NA7A 1AHTH 2BX4A 3AAVA 1BRBE 2ANMH 3A7ZA 5BPEA 2PW8H 4ZHMU 1LHDH 3URCA 4FUJA 1QHRB 3TJNA 1GHXH 4HI3A 3MNXA 4AORA 3RXHA 3RDZA 4E7NA 3TK6A 1LTOA 1GBTA 2YNAA 2UWOA 1IQIA 1SLXB 3ZVCA 1G3DA 3DFJA 3BG4B 1UCYH 3DHKH 4CRGA 1GJ6A 3NKKA 1G30B 1MU6B 2BMGB 3TPIZ 1ETTH 1RTKA 1NROH 2J34A 2ILNA 1FY8E 2BDCA 1NESE 2RG3A 1S84A 3BSQA 1GMHF 1JIRA 2AERH 2XC0A 4RKJB 1TGBA 1AUTC 2BX3A 1CSOE 2J95A 4OS1A 4X8UH 1TMUH 2OC1A 2VVUA 4U01A 4O03A 2BDYA 2FO9A 3H7OA 2V3HH 4Q7YA 1A5IA 3TJUA 1ACBE 2BD8A 3VFEA 1DUEA 1NRRH 1W0YH 2ANKH 4CR5A 2BD9A 2C3SA 1FY3A 4ISNA 3QZQA 5C67A 3A80A 3RMOH 3SNEA 3BTFE 2BLVA 1C1QA 1SGFA 1T4UH 1ZGVA 3UPEA 3UREA 4ABDA 1YCPH 1EOLA 2P3UB 3TJOA 1DPOA 3ELAH 2YOLA 1W12U 4DCDA 1HNEE 3GY6A 3GY8A 4JZ1A 1RIWB 4NSYA 4MQAA 1XUIA 1TBQH 1CGJE 4LOYH 1B5GH 1DSUA 1YYY1 4X6NA 1XVMA 1HAZB 3FFGA 1T8NA 3HPTB 2FS9A 3GY3A 3QUMP 4NWKA 4UEHH 1HYLA 2ZP0H 3V3MA 1MUEB 1KXCA 1SVPA 1UTKA 2F3CE 4KELA 1HB0B 1CA0B 1P2NA 5GDSH 4IW4E 1AGJA 1ELFA 1OS8A 1FY1A 3MO6A 1C2DA 3MTYA 1J17T 1A46H 1ELTA 1JIMA 1SB1H 2H1UA 4ABHA 2EC9H 4WH6A 1ZRKA 3F68H 1NRQH 1W3CA 3QTVH 5FCRA 3QN7A 2W26A 1DOJA 4KGAA 1TMTH 2JH0D 2QCYA 1RS0A 1HCGA 2PKSB 2ZFPH 3SN8A 4MNWA 1V2TT 1OWIA 1QL7A 1VCQA 4KTCA 1SGTA 4X1RU 1FDPA 2F9NA 3E90B 1EZUC 1O3JA 1OP8A 4JMYA 1Y8TA 4MPUA 1FQ3A 2OP9A 2FTMA 4CR9A 3IITA 1FMGA 2Z9IA 1O2RA 5GPIB 3VB3A 3F9GA 4AYYB 3M5OA 1DWBH 1KTTB 2DUCA 3P70B 1T7CA 1GBIA 1J14A 2A4GA 1DITH 1XUHA 5A09A 8LPRA 1JWTA 1ZHPA 2EI7A 1P01A 1V3XA 2V6NA 1C1OA 3MH5A 1GCDA 1WSSH 4BTIB 3UQOA 2ZFSA 1H9LB 1Q31A 2CV3A 4R0IA 1G3CA 3AVZA 4RSPA 4Z0KA 1EB2A 3VGCC 1A7SA 4H42U 2XBVA 3CS0A 1RRKA 3B9FH 4K2YA 2C8ZB 1O3DA 4JZIA 1OWHA 1AVGH 2IOTA 2B9LA 1HFDA 3MHWU 3T28A 3V13A 1S6FA 3V12A 4X1QU 3SUDA 4O3UA 3M7QA 1ARCA 4Y7AA 4LZ1H 1Y5BT 5F6MA 3ZZBA 1P3CA 3RXUA 4Y8ZA 4FUFA 2Z9GA 3EA8A 1TFXA 5IYTA 4OS7A 3MO9A 2FX6A 1TNHA 3ESTA 4X6OA 1C5ZB 2GTBA 1VGCC 3ZZDA 2XW9A 2ZO3H 1TNGA 5DP3A 2ZU5A 2G55A 1A3EH 1IHTH 3SGBE 1OPHB 3AAUA 1HGTH 1BJVA 1ZRBA 1B0EA 3R3GB 1ANEA 3DUXH 1QRZA 2ZGXH 1O32A 3ZVBA 1Y3UA 2P3FH 1HJ8A 2JETC 1GL1A 4FVDA 3EDXB 3RXEA 4DIHH 4OS4A 1L4ZA 1ANCA 1GDUA 3S0NA 1W2KH 1IQGA 3GY7A 5F8XA 1GBAA 3RU4D 3SU0A 5DP9A 1C5YB 1NZQH 1G3EA 4ASHA 3RXDA 2Y82A 4X6MA 2XWBI 3A8DA 1P04A 3K6ZA 4CHAC 1YLCA 1EPTB 5EQQA 3RC5A 2C4FH 1C5QA 2AYWA 2VWNA 3BTME 5FPTA 1D3QB 3K6YA 1SOTA 3EE0B 1F0TA 1NFXA 1AI8H 2ZU1A 6CHAB 3TGJE 2VWOA 2SGAA 5T3HA 4NSVA 3BG4C 4WMFA 4JK6A 1O2XA 3RM2H 2QY0B 1BMLA 1SGEE 3ZVEA 3RXOA 1BJUA 2GT7A 2GT8A 3L33A 4K60A 1Z8GA 3IG6B 3PMAB 4TPIZ 1EKBB 4FU7A 3H5CB 1O5BB 1GJ5H 1AQ7A 1V2LT 3BTQE 4DT7B 1HAXB 4Y10E 4ABFA 1HXEH 1L1GA 1BRAA 5LPFA 5A8ZA 2BY6X 2IPHA 1W7XH 3PYHA 5EQSA 3QTOH 4RN6A 3FANA 4UFGH 3MNCA 1Z8IB 1ID5H 3RXRA 1LPKB 5C3NA 3VEQB 4D9QA 3U1JB 1MKXH 2QXJA 3Q3KA 4CRDA 1AD8H 1BMNH 1RIWC 5DP6A 1VR1H 2W7SA 1MZDA 5EQRA 2YNBA 3U98H 1P57B 4ISOA 1J16A 1ELVA 1K1IA 4CRAA 4I8JA 3SQHE 1V2RT 2ZC9H 1OXGA 1O3GA 1KSNA 1K1LA 3QX5H 3GDVA 1ESTA 4H4FA 3GY2A 5DP5A 1CA0C 4UONA 1O5FH 3A86A 3ZZ6A 3NK8A 2SGQE 1GMHG 4BAMB 1XXDA 1O2KA 3ODFA 4YLUA 2FPZA 3ZVGA 1LVMA 5AF9H 1AU8A 2VB0A 1C9TA 1QBVH 2HNTF 5DGJA 5T6DA 3SI4H 4IMQA 4JZEH 3GCTF 2ZQ1A 2FOCA 2XWAA 3LDXH 1O5GH 4CH8B 1GI2A 3K65B 1C2KA 7LPRA 2Z9LA 3UR9A 2ZF0H 2VIPA 3R0FA 4WMDA 4KKDA 3PMBB 3ZYDA 1K22H 1UVUH 1C1PA 1S0RA 1L4DA 1QA7A 1QCPA 1V2OT 2QC2A 2ZKSA 4I7YH 1CVWH 4D7FA 2A5AA 2Z9KA 1OKXA 1WTGH 1PPHE 1K28D 4X0WU 3SW2B 8ESTE 4AG2A 5A0CA 1J9CH 1A1RA 5C1YA 1DLKB 1A5GH 1QNJA 5EPNA 2OXSA 1YPJH 1BDAA 1TX7A 1W10U 2TGAA 4X2YA 1UTJA 1HJ9A 3M3SA 2H9HA 4I8KA 3K9XB 3F9FA 1MBMA 1O2MA 1ZJDA 1DX5M 5J4SA 4Y7BA 4WH8A 1THPB 3SNBA 1AFQB 1BHXB 1TNKA 3LGVA 2FESH 3G01A 2R9PA 1BB0B 2I6SA 1SL3A 4X1NU 3JZ1B 2BY8X 1GHYH 2VIVA 2OCVB 1IQMA 1ZR0A 3A85A 4ZROA 5TCAA 2FI5E 1T8OA 1IQJA 1BUIA 2THFB 1TAWA 1O3IA 2FDAA 1L2EA 5EXMA 1YPMH 1D9IA 1Z8JB 4F4OC 1CA8B 2FIRH 2ZGJA 1TNJA 2FOBA 2XYAA 4IN1A 4XOJA 5H4IB 2VIWA 1C5LH 1PQ7A 2GDEH 1BHXF 3UNSA 1C2LA 2GX4A 1ZMNA 2C90B 4WF8A 3SU3A 1TB6H 3O8BA 3ATKA 3KGPA 2ODPA 1ETSH 2PUXB 2BDAA 2O8LA 1S83A 3SU2A 3U9AH 1QJ6B 2FOMB 1GHBF 2H9EH 4WVPE 3LC5A 1YGCH 3EYDA 4F49A 1ARBA 2BY9X 2WPHS 1Z7KA 1C4V2 3TGIE 2ZFRH 1K1PA 1QA0A 3CS7A 1AIXH 4GHTA 5HYOA 3FP8E 1UTOA 2FMJA 1Z6EA 1C2GA 2WYGA 2QXHA 4WXIA 3TITA 1W11U 1FN6A 2BM2A 2QV1A 1T4VH 1ZZZA 1EPTC 5DG6A 5TJXA 4NFEA 5C5OA 1BOQA 3UFAA 4XSKU 1HXFH 1RGQA 1UVSH 4CRFA 3S9BA 1AWFH 1TBZH 2VINA 3GCHB 1THSH 3GCNA 6CHAC 1EX3A 5GIBA 1QJ1B 1C5PA 1GCTB 1DXWA 4B76A 5GJ4B 2BLOA 2BLQA 2AGGX 1X7AC 2DE9A 2EEKA 2ODQA 1Y3XA 1TOMH 4ZMAH 4A1TA 2QYIA 1G2LA 3UNQA 2J2UA 1C5TA 2QF0A 1QQ4A 5BRRE 1CHOF 3LH1A 1HAOH 4UFDH 1C4U2 3ZVFA 3P8FA 1DSTA 1YPHC 2ALVA 1EUFA 1BMAA 1SOZA 1EP5A 2V3OH 1PFXC 3SBKA 2Q1JA 3V7TA 4MLFB 3ZZCA 3U8OH 2ZZUH 4U30A 3RU4T 1GMCF 4X2XA 3KF2A 3RMLH 4FUDA 3MWIU 2VH6A 2XC5A 4D8NA 3TH4H 3P8GA 4GUXA 1HAHH 3TNSA 4JYTA 3SHAH 1TPOA 1O3NA 3GDSA 1GHAF 3SNCA 3ZZ4A 1P2JA 1BBRK 3PTBA 2RA3A 1C2JA 1MAYA 1LQEA 3LH3A 3SNDA 2VH0A 1O2SA 2HNTC 1O2PA 1SLUB 1H1BA 1XXFA 1A2CH 1C1NA 4XBCA 2LPRA 4X8SH 4B75A 1P2MA 1O33A 1Z6JH 1GHZA 2TGPZ 1V2WT 3SGQE 3LGWA 3W94A 3HGNA 2NU3E 3STJA 2B0FA 4JZDH 1W7GH 3P8OA 4AGJA 1TRNA 5L2ZH 3QGJA 1BTYA 1CO7E 4NIXA 1NRPH 2J92A 5DP4A 1HUTH 2G00A 3NUMA 4Q80A 5J4QA 3ZV9A 4B2AA 1H4WA 4YT6H 3RC6A 1C4Y2 2WYJA 1ABJH 3P95A 3OYPA 4UD9H 2WINI 1HIAA 3PM3A 2Y7ZA 1UK2A 5CHAB 3P8NA 2GCTB 5AHGH 4I32A 4O9VA 2ZDNA 1CT4E 1AE5A 3GYLB 2QN5T 2CMYA 2FWWA 4DVAU 2VNTA 3S9AA 1JRSA 4MVNA 1SGYE 1NRNH 4B73A 2GZ9A 1LHFH 5F8ZA 2PTCE 3KEEA 6GCHG 5HM2A 2CF8H 4Q7ZA 2F9BH 1YPGH 2A2XH 1PQAA 8GCHF 4ZKNU 2PKAB 3VXFH 1L1JA 5LGOA 5E2PA 1UK4A 3HKJB 4R8TB 3MH4A 1SGPE 2BVRH 4ABIA 3M5LA 4NIWA 2TGTA 5ABWA 4U32A 2NWNA 3TH2H 1G32B 1O2QA 4JYUH 2BTCE 3A82A 4ZXYH 2ZG0H 1MTNB 1OSSA 1DUAA 3FZDA 2D8WA 1GI4A 1GI3A 2I6QA 3FP7E 1ZSLA 5GXPA 2JKHA 3TJVA 3GCTG 1KXFA 4MNVA 5DKMA 1GDNA 3LKWA 3GICB 1ELAA 4YOJA 2BD5A 2CXVA 1WU1A 1HAIH 3F6UH 4ISIH 1MD8A 4MG3A 1OX1A 3S7KB 1O2UA 1BITA 3MFJA 3SZNA 1VZQH 5EXLA 1DLEA 1SQTA 2BB4A 2SNWA 1M9UA 2OQ5A 5HGGA 4AFQA 3ITIA 1KXEA 5ETXA 2DE8A 1D6RA 3SU5A 2BY5X 2G81E 1DM4B 3KCGH 3M5NA 1UVPA 1O37A 1O3FA 5FX6A 4AG1A 1P8VC 1O3AA 2HVXA 2J4IA 1LHGH 2BDGA 2BVSH 1O2JA 1MMJN 3RXLA 3SV8A 4A6LA 2GCHF 3ZZ8A 1AMHA 1OOKB 1YP9A 2AGIX 2BOKA 3IWMA 4DURA 3MNSA 4Y0ZE 2JH6D 2D1JA 3UUZA 1KYNA 1ESAA 3ODDA 4D9RA 1IHSH 4K8BA 3T29A 4BOHA 4OS5A 3M3VA 1ORFA 3OTJE 1SGRE 1SMFE 1QL9A 5A0BA 1V2NT 2A31A 2B8OH 3A81A 1DE7H 1IQHA 1GL0E 1EPTA 5C2ZA 2SGPE 2A1DB 2ZQ2A 4XFQA 2BZ6H 1DY9A 3ATWA 1F2SE 1O38A 1QY6A 1GCTC 2QXIA 1ZSJA 3RLWH 3GY4A 3E6PH 5LPEA 1ELDE 3HKIB 2PSXA 3P92A 1GHBG 1GBEA 1VITF 2ZTZA 3UOPA 3S9CA 1GI0A 1WQSA 4OGXA 1GVLA 3EAJA 2VIDA 3M7TA 4X6PA 4JYVH 2GV6A 4AFZA 2EI8A 3LONA 5HXFA 2FOAA 1FJSA 1IOEA 1QGFA 4NIVA 1CGIE 2FOHA 3Q3XA 3SU6A 1ESBA 1UTLM 1GBMA 1MKWK 1EXFA 5B6OA 4E06H 2OLGA 2BD2A 1W13U 2Z6BD 2BDHA 3MU1A 1QTFA 2M5TA 2UUJB 3ZZ7A 1WOFA 2H6MA 1LKBA 4YOGA 4AFSA 1UHBA 2H2ZA 1V6DA 4NZQA 1C5XB 2NU2E 3FP6E 3VB4A 2WPLS 3Q76A 2F9UA 1OWEA 1AY6H 1LPZB 1SFIA 1BMMH 4JK5A 1TQ7B 1FI8A 3UQVA 1FN8A 1MU8B 2HGTH 1GG6B 2AGEX 1U6QA 1CHOG 1O2VA 3LGYA 1QR3E 4KP0A 2BD3A 5A0AE 3BEFB 5EXNA 1DDJA 1P0SH 1GI6A 1OP0A 1BTZA 1FNIA 1TIOA 5ESTE 2PGBB 4IS5A 4TWYA 1F0SA 1N8OB 5FHTA 1C2EA 2TPIZ 1GMCG 4IMZA 1DT2A 1IQEA 1LPGB 2GCTC 4D76A 1TMBH 3SJ8A 4K8YA 5HM9A 4SGAE 4IC6A 1GBLA 4ZKOU 1B0FA 2UUYA 2GMTB 3JZ2B 1NM6A 3LOXA 1G37A 1GHAG 3BEIB 1K2I1 4MPXA 2BQ7B 3OY6U 1BTPA 1LHEH 1C5VA 4ABGA 4BAHB 3MO3A 4FUCA 5DO4H 4FUBA 2R3YA 1O3CA 2Y5FA 3E3TA 2NU1E 1AKSA 3MH6A 4Y8YA 3A83A 3S7HB 1CGHA 1XVOA 1Y3VA 2GZ7A 3BTWE 1TONA 4CH2B 2J94A 4HTCH 2CF9H 2PSYA 4NIYA 3SV7A 1UVTH 2A45B 1H9IE 4Y79A 3GDUA 2H9TH 2LNCA 1QRXA 1JMOH 1MTNC 1XUKA 2ZU3A 3BN9A 1GJBB 2F91A 4IBLH 1K21H 3SJ9A 1GGDB 1YCPM 1ZMLA 1V2QT 3MU8A 4AX9H 2QIQA 2AIQA 4K1SA 1T32A 3KQCA 6LPRA 2EA3A 2SFAA 4LXBH 2XC4A 2PHBA 1QJ7B 2ANWA 1V2KT 5AFYH 1IQFA 3LJJA 2OBQA 4UE7H 4ISLA 1C1UH 3F1SB 1TRMA 6GCHF 4INLA 2GKVE 2Z3CA 2P93A 1N6YA 1C1TA 1Q3XA 1PPEE 3RXPA 1WYKA 1O3KA 5F8TA 1TA2A 3A8CA 2ZHWH 8GCHG 1RTFB 3EA7A 4DY7B 1VCWA 3PMJA 2O9QA 5T6FA 2H5CA 1MTWA 2R3UA 2ULLA 2D26C 1O2NA 1T8MA 5JB9S 4X8VH 4RKOB 4X8TH 1XMNB 1PQ5A 1GJ4H 1HDTH 1F7ZA 2B5TB 4D7GA 1ANBA 1WAYB 3RXTA 1QURH 3SO3A 3NWUA 2R0KA 2OC0A 3RXIA 1THRH 3PLBA 4TWWA 2V0BA 1HAVA 4CREA 1XKBC 1A0JA 3E91A 3LU9B 1O3BA 2TIOA 1AE8H 2GVFA 4ZKRU 2ZDVH 2PKSC 3BV9B 2Z7FE 2P95A 5A8XA 1P2IA 2GDDA 1TGNA 1HJAB 2Y7XA 5A8YA 4TY6A 4JCNA 1FPCH 1ELCA 3LC3A 3PWBA 4HFPB 1FONA 3GCOA 1SG8B 1NS3A 3LGIA 3M7UA 3URDA 3A8BA 5JBCS 3ATIA 4B2BA 1A3BH 1YLDA 2V35A 1O5AB 4ZHAA 1S5SA 4WXVA 2G52A 2VIOA 5JPMH 4YLQH 3ZZAA 2BXUH 4FXGH 2PV9B 3QGNB 1SFQB 1TGSZ 3E0NB 1TX8A 2IJOB 1O3LA 1BTXA 1TYNA 1KDQA 1HPGA 1K9OE 1CBWB 2CGAA 2RCEA 2P8OB 1LVOA 2WPJS 3NPSA 3ZZ9A 3KQEA 4AB8A 5AVDA 3UTUH 1LQDB 2AEIH 4A7IB 2FXRA 1FXYA 4I8LA 2ZGBH 4NGAH 1C1WH 3TK9A 2GCHG 1C2IA 2HALA 5AFZH 3HK3B 3BTGE 1GBDA 1NFWA 2ZHFH 1SLWB 1TOCB 3LPRA 1GI5A 1Z1IA 2P3TB 2WUCA 1CT2E 3A7TA 4BAQB 1UVOA 5GWZA 1DICA 2F83A 2ZPSA 3DD2H 1UTMA 4GPGA 2OTVA 1GBBA 3PB1E 2FM2A 1ETRH 2Z3DA 1J15A 1FY4A 1MCTA 3UY9A 1YPHE 3C27B 4B2CA 2ZEBA 2TRMA 4CBOA 2R2WU 3SHCH 2D2DA 1ANDA 4H6TA 1AZZA 1S0QA 2ZGCA 1EQ9A 3ZZ5A 5EPYA 3KIDU
chains in the Genus database with same CATH superfamily
3ZVDA 1C2MA 1EFRD 2TBSA 2QA9E 5JBTA 2RDEA 1C2HA 3SU1A 1K1MA 1ZPBA 2W3IA 1GG6C 1P05A 1H9HE 1VITG 1L0ZA 3RUOA 3T25A 5A2MH 3TLOA 1UMAH 1C5SA 1MQ5A 1TPAE 2Y5HA 1AVWA 3QO6A 1E1RD 1MZAA 3H7TA 5DK1A 1V2MT 2KAIA 3UIRA 2HNTE 1Z1JA 1MTUA 1UK3A 2VVVA 3SNAA 1YWUA 2WPMS 3A7YA 2PLXA 3EQ0H 4NFFA 3L3TA 1N8OC 5K7RA 1A5HA 1UTQA 1FPHH 2VWMA 1GPZA 5EODA 5L6NH 3BTHE 3BEUA 4OGYA 1AO5A 2XRCA 1HAGE 2STBE 4Y71A 5F03A 3A7XA 6ESTA 4FU8A 1VCPA 3ZV8A 2KZ4A 3GY5A 1Y5AT 2FI3E 2WPKS 1SR5C 3Q77A 1MH0A 1O34A 4K69A 3LGTA 2FOEA 2A5IA 3MYWA 2JIZD 4WWYA 5ESBA 1OP2A 2ZFFH 1P9SA 3QZRA 1GVZA 4ASUD 2F4LA 2PP6A 3U8TH 2Z9JA 1SGCA 4WY3A 1WV7H 3SUFA 1YC0A 4ZKSU 5L30H 3BTDE 1P9UA 2QAAA 4K1TA 1A4WH 1MAXA 1W8BH 2SGEE 2ALPA 2Y80A 4YZUA 5FBEA 1GWAA 1DS2E 4DJZB 1AWHB 4MPVA 4FUIA 2F9VA 5E2OA 4A1VA 3VGCB 4KTSA 4YM9A 1ZHMA 8KME2 2ZU2A 1TE0A 1GGDC 4X1PU 1E38B 3GOVB 4YO9A 1V2JT 1MD7A 4BTTB 1RJXB 4ABEA 1ZJKA 2KM0A 2Q6FA 1Z8RA 1DXPA 3RXVA 2VU8E 1F0UA 1FIZA 5EJ1A 2ZHEH 1BBRE 2W7UA 3E1XB 3PV4A 3OU0A 3LIWA 1CE5A 2UUFB 4LZ4B 7GCHF 3SV9A 3PROA 2CHAB 1TRYA 4XDEA 1AN1E 2XCNA 3RU4E 2KCPA 5E0GA 1ZTJA 1GI1A 3RMNH 2AMDA 3N99A 1TNIA 1TNLA 2XBWA 5GCHF 3WW7A 1O2YA 1UCYK 3A8AA 3F2GA 3HGPA 1UTPA 5HMAA 2P59A 4BNRA 4NCYA 1KTSB 2GGVB 1YPLH 4ABBA 2ZPRA 2Q6GA 5C94A 1LMWB 3KNXA 1BA8B 4X2VA 4B1TA 4FUEA 1NFYA 2PTNA 1PYTD 1FZZA 3RXQA 1WBGB 1GHWH 1D3TB 3OFND 2F9PA 1C1SA 2OBOA 3PO1B 2C93B 2JH5D 4XE4A 5CDFE 3GYMA 4FVBA 3RXBA 3AW0A 2LELA 4UDWH 1HJAC 1QQUA 1BBRH 4DOQA 4CHAB 2R2MB 1YPKH 1IQLA 4AZ2B 3WWBA 1C5OH 1NT1A 1ZTKA 4Y6DA 1BCUH 1NTPA 3KL6A 2QE7D 4BTUB 1RTLA 3S69A 2ZU4A 2ZCKP 4TPYA 2Q6DA 1EJMA 1QB6A 4NWLA 4Y8XA 1S6HA 2C8YB 1YCPK 2QF4A 4H6SB 1LVYA 1ZPCA 3BF6H 2J5UA 4GLYA 4ABJA 4OS6A 1C9PA 4XD7D 1D3DB 1MTVA 4UFFH 4TY7A 4Y11E 3UWJH 4A1XA 3SJIA 1LDTT 2HPQH 2FI4E 3C1KA 1BZXE 1CBWC 1P3EA 2P8OC 4INKA 3BIUH 1GMDG 1XX9A 4AB9A 5C1XA 2K1QA 1O36A 2QXGA 1O30A 4ACAA 2SGDE 4DG4A 4MDSA 1AFQC 3QLPH 4BAOB 3M35A 4U2WA 4A5TS 5SGAE 1OWKA 1AFEH 1NO9H 1P11E 2H5DA 1D4PB 2BD4A 3PWCA 4K5ZA 2J38A 3D49H 3A88A 3U1IB 1Q2WA 4CRBA 3F3BA 5DJ7A 2ZNKH 3DT0H 3LJOA 2ESTE 3P6ZB 4MPWA 1AB9B 3SZEA 1COWD 2O8WA 4OS2A 2C8WB 2R0LA 3OY5U 1TALA 3UAIC 3SOSA 2ASUB 4A92A 1AZ8A 2NU4E 5EG4A 1W14U 2VVCA 2AFQB 3DFLA 1QL8A 2XTTB 3W1EA 1XKAC 2ZFTA 1OWJA 1C1VH 1SQOA 2CN0H 3MH7A 3PLPA 1P10A 1O3HA 4HG6A 1NRSH 1MCVA 3B8JA 1G2MA 3D62A 4O3TA 1GBCA 3I78A 3AW1A 1O2TA 2WV9A 3TK5A 3P17H 4RI0A 3FAOA 4AGKA 1K0HA 1HIAB 2AMPA 4FUHA 1SQAA 1GJDB 1F0RA 1IQKA 4ISHH 1JBUH 1LVBA 2ZIQH 1XUGA 2BOHB 1ZSKA 1K1JA 2FP7B 1E34B 1GJ9B 4IN2A 1DWEH 4YTAA 4ZUHA 1C1MA 4DW2U 1ELEE 1NC6A 3RXSA 1C5UA 2FOGA 3PTNA 3TH3H 2BDBA 4AOQA 5JYIA 2OC7A 2CJIA 4FU9A 2HWLB 1ELGA 2ZDKA 1DFPA 3GCHC 4F55A 1O5EH 4BXSA 4VGCB 2WUBA 1DANH 2HLCA 2QGRA 1SSXA 5PTPA 3ZYEA 4NA8A 2J97A 3M61U 1OWDA 3MU4A 4ZAEA 5DPAA 2VWLA 1BQYA 5FX5A 5FXLA 3E16B 1J8AA 3RXMA 4ZHLU 3SJOA 3UOUA 2ANYA 1QRWA 1Y59T 1FIWA 3VPKA 4XBDA 4XBBA 1P2QA 1Y3YA 1MTSA 3QK1A 4DT4A 1SGNE 3KQDA 2FOFA 3KHVA 2HPPH 3UR6A 2ZFQH 4THNH 1SLVB 1TGCA 3TGKE 1KY9A 1YKTA 4YESB 3MNBA 2A4RA 1F5RA 1MQ6A 4IGDA 3E8LA 3KYFA 1T31A 5DP8A 3V0XA 3L6PA 1MBQA 1NPMA 1BTWA 1S81A 1CHGA 1TPSA 1GHVH 2PR3A 9ESTA 5EW2H 4MTBA 3ZZ3A 5C20A 5L2YH 4GVUA 1NN6A 3SUGA 3T5FH 1V2PT 3ATMA 2FYQA 2STAE 4Q2KA 3RXFA 2F9OA 1NFUA 2ODYB 2XXLA 2ZTXA 4PROA 2CHAC 4UFEH 2A0QB 4KTUA 1L1NA 4BXWA 3VG8A 3TVJB 1G3BA 2FLRH 3TIUA 2AH4X 3DCLA 1TBRH 1HBTH 1ELBA 4YT7H 1SPJA 2KCOA 2ZDLA 4J2YB 4GSOA 2FODA 2GZ8A 3EGKH 1G9IE 3M36A 1MKWH 2WPIS 2BVXH 3I77A 1SGDE 2J98B 5CHAC 1GBJA 2A4OA 1EAWA 3QWCH 3PO1C 1INCA 3F2HA 3QDZB 1FLEE 3RXAA 3BTEE 1O2IA 4GHQA 3T27A 1DY8A 1PPCE 3FZZA 1RFNA 1C5WB 2A7HA 3D23A 1PPBH 1Y5UT 3VB7A 3SQEE 3F9EA 1QBNA 1RD3B 2OC8A 1T8LA 3RC4A 1PJPA 3UWIA 4GCHG 1TQ0B 2XBYA 1QZ8A 7GCHG 4E05H 3AASA 1ZHRA 3D65E 1MKXK 5FPSA 1FY5A 1BIOA 1JOUB 2TGDA 1O2ZA 5GCHG 5LH8A 3M3TA 1HRTH 4BANB 2Z3EA 1EOJA 2ZCLP 1XM1A 1E36B 3LT3A 4K3JA 2XBXA 2PGQB 1A0HB 3OX7U 1AVXA 1A0LA 1C5NH 3RXGA 3ZIAD 2BXTH 4ZCNA 1SHHB 1UJ1A 2PWXA 2A5KA 2VGCB 1H8DH 1XUFA 1ZMJA 1A61H 2G5NA 2AMQA 2ZTYA 1O2GH 3SU4A 4K1EA 2WV4A 1O31A 1GBFA 2ZWLH 4X1SU 2FZZA 2UWLA 2EI6A 1UTNA 4DGJA 3T62A 1FAXA 1GI8B 2G5VA 1OYQA 4WMEA 1N1LA 3NXPA 1P09A 4SGBE 1E0FD 1V2VT 3NCLA 1UHBB 3T26A 3SV6A 4ABAA 1DWCH 1SGIB 4NA9H 1AB9C 1IQNA 3NRLA 4M7GA 3T2NA 4WJG2 3WY8A 3CP7A 5G4BA 2RA0A 2JJ1D 3PMHB 1WTHD 2O8UA 2Y81A 1EB1H 1RXPA 2BD7A 1H8IH 1TLDA 2WV5A 3SORA 1FUJA 3OSYA 5E8EH 5EOKA 3N7EA 1O35A 1GI9B 1GMDF 2Y5GA 1O3MA 1WCZA 2G4TA 1VITH 4RT1A 1V2UT 1EAXA 5E0HA 2NU0E 2B7DH 1C2FA 1P2OA 2QF3A 1QB9A 2OD3B 3VB6A 4I8HA 1C5RA 3E0PB 1PPFE 1O3EA 4JZFH 2ZECA 2FX4A 3N7DA 1TA6A 2HOBA 1ZYOA 5DN6D 3RLYH 2SGFE 2ZDMA 5KEDA 2BQWB 1P02A 1ZOMA 1D6WA 2IJD1 5CE1A 4FUGA 2FLBH 2SNVA 3K2UA 1KMHB 5F53A 1P12E 3LGUA 1P03A 5EJZA 4E7RG 4INHA 2PUQH 5FL7D 5K0HA 1EP6A 1C1RA 2BQ6B 4AYVB 2HRVA 3Q3YA 1F5LA 3HK6B 1PQ8A 4VGCC 7KMEH 2A7JA 3KYGA 1VJAU 3FVFB 1K1NA 5HIZA 4RT0A 1AKSB 1D3PB 2OUAA 1GBHA 3ZVAA 4I33A 5JBAS 3DSGA 2Z94A 1LKAA 2A7CA 5JBBS 2Y6TA 1QBOA 1HAYB 2ZHDA 2PFEA 3MU5A 1PYTC 4X2WA 2G51A 3MMGA 2G4UA 4AN7A 3A84A 3EA9A 1BRUP 1G36A 1GJCB 1PPGE 2W5EA 2BZAA 1ZTLA 1LCYA 2W3KA 1HLTH 2JJ2D 1FX0B 1O2HA 3A7VA 2BLWA 2BY7X 4QT8C 2OINA 1ABIH 4ESTE 1WXRA 4NG9H 2AS9A 3ENSB 5DP7A 1LHCH 1DVAH 3HATH 2RFKC 1P2KA 1FV9A 2BDIA 3MOCA 3KQBA 2UWPA 1YPEH 4YOIA 3TNTA 4Y0YE 1O39A 3DA9B 5FPYA 4O97A 4Q7XA 4I31A 1W0ZU 1TGTA 2ZGHA 2ZCHP 2ZHQH 1F92A 2FS8A 5FBIA 2OQUA 4LK4A 1V2ST 1JXPA 5TCCA 2BHGA 3O8DA 1VJ9U 3BG8A 3BTTE 1BTUA 2IN2A 1KLJH 1QB1A 5C1UA 1F5KU 1NU7B 1C5MD 1IAUA 1UO6A 5I46H 1KLTA 7ESTE 3RXJA 5EU8A 1HAVB 3VB5A 1ZGIA 5FCKA 2GP9B 1CU1A 1KIGH 4DIIH 2C8XB 3PRBA 3N7OA 1GJ7B 1BRCE 2A32A 3I29A 3A89A 2VIQA 1AUJA 1GJAB 3RXCA 3B23B 3O8RA 4HGCA 1PPZA 2FEQH 4CRCA 1N6XA 3OE7D 1EAUA 1GI7B 1EJAA 2ZDAH 1BT7A 1TPPA 4Y76A 2GMTC 1SGQE 5LPRA 5T6GA 5I25A 2ZPQA 3SJKA 1XUJA 3VXEH 4AFUA 5JDUB 1KXDA 4XRNA 2VJ1A 1QIXB 1JRTA 4P02A 4TYDA 3UNRA 1O3PB 4B74A 5E0JA 3F9HA 4ZH8A 1SGFG 1KDQB 2O8TA 1YBWA 3PLKA 4J1YA 1QFKH 1EZQA 1YM0A 2RDLA 4BAKB 1EAIA 3U69H 2PKAA 3SI3H 4I8GA 2A2QH 3W95A 1P06A 1E37B 3ATLA 1KXBA 1TX6A 2P94A 1SHYA 2FTLE 2L74A 3M5MA 4ZXXH 3RM0H 4B71A 1NY22 1DWDH 1WQVH 3MI4A 4MNXA 1TABE 1LO6A 1NU9A 1O2WA 1O3OA 3TU7H 1TWXB 9LPRA 3MU0A 4F48B 2UUKB 2VGCC 1WUNH 4MNYA 1YF4A 2FYRA 3M37A 1HAPH 3F0PA 3U8RH 4Z6AH 1CT0E 1S85A 4IC5A 4NZLA 3RP2A 3O8CA 1KXAA 3A87A 3KN2A 5FAHA 2J9NA 2KCYA 1GBKA 2G8TA 4GCHF 1EATA 1HV7A 2A4QA 3RMMH 1ZLRA 1GJ8B 3SGAE 5EGMA 2AIPA 1O2OA 1EZSC 3GISB 1S82A 3BTKE 1E35B 1O5CB 1K1OA 1E1QD 1SBWA 3NZIA 5IDKA 2GV7A 1EASA 3RXKA 1GDQA 1OYTH 2XNIA 1FAKH 1VGCB 2CK3D 3A7WA 3MQKC 1EZXC 1SI5H 1NBME 5JB8S 5EW1H 1BTHH 1SC8U 1UCYE 1Y3WA 4Q4LA 1GVKB 2P16A 1O0DH 2XCFA 3SUEA 2ZA5A 2ZI2H 3BIVH 5C5NA 1CQQA 3CENA 4HZHA 1O2LA 3STIA 2GD4B 1KLIH 2JETB 1Z71A 2O8MA 1O5DH 3SV2H 1EJNA 4GAWA 2KAIB 1ZPZA 3Q00A 3PRDA 4CBNA 1B7XB 2BYAX 5CMXH 4NA7A 1AHTH 2BX4A 3AAVA 1BRBE 2ANMH 3AK5A 3A7ZA 5BPEA 2PW8H 4ZHMU 1LHDH 3URCA 1H8ED 4FUJA 2IPQX 4Q63A 1QHRB 2JDID 3TJNA 1GHXH 4HI3A 3MNXA 4AORA 3RXHA 4ACBA 3RDZA 4E7NA 2KFWA 3TK6A 1LTOA 1GBTA 2YNAA 2UWOA 1IQIA 1SLXB 3ZVCA 1G3DA 3DFJA 3BG4B 1UCYH 3DHKH 4CRGA 1GJ6A 3NKKA 1G30B 1MU6B 2BMGB 3TPIZ 1ETTH 1RTKA 1NROH 2J34A 2ILNA 1FY8E 2BDCA 1NESE 2RG3A 1S84A 3BSQA 1GMHF 1JIRA 2AERH 2XC0A 4RKJB 2EQNA 1TGBA 1AUTC 2BX3A 1CSOE 2J95A 4OS1A 4X8UH 1TMUH 2OC1A 2VVUA 4U01A 4O03A 2BDYA 5EIYA 2FO9A 3H7OA 2KR7A 2V3HH 4Q7YA 1A5IA 3TJUA 1ACBE 2BD8A 3VFEA 1DUEA 1NRRH 1W0YH 2ANKH 4CR5A 2BD9A 2C3SA 1FY3A 4ISNA 5IK2D 2V7QD 3QZQA 5C67A 3A80A 3RMOH 3SNEA 3BTFE 2BLVA 1C1QA 1SGFA 1T4UH 1ZGVA 3UPEA 3UREA 4ABDA 1YCPH 1EOLA 2P3UB 3TJOA 1DPOA 3ELAH 2YOLA 1W12U 4DCDA 1HNEE 3GY6A 3GY8A 4JZ1A 1RIWB 4NSYA 4MQAA 1XUIA 1TBQH 1CGJE 4LOYH 1B5GH 1DSUA 1S6LA 1YYY1 3DSOA 4X6NA 1XVMA 1HAZB 3FFGA 1T8NA 3HPTB 2FS9A 3GY3A 3QUMP 4NWKA 4UEHH 1HYLA 2ZP0H 3OTPA 1MUEB 1KXCA 3V3MA 1SVPA 1UTKA 2F3CE 4KELA 1HB0B 1CA0B 1P2NA 5T1VA 5GDSH 4IW4E 1AGJA 1ELFA 1OS8A 1FY1A 3MO6A 1C2DA 3MTYA 1J17T 1A46H 1ELTA 1JIMA 1SB1H 2H1UA 4ABHA 2EC9H 4WH6A 1ZRKA 3F68H 1NRQH 1W3CA 3QTVH 5FCRA 3QN7A 2W26A 1DOJA 4KGAA 1TMTH 2JH0D 2QCYA 1RS0A 1HCGA 2PKSB 2ZFPH 3SN8A 4MNWA 1V2TT 1OWIA 1QL7A 1VCQA 4KTCA 1SGTA 4X1RU 1FDPA 2F9NA 3E90B 1EZUC 1O3JA 1OP8A 4JMYA 1Y8TA 4MPUA 1FQ3A 2OP9A 2FTMA 4I86A 4CR9A 3IITA 1FMGA 2Z9IA 1O2RA 5GPIB 3VB3A 3F9GA 4AYYB 3M5OA 1DWBH 1KTTB 2DUCA 3P70B 1T7CA 1GBIA 1J14A 2A4GA 1DITH 1XUHA 5A09A 8LPRA 1JWTA 1ZHPA 2EI7A 1P01A 1V3XA 2V6NA 1C1OA 3MH5A 1GCDA 1WSSH 4BTIB 3UQOA 2ZFSA 1H9LB 1Q31A 2CV3A 4R0IA 1G3CA 3AVZA 4RSPA 4Z0KA 1EB2A 3VGCC 1A7SA 4H42U 2XBVA 3CS0A 1RRKA 3B9FH 4K2YA 2C8ZB 1O3DA 4JZIA 1OWHA 1AVGH 2IOTA 2B9LA 1HFDA 3MHWU 3T28A 3V13A 1S6FA 3V12A 3OAAD 4X1QU 3SUDA 3PV2A 4O3UA 3M7QA 1ARCA 4Y7AA 4LZ1H 1Y5BT 5F6MA 3ZZBA 1P3CA 3RXUA 4Y8ZA 4FUFA 2Z9GA 3EA8A 1TFXA 5IYTA 4OS7A 3MO9A 2FX6A 1TNHA 3ESTA 4X6OA 1C5ZB 2GTBA 1VGCC 3ZZDA 2XW9A 2ZO3H 1TNGA 5DP3A 2ZU5A 2G55A 1A3EH 1IHTH 3SGBE 1OPHB 3AAUA 1HGTH 1BJVA 1ZRBA 1B0EA 3R3GB 1ANEA 1YLNA 3DUXH 1QRZA 2ZGXH 1O32A 3ZVBA 1Y3UA 2P3FH 1HJ8A 2JETC 1GL1A 4FVDA 3EDXB 3RXEA 4DIHH 4OS4A 1L4ZA 1ANCA 1GDUA 3S0NA 1W2KH 1IQGA 3GY7A 5F8XA 1GBAA 3RU4D 3SU0A 5DP9A 1C5YB 1NZQH 1G3EA 4ASHA 3RXDA 2Y82A 3F2FA 4X6MA 2XWBI 3A8DA 1P04A 3K6ZA 4CHAC 1YLCA 1EPTB 5EQQA 3RC5A 2C4FH 1C5QA 2AYWA 2VWNA 1E79D 4OM9A 3BTME 5FPTA 1D3QB 3K6YA 1SOTA 3EE0B 1F0TA 1NFXA 1AI8H 2ZU1A 6CHAB 3TGJE 2VWOA 2SGAA 5T3HA 4NSVA 3BG4C 4WMFA 2HLDD 4JK6A 1O2XA 3RM2H 2QY0B 1BMLA 1SGEE 3ZVEA 3RXOA 1BJUA 2GT7A 2GT8A 3L33A 2XNDD 4K60A 1Z8GA 3IG6B 3PMAB 4TPIZ 1EKBB 4FU7A 3H5CB 1O5BB 1YY3A 1GJ5H 1AQ7A 1V2LT 3BTQE 4DT7B 1HAXB 4Y10E 4ABFA 1HXEH 1L1GA 1BRAA 5LPFA 5A8ZA 2BY6X 2IPHA 2HVYB 1W7XH 3PYHA 5EQSA 3QTOH 4RN6A 3FANA 4UFGH 3MNCA 1Z8IB 1ID5H 5GNDA 3RXRA 2KCAA 1LPKB 4B6EA 3VEQB 4D9QA 5C3NA 3U1JB 1MKXH 2QXJA 3Q3KA 4CRDA 1AD8H 1BMNH 1RIWC 5DP6A 1VR1H 2W7SA 1MZDA 5EQRA 2YNBA 3U98H 1P57B 4ISOA 2YMSD 1J16A 1ELVA 1K1IA 4CRAA 4I8JA 3SQHE 1V2RT 2ZC9H 1OXGA 1O3GA 1KSNA 1K1LA 3QX5H 3GDVA 1ESTA 4H4FA 3GY2A 5DP5A 1CA0C 4UONA 1O5FH 3A86A 3ZZ6A 3NK8A 3SYJA 2SGQE 1GMHG 4BAMB 1XXDA 1O2KA 3ODFA 4YLUA 2FPZA 3ZVGA 1LVMA 5AF9H 1AU8A 2VB0A 1C9TA 1QBVH 2HNTF 5DGJA 5T6DA 2W6JD 3SI4H 4IMQA 4JZEH 3GCTF 2ZQ1A 2FOCA 2XWAA 3LDXH 1O5GH 4CH8B 1GI2A 3K65B 1C2KA 7LPRA 2Z9LA 3UR9A 2ZF0H 4TSFD 2VIPA 3R0FA 4WMDA 4KKDA 3PMBB 3ZYDA 1K22H 1UVUH 1C1PA 1S0RA 1L4DA 1QA7A 1QCPA 1V2OT 2QC2A 2ZKSA 2M2AA 4I7YH 1CVWH 4D7FA 2A5AA 2Z9KA 1OKXA 1WTGH 1PPHE 1K28D 4X0WU 3SW2B 8ESTE 4AG2A 5A0CA 1J9CH 1A1RA 5C1YA 1DLKB 1A5GH 1QNJA 5EPNA 2OXSA 1YPJH 1BDAA 1TX7A 1W10U 2TGAA 4X2YA 5DSFA 1UTJA 1HJ9A 3M3SA 2H9HA 4I8KA 3K9XB 3F9FA 1MBMA 1O2MA 1ZJDA 1DX5M 5J4SA 4Y7BA 4WH8A 1THPB 3SNBA 1AFQB 1BHXB 1TNKA 3LGVA 2FESH 3G01A 2R9PA 1BB0B 2I6SA 1SL3A 4X1NU 3JZ1B 2BY8X 1GHYH 5KGOA 2VIVA 2OCVB 1IQMA 1ZR0A 3A85A 4ZROA 5TCAA 2FI5E 1T8OA 1IQJA 1BUIA 2THFB 1TAWA 1O3IA 2FDAA 1L2EA 5EXMA 1YPMH 1D9IA 1Z8JB 4F4OC 1CA8B 2FIRH 2ZGJA 1TNJA 2FOBA 2XYAA 4IN1A 2K0QA 4XOJA 5H4IB 2VIWA 2WZQA 3U28C 1C5LH 1PQ7A 2GDEH 1BHXF 3UNSA 5HIYA 1C2LA 2GX4A 1ZMNA 2C90B 4WF8A 3SU3A 1TB6H 3O8BA 3GS9A 3ATKA 3KGPA 2ODPA 2V3MA 1ETSH 2PUXB 2BDAA 2O8LA 1S83A 3SU2A 3U9AH 1QJ6B 2FOMB 1GHBF 2H9EH 2WSSD 4WVPE 3LC5A 1YGCH 3EYDA 4F49A 1ARBA 2BY9X 2WPHS 1Z7KA 1C4V2 3TGIE 2ZFRH 2AHME 1K1PA 1QA0A 3CS7A 1AIXH 4GHTA 5HYOA 3FP8E 1UTOA 2FMJA 1Z6EA 1C2GA 2WYGA 2QXHA 4WXIA 3TITA 1W11U 1FN6A 2BM2A 2QV1A 1T4VH 1ZZZA 1EPTC 5DG6A 5TJXA 4NFEA 5C5OA 1BOQA 3UFAA 2YMSB 1VKYA 4XSKU 1HXFH 1RGQA 1UVSH 1OHHD 4CRFA 3S9BA 1AWFH 1TBZH 2VINA 3GCHB 1THSH 3GCNA 6CHAC 1EX3A 5GIBA 1QJ1B 1C5PA 1GCTB 1DXWA 4B76A 5GJ4B 2BLOA 2BLQA 2AGGX 1X7AC 2DE9A 2EEKA 2ODQA 1Y3XA 2L6OA 1TOMH 4ZMAH 4A1TA 2QYIA 1G2LA 3UNQA 2J2UA 1C5TA 2QF0A 1QQ4A 5BRRE 1CHOF 3LH1A 1HAOH 4UFDH 1C4U2 3ZVFA 3P8FA 1DSTA 1YPHC 2ALVA 1EUFA 4YXWD 1BMAA 1SOZA 1EP5A 2QF5A 2V3OH 1PFXC 3SBKA 2Q1JA 3V7TA 4MLFB 3ZZCA 3U8OH 2ZZUH 4U30A 3RU4T 1GMCF 4X2XA 3KF2A 3RMLH 4FUDA 3MWIU 2VH6A 2XC5A 4D8NA 3TH4H 3P8GA 5KECA 4GUXA 1HAHH 3TNSA 4JYTA 3SHAH 1TPOA 1O3NA 3GDSA 1GHAF 3SNCA 3ZZ4A 1P2JA 1BBRK 2F43B 2RA3A 1C2JA 1MAYA 3PTBA 1LQEA 3LH3A 3SNDA 2VH0A 1O2SA 2HNTC 1O2PA 1SLUB 1H1BA 1XXFA 1A2CH 1C1NA 4XBCA 2LPRA 5B6LA 4X8SH 4B75A 1P2MA 1O33A 1Z6JH 1GHZA 2TGPZ 1V2WT 3SGQE 3LGWA 3W94A 3HGNA 2NU3E 3STJA 2W6ID 2B0FA 4JZDH 1W7GH 3P8OA 4AGJA 1TRNA 5L2ZH 3QGJA 1BTYA 1CO7E 4NIXA 1NRPH 2J92A 5DP4A 1HUTH 2G00A 3NUMA 4Q80A 5J4QA 3ZV9A 4B2AA 1H4WA 4YT6H 3RC6A 1C4Y2 2WYJA 1ABJH 3P95A 3OYPA 4UD9H 2WINI 1HIAA 3PM3A 2EY4C 2Y7ZA 1UK2A 5CHAB 3P8NA 2GCTB 5AHGH 4I32A 4O9VA 1SKYE 5C0UA 2ZDNA 1CT4E 1AE5A 3GYLB 2QN5T 2CMYA 2FWWA 4DVAU 2VNTA 3S9AA 1JRSA 4MVNA 1SGYE 1NRNH 4B73A 2GZ9A 3KQ5A 1LHFH 1UW7A 5F8ZA 2PTCE 3KEEA 6GCHG 5HM2A 2CF8H 4Q7ZA 2F9BH 1YPGH 2A2XH 1PQAA 8GCHF 4ZKNU 2PKAB 3FO8D 3VXFH 1L1JA 5LGOA 5E2PA 1UK4A 3HKJB 3EE7A 4R8TB 3MH4A 1SGPE 2BVRH 4ABIA 3M5LA 4NIWA 2TGTA 5ABWA 4U32A 2NWNA 3TH2H 1G32B 1O2QA 4FETA 4JYUH 2BTCE 3A82A 4ZXYH 2ZG0H 1MTNB 1OSSA 1DUAA 3FZDA 2D8WA 1GI4A 1GI3A 2I6QA 3FP7E 1ZSLA 5GXPA 2JKHA 3TJVA 3GCTG 1KXFA 4MNVA 5DKMA 1GDNA 3LKWA 3DSPA 3GICB 1ELAA 4YOJA 2BD5A 2CXVA 1WU1A 1HAIH 3F6UH 4ISIH 1MD8A 4MG3A 1OX1A 3S7KB 1O2UA 1BITA 3MFJA 3SZNA 4TT3D 1VZQH 5EXLA 1DLEA 1SQTA 2BB4A 2SNWA 1M9UA 2OQ5A 5HGGA 4AFQA 3ITIA 1KXEA 5ETXA 2DE8A 1D6RA 3SU5A 2BY5X 2G81E 1DM4B 3KCGH 3M5NA 1UVPA 2VBCA 1O37A 1O3FA 5FX6A 4AG1A 1P8VC 1O3AA 2HVXA 2J4IA 3FKSD 1LHGH 2BDGA 2BVSH 1O2JA 1MMJN 3RXLA 3SV8A 4A6LA 2GCHF 3ZZ8A 1AMHA 1OOKB 1YP9A 2AGIX 2BOKA 3IWMA 4DURA 3MNSA 1BMFD 4Y0ZE 2J98A 2JH6D 2D1JA 3UUZA 1KYNA 1ESAA 3ODDA 4D9RA 1IHSH 4K8BA 2XOKD 3T29A 4BOHA 4OS5A 3M3VA 1ORFA 3OTJE 1SGRE 1SMFE 1QL9A 5A0BA 1V2NT 2A31A 2B8OH 3A81A 1DE7H 1IQHA 1GL0E 1EPTA 2YMSC 5C2ZA 2SGPE 1W0JD 2A1DB 2ZQ2A 4XFQA 2BZ6H 1DY9A 3ATWA 1F2SE 1O38A 1QY6A 1GCTC 2QXIA 1ZSJA 3RLWH 3GY4A 3E6PH 5LPEA 1ELDE 3HKIB 2PSXA 3P92A 1GHBG 1GBEA 1VITF 2ZTZA 3UOPA 3S9CA 1GI0A 1WQSA 3H09A 4OGXA 1GVLA 3EAJA 2VIDA 4FOUC 4B6FA 2K8IA 3M7TA 4X6PA 4JYVH 2GV6A 4AFZA 2EI8A 3LONA 1SQRA 5HXFA 2FOAA 1FJSA 1IOEA 1QGFA 4NIVA 1CGIE 2FOHA 3Q3XA 3SU6A 1ESBA 1UTLM 1GBMA 1MKWK 1EXFA 5B6OA 4E06H 2OLGA 2BD2A 1W13U 2Z6BD 2BDHA 3MU1A 1QTFA 2M5TA 2UUJB 3ZZ7A 1WOFA 2H6MA 1LKBA 1H8HD 4YOGA 3F0OA 4AFSA 1UHBA 2H2ZA 1V6DA 4NZQA 1C5XB 2NU2E 3FP6E 3VB4A 2WPLS 3Q76A 2F9UA 1OWEA 1AY6H 1LPZB 1SFIA 1BMMH 2OK5A 4JK5A 1TQ7B 1FI8A 3UQVA 1FN8A 1MU8B 2HGTH 3FOAA 1GG6B 2AGEX 1U6QA 1CHOG 1O2VA 3LGYA 1QR3E 4KP0A 2BD3A 5A0AE 3BEFB 5EXNA 4AC9A 1DDJA 1P0SH 1GI6A 1OP0A 1BTZA 3UB0A 1FNIA 1TIOA 5ESTE 2PGBB 4IS5A 4TWYA 1F0SA 1N8OB 5FHTA 1C2EA 2TPIZ 1GMCG 1WDIA 1NBMD 4IMZA 1DT2A 1IQEA 1LPGB 2GCTC 4D76A 1TMBH 3SJ8A 4K8YA 5HM9A 4SGAE 2GJGA 4IC6A 1GBLA 4ZKOU 1B0FA 2UUYA 2GMTB 3JZ2B 1NM6A 3LOXA 1G37A 1GHAG 3BEIB 1K2I1 4MPXA 2BQ7B 3OY6U 1BTPA 1LHEH 1C5VA 4ABGA 5C17A 4BAHB 3MO3A 2WHXA 4FUCA 5DO4H 2KX4A 4FUBA 2R3YA 1O3CA 2Y5FA 3E3TA 2NU1E 1AKSA 3MH6A 4Y8YA 3A83A 3S7HB 1CGHA 1XVOA 1Y3VA 2GZ7A 3BTWE 1TONA 4CH2B 2J94A 4HTCH 5C0TA 2CF9H 2PSYA 4NIYA 3SV7A 1UVTH 2A45B 1H9IE 4Y79A 3GDUA 2H9TH 1QRXA 1JMOH 2LNCA 1MTNC 1XUKA 2ZU3A 3BN9A 1GJBB 2F91A 4IBLH 1K21H 3SJ9A 1MABB 1GGDB 1YCPM 1ZMLA 1V2QT 3MU8A 4AX9H 2QIQA 2AIQA 4K1SA 1T32A 3KQCA 4P00A 6LPRA 2EA3A 2SFAA 4LXBH 2XC4A 2PHBA 1QJ7B 2ANWA 1V2KT 5AFYH 1IQFA 3LJJA 2OBQA 4UE7H 4ISLA 1C1UH 3F1SB 1TRMA 6GCHF 4INLA 2GKVE 2Z3CA 2P93A 1N6YA 1C1TA 1Q3XA 1PPEE 3RXPA 1WYKA 1O3KA 2WPDD 5F8TA 1TA2A 3A8CA 2ZHWH 8GCHG 1RTFB 3EA7A 4DY7B 1VCWA 3PMJA 2O9QA 5T6FA 2H5CA 1MTWA 2R3UA 2ULLA 2D26C 1O2NA 1T8MA 5JB9S 3OEED 4X8VH 4RKOB 4X8TH 1XMNB 1PQ5A 1GJ4H 1HDTH 1F7ZA 2B5TB 4D7GA 5HKKD 1ANBA 1WAYB 3RXTA 1QURH 3SO3A 3NWUA 2R0KA 2OC0A 3RXIA 3OEHD 1THRH 3PLBA 4TWWA 2V0BA 1HAVA 3CNRA 5CHBA 4CREA 1XKBC 1A0JA 3E91A 3LU9B 1O3BA 2TIOA 1AE8H 2GVFA 4ZKRU 2ZDVH 2PKSC 3BV9B 2Z7FE 2P95A 5A8XA 1P2IA 2GDDA 1TGNA 1HJAB 2Y7XA 5A8YA 4TY6A 4JCNA 1FPCH 1ELCA 3LC3A 3PWBA 4HFPB 1FONA 3GCOA 1SG8B 1NS3A 3LGIA 3M7UA 3URDA 3A8BA 5JBCS 3ATIA 4B2BA 1A3BH 1YLDA 2V35A 1O5AB 4ZHAA 1S5SA 4WXVA 2G52A 2VIOA 3WWFA 5JPMH 4YLQH 3ZZAA 2BXUH 4FXGH 2PV9B 3QGNB 1SFQB 1TGSZ 3E0NB 1TX8A 2IJOB 1O3LA 1BTXA 1TYNA 1KDQA 1HPGA 1K9OE 1CBWB 2CGAA 2RCEA 2P8OB 1LVOA 2WPJS 3NPSA 3ZZ9A 3KQEA 4AB8A 5AVDA 3UTUH 3PV5A 1LQDB 2AEIH 4A7IB 2FXRA 1FXYA 4I8LA 2ZGBH 4NGAH 1C1WH 3TK9A 1W0KD 2GCHG 1C2IA 2HALA 5AFZH 3HK3B 3BTGE 1GBDA 1NFWA 2ZHFH 1SLWB 1TOCB 3LPRA 1GI5A 1Z1IA 4Z1MD 2P3TB 4M9FA 5EJLA 2WUCA 1CT2E 3A7TA 4BAQB 1UVOA 5GWZA 1DICA 2F83A 2ZPSA 3DD2H 1UTMA 4GPGA 2OTVA 1GBBA 3PB1E 2FM2A 1ETRH 2Z3DA 1J15A 1FY4A 3FN8A 1MCTA 3UY9A 1YPHE 3C27B 4B2CA 2ZEBA 2TRMA 4CBOA 2R2WU 3SHCH 2D2DA 1ANDA 4H6TA 1AZZA 1S0QA 2LP6A 2ZGCA 1EQ9A 3ZZ5A 5EPYA 3KIDU
chains in the Genus database with same CATH topology
3ZVDA 1C2MA 2TBSA 2QA9E 5JBTA 1C2HA 3SU1A 1K1MA 1ZPBA 2W3IA 1GG6C 1P05A 1H9HE 1VITG 1L0ZA 3RUOA 3T25A 5A2MH 3TLOA 1UMAH 1C5SA 1MQ5A 1TPAE 2Y5HA 1AVWA 3QO6A 1MZAA 3H7TA 5DK1A 1V2MT 2KAIA 3UIRA 2HNTE 1Z1JA 1MTUA 1UK3A 2VVVA 3SNAA 2WPMS 3A7YA 2PLXA 3EQ0H 4NFFA 3L3TA 1N8OC 5K7RA 1A5HA 1UTQA 1FPHH 2VWMA 1GPZA 5EODA 5L6NH 3BTHE 3BEUA 4OGYA 1AO5A 2XRCA 1HAGE 2STBE 4Y71A 5F03A 3A7XA 6ESTA 4FU8A 1VCPA 3ZV8A 3GY5A 1Y5AT 2FI3E 2WPKS 1SR5C 3Q77A 1MH0A 1O34A 4K69A 3LGTA 2FOEA 2A5IA 3MYWA 4WWYA 5ESBA 1OP2A 2ZFFH 1P9SA 3QZRA 1GVZA 3U8TH 2Z9JA 1SGCA 4WY3A 1WV7H 3SUFA 1YC0A 4ZKSU 5L30H 3BTDE 1P9UA 2QAAA 4K1TA 1A4WH 1MAXA 1W8BH 2SGEE 2ALPA 2Y80A 4YZUA 5FBEA 1GWAA 1DS2E 4DJZB 1AWHB 4MPVA 4FUIA 2F9VA 5E2OA 4A1VA 3VGCB 4KTSA 4YM9A 1ZHMA 8KME2 2ZU2A 1TE0A 1GGDC 4X1PU 1E38B 3GOVB 4YO9A 1V2JT 1MD7A 4BTTB 1RJXB 4ABEA 1ZJKA 2Q6FA 1Z8RA 1DXPA 3RXVA 2VU8E 1F0UA 1FIZA 2ZHEH 1BBRE 2W7UA 3E1XB 3PV4A 3OU0A 3LIWA 1CE5A 2UUFB 4LZ4B 7GCHF 3SV9A 3PROA 2CHAB 1TRYA 4XDEA 1AN1E 2XCNA 3RU4E 5E0GA 1ZTJA 1GI1A 3RMNH 2AMDA 1TNIA 1TNLA 2XBWA 5GCHF 1O2YA 1UCYK 3A8AA 3HGPA 1UTPA 5HMAA 2P59A 4BNRA 4NCYA 1KTSB 2GGVB 1YPLH 4ABBA 2ZPRA 2Q6GA 1LMWB 3KNXA 1BA8B 4X2VA 4B1TA 4FUEA 1NFYA 2PTNA 1PYTD 1FZZA 3RXQA 1WBGB 1GHWH 1D3TB 2F9PA 1C1SA 2OBOA 3PO1B 2C93B 2JH5D 4XE4A 3GYMA 4FVBA 3RXBA 3AW0A 4UDWH 1HJAC 1QQUA 1BBRH 4DOQA 4CHAB 2R2MB 1YPKH 1IQLA 4AZ2B 1C5OH 1NT1A 1ZTKA 4Y6DA 1BCUH 1NTPA 3KL6A 4BTUB 1RTLA 3S69A 2ZU4A 2ZCKP 4TPYA 2Q6DA 1EJMA 1QB6A 4NWLA 4Y8XA 1S6HA 2C8YB 1YCPK 4H6SB 1LVYA 1ZPCA 3BF6H 4GLYA 4ABJA 4OS6A 1C9PA 1D3DB 1MTVA 4UFFH 4TY7A 4Y11E 3UWJH 4A1XA 3SJIA 1LDTT 2HPQH 2FI4E 3C1KA 1BZXE 1CBWC 1P3EA 2P8OC 4INKA 3BIUH 1GMDG 1XX9A 4AB9A 5C1XA 2K1QA 1O36A 2QXGA 1O30A 2SGDE 4DG4A 4MDSA 1AFQC 3QLPH 4BAOB 3M35A 4U2WA 4A5TS 5SGAE 1OWKA 1AFEH 1NO9H 1P11E 2H5DA 1D4PB 2BD4A 3PWCA 4K5ZA 2J38A 3D49H 3A88A 3U1IB 1Q2WA 4CRBA 5DJ7A 2ZNKH 3DT0H 3LJOA 2ESTE 3P6ZB 4MPWA 1AB9B 2O8WA 4OS2A 2C8WB 2R0LA 3OY5U 1TALA 3SOSA 2ASUB 4A92A 1AZ8A 2NU4E 5EG4A 1W14U 2VVCA 2AFQB 3DFLA 1QL8A 2XTTB 1XKAC 2ZFTA 1OWJA 1C1VH 1SQOA 2CN0H 3MH7A 3PLPA 1P10A 1O3HA 1NRSH 1MCVA 3B8JA 1G2MA 3D62A 4O3TA 1GBCA 3I78A 3AW1A 1O2TA 3TK5A 3P17H 3FAOA 4AGKA 1HIAB 2AMPA 4FUHA 1SQAA 1GJDB 1F0RA 1IQKA 4ISHH 1JBUH 1LVBA 2ZIQH 1XUGA 2BOHB 1ZSKA 1K1JA 2FP7B 1E34B 1GJ9B 4IN2A 1DWEH 4YTAA 4ZUHA 1C1MA 4DW2U 1ELEE 1NC6A 3RXSA 1C5UA 2FOGA 3PTNA 3TH3H 2BDBA 4AOQA 5JYIA 2OC7A 2CJIA 4FU9A 2HWLB 1ELGA 2ZDKA 1DFPA 3GCHC 1O5EH 4BXSA 4VGCB 2WUBA 1DANH 2HLCA 2QGRA 1SSXA 5PTPA 3ZYEA 4NA8A 3M61U 1OWDA 3MU4A 4ZAEA 5DPAA 2VWLA 1BQYA 5FX5A 5FXLA 3E16B 1J8AA 3RXMA 4ZHLU 3SJOA 3UOUA 2ANYA 1QRWA 1Y59T 1FIWA 3VPKA 4XBDA 4XBBA 1P2QA 1Y3YA 1MTSA 3QK1A 1SGNE 3KQDA 2FOFA 3KHVA 2HPPH 3UR6A 2ZFQH 4THNH 1SLVB 1TGCA 3TGKE 1KY9A 1YKTA 4YESB 3MNBA 2A4RA 1F5RA 1MQ6A 4IGDA 3E8LA 1T31A 5DP8A 3V0XA 3L6PA 1MBQA 1NPMA 1BTWA 1S81A 1CHGA 1TPSA 1GHVH 2PR3A 9ESTA 5EW2H 4MTBA 3ZZ3A 5C20A 5L2YH 4GVUA 1NN6A 3SUGA 3T5FH 1V2PT 3ATMA 2FYQA 2STAE 4Q2KA 3RXFA 2F9OA 1NFUA 2ODYB 2XXLA 2ZTXA 4PROA 2CHAC 4UFEH 2A0QB 4KTUA 1L1NA 4BXWA 3TVJB 1G3BA 2FLRH 3TIUA 2AH4X 1TBRH 1HBTH 1ELBA 4YT7H 1SPJA 2ZDLA 4J2YB 4GSOA 2FODA 2GZ8A 3EGKH 1G9IE 3M36A 1MKWH 2WPIS 2BVXH 3I77A 1SGDE 5CHAC 1GBJA 2A4OA 1EAWA 3QWCH 3PO1C 1INCA 3QDZB 1FLEE 3RXAA 3BTEE 1O2IA 4GHQA 3T27A 1DY8A 1PPCE 3FZZA 1RFNA 1C5WB 2A7HA 3D23A 1PPBH 1Y5UT 3VB7A 3SQEE 3F9EA 1QBNA 1RD3B 2OC8A 1T8LA 3RC4A 1PJPA 3UWIA 4GCHG 1TQ0B 2XBYA 7GCHG 4E05H 3AASA 1ZHRA 3D65E 1MKXK 5FPSA 1FY5A 1BIOA 1JOUB 2TGDA 1O2ZA 5GCHG 5LH8A 3M3TA 1HRTH 4BANB 2Z3EA 1EOJA 2ZCLP 1XM1A 1E36B 3LT3A 4K3JA 2XBXA 2PGQB 1A0HB 3OX7U 1AVXA 1A0LA 1C5NH 3RXGA 2BXTH 1SHHB 1UJ1A 2PWXA 2A5KA 2VGCB 1H8DH 1XUFA 1ZMJA 1A61H 2G5NA 2AMQA 2ZTYA 1O2GH 3SU4A 4K1EA 2WV4A 1O31A 1GBFA 2ZWLH 4X1SU 2FZZA 2UWLA 2EI6A 1UTNA 4DGJA 3T62A 1FAXA 1GI8B 2G5VA 1OYQA 4WMEA 1N1LA 3NXPA 1P09A 4SGBE 1E0FD 1V2VT 3NCLA 1UHBB 3T26A 3SV6A 4ABAA 1DWCH 1SGIB 4NA9H 1AB9C 1IQNA 4M7GA 3T2NA 4WJG2 3WY8A 3CP7A 5G4BA 2RA0A 3PMHB 1WTHD 2O8UA 2Y81A 1EB1H 1RXPA 2BD7A 1H8IH 1TLDA 2WV5A 3SORA 1FUJA 3OSYA 5E8EH 5EOKA 1O35A 1GI9B 1GMDF 2Y5GA 1O3MA 1WCZA 2G4TA 1VITH 1V2UT 1EAXA 5E0HA 2NU0E 2B7DH 1C2FA 1P2OA 2QF3A 1QB9A 2OD3B 3VB6A 4I8HA 1C5RA 3E0PB 1PPFE 1O3EA 4JZFH 2ZECA 2FX4A 1TA6A 2HOBA 1ZYOA 3RLYH 2SGFE 2ZDMA 2BQWB 1P02A 1ZOMA 1D6WA 5CE1A 4FUGA 2FLBH 2SNVA 3K2UA 1P12E 3LGUA 1P03A 4E7RG 4INHA 2PUQH 5K0HA 1EP6A 1C1RA 2BQ6B 4AYVB 2HRVA 3Q3YA 1F5LA 3HK6B 1PQ8A 4VGCC 7KMEH 2A7JA 1VJAU 3FVFB 1K1NA 1AKSB 1D3PB 2OUAA 1GBHA 3ZVAA 4I33A 5JBAS 2Z94A 1LKAA 2A7CA 5JBBS 2Y6TA 1QBOA 1HAYB 2ZHDA 2PFEA 3MU5A 1PYTC 4X2WA 2G51A 3MMGA 2G4UA 4AN7A 3A84A 3EA9A 1BRUP 1G36A 1GJCB 1PPGE 2W5EA 2BZAA 1ZTLA 1LCYA 2W3KA 1HLTH 1O2HA 3A7VA 2BLWA 2BY7X 4QT8C 2OINA 1ABIH 4ESTE 4NG9H 2AS9A 3ENSB 5DP7A 1LHCH 1DVAH 3HATH 1P2KA 1FV9A 2BDIA 3MOCA 3KQBA 2UWPA 1YPEH 4YOIA 3TNTA 4Y0YE 1O39A 3DA9B 5FPYA 4O97A 4Q7XA 4I31A 1W0ZU 1TGTA 2ZGHA 2ZCHP 2ZHQH 1F92A 2FS8A 5FBIA 2OQUA 4LK4A 1V2ST 1JXPA 5TCCA 2BHGA 3O8DA 1VJ9U 3BG8A 3BTTE 1BTUA 2IN2A 1KLJH 1QB1A 5C1UA 1F5KU 1NU7B 1C5MD 1IAUA 1UO6A 5I46H 1KLTA 7ESTE 3RXJA 5EU8A 1HAVB 3VB5A 1ZGIA 5FCKA 2GP9B 1CU1A 1KIGH 4DIIH 2C8XB 3N7OA 1GJ7B 1BRCE 2A32A 3I29A 3A89A 2VIQA 1AUJA 1GJAB 3RXCA 3B23B 3O8RA 4HGCA 1PPZA 2FEQH 4CRCA 1N6XA 1EAUA 1GI7B 1EJAA 2ZDAH 1BT7A 1TPPA 4Y76A 2GMTC 1SGQE 5LPRA 5T6GA 5I25A 2ZPQA 3SJKA 1XUJA 3VXEH 4AFUA 5JDUB 1KXDA 2VJ1A 1QIXB 1JRTA 4TYDA 3UNRA 1O3PB 4B74A 5E0JA 3F9HA 4ZH8A 1SGFG 1KDQB 2O8TA 1YBWA 3PLKA 4J1YA 1QFKH 1EZQA 1YM0A 2RDLA 4BAKB 1EAIA 3U69H 2PKAA 3SI3H 4I8GA 2A2QH 3W95A 1P06A 1E37B 3ATLA 1KXBA 1TX6A 2P94A 1SHYA 2FTLE 3M5MA 4ZXXH 3RM0H 4B71A 1NY22 1DWDH 1WQVH 3MI4A 4MNXA 1TABE 1LO6A 1NU9A 1O2WA 1O3OA 3TU7H 1TWXB 9LPRA 3MU0A 2UUKB 2VGCC 1WUNH 4MNYA 1YF4A 2FYRA 3M37A 1HAPH 3U8RH 4Z6AH 1CT0E 1S85A 4IC5A 4NZLA 3RP2A 3O8CA 1KXAA 3A87A 3KN2A 5FAHA 2J9NA 1GBKA 2G8TA 4GCHF 1EATA 1HV7A 2A4QA 3RMMH 1ZLRA 1GJ8B 3SGAE 5EGMA 2AIPA 1O2OA 1EZSC 3GISB 1S82A 3BTKE 1E35B 1O5CB 1K1OA 1SBWA 3NZIA 5IDKA 2GV7A 1EASA 3RXKA 1GDQA 1OYTH 2XNIA 1FAKH 1VGCB 3A7WA 1EZXC 1SI5H 5JB8S 5EW1H 1BTHH 1SC8U 1UCYE 1Y3WA 1GVKB 2P16A 1O0DH 2XCFA 3SUEA 2ZA5A 2ZI2H 3BIVH 5C5NA 1CQQA 3CENA 4HZHA 1O2LA 3STIA 2GD4B 1KLIH 2JETB 1Z71A 2O8MA 1O5DH 3SV2H 1EJNA 4GAWA 2KAIB 1ZPZA 3Q00A 4CBNA 1B7XB 2BYAX 5CMXH 4NA7A 1AHTH 2BX4A 3AAVA 1BRBE 2ANMH 3A7ZA 5BPEA 2PW8H 4ZHMU 1LHDH 3URCA 4FUJA 1QHRB 3TJNA 1GHXH 4HI3A 3MNXA 4AORA 3RXHA 3RDZA 4E7NA 3TK6A 1LTOA 1GBTA 2YNAA 2UWOA 1IQIA 1SLXB 3ZVCA 1G3DA 3DFJA 3BG4B 1UCYH 3DHKH 4CRGA 1GJ6A 3NKKA 1G30B 1MU6B 2BMGB 3TPIZ 1ETTH 1RTKA 1NROH 2J34A 2ILNA 1FY8E 2BDCA 1NESE 2RG3A 1S84A 3BSQA 1GMHF 1JIRA 2AERH 2XC0A 4RKJB 1TGBA 1AUTC 2BX3A 1CSOE 2J95A 4OS1A 4X8UH 1TMUH 2OC1A 2VVUA 4U01A 4O03A 2BDYA 2FO9A 3H7OA 2V3HH 4Q7YA 1A5IA 3TJUA 1ACBE 2BD8A 3VFEA 1DUEA 1NRRH 1W0YH 2ANKH 4CR5A 2BD9A 2C3SA 1FY3A 4ISNA 3QZQA 5C67A 3A80A 3RMOH 3SNEA 3BTFE 2BLVA 1C1QA 1SGFA 1T4UH 1ZGVA 3UPEA 3UREA 4ABDA 1YCPH 1EOLA 2P3UB 3TJOA 1DPOA 3ELAH 2YOLA 1W12U 4DCDA 1HNEE 3GY6A 3GY8A 4JZ1A 1RIWB 4NSYA 4MQAA 1XUIA 1TBQH 1CGJE 4LOYH 1B5GH 1DSUA 1YYY1 4X6NA 1XVMA 1HAZB 3FFGA 1T8NA 3HPTB 2FS9A 3GY3A 3QUMP 4NWKA 4UEHH 1HYLA 2ZP0H 3V3MA 1MUEB 1KXCA 1SVPA 1UTKA 2F3CE 4KELA 1HB0B 1CA0B 1P2NA 5GDSH 4IW4E 1AGJA 1ELFA 1OS8A 1FY1A 3MO6A 1C2DA 3MTYA 1J17T 1A46H 1ELTA 1JIMA 1SB1H 2H1UA 4ABHA 2EC9H 4WH6A 1ZRKA 3F68H 1NRQH 1W3CA 3QTVH 5FCRA 3QN7A 2W26A 1DOJA 4KGAA 1TMTH 2JH0D 2QCYA 1RS0A 1HCGA 2PKSB 2ZFPH 3SN8A 4MNWA 1V2TT 1OWIA 1QL7A 1VCQA 4KTCA 1SGTA 4X1RU 1FDPA 2F9NA 3E90B 1EZUC 1O3JA 1OP8A 4JMYA 1Y8TA 4MPUA 1FQ3A 2OP9A 2FTMA 4CR9A 3IITA 1FMGA 2Z9IA 1O2RA 5GPIB 3VB3A 3F9GA 4AYYB 3M5OA 1DWBH 1KTTB 2DUCA 3P70B 1T7CA 1GBIA 1J14A 2A4GA 1DITH 1XUHA 5A09A 8LPRA 1JWTA 1ZHPA 2EI7A 1P01A 1V3XA 2V6NA 1C1OA 3MH5A 1GCDA 1WSSH 4BTIB 3UQOA 2ZFSA 1H9LB 1Q31A 2CV3A 4R0IA 1G3CA 3AVZA 4RSPA 4Z0KA 1EB2A 3VGCC 1A7SA