3A81A

Crystal structure of trypsin complexed with (e)-4-((2-nicotinoylhydrazono)methyl)benzimidamide (soaking 8 hours)
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cationic trypsin
publication title In-Crystal Chemical Ligation for Drug Discovery
rcsb
molecule tags Hydrolase
total genus 58
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2009-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3a81A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3a81A02
2H9EH 3KGPA 5A2MH 3STIA 3O8BA 2H9TH 2P94A 3KQEA 3UUZA 3GY6A 1YPKH 1Q3XA 5EXMA 2HRVA 1MTVA 1UTNA 1IQNA 1BMNH 1XVOA 1HJAB 1K1NA 4E7RG 3S9AA 1TNHA 2BY5X 1O39A 2VH6A 3KQBA 1UTKA 4WJG2 4GLYA 1XUJA 1QIXB 1FLEE 6GCHG 3U98H 5BPEA 2XWBI 1KXEA 1ZOMA 4Y7AA 1SGQE 3U8RH 4AGJA 1NFWA 2ZTYA 1F5KU 1G2LA 2ZF0H 2ZU4A 3DFLA 5C67A 2GTBA 1EQ9A 1ZGVA 3TGJE 2BY7X 1C5SA 1LPZB 2BX4A 2CGAA 2QIQA 3SORA 3QUMP 2VJ1A 1GJ8B 1MKXK 4DW2U 4NSYA 1ABJH 3ZVBA 3FAOA 3GICB 2A2XH 1EX3A 2TIOA 1FY3A 3V12A 4AB8A 1NFYA 1GMDG 2A7HA 3GCOA 7GCHF 2J95A 1K1OA 3FVFB 1MAYA 1ZPBA 1WAYB 4X1QU 3GDUA 1LHCH 2I6QA 3RXQA 3PMAB 1IQKA 4BAQB 1QL7A 5AVDA 1CO7E 4TPIZ 1QJ1B 1CBWC 1RXPA 3V3MA 2Y5GA 1VGCC 3F6UH 8LPRA 1RGQA 2FESH 3ENSB 4Q7ZA 4I31A 5FX6A 4AB9A 1V2PT 1NY22 1ZHMA 1HV7A 4H6SB 1HIAB 4UE7H 2BLOA 5F8ZA 2Z9LA 5L30H 2GZ7A 2A5IA 2QF3A 3JZ1B 1GVZA 1PPBH 1T31A 1OWEA 2PUXB 3EA7A 2W5EA 1K1MA 2PKSB 1DPOA 2FIRH 1XM1A 3UTUH 3OTJE 4B2CA 3C1KA 1A0HB 2Z9GA 1C5MD 2AH4X 1ESTA 1O3BA 2QGRA 3A7WA 3RDZA 3IWMA 1GI6A 4K2YA 1HCGA 3EYDA 1O2YA 1QHRB 2ZFPH 3LIWA 5L2YH 5CHAC 2BQWB 1P2MA 3PO1C 3K2UA 1Q2WA 1YPJH 1FPCH 1O35A 4ZUHA 3ZZ6A 3UNSA 1AQ7A 1SLXB 3RXLA 2SGDE 3QX5H 5C1YA 1C2EA 1QGFA 1BTXA 1HPGA 1QY6A 1VZQH 4ZMAH 2HPQH 3PB1E 4I7YH 1WUNH 8KME2 3PMJA 2Z7FE 1DXPA 1O5AB 3ATWA 1DDJA 1SGEE 2W7UA 1J14A 3S9CA 1O36A 3M5LA 4AFZA 1GG6C 3MU4A 1V2ST 5FCRA 1QB9A 1OP8A 1SFIA 3BTDE 1FZZA 1OSSA 3HPTB 1UVPA 4XSKU 1UK4A 1XKAC 3VXEH 5LH8A 2BDIA 5A8ZA 4ZAEA 4D9QA 4ISLA 9LPRA 1OPHB 2CMYA 1SGCA 1CBWB 5CMXH 1FV9A 1P11E 3A7TA 1DFPA 3A81A 2WV5A 1IQGA 2EEKA 1V2LT 1C1OA 1GJDB 2ZCHP 3NXPA 4MTBA 4YLQH 1QB6A 4IBLH 4U01A 2Z94A 1PQAA 3ZVFA 1K21H 1W12U 1LHDH 3S7HB 4BAOB 5F03A 1LDTT 1SOTA 1QQ4A 1UCYH 2FMJA 1GI9B 3UOUA 2HNTF 3PYHA 4X2YA 3ATIA 2VIDA 4Q2KA 3QZRA 2AMPA 4OS5A 2XC5A 1TBQH 3KCGH 1D3DB 1HLTH 1WBGB 1SHHB 1TNIA 3FP6E 4ZKRU 2QAAA 1EB1H 1EATA 5CHAB 2HLCA 7GCHG 3PO1B 1CQQA 4AX9H 1C2DA 1A61H 2ZGHA 3F9HA 1D3QB 1BBRK 1LKAA 1EKBB 1GDNA 1ZSLA 1Y3UA 4XOJA 2BLVA 1SI5H 2C4FH 1AFEH 1O2KA 1K2I1 1P02A 4K8YA 1ELGA 3RXSA 4OS1A 4CH8B 1K1LA 3NPSA 4XFQA 3RC5A 1XUHA 1VCQA 1GG6B 1SQOA 4K3JA 1BZXE 1P2KA 1OP2A 4Y8ZA 4FXGH 4Y10E 1NC6A 1EAXA 3M37A 3GCTF 2ZGBH 2AMQA 4AORA 1E37B 3A86A 4DVAU 4UD9H 1XUGA 3RXAA 3AW1A 1Z6JH 4ABFA 6CHAB 1O3MA 1BMLA 2HVXA 1ZTJA 3SNAA 1EXFA 8GCHF 2HWLB 2P3UB 3A83A 2ZQ2A 1SPJA 1QQUA 1F5LA 1O5DH 2FOCA 2H5CA 3O8DA 3R3GB 1D3PB 2P95A 1BT7A 2D1JA 2NU1E 1EUFA 1RTLA 1YM0A 1TRMA 1LQDB 1GI2A 3O8RA 1LQEA 1UVSH 3A7ZA 2FTMA 2BDHA 1EJMA 1GWAA 3RXMA 3ATKA 1HRTH 1XUFA 3P8OA 1DWEH 2PTNA 1FY1A 3TH4H 1MD7A 4X6NA 1KXAA 2DUCA 2GT7A 2SGPE 4ESTE 2JKHA 1KYNA 2RDLA 4Q7YA 4WWYA 3UQOA 5EW1H 2OP9A 1C9TA 1YPLH 1Z8RA 3V0XA 1SLVB 5HYOA 3WY8A 1YCPK 3AASA 2BXUH 1FY8E 5EODA 1WU1A 1K1JA 2XW9A 5GIBA 2GDDA 3M7QA 3BV9B 4ZH8A 1AI8H 1MUEB 3M5MA 2VWMA 2Q6FA 4D8NA 3MOCA 2QN5T 1EB2A 4SGAE 1ZRBA 1F92A 3SNBA 1KDQB 2VU8E 1O2MA 5JB8S 1YPHE 1D4PB 3SNCA 5G4BA 1G32B 4NA8A 2PLXA 2THFB 2FXRA 2AIPA 3RXDA 3QLPH 2PSYA 2Y5HA 1HNEE 3MU5A 4BAMB 5C2ZA 1Z8JB 2GCTC 5EQQA 1S6HA 3SO3A 2FYRA 4ABEA 4CRAA 3Q3KA 3UPEA 4NSVA 3CP7A 3SV6A 2OC7A 1AVXA 1TIOA 4M7GA 3F9FA 2GX4A 2BD8A 1OS8A 3Q76A 4E06H 1MKWH 1BTYA 3V13A 3S9BA 2H1UA 1WQVH 2BDYA 1TPSA 2W3IA 3RXPA 1B0EA 1SGTA 3FANA 1ZJKA 1C1UH 1BRBE 2BLQA 1G30B 4GCHG 4K1TA 1DUAA 1LPGB 4ISOA 3L6PA 1G37A 3RMOH 3MH5A 1VITH 1FMGA 2BY9X 3AAVA 3BTME 3TJOA 1A3EH 2ASUB 1X7AC 1FN8A 1L4ZA 1SG8B 4A1XA 4BXWA 5T6FA 1MTNC 4TWWA 2XC4A 1C5UA 3A8CA 1VR1H 3CENA 1BUIA 1QNJA 3GCTG 2BY6X 1GMCF 3LH3A 1BB0B 3ZVEA 4ABGA 4D7FA 1BA8B 4ABBA 1OWJA 1LO6A 3BG4B 4U30A 4MQAA 2RA0A 3SU5A 1C1SA 1GHAF 1AO5A 3PWCA 2FP7B 5JBAS 1BIOA 5EPYA 2SGFE 5GPIB 1FY4A 3RXJA 4X1RU 1LVBA 1HJ8A 4MLFB 1AWFH 2GDEH 1BMMH 1XUIA 5GCHF 4R8TB 1W3CA 1Z8GA 3A85A 1S84A 3LONA 4YZUA 1MTSA 3GOVB 3M5NA 1HJ9A 1AUJA 3A82A 3KNXA 2STBE 4MNVA 1TLDA 1QA7A 4CBNA 4JZDH 1AKSB 1HAVB 4ABHA 1H1BA 4UFFH 3D49H 2GCTB 4WMFA 2G8TA 1DT2A 1DLEA 1O38A 5TJXA 4DT7B 2P93A 3EA8A 1TMBH 3GY4A 4K60A 1SL3A 1UVTH 2P3FH 1OKXA 1ANCA 2ZG0H 4NWLA 5I46H 3MNBA 3I77A 5LGOA 1C5LH 1S0QA 3GCNA 1IQMA 1HYLA 1UVUH 1YPMH 2ANYA 1IAUA 4NGAH 4YTAA 1QBNA 2RG3A 3B8JA 1TA6A 2QC2A 1UO6A 3RU4D 1A0JA 2P8OB 3VXFH 1GDUA 1A2CH 1NFUA 3LPRA 3RU4T 3U8TH 2FS8A 4AYYB 1Z1IA 2C8YB 3NWUA 1NN6A 3P17H 1GJ6A 1HXEH 3PWBA 5EQRA 1MTNB 1O2HA 2XRCA 4ISHH 3MWIU 3MYWA 5JDUB 2FZZA 2V3OH 1O32A 3UIRA 1Y3WA 3ZZBA 1CA8B 3HK3B 3MU0A 5FBEA 1O2TA 5AFZH 2AYWA 1J15A 3DT0H 1ZHPA 2BD5A 1W13U 4KTSA 3ZZ9A 1MH0A 1MKXH 1ESBA 5DP9A 1F5RA 3SV7A 4NG9H 3RLYH 1W7XH 1P2NA 4K5ZA 4IC6A 2BOKA 1P03A 4BTUB 4LZ4B 3DD2H 3RLWH 1HAIH 2FDAA 2BB4A 4GPGA 2O9QA 2F9UA 2F9BH 4H4FA 1IQEA 1TB6H 1XUKA 5TCCA 7LPRA 1HXFH 2FX6A 1FQ3A 3A8AA 2G4UA 2XBVA 1EPTB 5IDKA 1UJ1A 2K1QA 1V2QT 2WPLS 2Z9IA 4WXIA 1WV7H 1GMCG 2SNWA 3OYPA 3TGIE 1C2LA 3M7UA 2EI6A 1EZXC 4AFUA 2HNTE 2B7DH 1MTUA 3SV2H 3K65B 1GHAG 2HGTH 4A5TS 4ABDA 1O31A 1NS3A 5DJ7A 5FCKA 1P3CA 1GVLA 1B5GH 1A3BH 5DGJA 3PLBA 2Z3EA 1AN1E 1ZYOA 1O5FH 1Y3VA 2Z9KA 1ELAA 5GCHG 1P8VC 2BD9A 1BITA 1KXCA 1MMJN 1P06A 1DM4B 4F4OC 1EOJA 3JZ2B 2ZDAH 2EC9H 2KAIA 3KQDA 1LHGH 5H4IB 1OXGA 4YLUA 1L1GA 3A7YA 1P0SH 3GY2A 1JOUB 1RFNA 1MD8A 2HOBA 4FUFA 4AYVB 1MQ6A 1C2HA 3E91A 3TU7H 2VINA 3URDA 3LGVA 3RXVA 2ZTXA 2VVUA 4BTTB 3VGCC 1GBTA 4IN1A 4J1YA 1TX6A 3SI4H 1JIRA 2SGEE 3OX7U 3TK9A 5EXNA 3SU3A 3E16B 2WPKS 3PM3A 1HB0B 3VFEA 2A45B 1P2QA 1Z6EA 1W7GH 4K8BA 1IQJA 1QJ6B 1GBMA 1SGFA 1C2IA 1P01A 1ORFA 3P8NA 3MNXA 5AFYH 4JCNA 1LPKB 1GCTC 3TJNA 2EI7A 3MU8A 1PFXC 2RA3A 3A87A 5T6GA 3RXGA 1O2SA 2OC1A 1YBWA 2HPPH 1TBZH 2M5TA 1XKBC 1C9PA 2ZHWH 2D26C 2WV4A 1AB9B 2PTCE 2DE9A 3UY9A 4ZHLU 1O37A 2A5KA 5ESTE 1TBRH 1TQ0B 1T8MA 5L2ZH 2WPJS 4CRCA 1ETTH 1GBFA 2IPHA 3BTGE 2F9OA 2WPIS 3FP7E 2GVFA 3GY3A 2O8UA 1C4V2 4DJZB 3H7TA 2BQ6B 4Z0KA 1J17T 2J94A 3RXIA 5DO4H 1OWDA 4X8UH 5CE1A 3ATMA 3LOXA 1O3GA 2GV6A 1BBRH 2QCYA 3SJOA 2WYJA 3K6YA 3NZIA 2G81E 4JK5A 4RKJB 2A5AA 1BJUA 1NO9H 5E8EH 1RRKA 3UWJH 3EQ0H 1FIWA 1NT1A 4ZKNU 3SU2A 2CHAC 1QBOA 1SGNE 4NIVA 3LGTA 2BD7A 4FUIA 1UTQA 3F9GA 3MH7A 2OXSA 3VGCB 1GI4A 1PQ5A 2O8LA 5GXPA 1C5RA 1Y8TA 2A1DB 1SR5C 4LOYH 5B6OA 1W10U 4ISNA 4BOHA 2VGCC 2CXVA 5GDSH 2SGQE 3RU4E 2R0LA 1O5GH 1L4DA 2JH6D 4CHAC 3VB4A 2TGTA 4GHQA 3VEQB 4LZ1H 3Q3YA 3SV8A 3BTEE 4NZQA 3MI4A 5AF9H 2G55A 1W14U 1P12E 2UWPA 1UK2A 1GCTB 1TPOA 2FODA 2STAE 3V7TA 1EJNA 2PWXA 1BTHH 2PGBB 2VNTA 2WPHS 1EAIA 1TNJA 2VH0A 1Y5UT 1GBEA 2Z3CA 3TITA 4TYDA 3LGWA 1GVKB 1BMAA 2QXHA 3MO3A 2PW8H 2Z3DA 4CR5A 3QWCH 2Y82A 3U1IB 5J4QA 4ABJA 4FUCA 3RXBA 1C2KA 1UHBA 1TONA 4CH2B 4O97A 3GY5A 1SB1H 1VJAU 2FOMB 3HKIB 2B9LA 4WY3A 1GBHA 1Q31A 1C1WH 1DUEA 3BTFE 2HNTC 1A4WH 4B76A 4YT7H 1GBIA 4WXVA 4I8KA 5DP8A 1VGCB 2GT8A 3ZZ8A 3SU1A 1NRQH 2XWAA 2FI3E 1K22H 1KTSB 5A0AE 4A92A 1C5ZB 5EG4A 1WTGH 4DY7B 1FXYA 1QCPA 1DANH 1ZRKA 1ZTLA 3ZYDA 1TGNA 1LHFH 3MNSA 3RC4A 2CHAB 5FXLA 1H9IE 2OTVA 1P9SA 1AE8H 3RXRA 1AD8H 1O33A 3W95A 2VIWA 3SGQE 5EXLA 1T8LA 4X1PU 3RUOA 1GJ4H 1PQ8A 1WYKA 2FX4A 3Q00A 1O3DA 2BLWA 4DOQA 2UUJB 1Y5BT 1ZSKA 2PV9B 1P10A 1BHXB 1L0ZA 2OCVB 4YOIA 4A1TA 1HGTH 1KDQA 6LPRA 4Y76A 3SUDA 2VGCB 3HKJB 1PPEE 1CGIE 2NWNA 3NUMA 3RMMH 1GPZA 4CHAB 1SC8U 2TBSA 1S0RA 1P2IA 3LH1A 1UTJA 2BZAA 3B9FH 1BRCE 1E38B 3AW0A 2ZPSA 4Y7BA 4OGYA 2R3YA 5DK1A 1C1PA 1QRXA 4ABIA 4ASHA 5LPEA 2J9NA 3AAUA 2CF9H 5TCAA 3KN2A 4TY7A 1EZQA 1BRAA 1YF4A 3SU4A 2BOHB 1BTUA 1SGPE 3A8BA 2VWOA 4F49A 1ELVA 3RXKA 4THNH 1AGJA 1IHSH 2F9VA 3MH6A 1HFDA 1Y5AT 1VJ9U 2FOEA 1GI3A 1YCPM 1A5GH 1O2NA 5ESBA 3E90B 3KEEA 4Y6DA 1TGSZ 3P8FA 5LPRA 5HGGA 4FU7A 3TH3H 1G3BA 1MBQA 2JETC 1GL0E 1TRYA 1GCDA 1SQAA 3M35A 1ESAA 4KP0A 4XBBA 3SHCH 1RTKA 1H8DH 3M61U 4WVPE 3RXUA 1TA2A 1KXBA 2ZNKH 3TPIZ 4UFGH 1ID5H 1TGCA 1SVPA 1BTZA 2ZI2H 1AUTC 4I8LA 1P04A 1ZMLA 2PKAB 1M9UA 2H6MA 1OYQA 1DS2E 2EA3A 1LVMA 1S6FA 3T25A 1NRNH 2VIQA 1F0SA 5K7RA 1GDQA 2BX3A 1ZSJA 1SGDE 4AG2A 1NRSH 1YLDA 4K1EA 4KTUA 1Z1JA 5AHGH 5ETXA 1O2OA 1O3CA 1C1VH 3LGYA 4HI3A 5HXFA 3UQVA 1TWXB 2JH0D 1ZMNA 3H7OA 1AKSA 4KKDA 1HAVA 1MZAA 2FS9A 1AY6H 2ZPQA 2FOFA 5F8TA 3HGNA 3LJOA 1OP0A 3MHWU 4OS7A 4MDSA 1HBTH 3C27B 4IMQA 1TNGA 1FY5A 2ZU1A 1UTMA 1QJ7B 5T3HA 5I25A 3SBKA 2CN0H 2C93B 1AVGH 2A32A 4IW4E 1O2VA 7KMEH 1QL8A 2WUBA 1PJPA 1LHEH 1QRWA 4BXSA 1F0TA 1UMAH 4H6TA 4ZROA 3BEFB 1FAKH 3MO6A 3EE0B 1KSNA 2ILNA 2RCEA 1HAPH 2C8XB 3QO6A 2FOAA 4HZHA 1JMOH 2PHBA 2FEQH 1NFXA 1FIZA 3LGIA 1O3OA 3ODDA 1T8NA 1P05A 2BTCE 2JETB 1UCYK 1FJSA 3ZVCA 4CREA 3P92A 2ZU5A 4IS5A 3M3SA 2Z6BD 4I8JA 2GZ9A 1UTPA 2R0KA 1DSTA 4FUGA 4B75A 1TMUH 4NZLA 2CV3A 1V2NT 1O2IA 1TRNA 2FOGA 1O5BB 4FUJA 1C2GA 1HAYB 3SQHE 4CBOA 4B73A 1E34B 5FPYA 1PYTC 5EPNA 5BRRE 1WQSA 2XBYA 3VPKA 2BHGA 3LU9B 1B0FA 3STJA 1C1MA 1YKTA 4XDEA 1HAXB 1CT4E 5F8XA 1O3IA 1AIXH 1DY8A 2GP9B 3ZZ7A 2VIOA 1W2KH 2Y7XA 5PTPA 5JYIA 1MCVA 3BEIB 2PSXA 3S69A 3S7KB 1Y59T 1NPMA 2O8TA 2OQ5A 1WCZA 4TY6A 8GCHG 1BDAA 4RKOB 1EPTA 1NZQH 4X1SU 3O8CA 1FI8A 3UWIA 2UUKB 4I32A 5E0HA 1S83A 1DY9A 1TGBA 4SGBE 2J92A 3MH4A 3ZZCA 3EA9A 5C20A 3M7TA 4DIIH 2UWOA 1C4Y2 3SN8A 2P3TB 1KXFA 1ELFA 2OBOA 4VGCC 1NRRH 2ZC9H 5ABWA 5EU8A 1C4U2 1V2MT 2BDCA 1O3PB 1O3HA 2BMGB 2W26A 1GMHF 1SQTA 1GHBF 1NU7B 1K28D 5A0CA 3OY6U 2ZQ1A 4HFPB 4YT6H 1AZ8A 2AFQB 4OGXA 1PPHE 6ESTA 1F0UA 1GJBB 1GJ9B 4BAHB 1LTOA 1YP9A 2BQ7B 1GBAA 1ETSH 1PPZA 5SGAE 3SU6A 1ELCA 5DKMA 1W11U 1MBMA 4KELA 1VITF 1WOFA 1TPPA 4NFEA 1V6DA 4IMZA 1UTLM 1RIWC 3L33A 2FTLE 4A7IB 1TFXA 3A8DA 4JYTA 2BY8X 1NRPH 1GI1A 1O2ZA 3E0PB 2IJOB 1D3TB 4CRDA 3NCLA 2Y5FA 3M36A 3TNTA 3U1JB 1GHVH 2QV1A 4Q80A 1RD3B 5A0BA 1DLKB 7ESTE 2XCNA 1P3EA 1CA0C 3PROA 4MNYA 3FFGA 3NKKA 2A7CA 3QK1A 3LDXH 1S85A 2ZU3A 1O3LA 3UR9A 2BYAX 1UVOA 1INCA 2BDAA 1XVMA 3M3VA 1TOCB 2AS9A 1E35B 3SU0A 2XTTB 3VB5A 3P6ZB 4R0IA 1BTPA 2OC8A 2ZEBA 3ZVDA 2VB0A 3E6PH 3SJ8A 5DP6A 4PROA 4VGCB 4Y71A 3HGPA 1KLIH 1EP6A 4NWKA 5GWZA 3SNDA 5FPTA 4B1TA 2ZKSA 2ZGCA 1PYTD 1N8OC 4ZHAA 3T29A 3RXFA 2AGEX 1O2RA 1D6RA 2XCFA 1DXWA 1HIAA 1HJAC 1O2GH 3HATH 1H4WA 1C5XB 3NK8A 4X2WA 2GCHF 1V2KT 1YPGH 1TYNA 4B71A 1ELTA 2VIVA 2OQUA 1TQ7B 3TK5A 2F9PA 3QTOH 3RC6A 1TMTH 1AMHA 4AZ2B 1F7ZA 4YOGA 4K1SA 2GMTC 1BRUP 2ESTE 1GJ7B 5EOKA 2C3SA 3VB7A 4NCYA 2ZZUH 3ZV8A 3FZDA 1DVAH 3BEUA 3MMGA 4GSOA 2BM2A 4X2XA 1RIWB 4INLA 5C5NA 1A46H 1MZDA 2DE8A 3IITA 1DWBH 2G51A 2F83A 1GI8B 1V2OT 2FM2A 4FVDA 1KLJH 2XNIA 5E2OA 2V6NA 3PMBB 1JXPA 2VVCA 3TIUA 3ODFA 3L3TA 1IOEA 1MCTA 3F9EA 1TNKA 1CA0B 3UOPA 1V2TT 4YO9A 1CT2E 3LJJA 1C1NA 1GHBG 3UR6A 3EAJA 3RXEA 2BDGA 1ANBA 1AHTH 3BTWE 1KXDA 1A0LA 1XXFA 1HAOH 3ZZ4A 1CGHA 1FDPA 4X8VH 2ZDLA 1CGJE 1P09A 1SGIB 1L1NA 1GBCA 1YGCH 5DP3A 2BXTH 1GJCB 1GGDC 1QR3E 2D2DA 5HM2A 1J9CH 4JYUH 1EP5A 2Q6DA 2FI5E 2O8MA 1FPHH 2UUFB 4ISIH 3ZZ5A 3KL6A 4MPWA 1VITG 1Y3XA 4FUBA 4UEHH 5FX5A 3RXOA 2J38A 1N8OB 3R0FA 5A8XA 5FBIA 4MVNA 2A4OA 4WMDA 2SGAA 4B2AA 1C5VA 3MNCA 4KGAA 1P57B 4YM9A 2JH5D 2PFEA 1TE0A 3ATLA 1DITH 1UCYE 5L6NH 4UONA 3A88A 1K1IA 2H2ZA 4GVUA 3ZZAA 1T4VH 1TX7A 2A4QA 4CRBA 4JZ1A 3GY7A 2V3HH 1O30A 2GMTB 2Y81A 5E0JA 3BTTE 1EASA 1HDTH 4A1VA 1D9IA 4Z6AH 5DG6A 3UFAA 1AE5A 1CHOF 5A09A 1IQIA 2VWNA 1O3JA 2GGVB 3DHKH 4TWYA 4E05H 1SSXA 2J2UA 1O3EA 1K1PA 2C8WB 4XE4A 2ODQA 1C5YB 3CS7A 2PR3A 1H8IH 3ITIA 5GJ4B 3VB6A 3KF2A 2QXIA 1C5PA 1D6WA 2UUYA 4INHA 4NIWA 2XYAA 1QA0A 1O5CB 4DG4A 4BNRA 1H9LB 2GD4B 4Y79A 2OUAA 1SBWA 3QTVH 1GI7B 3ZYEA 3SUEA 2GCHG 3GCHC 3E8LA 1QBVH 3H5CB 1OWHA 1GI0A 3A80A 1ZGIA 3ZZ3A 1G2MA 1AU8A 2O8WA 4ZKSU 1GHXH 2VVVA 1KLTA 2ANWA 1GGDB 3BSQA 4IC5A 2GV7A 4ZKOU 4X0WU 1GBBA 2I6SA 2BDBA 1S82A 1ELEE 1WSSH 2G52A 3T5FH 1QFKH 3QN7A 2FYQA 1C5WB 4GHTA 2XXLA 1FAXA 3QGNB 2ZFSA 1BOQA 2ANKH 2A31A 2R2MB 4KTCA 1G36A 2TGDA 4WMEA 2G4TA 1T32A 1SLWB 2KAIB 1PPCE 2PKAA 1O3FA 3LC3A 3LGUA 3AVZA 1GBLA 3QDZB 1MQ5A 1Y3YA 1J16A 1PPGE 3RMNH 1DOJA 1TAWA 2CF8H 1DWCH 4JZFH 3HK6B 3BIVH 1BHXF 3IG6B 4AN7A 1OWKA 4AGKA 1GJAB 2BVXH 2LNCA 1LVOA 2F9NA 2TGPZ 5FAHA 1FN6A 1E36B 1YCPH 5DP7A 1FNIA 2EI8A 1QTFA 1ZPZA 2LPRA 3ZVGA 1GHYH 3GYMA 3ZZDA 3SI3H 3SGAE 3FP8E 1VCWA 4ZHMU 4IN2A 4DIHH 6CHAC 4HTCH 2QA9E 5FHTA 2FOBA 5C3NA 2ANMH 1C5QA 2FPZA 1BCUH 4WH8A 3RXCA 3GY8A 4E7NA 1NESE 4OS4A 5LPFA 3GCHB 4MPUA 2YNBA 2BD2A 4I33A 3SJKA 1MAXA 1ZZZA 4J2YB 1YC0A 3KIDU 4FUHA 3SGBE 1Z7KA 5EQSA 2ZDNA 2G00A 2A4GA 3KHVA 4GUXA 4UDWH 2Y7ZA 1CHGA 1NM6A 1G3CA 3A84A 4FVBA 1CHOG 1CE5A 3DUXH 4JMYA 1B7XB 1T7CA 4NIYA 3B23B 2Z9JA 2A0QB 3RP2A 1JRSA 3BIUH 1O2WA 1O3KA 2ZTZA 1EJAA 1G3EA 4H42U 4NFFA 5T6DA 3A89A 4NIXA 2BVRH 3A7XA 4X6PA 2PUQH 4UFEH 2HALA 1WTHD 1SOZA 1HAZB 2SFAA 1GI5A 3SV9A 2J34A 4GAWA 3PTBA 1LKBA 4GCHF 4MNWA 2A7JA 1DE7H 1FUJA 3OY5U 2V0BA 2C90B 1ARCA 4YESB 4MPVA 3LKWA 1JBUH 1VCPA 4AFQA 4ZXYH 1G3DA 3U8OH 1GL1A 1H9HE 1ZTKA 1SGFG 3GISB 3SQEE 2H9HA 3RMLH 2ZO3H 1YYY1 4X6MA 1TABE 1V2UT 1YLCA 3P8GA 3PLKA 2ZGXH 3E1XB 1C5TA 3TLOA 2Y80A 1DWDH 3GDSA 4AFSA 2YOLA 1ANEA 1EZSC 1SLUB 3I78A 3URCA 4BANB 3MTYA 1XX9A 2NU2E 2AGIX 1T8OA 2AEIH 1HAHH 4MNXA 2BVSH 2BZ6H 2ZPRA 3EGKH 3RXHA 2OINA 4DURA 1ZMJA 1CVWH 1DX5M 1EZUC 2ZHQH 3TH2H 5HMAA 2IN2A 2NU3E 1TALA 3M3TA 2ODPA 1ZHRA 3RM0H 1TGTA 3D23A 2BD4A 1QURH 4JYVH 1AZZA 1UHBB 1F2SE 1ABIH 3TNSA 9ESTA 1C1QA 2UWLA 2YNAA 4B74A 2OC0A 4MG3A 1SHYA 1EOLA 3T62A 4FUDA 1KTTB 1Z71A 3BF6H 1W0YH 3MU1A 3UNRA 1CU1A 3QGJA 4X2VA 1JWTA 5JBBS 2VWLA 4JK6A 1ZPCA 2CJIA 1O5EH 4X8TH 3BG4C 1UK3A 3ELAH 2TRMA 4Y8XA 1CSOE 1O2LA 1NU9A 3BTKE 4WF8A 2FWWA 1TPAE 1U6QA 3M5OA 4ZXXH 1MU8B 1P9UA 1V2VT 4Y0YE 2VIPA 1GHZA 1CT0E 1E0FD 1NTPA 1SGYE 4Y8YA 2QF0A 2R2WU 5JBCS 1PQ7A 4AOQA 2B8OH 1C1TA 2V35A 3E3TA 1QL9A 2OD3B 2ZFFH 1GBKA 1YPEH 3I29A 5JBTA 4LK4A 5EW2H 2ALVA 3F1SB 3SZNA 3T2NA 3G01A 2TPIZ 4XBCA 1GBDA 4I8HA 2WINI 3SUFA 2B5TB 4I8GA 2C8ZB 1MTWA 3DA9B 2Y6TA 3UNQA 4FU8A 1XMNB 5IYTA 4D76A 1ZLRA 2BD3A 1IQLA 3BN9A 3LC5A 1IQFA 4QT8C 5C5OA 1ZJDA 3BTHE 4A6LA 1T4UH 2P16A 2P59A 2WYGA 5DP5A 1IQHA 4O9VA 1AVWA 1DSUA 1TX8A 3MFJA 1C2FA 2ZGJA 2P8OC 2ZU2A 4RSPA 1FONA 1S81A 2H5DA 1O2UA 3EDXB 1KIGH 5JPMH 3ESTA 2F3CE 3LT3A 1PPFE 1V3XA 4JZEH 3PV4A 1O2QA 1OX1A 1RJXB 2TGAA 3K6ZA 2W7SA 1ACBE 3SOSA 1LMWB 2ZDKA 2R3UA 1GBJA 1N6XA 1EAWA 5HM9A 4U32A 3SJIA 3W94A 2G5VA 3T28A 1A5IA 3KQCA 4BTIB 2XBXA 1ELBA 2W3KA 1F0RA 2ZA5A 3SW2B 1THPB 1QRZA 1QB1A 3K9XB 1C2MA 2NU4E 4DGJA 1L2EA 2AGGX 1V2WT 1AFQC 3SJ9A 3P95A 3TVJB 2SNVA 1XXDA 4MPXA 2FO9A 3RM2H 1UTOA 1OYTH 1EPTC 2FLBH 4NA9H 4OS2A 2ODYB 1AWHB 1N1LA 2ZECA 1GJ5H 3CS0A 1HUTH 2J4IA 2AERH 2A4RA 4CRGA 5DP4A 2WUCA 4WH6A 1BQYA 2ZIQH 4RN6A 1SFQB 2ULLA 4AG1A 1SMFE 1BTWA 3TGKE 2ZFTA 2Q6GA 6GCHF 3Q77A 2ZCKP 4YOJA 3T27A 3GYLB 4BAKB 2ZCLP 1C5NH 4FUEA 2XC0A 1O34A 1TNLA 2ZFRH 3VB3A 4Q7XA 4Y11E 2XBWA 1W8BH 1MU6B 4DCDA 1HAGE 1C5OH 2ZHFH 1TOMH 1LVYA 2ZHEH 2A2QH 3D62A 4IGDA 1OWIA 3N7OA 1O2PA 1ZR0A 1N6YA 3BG8A 1GMDF 1MKWK 3BTQE 3SNEA 4D7GA 3FZZA 3TK6A 1BBRE 1ANDA 1W0ZU 2GZ8A 5E0GA 2IOTA 2R9PA 2NU0E 1ETRH 3U69H 4TPYA 5C1UA 2ZDVH 4CRFA 4FU9A 1JIMA 3TJVA 3SUGA 4O3UA 2QY0B 2Q1JA 4HGCA 3T26A 5K0HA 2ZDMA 3RXTA 3QZQA 3UREA 1A7SA 1J8AA 1P2JA 2ZHDA 1AFQB 3PTNA 2QYIA 1GHWH 3DFJA 4JZIA 1DICA 3GDVA 4B2BA 1V2JT 2FLRH 2WPMS 2AIQA 4O3TA 4D9RA 2OBQA 1S5SA 4OS6A 2PGQB 1YPHC 5F6MA 5J4SA 2QXJA 3Q3XA 4X8SH 1EAUA 4U2WA 1L1JA 1AB9C 2OLGA 1NROH 3OSYA 2ZWLH 3A7VA 5A8YA 5DPAA 3TJUA 3ZVAA 1P2OA 1O3AA 4Y0ZE 2FI4E 4LXBH 1O0DH 1BJVA 2D8WA 1G9IE 4X6OA 1O2JA 4UFDH 3ZV9A 1THRH 5EGMA 1SGRE 4INKA 3U9AH 1LCYA 3D65E 8ESTE 1C1RA 3PMHB 2ZFQH 2FOHA 1ARBA 2B0FA 1GMHG 4O03A 1ELDE 5JB9S 1A5HA 2GKVE 3OU0A 1OOKB 1A1RA 1JRTA 1RTFB 2F91A 1C2JA 2ZP0H 1O3NA 1O2XA 3PLPA 4XBDA 3S0NA 1Z8IB 1RS0A 2G5NA 5C1XA 5FPSA 3E0NB 3F68H 1THSH 4NA7A 3P70B 1V2RT 5E2PA 1KY9A 2AMDA 3SHAH 2PKSC 2QXGA 1K9OE 1IHTH 4CR9A 3MO9A 2ALPA 4X1NU 4ABAA 4K69A
chains in the Genus database with same CATH superfamily
2H9EH 3KGPA 5A2MH 3STIA 3O8BA 2H9TH 2P94A 3KQEA 3UUZA 3GY6A 1YPKH 1Q3XA 5EXMA 2HRVA 1MTVA 1UTNA 1IQNA 1BMNH 1XVOA 1HJAB 1K1NA 4E7RG 3S9AA 1TNHA 2BY5X 1O39A 2VH6A 3KQBA 1UTKA 4WJG2 4GLYA 1XUJA 1QIXB 1FLEE 6GCHG 3U98H 5BPEA 2XWBI 1KXEA 1ZOMA 4Y7AA 1SGQE 3U8RH 4AGJA 1NFWA 2ZTYA 1F5KU 1G2LA 2ZF0H 2ZU4A 3DFLA 5C67A 2GTBA 1EQ9A 1ZGVA 3TGJE 2BY7X 1C5SA 1LPZB 2BX4A 2CGAA 2QIQA 4TSFD 3SORA 3QUMP 2VJ1A 1GJ8B 1MKXK 4DW2U 4NSYA 1ABJH 3ZVBA 3FAOA 3GICB 2A2XH 2IPQX 1EX3A 2TIOA 1FY3A 3V12A 4AB8A 1NFYA 1GMDG 2A7HA 3GCOA 7GCHF 2J95A 1K1OA 3FVFB 1MAYA 1ZPBA 1WAYB 4X1QU 3GDUA 1LHCH 2I6QA 3RXQA 3PMAB 1IQKA 4BAQB 1QL7A 5AVDA 1CO7E 4TPIZ 1QJ1B 1CBWC 1RXPA 3V3MA 2Y5GA 1VGCC 3F6UH 8LPRA 1RGQA 2FESH 3ENSB 4Q7ZA 4I31A 5FX6A 4AB9A 1V2PT 1NY22 1ZHMA 1HV7A 4H6SB 1HIAB 4UE7H 2BLOA 5F8ZA 2Z9LA 5L30H 2GZ7A 3OEHD 2A5IA 2QF3A 3JZ1B 1GVZA 1PPBH 1T31A 1OWEA 2PUXB 3EA7A 4XD7D 2W5EA 1K1MA 2PKSB 1DPOA 2FIRH 2KCOA 1XM1A 3UTUH 2XNDD 3OTJE 4B2CA 3C1KA 1A0HB 2Z9GA 3F2GA 1C5MD 4M9FA 2AH4X 1ESTA 1O3BA 2QGRA 3A7WA 3RDZA 3IWMA 1GI6A 4K2YA 1HCGA 3EYDA 1O2YA 1QHRB 2ZFPH 3LIWA 5L2YH 5CHAC 2BQWB 1P2MA 3PO1C 3K2UA 1Q2WA 1YPJH 1FPCH 1O35A 4ZUHA 3ZZ6A 3UNSA 1AQ7A 1SLXB 3RXLA 2SGDE 3QX5H 5C1YA 1C2EA 1QGFA 1BTXA 1HPGA 1QY6A 1VZQH 4ZMAH 2HPQH 3PB1E 4I7YH 1WUNH 8KME2 3PMJA 2Z7FE 1DXPA 1O5AB 3ATWA 1DDJA 1SGEE 2W7UA 1J14A 3S9CA 1O36A 3M5LA 4AFZA 1GG6C 2YMSD 3MU4A 1V2ST 5FCRA 1QB9A 1OP8A 1SFIA 3BTDE 1FZZA 1OSSA 3HPTB 1UVPA 4XSKU 1UK4A 1XKAC 3VXEH 5LH8A 2BDIA 5A8ZA 4ZAEA 4D9QA 4ISLA 3KQ5A 9LPRA 2F43B 1OPHB 2CMYA 1SGCA 1CBWB 4DT4A 3PRDA 5CMXH 1FV9A 1P11E 3A7TA 1DFPA 3A81A 2WV5A 1IQGA 2EEKA 3F0OA 1V2LT 1C1OA 1GJDB 2ZCHP 3NXPA 4MTBA 4YLQH 1QB6A 4IBLH 4U01A 2Z94A 1PQAA 3ZVFA 1K21H 1W12U 1LHDH 3S7HB 4BAOB 5EJ1A 5F03A 1LDTT 1SOTA 1QQ4A 1UCYH 2FMJA 1GI9B 3UOUA 2HNTF 3PYHA 4X2YA 3ATIA 2VIDA 2L74A 4Q2KA 3QZRA 2AMPA 4OS5A 2XC5A 1TBQH 3KCGH 1D3DB 2W6JD 1HLTH 1WBGB 1SHHB 1TNIA 3FP6E 4ZKRU 2QAAA 4YXWD 1EB1H 1EATA 5CHAB 2HLCA 7GCHG 3PO1B 1CQQA 4AX9H 1C2DA 1A61H 2ZGHA 3F9HA 1D3QB 1BBRK 1LKAA 2IJD1 1EKBB 1GDNA 1ZSLA 1Y3UA 4XOJA 2BLVA 1SI5H 2C4FH 1AFEH 1O2KA 1K2I1 1P02A 4K8YA 1ELGA 3RXSA 4OS1A 4CH8B 3PRBA 1K1LA 3NPSA 4XFQA 3RC5A 1XUHA 1VCQA 1GG6B 1SQOA 4K3JA 1BZXE 5HIYA 3DSGA 1P2KA 1OP2A 4Y8ZA 4FXGH 4Y10E 1NC6A 1EAXA 3M37A 3GCTF 2ZGBH 2AMQA 4AORA 1E37B 3A86A 4DVAU 4UD9H 1XUGA 3RXAA 3AW1A 1Z6JH 4ABFA 6CHAB 1O3MA 1BMLA 2HVXA 1ZTJA 3SNAA 1EXFA 8GCHF 2HWLB 2P3UB 3A83A 2ZQ2A 2V7QD 1SPJA 1QQUA 1F5LA 1O5DH 2FOCA 2H5CA 3O8DA 3R3GB 1D3PB 1VKYA 2P95A 2D1JA 1BT7A 2NU1E 1EUFA 1RTLA 1YM0A 1TRMA 4F48B 1LQDB 1GI2A 3O8RA 1LQEA 1UVSH 3A7ZA 2FTMA 2BDHA 1EJMA 3PV2A 1GWAA 3RXMA 3ATKA 1HRTH 1XUFA 3P8OA 1DWEH 2PTNA 1FY1A 3TH4H 1MD7A 4X6NA 1KXAA 2OK5A 2DUCA 2GT7A 2SGPE 4ESTE 2JKHA 4Q63A 1KYNA 2RDLA 4Q7YA 4WWYA 3UQOA 5EW1H 2OP9A 1C9TA 1YPLH 1Z8RA 3V0XA 1SLVB 5HYOA 3WY8A 1YCPK 3AASA 2BXUH 1FY8E 5EODA 1WU1A 1K1JA 2XW9A 5GIBA 2GDDA 3M7QA 3BV9B 4ZH8A 1AI8H 1MUEB 3M5MA 2VWMA 2Q6FA 4D8NA 3MOCA 2QN5T 1EB2A 4SGAE 1ZRBA 1F92A 2WSSD 3SNBA 1KDQB 2VU8E 1O2MA 5JB8S 1YLNA 1YPHE 1D4PB 3SNCA 5G4BA 1G32B 4NA8A 2PLXA 2THFB 2FXRA 2AIPA 3RXDA 3QLPH 2PSYA 2Y5HA 1HNEE 3MU5A 4BAMB 5C2ZA 1Z8JB 2GCTC 5EQQA 1S6HA 3UB0A 3SO3A 2FYRA 4ABEA 4CRAA 3Q3KA 3UPEA 4NSVA 3CP7A 3SV6A 2OC7A 1AVXA 1TIOA 4M7GA 4ACAA 3F9FA 2GX4A 2BD8A 1OS8A 3Q76A 4E06H 1MKWH 1BTYA 3V13A 3S9BA 2H1UA 1WXRA 1WQVH 2BDYA 1TPSA 2W3IA 3RXPA 1B0EA 1SGTA 3FANA 1ZJKA 1C1UH 1BRBE 2BLQA 1G30B 4GCHG 4K1TA 1DUAA 1LPGB 4ISOA 3L6PA 1G37A 3RMOH 3MH5A 1VITH 1FMGA 2BY9X 3AAVA 3BTME 3TJOA 1A3EH 2ASUB 1X7AC 1FN8A 1L4ZA 1SG8B 5CHBA 4A1XA 4BXWA 5T6FA 1MTNC 2RDEA 4TWWA 2XC4A 1C5UA 3A8CA 1VR1H 3CENA 2LP6A 1BUIA 3WWFA 4Z1MD 1QNJA 3GCTG 2KZ4A 2BY6X 1GMCF 3LH3A 1BB0B 3ZVEA 4ABGA 4D7FA 1BA8B 4ABBA 1OWJA 1LO6A 3BG4B 4U30A 4MQAA 2RA0A 3SU5A 1C1SA 1GHAF 1AO5A 3PWCA 2FP7B 5JBAS 1BIOA 5EPYA 2SGFE 1K0HA 5GPIB 1FY4A 3RXJA 4X1RU 1LVBA 1HJ8A 4MLFB 1AWFH 2GDEH 1BMMH 1XUIA 5GCHF 3SZEA 4R8TB 1W3CA 1Z8GA 3A85A 1S84A 3LONA 4YZUA 1EFRD 1MTSA 1MABB 3GOVB 3M5NA 1HJ9A 1AUJA 3A82A 3KNXA 2STBE 4MNVA 1TLDA 1QA7A 1W0JD 4CBNA 4JZDH 1AKSB 1HAVB 4ABHA 1H1BA 4UFFH 3D49H 2GCTB 3DCLA 2G8TA 1DT2A 1DLEA 1O38A 4WMFA 5TJXA 4DT7B 2P93A 3EA8A 1TMBH 3GY4A 4K60A 1SL3A 1UVTH 2P3FH 1OKXA 1ANCA 2ZG0H 4NWLA 2F4LA 5I46H 3MNBA 2QF4A 3I77A 5LGOA 1C5LH 1S0QA 3GCNA 1IQMA 1HYLA 1UVUH 1YPMH 2ANYA 1IAUA 4NGAH 4YTAA 1QBNA 2RG3A 3B8JA 1TA6A 2QC2A 1UO6A 3RU4D 1A0JA 2P8OB 3VXFH 1GDUA 1A2CH 1NFUA 3LPRA 3RU4T 3U8TH 2FS8A 4AYYB 1Z1IA 2C8YB 3NWUA 1NN6A 3P17H 1GJ6A 1HXEH 3PWBA 5EQRA 1MTNB 1O2HA 2XRCA 4ISHH 3MWIU 3MYWA 5JDUB 2FZZA 2V3OH 1O32A 3UIRA 1Y3WA 3ZZBA 1CA8B 4RT1A 3HK3B 3MU0A 5FBEA 1O2TA 5AFZH 2AYWA 1J15A 3DT0H 1ZHPA 2BD5A 1W13U 4KTSA 3ZZ9A 1MH0A 1MKXH 1ESBA 5DP9A 1F5RA 3SV7A 4NG9H 3RLYH 1W7XH 1P2NA 4K5ZA 5B6LA 4IC6A 2BOKA 5F53A 1P03A 4BTUB 4LZ4B 3DD2H 3RLWH 1HAIH 2FDAA 2VBCA 2BB4A 4GPGA 2O9QA 2F9UA 2F9BH 4H4FA 1IQEA 1TB6H 1XUKA 5TCCA 7LPRA 1HXFH 2FX6A 1FQ3A 3A8AA 2G4UA 2XBVA 1EPTB 5IDKA 1UJ1A 2K1QA 1V2QT 3OFND 3KYFA 2WPLS 2Z9IA 4WXIA 2EY4C 1WV7H 1GMCG 2SNWA 3OYPA 3TGIE 1C2LA 3M7UA 2EI6A 1EZXC 4AFUA 2HNTE 2B7DH 1MTUA 3SV2H 3K65B 1GHAG 1W0KD 2HGTH 4A5TS 4ABDA 3MQKC 1O31A 1NS3A 5DJ7A 5FCKA 1P3CA 1GVLA 1B5GH 1A3BH 5DGJA 3PLBA 2Z3EA 1AN1E 1ZYOA 3OE7D 1O5FH 1Y3VA 2Z9KA 1ELAA 5GCHG 1P8VC 2BD9A 1BITA 1KXCA 1MMJN 1P06A 1DM4B 4F4OC 1EOJA 2KR7A 3JZ2B 2ZDAH 2EC9H 2KAIA 2YMSC 1WDIA 3KQDA 1LHGH 1UW7A 5H4IB 1OXGA 4YLUA 4RI0A 1L1GA 3A7YA 1P0SH 3GY2A 3WW7A 1JOUB 1RFNA 1MD8A 2HOBA 4FUFA 4AYVB 1MQ6A 1C2HA 3E91A 3TU7H 2VINA 3URDA 3LGVA 3RXVA 2ZTXA 2VVUA 4BTTB 3VGCC 1GBTA 4IN1A 4J1YA 1TX6A 3SI4H 1JIRA 2SGEE 3OX7U 3TK9A 5EXNA 3SU3A 2LELA 3E16B 4FETA 2WPKS 3PM3A 1HB0B 3VFEA 2A45B 1P2QA 1Z6EA 1W7GH 5C94A 4K8BA 1IQJA 4P02A 1QJ6B 1GBMA 1SGFA 1C2IA 1P01A 1ORFA 3P8NA 3MNXA 5AFYH 4JCNA 1LPKB 1GCTC 3TJNA 2EI7A 3MU8A 1PFXC 2RA3A 3A87A 5T6GA 3RXGA 1O2SA 2OC1A 5GNDA 1YBWA 2HPPH 1TBZH 2M5TA 1E1RD 1XKBC 1C9PA 2ZHWH 2D26C 2WV4A 1OHHD 1AB9B 2PTCE 2DE9A 3UY9A 4ZHLU 1O37A 2A5KA 5ESTE 1TBRH 1TQ0B 3KYGA 1T8MA 5L2ZH 2WPJS 4CRCA 1ETTH 1S6LA 1GBFA 2IPHA 3BTGE 2F9OA 2WPIS 3FP7E 2GVFA 3GY3A 2O8UA 1C4V2 4DJZB 3H7TA 2BQ6B 4Z0KA 1J17T 2J94A 3RXIA 5DO4H 1OWDA 4X8UH 5CE1A 3ATMA 3LOXA 1O3GA 2GV6A 1BBRH 5KECA 2QCYA 3SJOA 2WYJA 3K6YA 3NZIA 2G81E 4JK5A 4RKJB 2A5AA 1BJUA 1NO9H 5E8EH 2YMSB 1RRKA 3UWJH 3EQ0H 2KCPA 1FIWA 1NT1A 4ZKNU 3SU2A 2CHAC 1QBOA 1SGNE 4NIVA 3LGTA 2BD7A 4FUIA 1UTQA 3F9GA 3MH7A 5T1VA 2OXSA 3VGCB 1GI4A 1PQ5A 2O8LA 5GXPA 1C5RA 1Y8TA 2A1DB 1SR5C 4LOYH 5B6OA 2HVYB 1W10U 4ISNA 4BOHA 2VGCC 2CXVA 5GDSH 2SGQE 1YWUA 3RU4E 2R0LA 1O5GH 1L4DA 2JH6D 4CHAC 3VB4A 2TGTA 4GHQA 3VEQB 4LZ1H 3Q3YA 3SV8A 3BTEE 4NZQA 3MI4A 5AF9H 2G55A 1W14U 1P12E 2UWPA 1UK2A 1GCTB 1TPOA 2FODA 2STAE 3V7TA 4AC9A 1EJNA 2PWXA 1BTHH 4F55A 2PGBB 2VNTA 2WPHS 1EAIA 1TNJA 2VH0A 1Y5UT 1GBEA 2Z3CA 3TITA 4TYDA 3LGWA 1GVKB 1BMAA 2QXHA 3MO3A 2K8IA 2PW8H 2Z3DA 4CR5A 3QWCH 2Y82A 3U1IB 5J4QA 4ABJA 4FUCA 3RXBA 1C2KA 5DSFA 1UHBA 1TONA 4CH2B 4O97A 3GY5A 1SB1H 1VJAU 2FOMB 3HKIB 2B9LA 4WY3A 1GBHA 1Q31A 1C1WH 1DUEA 3BTFE 2HNTC 1A4WH 4B76A 4YT7H 1GBIA 4WXVA 4I8KA 5DP8A 1VGCB 2GT8A 3ZZ8A 3SU1A 3AK5A 1NRQH 2XWAA 2FI3E 1K22H 1KTSB 5A0AE 4A92A 1C5ZB 5EG4A 1WTGH 4DY7B 1FXYA 1QCPA 1DANH 1ZRKA 1ZTLA 2EQNA 3ZYDA 1TGNA 1LHFH 3MNSA 3RC4A 2WV9A 2CHAB 3N7EA 5FXLA 1H9IE 2OTVA 1P9SA 1AE8H 1H8HD 3RXRA 1AD8H 1O33A 3W95A 2VIWA 3SGQE 5EXLA 1T8LA 4X1PU 3RUOA 1GJ4H 1PQ8A 1WYKA 2FX4A 3Q00A 1O3DA 2BLWA 4DOQA 2UUJB 1Y5BT 1ZSKA 2PV9B 1P10A 1BHXB 1L0ZA 2OCVB 4YOIA 4A1TA 1HGTH 1KDQA 6LPRA 4Y76A 3SUDA 2VGCB 5FL7D 3HKJB 1PPEE 1CGIE 2NWNA 3NUMA 3RMMH 1GPZA 4CHAB 1SC8U 2TBSA 1S0RA 1P2IA 3LH1A 1UTJA 2BZAA 3B9FH 1BRCE 1E38B 3AW0A 2ZPSA 4Y7BA 4OGYA 2R3YA 5DK1A 1C1PA 1QRXA 2AHME 4ABIA 4ASHA 5LPEA 2J9NA 3AAUA 2CF9H 5TCAA 3KN2A 4TY7A 1EZQA 1BRAA 1YF4A 3SU4A 2BOHB 1BTUA 1SGPE 3A8BA 2VWOA 4F49A 1ELVA 3RXKA 4THNH 1AGJA 1IHSH 2F9VA 3MH6A 1HFDA 1Y5AT 1VJ9U 2FOEA 1GI3A 1YCPM 1A5GH 1O2NA 5ESBA 3E90B 3KEEA 4Y6DA 1TGSZ 3P8FA 5LPRA 5HGGA 4FU7A 3TH3H 1G3BA 1MBQA 2JETC 1GL0E 1TRYA 1GCDA 1SQAA 3M35A 1ESAA 4KP0A 4XBBA 3SHCH 1RTKA 1H8DH 3M61U 4WVPE 3RXUA 1TA2A 1KXBA 2ZNKH 3TPIZ 4UFGH 2KCYA 1ID5H 1TGCA 1SVPA 2QF5A 1BTZA 2ZI2H 1AUTC 4I8LA 1P04A 2QE7D 1ZMLA 2PKAB 1M9UA 2H6MA 5HKKD 1OYQA 1DS2E 2EA3A 1LVMA 1S6FA 3T25A 1NRNH 2VIQA 1F0SA 5K7RA 1GDQA 2BX3A 1ZSJA 1SGDE 5HIZA 4AG2A 1NRSH 1YLDA 4K1EA 4KTUA 1FX0B 1Z1JA 5AHGH 5ETXA 3VG8A 1O2OA 3CNRA 1O3CA 1C1VH 3LGYA 4HI3A 5C17A 5HXFA 3UQVA 1TWXB 2JH0D 1ZMNA 3H7OA 1AKSA 4KKDA 1HAVA 1MZAA 2FS9A 1AY6H 2ZPQA 2FOFA 5F8TA 3HGNA 3LJOA 1OP0A 3MHWU 4OS7A 4MDSA 1HBTH 3C27B 4IMQA 1TNGA 1FY5A 2ZU1A 1UTMA 1QJ7B 5T3HA 5I25A 3SBKA 2CN0H 2C93B 1AVGH 2A32A 4IW4E 3FO8D 1O2VA 7KMEH 5C0TA 1QL8A 2WUBA 1PJPA 1LHEH 1QRWA 4BXSA 1F0TA 1UMAH 4H6TA 4ZROA 3BEFB 1FAKH 3MO6A 3EE0B 1KSNA 2ILNA 2RCEA 1HAPH 2C8XB 3QO6A 2FOAA 4HZHA 1JMOH 2PHBA 3U28C 2FEQH 1NFXA 1FIZA 3LGIA 1O3OA 3ODDA 1T8NA 1P05A 2BTCE 2JETB 1UCYK 1FJSA 3ZVCA 4CREA 3P92A 2ZU5A 4IS5A 3M3SA 2Z6BD 4I8JA 2GZ9A 1UTPA 2R0KA 3DSOA 1DSTA 4FUGA 4B75A 1TMUH 4NZLA 2CV3A 1V2NT 1O2IA 1TRNA 2FOGA 1O5BB 4FUJA 1C2GA 1HAYB 3SQHE 4CBOA 4B73A 1E34B 5FPYA 1PYTC 5EPNA 5BRRE 1WQSA 2XBYA 3VPKA 2BHGA 3EE7A 3LU9B 1B0FA 3STJA 1C1MA 1YKTA 4XDEA 1HAXB 1CT4E 5F8XA 1O3IA 1AIXH 1DY8A 2GP9B 3ZZ7A 2VIOA 1W2KH 2Y7XA 5PTPA 5JYIA 1MCVA 3BEIB 2PSXA 2JDID 3S69A 3S7KB 1Y59T 1NPMA 2O8TA 3FOAA 2OQ5A 1WCZA 5KEDA 4TY6A 8GCHG 1BDAA 4RKOB 1EPTA 1NZQH 4X1SU 3O8CA 1FI8A 3UWIA 2UUKB 4I32A 5E0HA 1S83A 4OM9A 1DY9A 1TGBA 4SGBE 2J92A 3MH4A 3ZZCA 3EA9A 5C20A 3M7TA 4DIIH 2UWOA 1C4Y2 3SN8A 2P3TB 1KXFA 1ELFA 2OBOA 4VGCC 1NRRH 2ZC9H 5ABWA 5EU8A 1C4U2 1V2MT 2BDCA 1O3PB 1O3HA 2BMGB 2W26A 1GMHF 1SQTA 1GHBF 1NU7B 1K28D 5A0CA 3OY6U 2ZQ1A 4HFPB 4YT6H 1AZ8A 2AFQB 4OGXA 1PPHE 6ESTA 1F0UA 1GJBB 1GJ9B 4BAHB 1LTOA 1YP9A 2BQ7B 3OTPA 4B6FA 4ZCNA 1GBAA 4RT0A 1ETSH 2KM0A 1PPZA 5SGAE 3SU6A 1ELCA 5DKMA 1W11U 1MBMA 4KELA 1VITF 1WOFA 1TPPA 4NFEA 1V6DA 4IMZA 1UTLM 1E79D 1RIWC 3L33A 2FTLE 4A7IB 1TFXA 3A8DA 4JYTA 2BY8X 1NRPH 1GI1A 3FN8A 1O2ZA 3E0PB 2IJOB 1D3TB 4CRDA 3NCLA 4HG6A 2Y5FA 3M36A 3TNTA 3U1JB 1GHVH 2QV1A 4Q80A 1RD3B 5A0BA 1DLKB 7ESTE 2XCNA 1P3EA 1CA0C 3PROA 4MNYA 3FFGA 3NKKA 2A7CA 3QK1A 3LDXH 1S85A 2ZU3A 1O3LA 3UR9A 2BYAX 1UVOA 1QZ8A 1INCA 2BDAA 1XVMA 3M3VA 1TOCB 3F0PA 2KFWA 2AS9A 1E35B 4FOUC 3SU0A 2XTTB 3VB5A 3P6ZB 4R0IA 1BTPA 2OC8A 2ZEBA 3ZVDA 2VB0A 3E6PH 3SJ8A 5DP6A 4PROA 4VGCB 4Y71A 3HGPA 1KLIH 1EP6A 4NWKA 2HLDD 5GWZA 3SNDA 5FPTA 4B1TA 2ZKSA 2ZGCA 1PYTD 1N8OC 4ZHAA 3T29A 3RXFA 2AGEX 1O2RA 1D6RA 2XCFA 1DXWA 1HIAA 1HJAC 1O2GH 5CDFE 3HATH 1H4WA 1C5XB 3NK8A 4X2WA 2GCHF 1V2KT 1YPGH 1TYNA 4B71A 1ELTA 2VIVA 2OQUA 2RFKC 1TQ7B 3TK5A 2F9PA 3QTOH 3RC6A 1TMTH 1AMHA 4AZ2B 1F7ZA 4YOGA 4K1SA 2GMTC 1BRUP 2ESTE 1GJ7B 5EOKA 2C3SA 3VB7A 4NCYA 2ZZUH 2WZQA 3ZV8A 3FZDA 1DVAH 3BEUA 3MMGA 4GSOA 2BM2A 4X2XA 1RIWB 4INLA 5C5NA 1A46H 1MZDA 2DE8A 3IITA 1DWBH 2G51A 2F83A 1GI8B 1V2OT 2FM2A 4FVDA 1KLJH 2XNIA 5E2OA 2V6NA 3PMBB 1JXPA 2VVCA 3TIUA 2J98B 3ODFA 3L3TA 1IOEA 1MCTA 3F9EA 1TNKA 1CA0B 3UOPA 1V2TT 4YO9A 1CT2E 3LJJA 1C1NA 1GHBG 3UR6A 3EAJA 3RXEA 2BDGA 1ANBA 1AHTH 3BTWE 1KXDA 1A0LA 1XXFA 1HAOH 3ZZ4A 1CGHA 1FDPA 4X8VH 2ZDLA 1CGJE 1P09A 1SGIB 1L1NA 1GBCA 1YGCH 5DP3A 2BXTH 1GJCB 1GGDC 1QR3E 2D2DA 5HM2A 1J9CH 4JYUH 1EP5A 2Q6DA 2FI5E 2O8MA 1FPHH 2UUFB 4ISIH 3ZZ5A 3KL6A 4MPWA 1VITG 1Y3XA 4FUBA 4UEHH 5FX5A 3RXOA 2J38A 1N8OB 3R0FA 5A8XA 5FBIA 4MVNA 2A4OA 4WMDA 2SGAA 4B2AA 1C5VA 3MNCA 4KGAA 1P57B 4YM9A 2JH5D 2PFEA 1TE0A 3ATLA 1DITH 1UCYE 5L6NH 4UONA 3A88A 1K1IA 2H2ZA 4GVUA 3ZZAA 1T4VH 1TX7A 2A4QA 2CK3D 4CRBA 4JZ1A 3GY7A 2V3HH 1O30A 2GMTB 1YY3A 2Y81A 5E0JA 3BTTE 3F2HA 1EASA 1HDTH 4A1VA 1D9IA 4Z6AH 5DG6A 3UFAA 1AE5A 1CHOF 5A09A 1IQIA 2VWNA 1O3JA 2GGVB 3DHKH 4TWYA 4E05H 1SSXA 2J2UA 1O3EA 1K1PA 2C8WB 4XE4A 2ODQA 1C5YB 3CS7A 2PR3A 1H8IH 3ITIA 5GJ4B 3VB6A 4TT3D 3KF2A 2QXIA 1C5PA 1D6WA 2UUYA 4INHA 4NIWA 2XYAA 1QA0A 1O5CB 4DG4A 4BNRA 1H9LB 2PP6A 2GD4B 4Y79A 2OUAA 1SBWA 3QTVH 1GI7B 3ZYEA 3SUEA 2GCHG 3GCHC 3E8LA 1QBVH 3H5CB 1OWHA 1GI0A 3A80A 1ZGIA 3ZZ3A 1G2MA 1AU8A 2O8WA 4ZKSU 1GHXH 2VVVA 1KLTA 2ANWA 1GGDB 3BSQA 4IC5A 2GV7A 4ZKOU 4X0WU 1GBBA 2I6SA 2BDBA 1S82A 1ELEE 1WSSH 2G52A 3T5FH 1QFKH 3QN7A 2FYQA 1C5WB 4GHTA 2XXLA 1FAXA 3QGNB 2ZFSA 1BOQA 2ANKH 2A31A 2R2MB 4KTCA 1G36A 2TGDA 4WMEA 1H8ED 2G4TA 1T32A 1SLWB 2KAIB 1PPCE 2PKAA 1O3FA 3LC3A 3LGUA 3AVZA 1GBLA 3QDZB 1MQ5A 2XOKD 3FKSD 1Y3YA 1J16A 1PPGE 3RMNH 1DOJA 1TAWA 2CF8H 1DWCH 4JZFH 3HK6B 3BIVH 1BHXF 3IG6B 4AN7A 3N99A 1NBMD 1OWKA 4AGKA 1GJAB 2BVXH 1LVOA 2LNCA 2F9NA 2TGPZ 5FAHA 1FN6A 1E36B 1YCPH 5DP7A 1FNIA 2EI8A 1QTFA 1ZPZA 2L6OA 2LPRA 3ZVGA 1GHYH 3GYMA 3ZZDA 3SI3H 3SGAE 3FP8E 1VCWA 4ZHMU 2M2AA 4IN2A 4DIHH 6CHAC 4HTCH 2QA9E 5FHTA 2FOBA 5C3NA 2ANMH 1C5QA 2FPZA 1BCUH 4WH8A 3RXCA 3GY8A 2W6ID 4E7NA 1NESE 4OS4A 5LPFA 3GCHB 4MPUA 2YNBA 5IK2D 3PV5A 2BD2A 3F3BA 4I33A 3SJKA 1MAXA 1ZZZA 4J2YB 1YC0A 3KIDU 4FUHA 3SGBE 1Z7KA 5EQSA 2ZDNA 2G00A 2A4GA 3KHVA 4GUXA 4UDWH 2Y7ZA 1CHGA 1NM6A 1G3CA 3A84A 4FVBA 1CHOG 3SYJA 1CE5A 3DUXH 4JMYA 1B7XB 1T7CA 4NIYA 3B23B 2Z9JA 2A0QB 3RP2A 1JRSA 3F2FA 3BIUH 1O2WA 1O3KA 2ZTZA 1EJAA 1G3EA 4H42U 4NFFA 5T6DA 3A89A 4NIXA 2BVRH 3A7XA 4X6PA 2PUQH 4UFEH 2HALA 1WTHD 1SOZA 1HAZB 2SFAA 1GI5A 3SV9A 2J34A 4GAWA 3PTBA 1LKBA 4GCHF 4MNWA 2A7JA 3WWBA 1DE7H 1FUJA 3OY5U 2V0BA 2C90B 1ARCA 4YESB 4MPVA 3LKWA 1JBUH 1VCPA 4AFQA 4ZXYH 1G3DA 3U8OH 1GL1A 1H9HE 1ZTKA 1SGFG 3GISB 3SQEE 2H9HA 3RMLH 2ZO3H 1YYY1 4X6MA 1TABE 1V2UT 1YLCA 4P00A 3P8GA 3PLKA 2ZGXH 3E1XB 1C5TA 3TLOA 2Y80A 1DWDH 3GDSA 4AFSA 2YOLA 1ANEA 1EZSC 1SLUB 3I78A 3URCA 4BANB 3MTYA 1XX9A 2NU2E 2AGIX 1T8OA 2AEIH 1HAHH 4MNXA 2BVSH 2BZ6H 2ZPRA 3EGKH 3RXHA 2OINA 3NRLA 4DURA 1ZMJA 1CVWH 1DX5M 1EZUC 2ZHQH 3TH2H 5HMAA 2IN2A 2NU3E 1TALA 3M3TA 2ODPA 1ZHRA 3RM0H 1TGTA 3N7DA 3D23A 2BD4A 1QURH 4JYVH 1AZZA 1UHBB 1F2SE 1ABIH 3TNSA 9ESTA 1C1QA 2UWLA 2YNAA 4B74A 2OC0A 2J97A 4MG3A 1SHYA 1EOLA 3T62A 4FUDA 1KTTB 1Z71A 3BF6H 1W0YH 3MU1A 3UNRA 1CU1A 3QGJA 4X2VA 1JWTA 5JBBS 2VWLA 4JK6A 1ZPCA 2CJIA 1O5EH 4X8TH 3BG4C 4I86A 1UK3A 3ELAH 2TRMA 4Y8XA 1CSOE 1O2LA 1NU9A 3BTKE 4WF8A 1SKYE 2FWWA 1TPAE 1U6QA 3M5OA 4ZXXH 1MU8B 1P9UA 1V2VT 4Y0YE 4B6EA 2VIPA 1GHZA 1CT0E 1E0FD 5KGOA 1NTPA 1SGYE 1KMHB 4Y8YA 2QF0A 2R2WU 5JBCS 1PQ7A 4AOQA 2B8OH 1C1TA 2V35A 3E3TA 1QL9A 2OD3B 2ZFFH 1GBKA 1YPEH 3I29A 5JBTA 4LK4A 5EW2H 2ALVA 3F1SB 4Q4LA 3SZNA 3T2NA 3G01A 2TPIZ 4XBCA 1GBDA 4I8HA 2WINI 3SUFA 1E1QD 2B5TB 4I8GA 2C8ZB 5C0UA 1MTWA 3DA9B 2Y6TA 3UNQA 4FU8A 1XMNB 5IYTA 4D76A 1ZLRA 2BD3A 1IQLA 3BN9A 3LC5A 1IQFA 4QT8C 5C5OA 1ZJDA 3BTHE 4A6LA 1T4UH 2P16A 2P59A 2WYGA 5DP5A 1IQHA 4O9VA 1AVWA 1DSUA 1TX8A 3MFJA 1C2FA 2ZGJA 3OEED 1NBME 4ASUD 2P8OC 2ZU2A 4RSPA 1FONA 1S81A 2H5DA 1O2UA 3EDXB 1KIGH 5JPMH 3ESTA 2F3CE 3LT3A 1BMFD 1PPFE 1V3XA 4JZEH 3PV4A 1O2QA 1OX1A 1RJXB 2TGAA 3K6ZA 2W7SA 1ACBE 3SOSA 1LMWB 2ZDKA 2R3UA 1GBJA 1N6XA 1EAWA 5HM9A 3W1EA 4U32A 3SJIA 3W94A 2G5VA 3T28A 1A5IA 3KQCA 4BTIB 5EIYA 2XBXA 1ELBA 2W3KA 1F0RA 2ZA5A 3SW2B 2JJ2D 1THPB 1QRZA 1QB1A 3K9XB 1C2MA 5DN6D 2NU4E 4DGJA 1L2EA 2J5UA 2AGGX 1V2WT 2J98A 1AFQC 3SJ9A 3P95A 3TVJB 3DSPA 2SNVA 1XXDA 2JJ1D 4MPXA 2FO9A 3RM2H 1UTOA 1OYTH 1EPTC 4ACBA 3H09A 2FLBH 2KCAA 4NA9H 4OS2A 2ODYB 1AWHB 1N1LA 2JIZD 1GJ5H 2ZECA 3CS0A 1HUTH 2J4IA 2AERH 3ZIAD 2A4RA 3UAIC 4CRGA 5DP4A 2WUCA 4WH6A 1BQYA 2ZIQH 4RN6A 1SFQB 2ULLA 4AG1A 1SMFE 1BTWA 3TGKE 2ZFTA 2Q6GA 6GCHF 3Q77A 2ZCKP 4YOJA 3T27A 3GYLB 4BAKB 2ZCLP 1C5NH 4FUEA 2XC0A 1O34A 1TNLA 2ZFRH 3VB3A 4Q7XA 4Y11E 2XBWA 1W8BH 1MU6B 4XRNA 4DCDA 1HAGE 1C5OH 2ZHFH 1TOMH 1LVYA 2ZHEH 2A2QH 3OAAD 3D62A 4IGDA 1OWIA 2WHXA 3N7OA 1O2PA 1ZR0A 1N6YA 3BG8A 1GMDF 1MKWK 3BTQE 3SNEA 4D7GA 3FZZA 3TK6A 1BBRE 1ANDA 1W0ZU 2GZ8A 5E0GA 2IOTA 2R9PA 2NU0E 1ETRH 3U69H 4TPYA 5C1UA 2ZDVH 4CRFA 4FU9A 1JIMA 3TJVA 3SUGA 4O3UA 2QY0B 2Q1JA 4HGCA 3T26A 5K0HA 2ZDMA 3RXTA 3QZQA 1COWD 2KX4A 3UREA 1A7SA 1J8AA 1P2JA 2ZHDA 1AFQB 3PTNA 2QYIA 1GHWH 3DFJA 4JZIA 1DICA 3GDVA 3GS9A 4B2BA 1V2JT 2FLRH 2WPMS 2AIQA 4O3TA 2WPDD 4D9RA 2OBQA 1S5SA 4OS6A 2PGQB 1YPHC 5F6MA 5J4SA 2QXJA 3Q3XA 4X8SH 1EAUA 2K0QA 2GJGA 4U2WA 1L1JA 1AB9C 2OLGA 1NROH 3OSYA 2ZWLH 3A7VA 5A8YA 5DPAA 3TJUA 3ZVAA 1P2OA 1O3AA 4Y0ZE 2FI4E 4LXBH 1O0DH 1BJVA 2D8WA 1G9IE 4X6OA 1O2JA 4UFDH 3ZV9A 1THRH 5EGMA 1SGRE 4INKA 3U9AH 1LCYA 3D65E 8ESTE 1C1RA 2V3MA 3PMHB 2ZFQH 2FOHA 1ARBA 2B0FA 1GMHG 4O03A 1ELDE 5JB9S 1A5HA 2GKVE 3OU0A 1OOKB 1A1RA 1JRTA 1RTFB 2F91A 1C2JA 2ZP0H 1O3NA 1O2XA 3PLPA 4XBDA 3S0NA 1Z8IB 1RS0A 2G5NA 5C1XA 5FPSA 3E0NB 3F68H 1THSH 5EJZA 4NA7A 3P70B 1V2RT 5EJLA 5E2PA 1KY9A 2AMDA 1SQRA 3SHAH 2PKSC 2QXGA 1K9OE 1IHTH 4CR9A 3MO9A 2ALPA 4X1NU 4ABAA 4K69A
chains in the Genus database with same CATH topology
2H9EH 3KGPA 5A2MH 3STIA 3O8BA 2H9TH 2P94A 3KQEA 3UUZA 3GY6A 1YPKH 1Q3XA 5EXMA 2HRVA 1MTVA 1UTNA 1IQNA 1BMNH 1XVOA 1HJAB 1K1NA 4E7RG 3S9AA 1TNHA 2BY5X 1O39A 2VH6A 3KQBA 1UTKA 4WJG2 4GLYA 1XUJA 1QIXB 1FLEE 6GCHG 3U98H 5BPEA 2XWBI 1KXEA 1ZOMA 4Y7AA 1SGQE 3U8RH 4AGJA 1NFWA 2ZTYA 1F5KU 1G2LA 2ZF0H 2ZU4A 3DFLA 5C67A 2GTBA 1EQ9A 1ZGVA 3TGJE 2BY7X 1C5SA 1LPZB 2BX4A 2CGAA 2QIQA 3SORA 3QUMP 2VJ1A 1GJ8B 1MKXK 4DW2U 4NSYA 1ABJH 3ZVBA 3FAOA 3GICB 2A2XH 1EX3A 2TIOA 1FY3A 3V12A 4AB8A 1NFYA 1GMDG 2A7HA 3GCOA 7GCHF 2J95A 1K1OA 3FVFB 1MAYA 1ZPBA 1WAYB 4X1QU 3GDUA 1LHCH 2I6QA 3RXQA 3PMAB 1IQKA 4BAQB 1QL7A 5AVDA 1CO7E 4TPIZ 1QJ1B 1CBWC 1RXPA 3V3MA 2Y5GA 1VGCC 3F6UH 8LPRA 1RGQA 2FESH 3ENSB 4Q7ZA 4I31A 5FX6A 4AB9A 1V2PT 1NY22 1ZHMA 1HV7A 4H6SB 1HIAB 4UE7H 2BLOA 5F8ZA 2Z9LA 5L30H 2GZ7A 2A5IA 2QF3A 3JZ1B 1GVZA 1PPBH 1T31A 1OWEA 2PUXB 3EA7A 2W5EA 1K1MA 2PKSB 1DPOA 2FIRH 1XM1A 3UTUH 3OTJE 4B2CA 3C1KA 1A0HB 2Z9GA 1C5MD 2AH4X 1ESTA 1O3BA 2QGRA 3A7WA 3RDZA 3IWMA 1GI6A 4K2YA 1HCGA 3EYDA 1O2YA 1QHRB 2ZFPH 3LIWA 5L2YH 5CHAC 2BQWB 1P2MA 3PO1C 3K2UA 1Q2WA 1YPJH 1FPCH 1O35A 4ZUHA 3ZZ6A 3UNSA 1AQ7A 1SLXB 3RXLA 2SGDE 3QX5H 5C1YA 1C2EA 1QGFA 1BTXA 1HPGA 1QY6A 1VZQH 4ZMAH 2HPQH 3PB1E 4I7YH 1WUNH 8KME2 3PMJA 2Z7FE 1DXPA 1O5AB 3ATWA 1DDJA 1SGEE 2W7UA 1J14A 3S9CA 1O36A 3M5LA 4AFZA 1GG6C 3MU4A 1V2ST 5FCRA 1QB9A 1OP8A 1SFIA 3BTDE 1FZZA 1OSSA 3HPTB 1UVPA 4XSKU 1UK4A 1XKAC 3VXEH 5LH8A 2BDIA 5A8ZA 4ZAEA 4D9QA 4ISLA 9LPRA 1OPHB 2CMYA 1SGCA 1CBWB 5CMXH 1FV9A 1P11E 3A7TA 1DFPA 3A81A 2WV5A 1IQGA 2EEKA 1V2LT 1C1OA 1GJDB 2ZCHP 3NXPA 4MTBA 4YLQH 1QB6A 4IBLH 4U01A 2Z94A 1PQAA 3ZVFA 1K21H 1W12U 1LHDH 3S7HB 4BAOB 5F03A 1LDTT 1SOTA 1QQ4A 1UCYH 2FMJA 1GI9B 3UOUA 2HNTF 3PYHA 4X2YA 3ATIA 2VIDA 4Q2KA 3QZRA 2AMPA 4OS5A 2XC5A 1TBQH 3KCGH 1D3DB 1HLTH 1WBGB 1SHHB 1TNIA 3FP6E 4ZKRU 2QAAA 1EB1H 1EATA 5CHAB 2HLCA 7GCHG 3PO1B 1CQQA 4AX9H 1C2DA 1A61H 2ZGHA 3F9HA 1D3QB 1BBRK 1LKAA 1EKBB 1GDNA 1ZSLA 1Y3UA 4XOJA 2BLVA 1SI5H 2C4FH 1AFEH 1O2KA 1K2I1 1P02A 4K8YA 1ELGA 3RXSA 4OS1A 4CH8B 1K1LA 3NPSA 4XFQA 3RC5A 1XUHA 1VCQA 1GG6B 1SQOA 4K3JA 1BZXE 1P2KA 1OP2A 4Y8ZA 4FXGH 4Y10E 1NC6A 1EAXA 3M37A 3GCTF 2ZGBH 2AMQA 4AORA 1E37B 3A86A 4DVAU 4UD9H 1XUGA 3RXAA 3AW1A 1Z6JH 4ABFA 6CHAB 1O3MA 1BMLA 2HVXA 1ZTJA 3SNAA 1EXFA 8GCHF 2HWLB 2P3UB 3A83A 2ZQ2A 1SPJA 1QQUA 1F5LA 1O5DH 2FOCA 2H5CA 3O8DA 3R3GB 1D3PB 2P95A 1BT7A 2D1JA 2NU1E 1EUFA 1RTLA 1YM0A 1TRMA 1LQDB 1GI2A 3O8RA 1LQEA 1UVSH 3A7ZA 2FTMA 2BDHA 1EJMA 1GWAA 3RXMA 3ATKA 1HRTH 1XUFA 3P8OA 1DWEH 2PTNA 1FY1A 3TH4H 1MD7A 4X6NA 1KXAA 2DUCA 2GT7A 2SGPE 4ESTE 2JKHA 1KYNA 2RDLA 4Q7YA 4WWYA 3UQOA 5EW1H 2OP9A 1C9TA 1YPLH 1Z8RA 3V0XA 1SLVB 5HYOA 3WY8A 1YCPK 3AASA 2BXUH 1FY8E 5EODA 1WU1A 1K1JA 2XW9A 5GIBA 2GDDA 3M7QA 3BV9B 4ZH8A 1AI8H 1MUEB 3M5MA 2VWMA 2Q6FA 4D8NA 3MOCA 2QN5T 1EB2A 4SGAE 1ZRBA 1F92A 3SNBA 1KDQB 2VU8E 1O2MA 5JB8S 1YPHE 1D4PB 3SNCA 5G4BA 1G32B 4NA8A 2PLXA 2THFB 2FXRA 2AIPA 3RXDA 3QLPH 2PSYA 2Y5HA 1HNEE 3MU5A 4BAMB 5C2ZA 1Z8JB 2GCTC 5EQQA 1S6HA 3SO3A 2FYRA 4ABEA 4CRAA 3Q3KA 3UPEA 4NSVA 3CP7A 3SV6A 2OC7A 1AVXA 1TIOA 4M7GA 3F9FA 2GX4A 2BD8A 1OS8A 3Q76A 4E06H 1MKWH 1BTYA 3V13A 3S9BA 2H1UA 1WQVH 2BDYA 1TPSA 2W3IA 3RXPA 1B0EA 1SGTA 3FANA 1ZJKA 1C1UH 1BRBE 2BLQA 1G30B 4GCHG 4K1TA 1DUAA 1LPGB 4ISOA 3L6PA 1G37A 3RMOH 3MH5A 1VITH 1FMGA 2BY9X 3AAVA 3BTME 3TJOA 1A3EH 2ASUB 1X7AC 1FN8A 1L4ZA 1SG8B 4A1XA 4BXWA 5T6FA 1MTNC 4TWWA 2XC4A 1C5UA 3A8CA 1VR1H 3CENA 1BUIA 1QNJA 3GCTG 2BY6X 1GMCF 3LH3A 1BB0B 3ZVEA 4ABGA 4D7FA 1BA8B 4ABBA 1OWJA 1LO6A 3BG4B 4U30A 4MQAA 2RA0A 3SU5A 1C1SA 1GHAF 1AO5A 3PWCA 2FP7B 5JBAS 1BIOA 5EPYA 2SGFE 5GPIB 1FY4A 3RXJA 4X1RU 1LVBA 1HJ8A 4MLFB 1AWFH 2GDEH 1BMMH 1XUIA 5GCHF 4R8TB 1W3CA 1Z8GA 3A85A 1S84A 3LONA 4YZUA 1MTSA 3GOVB 3M5NA 1HJ9A 1AUJA 3A82A 3KNXA 2STBE 4MNVA 1TLDA 1QA7A 4CBNA 4JZDH 1AKSB 1HAVB 4ABHA 1H1BA 4UFFH 3D49H 2GCTB 4WMFA 2G8TA 1DT2A 1DLEA 1O38A 5TJXA 4DT7B 2P93A 3EA8A 1TMBH 3GY4A 4K60A 1SL3A 1UVTH 2P3FH 1OKXA 1ANCA 2ZG0H 4NWLA 5I46H 3MNBA 3I77A 5LGOA 1C5LH 1S0QA 3GCNA 1IQMA 1HYLA 1UVUH 1YPMH 2ANYA 1IAUA 4NGAH 4YTAA 1QBNA 2RG3A 3B8JA 1TA6A 2QC2A 1UO6A 3RU4D 1A0JA 2P8OB 3VXFH 1GDUA 1A2CH 1NFUA 3LPRA 3RU4T 3U8TH 2FS8A 4AYYB 1Z1IA 2C8YB 3NWUA 1NN6A 3P17H 1GJ6A 1HXEH 3PWBA 5EQRA 1MTNB 1O2HA 2XRCA 4ISHH 3MWIU 3MYWA 5JDUB 2FZZA 2V3OH 1O32A 3UIRA 1Y3WA 3ZZBA 1CA8B 3HK3B 3MU0A 5FBEA 1O2TA 5AFZH 2AYWA 1J15A 3DT0H 1ZHPA 2BD5A 1W13U 4KTSA 3ZZ9A 1MH0A 1MKXH 1ESBA 5DP9A 1F5RA 3SV7A 4NG9H 3RLYH 1W7XH 1P2NA 4K5ZA 4IC6A 2BOKA 1P03A 4BTUB 4LZ4B 3DD2H 3RLWH 1HAIH 2FDAA 2BB4A 4GPGA 2O9QA 2F9UA 2F9BH 4H4FA 1IQEA 1TB6H 1XUKA 5TCCA 7LPRA 1HXFH 2FX6A 1FQ3A 3A8AA 2G4UA 2XBVA 1EPTB 5IDKA 1UJ1A 2K1QA 1V2QT 2WPLS 2Z9IA 4WXIA 1WV7H 1GMCG 2SNWA 3OYPA 3TGIE 1C2LA 3M7UA 2EI6A 1EZXC 4AFUA 2HNTE 2B7DH 1MTUA 3SV2H 3K65B 1GHAG 2HGTH 4A5TS 4ABDA 1O31A 1NS3A 5DJ7A 5FCKA 1P3CA 1GVLA 1B5GH 1A3BH 5DGJA 3PLBA 2Z3EA 1AN1E 1ZYOA 1O5FH 1Y3VA 2Z9KA 1ELAA 5GCHG 1P8VC 2BD9A 1BITA 1KXCA 1MMJN 1P06A 1DM4B 4F4OC 1EOJA 3JZ2B 2ZDAH 2EC9H 2KAIA 3KQDA 1LHGH 5H4IB 1OXGA 4YLUA 1L1GA 3A7YA 1P0SH 3GY2A 1JOUB 1RFNA 1MD8A 2HOBA 4FUFA 4AYVB 1MQ6A 1C2HA 3E91A 3TU7H 2VINA 3URDA 3LGVA 3RXVA 2ZTXA 2VVUA 4BTTB 3VGCC 1GBTA 4IN1A 4J1YA 1TX6A 3SI4H 1JIRA 2SGEE 3OX7U 3TK9A 5EXNA 3SU3A 3E16B 2WPKS 3PM3A 1HB0B 3VFEA 2A45B 1P2QA 1Z6EA 1W7GH 4K8BA 1IQJA 1QJ6B 1GBMA 1SGFA 1C2IA 1P01A 1ORFA 3P8NA 3MNXA 5AFYH 4JCNA 1LPKB 1GCTC 3TJNA 2EI7A 3MU8A 1PFXC 2RA3A 3A87A 5T6GA 3RXGA 1O2SA 2OC1A 1YBWA 2HPPH 1TBZH 2M5TA 1XKBC 1C9PA 2ZHWH 2D26C 2WV4A 1AB9B 2PTCE 2DE9A 3UY9A 4ZHLU 1O37A 2A5KA 5ESTE 1TBRH 1TQ0B 1T8MA 5L2ZH 2WPJS 4CRCA 1ETTH 1GBFA 2IPHA 3BTGE 2F9OA 2WPIS 3FP7E 2GVFA 3GY3A 2O8UA 1C4V2 4DJZB 3H7TA 2BQ6B 4Z0KA 1J17T 2J94A 3RXIA 5DO4H 1OWDA 4X8UH 5CE1A 3ATMA 3LOXA 1O3GA 2GV6A 1BBRH 2QCYA 3SJOA 2WYJA 3K6YA 3NZIA 2G81E 4JK5A 4RKJB 2A5AA 1BJUA 1NO9H 5E8EH 1RRKA 3UWJH 3EQ0H 1FIWA 1NT1A 4ZKNU 3SU2A 2CHAC 1QBOA 1SGNE 4NIVA 3LGTA 2BD7A 4FUIA 1UTQA 3F9GA 3MH7A 2OXSA 3VGCB 1GI4A 1PQ5A 2O8LA 5GXPA 1C5RA 1Y8TA 2A1DB 1SR5C 4LOYH 5B6OA 1W10U 4ISNA 4BOHA 2VGCC 2CXVA 5GDSH 2SGQE 3RU4E 2R0LA 1O5GH 1L4DA 2JH6D 4CHAC 3VB4A 2TGTA 4GHQA 3VEQB 4LZ1H 3Q3YA 3SV8A 3BTEE 4NZQA 3MI4A 5AF9H 2G55A 1W14U 1P12E 2UWPA 1UK2A 1GCTB 1TPOA 2FODA 2STAE 3V7TA 1EJNA 2PWXA 1BTHH 2PGBB 2VNTA 2WPHS 1EAIA 1TNJA 2VH0A 1Y5UT 1GBEA 2Z3CA 3TITA 4TYDA 3LGWA 1GVKB 1BMAA 2QXHA 3MO3A 2PW8H 2Z3DA 4CR5A 3QWCH 2Y82A 3U1IB 5J4QA 4ABJA 4FUCA 3RXBA 1C2KA 1UHBA 1TONA 4CH2B 4O97A 3GY5A 1SB1H 1VJAU 2FOMB 3HKIB 2B9LA 4WY3A 1GBHA 1Q31A 1C1WH 1DUEA 3BTFE 2HNTC 1A4WH 4B76A 4YT7H 1GBIA 4WXVA 4I8KA 5DP8A 1VGCB 2GT8A 3ZZ8A 3SU1A 1NRQH 2XWAA 2FI3E 1K22H 1KTSB 5A0AE 4A92A 1C5ZB 5EG4A 1WTGH 4DY7B 1FXYA 1QCPA 1DANH 1ZRKA 1ZTLA 3ZYDA 1TGNA 1LHFH 3MNSA 3RC4A 2CHAB 5FXLA 1H9IE 2OTVA 1P9SA 1AE8H 3RXRA 1AD8H 1O33A 3W95A 2VIWA 3SGQE 5EXLA 1T8LA 4X1PU 3RUOA 1GJ4H 1PQ8A 1WYKA 2FX4A 3Q00A 1O3DA 2BLWA 4DOQA 2UUJB 1Y5BT 1ZSKA 2PV9B 1P10A 1BHXB 1L0ZA 2OCVB 4YOIA 4A1TA 1HGTH 1KDQA 6LPRA 4Y76A 3SUDA 2VGCB 3HKJB 1PPEE 1CGIE 2NWNA 3NUMA 3RMMH 1GPZA 4CHAB 1SC8U 2TBSA 1S0RA 1P2IA 3LH1A 1UTJA 2BZAA 3B9FH 1BRCE 1E38B 3AW0A 2ZPSA 4Y7BA 4OGYA 2R3YA 5DK1A 1C1PA 1QRXA 4ABIA 4ASHA 5LPEA 2J9NA 3AAUA 2CF9H 5TCAA 3KN2A 4TY7A 1EZQA 1BRAA 1YF4A 3SU4A 2BOHB 1BTUA 1SGPE 3A8BA 2VWOA 4F49A 1ELVA 3RXKA 4THNH 1AGJA 1IHSH 2F9VA 3MH6A 1HFDA 1Y5AT 1VJ9U 2FOEA 1GI3A 1YCPM 1A5GH 1O2NA 5ESBA 3E90B 3KEEA 4Y6DA 1TGSZ 3P8FA 5LPRA 5HGGA 4FU7A 3TH3H 1G3BA 1MBQA 2JETC 1GL0E 1TRYA 1GCDA 1SQAA 3M35A 1ESAA 4KP0A 4XBBA 3SHCH 1RTKA 1H8DH 3M61U 4WVPE 3RXUA 1TA2A 1KXBA 2ZNKH 3TPIZ 4UFGH 1ID5H 1TGCA 1SVPA 1BTZA 2ZI2H 1AUTC 4I8LA 1P04A 1ZMLA 2PKAB 1M9UA 2H6MA 1OYQA 1DS2E 2EA3A 1LVMA 1S6FA 3T25A 1NRNH 2VIQA 1F0SA 5K7RA 1GDQA 2BX3A 1ZSJA 1SGDE 4AG2A 1NRSH 1YLDA 4K1EA 4KTUA 1Z1JA 5AHGH 5ETXA 1O2OA 1O3CA 1C1VH 3LGYA 4HI3A 5HXFA 3UQVA 1TWXB 2JH0D 1ZMNA 3H7OA 1AKSA 4KKDA 1HAVA 1MZAA 2FS9A 1AY6H 2ZPQA