3A81A

Crystal structure of trypsin complexed with (e)-4-((2-nicotinoylhydrazono)methyl)benzimidamide (soaking 8 hours)
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
223
structure length
223
Chain Sequence
b'IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cationic trypsin
publication title In-Crystal Chemical Ligation for Drug Discovery
rcsb
molecule tags Hydrolase
total genus 58
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2009-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3a81A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3a81A02
1ZSKA 3RXJA 4ABAA 1ZMNA 1HRTH 1NU7B 4X8VH 1N6YA 5HM2A 1JRTA 4PROA 5T6FA 2HALA 4FXGH 1GDNA 5EU8A 5FBEA 3UIRA 5HM9A 2ZTZA 1TMTH 4VGCB 9ESTA 1F0TA 1O34A 2Z9KA 5A8XA 3S9CA 4ZHMU 1GHAG 1DS2E 1C2IA 2QV1A 3OU0A 2F9BH 3HK3B 2PKAA 4F4OC 3SQHE 2W7SA 1JRSA 2QN5T 5T6DA 3ZZ4A 3RLYH 1PYTC 2XCNA 1GL1A 3SNBA 1YPKH 4LK4A 3S7KB 3RXSA 1UTQA 3K6ZA 2J94A 1NESE 2PGBB 2UWPA 3U1IB 4TWWA 4Q2KA 4I7YH 4GCHG 1OYTH 3ZZ7A 1GCDA 1Y5BT 3AASA 3SBKA 1RFNA 1FN8A 3VXEH 5GWZA 3SV7A 1P05A 1K1MA 1CSOE 1GI0A 4YESB 4D7GA 3BTQE 1QBVH 2ZFPH 4CRDA 1P9SA 1JIRA 3FANA 1W12U 1W2KH 4LZ1H 4WMDA 3LH3A 3LGWA 4X6MA 2AMQA 5HGGA 1H9HE 2FLBH 1HJAB 1PPGE 1BHXF 2ZHFH 1C2MA 2A1DB 1LQDB 3M61U 1P2JA 3D62A 4Q7XA 1LKBA 3V3MA 1HCGA 2HVXA 1DSTA 3GDSA 1J15A 4IN2A 1C5MD 1P2QA 1NFYA 3BTEE 1OSSA 1BZXE 1YGCH 5K7RA 1AKSA 1UO6A 1C1WH 1CA0B 5DPAA 1ZTLA 1V2TT 1ZTKA 1Z71A 5GPIB 3Q00A 1H8IH 4H42U 2M5TA 3P8FA 5EXNA 3BIVH 4ZH8A 3V7TA 3U8RH 3GICB 2ZU5A 4OS6A 4JZFH 3GY7A 1YM0A 3B8JA 2LPRA 1OWIA 1AD8H 2DE8A 4ABEA 1KXDA 3ZZBA 3O8DA 3U69H 3SU4A 1T4VH 2UUYA 2QXGA 4I8GA 3I29A 6LPRA 2Y6TA 3VB4A 3BTHE 4WWYA 1L1JA 1BRCE 1TGSZ 3K9XB 4YLUA 1Z8RA 4U30A 2AGGX 4DCDA 4FUHA 5L2YH 5FCRA 3RU4E 3A8DA 1O3LA 1TBQH 1KLTA 1BTZA 1DUAA 1ESAA 4IMZA 1O2GH 1ELCA 2V3OH 3ZZ3A 1P12E 1MAXA 1YF4A 2P94A 2F83A 1XM1A 2OLGA 1OS8A 2Z9IA 1OOKB 3TU7H 3SN8A 4FUEA 2QXJA 1O3AA 4CRGA 3UOUA 4WMEA 1TA2A 1ELFA 4TPYA 2EI7A 1C9PA 1VITG 2SGPE 2ZCKP 4I33A 3PO1C 1V2WT 8KME2 3ZYEA 4DURA 3GY6A 1HBTH 2HPQH 1AWHB 1C4U2 3VEQB 1RS0A 1O32A 1W7XH 3LOXA 2AH4X 1O5FH 3P17H 3GCTG 1BTHH 1GHYH 5FXLA 4AZ2B 3FP6E 3SU6A 1F5RA 4YT7H 1BTUA 2GDEH 2ZFTA 1LHEH 4CHAC 2EC9H 1EQ9A 1ZMJA 4R0IA 3TH3H 1HJ8A 1AO5A 2PR3A 1F7ZA 3BN9A 3ZVEA 5TCAA 1E38B 2QCYA 3NK8A 3EA7A 3KN2A 1E34B 1W10U 3ATKA 1BRUP 4Q80A 1C2LA 1ZRKA 1J8AA 1Z6JH 5EG4A 1LQEA 1L4ZA 2BVXH 5CMXH 1S83A 1KY9A 1A5IA 1YCPM 2FLRH 3RXKA 1HJ9A 3FFGA 4AFSA 1O3KA 1TBZH 1LMWB 1DSUA 2V3HH 1AZ8A 5FHTA 2QC2A 2IOTA 2BZAA 1MUEB 1SSXA 1SFIA 1JMOH 3E6PH 5FPTA 1MCVA 5F6MA 2OD3B 4DOQA 1MTVA 3RXUA 1W0ZU 2YNAA 4NWLA 4B75A 3A7XA 1FXYA 1P57B 3NUMA 1CE5A 3UWJH 1L4DA 3TK6A 4DGJA 1A4WH 1BOQA 1C2EA 2V0BA 1O2VA 1S6FA 3TJNA 4CH2B 3OX7U 1O31A 1OYQA 1GBDA 1L1GA 1N6XA 1FV9A 2PW8H 3SOSA 2A5KA 3A7WA 1WV7H 1YPLH 1SGYE 1VR1H 4YOGA 5EXMA 1DE7H 5EXLA 1O5CB 4XE4A 1SGRE 1C2HA 4TPIZ 1QRXA 1FONA 4ISLA 3U8TH 4Y76A 5E8EH 4TY7A 1D3DB 1FY4A 1Q2WA 1YPMH 4AN7A 4GAWA 1FY5A 1HXFH 4BAHB 5EOKA 1WUNH 4LZ4B 2H5DA 4FUFA 3QGNB 1HAVA 1XUGA 3RXHA 5T6GA 1UVSH 3KNXA 1P10A 2XC0A 2SGAA 2BM2A 4NWKA 1ID5H 1RXPA 2BLVA 3M5LA 3LGYA 4X6OA 4CH8B 1SHYA 4BTIB 4HGCA 1P3CA 2O9QA 1ZGIA 5GCHF 1AUJA 3BIUH 5AF9H 1GHBF 1O3IA 1SG8B 1JBUH 3LIWA 5EPNA 1K1OA 1DICA 1MAYA 1GVZA 2B0FA 4Y0YE 1L1NA 3STJA 3UPEA 1O3FA 3M7TA 1KXFA 1D3PB 3M3VA 3CS0A 1C5TA 3F9GA 3LGTA 4IN1A 1UHBB 3TGKE 4OS1A 2R3UA 1TONA 1B0FA 2TRMA 1RIWB 4ZKSU 1SPJA 3A82A 1P06A 3EYDA 5GJ4B 5DP5A 3U1JB 3A88A 1ZGVA 2WV5A 5E0HA 2B9LA 2FXRA 1ANCA 2ZFFH 4KKDA 1VCWA 1GBTA 1V2RT 2QY0B 2XRCA 4ABIA 4B1TA 2J2UA 2XTTB 1GMCF 1NZQH 3JZ1B 1O3NA 1O5BB 4ZXXH 1HAPH 1G2LA 1GBEA 2IN2A 4NIWA 1D4PB 1GBAA 5GIBA 1H9LB 4UFFH 2HNTF 1HNEE 3STIA 2WPJS 4X6NA 3PTBA 2C3SA 2FZZA 4RSPA 1GJ8B 1ZHMA 3EDXB 2A2QH 4FUIA 2OBQA 2GZ8A 1K28D 3O8BA 2FI3E 5CE1A 3A7ZA 5T3HA 2GMTB 1ZJDA 3UNQA 4I31A 2Q6DA 5C2ZA 2FS9A 1P03A 3CP7A 3TK5A 3MO3A 2PTCE 1V2UT 4SGAE 2XYAA 2A31A 3MU0A 1C5SA 2VH0A 4MNXA 5EQRA 1FMGA 1K2I1 4JZ1A 1QY6A 1PJPA 1P2KA 1G3CA 1NFXA 1ABIH 4OGYA 3QX5H 4TWYA 1DY8A 2ODQA 1O3GA 3K65B 2F9OA 1CO7E 1FIWA 2GX4A 1OP2A 4YO9A 1QTFA 4MNVA 1CU1A 4FVBA 3RXAA 1LPZB 2H9TH 1O2PA 4JK5A 1QCPA 3QUMP 1FLEE 3RXEA 1LHCH 1XMNB 1TPPA 1DWCH 5BPEA 2VWNA 1V2NT 2Z6BD 2GZ7A 2HOBA 4O97A 2WPMS 1LDTT 3HKIB 1GBLA 3PLPA 1ZTJA 4NIYA 1AY6H 1NRQH 3EQ0H 2R2MB 3NZIA 1DXWA 3QZRA 4AYVB 2VIWA 4AFQA 3TK9A 2G55A 3BEIB 1GI6A 1K1IA 2CGAA 1A5GH 1C4Y2 3A85A 4ABDA 1O33A 1QRWA 3FZZA 3TIUA 3UFAA 3S7HB 1O2JA 2ZDAH 4X8SH 4KGAA 3GDVA 1QA0A 3DA9B 2ZDLA 1T7CA 1YPJH 6CHAB 1EZSC 2P8OB 4CBOA 2Z3EA 1TNLA 3F68H 1GHXH 3SORA 1YLCA 1O3CA 2AFQB 1TRMA 1VGCC 3U9AH 3LH1A 3ZZDA 2FOHA 1ZZZA 3A86A 4O3UA 2D26C 1S82A 5CHAC 5EPYA 4DJZB 1DM4B 1O35A 3EE0B 1TRYA 2EEKA 2FTLE 2BY5X 1EJAA 4RKOB 2FP7B 1O2IA 1PQ5A 1K1JA 1HLTH 2NWNA 1OWJA 4JCNA 4H6SB 5TCCA 1BTXA 1FQ3A 1BJUA 1O5DH 3GY3A 3P8NA 4XBCA 1SGNE 3A84A 1TMUH 3FAOA 4INHA 1SQOA 1O3JA 2GVFA 1BMLA 1AI8H 1CGJE 1C5OH 3QK1A 1CHOF 1SLWB 2ZQ1A 4Y8ZA 2PSXA 2BX4A 1SB1H 2GT7A 3LU9B 2W3IA 3MU8A 1CBWB 1GCTB 3CENA 5A8YA 1ELDE 2FOFA 2RG3A 2BLQA 2Z9GA 4E05H 1YKTA 3TVJB 3LGIA 9LPRA 2XNIA 1TWXB 1AVWA 4ZXYH 3M5OA 1YPEH 4AB9A 4CREA 1NO9H 2J4IA 1HIAB 4AGJA 3HPTB 1C1SA 1DANH 4D76A 1X7AC 5I46H 2JH0D 3A7YA 2ZF0H 1FUJA 1BHXB 1TFXA 1UVOA 2F9NA 3AW0A 1ORFA 1F0RA 1AFQB 3VFEA 3ZVGA 1A5HA 3ZZ9A 1GMDF 4B74A 3EAJA 3Q3XA 1S81A 4ABFA 2DE9A 1OP8A 1AE8H 1YPGH 1C5UA 5ETXA 1O3OA 1YBWA 3SU0A 1QBOA 3BTGE 3GCOA 4B71A 4RKJB 1W11U 2VJ1A 4NA8A 1EP6A 1T32A 1HAGE 1W14U 1MU6B 1C5ZB 4NZLA 2PGQB 3DD2H 1HAOH 2ANWA 1HJAC 3TNSA 1FAKH 1KXAA 1QQUA 4LOYH 2P3TB 5LPEA 1GI5A 2F91A 1O2SA 3M3TA 4ABJA 1GJAB 4ZROA 3RXRA 2G8TA 1QB9A 2BDGA 5FX5A 2OTVA 1GI1A 1A0JA 1O2LA 4XBDA 1V2ST 3S69A 1GBBA 2H5CA 1C5VA 4AB8A 3TNTA 1CA0C 2QIQA 2R0KA 1MBQA 1ANDA 1MTSA 6GCHG 1QA7A 2BD2A 2FESH 2ZWLH 1LVOA 5JBCS 1YYY1 2QYIA 1C2KA 1XXDA 4MQAA 1DXPA 4FUGA 4Y7AA 3Q3KA 8GCHF 4J2YB 2ESTE 3URDA 1MQ6A 4X1PU 2PKSB 1G9IE 4KTCA 2RA3A 2BVSH 3FP8E 1XUFA 1EASA 2I6SA 5JBAS 3PLBA 2OC0A 5IDKA 1EAIA 1AQ7A 5DP3A 2BY6X 2Y82A 1TPSA 2H2ZA 3OY5U 1ZR0A 3A87A 2CHAB 2STBE 4J1YA 1G32B 1LVMA 2PUQH 5JDUB 1AN1E 1HAHH 1D6WA 2BDIA 2HGTH 2Y7ZA 1SQTA 2F9PA 4WH6A 2G4TA 1EPTA 3GCHC 2KAIA 1MMJN 4X2YA 2FOBA 1DOJA 4DW2U 1SGCA 3SGQE 2I6QA 1SBWA 3RXFA 2OP9A 1GMHF 1QQ4A 1GL0E 3M7QA 5DP9A 3T29A 4AOQA 3RC6A 3UNRA 2WV4A 2R9PA 4ZAEA 3LJOA 1TPAE 4BNRA 1O5GH 1S84A 3BF6H 3H7TA 1CT2E 4Y7BA 3SHCH 2ZU1A 1GHZA 1GVLA 3RXIA 3AW1A 8LPRA 4ZKRU 1N1LA 5DJ7A 1WQSA 5B6OA 1O5EH 5AVDA 5C1XA 2CXVA 3LONA 2GCTC 1QB1A 1Z8JB 2VIOA 2ZIQH 2F9UA 1Z1JA 1FZZA 2CV3A 3RDZA 3NKKA 1ETTH 3BG4B 3SNEA 3QTVH 1NPMA 5GCHG 2BMGB 5I25A 2ZNKH 4ABHA 4O9VA 1A2CH 1C4V2 1ELBA 1T8NA 5JBBS 1P0SH 3QZQA 2AGEX 1SLVB 2J95A 2ZFSA 2GD4B 4X8UH 2TGAA 1XKBC 1TNKA 3RMMH 1O5AB 1T8LA 1FPCH 4NSYA 1RJXB 2BZ6H 3L33A 4HTCH 2OC7A 3GY4A 1ANBA 2NU2E 8ESTE 3LDXH 1Q3XA 2FOGA 4O3TA 1YLDA 1V3XA 2AEIH 1ZOMA 2FIRH 2AIQA 3A83A 4K1TA 1E36B 3HK6B 1P02A 1AIXH 4CR9A 3TGIE 3DFLA 1ELVA 1MKXK 4AGKA 2G51A 1GMCG 3HATH 1NS3A 1MZDA 3KL6A 4BXSA 5ABWA 4FUBA 3E90B 5PTPA 2Z9JA 3PB1E 1UTOA 2Y5HA 3F1SB 3ITIA 3KEEA 1P8VC 2AYWA 1GJDB 3BTDE 2ZI2H 2BY9X 2ZDMA 4WY3A 2VIPA 3M35A 2ZHEH 3RXLA 1BRAA 2DUCA 3SU5A 3TPIZ 4UONA 1WTHD 2AIPA 2GDDA 4X6PA 1TOMH 2WUCA 4D7FA 1G3DA 1OX1A 1W8BH 2H9EH 1C2GA 1Y8TA 3C27B 3LPRA 3ZVFA 1O2YA 1J14A 1FY8E 3V12A 1ARBA 1Y5AT 3GY5A 5FPSA 4YZUA 3E91A 4K5ZA 4A7IB 2GTBA 4O03A 1YCPK 1SGEE 2GV7A 1V2QT 2FYQA 3SV6A 1IQIA 3P6ZB 1V6DA 5C5NA 3ZZAA 3WY8A 2Y5FA 1KIGH 3KHVA 1G30B 4K8BA 1AMHA 3B23B 3PLKA 1GBCA 5A2MH 5FBIA 1UVUH 4LXBH 2WYGA 2A4RA 1SR5C 2XC5A 3BSQA 3MU5A 1BMMH 1EXFA 3NCLA 2O8TA 1P9UA 3QO6A 2ZGCA 1C1QA 3A7TA 2OBOA 1RIWC 1S85A 2Q6GA 4Q7ZA 3DFJA 1BRBE 7GCHG 1SL3A 3LC3A 3ODDA 1EX3A 1OXGA 2J92A 2ZU3A 4A5TS 4BTTB 2C8WB 3A8AA 4MPVA 1JIMA 1F5KU 2VB0A 1NTPA 1RTFB 5HMAA 4JYUH 3AAVA 2Y7XA 1K1PA 4NZQA 3ZZ8A 3UREA 2YOLA 3SU3A 3SV9A 2PV9B 4I8JA 2WPIS 4ZMAH 4AFUA 1WBGB 4ISNA 1QJ6B 3MU4A 4JZDH 4FVDA 3RXVA 2WPLS 2PUXB 3SNCA 1Z8IB 1A61H 1BDAA 1GBMA 1V2PT 1A0HB 2Z7FE 1O2HA 2GMTC 2ODYB 1S6HA 2A0QB 4B2BA 4BANB 1LTOA 2A7JA 3GISB 1RTLA 3SGBE 4A92A 3ZYDA 5DGJA 5A0CA 1V2KT 1TQ7B 1KSNA 2GCHF 2STAE 4WMFA 1WU1A 1HAXB 1QRZA 2PWXA 3ATMA 1CGHA 1GBFA 4K69A 3HGNA 3U98H 1IAUA 1O2ZA 4WXVA 1GBIA 1NT1A 1F5LA 2VIQA 2R3YA 1PYTD 2XXLA 1PFXC 3R3GB 1SGFA 2HRVA 3SHAH 1C2JA 1IQHA 1L2EA 1JOUB 3M5MA 1OKXA 2FM2A 1N8OB 1VITH 4RN6A 1O2RA 1EJNA 1TGCA 3V0XA 3M37A 4KTSA 1GHVH 2H6MA 1EZUC 2B5TB 1C5NH 1CHOG 2VVUA 2PKAB 4XDEA 3RXGA 3VB6A 1ZHPA 3BV9B 3TLOA 3VPKA 1GBJA 1TMBH 1CVWH 1O39A 3ODFA 1PQ7A 2ZA5A 3MYWA 4Z0KA 3TH4H 1TGTA 1YC0A 1QB6A 2A32A 2ZGXH 3E0NB 2PSYA 1XUIA 3SJ8A 2NU1E 3MNXA 1INCA 2OC8A 1GBHA 4ZKNU 3VB3A 4NG9H 3S9AA 2QF3A 4UEHH 5FCKA 1DVAH 2BDHA 1O2KA 1DPOA 1HAZB 1ZRBA 3FZDA 1C5WB 2ZO3H 5EW1H 2Z3CA 2XBXA 2RCEA 2BB4A 1IQMA 2BXTH 4NIVA 1GMDG 3BTWE 1EPTB 1ELGA 5DP8A 1NROH 3SUGA 1BMNH 4ISOA 1B7XB 2BVRH 2Z94A 4FU8A 5C1YA 1F0UA 2O8LA 4CRCA 1IQGA 2JETB 2WPHS 1A1RA 1MTNB 1C1MA 3K2UA 2BTCE 3BTKE 1Y3WA 2BLWA 1YPHE 2BDYA 4Y8YA 1MBMA 4ESTE 3L3TA 4GPGA 4JYTA 1K1NA 2C93B 4UFGH 4OS7A 3T5FH 1AKSB 4GVUA 3RUOA 1QURH 1Y3VA 1GG6B 2QF0A 2ZPRA 1G2MA 1XUJA 1O0DH 2QXIA 3E8LA 4D9RA 2HPPH 3QWCH 1F92A 4NIXA 4X2VA 1GI2A 3UTUH 1PPZA 3K6YA 2HLCA 3MFJA 1RTKA 3RM0H 3U8OH 3OY6U 1WCZA 3O8RA 2THFB 3M5NA 3VB5A 1Q31A 1QGFA 4B2AA 1U6QA 4WVPE 1O2UA 5LPFA 4X8TH 1SI5H 1W0YH 1XUHA 1NFUA 3O8CA 2BD5A 5J4SA 4Z6AH 1Z1IA 1KLIH 2CN0H 4JZEH 5A09A 1LKAA 1CQQA 1YP9A 1C1RA 1C1PA 2ANMH 1JXPA 4X0WU 2BDBA 1GCTC 1O2TA 1AB9B 1E0FD 1GWAA 1QL8A 2ODPA 3MH6A 1FNIA 1C5YB 4K2YA 6ESTA 1SQAA 3A89A 5FAHA 4FUDA 1TNIA 2G5NA 1RGQA 2SNVA 3KQEA 1HYLA 3T27A 2Y81A 2O8MA 1G36A 1TPOA 1AGJA 3LGVA 1UTPA 3Q3YA 4YOJA 4GHQA 2W5EA 2C4FH 2OXSA 1AFQC 2RDLA 2C90B 3F9HA 1XVOA 1RRKA 3F6UH 3M7UA 2ZZUH 4IW4E 4MLFB 4Y71A 4NFFA 2FO9A 2YNBA 2HNTE 2VNTA 3QLPH 3UQVA 3GDUA 3RM2H 3B9FH 1NRNH 3GOVB 2P93A 3MO9A 4KTUA 4MTBA 1TX6A 3RXPA 4B76A 1P2OA 1V2JT 4CRBA 1K9OE 3BTTE 1NU9A 1AUTC 1K22H 5F8ZA 1BTWA 1UCYE 2CJIA 1FY3A 2QGRA 4WJG2 3G01A 1C1OA 1UVTH 1GHWH 2ZTYA 2ZTXA 1MKWK 1O3PB 3M36A 3PV4A 1TNJA 3OTJE 2FOEA 4JZIA 5EQQA 1AFEH 1UTLM 1EUFA 3VGCB 2OQUA 2VGCB 4IC6A 1J17T 4MNYA 3LGUA 5ESBA 1PPHE 4Y10E 1GGDB 3PROA 1SOTA 1XVMA 1MKXH 2BQ6B 1GI9B 1EOLA 1TABE 2UUFB 1DFPA 4VGCC 1DITH 5EODA 1O3DA 1UTNA 1W3CA 2OCVB 3KQCA 1ELAA 2UUJB 3MH7A 2ZP0H 1KLJH 1P2IA 4IGDA 3F9EA 1SVPA 3H5CB 1Y59T 1BT7A 2PKSC 4X2WA 5LGOA 2D2DA 5DP4A 1TX8A 5DKMA 2JH5D 1SGTA 4ISHH 3ZVCA 3E16B 3EA8A 1V2MT 4OGXA 1QFKH 1OWEA 3GCNA 5C1UA 3SU1A 2VH6A 2CF8H 1SGQE 1SHHB 1F0SA 3SQEE 1TAWA 3A81A 4HFPB 1SGFG 5GXPA 5AFYH 1A0LA 3ATWA 3Q76A 2C8YB 1EAXA 1VJ9U 1BB0B 1XKAC 4H6TA 4OS2A 3TJVA 1C1VH 1QR3E 4GSOA 1ZYOA 3ZVAA 1A7SA 4X1QU 3UQOA 3RXDA 2UWOA 1C5PA 1LCYA 1IQNA 2AMDA 4NSVA 3RXCA 1HB0B 2ASUB 3MOCA 5C67A 3EGKH 1SFQB 1CT0E 3ESTA 2PTNA 2P3FH 4UFDH 1AVGH 1O38A 2VVCA 4YM9A 1ANEA 1UTMA 2BHGA 1Z7KA 1THPB 4MNWA 1EKBB 1ZSLA 2VWLA 1IQFA 2FODA 2ZU2A 5C5OA 1O2OA 1UCYK 1BJVA 1TYNA 4YLQH 2PLXA 1E37B 1HAVB 1EAWA 1QJ1B 1OWDA 3N7OA 4CBNA 4QT8C 2A5AA 4MVNA 3D23A 1XUKA 3AVZA 2ZDVH 4JK6A 4D8NA 1EB1H 4MPWA 2WPKS 5G4BA 2ZCHP 2FX4A 2G00A 1FAXA 1TNGA 5IYTA 2EI6A 4NCYA 7LPRA 5JYIA 4CRAA 1LPGB 4R8TB 5F8XA 5FPYA 2VINA 1S5SA 2TGPZ 4I8HA 1TOCB 2RA0A 3QDZB 3BG4C 4JMYA 3SNDA 2AGIX 2VIDA 3SUFA 5AFZH 3P8GA 5JB8S 4I8LA 2JH6D 2XWBI 1D6RA 1O2WA 4XOJA 1C5QA 4WF8A 1UK4A 3NPSA 1H9IE 1H4WA 4IBLH 1UHBA 1XX9A 1BBRK 3T62A 1ZPZA 2SGFE 3PTNA 1H8DH 4ABGA 4BXWA 1VZQH 2GZ9A 3TH2H 2J9NA 1SLXB 4Y6DA 3TITA 4AFZA 2ZGHA 1TALA 1BCUH 1YPHC 1D3TB 1E35B 1ZPCA 1PPFE 5C3NA 1ABJH 1IOEA 3D49H 1O2MA 2ALPA 4I32A 1SGDE 2SGQE 3OYPA 2G5VA 2NU4E 4B73A 1TBRH 2AERH 1QBNA 2FX6A 5DK1A 5JPMH 2O8UA 3HKJB 2FI4E 1QJ7B 2ZHQH 5FX6A 2G52A 2FI5E 3FP7E 2TGDA 4A1TA 5ESTE 1OWHA 2XCFA 2VWMA 3MO6A 3A8BA 3LJJA 1DWBH 4ABBA 1PQ8A 2CF9H 3ELAH 1P2NA 3RU4D 2ZCLP 2OQ5A 2VVVA 2R2WU 1Y5UT 3MWIU 4ZHLU 2GP9B 3UWIA 1NM6A 1T8MA 2QA9E 1KXEA 2ZDNA 1W7GH 1ARCA 1Z6EA 1OP0A 3MNSA 2GCHG 1NRSH 1V2OT 4UDWH 1NRPH 4ZHAA 3A7VA 1B5GH 1FIZA 2Z3DA 1HFDA 3KF2A 1IQLA 1D3QB 1TA6A 2XBVA 2G81E 1TRNA 2ZHDA 2J34A 1GHBG 1XXFA 4I8KA 4XBBA 1ZMLA 1C5LH 4NGAH 1O3HA 3LKWA 4AG2A 2ILNA 3JZ2B 1MD8A 1KDQA 2QXHA 2OC1A 5JB9S 1GJ7B 1L0ZA 4THNH 2BY7X 1UK2A 4MG3A 2BQWB 3MMGA 5F8TA 3UOPA 3SZNA 4FUJA 4F49A 3LT3A 5TJXA 2ZKSA 5K0HA 2HNTC 4ASHA 2FWWA 1KXBA 1P01A 1ESBA 2OUAA 3UR9A 4BOHA 1ELEE 1O2QA 1OWKA 2BDCA 1MD7A 4INKA 5F03A 4BAMB 3BG8A 3RU4T 2ZFRH 1KTSB 1A3BH 1FN6A 1D9IA 2EA3A 3LC5A 5A8ZA 4TY6A 1W13U 1EJMA 1DT2A 5DP6A 1QL9A 2WYJA 1TGBA 1KYNA 3RC5A 2R0LA 5AHGH 4K3JA 1ETRH 4MPXA 1IQKA 1RD3B 3RMNH 5DO4H 3PWCA 2ZECA 4E7RG 2UUKB 4NA7A 3UNSA 3GCHB 1F2SE 4XFQA 3OSYA 4DIIH 4DG4A 1P2MA 1TIOA 2ZC9H 4A1XA 1O3MA 4WXIA 2A45B 1LHDH 2BY8X 2D1JA 2ULLA 2ZG0H 1Z8GA 4UD9H 1OPHB 1BUIA 2GV6A 2ZHWH 4K8YA 1THSH 2XWAA 1ETSH 3FVFB 3SO3A 3ATIA 1V2LT 2A7CA 2PHBA 1LHFH 1NRRH 3PM3A 1TGNA 1ZLRA 2FMJA 2XBYA 2W26A 1DLKB 5J4QA 3CS7A 1ACBE 1HPGA 2FTMA 6GCHF 1C5RA 1JWTA 1S0QA 2BOHB 2GCTB 1N8OC 2ZQ2A 5JBTA 2B8OH 3HGPA 1DLEA 2ZEBA 1TNHA 3SGAE 2O8WA 3T28A 1GHAF 1TLDA 4KELA 1GJ4H 1WAYB 2W3KA 2FPZA 2FOMB 3ZZ5A 2EI8A 1GDQA 2BD3A 1QL7A 4DVAU 1DWEH 1MKWH 4X2XA 3NWUA 3SUDA 2TBSA 3C1KA 2ANKH 1FY1A 2TIOA 4DIHH 3RXTA 1K21H 4GCHF 1UMAH 4AORA 1HIAA 4GLYA 1THRH 1GJ6A 3ZZCA 3BTFE 2A5IA 2ZPQA 1PPCE 1GDUA 3SNAA 4NA9H 4FUCA 1EPTC 3SJOA 1KTTB 2A4GA 2ZGJA 2FOAA 3BTME 5GDSH 3TJOA 1H1BA 2TPIZ 4XSKU 2Q6FA 3PO1B 2JETC 5HXFA 1HGTH 4AG1A 5A0AE 2FYRA 1MTNC 1DUEA 1S0RA 3PMBB 3R0FA 2W7UA 3GYMA 4U2WA 2ZDKA 2LNCA 1K1LA 4E7NA 1NFWA 1ZJKA 2A7HA 3TJUA 1CGIE 1GJ9B 4Q7YA 1PPEE 2C8XB 2VU8E 1SLUB 4Y11E 1B0EA 3E0PB 4CHAB 1GG6C 2BQ7B 1GI8B 5SGAE 5A0BA 4KP0A 3MH4A 3RXQA 5L30H 1AWFH 1C1UH 1AE5A 3ZVDA 1BITA 3T26A 4ZUHA 1C2FA 1MZAA 2J38A 4WH8A 1GI7B 1GVKB 4IC5A 3PYHA 3RXOA 1FI8A 3QN7A 2FS8A 4CRFA 3DHKH 5HYOA 3UY9A 2AS9A 3PWBA 3NXPA 2SGEE 3GY2A 3E1XB 4BTUB 3UR6A 2CMYA 4K1SA 1AB9C 3SJIA 1MTUA 2BDAA 2H9HA 1UCYH 5EW2H 4X1SU 4E06H 3ZZ6A 1ZHRA 1P3EA 1TB6H 3ZVBA 1GJCB 2BLOA 3KQBA 3T25A 1SMFE 2VWOA 2Z9LA 1WQVH 5DG6A 1O37A 1CHGA 1G3EA 4IS5A 3V13A 1IHTH 3VXFH 2KAIB 1BMAA 6CHAC 1NN6A 2P8OC 3S9BA 4BAKB 1SGPE 1MQ5A 1A3EH 4UFEH 2UWLA 1VITF 5E0JA 3SI3H 4TYDA 3SJKA 1AHTH 1TE0A 1O2XA 2WINI 3MH5A 1SC8U 1EZXC 1T4UH 1EZQA 2ZFQH 1MTWA 2SFAA 3GCTF 4AYYB 1EAUA 4X1NU 4ISIH 1BBRH 2XC4A 3DT0H 1WYKA 3I78A 1PQAA 3UUZA 4MPUA 2BX3A 4HI3A 3MHWU 4OS4A 1QIXB 1UTKA 3P70B 2C8ZB 1P09A 5E2PA 1Y3YA 3VGCC 2VGCC 3BEFB 4HZHA 1P11E 1TX7A 3Q77A 3RMLH 2ANYA 1J16A 1QHRB 1UTJA 3KCGH 1EOJA 1LO6A 1GGDC 1LPKB 1CT4E 2PFEA 3SJ9A 1IHSH 5C20A 3W95A 1HXEH 8GCHG 1BTPA 1CBWC 4K60A 1T8OA 1HAYB 5LPRA 1KDQB 3AAUA 2BD4A 3BEUA 4U01A 2IJOB 1G3BA 1BQYA 2FEQH 4ZKOU 1AU8A 1DY9A 3DUXH 4CR5A 4K1EA 3KQDA 1HUTH 1FDPA 2A4QA 1UJ1A 4Y0ZE 3P8OA 1QNJA 2B7DH 3E3TA 4IMQA 1C1NA 1ZPBA 3VB7A 1O3BA 2G4UA 3P92A 7GCHF 2GGVB 2Y80A 1GI4A 2IPHA 3IG6B 4B2CA 3PMJA 3KIDU 1MH0A 5L2ZH 1WOFA 4GHTA 2ALVA 4X1RU 1WSSH 3S0NA 1GPZA 1GBKA 2FOCA 1J9CH 3SV2H 4DY7B 4M7GA 1TQ0B 7KMEH 3L6PA 1EB2A 2VIVA 3MNBA 1GI3A 3I77A 3RP2A 2QAAA 1DX5M 1BA8B 4NFEA 4A1VA 3GYLB 1GJBB 3IWMA 3MU1A 1GMHG 3QGJA 1SOZA 2D8WA 1BIOA 2K1QA 1CA8B 4UE7H 1FJSA 5EGMA 5EQSA 1VCPA 2V35A 4BAOB 1VCQA 2H1UA 2JKHA 1EATA 4OS5A 3RLWH 4BAQB 1BTYA 1V2VT 3MI4A 3A80A 3H7OA 1ESTA 2P95A 1MU8B 3TGJE 1A46H 1NC6A 1EP5A 3P95A 1M9UA 2BOKA 2AMPA 3GY8A 1Y3UA 3SV8A 2TGTA 1FPHH 3F9FA 2FDAA 1DDJA 1ELTA 1IQJA 2BXUH 3MNCA 4D9QA 2Y5GA 3RXBA 4MDSA 1C5XB 2NU0E 4YT6H 1T31A 1LHGH 1KXCA 2BD7A 1LVBA 2V6NA 3QTOH 7ESTE 1BBRE 2ZPSA 2BD8A 3ZV9A 2A2XH 5L6NH 5LH8A 1YCPH 1HDTH 1P04A 1O36A 2SGDE 2F9VA 4Y8XA 2CHAC 1NY22 1O30A 4INLA 1C1TA 2GT8A 1LVYA 3EA9A 4H4FA 2WUBA 3PMHB 1Y3XA 3T2NA 1O2NA 2HWLB 1O3EA 3ENSB 4FU7A 1MCTA 1DWDH 2F3CE 4FU9A 4JYVH 2OINA 5BRRE 3MTYA 2P16A 3RXMA 3A8CA 1ZSJA 3SU2A 3D65E 2NU3E 5DP7A 3IITA 1VJAU 1UK3A 3M3SA 4YTAA 1AVXA 1HAIH 3SI4H 1VGCB 4AX9H 4A6LA 1G37A 3URCA 1GJ5H 2BYAX 5H4IB 3ATLA 2A4OA 4U32A 5CHAB 2XBWA 1IQEA 3RC4A 4YOIA 3ZV8A 2P59A 1C9TA 4GUXA 5E2OA 1UVPA 2BD9A 3RMOH 1HV7A 1PPBH 1C2DA 3SUEA 2Q1JA 1WTGH 2GKVE 2ZGBH 4SGBE 3W94A 1AZZA 4Y79A 3SW2B 2ZU4A 4DT7B 5E0GA 3KGPA 3PMAB 2P3UB 2SNWA 2XW9A 1SGIB
chains in the Genus database with same CATH superfamily
1ZSKA 3RXJA 4ABAA 1ZMNA 1HRTH 1NU7B 4X8VH 1W0KD 1N6YA 5HM2A 1JRTA 4PROA 5T6FA 2HALA 4FXGH 1GDNA 5EU8A 5FBEA 3UIRA 5HM9A 2ZTZA 1TMTH 1YWUA 4VGCB 9ESTA 1F0TA 1O34A 2Z9KA 5A8XA 3S9CA 3PRDA 4ZHMU 1GHAG 1DS2E 1C2IA 2QV1A 3OU0A 2F9BH 3HK3B 2PKAA 4F4OC 3SQHE 2W7SA 1JRSA 2QN5T 5DSFA 5T6DA 3ZZ4A 3RLYH 1PYTC 2WV9A 2XCNA 1GL1A 3SNBA 1YPKH 1EFRD 4LK4A 3S7KB 3RXSA 1UTQA 4RT0A 3K6ZA 2J94A 1NESE 2PGBB 2UWPA 3U1IB 3FO8D 4TWWA 4Q2KA 4I7YH 4GCHG 1OYTH 3ZZ7A 1GCDA 1Y5BT 3AASA 3SBKA 1RFNA 1FN8A 3VXEH 5GWZA 3SV7A 1P05A 4YXWD 1K1MA 1CSOE 1GI0A 4YESB 4D7GA 3BTQE 5CDFE 5GNDA 1QBVH 2ZFPH 4CRDA 1P9SA 1JIRA 5DN6D 3FANA 1W12U 1W2KH 4LZ1H 4WMDA 3LH3A 3LGWA 4X6MA 2AMQA 3KYGA 5HGGA 1H9HE 2FLBH 1HJAB 1PPGE 1BHXF 2ZHFH 1C2MA 2A1DB 1LQDB 3M61U 1P2JA 3D62A 4Q7XA 1LKBA 3V3MA 1HCGA 2HVXA 1DSTA 3PRBA 3GDSA 1J15A 4IN2A 1C5MD 4AC9A 1P2QA 1NFYA 3BTEE 1OSSA 1BZXE 1YGCH 5K7RA 1AKSA 1UO6A 1C1WH 1CA0B 5DPAA 1ZTLA 2XNDD 1V2TT 1ZTKA 1Z71A 5GPIB 3PV2A 1H8IH 3Q00A 4H42U 2M5TA 3P8FA 5EXNA 3BIVH 4ZH8A 3V7TA 4F55A 3U8RH 3GICB 2ZU5A 4OS6A 4JZFH 3GY7A 1YM0A 3B8JA 2LPRA 1OWIA 1AD8H 2DE8A 4ABEA 1KXDA 3ZZBA 3O8DA 3U69H 3SU4A 1T4VH 2UUYA 2QXGA 2QE7D 4I8GA 3I29A 6LPRA 2Y6TA 3VB4A 3BTHE 2F4LA 4WWYA 1L1JA 3CNRA 1BRCE 1TGSZ 3K9XB 4YLUA 1Z8RA 2F43B 4U30A 2AGGX 4DCDA 4FUHA 5L2YH 5FCRA 3RU4E 3N7EA 3A8DA 1O3LA 1TBQH 1KLTA 1BTZA 1DUAA 1ESAA 4IMZA 1O2GH 1ELCA 2V3OH 3ZZ3A 1P12E 1MAXA 1YF4A 2P94A 2IJD1 2F83A 1XM1A 2OLGA 1OS8A 2Z9IA 1OOKB 3TU7H 3SN8A 4FUEA 4DT4A 1E1QD 2QXJA 1O3AA 2KCYA 4CRGA 3UOUA 4WMEA 1TA2A 1ELFA 4TPYA 2EI7A 1C9PA 1VITG 2SGPE 2ZCKP 4I33A 3PO1C 1V2WT 8KME2 3ZYEA 4DURA 3GY6A 1HBTH 2HPQH 1AWHB 1C4U2 3VEQB 1RS0A 1O32A 1W7XH 3LOXA 2AH4X 1O5FH 3P17H 3GCTG 1BTHH 1GHYH 5FXLA 4AZ2B 3FP6E 3SU6A 1F5RA 2V3MA 4YT7H 1BTUA 2GDEH 2ZFTA 1LHEH 4CHAC 2EC9H 1EQ9A 1ZMJA 4R0IA 3TH3H 2J5UA 1HJ8A 1AO5A 2PR3A 1F7ZA 3BN9A 3ZVEA 4ACAA 5TCAA 1E38B 2QCYA 3NK8A 3EA7A 3KN2A 1E34B 1W10U 3ATKA 1BRUP 2KX4A 4Q80A 1C2LA 1ZRKA 1J8AA 1Z6JH 5EG4A 1LQEA 1L4ZA 2BVXH 5CMXH 1S83A 3N99A 2PP6A 1KY9A 5T1VA 1A5IA 1YCPM 2FLRH 3RXKA 1HJ9A 3FFGA 4AFSA 1O3KA 1TBZH 2V7QD 1LMWB 2GJGA 2JIZD 1DSUA 2V3HH 3VG8A 1AZ8A 5FHTA 2QC2A 2IOTA 2BZAA 1MUEB 1SSXA 1SFIA 1JMOH 3E6PH 5FPTA 1MCVA 5F6MA 2OD3B 4DOQA 1MTVA 2KCOA 3RXUA 1W0ZU 2YNAA 4NWLA 4B75A 3A7XA 1FXYA 1P57B 3NUMA 1CE5A 3UWJH 1L4DA 3TK6A 4DGJA 1A4WH 1BOQA 2KCPA 1C2EA 2V0BA 1O2VA 1S6FA 3TJNA 4CH2B 3OX7U 2W6JD 1O31A 1OYQA 1GBDA 1L1GA 1N6XA 1FV9A 2PW8H 3SOSA 2A5KA 1W0JD 3A7WA 1WV7H 1YPLH 1SGYE 1VR1H 4YOGA 5EXMA 1DE7H 1COWD 5EXLA 1O5CB 4XE4A 1SGRE 1C2HA 4TPIZ 4XD7D 1QRXA 1FONA 4ISLA 3U8TH 4Y76A 5E8EH 4TY7A 1D3DB 1FY4A 1Q2WA 1YPMH 4AN7A 4GAWA 1FY5A 1HXFH 1NBMD 4BAHB 5EOKA 1WUNH 4LZ4B 2H5DA 4FUFA 1YY3A 3QGNB 1HAVA 1XUGA 3RXHA 5T6GA 1UVSH 3KNXA 1P10A 2XC0A 2SGAA 2BM2A 4NWKA 1ID5H 1RXPA 2BLVA 3M5LA 3LGYA 4X6OA 4CH8B 1SHYA 4BTIB 4HGCA 1P3CA 2O9QA 1ZGIA 5GCHF 1AUJA 3BIUH 5AF9H 1GHBF 1O3IA 1SG8B 1JBUH 3LIWA 5EPNA 1K1OA 1DICA 1MAYA 1GVZA 2B0FA 4Y0YE 1L1NA 3STJA 3UPEA 1O3FA 3M7TA 1KXFA 1D3PB 3M3VA 3CS0A 1C5TA 3F9GA 3LGTA 4IN1A 1UHBB 3TGKE 4OS1A 2YMSB 2R3UA 1TONA 1B0FA 2TRMA 1RIWB 4ZKSU 2RDEA 1SPJA 3A82A 1P06A 3EYDA 5GJ4B 5DP5A 3U1JB 3A88A 1ZGVA 2WV5A 5E0HA 2B9LA 2FXRA 1ANCA 2ZFFH 4KKDA 1VCWA 1GBTA 1V2RT 2QY0B 2XRCA 4ABIA 4B1TA 2J2UA 2XTTB 1GMCF 1NZQH 3JZ1B 2LELA 1O3NA 1O5BB 4ZXXH 1HAPH 1G2LA 1GBEA 2IN2A 4NIWA 1D4PB 1GBAA 5GIBA 1H9LB 4UFFH 2HNTF 1HNEE 3STIA 2WPJS 2M2AA 3PTBA 2C3SA 4X6NA 2FZZA 4RSPA 3WWFA 1GJ8B 1ZHMA 3EDXB 3N7DA 2A2QH 4FUIA 2OBQA 2GZ8A 1K28D 3O8BA 2FI3E 5CE1A 3A7ZA 3FOAA 2GMTB 1ZJDA 5T3HA 3UNQA 4I31A 2Q6DA 5C2ZA 2FS9A 1P03A 3CP7A 3TK5A 3MO3A 2PTCE 1V2UT 3OFND 4SGAE 2XYAA 2A31A 3MU0A 1C5SA 2VH0A 4MNXA 5EQRA 1FMGA 1K2I1 4JZ1A 1QY6A 1PJPA 1P2KA 1G3CA 1NFXA 1ABIH 4OGYA 3QX5H 4TWYA 1DY8A 2ODQA 1O3GA 3K65B 2F9OA 1CO7E 1FIWA 2GX4A 1OP2A 4YO9A 1QTFA 4MNVA 1CU1A 4FVBA 3RXAA 1LPZB 2H9TH 5KEDA 1O2PA 4JK5A 1QCPA 3QUMP 1FLEE 3RXEA 1LHCH 4ASUD 1XMNB 1TPPA 1DWCH 5BPEA 2VWNA 1V2NT 2Z6BD 2GZ7A 2HOBA 4O97A 2WZQA 2WPMS 1LDTT 3HKIB 2JJ2D 1GBLA 3PLPA 1ZTJA 4NIYA 1AY6H 5FL7D 1NRQH 3EQ0H 2R2MB 3NZIA 1DXWA 3QZRA 4Q4LA 4AYVB 2VIWA 4AFQA 3TK9A 2G55A 3BEIB 1GI6A 1K1IA 2CGAA 1A5GH 1C4Y2 3A85A 4ABDA 1O33A 1QRWA 3FZZA 4TT3D 3TIUA 3UFAA 3S7HB 1O2JA 2ZDAH 4X8SH 4KGAA 3GDVA 1QA0A 3DA9B 2ZDLA 1T7CA 1YPJH 6CHAB 1EZSC 2P8OB 4CBOA 2Z3EA 1TNLA 3F68H 1GHXH 3SORA 3NRLA 1YLCA 1O3CA 2AFQB 1TRMA 1VGCC 3U9AH 3LH1A 3ZZDA 2FOHA 1ZZZA 3SZEA 3A86A 4O3UA 2D26C 1S82A 5CHAC 5EPYA 4DJZB 1DM4B 1O35A 3EE0B 1TRYA 2EEKA 2FTLE 2BY5X 1EJAA 4RKOB 2FP7B 1O2IA 1PQ5A 3KQ5A 1K1JA 1HLTH 2NWNA 1OWJA 4JCNA 4H6SB 5TCCA 1BTXA 1FQ3A 1BJUA 1O5DH 3GY3A 3P8NA 4XBCA 1SGNE 3A84A 1TMUH 3FAOA 4INHA 1SQOA 1O3JA 2GVFA 1BMLA 1AI8H 1CGJE 1C5OH 1E79D 3QK1A 1CHOF 1SLWB 2ZQ1A 4Y8ZA 2PSXA 2BX4A 1SB1H 2GT7A 3LU9B 2W3IA 3MU8A 1CBWB 1GCTB 3CENA 5A8YA 1ELDE 2FOFA 2RG3A 2BLQA 2Z9GA 5CHBA 4E05H 1YKTA 3TVJB 3LGIA 9LPRA 2XNIA 1TWXB 1AVWA 4ZXYH 3M5OA 1YPEH 4AB9A 4CREA 1NO9H 2J4IA 1HIAB 4AGJA 3HPTB 1C1SA 1DANH 4D76A 1X7AC 5I46H 2JH0D 3A7YA 2ZF0H 1FUJA 1BHXB 1TFXA 1UVOA 2F9NA 3AW0A 1ORFA 1F0RA 1AFQB 3VFEA 3ZVGA 1A5HA 3ZZ9A 1GMDF 4B74A 2XOKD 3EAJA 3Q3XA 1S81A 4ABFA 2DE9A 1OP8A 1AE8H 1YPGH 1C5UA 5ETXA 1O3OA 1YBWA 3SU0A 1QBOA 3BTGE 3GCOA 4B71A 4RKJB 1W11U 2VJ1A 4NA8A 1EP6A 1T32A 1HAGE 1W14U 1MU6B 1C5ZB 4NZLA 2PGQB 3DD2H 1HAOH 2ANWA 1HJAC 3TNSA 2RFKC 2KCAA 1FAKH 1KXAA 1QQUA 4LOYH 2P3TB 5LPEA 1GI5A 2F91A 1O2SA 3M3TA 4ABJA 1GJAB 4ZROA 3RXRA 2G8TA 1QB9A 2BDGA 5FX5A 2OTVA 1GI1A 1A0JA 1O2LA 4XBDA 1V2ST 3S69A 1GBBA 2H5CA 1C5VA 4AB8A 3TNTA 1CA0C 2QIQA 2R0KA 1MBQA 1ANDA 1MTSA 6GCHG 1QA7A 2BD2A 2FESH 2ZWLH 1LVOA 5JBCS 1YYY1 2QYIA 1C2KA 1XXDA 4MQAA 1DXPA 4FUGA 4Y7AA 3Q3KA 8GCHF 3FKSD 4J2YB 2ESTE 3URDA 1MQ6A 4X1PU 2PKSB 1G9IE 4KTCA 2RA3A 2BVSH 3FP8E 1XUFA 1EASA 2I6SA 5JBAS 3PLBA 2OC0A 5IDKA 1EAIA 1AQ7A 5DP3A 3UAIC 2VBCA 2BY6X 2Y82A 1TPSA 2H2ZA 3OY5U 1ZR0A 3A87A 2CHAB 2STBE 4J1YA 1G32B 1LVMA 2PUQH 5JDUB 1AN1E 1HAHH 1D6WA 2BDIA 2HGTH 2Y7ZA 1SQTA 2F9PA 3F2FA 4WH6A 5KGOA 4M9FA 2G4TA 1EPTA 3GCHC 2KAIA 1MMJN 4ZCNA 4X2YA 2FOBA 1DOJA 5EIYA 4DW2U 3F0PA 1SGCA 3SGQE 2I6QA 1SBWA 3RXFA 2OP9A 1GMHF 1QQ4A 1GL0E 3M7QA 5DP9A 3T29A 4AOQA 3RC6A 3UNRA 2WV4A 2R9PA 4ZAEA 3LJOA 1TPAE 4BNRA 3W1EA 4Q63A 1O5GH 1S84A 3BF6H 3H7TA 1CT2E 4Y7BA 3SHCH 2ZU1A 1GHZA 1GVLA 3RXIA 3AW1A 8LPRA 4ZKRU 1N1LA 5DJ7A 1WQSA 5B6OA 4OM9A 1O5EH 5AVDA 5C1XA 2CXVA 3LONA 2GCTC 1QB1A 1Z8JB 2VIOA 2ZIQH 2F9UA 1Z1JA 1FZZA 2CV3A 3RDZA 3NKKA 1ETTH 3BG4B 3SNEA 3QTVH 1NPMA 5GCHG 2BMGB 5I25A 2ZNKH 4ABHA 4O9VA 1A2CH 1C4V2 1ELBA 1T8NA 5JBBS 1P0SH 3QZQA 2AGEX 1SLVB 2J95A 2ZFSA 2GD4B 4X8UH 2TGAA 1XKBC 3OEED 1TNKA 3RMMH 1O5AB 1T8LA 1FPCH 4NSYA 1RJXB 2BZ6H 2WHXA 3L33A 4HTCH 2OC7A 3GY4A 1ANBA 2NU2E 8ESTE 3LDXH 1Q3XA 2FOGA 2K0QA 4O3TA 1YLDA 1V3XA 2AEIH 1ZOMA 2FIRH 2AIQA 3A83A 4K1TA 1E36B 3HK6B 1P02A 1AIXH 4CR9A 3TGIE 3DFLA 1ELVA 1MKXK 4AGKA 2G51A 1GMCG 3HATH 1NS3A 1MZDA 3KL6A 4BXSA 5ABWA 2IPQX 3E90B 4FUBA 5PTPA 2Z9JA 3PB1E 1UTOA 2Y5HA 3F1SB 3ITIA 3KEEA 4RI0A 1FX0B 1P8VC 2AYWA 1GJDB 3BTDE 2ZI2H 1UW7A 2BY9X 2ZDMA 4WY3A 4Z1MD 2VIPA 3M35A 2ZHEH 3RXLA 1BRAA 2DUCA 3SU5A 3TPIZ 4UONA 1WTHD 2AIPA 2GDDA 4X6PA 1TOMH 2WUCA 4D7FA 1G3DA 1OX1A 1W8BH 2H9EH 1C2GA 1Y8TA 3C27B 3LPRA 3ZVFA 1O2YA 1J14A 1FY8E 2EQNA 1ARBA 3V12A 2W6ID 1Y5AT 3GY5A 5FPSA 4YZUA 3E91A 4K5ZA 4A7IB 2GTBA 4O03A 1YCPK 1SGEE 2GV7A 1V2QT 2FYQA 2J98A 3SV6A 1IQIA 3P6ZB 1V6DA 5C5NA 3ZZAA 3WY8A 2Y5FA 1KIGH 3KHVA 1G30B 4K8BA 1AMHA 3B23B 4B6EA 3PLKA 1GBCA 5A2MH 5FBIA 1UVUH 4LXBH 2WYGA 2A4RA 1SR5C 2XC5A 3BSQA 3MU5A 1BMMH 1EXFA 3NCLA 2O8TA 2HLDD 1P9UA 3QO6A 2YMSC 2ZGCA 1C1QA 3A7TA 2OBOA 1RIWC 1S85A 2Q6GA 4Q7ZA 3DFJA 1BRBE 7GCHG 1WXRA 1SL3A 3LC3A 3ODDA 1EX3A 5F53A 1OXGA 2J92A 5B6LA 2ZU3A 4A5TS 4BTTB 2C8WB 3A8AA 3GS9A 4MPVA 1JIMA 1F5KU 2VB0A 3WW7A 1NTPA 1RTFB 5HMAA 4JYUH 3AAVA 2Y7XA 1K1PA 4NZQA 3ZZ8A 3UREA 2YOLA 3DSOA 3SU3A 3SV9A 5HIYA 2PV9B 4I8JA 2WPIS 1S6LA 4ZMAH 4AFUA 1WBGB 4ISNA 1QJ6B 3MU4A 4JZDH 4FVDA 3RXVA 2WPLS 2PUXB 3SNCA 1Z8IB 1A61H 1BDAA 1GBMA 1V2PT 1A0HB 2Z7FE 1O2HA 2GMTC 2ODYB 1S6HA 2A0QB 4B2BA 4BANB 1LTOA 2A7JA 3GISB 1RTLA 3SGBE 4A92A 3ZYDA 5DGJA 5A0CA 1V2KT 1TQ7B 1KSNA 2GCHF 2STAE 4WMFA 1WU1A 1HAXB 1QRZA 2PWXA 3ATMA 1CGHA 1GBFA 4K69A 3HGNA 3U98H 1IAUA 1O2ZA 4WXVA 1GBIA 1NT1A 1F5LA 2VIQA 2R3YA 1PYTD 2XXLA 1PFXC 3R3GB 1SGFA 2HRVA 3SHAH 1C2JA 1IQHA 1L2EA 1JOUB 3M5MA 1OKXA 2FM2A 1N8OB 1VITH 2J97A 4RN6A 1O2RA 1EJNA 1TGCA 3V0XA 3M37A 4KTSA 1GHVH 2H6MA 1EZUC 2B5TB 1C5NH 1CHOG 2VVUA 2PKAB 4XDEA 3RXGA 3VB6A 1ZHPA 3BV9B 3TLOA 3VPKA 1GBJA 1TMBH 1CVWH 1O39A 3ODFA 1PQ7A 2ZA5A 3MYWA 4Z0KA 3TH4H 1TGTA 1YC0A 1QB6A 2A32A 2ZGXH 3E0NB 3ZIAD 2PSYA 1XUIA 3SJ8A 5EJ1A 2NU1E 3MNXA 1INCA 2OC8A 3F2GA 1GBHA 4ZKNU 3VB3A 4NG9H 3S9AA 2QF3A 4UEHH 5FCKA 1DVAH 2BDHA 1O2KA 1DPOA 1HAZB 1ZRBA 1NBME 3FZDA 1C5WB 2ZO3H 5EW1H 2Z3CA 2XBXA 2RCEA 2BB4A 1IQMA 2BXTH 4NIVA 1GMDG 3BTWE 1EPTB 1ELGA 5DP8A 1NROH 3SUGA 1BMNH 4ISOA 3U28C 1B7XB 2BVRH 2Z94A 4FU8A 5C1YA 2KFWA 1F0UA 2O8LA 4CRCA 1IQGA 2JETB 5C17A 2WPHS 4P00A 1A1RA 1MTNB 1C1MA 3K2UA 3DSGA 2BTCE 3BTKE 1Y3WA 2BLWA 1YPHE 2BDYA 4Y8YA 5HKKD 1MBMA 4ESTE 3L3TA 4GPGA 4JYTA 1K1NA 2C93B 4UFGH 4OS7A 3T5FH 1AKSB 4GVUA 3RUOA 1QURH 1Y3VA 1GG6B 2QF0A 2ZPRA 1G2MA 1XUJA 1O0DH 2QXIA 3E8LA 4D9RA 2HPPH 3QWCH 1F92A 4NIXA 4X2VA 1GI2A 3UTUH 1PPZA 3K6YA 2HLCA 3MFJA 1RTKA 3RM0H 3U8OH 3OY6U 1WCZA 3O8RA 2THFB 3M5NA 1YLNA 3VB5A 1Q31A 1QGFA 4B2AA 1U6QA 4WVPE 1O2UA 5LPFA 4X8TH 1SI5H 1W0YH 1XUHA 1NFUA 3O8CA 2BD5A 5J4SA 4Z6AH 1Z1IA 3SYJA 1KLIH 2CN0H 4JZEH 5A09A 1LKAA 1CQQA 1YP9A 1C1RA 1C1PA 2ANMH 1JXPA 4X0WU 2BDBA 2JDID 1GCTC 1O2TA 1AB9B 1E0FD 1GWAA 1QL8A 2ODPA 3MH6A 1FNIA 1C5YB 4K2YA 6ESTA 1SQAA 3A89A 5FAHA 4FUDA 1TNIA 2G5NA 1RGQA 2SNVA 3KQEA 1HYLA 3T27A 2Y81A 2O8MA 1G36A 1TPOA 1AGJA 3LGVA 1UTPA 3Q3YA 4YOJA 4GHQA 2W5EA 2C4FH 2OXSA 1AFQC 2RDLA 2C90B 3F9HA 1XVOA 1RRKA 3F6UH 3M7UA 2ZZUH 4IW4E 4MLFB 4Y71A 4NFFA 2FO9A 2YNBA 2HNTE 2VNTA 3QLPH 3UQVA 3GDUA 3RM2H 3B9FH 1NRNH 3GOVB 2P93A 3MO9A 4KTUA 4MTBA 1TX6A 3RXPA 4ACBA 4B76A 1P2OA 1V2JT 4CRBA 1K9OE 3BTTE 1NU9A 1AUTC 1K22H 5F8ZA 1BTWA 1H8HD 1UCYE 2CJIA 1FY3A 2WPDD 2QGRA 3OEHD 4WJG2 3G01A 1C1OA 1UVTH 1GHWH 2ZTYA 2ZTXA 1MKWK 1O3PB 4B6FA 3M36A 3PV4A 1TNJA 3OTJE 2FOEA 4JZIA 5EQQA 1AFEH 1UTLM 1EUFA 3VGCB 2OQUA 2VGCB 4IC6A 1J17T 4MNYA 3LGUA 5ESBA 1PPHE 4F48B 4Y10E 1GGDB 2J98B 3PROA 1SOTA 1XVMA 1MKXH 2BQ6B 1GI9B 1EOLA 1MABB 1TABE 2AHME 2UUFB 1DFPA 4VGCC 1DITH 5EODA 1O3DA 1UTNA 1W3CA 2OCVB 3KQCA 5HIZA 1ELAA 2UUJB 5C94A 3MH7A 2ZP0H 1KLJH 1P2IA 4IGDA 3F9EA 1SVPA 3H5CB 3UB0A 1Y59T 1BT7A 2PKSC 4X2WA 5LGOA 2D2DA 5DP4A 1TX8A 5DKMA 2JH5D 1SGTA 4ISHH 3ZVCA 3E16B 3EA8A 1V2MT 4OGXA 1QFKH 1OWEA 1VKYA 3GCNA 5C1UA 3SU1A 2VH6A 2CF8H 1SGQE 1SHHB 1F0SA 3SQEE 1TAWA 3A81A 4HFPB 1SGFG 5GXPA 5AFYH 1A0LA 3ATWA 3OTPA 3Q76A 2C8YB 1EAXA 1VJ9U 1BB0B 1XKAC 4H6TA 4OS2A 3TJVA 1C1VH 1QR3E 4GSOA 1ZYOA 3ZVAA 1A7SA 4X1QU 3UQOA 3RXDA 2UWOA 1C5PA 1LCYA 1IQNA 2AMDA 4NSVA 3RXCA 1HB0B 2ASUB 3MOCA 5C67A 3EGKH 1SFQB 1CT0E 3ESTA 2PTNA 4TSFD 2P3FH 4UFDH 1AVGH 1O38A 2VVCA 4YM9A 1ANEA 1UTMA 2BHGA 1Z7KA 1THPB 4MNWA 1EKBB 1ZSLA 2VWLA 1IQFA 2FODA 2ZU2A 5C5OA 1O2OA 1UCYK 1BJVA 1TYNA 4YLQH 2WSSD 2PLXA 1E37B 1HAVB 1EAWA 1QJ1B 1OWDA 3N7OA 4CBNA 4QT8C 2A5AA 4MVNA 3D23A 1QZ8A 1XUKA 2ZDVH 3AVZA 4JK6A 4D8NA 1EB1H 4MPWA 2WPKS 5G4BA 2ZCHP 2FX4A 2G00A 1FAXA 5C0UA 1TNGA 5IYTA 2EI6A 4NCYA 7LPRA 1K0HA 5JYIA 4CRAA 1LPGB 4R8TB 5F8XA 5FPYA 2VINA 1S5SA 2TGPZ 4I8HA 1TOCB 3H09A 2KR7A 2RA0A 3QDZB 3BG4C 4JMYA 3SNDA 2AGIX 5EJLA 2VIDA 3SUFA 5AFZH 3P8GA 5JB8S 4I8LA 2JH6D 2XWBI 1D6RA 1O2WA 4XOJA 1C5QA 4WF8A 1UK4A 3NPSA 1H9IE 1H4WA 4IBLH 1UHBA 1XX9A 1BBRK 3T62A 1ZPZA 2SGFE 3PTNA 1H8DH 4ABGA 4BXWA 1VZQH 2GZ9A 3TH2H 2J9NA 1SLXB 4Y6DA 3TITA 4AFZA 2ZGHA 1TALA 1BCUH 1YPHC 1D3TB 1E35B 1ZPCA 1PPFE 5C3NA 1ABJH 1IOEA 3D49H 1O2MA 2ALPA 4I32A 1SGDE 2SGQE 3OYPA 2G5VA 2NU4E 4B73A 1TBRH 2AERH 1QBNA 2FX6A 5DK1A 5JPMH 2O8UA 3HKJB 2FI4E 1QJ7B 2ZHQH 5FX6A 2G52A 2FI5E 3FP7E 2TGDA 4A1TA 5ESTE 1OWHA 2XCFA 2VWMA 3MO6A 3A8BA 2HVYB 3LJJA 1DWBH 4ABBA 1PQ8A 2CF9H 3ELAH 1P2NA 3RU4D 2ZCLP 2OQ5A 2KZ4A 2VVVA 2R2WU 1Y5UT 3MWIU 4ZHLU 2GP9B 3UWIA 1NM6A 1T8MA 2QA9E 1KXEA 2ZDNA 1W7GH 1ARCA 1Z6EA 1OP0A 3MNSA 2GCHG 1NRSH 1V2OT 4UDWH 2QF4A 1NRPH 4ZHAA 3A7VA 1B5GH 1FIZA 2Z3DA 1HFDA 3KF2A 1IQLA 1D3QB 1TA6A 2XBVA 2G81E 1TRNA 2ZHDA 2J34A 1GHBG 1XXFA 4I8KA 4XBBA 1ZMLA 1C5LH 4NGAH 1O3HA 3LKWA 4AG2A 2ILNA 3JZ2B 1MD8A 1KDQA 2QXHA 2OC1A 5JB9S 1GJ7B 1L0ZA 4THNH 2BY7X 1UK2A 2CK3D 4MG3A 2BQWB 3MMGA 5F8TA 3UOPA 3SZNA 4FUJA 4F49A 3LT3A 5TJXA 2ZKSA 5K0HA 2HNTC 4ASHA 2FWWA 1KXBA 1P01A 1ESBA 2KM0A 2OUAA 3UR9A 4BOHA 1ELEE 1O2QA 1OWKA 2BDCA 1MD7A 4INKA 5F03A 4BAMB 3BG8A 3RU4T 2ZFRH 1KTSB 1A3BH 1FN6A 1D9IA 2EA3A 3LC5A 5A8ZA 4TY6A 1W13U 1EJMA 1DT2A 5DP6A 1QL9A 2WYJA 1TGBA 1KYNA 3RC5A 2R0LA 5AHGH 4K3JA 1ETRH 4MPXA 1IQKA 1RD3B 3RMNH 5DO4H 3PWCA 2ZECA 4E7RG 2UUKB 4NA7A 3UNSA 3GCHB 2QF5A 1F2SE 4XFQA 3OSYA 4DIIH 4DG4A 1P2MA 1TIOA 2ZC9H 4A1XA 1O3MA 4WXIA 2A45B 1LHDH 2BY8X 2D1JA 2ULLA 2EY4C 2ZG0H 1Z8GA 4UD9H 2OK5A 1OPHB 1BUIA 2GV6A 2ZHWH 4K8YA 1THSH 2XWAA 1ETSH 3FVFB 3SO3A 3ATIA 1V2LT 2A7CA 2PHBA 2L6OA 1LHFH 1NRRH 3PM3A 1TGNA 1ZLRA 2FMJA 2XBYA 2W26A 1DLKB 4P02A 5J4QA 3CS7A 1ACBE 1HPGA 2FTMA 6GCHF 1C5RA 1JWTA 1S0QA 2BOHB 2GCTB 1N8OC 2ZQ2A 5JBTA 2B8OH 3HGPA 1DLEA 2ZEBA 1TNHA 3SGAE 2O8WA 3T28A 1GHAF 1TLDA 4KELA 1GJ4H 1WAYB 2W3KA 2FPZA 2FOMB 3ZZ5A 2EI8A 1GDQA 2K8IA 2BD3A 1QL7A 4DVAU 1DWEH 1MKWH 4X2XA 3NWUA 3SUDA 2TBSA 3C1KA 2ANKH 1FY1A 2TIOA 5C0TA 4DIHH 3RXTA 1K21H 4GCHF 1UMAH 4AORA 1HIAA 4GLYA 1THRH 1GJ6A 3ZZCA 3BTFE 2A5IA 2ZPQA 1PPCE 1GDUA 3SNAA 4NA9H 4FUCA 1EPTC 3SJOA 1KTTB 2A4GA 2LP6A 1SKYE 2ZGJA 2FOAA 3BTME 5GDSH 3TJOA 1H1BA 2TPIZ 4XSKU 2Q6FA 3PO1B 2JETC 5HXFA 1HGTH 4AG1A 5A0AE 2FYRA 1MTNC 1DUEA 1S0RA 3PMBB 3R0FA 2W7UA 3GYMA 4U2WA 2ZDKA 2LNCA 1K1LA 4E7NA 1NFWA 1ZJKA 2A7HA 3TJUA 1CGIE 1GJ9B 4Q7YA 1PPEE 2C8XB 2VU8E 1SLUB 4Y11E 1B0EA 3E0PB 4CHAB 1GG6C 2BQ7B 1GI8B 5SGAE 5A0BA 4KP0A 3MH4A 3RXQA 5L30H 1AWFH 1BMFD 1C1UH 3OE7D 1AE5A 3ZVDA 1BITA 1SQRA 3T26A 4ZUHA 1C2FA 1MZAA 2J38A 4WH8A 1GI7B 1GVKB 4IC5A 3PYHA 3RXOA 1FI8A 3QN7A 1OHHD 2FS8A 4CRFA 3DHKH 5HYOA 3UY9A 2AS9A 3PWBA 3NXPA 2SGEE 3GY2A 3E1XB 4BTUB 3UR6A 2CMYA 4K1SA 1AB9C 3SJIA 1MTUA 2BDAA 2H9HA 1UCYH 5EW2H 4X1SU 4E06H 3ZZ6A 1ZHRA 1P3EA 1TB6H 3ZVBA 3KYFA 2L74A 1GJCB 2BLOA 3KQBA 3T25A 1SMFE 2VWOA 2Z9LA 1WQVH 5DG6A 1O37A 1CHGA 1G3EA 4IS5A 3V13A 1IHTH 3VXFH 2KAIB 1BMAA 6CHAC 1NN6A 2P8OC 3DSPA 3S9BA 4BAKB 1SGPE 1MQ5A 1A3EH 4UFEH 2UWLA 1KMHB 1VITF 5E0JA 3F2HA 3SI3H 4TYDA 3SJKA 1AHTH 1TE0A 1O2XA 2WINI 3AK5A 3MH5A 1SC8U 3PV5A 5KECA 1EZXC 1T4UH 1EZQA 2ZFQH 1MTWA 2SFAA 3GCTF 4AYYB 1EAUA 4X1NU 4ISIH 1BBRH 2XC4A 3DT0H 1WYKA 3I78A 1PQAA 3UUZA 4MPUA 2BX3A 4HI3A 3MHWU 4OS4A 1QIXB 1UTKA 3P70B 2C8ZB 1P09A 5E2PA 1Y3YA 3VGCC 2VGCC 3BEFB 1E1RD 1P11E 1TX7A 3Q77A 4HZHA 2ANYA 3RMLH 1J16A 1QHRB 1UTJA 3KCGH 1EOJA 1LO6A 1GGDC 4FOUC 1LPKB 1CT4E 2PFEA 3SJ9A 1IHSH 5C20A 3W95A 4XRNA 1HXEH 8GCHG 1BTPA 1CBWC 4K60A 1T8OA 1HAYB 5LPRA 1KDQB 3AAUA 2BD4A 3BEUA 4U01A 2IJOB 1G3BA 1BQYA 2FEQH 4ZKOU 1AU8A 1DY9A 3DUXH 4CR5A 4K1EA 3KQDA 1HUTH 1FDPA 2A4QA 1UJ1A 4Y0ZE 3P8OA 1QNJA 3DCLA 2B7DH 3E3TA 4IMQA 5EJZA 1C1NA 1ZPBA 3VB7A 1O3BA 2G4UA 3P92A 7GCHF 2GGVB 2Y80A 1GI4A 2IPHA 3IG6B 4B2CA 3PMJA 3KIDU 1MH0A 5L2ZH 1WOFA 4GHTA 2ALVA 4X1RU 1WSSH 3S0NA 1GPZA 1GBKA 2FOCA 1J9CH 3SV2H 4DY7B 4M7GA 1TQ0B 3F3BA 7KMEH 3L6PA 1EB2A 2VIVA 3MNBA 1GI3A 3I77A 3RP2A 2QAAA 1DX5M 1BA8B 4NFEA 4A1VA 3GYLB 1GJBB 3IWMA 3MU1A 1GMHG 3QGJA 1SOZA 2D8WA 1BIOA 2K1QA 1CA8B 4UE7H 1FJSA 5EGMA 5EQSA 1VCPA 2V35A 4BAOB 1VCQA 2H1UA 2JKHA 1EATA 4OS5A 3RLWH 3EE7A 4BAQB 1BTYA 1V2VT 3MI4A 3A80A 3FN8A 3H7OA 1ESTA 2P95A 2JJ1D 1MU8B 3TGJE 4RT1A 1A46H 1NC6A 1EP5A 3P95A 1M9UA 2BOKA 2AMPA 3GY8A 2YMSD 1Y3UA 3SV8A 2TGTA 1FPHH 3F9FA 2FDAA 1DDJA 1ELTA 1IQJA 2BXUH 3MNCA 4D9QA 2Y5GA 3RXBA 4MDSA 1C5XB 2NU0E 4YT6H 1T31A 1LHGH 1KXCA 2BD7A 1LVBA 2V6NA 3QTOH 7ESTE 1BBRE 2ZPSA 2BD8A 3ZV9A 2A2XH 5L6NH 5LH8A 1YCPH 1HDTH 1P04A 1O36A 2SGDE 2F9VA 1H8ED 2CHAC 1NY22 1O30A 4Y8XA 4INLA 1C1TA 2GT8A 1LVYA 3EA9A 4H4FA 2WUBA 3WWBA 3PMHB 1Y3XA 3T2NA 1O2NA 2HWLB 1O3EA 3ENSB 4FU7A 1MCTA 1DWDH 2F3CE 4FU9A 4JYVH 2OINA 5BRRE 3MTYA 2P16A 3RXMA 3A8CA 1ZSJA 3SU2A 3D65E 2NU3E 5DP7A 3IITA 1VJAU 1UK3A 3M3SA 4YTAA 1AVXA 1HAIH 3SI4H 1VGCB 3OAAD 4AX9H 4A6LA 1G37A 3URCA 1GJ5H 2BYAX 3F0OA 5H4IB 1WDIA 3ATLA 2A4OA 4U32A 5CHAB 2XBWA 1IQEA 3RC4A 4YOIA 3ZV8A 2P59A 1C9TA 4GUXA 5E2OA 1UVPA 2BD9A 3RMOH 3MQKC 4FETA 1HV7A 1PPBH 1C2DA 3SUEA 2Q1JA 4I86A 1WTGH 2GKVE 2ZGBH 4SGBE 3W94A 1AZZA 4Y79A 5IK2D 3SW2B 4HG6A 2ZU4A 4DT7B 5E0GA 3KGPA 3PMAB 2P3UB 2SNWA 2XW9A 1SGIB
chains in the Genus database with same CATH topology
1ZSKA 3RXJA 4ABAA 1ZMNA 1HRTH 1NU7B 4X8VH 1N6YA 5HM2A 1JRTA 4PROA 5T6FA 2HALA 4FXGH 1GDNA 5EU8A 5FBEA 3UIRA 5HM9A 2ZTZA 1TMTH 4VGCB 9ESTA 1F0TA 1O34A 2Z9KA 5A8XA 3S9CA 4ZHMU 1GHAG 1DS2E 1C2IA 2QV1A 3OU0A 2F9BH 3HK3B 2PKAA 4F4OC 3SQHE 2W7SA 1JRSA 2QN5T 5T6DA 3ZZ4A 3RLYH 1PYTC 2XCNA 1GL1A 3SNBA 1YPKH 4LK4A 3S7KB 3RXSA 1UTQA 3K6ZA 2J94A 1NESE 2PGBB 2UWPA 3U1IB 4TWWA 4Q2KA 4I7YH 4GCHG 1OYTH 3ZZ7A 1GCDA 1Y5BT 3AASA 3SBKA 1RFNA 1FN8A 3VXEH 5GWZA 3SV7A 1P05A 1K1MA 1CSOE 1GI0A 4YESB 4D7GA 3BTQE 1QBVH 2ZFPH 4CRDA 1P9SA 1JIRA 3FANA 1W12U 1W2KH 4LZ1H 4WMDA 3LH3A 3LGWA 4X6MA 2AMQA 5HGGA 1H9HE 2FLBH 1HJAB 1PPGE 1BHXF 2ZHFH 1C2MA 2A1DB 1LQDB 3M61U 1P2JA 3D62A 4Q7XA 1LKBA 3V3MA 1HCGA 2HVXA 1DSTA 3GDSA 1J15A 4IN2A 1C5MD 1P2QA 1NFYA 3BTEE 1OSSA 1BZXE 1YGCH 5K7RA 1AKSA 1UO6A 1C1WH 1CA0B 5DPAA 1ZTLA 1V2TT 1ZTKA 1Z71A 5GPIB 3Q00A 1H8IH 4H42U 2M5TA 3P8FA 5EXNA 3BIVH 4ZH8A 3V7TA 3U8RH 3GICB 2ZU5A 4OS6A 4JZFH 3GY7A 1YM0A 3B8JA 2LPRA 1OWIA 1AD8H 2DE8A 4ABEA 1KXDA 3ZZBA 3O8DA 3U69H 3SU4A 1T4VH 2UUYA 2QXGA 4I8GA 3I29A 6LPRA 2Y6TA 3VB4A 3BTHE 4WWYA 1L1JA 1BRCE 1TGSZ 3K9XB 4YLUA 1Z8RA 4U30A 2AGGX 4DCDA 4FUHA 5L2YH 5FCRA 3RU4E 3A8DA 1O3LA 1TBQH 1KLTA 1BTZA 1DUAA 1ESAA 4IMZA 1O2GH 1ELCA 2V3OH 3ZZ3A 1P12E 1MAXA 1YF4A 2P94A 2F83A 1XM1A 2OLGA 1OS8A 2Z9IA 1OOKB 3TU7H 3SN8A 4FUEA 2QXJA 1O3AA 4CRGA 3UOUA 4WMEA 1TA2A 1ELFA 4TPYA 2EI7A 1C9PA 1VITG 2SGPE 2ZCKP 4I33A 3PO1C 1V2WT 8KME2 3ZYEA 4DURA 3GY6A 1HBTH 2HPQH 1AWHB 1C4U2 3VEQB 1RS0A 1O32A 1W7XH 3LOXA 2AH4X 1O5FH 3P17H 3GCTG 1BTHH 1GHYH 5FXLA 4AZ2B 3FP6E 3SU6A 1F5RA 4YT7H 1BTUA 2GDEH 2ZFTA 1LHEH 4CHAC 2EC9H 1EQ9A 1ZMJA 4R0IA 3TH3H 1HJ8A 1AO5A 2PR3A 1F7ZA 3BN9A 3ZVEA 5TCAA 1E38B 2QCYA 3NK8A 3EA7A 3KN2A 1E34B 1W10U 3ATKA 1BRUP 4Q80A 1C2LA 1ZRKA 1J8AA 1Z6JH 5EG4A 1LQEA 1L4ZA 2BVXH 5CMXH 1S83A 1KY9A 1A5IA 1YCPM 2FLRH 3RXKA 1HJ9A 3FFGA 4AFSA 1O3KA 1TBZH 1LMWB 1DSUA 2V3HH 1AZ8A 5FHTA 2QC2A 2IOTA 2BZAA 1MUEB 1SSXA 1SFIA 1JMOH 3E6PH 5FPTA 1MCVA 5F6MA 2OD3B 4DOQA 1MTVA 3RXUA 1W0ZU 2YNAA 4NWLA 4B75A 3A7XA 1FXYA 1P57B 3NUMA 1CE5A 3UWJH 1L4DA 3TK6A 4DGJA 1A4WH 1BOQA 1C2EA 2V0BA 1O2VA 1S6FA 3TJNA 4CH2B 3OX7U 1O31A 1OYQA 1GBDA 1L1GA 1N6XA 1FV9A 2PW8H 3SOSA 2A5KA 3A7WA 1WV7H 1YPLH 1SGYE 1VR1H 4YOGA 5EXMA 1DE7H 5EXLA 1O5CB 4XE4A 1SGRE 1C2HA 4TPIZ 1QRXA 1FONA 4ISLA 3U8TH 4Y76A 5E8EH 4TY7A 1D3DB 1FY4A 1Q2WA 1YPMH 4AN7A 4GAWA 1FY5A 1HXFH 4BAHB 5EOKA 1WUNH 4LZ4B 2H5DA 4FUFA 3QGNB 1HAVA 1XUGA 3RXHA 5T6GA 1UVSH 3KNXA 1P10A 2XC0A 2SGAA 2BM2A 4NWKA 1ID5H 1RXPA 2BLVA 3M5LA 3LGYA 4X6OA 4CH8B 1SHYA 4BTIB 4HGCA 1P3CA 2O9QA 1ZGIA 5GCHF 1AUJA 3BIUH 5AF9H 1GHBF 1O3IA 1SG8B 1JBUH 3LIWA 5EPNA 1K1OA 1DICA 1MAYA 1GVZA 2B0FA 4Y0YE 1L1NA 3STJA 3UPEA 1O3FA 3M7TA 1KXFA 1D3PB 3M3VA 3CS0A 1C5TA 3F9GA 3LGTA 4IN1A 1UHBB 3TGKE 4OS1A 2R3UA 1TONA 1B0FA 2TRMA 1RIWB 4ZKSU 1SPJA 3A82A 1P06A 3EYDA 5GJ4B 5DP5A 3U1JB 3A88A 1ZGVA 2WV5A 5E0HA 2B9LA 2FXRA 1ANCA 2ZFFH 4KKDA 1VCWA 1GBTA 1V2RT 2QY0B 2XRCA 4ABIA 4B1TA 2J2UA 2XTTB 1GMCF 1NZQH 3JZ1B 1O3NA 1O5BB 4ZXXH 1HAPH 1G2LA 1GBEA 2IN2A 4NIWA 1D4PB 1GBAA 5GIBA 1H9LB 4UFFH 2HNTF 1HNEE 3STIA 2WPJS 4X6NA 3PTBA 2C3SA 2FZZA 4RSPA 1GJ8B 1ZHMA 3EDXB 2A2QH 4FUIA 2OBQA 2GZ8A 1K28D 3O8BA 2FI3E 5CE1A 3A7ZA 5T3HA 2GMTB 1ZJDA 3UNQA 4I31A 2Q6DA 5C2ZA 2FS9A 1P03A 3CP7A 3TK5A 3MO3A 2PTCE 1V2UT 4SGAE 2XYAA 2A31A 3MU0A 1C5SA 2VH0A 4MNXA 5EQRA 1FMGA 1K2I1 4JZ1A 1QY6A 1PJPA 1P2KA 1G3CA 1NFXA 1ABIH 4OGYA 3QX5H 4TWYA 1DY8A 2ODQA 1O3GA 3K65B 2F9OA 1CO7E 1FIWA 2GX4A 1OP2A 4YO9A 1QTFA 4MNVA 1CU1A 4FVBA 3RXAA 1LPZB 2H9TH 1O2PA 4JK5A 1QCPA 3QUMP 1FLEE 3RXEA 1LHCH 1XMNB 1TPPA 1DWCH 5BPEA 2VWNA 1V2NT 2Z6BD 2GZ7A 2HOBA 4O97A 2WPMS 1LDTT 3HKIB 1GBLA 3PLPA 1ZTJA 4NIYA 1AY6H 1NRQH 3EQ0H 2R2MB 3NZIA 1DXWA 3QZRA 4AYVB 2VIWA 4AFQA 3TK9A 2G55A 3BEIB 1GI6A 1K1IA 2CGAA 1A5GH 1C4Y2 3A85A 4ABDA 1O33A 1QRWA 3FZZA 3TIUA 3UFAA 3S7HB 1O2JA 2ZDAH 4X8SH 4KGAA 3GDVA 1QA0A 3DA9B 2ZDLA 1T7CA 1YPJH 6CHAB 1EZSC 2P8OB 4CBOA 2Z3EA 1TNLA 3F68H 1GHXH 3SORA 1YLCA 1O3CA 2AFQB 1TRMA 1VGCC 3U9AH 3LH1A 3ZZDA 2FOHA 1ZZZA 3A86A 4O3UA 2D26C 1S82A 5CHAC 5EPYA 4DJZB 1DM4B 1O35A 3EE0B 1TRYA 2EEKA 2FTLE 2BY5X 1EJAA 4RKOB 2FP7B 1O2IA 1PQ5A 1K1JA 1HLTH 2NWNA 1OWJA 4JCNA 4H6SB 5TCCA 1BTXA 1FQ3A 1BJUA 1O5DH 3GY3A 3P8NA 4XBCA 1SGNE 3A84A 1TMUH 3FAOA 4INHA 1SQOA 1O3JA 2GVFA 1BMLA 1AI8H 1CGJE 1C5OH 3QK1A 1CHOF 1SLWB 2ZQ1A 4Y8ZA 2PSXA 2BX4A 1SB1H 2GT7A 3LU9B 2W3IA 3MU8A 1CBWB 1GCTB 3CENA 5A8YA 1ELDE 2FOFA 2RG3A 2BLQA 2Z9GA 4E05H 1YKTA 3TVJB 3LGIA 9LPRA 2XNIA 1TWXB 1AVWA 4ZXYH 3M5OA 1YPEH 4AB9A 4CREA 1NO9H 2J4IA 1HIAB 4AGJA 3HPTB 1C1SA 1DANH 4D76A 1X7AC 5I46H 2JH0D 3A7YA 2ZF0H 1FUJA 1BHXB 1TFXA 1UVOA 2F9NA 3AW0A 1ORFA 1F0RA 1AFQB 3VFEA 3ZVGA 1A5HA 3ZZ9A 1GMDF 4B74A 3EAJA 3Q3XA 1S81A 4ABFA 2DE9A 1OP8A 1AE8H 1YPGH 1C5UA 5ETXA 1O3OA 1YBWA 3SU0A 1QBOA 3BTGE 3GCOA 4B71A 4RKJB 1W11U 2VJ1A 4NA8A 1EP6A 1T32A 1HAGE 1W14U 1MU6B 1C5ZB 4NZLA 2PGQB 3DD2H 1HAOH 2ANWA 1HJAC 3TNSA 1FAKH 1KXAA 1QQUA 4LOYH 2P3TB 5LPEA 1GI5A 2F91A 1O2SA 3M3TA 4ABJA 1GJAB 4ZROA 3RXRA 2G8TA 1QB9A 2BDGA 5FX5A 2OTVA 1GI1A 1A0JA 1O2LA 4XBDA 1V2ST 3S69A 1GBBA 2H5CA 1C5VA 4AB8A 3TNTA 1CA0C 2QIQA 2R0KA 1MBQA 1ANDA 1MTSA 6GCHG 1QA7A 2BD2A 2FESH 2ZWLH 1LVOA 5JBCS 1YYY1 2QYIA 1C2KA 1XXDA 4MQAA 1DXPA 4FUGA 4Y7AA 3Q3KA 8GCHF 4J2YB 2ESTE 3URDA 1MQ6A 4X1PU 2PKSB 1G9IE 4KTCA 2RA3A 2BVSH 3FP8E 1XUFA 1EASA 2I6SA 5JBAS 3PLBA 2OC0A 5IDKA 1EAIA 1AQ7A 5DP3A 2BY6X 2Y82A 1TPSA 2H2ZA 3OY5U 1ZR0A 3A87A 2CHAB 2STBE 4J1YA 1G32B 1LVMA 2PUQH 5JDUB 1AN1E 1HAHH 1D6WA 2BDIA 2HGTH 2Y7ZA 1SQTA 2F9PA 4WH6A 2G4TA 1EPTA 3GCHC 2KAIA 1MMJN 4X2YA 2FOBA 1DOJA 4DW2U 1SGCA 3SGQE 2I6QA 1SBWA 3RXFA 2OP9A 1GMHF 1QQ4A 1GL0E 3M7QA 5DP9A 3T29A 4AOQA 3RC6A 3UNRA 2WV4A 2R9PA 4ZAEA 3LJOA 1TPAE 4BNRA 1O5GH 1S84A 3BF6H 3H7TA 1CT2E 4Y7BA 3SHCH 2ZU1A 1GHZA 1GVLA 3RXIA 3AW1A 8LPRA 4ZKRU 1N1LA 5DJ7A 1WQSA 5B6OA 1O5EH 5AVDA 5C1XA 2CXVA 3LONA 2GCTC 1QB1A 1Z8JB 2VIOA 2ZIQH 2F9UA 1Z1JA 1FZZA 2CV3A 3RDZA 3NKKA 1ETTH 3BG4B 3SNEA 3QTVH 1NPMA 5GCHG 2BMGB 5I25A 2ZNKH 4ABHA 4O9VA 1A2CH 1C4V2 1ELBA 1T8NA 5JBBS 1P0SH 3QZQA 2AGEX 1SLVB 2J95A 2ZFSA 2GD4B 4X8UH 2TGAA 1XKBC 1TNKA 3RMMH 1O5AB 1T8LA 1FPCH 4NSYA 1RJXB 2BZ6H 3L33A 4HTCH 2OC7A 3GY4A 1ANBA 2NU2E 8ESTE 3LDXH 1Q3XA 2FOGA 4O3TA 1YLDA 1V3XA 2AEIH 1ZOMA 2FIRH 2AIQA 3A83A 4K1TA 1E36B 3HK6B 1P02A 1AIXH 4CR9A 3TGIE 3DFLA 1ELVA 1MKXK 4AGKA 2G51A 1GMCG 3HATH 1NS3A 1MZDA 3KL6A 4BXSA 5ABWA 4FUBA 3E90B 5PTPA 2Z9JA 3PB1E 1UTOA 2Y5HA 3F1SB 3ITIA 3KEEA 1P8VC 2AYWA 1GJDB 3BTDE 2ZI2H 2BY9X 2ZDMA 4WY3A 2VIPA 3M35A 2ZHEH 3RXLA 1BRAA 2DUCA 3SU5A 3TPIZ 4UONA 1WTHD 2AIPA 2GDDA 4X6PA 1TOMH 2WUCA 4D7FA 1G3DA 1OX1A 1W8BH 2H9EH 1C2GA 1Y8TA 3C27B 3LPRA 3ZVFA 1O2YA 1J14A 1FY8E 3V12A 1ARBA 1Y5AT 3GY5A 5FPSA 4YZUA 3E91A 4K5ZA 4A7IB 2GTBA 4O03A 1YCPK 1SGEE 2GV7A 1V2QT 2FYQA 3SV6A 1IQIA 3P6ZB 1V6DA 5C5NA 3ZZAA 3WY8A 2Y5FA 1KIGH 3KHVA 1G30B 4K8BA 1AMHA 3B23B 3PLKA 1GBCA 5A2MH 5FBIA 1UVUH 4LXBH 2WYGA 2A4RA 1SR5C 2XC5A 3BSQA 3MU5A 1BMMH 1EXFA 3NCLA 2O8TA 1P9UA 3QO6A 2ZGCA 1C1QA 3A7TA 2OBOA 1RIWC 1S85A 2Q6GA 4Q7ZA 3DFJA 1BRBE 7GCHG 1SL3A 3LC3A 3ODDA 1EX3A 1OXGA 2J92A 2ZU3A 4A5TS 4BTTB 2C8WB 3A8AA 4MPVA 1JIMA 1F5KU 2VB0A 1NTPA 1RTFB 5HMAA 4JYUH 3AAVA 2Y7XA 1K1PA 4NZQA 3ZZ8A 3UREA 2YOLA 3SU3A 3SV9A 2PV9B 4I8JA 2WPIS 4ZMAH 4AFUA 1WBGB 4ISNA 1QJ6B 3MU4A 4JZDH 4FVDA 3RXVA 2WPLS 2PUXB 3SNCA 1Z8IB 1A61H 1BDAA 1GBMA 1V2PT 1A0HB 2Z7FE 1O2HA 2GMTC 2ODYB 1S6HA 2A0QB 4B2BA 4BANB 1LTOA 2A7JA 3GISB 1RTLA 3SGBE 4A92A 3ZYDA 5DGJA 5A0CA 1V2KT 1TQ7B 1KSNA 2GCHF 2STAE 4WMFA 1WU1A 1HAXB 1QRZA 2PWXA 3ATMA 1CGHA 1GBFA 4K69A 3HGNA 3U98H 1IAUA 1O2ZA 4WXVA 1GBIA 1NT1A 1F5LA 2VIQA 2R3YA 1PYTD 2XXLA 1PFXC 3R3GB 1SGFA 2HRVA 3SHAH 1C2JA 1IQHA 1L2EA 1JOUB 3M5MA 1OKXA 2FM2A 1N8OB 1VITH 4RN6A 1O2RA 1EJNA 1TGCA 3V0XA 3M37A 4KTSA 1GHVH 2H6MA 1EZUC 2B5TB 1C5NH 1CHOG 2VVUA 2PKAB 4XDEA 3RXGA 3VB6A 1ZHPA 3BV9B 3TLOA 3VPKA 1GBJA 1TMBH 1CVWH 1O39A 3ODFA 1PQ7A 2ZA5A 3MYWA