3A81A

Crystal structure of trypsin complexed with (e)-4-((2-nicotinoylhydrazono)methyl)benzimidamide (soaking 8 hours)
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title In-Crystal Chemical Ligation for Drug Discovery
rcsb
molecule tags Hydrolase
molecule keywords Cationic trypsin
total genus 58
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2009-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3a81A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3a81A02
5DO4H 1O2OA 3KL6A 4Y10E 1DT2A 2BXUH 2CV3A 4U30A 3BTHE 1UK2A 1HUTH 1W7XH 3OY5U 2GVFA 5FAHA 3AAVA 3QZRA 2ILNA 1ORFA 1H1BA 1ZHPA 4OS7A 1TGBA 1ETRH 3F9GA 3TVJB 1OWDA 1HAVB 3QTVH 1FDPA 3EAJA 2H1UA 1ZPBA 1G3CA 3RXHA 3BEIB 1MTVA 1UTJA 4IMZA 1MAXA 1A3BH 1BB0B 1LVMA 1FY8E 2Z9JA 1FY3A 1Z8JB 1IAUA 3V12A 4Y11E 2WPHS 2VIDA 4OS2A 1OWHA 1A4WH 4FUJA 2WPIS 3ZZ8A 1YLCA 1HJ9A 6ESTA 3UR6A 3E6PH 2FDAA 1P01A 4MNYA 4B73A 1EX3A 1QB6A 1RTLA 1CO7E 1TGSZ 1AO5A 1KXCA 1V2NT 1NRRH 1QY6A 4Q2KA 2ZTZA 1IQLA 2PKAB 1O3KA 3B8JA 2HNTE 1ANDA 2AEIH 1P8VC 1GDNA 3ZYEA 2PKAA 2ZU2A 1OWIA 1MTNC 4E7NA 2AGEX 2VU8E 4WMFA 5DPAA 1EAXA 3LDXH 1AWHB 3E1XB 1EUFA 2FTLE 4I31A 4WF8A 2BHGA 1MCVA 3BTEE 5AFZH 5DG6A 4DIHH 4JZDH 1ELCA 1V2UT 1BTWA 1GMDG 2J2UA 1YBWA 1F0UA 4BAOB 4I33A 3TPIZ 5F8ZA 4AFZA 2Z7FE 1GMHG 4YT6H 1ZOMA 1QBVH 2SGAA 5C3NA 1ELEE 3RU4D 4FUBA 1L1GA 1K1IA 1RIWB 1FIZA 2JETC 5C2ZA 2P16A 1BTXA 2ZFTA 4XBCA 7GCHG 1C2JA 2QN5T 3UREA 1GJBB 2ZG0H 5DK1A 1SSXA 1ZTJA 1G3DA 5FCRA 1CGIE 2BYAX 1C1OA 1RTKA 2BVRH 1ANEA 3MU1A 4ABAA 3JZ1B 5CMXH 2BLWA 2XCFA 1HAHH 3B23B 2ZFSA 2C8XB 2QXIA 3AAUA 1P9UA 2GZ9A 1J16A 3PYHA 1HCGA 4FUEA 4K5ZA 1DDJA 1V2VT 4VGCB 4DURA 4Y71A 1OKXA 3MNXA 3VB7A 3U69H 5ESBA 4Y76A 1SFQB 1C5MD 1NROH 4UFFH 3ZVGA 2OC7A 4CR9A 1O3DA 4FUFA 1P04A 1HLTH 5IDKA 4WWYA 2YOLA 4CRGA 3EE0B 5JB9S 4Q80A 1FXYA 2FMJA 1SFIA 2CGAA 5HXFA 3VB3A 3TH2H 4CRBA 1WV7H 2GX4A 4B75A 2PKSB 1GVZA 1TYNA 1P09A 2ZQ1A 1LHFH 2ZQ2A 1MCTA 3KN2A 3PWBA 3HGPA 3PMJA 1IQFA 1N6YA 3GY4A 2ODPA 1TGNA 1AFQB 2FYRA 1O3OA 3RXAA 1F5KU 2Z3DA 3GY6A 1BUIA 3NXPA 1MZDA 5FXLA 2BD9A 1Y3UA 3GICB 4X2XA 5HGGA 1HXEH 2Y7XA 3O8BA 3RXKA 3PTNA 2UUJB 2A4GA 1BA8B 4K69A 4I8GA 2GKVE 1HJAB 1BHXF 1C2LA 4OS6A 4AZ2B 1C5XB 2H2ZA 4RKOB 3RXLA 2ZGXH 2B9LA 3GCNA 4E05H 4CH8B 1HAPH 2I6QA 3SU1A 4Y8YA 4MG3A 1SLVB 3M3TA 2IPHA 2ODQA 4Y0ZE 2FS8A 3QO6A 4ZKNU 1SLUB 1GHBG 1V2RT 1BMMH 2H5CA 2BB4A 2AMPA 1NS3A 2VWLA 1UVUH 1V6DA 1MTWA 1IHTH 3SNDA 1TPPA 2CHAC 2ZFQH 2VGCB 5GDSH 1GBEA 1EP5A 3GCTG 2WYGA 3HKJB 1C5PA 1XUJA 3V7TA 3A83A 1K2I1 1NZQH 1TQ0B 1QHRB 1LVYA 2QXGA 1C4V2 5DKMA 5ABWA 3SNBA 4TY7A 1DXWA 1TNIA 3OU0A 1GMCF 1Q2WA 3M5MA 3QDZB 3D23A 1CGHA 2V35A 2ZWLH 5DP4A 1N1LA 5K7RA 1EJAA 2VINA 3A89A 3DT0H 5FBEA 5L2ZH 1C5SA 2OBOA 1OSSA 1TX6A 2GCHG 2XBYA 4ZHLU 1L0ZA 2J38A 3M7UA 4SGBE 4MLFB 4BNRA 3K6YA 1KLJH 1GBCA 3ZVDA 3U8RH 2D2DA 2W26A 1O39A 3KIDU 1GJ7B 2XRCA 3BIUH 1C2KA 2GT8A 1Z71A 1P2OA 4ZKOU 3MI4A 2VWMA 1CA8B 4NIYA 1NM6A 1P2MA 8GCHG 1EASA 3S7HB 4ISHH 4MPVA 1K21H 2R3UA 4X1SU 1CBWC 1GCTB 1T4UH 1B0EA 3KHVA 3SI3H 1XMNB 4IMQA 4X8TH 3ZVFA 1L1NA 3UWJH 1DSUA 3GOVB 3ATIA 3KQCA 4JK6A 2V6NA 1GJ6A 2WPJS 4DJZB 1JIMA 1MZAA 5C67A 1O2RA 1LPGB 4WVPE 1G32B 1NRSH 2W5EA 2G5VA 1KTTB 4X1RU 1J15A 1SGTA 2G00A 4K3JA 3L6PA 2J92A 1TE0A 4RKJB 2Z9IA 2H9HA 3RMMH 1OX1A 1SMFE 1E36B 1DWEH 4K1SA 2D26C 2FO9A 2NU4E 4ZHAA 1RFNA 4AYYB 3SHAH 4RN6A 1V2OT 3LGIA 1S6FA 3PO1C 1HDTH 3RXBA 3RU4T 1C5OH 1V2WT 1XUFA 1AB9B 5L2YH 1O0DH 2CF9H 4CRDA 2UWLA 3O8RA 3GYLB 1A46H 1GHZA 1LTOA 4O3UA 1UMAH 1O2ZA 3KF2A 2GCTB 2C8WB 3LT3A 3SU0A 3M7TA 3GISB 2Y80A 3BG8A 1SGCA 5JB8S 2FOEA 3GY8A 1O5GH 1S83A 1F92A 1THRH 3Q77A 1GJ9B 5EG4A 1AZZA 2VIPA 1A5IA 4X2VA 1DWDH 3A81A 5LPEA 1Y5UT 1AE5A 5GCHG 1Q31A 1PQ7A 4MNWA 1ANCA 3TLOA 2NU1E 4HFPB 2ZKSA 2GV6A 3E16B 1EZQA 1O2WA 3PMHB 4MPUA 1TMTH 1KDQB 5DP7A 1WYKA 1XX9A 3T28A 4Y8ZA 3FFGA 2XYAA 1T32A 2A31A 4TPYA 2O9QA 1LQEA 2OINA 3STJA 4MTBA 1PYTD 4WMEA 2Z6BD 4X6PA 4HGCA 1GGDC 2SGQE 3NK8A 1DICA 1XUIA 2FX6A 1FN6A 1SGDE 2PV9B 3F1SB 1F0SA 1O5DH 1LHGH 1BRUP 1F5LA 3LJOA 4ABEA 1A1RA 1IQEA 3PLKA 4NZQA 3ESTA 3S9AA 1LCYA 1TBZH 3RUOA 2ZO3H 1GBHA 1N8OB 5E8EH 1YPKH 4LZ4B 1IQNA 3LC5A 1V2PT 4Q7YA 2ZFPH 2BDHA 4WMDA 4X1QU 5EQSA 1O3JA 1O5BB 1C5LH 3ZVAA 3FANA 3SJ9A 3OSYA 2HNTF 2A5IA 3A7TA 1KXBA 3VB6A 1O2HA 4YM9A 3VPKA 1DWBH 3LPRA 3GY7A 2BTCE 1JBUH 3ATKA 1GMDF 1ZMLA 4J1YA 2ANMH 3LH1A 2W3IA 1XKAC 1TLDA 1GCTC 1Z7KA 2GMTB 3S9CA 3RXPA 1O2XA 1EPTC 1VCQA 1BBRE 2PSYA 4NIXA 1OXGA 2IN2A 3NPSA 1W11U 5A8XA 1BJVA 3T2NA 3UFAA 1T8MA 2C3SA 1MKWK 1O5FH 5I25A 1KYNA 2M5TA 3M61U 4OGXA 4UE7H 2ZHEH 1B0FA 1QL9A 2ANKH 3SW2B 5EODA 1T8LA 3RC5A 1GI8B 3SNEA 1HB0B 5SGAE 1O5AB 1TNJA 3RXSA 1O2LA 1Z8GA 4INHA 4UDWH 1ABIH 1VITG 1NT1A 5J4SA 3O8CA 4WXIA 3EYDA 2WV5A 5AFYH 1XUGA 3SV9A 4A5TS 3GCTF 1E38B 1QB1A 2J34A 4Z0KA 2V3HH 1FAKH 1O2MA 1GHBF 2QIQA 1JRSA 2RA3A 1O32A 3H7TA 1LHCH 1ACBE 1D3TB 1ZHMA 5E0HA 3P95A 1TNKA 2ZPRA 5JBCS 3LGTA 2F9PA 4Y0YE 3A7YA 1HRTH 1SG8B 2AERH 2QXHA 4FVBA 2UUYA 4YO9A 4WY3A 1EZUC 4YOIA 1MQ5A 3RXVA 2PWXA 1EB1H 5EQQA 4DCDA 4ISIH 1HAVA 4IGDA 1IQKA 2STBE 3M3VA 2BY8X 1DITH 1ZJKA 2O8MA 1JIRA 5F03A 1GVKB 1K1PA 1DOJA 1FN8A 1TB6H 1T8OA 3SUEA 2IJOB 4LK4A 1TQ7B 3MOCA 2O8UA 1AIXH 5GJ4B 2PLXA 4FUHA 4LOYH 2PW8H 2PSXA 5AVDA 4JYTA 1PPBH 1WTGH 1FLEE 3T62A 3HK6B 2FX4A 1L2EA 1XUHA 2EI7A 2F83A 1C1UH 2FEQH 1QA0A 1QGFA 3S0NA 4JZEH 1MUEB 1WTHD 1CU1A 2VIWA 4F4OC 4B74A 1LDTT 2BOHB 1Z1JA 4OS1A 1S6HA 3SHCH 3MHWU 3QWCH 3SNCA 1BRAA 6CHAC 1F2SE 4NA9H 1SGYE 3FZDA 2BZAA 1EZSC 2B5TB 2P94A 1ZMJA 3A86A 1LPKB 1SGFG 2ZPSA 3SGAE 1YF4A 2A45B 1WSSH 3A8AA 2A5KA 4A1VA 2A4QA 5GXPA 3T27A 4FVDA 2XNIA 1AU8A 3UIRA 1FMGA 1S0QA 1AVXA 1F0RA 2TBSA 3ZZAA 3P92A 4KP0A 1HYLA 4Y8XA 2ZECA 5FPTA 4DY7B 1HPGA 1ZPCA 3M5OA 3RMOH 1NU9A 4ZKSU 3HATH 2TGAA 3P8FA 1MTUA 3PMAB 2ZHFH 4BTIB 5C5OA 1AHTH 3SQHE 1THSH 1GI2A 1ZSKA 3SU6A 2ZU5A 3D62A 3URCA 3E3TA 1M9UA 5DP3A 2BD4A 1WOFA 1OYTH 1FJSA 2GZ8A 2ZDAH 1QNJA 2XBWA 4E06H 1SGIB 1GI4A 2PKSC 3LC3A 1DLKB 3RMNH 2FESH 8GCHF 2P8OC 3Q3KA 2A7JA 4K8BA 1LQDB 1UCYK 2F9OA 5JBAS 1GBAA 2P3UB 2ZDNA 2VVCA 1K1LA 1XVMA 1KXDA 1TBQH 2OC8A 1P9SA 1ZRBA 5L6NH 2KAIB 1UCYH 4HI3A 3M36A 3GDSA 3ZVCA 1A3EH 4TWWA 1BBRH 1A61H 2ANYA 3P8NA 1HAIH 4YT7H 1FIWA 4YOJA 7LPRA 1C5QA 3OTJE 1BRBE 3AW1A 4FUCA 1OOKB 4INLA 3A88A 3QUMP 1SQOA 2FOGA 4ZAEA 4WXVA 1EATA 2BD2A 4GPGA 5GIBA 5JPMH 2ANWA 1OWJA 4U32A 2BM2A 3DFLA 5HMAA 1ELDE 2D8WA 2Y81A 3HK3B 5T6FA 3ZZ6A 3TGKE 1D6WA 4I8LA 2VVUA 3C27B 5FX6A 3TH3H 4CBNA 3VXFH 1P3EA 1A5GH 4AB9A 3D49H 1E0FD 1AKSA 1P2IA 2VGCC 4ZKRU 1S84A 2Z9KA 4YZUA 1MMJN 3SJOA 3MMGA 5EXMA 4D8NA 2YNBA 3A82A 3HPTB 3SORA 2BDAA 3LGYA 4O97A 3BG4B 4Y79A 8KME2 1C5RA 4OGYA 4NSVA 2DE9A 3G01A 4O03A 2XW9A 3SQEE 1DS2E 4IN2A 2SNWA 2ZCKP 1BIOA 1QBOA 1W2KH 1MAYA 1NY22 1S81A 1VCWA 1NU7B 1C1PA 4NFFA 1BMNH 1PPGE 1C2GA 2XBVA 2CJIA 3AASA 2BVSH 3A8CA 4ZROA 3F9FA 1T4VH 3IITA 1CHOG 2JH6D 1MTNB 2GV7A 5F8TA 3LGVA 5GPIB 1BRCE 1MTSA 3SNAA 1PYTC 1J9CH 2VNTA 1P0SH 4XDEA 1ELVA 3SV7A 2LNCA 3OX7U 2VIVA 4I8KA 3UNSA 2BDBA 5HM2A 2BQ6B 2R0KA 1S0RA 4CR5A 1H9IE 3OYPA 1MBMA 4R8TB 1C1MA 2Z3EA 4A1TA 2XBXA 3RXFA 1BMAA 2Q6DA 1RXPA 2BLQA 1YC0A 5FBIA 1Y3WA 2G4UA 4YOGA 1SQAA 3PLPA 2ZDKA 1ZZZA 4JCNA 1TAWA 3RM2H 3ODFA 2ZU4A 4H6TA 1GI3A 1K1JA 5JBBS 5C5NA 1RIWC 4NGAH 4ISOA 1QRWA 2CHAB 3KNXA 5AF9H 4MDSA 4AN7A 1P11E 3FZZA 2FI5E 3E90B 4KELA 1XKBC 1ZGIA 1O2PA 1QB9A 4A92A 3RU4E 4ZXXH 1VITF 5FX5A 1DX5M 2Z94A 2WINI 4F49A 1INCA 4NWLA 1GHAF 2W7UA 2GP9B 1TGTA 2EI8A 2PHBA 3MU5A 1GJ8B 2FOAA 4ZMAH 3I29A 2WPMS 4UFGH 4D7GA 2ZDLA 1EAWA 5T6DA 4AGJA 4GHQA 1KIGH 4ABGA 2ZC9H 2ZP0H 1QR3E 1SR5C 1TALA 1CT2E 1QRZA 1EOLA 9LPRA 1D6RA 1VZQH 2GD4B 2BZ6H 4K60A 2VIQA 1NTPA 1J14A 1PPEE 4CRFA 1C1TA 3TK9A 1SHYA 1K28D 2FM2A 1UTNA 5CHAB 5EOKA 1PQ5A 3MFJA 1O37A 1OP8A 1PFXC 3E8LA 3LH3A 4ZHMU 2J94A 1YCPK 4AORA 4BAKB 1SGFA 3UNRA 3SUFA 2SGEE 1O34A 1H4WA 1UCYE 2J4IA 1HXFH 2QF0A 2QC2A 1EZXC 4NZLA 1TMUH 1LVOA 2FOFA 1S5SA 2PR3A 2ZHWH 1SLWB 2ZZUH 1SGQE 2AGIX 1QA7A 2BDYA 1V2TT 3EDXB 2BY7X 2ZGCA 1GHYH 2F9UA 2NU0E 3O8DA 4FXGH 4NWKA 1O2VA 2CN0H 1C2HA 1YCPM 4TWYA 3SU5A 1YYY1 2PFEA 2ZPQA 4MVNA 4FUDA 1C9TA 1TGCA 1AB9C 2FOCA 4CH2B 3VB4A 1JRTA 3TJUA 4X2WA 4ZUHA 4AOQA 1AUTC 3GCHB 3ZVEA 3I78A 1LKAA 3TIUA 3QK1A 2ZHQH 4D9QA 1YLDA 3KEEA 4JZFH 2GCTC 1O33A 4K1EA 1GL0E 1MU6B 1GBIA 1XXFA 4Q7XA 2EA3A 1EB2A 3BIVH 1X7AC 3A7VA 3SV6A 1AE8H 1KTSB 1T7CA 1PPCE 3EQ0H 1AKSB 5A0BA 2AFQB 5F6MA 1C2FA 4NA8A 4K2YA 1GBTA 3CS0A 1BTYA 3LONA 4ZH8A 2BX3A 4X0WU 3A7ZA 3LIWA 1E35B 3R3GB 2C8ZB 1GBDA 1HV7A 1GI5A 4ABFA 1GWAA 3F6UH 2O8LA 2ALVA 1TOMH 3JZ2B 4BXWA 8ESTE 2OLGA 1GI7B 1C2MA 4GLYA 3DD2H 2BXTH 2QCYA 2THFB 1FPHH 1Y8TA 3DUXH 4MPXA 1UHBA 5EQRA 4TPIZ 1ESTA 1GHAG 1O31A 3ITIA 3F9EA 4NIVA 2G55A 1NN6A 4NA7A 2VVVA 1UTLM 4SGAE 2OD3B 1O2IA 2FIRH 1O2SA 4AFQA 2GMTC 1TNLA 1G37A 1QJ7B 4IN1A 4BTUB 3BTWE 3SU3A 1PPZA 2KAIA 2XTTB 4DW2U 3SV2H 1G3BA 2ESTE 4B71A 3PV4A 1IHSH 2Y5FA 1RGQA 3RDZA 1ESBA 5EXNA 3FP7E 1GBBA 2HGTH 1O38A 2ZU3A 3MO6A 1V2JT 5FPSA 2AIQA 1DY9A 2XWBI 4JZ1A 1EPTA 1AFEH 1QJ1B 3NWUA 2QY0B 1DXPA 4ESTE 1GJ4H 4Y7AA 3UR9A 1CSOE 3KGPA 1O3NA 1UJ1A 1ELGA 3MWIU 2JH0D 2OP9A 1V3XA 4TYDA 1FY1A 2CMYA 2FOBA 4BAMB 4D76A 2Z9LA 3SJIA 2ZA5A 1V2QT 4K1TA 2IOTA 4OS5A 1K1MA 1ZJDA 3MYWA 3IG6B 1LHDH 2BMGB 3M37A 3RXGA 1C9PA 2P93A 3MNSA 2UWPA 4NSYA 5I46H 2WUCA 1W8BH 1C2EA 2ALPA 1GBKA 4X6OA 3TK5A 3NZIA 4DG4A 2RCEA 2W7SA 1UTKA 2AIPA 3SJ8A 3PO1B 1AQ7A 3TK6A 1GMCG 4OS4A 1EAUA 1EPTB 1VITH 1CHGA 5J4QA 1SGEE 1G30B 1T8NA 4GAWA 1PPFE 1TWXB 4A6LA 1Y5AT 3M35A 2BDGA 1O2YA 2FTMA 4GVUA 4O9VA 3TNSA 3SJKA 2Z3CA 4XSKU 1KDQA 4AB8A 2PGQB 4KTSA 1BZXE 1NPMA 2A1DB 4FUIA 2C8YB 2ZFRH 1AZ8A 2FZZA 3U1IB 5LH8A 4Y7BA 3NUMA 1O2NA 4KKDA 4AFSA 1GBMA 2A0QB 3ZV8A 5A09A 2Y5GA 3MH4A 3Q3XA 5DGJA 3ATMA 3SUDA 1TOCB 2O8TA 4JK5A 3MU0A 2BD7A 1GBJA 1JXPA 4YLQH 1ANBA 5PTPA 1O2GH 1UVOA 3UNQA 1UHBB 3ZYDA 6GCHF 2A4OA 2OBQA 3T5FH 1Y5BT 1WUNH 4ISLA 3TJVA 1SL3A 4YLUA 1EKBB 4KTCA 1D3PB 5EW2H 2HWLB 5A0AE 4BANB 3CS7A 1NESE 1P06A 3LGUA 2VWNA 1TPAE 3MH5A 4H4FA 1WCZA 1IQHA 1VJAU 2OC1A 4XFQA 2EI6A 3C1KA 4LXBH 5G4BA 1ZSLA 4IC6A 3DHKH 1GG6C 4U2WA 2WYJA 4ZXYH 1NFUA 5EW1H 3F68H 5FPYA 1ETTH 2SGPE 1O3AA 1Y3YA 4UFEH 5C1XA 5A8ZA 1SOZA 3Q3YA 4X2YA 2ZHDA 1SQTA 3L33A 1LO6A 1DFPA 5GWZA 4MNVA 3CP7A 2J95A 2JKHA 4A1XA 1CVWH 5LPRA 1HNEE 4JZIA 4LZ1H 1C5UA 3BN9A 5B6OA 1BTUA 1FV9A 1SC8U 6CHAB 3A85A 3A7WA 2O8WA 2CF8H 2ZCHP 3RXQA 2SGFE 1QRXA 4ABDA 2BX4A 1GHVH 5E2OA 3ZZCA 2A7HA 1C5WB 1LHEH 2GT7A 3F9HA 3A8DA 1IOEA 2P3TB 1DY8A 4H6SB 2BD3A 1O3HA 1J17T 1RS0A 5A0CA 1N6XA 4KTUA 1NRPH 4IS5A 1ID5H 3UQOA 2AMDA 3PLBA 3W95A 2ZIQH 4CRAA 5DP9A 2Q1JA 1VGCB 1H8IH 1FUJA 3ZZ7A 3RM0H 4ABJA 1PQ8A 4X6NA 1D3QB 1AN1E 2NU2E 1XVOA 5T6GA 1P12E 4J2YB 1W13U 1MKWH 2G81E 1EXFA 1C1SA 1Z6EA 5CE1A 2A5AA 2BDIA 1Y3XA 2FLRH 1RD3B 2FS9A 3EGKH 4QT8C 3DFJA 3RLWH 5BPEA 1CQQA 2ZTXA 4KGAA 3OY6U 2BY6X 2ZTYA 1W0ZU 1YPEH 3VGCC 1H8DH 1XXDA 5C1UA 4FU7A 1QTFA 2GGVB 3RXRA 1ZYOA 2XXLA 4WH8A 3MU4A 3E91A 2FP7B 2V3OH 1AVGH 2OXSA 3ZZ3A 4AGKA 2OQ5A 1OP0A 1ELBA 1BTHH 1EP6A 3GDUA 2BDCA 1E37B 4YESB 1HAYB 3GYMA 1YPGH 3ZZ9A 1P05A 5DP6A 1SGNE 3EA9A 2G52A 3L3TA 1TRYA 1BBRK 1P02A 1TRNA 4NCYA 1GJAB 1TPOA 2EEKA 1VGCC 2B0FA 3W94A 1UVTH 2ZDVH 2AMQA 3S9BA 2HRVA 2TRMA 3QZQA 3UUZA 1BJUA 1SPJA 5HM9A 3ATWA 1A0LA 2HLCA 1GDQA 6GCHG 3E0NB 2H9EH 3GCOA 1GJCB 1ZGVA 2D1JA 3U1JB 1P10A 3MU8A 1HJAC 4BAQB 2P59A 1H9HE 3RC6A 1WQSA 1IQMA 3M7QA 3SUGA 2WPKS 4GCHF 1SI5H 2BVXH 2G8TA 2AH4X 2BOKA 1DPOA 5FCKA 3P8OA 1TA6A 1YPMH 3UPEA 2B8OH 1QCPA 1EOJA 2QGRA 1P03A 1U6QA 1Y59T 1GBLA 1C2DA 3NKKA 2HPQH 4ABBA 4DVAU 1GPZA 4ABHA 3VXEH 1Z8RA 5A2MH 5BRRE 4XBBA 4IW4E 1P2KA 1KXEA 1BITA 5HYOA 3SI4H 1GMHF 3SBKA 3LOXA 4MNXA 4NG9H 1LVBA 1GHWH 2PTCE 3B9FH 2B7DH 4I7YH 5LGOA 2HOBA 1D4PB 1Z6JH 1C2IA 3UWIA 3R0FA 1YCPH 3MNCA 5TCCA 3BG4C 3FP8E 1CHOF 3I77A 2WPLS 4INKA 1BHXB 1ABJH 1NFYA 4X8VH 2OC0A 3V3MA 1C1VH 1FNIA 1ZTLA 2P95A 3A87A 4UFDH 3ZV9A 2HALA 3URDA 1AMHA 2BD8A 3MH7A 1DSTA 2JETB 1YM0A 1KSNA 1EJMA 2PTNA 2SGDE 1ZR0A 1O30A 3BV9B 4NFEA 5C1YA 1TFXA 1SBWA 2V0BA 2Y82A 3TH4H 3BTTE 3MO3A 3ZVBA 2Z9GA 2TGPZ 2R2MB 4GCHG 4XBDA 3ZZ5A 1W12U 5H4IB 2A32A 2WUBA 1AVWA 2C4FH 4HTCH 4X6MA 3TITA 1CBWB 3RMLH 1ZLRA 1EQ9A 1VCPA 3EA7A 2UUKB 3K6ZA 3P17H 1Y3VA 4YTAA 4I32A 1O3PB 2QF3A 1BDAA 1KLIH 3MH6A 1O3BA 1RRKA 2YNAA 2PUQH 1C5TA 1UTMA 2OCVB 1TMBH 3P6ZB 1C1NA 7GCHF 1MD7A 2CXVA 1QL7A 1ZSJA 1WU1A 1TONA 3SZNA 1TX8A 3BTKE 1FY4A 2A7CA 3QX5H 1FAXA 1P3CA 2FODA 1MU8B 1NRNH 1MQ6A 2ZF0H 3S7KB 1HAZB 1V2ST 3VB5A 2NWNA 2W3KA 2UUFB 5GCHF 1VJ9U 1SLXB 1QIXB 1TABE 2BD5A 3UOPA 1O2TA 4JMYA 2H9TH 3RXEA 5E0JA 2TGTA 1G36A 2DUCA 1NRQH 2FOHA 1OWEA 4B2AA 1MKXH 2Q6FA 1W14U 1T31A 3QGJA 2ZCLP 1ESAA 4JYVH 2R0LA 3D65E 1Z1IA 3BEFB 1XM1A 2PGBB 5T3HA 1MKXK 4XOJA 2EC9H 5L30H 1FPCH 4DGJA 2OTVA 3P70B 4AG2A 3TGIE 1ZMNA 3K9XB 1O3FA 1Z8IB 5A8YA 1GVLA 1F0TA 1ZHRA 2ODYB 2GDEH 1JOUB 3NCLA 3UOUA 1AWFH 2K1QA 5EU8A 4X8SH 4WJG2 1DANH 4IC5A 3ENSB 1DVAH 1YPLH 2VH6A 1IQJA 1GJDB 1A0HB 1QQUA 1O2JA 1C4U2 4D9RA 1FONA 1DWCH 1AFQC 3PWCA 2F9BH 2F9NA 2PUXB 1KLTA 5K0HA 1YPHE 3AVZA 3RXTA 2ASUB 1YP9A 2Q6GA 2BQ7B 1HFDA 1G3EA 2G5NA 7KMEH 3U8OH 1GJ5H 1UO6A 1V2MT 1HGTH 1SVPA 4R0IA 4DOQA 2VWOA 4RSPA 2G51A 1W7GH 2XWAA 1O3IA 1TRMA 2DE8A 2P3FH 3A7XA 1IQGA 1TNHA 1ETSH 4H42U 3PMBB 1BTPA 2RG3A 3RXUA 3SGQE 2GTBA 1QURH 1NFXA 2FI4E 1UVPA 3BF6H 2ZU1A 2C93B 1AD8H 1GI0A 1UTOA 2FI3E 5DP8A 1GDUA 3N7OA 5DJ7A 3SU4A 3T26A 1UVSH 1DE7H 2XC4A 1BQYA 1S85A 1THPB 2VH0A 2FOMB 4CHAB 4B76A 1MD8A 2BLVA 3UQVA 5LPFA 2FXRA 1O2KA 2VIOA 4FU9A 4JYUH 3M3SA 5JYIA 1P57B 3CENA 3KQDA 1WBGB 3ELAH 3Q00A 2XC5A 3U9AH 2A2QH 4AFUA 1SGPE 4CBOA 2R2WU 4PROA 4FU8A 2AYWA 1TNGA 2UWOA 4UEHH 1C5YB 2WV4A 1SHHB 1G2MA 2HVXA 3BTME 4UONA 4CHAC 3TNTA 2H5DA 4CREA 3HKIB 2GCHF 1GCDA 2XCNA 1B5GH 2RDLA 3RXMA 1GGDB 1BT7A 3VFEA 1FZZA 1HBTH 1RJXB 3GY5A 2ZNKH 3RXCA 2BLOA 1O3MA 4ASHA 1L4DA 5C20A 2STAE 3IWMA 3RXIA 1QQ4A 3SN8A 4UD9H 4ISNA 3FP6E 2QAAA 5ETXA 4BTTB 3TJOA 1HAXB 1CE5A 1DUAA 1O5CB 1V2LT 1FI8A 4B1TA 1J8AA 1O36A 1L4ZA 2AS9A 2LPRA 4M7GA 2TGDA 1IQIA 1GI9B 3RC4A 1DLEA 1SB1H 2J9NA 1BOQA 2FPZA 3BTGE 2ZGHA 3QTOH 2Y7ZA 4BOHA 3TU7H 2HNTC 5EPNA 1SOTA 1HIAA 3V13A 3KQBA 1LMWB 1ZTKA 4BAHB 4BXSA 5EXLA 4B2CA 3T25A 5E2PA 3SGBE 2SFAA 5CHAC 1ZPZA 4IBLH 1P2QA 4Z6AH 2F3CE 4MPWA 3DA9B 3PTBA 1A2CH 1AGJA 2ZFFH 4WH6A 2VB0A 3H5CB 4DT7B 1AY6H 3LGWA 1VR1H 1TIOA 1D9IA 2OQUA 1P2JA 1Q3XA 1MBQA 1TBRH 2HPPH 2ZGJA 2ZDMA 1HAOH 3T29A 3ODDA 1UTQA 3H7OA 3QLPH 3A80A 2OUAA 4B2BA 3LJJA 2ULLA 4O3TA 1BMLA 3Q76A 5FHTA 5TCAA 1W10U 3ATLA 1FQ3A 1QJ6B 4CRCA 1GL1A 1C4Y2 8LPRA 1F7ZA 1DUEA 1F5RA 2A4RA 1G9IE 1RTFB 1MH0A 1D3DB 3A84A 1HAGE 3BEUA 1OS8A 1G2LA 1HIAB 1C1WH 1XUKA 4GUXA 4U01A 2ZEBA 2ZGBH 1EAIA 3MO9A 2ZI2H 1A7SA 1CT4E 1ELTA 1O3EA 1V2KT 1YGCH 4GSOA 4X1PU 3K2UA 1GG6B 3SO3A 3PM3A 3MNBA 1ELFA 1JMOH 1E34B 1QFKH 1FY5A 3V0XA 5TJXA 1TA2A 1BTZA 4Q7ZA 1NFWA 1LKBA 3GCHC 3GY2A 4THNH 5JBTA 1YKTA 3SU2A 1A5HA 4K8YA 3WY8A 4NIWA 3RXOA 1OP2A 2JH5D 6LPRA 1CA0B 1PJPA 1C1QA 4E7RG 1KXAA 1LPZB 3TGJE 1PPHE 3HGNA 3BSQA 4X8UH 3RP2A 1C5NH 1O3GA 4D7FA 3PB1E 5ESTE 1DM4B 3S69A 1N8OC 3STIA 2BQWB 2RA0A 1CGJE 1CA0C 1GBFA 1QL8A 2FYQA 1UK3A 2QV1A 5IYTA 1NC6A 2C90B 4Y6DA 2Y5HA 5DP5A 1ZRKA 2NU3E 1OPHB 1O3LA 4ABIA 1TPSA 3RLYH 1GI6A 2GDDA 2TIOA 1ELAA 1W3CA 4A7IB 5F8XA 1SGRE 1C5VA 3SOSA 3P8GA 3ZZ4A 2QA9E 4AX9H 1S82A 4AYVB 2SNVA 2FLBH 4I8JA 3M5LA 4DIIH 2TPIZ 1K9OE 7ESTE 2F91A 2VJ1A 1PQAA 2AGGX 4X1NU 1L1JA 3K65B 1YPJH 4GHTA 3E0PB 1OWKA 2FWWA 1B7XB 2GZ7A 1AUJA 3RXDA 3VEQB 5EPYA 2F9VA 1JWTA 3FAOA 3BTDE 1C1RA 1EJNA 3BTQE 5EGMA 2Y6TA 4XE4A 1W0YH 2QYIA 3M5NA 3LKWA 3KCGH 2P8OB 5E0GA 3QGNB 1KXFA 1UTPA 3FVFB 3PROA 1KY9A 4FUGA 2G4TA 1C5ZB 1O35A 1K1NA 3RXJA 1H9LB 1O3CA 2R9PA 2R3YA 5JDUB 1ARBA 1K22H 1O2UA 1QBNA 1WQVH 1P2NA 2QXJA 1WAYB 2H6MA 4I8HA 3U98H 3ZZDA 1UK4A 3UTUH 3VGCB 1ARCA 3SV8A 1YPHC 1AI8H 1GI1A 4HZHA 3ZZBA 3LU9B 2BY9X 4VGCC 2XC0A 3UY9A 3A8BA 1BCUH 9ESTA 5AHGH 1OYQA 3QN7A 4TY6A 3TJNA 1CT0E 2I6SA 1O5EH 2A2XH 1GHXH 1HJ8A 3EA8A 4MQAA 1O2QA 3KQEA 3BTFE 3GY3A 1TX7A 2BY5X 4AG1A 3MTYA 1A0JA 3U8TH 1NO9H 3AW0A 3GDVA 1K1OA
chains in the Genus database with same CATH superfamily
5DO4H 1O2OA 3KL6A 4Y10E 2HVYB 1DT2A 2BXUH 2CV3A 4U30A 3BTHE 1SQRA 1UK2A 1HUTH 1W7XH 3OY5U 2GVFA 5FAHA 3AAVA 3QZRA 2ILNA 1ORFA 1H1BA 1ZHPA 4OS7A 1TGBA 1ETRH 3F9GA 3TVJB 1OWDA 1HAVB 2F43B 3QTVH 1FDPA 3EAJA 2H1UA 1ZPBA 1G3CA 3RXHA 3BEIB 1MTVA 1UTJA 4IMZA 1MAXA 1A3BH 1BB0B 1LVMA 1FY8E 2Z9JA 1FY3A 1Z8JB 1EFRD 1IAUA 3V12A 4Y11E 2WPHS 2VIDA 5KECA 5C17A 4OS2A 1OWHA 1A4WH 4FUJA 2WPIS 3ZZ8A 1YLCA 1HJ9A 6ESTA 3UR6A 3E6PH 1KMHB 2FDAA 1P01A 4MNYA 4B73A 1EX3A 1QB6A 1RTLA 1CO7E 1TGSZ 1AO5A 1KXCA 1V2NT 1NRRH 2VBCA 1QY6A 4Q2KA 2ZTZA 1IQLA 2PKAB 1O3KA 3B8JA 2HNTE 1ANDA 2AEIH 1P8VC 1GDNA 3ZYEA 2PKAA 2ZU2A 1OWIA 1MTNC 4E7NA 2AGEX 2VU8E 4WMFA 5DPAA 1EAXA 3LDXH 1AWHB 3E1XB 1EUFA 2FTLE 4I31A 4WF8A 2BHGA 1MCVA 3BTEE 5AFZH 5DG6A 4DIHH 4JZDH 1ELCA 1V2UT 1BTWA 1GMDG 2J2UA 1YBWA 1F0UA 4BAOB 4I33A 3TPIZ 2YMSB 5F8ZA 4AFZA 2Z7FE 2AHME 1GMHG 4YT6H 1ZOMA 1QBVH 2SGAA 5C3NA 1ELEE 2LP6A 4FUBA 3RU4D 4Z1MD 1L1GA 1K1IA 1RIWB 1FIZA 2JETC 5C2ZA 2P16A 2L74A 1BTXA 2ZFTA 4XBCA 7GCHG 1C2JA 2QN5T 3UREA 1GJBB 2ZG0H 2LELA 5DK1A 3PRDA 1SSXA 1ZTJA 1G3DA 5FCRA 1CGIE 2BYAX 1BMFD 1C1OA 1RTKA 2BVRH 1ANEA 3MU1A 4ABAA 3JZ1B 5CMXH 2BLWA 2XCFA 1HAHH 3B23B 2ZFSA 3OAAD 2C8XB 2QXIA 3PRBA 3AAUA 1P9UA 2GZ9A 1J16A 3PYHA 1HCGA 4FUEA 4K5ZA 1DDJA 1V2VT 4VGCB 4DURA 4Y71A 1OKXA 3MNXA 3VB7A 2J5UA 3U69H 5ESBA 4Y76A 1SFQB 1C5MD 1NROH 4UFFH 3ZVGA 2OC7A 4CR9A 1O3DA 4FUFA 1P04A 1HLTH 5IDKA 4WWYA 2YOLA 4CRGA 3EE0B 5JB9S 4Q80A 1FXYA 4P02A 2FMJA 1SFIA 2CGAA 5HXFA 3VB3A 3TH2H 4CRBA 1WV7H 2GX4A 4B75A 5F53A 2PKSB 1GVZA 1TYNA 1P09A 2ZQ1A 1LHFH 2ZQ2A 1MCTA 3KN2A 3PWBA 3HGPA 3PMJA 1IQFA 1N6YA 3GY4A 2ODPA 1TGNA 1AFQB 2FYRA 1O3OA 3RXAA 1F5KU 2Z3DA 2GJGA 3GY6A 1BUIA 3NXPA 1MZDA 5FXLA 2BD9A 1Y3UA 3GICB 4YXWD 4X2XA 5HGGA 1HXEH 2Y7XA 3O8BA 3RXKA 3PTNA 2UUJB 2A4GA 1BA8B 4K69A 4I8GA 2GKVE 1HJAB 1BHXF 1C2LA 4OS6A 4AZ2B 1C5XB 2H2ZA 4RKOB 3RXLA 2ZGXH 2B9LA 3GCNA 4E05H 4CH8B 1HAPH 2I6QA 3SU1A 5HIYA 4Y8YA 4MG3A 1SLVB 3M3TA 2IPHA 4FETA 2ODQA 4Y0ZE 2FS8A 3QO6A 4B6EA 4ZKNU 2IJD1 1SLUB 1GHBG 1V2RT 1BMMH 2H5CA 2BB4A 2AMPA 5B6LA 1NS3A 2VWLA 1UVUH 1V6DA 1MTWA 1IHTH 3SNDA 1TPPA 2CHAC 2ZFQH 2VGCB 5GDSH 1GBEA 1EP5A 3GCTG 2WYGA 3HKJB 1C5PA 1XUJA 3V7TA 5EJ1A 3A83A 1K2I1 1NZQH 1TQ0B 1QHRB 1LVYA 2QXGA 1C4V2 5DKMA 5ABWA 3SNBA 4TY7A 1DXWA 1TNIA 3OU0A 1GMCF 1Q2WA 3M5MA 3QDZB 3D23A 1CGHA 2V35A 2ZWLH 5DP4A 1N1LA 5K7RA 1EJAA 2VINA 3A89A 3DT0H 5FBEA 5KEDA 5L2ZH 1C5SA 2OBOA 1OSSA 5DN6D 2WZQA 1TX6A 2GCHG 2XBYA 4ZHLU 1L0ZA 2J38A 3M7UA 4SGBE 4MLFB 4BNRA 3K6YA 1KLJH 1GBCA 3ZVDA 3U8RH 3WWBA 2D2DA 2W26A 1O39A 3KIDU 1GJ7B 2XRCA 3BIUH 1C2KA 2GT8A 1Z71A 1P2OA 4ZKOU 5HIZA 3MI4A 2VWMA 1CA8B 4NIYA 1NM6A 1P2MA 8GCHG 1EASA 3S7HB 4ISHH 4MPVA 1K21H 2R3UA 4X1SU 1CBWC 1GCTB 1T4UH 1B0EA 3KHVA 3SI3H 1XMNB 4IMQA 4X8TH 5HKKD 3ZVFA 1L1NA 3UWJH 1DSUA 3GOVB 3ATIA 3KQCA 3PV2A 4JK6A 2V6NA 1GJ6A 2WPJS 1E1RD 4DJZB 1JIMA 1MZAA 3DSOA 5C67A 1O2RA 1LPGB 4WVPE 1G32B 1NRSH 1OHHD 2W5EA 2G5VA 1KTTB 4X1RU 1J15A 1SGTA 5IK2D 2G00A 4K3JA 3L6PA 2J92A 1TE0A 4RKJB 2Z9IA 2H9HA 3RMMH 1OX1A 1SMFE 1E36B 1DWEH 4K1SA 2D26C 2FO9A 2NU4E 4ZHAA 1RFNA 4AYYB 3SHAH 4RN6A 1V2OT 3LGIA 1S6FA 3PO1C 1HDTH 3RXBA 3RU4T 2V7QD 1C5OH 1V2WT 1XUFA 1AB9B 5L2YH 1O0DH 2CF9H 4CRDA 2UWLA 3O8RA 3GYLB 1A46H 1GHZA 1LTOA 4O3UA 1UMAH 1O2ZA 2QF4A 3KF2A 2GCTB 4XRNA 2C8WB 3LT3A 3SU0A 3M7TA 3GISB 2Y80A 3BG8A 1SGCA 5JB8S 2FOEA 3GY8A 1O5GH 1S83A 1F92A 1THRH 3Q77A 1GJ9B 5EG4A 1AZZA 1A5IA 2VIPA 4X2VA 1DWDH 3UB0A 3A81A 5LPEA 1Y5UT 1AE5A 5GCHG 1Q31A 1PQ7A 4MNWA 1ANCA 3TLOA 2NU1E 4HFPB 2ZKSA 2GV6A 3E16B 1EZQA 1O2WA 3PMHB 4MPUA 1TMTH 1KDQB 5DP7A 1WYKA 1XX9A 3T28A 4Y8ZA 1COWD 3FFGA 2XYAA 1T32A 2A31A 4TPYA 2O9QA 1LQEA 4RT0A 2OINA 2IPQX 3STJA 4MTBA 1PYTD 5CHBA 4WMEA 2Z6BD 4X6PA 4HGCA 1GGDC 2SGQE 3NK8A 1DICA 1XUIA 2FX6A 1FN6A 1SGDE 2EY4C 2PV9B 3F1SB 1F0SA 4RI0A 1O5DH 1LHGH 1BRUP 1F5LA 3LJOA 4ABEA 1A1RA 1IQEA 3PLKA 4NZQA 3ESTA 3S9AA 1LCYA 3FOAA 1TBZH 3RUOA 2ZO3H 2K0QA 1GBHA 1N8OB 1NBME 5E8EH 1YPKH 4LZ4B 1IQNA 3LC5A 1V2PT 4Q7YA 2ZFPH 2BDHA 4WMDA 4X1QU 5EQSA 1O3JA 1O5BB 1C5LH 3ZVAA 3FANA 3SJ9A 3OSYA 2HNTF 2A5IA 3A7TA 1KXBA 3VB6A 1O2HA 4YM9A 3VPKA 1DWBH 3LPRA 4OM9A 3GY7A 2BTCE 1JBUH 3ATKA 1GMDF 1ZMLA 4J1YA 2ANMH 3LH1A 2W3IA 1XKAC 1TLDA 1GCTC 1Z7KA 2GMTB 3S9CA 3RXPA 1O2XA 1EPTC 1VCQA 1BBRE 2PSYA 4NIXA 5EIYA 1OXGA 2IN2A 3NPSA 1W11U 5A8XA 1BJVA 3T2NA 3UFAA 1T8MA 3FKSD 2C3SA 1MKWK 1O5FH 5I25A 1KYNA 2M5TA 3M61U 4OGXA 4UE7H 2ZHEH 1B0FA 1QL9A 2ANKH 3SW2B 5EODA 1T8LA 3RC5A 1GI8B 3SNEA 1HB0B 5SGAE 1O5AB 1TNJA 3RXSA 1O2LA 1Z8GA 4INHA 4UDWH 1ABIH 1VITG 1NT1A 5J4SA 3O8CA 4WXIA 3EYDA 2WV5A 5AFYH 1XUGA 3SV9A 4A5TS 3GCTF 1E38B 1QB1A 2J34A 4Z0KA 2V3HH 1FAKH 1O2MA 1GHBF 2QIQA 1JRSA 1YWUA 1O32A 2RA3A 3H7TA 1LHCH 1ACBE 1D3TB 1ZHMA 5E0HA 3P95A 1TNKA 2ZPRA 5JBCS 3LGTA 2F9PA 4Y0YE 3A7YA 1HRTH 1SG8B 2AERH 2QXHA 4FVBA 2UUYA 4YO9A 4WY3A 1EZUC 4YOIA 1MQ5A 3RXVA 2PWXA 1EB1H 5EQQA 4DCDA 4ISIH 5C0UA 1HAVA 4IGDA 1IQKA 2STBE 3M3VA 2BY8X 1DITH 1ZJKA 2O8MA 1JIRA 5F03A 1GVKB 1K1PA 1DOJA 1FN8A 1TB6H 1T8OA 3SUEA 2IJOB 4LK4A 1TQ7B 3MOCA 2O8UA 1AIXH 5GJ4B 2PLXA 4FUHA 4LOYH 2PW8H 2PSXA 5AVDA 4JYTA 1PPBH 1WTGH 1FLEE 3T62A 3HK6B 2FX4A 1L2EA 1XUHA 3NRLA 2EI7A 2F83A 1C1UH 2FEQH 1QA0A 1QGFA 3S0NA 4JZEH 1MUEB 1WTHD 1CU1A 2VIWA 4F4OC 4B74A 1LDTT 2BOHB 1Z1JA 4OS1A 1S6HA 3SHCH 4FOUC 3MHWU 3QWCH 3SNCA 1BRAA 6CHAC 1F2SE 4NA9H 1SGYE 3FZDA 2BZAA 1EZSC 3H09A 2B5TB 2P94A 1ZMJA 3A86A 1LPKB 1SGFG 2ZPSA 3SGAE 1YF4A 2A45B 1WSSH 3A8AA 2A5KA 4A1VA 2A4QA 3U28C 3DSPA 4FVDA 3T27A 5GXPA 2XNIA 1AU8A 3UIRA 1FMGA 1S0QA 1AVXA 1F0RA 2TBSA 3ZZAA 3P92A 4KP0A 1HYLA 4Y8XA 2ZECA 5FPTA 4DY7B 1HPGA 1ZPCA 3M5OA 3RMOH 1NU9A 4ZKSU 3HATH 2TGAA 3P8FA 1MTUA 3PMAB 2ZHFH 4BTIB 5C5OA 1AHTH 3SQHE 1THSH 1GI2A 1ZSKA 3SU6A 2ZU5A 4M9FA 3D62A 3URCA 3E3TA 1M9UA 5DP3A 2BD4A 1WOFA 1OYTH 1FJSA 2GZ8A 2ZDAH 1QNJA 2XBWA 4E06H 1NBMD 1SGIB 1GI4A 2PKSC 3LC3A 1DLKB 3RMNH 2FESH 8GCHF 2P8OC 3Q3KA 2A7JA 4K8BA 1LQDB 1UCYK 2F9OA 5JBAS 1GBAA 2P3UB 2ZDNA 2VVCA 5FL7D 1K1LA 1XVMA 4Q4LA 1KXDA 1TBQH 1ZRBA 2OC8A 1P9SA 5L6NH 2KAIB 1UCYH 1UW7A 4HI3A 3M36A 3GDSA 3ZVCA 1A3EH 4TWWA 1BBRH 1A61H 2ANYA 3P8NA 1HAIH 4YT7H 1FIWA 2WPDD 4YOJA 7LPRA 1C5QA 1WDIA 3F2GA 3OTJE 5C0TA 1BRBE 3AW1A 4FUCA 3VG8A 1OOKB 4INLA 3A88A 3QUMP 1SQOA 3FN8A 2FOGA 4ZAEA 4WXVA 1EATA 2BD2A 4GPGA 5GIBA 5JPMH 2ANWA 1OWJA 4U32A 2BM2A 3DFLA 5HMAA 1ELDE 2D8WA 2Y81A 1SKYE 3HK3B 5T6FA 3ZZ6A 3TGKE 3OEED 1D6WA 4I8LA 2RDEA 2VVUA 3C27B 5FX6A 3TH3H 4CBNA 3VXFH 2KFWA 1P3EA 1A5GH 4AB9A 3D49H 3N7DA 1E0FD 1AKSA 1P2IA 2VGCC 4ZKRU 1S84A 2Z9KA 4YZUA 1MMJN 3SJOA 3MMGA 5EXMA 4D8NA 2YNBA 3A82A 3HPTB 3OTPA 3SORA 2BDAA 3LGYA 4O97A 3BG4B 3CNRA 4Y79A 8KME2 1C5RA 4OGYA 4NSVA 2DE9A 3G01A 4O03A 2XW9A 3SQEE 1DS2E 4IN2A 2SNWA 2ZCKP 1BIOA 1QBOA 1W2KH 1MAYA 1NY22 1S81A 1VCWA 1NU7B 3F0OA 1C1PA 2L6OA 4NFFA 2JJ2D 1BMNH 1PPGE 1C2GA 2XBVA 2CJIA 3AASA 2BVSH 3A8CA 4ZROA 3F9FA 3F2HA 1T4VH 3IITA 2F4LA 1CHOG 2JH6D 1MTNB 2GV7A 5F8TA 3LGVA 5GPIB 1BRCE 1MTSA 3SNAA 1W0KD 1PYTC 1J9CH 2VNTA 1P0SH 4XDEA 1ELVA 3SV7A 2LNCA 3OX7U 2VIVA 4I8KA 3UNSA 2BDBA 5HM2A 2BQ6B 2R0KA 1S0RA 4CR5A 1H9IE 3OYPA 1MBMA 4R8TB 1C1MA 2Z3EA 4A1TA 2XBXA 3RXFA 1BMAA 2Q6DA 1RXPA 2BLQA 1YC0A 5FBIA 1Y3WA 2G4UA 4YOGA 1SQAA 3PLPA 2ZDKA 1ZZZA 4JCNA 1TAWA 3RM2H 3ODFA 2ZU4A 4H6TA 1GI3A 1K1JA 5JBBS 5C5NA 1RIWC 4NGAH 4ISOA 2W6JD 3KYGA 1QRWA 2CHAB 3KNXA 5AF9H 4MDSA 4AN7A 1P11E 3FZZA 2FI5E 1QZ8A 3E90B 4KELA 1XKBC 1ZGIA 1O2PA 1QB9A 4A92A 3RU4E 4ZXXH 1VITF 5FX5A 4TSFD 1DX5M 2Z94A 2WINI 4F49A 2KZ4A 1INCA 4NWLA 2YMSC 1GHAF 2W7UA 2GP9B 1MABB 1TGTA 2EI8A 2PHBA 3MU5A 1GJ8B 2FOAA 4ZMAH 3I29A 2WPMS 4UFGH 4D7GA 2ZDLA 1EAWA 5T6DA 3ZIAD 4AGJA 4GHQA 1KIGH 4ABGA 2ZC9H 2ZP0H 1QR3E 1SR5C 1TALA 1CT2E 1QRZA 1EOLA 9LPRA 1D6RA 1VZQH 2GD4B 2BZ6H 4K60A 2VIQA 1NTPA 1J14A 1PPEE 2KM0A 5CDFE 3W1EA 4CRFA 1C1TA 3TK9A 1SHYA 1K28D 2FM2A 1UTNA 5CHAB 5EOKA 1PQ5A 3MFJA 1O37A 1OP8A 1PFXC 3E8LA 3LH3A 4ZHMU 2J94A 1YCPK 4AORA 4BAKB 1SGFA 3UNRA 3SUFA 2SGEE 1O34A 1H4WA 1UCYE 2J4IA 4F55A 1HXFH 2QF0A 2QC2A 1EZXC 4NZLA 1TMUH 3F2FA 1LVOA 2FOFA 1S5SA 2PR3A 2ZHWH 1SLWB 2ZZUH 2KCYA 1SGQE 2AGIX 1QA7A 2BDYA 1V2TT 3EDXB 2BY7X 2ZGCA 1GHYH 2F9UA 2NU0E 3O8DA 4FXGH 4NWKA 1O2VA 2CN0H 1C2HA 1YCPM 4TWYA 3SU5A 1YYY1 2PFEA 2ZPQA 4MVNA 4FUDA 1C9TA 1TGCA 1AB9C 2FOCA 4CH2B 3VB4A 1JRTA 3TJUA 4X2WA 4ZUHA 4AOQA 1AUTC 3GCHB 3ZVEA 3I78A 1LKAA 3TIUA 3QK1A 2ZHQH 4D9QA 1YLDA 3KEEA 4JZFH 2GCTC 1O33A 4K1EA 1GL0E 1MU6B 1GBIA 1XXFA 4Q7XA 2EA3A 1EB2A 3BIVH 1X7AC 3A7VA 3SV6A 1AE8H 1KTSB 1T7CA 1PPCE 4HG6A 3SZEA 3EQ0H 1AKSB 3GS9A 5A0BA 2AFQB 5F6MA 1C2FA 4NA8A 4K2YA 1GBTA 3CS0A 1BTYA 3LONA 3PV5A 4ZH8A 2BX3A 4X0WU 3A7ZA 4ASUD 3LIWA 1E35B 3R3GB 1H8ED 1GBDA 2C8ZB 1HV7A 1GI5A 4ABFA 1GWAA 3F6UH 2O8LA 2ALVA 1TOMH 3JZ2B 4BXWA 8ESTE 2OLGA 1GI7B 1C2MA 4GLYA 3DD2H 2BXTH 2QCYA 2THFB 1FPHH 1Y8TA 2V3MA 3DUXH 4MPXA 1UHBA 5EQRA 4TPIZ 1ESTA 1GHAG 1O31A 3ITIA 3F9EA 4NIVA 2G55A 1NN6A 4NA7A 2VVVA 1UTLM 4SGAE 2OD3B 1O2IA 2FIRH 1O2SA 4AFQA 2GMTC 1TNLA 1G37A 1QJ7B 2J97A 4IN1A 4BTUB 3BTWE 3SU3A 1PPZA 2KAIA 2XTTB 2JIZD 4DW2U 3SV2H 1G3BA 2ESTE 4B71A 3PV4A 1IHSH 2Y5FA 3DSGA 1RGQA 3RDZA 1ESBA 5EXNA 3FP7E 3MQKC 1GBBA 2HGTH 1O38A 2ZU3A 3MO6A 1V2JT 5FPSA 2AIQA 1DY9A 2XWBI 4P00A 4JZ1A 1EPTA 1AFEH 1QJ1B 3NWUA 2QY0B 1DXPA 4ESTE 1GJ4H 4Y7AA 3UR9A 1CSOE 3KGPA 1O3NA 1UJ1A 1ELGA 3MWIU 2JH0D 2OP9A 1V3XA 4TYDA 2J98B 1FY1A 2CMYA 2FOBA 4BAMB 4D76A 2Z9LA 3SJIA 2ZA5A 1V2QT 4K1TA 2IOTA 4OS5A 1K1MA 1ZJDA 3MYWA 3IG6B 1LHDH 2BMGB 3M37A 3RXGA 1C9PA 2P93A 3MNSA 2UWPA 4NSYA 5I46H 2WUCA 1W8BH 1C2EA 2ALPA 1GBKA 4X6OA 3TK5A 3NZIA 4DG4A 2RCEA 2W7SA 1UTKA 2AIPA 3FO8D 3SJ8A 3PO1B 2JDID 1AQ7A 3TK6A 1GMCG 2RFKC 4OS4A 1FX0B 1EAUA 1EPTB 1VITH 1CHGA 2EQNA 5J4QA 1SGEE 1G30B 1T8NA 4GAWA 1PPFE 1TWXB 5C94A 4A6LA 1Y5AT 3M35A 2BDGA 1O2YA 2FTMA 4GVUA 4O9VA 3TNSA 3SJKA 2Z3CA 4XSKU 1KDQA 4AB8A 2PGQB 4KTSA 1BZXE 1NPMA 2A1DB 2KCPA 4FUIA 2C8YB 2ZFRH 1AZ8A 2FZZA 3U1IB 5LH8A 4Y7BA 3NUMA 1O2NA 4KKDA 4AFSA 1GBMA 2A0QB 3KQ5A 3ZV8A 5A09A 3WWFA 2Y5GA 3MH4A 3Q3XA 5DGJA 3ATMA 3SUDA 1TOCB 2O8TA 4JK5A 3MU0A 2BD7A 1GBJA 1JXPA 4YLQH 1ANBA 5PTPA 1O2GH 1UVOA 3UNQA 1UHBB 3ZYDA 6GCHF 2A4OA 2OBQA 3T5FH 1Y5BT 1WUNH 4ISLA 4ACAA 3TJVA 1SL3A 4YLUA 4B6FA 1EKBB 2W6ID 4KTCA 1D3PB 5EW2H 2HWLB 5A0AE 4BANB 3CS7A 1NESE 1P06A 3LGUA 2VWNA 1TPAE 3MH5A 4H4FA 1WCZA 1IQHA 5KGOA 1VJAU 2OC1A 4XFQA 2EI6A 3C1KA 4LXBH 5G4BA 1ZSLA 4IC6A 3DHKH 1GG6C 4U2WA 2WYJA 4ZXYH 1NFUA 5EW1H 3F68H 5FPYA 1ETTH 2SGPE 1O3AA 1Y3YA 4UFEH 5C1XA 5A8ZA 1SOZA 3Q3YA 4X2YA 2ZHDA 1SQTA 3L33A 1LO6A 1DFPA 5GWZA 4MNVA 3CP7A 2J95A 2JKHA 4A1XA 1CVWH 5LPRA 1HNEE 4JZIA 4LZ1H 1C5UA 3BN9A 5B6OA 1BTUA 1FV9A 1SC8U 6CHAB 3A85A 3A7WA 2O8WA 2CF8H 2ZCHP 3RXQA 2SGFE 1QRXA 4ABDA 2BX4A 1GHVH 5E2OA 3ZZCA 2A7HA 1C5WB 1LHEH 2GT7A 3F9HA 3A8DA 1IOEA 2P3TB 1DY8A 4H6SB 2BD3A 1O3HA 1J17T 1RS0A 5A0CA 1N6XA 1K0HA 4KTUA 1NRPH 4IS5A 1ID5H 3UQOA 2AMDA 3PLBA 2YMSD 3W95A 2ZIQH 4CRAA 5DP9A 2Q1JA 1VGCB 1H8IH 1FUJA 3ZZ7A 3RM0H 4ABJA 1PQ8A 4RT1A 4X6NA 1D3QB 1AN1E 2NU2E 1XVOA 5T6GA 1P12E 4J2YB 1W13U 1MKWH 2G81E 1EXFA 1C1SA 1Z6EA 5CE1A 2A5AA 2BDIA 1Y3XA 2FLRH 1RD3B 2FS9A 3EGKH 4QT8C 3DFJA 3RLWH 5BPEA 1CQQA 2ZTXA 4KGAA 3OY6U 2BY6X 2ZTYA 1W0ZU 1YPEH 3VGCC 1H8DH 1XXDA 5C1UA 4FU7A 1QTFA 3OEHD 2GGVB 3RXRA 1ZYOA 2XXLA 4WH8A 3MU4A 3E91A 2FP7B 2KX4A 2V3OH 1AVGH 2OXSA 3ZZ3A 4AGKA 2OQ5A 1OP0A 1ELBA 1BTHH 1EP6A 3GDUA 2BDCA 1E37B 4YESB 1HAYB 3GYMA 1YPGH 3ZZ9A 1P05A 5DP6A 1SGNE 3EA9A 2G52A 3L3TA 1TRYA 1BBRK 3OE7D 1P02A 1TRNA 4NCYA 3KYFA 1GJAB 1TPOA 2EEKA 1VGCC 2B0FA 3W94A 1YY3A 1UVTH 2ZDVH 2AMQA 3S9BA 2HRVA 2TRMA 1E1QD 3QZQA 3UUZA 1BJUA 1SPJA 5HM9A 3ATWA 1A0LA 2HLCA 1GDQA 6GCHG 3E0NB 2H9EH 3GCOA 1GJCB 1ZGVA 2D1JA 3U1JB 1P10A 3MU8A 1HJAC 4BAQB 2P59A 1H9HE 3RC6A 1WQSA 1IQMA 3M7QA 3SUGA 2WPKS 4GCHF 1SI5H 2BVXH 2G8TA 2AH4X 2BOKA 1DPOA 5FCKA 3P8OA 1TA6A 1YPMH 3UPEA 2B8OH 1QCPA 3SYJA 1EOJA 2QGRA 1P03A 1U6QA 1Y59T 1GBLA 1C2DA 3NKKA 2HPQH 4ABBA 4DVAU 1GPZA 4ABHA 3VXEH 1Z8RA 5A2MH 5BRRE 4XBBA 4IW4E 1P2KA 1KXEA 1BITA 5HYOA 3SI4H 1GMHF 3SBKA 3LOXA 4MNXA 4NG9H 1LVBA 1GHWH 2PTCE 3B9FH 2B7DH 4I7YH 5LGOA 2HOBA 1D4PB 1Z6JH 1C2IA 3UWIA 3R0FA 1YCPH 3MNCA 5TCCA 3BG4C 3FP8E 1CHOF 3I77A 2WPLS 1E79D 4INKA 1BHXB 1ABJH 1NFYA 4X8VH 2OC0A 2OK5A 3V3MA 1C1VH 1FNIA 1ZTLA 2P95A 3A87A 4UFDH 3ZV9A 2HALA 3URDA 1AMHA 2BD8A 3MH7A 1DSTA 2JETB 1YM0A 1KSNA 1EJMA 2PTNA 2SGDE 1ZR0A 1O30A 3BV9B 4NFEA 5C1YA 1TFXA 1SBWA 2V0BA 2Y82A 3TH4H 3BTTE 3MO3A 3ZVBA 2Z9GA 3DCLA 3F0PA 2TGPZ 2R2MB 4GCHG 4XBDA 3ZZ5A 1W12U 5H4IB 2A32A 2WUBA 1AVWA 2C4FH 4Q63A 4HTCH 4X6MA 3TITA 1CBWB 3RMLH 1ZLRA 1EQ9A 1VCPA 3EA7A 2UUKB 3K6ZA 3P17H 1Y3VA 4YTAA 4I32A 1O3PB 2QF3A 1BDAA 1KLIH 3MH6A 1O3BA 1RRKA 2YNAA 2PUQH 1C5TA 1UTMA 2OCVB 1TMBH 3P6ZB 1C1NA 7GCHF 1MD7A 2CXVA 1QL7A 1ZSJA 1WU1A 1TONA 3SZNA 1TX8A 3BTKE 3EE7A 1FY4A 2A7CA 3QX5H 1FAXA 1P3CA 2FODA 1MU8B 1NRNH 1MQ6A 2ZF0H 3S7KB 1HAZB 1V2ST 3VB5A 2NWNA 2W3KA 2UUFB 5GCHF 1VJ9U 1SLXB 1QIXB 1TABE 2BD5A 3UOPA 1O2TA 4JMYA 2H9TH 3RXEA 5E0JA 2TGTA 1G36A 2DUCA 1NRQH 2FOHA 1OWEA 4B2AA 1MKXH 2PP6A 1W14U 1T31A 2Q6FA 2ZCLP 1ESAA 3QGJA 4JYVH 2R0LA 3D65E 1Z1IA 2QF5A 3BEFB 1XM1A 2PGBB 5T3HA 1MKXK 4XOJA 2EC9H 5L30H 1FPCH 4DGJA 2OTVA 3P70B 4AG2A 3TGIE 1ZMNA 2WSSD 1O3FA 1Z8IB 3K9XB 5A8YA 1GVLA 1F0TA 1ZHRA 2ODYB 2GDEH 1JOUB 3NCLA 3UOUA 1AWFH 2K1QA 5DSFA 5EU8A 4X8SH 4WJG2 1DANH 4IC5A 3ENSB 1DVAH 1YPLH 2VH6A 1IQJA 1GJDB 1A0HB 1QQUA 1O2JA 1C4U2 2KCAA 4D9RA 1FONA 1DWCH 1AFQC 3PWCA 2F9BH 2F9NA 2PUXB 1KLTA 5K0HA 1YPHE 3AVZA 3RXTA 2ASUB 1YP9A 2Q6GA 2BQ7B 1HFDA 1G3EA 2G5NA 7KMEH 3U8OH 4DT4A 1GJ5H 1UO6A 1V2MT 1HGTH 1H8HD 1SVPA 4R0IA 4DOQA 2VWOA 4RSPA 2G51A 1W7GH 2JJ1D 2XWAA 1O3IA 1TRMA 2DE8A 2P3FH 3A7XA 1IQGA 1TNHA 1ETSH 4H42U 3PMBB 1BTPA 2RG3A 3RXUA 5EJZA 2GTBA 3SGQE 1QURH 1NFXA 2FI4E 1UVPA 3BF6H 2ZU1A 2C93B 1AD8H 1GI0A 1UTOA 2FI3E 5DP8A 1GDUA 3N7OA 5DJ7A 3SU4A 3T26A 1UVSH 1DE7H 2XC4A 1BQYA 1S85A 1THPB 2VH0A 2FOMB 4CHAB 4B76A 1MD8A 2BLVA 3UQVA 5LPFA 2FXRA 1O2KA 2VIOA 4FU9A 4JYUH 3M3SA 5JYIA 1P57B 3CENA 3KQDA 1WBGB 3ELAH 3Q00A 3F3BA 2XC5A 3U9AH 2A2QH 4AFUA 1SGPE 4CBOA 2R2WU 4PROA 5EJLA 4FU8A 2AYWA 1TNGA 2UWOA 4UEHH 1C5YB 1W0JD 2WV4A 1SHHB 1G2MA 3N7EA 2HVXA 3BTME 4UONA 4CHAC 3TNTA 2H5DA 4CREA 3HKIB 2GCHF 1GCDA 2XCNA 1B5GH 2RDLA 3RXMA 1GGDB 1BT7A 3VFEA 1FZZA 1HBTH 1RJXB 3GY5A 2ZNKH 3RXCA 2BLOA 1O3MA 4ASHA 1L4DA 5C20A 2STAE 3IWMA 3RXIA 1QQ4A 3SN8A 4UD9H 4ISNA 3FP6E 2QAAA 5ETXA 4BTTB 3TJOA 1HAXB 1CE5A 1DUAA 1O5CB 1S6LA 1V2LT 1FI8A 4B1TA 1J8AA 1O36A 1L4ZA 2AS9A 2LPRA 4M7GA 2TGDA 1IQIA 4ZCNA 1GI9B 3RC4A 1DLEA 1SB1H 2J9NA 1BOQA 2FPZA 2QE7D 3BTGE 2ZGHA 3QTOH 2Y7ZA 4BOHA 3TU7H 2HNTC 5EPNA 1SOTA 1HIAA 5GNDA 3KQBA 3V13A 1LMWB 1ZTKA 4BAHB 4BXSA 5EXLA 4B2CA 2WHXA 4F48B 3T25A 4XD7D 5E2PA 3SGBE 2SFAA 5CHAC 1ZPZA 4IBLH 1P2QA 4Z6AH 2F3CE 4MPWA 3DA9B 3PTBA 1A2CH 1AGJA 2ZFFH 4WH6A 2VB0A 3H5CB 4DT7B 1AY6H 3LGWA 1VR1H 1TIOA 1D9IA 2OQUA 1P2JA 1Q3XA 1MBQA 1TBRH 2HPPH 2ZGJA 2ZDMA 1HAOH 1YLNA 3T29A 3ODDA 1UTQA 3H7OA 3QLPH 3A80A 2OUAA 4B2BA 3LJJA 2ULLA 4O3TA 1BMLA 3Q76A 5FHTA 5TCAA 1VKYA 1W10U 3AK5A 3ATLA 1FQ3A 1QJ6B 4CRCA 1GL1A 2K8IA 2KCOA 1C4Y2 8LPRA 1F7ZA 1DUEA 1F5RA 2A4RA 1G9IE 5T1VA 1RTFB 1MH0A 1D3DB 2XOKD 3A84A 1HAGE 3BEUA 1OS8A 1G2LA 1HIAB 1C1WH 1XUKA 4GUXA 4U01A 3UAIC 2ZEBA 2ZGBH 1EAIA 3N99A 3MO9A 2ZI2H 4I86A 1A7SA 1CT4E 1ELTA 1O3EA 1V2KT 1YGCH 4GSOA 4X1PU 3K2UA 1GG6B 3SO3A 3PM3A 3MNBA 1ELFA 1JMOH 1E34B 1QFKH 1FY5A 3V0XA 5TJXA 1TA2A 1BTZA 4Q7ZA 1NFWA 1LKBA 3GCHC 3GY2A 4THNH 5JBTA 1YKTA 3SU2A 1A5HA 4K8YA 3WY8A 4NIWA 3RXOA 1OP2A 2JH5D 6LPRA 1CA0B 1PJPA 1C1QA 4E7RG 1KXAA 1LPZB 2CK3D 3TGJE 1PPHE 2HLDD 3HGNA 3BSQA 4X8UH 3RP2A 1C5NH 1O3GA 2M2AA 3PB1E 4D7FA 5ESTE 1DM4B 3S69A 2KR7A 1N8OC 3STIA 2BQWB 2RA0A 1CGJE 1CA0C 1GBFA 1QL8A 2FYQA 1UK3A 2QV1A 5IYTA 1NC6A 2C90B 4Y6DA 2Y5HA 5DP5A 1ZRKA 2WV9A 2NU3E 1OPHB 1O3LA 4ABIA 1TPSA 3RLYH 1GI6A 2GDDA 2TIOA 1ELAA 1W3CA 4A7IB 5F8XA 1SGRE 1C5VA 3SOSA 3P8GA 3ZZ4A 2QA9E 1WXRA 4AX9H 1S82A 4AYVB 2SNVA 2FLBH 4I8JA 3M5LA 4DIIH 2TPIZ 1K9OE 7ESTE 2F91A 2VJ1A 1PQAA 2AGGX 4X1NU 1L1JA 3K65B 1YPJH 4GHTA 3E0PB 1OWKA 2FWWA 1B7XB 2GZ7A 2XNDD 1AUJA 3RXDA 3VEQB 5EPYA 2F9VA 1JWTA 3FAOA 3BTDE 1C1RA 1EJNA 3BTQE 5EGMA 2Y6TA 4XE4A 1W0YH 2QYIA 3M5NA 3LKWA 3KCGH 2P8OB 5E0GA 3QGNB 1KXFA 4TT3D 1UTPA 3FVFB 3PROA 1KY9A 4FUGA 2G4TA 1C5ZB 1O35A 1K1NA 3RXJA 1H9LB 1O3CA 2R9PA 2R3YA 5JDUB 1ARBA 1K22H 1O2UA 1QBNA 1WQVH 1P2NA 2QXJA 1WAYB 2H6MA 4I8HA 3U98H 3ZZDA 1UK4A 3UTUH 3VGCB 1ARCA 3SV8A 1YPHC 1AI8H 1GI1A 4HZHA 3ZZBA 3LU9B 2BY9X 4VGCC 2XC0A 3UY9A 3A8BA 1BCUH 9ESTA 5AHGH 1OYQA 3QN7A 4TY6A 3TJNA 1CT0E 2I6SA 1O5EH 2A2XH 3WW7A 1GHXH 1HJ8A 3EA8A 4MQAA 1O2QA 3KQEA 3BTFE 2J98A 1TX7A 3GY3A 4AC9A 2BY5X 4AG1A 3MTYA 1A0JA 4ACBA 3U8TH 3OFND 1NO9H 3AW0A 3GDVA 1K1OA
chains in the Genus database with same CATH topology
5DO4H 1O2OA 3KL6A 4Y10E 1DT2A 2BXUH 2CV3A 4U30A 3BTHE 1UK2A 1HUTH 1W7XH 3OY5U 2GVFA 5FAHA 3AAVA 3QZRA 2ILNA 1ORFA 1H1BA 1ZHPA 4OS7A 1TGBA 1ETRH 3F9GA 3TVJB 1OWDA 1HAVB 3QTVH 1FDPA 3EAJA 2H1UA 1ZPBA 1G3CA 3RXHA 3BEIB 1MTVA 1UTJA 4IMZA 1MAXA 1A3BH 1BB0B 1LVMA 1FY8E 2Z9JA 1FY3A 1Z8JB 1IAUA 3V12A 4Y11E 2WPHS 2VIDA 4OS2A 1OWHA 1A4WH 4FUJA 2WPIS 3ZZ8A 1YLCA 1HJ9A 6ESTA 3UR6A 3E6PH 2FDAA 1P01A 4MNYA 4B73A 1EX3A 1QB6A 1RTLA 1CO7E 1TGSZ 1AO5A 1KXCA 1V2NT 1NRRH 1QY6A 4Q2KA 2ZTZA 1IQLA 2PKAB 1O3KA 3B8JA 2HNTE 1ANDA 2AEIH 1P8VC 1GDNA 3ZYEA 2PKAA 2ZU2A 1OWIA 1MTNC 4E7NA 2AGEX 2VU8E 4WMFA 5DPAA 1EAXA 3LDXH 1AWHB 3E1XB 1EUFA 2FTLE 4I31A 4WF8A 2BHGA 1MCVA 3BTEE 5AFZH 5DG6A 4DIHH 4JZDH 1ELCA 1V2UT 1BTWA 1GMDG 2J2UA 1YBWA 1F0UA 4BAOB 4I33A 3TPIZ 5F8ZA 4AFZA 2Z7FE 1GMHG 4YT6H 1ZOMA 1QBVH 2SGAA 5C3NA 1ELEE 3RU4D 4FUBA 1L1GA 1K1IA 1RIWB 1FIZA 2JETC 5C2ZA 2P16A 1BTXA 2ZFTA 4XBCA 7GCHG 1C2JA 2QN5T 3UREA 1GJBB 2ZG0H 5DK1A 1SSXA 1ZTJA 1G3DA 5FCRA 1CGIE 2BYAX 1C1OA 1RTKA 2BVRH 1ANEA 3MU1A 4ABAA 3JZ1B 5CMXH 2BLWA 2XCFA 1HAHH 3B23B 2ZFSA 2C8XB 2QXIA 3AAUA 1P9UA 2GZ9A 1J16A 3PYHA 1HCGA 4FUEA 4K5ZA 1DDJA 1V2VT 4VGCB 4DURA 4Y71A 1OKXA 3MNXA 3VB7A 3U69H 5ESBA 4Y76A 1SFQB 1C5MD 1NROH 4UFFH 3ZVGA 2OC7A 4CR9A 1O3DA 4FUFA 1P04A 1HLTH 5IDKA 4WWYA 2YOLA 4CRGA 3EE0B 5JB9S 4Q80A 1FXYA 2FMJA 1SFIA 2CGAA 5HXFA 3VB3A 3TH2H 4CRBA 1WV7H 2GX4A 4B75A 2PKSB 1GVZA 1TYNA 1P09A 2ZQ1A 1LHFH 2ZQ2A 1MCTA 3KN2A 3PWBA 3HGPA 3PMJA 1IQFA 1N6YA 3GY4A 2ODPA 1TGNA 1AFQB 2FYRA 1O3OA 3RXAA 1F5KU 2Z3DA 3GY6A 1BUIA 3NXPA 1MZDA 5FXLA 2BD9A 1Y3UA 3GICB 4X2XA 5HGGA 1HXEH 2Y7XA 3O8BA 3RXKA 3PTNA 2UUJB 2A4GA 1BA8B 4K69A 4I8GA 2GKVE 1HJAB 1BHXF 1C2LA 4OS6A 4AZ2B 1C5XB 2H2ZA 4RKOB 3RXLA 2ZGXH 2B9LA 3GCNA 4E05H 4CH8B 1HAPH 2I6QA 3SU1A 4Y8YA 4MG3A 1SLVB 3M3TA 2IPHA 2ODQA 4Y0ZE 2FS8A 3QO6A 4ZKNU 1SLUB 1GHBG 1V2RT 1BMMH 2H5CA 2BB4A 2AMPA 1NS3A 2VWLA 1UVUH 1V6DA 1MTWA 1IHTH 3SNDA 1TPPA 2CHAC 2ZFQH 2VGCB 5GDSH 1GBEA 1EP5A 3GCTG 2WYGA 3HKJB 1C5PA 1XUJA 3V7TA 3A83A 1K2I1 1NZQH 1TQ0B 1QHRB 1LVYA 2QXGA 1C4V2 5DKMA 5ABWA 3SNBA 4TY7A 1DXWA 1TNIA 3OU0A 1GMCF 1Q2WA 3M5MA 3QDZB 3D23A 1CGHA 2V35A 2ZWLH 5DP4A 1N1LA 5K7RA 1EJAA 2VINA 3A89A 3DT0H 5FBEA 5L2ZH 1C5SA 2OBOA 1OSSA 1TX6A 2GCHG 2XBYA 4ZHLU 1L0ZA 2J38A 3M7UA 4SGBE 4MLFB 4BNRA 3K6YA 1KLJH 1GBCA 3ZVDA 3U8RH 2D2DA 2W26A 1O39A 3KIDU 1GJ7B 2XRCA 3BIUH 1C2KA 2GT8A 1Z71A 1P2OA 4ZKOU 3MI4A 2VWMA 1CA8B 4NIYA 1NM6A 1P2MA 8GCHG 1EASA 3S7HB 4ISHH 4MPVA 1K21H 2R3UA 4X1SU 1CBWC 1GCTB 1T4UH 1B0EA 3KHVA 3SI3H 1XMNB 4IMQA 4X8TH 3ZVFA 1L1NA 3UWJH 1DSUA 3GOVB 3ATIA 3KQCA 4JK6A 2V6NA 1GJ6A 2WPJS 4DJZB 1JIMA 1MZAA 5C67A 1O2RA 1LPGB 4WVPE 1G32B 1NRSH 2W5EA 2G5VA 1KTTB 4X1RU 1J15A 1SGTA 2G00A 4K3JA 3L6PA 2J92A 1TE0A 4RKJB 2Z9IA 2H9HA 3RMMH 1OX1A 1SMFE 1E36B 1DWEH 4K1SA 2D26C 2FO9A 2NU4E 4ZHAA 1RFNA 4AYYB 3SHAH 4RN6A 1V2OT 3LGIA 1S6FA 3PO1C 1HDTH 3RXBA 3RU4T 1C5OH 1V2WT 1XUFA 1AB9B 5L2YH 1O0DH 2CF9H 4CRDA 2UWLA 3O8RA 3GYLB 1A46H 1GHZA 1LTOA 4O3UA 1UMAH 1O2ZA 3KF2A 2GCTB 2C8WB 3LT3A 3SU0A 3M7TA 3GISB 2Y80A 3BG8A 1SGCA 5JB8S 2FOEA 3GY8A 1O5GH 1S83A 1F92A 1THRH 3Q77A 1GJ9B 5EG4A 1AZZA 2VIPA 1A5IA 4X2VA 1DWDH 3A81A 5LPEA 1Y5UT 1AE5A 5GCHG 1Q31A 1PQ7A 4MNWA 1ANCA 3TLOA 2NU1E 4HFPB 2ZKSA 2GV6A 3E16B 1EZQA 1O2WA 3PMHB 4MPUA 1TMTH 1KDQB 5DP7A 1WYKA 1XX9A 3T28A 4Y8ZA 3FFGA 2XYAA 1T32A 2A31A 4TPYA 2O9QA 1LQEA 2OINA 3STJA 4MTBA 1PYTD 4WMEA 2Z6BD 4X6PA 4HGCA 1GGDC 2SGQE 3NK8A 1DICA 1XUIA 2FX6A 1FN6A 1SGDE 2PV9B 3F1SB 1F0SA 1O5DH 1LHGH 1BRUP 1F5LA 3LJOA 4ABEA 1A1RA 1IQEA 3PLKA 4NZQA 3ESTA 3S9AA 1LCYA 1TBZH 3RUOA 2ZO3H 1GBHA 1N8OB 5E8EH 1YPKH 4LZ4B 1IQNA 3LC5A 1V2PT 4Q7YA 2ZFPH 2BDHA 4WMDA 4X1QU 5EQSA 1O3JA 1O5BB 1C5LH 3ZVAA 3FANA 3SJ9A 3OSYA 2HNTF 2A5IA 3A7TA 1KXBA 3VB6A 1O2HA 4YM9A 3VPKA 1DWBH 3LPRA 3GY7A 2BTCE 1JBUH 3ATKA 1GMDF 1ZMLA 4J1YA 2ANMH 3LH1A 2W3IA 1XKAC 1TLDA 1GCTC 1Z7KA 2GMTB 3S9CA 3RXPA 1O2XA 1EPTC 1VCQA 1BBRE 2PSYA 4NIXA 1OXGA 2IN2A 3NPSA 1W11U 5A8XA 1BJVA 3T2NA 3UFAA 1T8MA 2C3SA 1MKWK 1O5FH 5I25A 1KYNA 2M5TA 3M61U 4OGXA 4UE7H 2ZHEH 1B0FA 1QL9A 2ANKH 3SW2B 5EODA 1T8LA 3RC5A 1GI8B 3SNEA 1HB0B 5SGAE 1O5AB 1TNJA 3RXSA 1O2LA 1Z8GA 4INHA 4UDWH 1ABIH 1VITG 1NT1A 5J4SA 3O8CA 4WXIA 3EYDA 2WV5A 5AFYH 1XUGA 3SV9A 4A5TS 3GCTF 1E38B 1QB1A 2J34A 4Z0KA 2V3HH 1FAKH 1O2MA 1GHBF 2QIQA 1JRSA 2RA3A 1O32A 3H7TA 1LHCH 1ACBE 1D3TB 1ZHMA 5E0HA 3P95A 1TNKA 2ZPRA 5JBCS 3LGTA 2F9PA 4Y0YE 3A7YA 1HRTH 1SG8B 2AERH 2QXHA 4FVBA 2UUYA 4YO9A 4WY3A 1EZUC 4YOIA 1MQ5A 3RXVA 2PWXA 1EB1H 5EQQA 4DCDA 4ISIH 1HAVA 4IGDA 1IQKA 2STBE 3M3VA 2BY8X 1DITH 1ZJKA 2O8MA 1JIRA 5F03A 1GVKB 1K1PA 1DOJA 1FN8A 1TB6H 1T8OA 3SUEA 2IJOB 4LK4A 1TQ7B 3MOCA 2O8UA 1AIXH 5GJ4B 2PLXA 4FUHA 4LOYH 2PW8H 2PSXA 5AVDA 4JYTA 1PPBH 1WTGH 1FLEE 3T62A 3HK6B 2FX4A 1L2EA 1XUHA 2EI7A 2F83A 1C1UH 2FEQH 1QA0A 1QGFA 3S0NA 4JZEH 1MUEB 1WTHD 1CU1A 2VIWA 4F4OC 4B74A 1LDTT 2BOHB 1Z1JA 4OS1A 1S6HA 3SHCH 3MHWU 3QWCH 3SNCA 1BRAA 6CHAC 1F2SE 4NA9H 1SGYE 3FZDA 2BZAA 1EZSC 2B5TB 2P94A 1ZMJA 3A86A 1LPKB 1SGFG 2ZPSA 3SGAE 1YF4A 2A45B 1WSSH 3A8AA 2A5KA 4A1VA 2A4QA 5GXPA 3T27A 4FVDA 2XNIA 1AU8A 3UIRA 1FMGA 1S0QA 1AVXA 1F0RA 2TBSA 3ZZAA 3P92A 4KP0A 1HYLA 4Y8XA 2ZECA 5FPTA 4DY7B 1HPGA 1ZPCA 3M5OA 3RMOH 1NU9A 4ZKSU 3HATH 2TGAA 3P8FA 1MTUA 3PMAB 2ZHFH 4BTIB 5C5OA 1AHTH 3SQHE 1THSH 1GI2A 1ZSKA 3SU6A 2ZU5A 3D62A 3URCA 3E3TA 1M9UA 5DP3A 2BD4A 1WOFA 1OYTH 1FJSA 2GZ8A 2ZDAH 1QNJA 2XBWA 4E06H 1SGIB 1GI4A 2PKSC 3LC3A 1DLKB 3RMNH 2FESH 8GCHF 2P8OC 3Q3KA 2A7JA 4K8BA 1LQDB 1UCYK 2F9OA 5JBAS 1GBAA 2P3UB 2ZDNA 2VVCA 1K1LA 1XVMA 1KXDA 1TBQH 2OC8A 1P9SA 1ZRBA 5L6NH 2KAIB 1UCYH 4HI3A 3M36A 3GDSA 3ZVCA 1A3EH 4TWWA 1BBRH 1A61H 2ANYA 3P8NA 1HAIH 4YT7H 1FIWA 4YOJA 7LPRA 1C5QA 3OTJE 1BRBE 3AW1A 4FUCA 1OOKB 4INLA 3A88A 3QUMP 1SQOA 2FOGA 4ZAEA 4WXVA 1EATA 2BD2A 4GPGA 5GIBA 5JPMH 2ANWA 1OWJA 4U32A 2BM2A 3DFLA 5HMAA 1ELDE 2D8WA 2Y81A 3HK3B 5T6FA 3ZZ6A 3TGKE 1D6WA 4I8LA 2VVUA 3C27B 5FX6A 3TH3H 4CBNA 3VXFH 1P3EA 1A5GH 4AB9A 3D49H 1E0FD 1AKSA 1P2IA 2VGCC 4ZKRU 1S84A 2Z9KA 4YZUA 1MMJN 3SJOA 3MMGA 5EXMA 4D8NA 2YNBA 3A82A 3HPTB 3SORA 2BDAA 3LGYA 4O97A 3BG4B 4Y79A 8KME2 1C5RA 4OGYA 4NSVA 2DE9A 3G01A 4O03A 2XW9A 3SQEE 1DS2E 4IN2A 2SNWA 2ZCKP 1BIOA 1QBOA 1W2KH 1MAYA 1NY22 1S81A 1VCWA 1NU7B 1C1PA 4NFFA 1BMNH 1PPGE 1C2GA 2XBVA 2CJIA 3AASA 2BVSH 3A8CA 4ZROA 3F9FA 1T4VH 3IITA 1CHOG 2JH6D 1MTNB 2GV7A 5F8TA 3LGVA 5GPIB 1BRCE 1MTSA 3SNAA 1PYTC 1J9CH 2VNTA 1P0SH 4XDEA 1ELVA 3SV7A 2LNCA 3OX7U 2VIVA 4I8KA 3UNSA 2BDBA 5HM2A 2BQ6B 2R0KA 1S0RA 4CR5A 1H9IE 3OYPA 1MBMA 4R8TB 1C1MA 2Z3EA 4A1TA 2XBXA 3RXFA 1BMAA 2Q6DA 1RXPA 2BLQA 1YC0A 5FBIA 1Y3WA 2G4UA 4YOGA 1SQAA 3PLPA 2ZDKA 1ZZZA 4JCNA 1TAWA 3RM2H 3ODFA 2ZU4A 4H6TA 1GI3A 1K1JA 5JBBS 5C5NA 1RIWC 4NGAH 4ISOA 1QRWA 2CHAB 3KNXA 5AF9H 4MDSA 4AN7A 1P11E 3FZZA 2FI5E 3E90B 4KELA 1XKBC 1ZGIA 1O2PA 1QB9A 4A92A 3RU4E 4ZXXH 1VITF 5FX5A 1DX5M 2Z94A 2WINI 4F49A 1INCA 4NWLA 1GHAF 2W7UA 2GP9B 1TGTA 2EI8A 2PHBA 3MU5A 1GJ8B 2FOAA 4ZMAH 3I29A 2WPMS 4UFGH 4D7GA 2ZDLA 1EAWA 5T6DA 4AGJA 4GHQA 1KIGH 4ABGA 2ZC9H 2ZP0H 1QR3E 1SR5C 1TALA 1CT2E 1QRZA 1EOLA 9LPRA 1D6RA 1VZQH 2GD4B 2BZ6H 4K60A 2VIQA 1NTPA 1J14A 1PPEE 4CRFA 1C1TA 3TK9A 1SHYA 1K28D 2FM2A 1UTNA 5CHAB 5EOKA 1PQ5A 3MFJA 1O37A 1OP8A 1PFXC 3E8LA 3LH3A 4ZHMU 2J94A 1YCPK 4AORA 4BAKB 1SGFA 3UNRA 3SUFA 2SGEE 1O34A 1H4WA 1UCYE 2J4IA 1HXFH 2QF0A 2QC2A 1EZXC 4NZLA 1TMUH 1LVOA 2FOFA 1S5SA 2PR3A 2ZHWH 1SLWB 2ZZUH 1SGQE 2AGIX 1QA7A 2BDYA 1V2TT 3EDXB 2BY7X 2ZGCA 1GHYH 2F9UA 2NU0E 3O8DA 4FXGH 4NWKA 1O2VA 2CN0H 1C2HA 1YCPM 4TWYA 3SU5A 1YYY1 2PFEA 2ZPQA 4MVNA 4FUDA 1C9TA 1TGCA 1AB9C 2FOCA 4CH2B 3VB4A 1JRTA 3TJUA 4X2WA 4ZUHA 4AOQA 1AUTC 3GCHB 3ZVEA 3I78A 1LKAA 3TIUA 3QK1A 2ZHQH 4D9QA 1YLDA 3KEEA 4JZFH 2GCTC 1O33A 4K1EA 1GL0E 1MU6B 1GBIA 1XXFA 4Q7XA 2EA3A 1EB2A 3BIVH 1X7AC 3A7VA 3SV6A 1AE8H 1KTSB 1T7CA 1PPCE 3EQ0H 1AKSB 5A0BA 2AFQB 5F6MA 1C2FA 4NA8A 4K2YA 1GBTA 3CS0A 1BTYA 3LONA 4ZH8A 2BX3A 4X0WU 3A7ZA 3LIWA