1Y3YA

Trypsin inhibitor complex
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Trypsin, cationic
publication title A simple protocol to estimate differences in protein binding affinity for enantiomers without prior resolution of racemates.
pubmed doi rcsb
molecule tags Hydrolase
total genus 58
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2004-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1y3yA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1y3yA02
5LH8A 3GY8A 1QCPA 3LJJA 1FUJA 3M5OA 3RXPA 1ABIH 1P8VC 4Y10E 1TNIA 1A7SA 4LK4A 1XUIA 5B6OA 3PMHB 2ZHDA 5HXFA 1GI8B 1TX7A 2GZ7A 2J34A 3GY4A 4ABBA 3PMAB 2R3UA 5ABWA 1CT0E 3QZQA 1A1RA 1BZXE 5FPYA 3H7OA 3RLYH 2GP9B 3SNEA 3BV9B 1C2DA 3RXFA 3UPEA 2F9VA 1HB0B 4DG4A 2TRMA 1GMHF 4D9QA 1QBVH 1ANDA 1O2HA 4CR5A 1G3DA 2Q6FA 4ZXYH 1SLXB 2G51A 3M35A 3NWUA 5EQQA 3SJOA 4CH8B 1GCDA 1O37A 2PKSC 1RXPA 3UFAA 2GZ8A 4NZQA 6ESTA 2I6SA 1WBGB 3ZZ5A 3GY5A 1AUTC 2BD9A 2Z6BD 3KHVA 5T6FA 3ATMA 1TRYA 2D26C 2Y80A 4R0IA 1ESAA 5DP7A 3BF6H 1GVZA 1T31A 4M7GA 2AIQA 1FY8E 3T27A 1AN1E 3L33A 1CE5A 3GCOA 2W5EA 1ELBA 1ELCA 4NA7A 4SGAE 4X1PU 2NU2E 4DW2U 5JDUB 4JMYA 1C1TA 5GDSH 3FFGA 1TBRH 1KTTB 4FUEA 1GBTA 1V2MT 2O8LA 3KL6A 1A2CH 1XKBC 3TJNA 2BY7X 1ZTJA 1P3EA 1O2MA 2ZPSA 4LXBH 1EP5A 3SU1A 3UTUH 2UUYA 5TCCA 1HCGA 1PQ7A 3NZIA 1A5IA 1OP0A 1TX6A 4WJG2 3RXLA 4AGKA 1TYNA 2SGQE 5CE1A 1O5BB 2A5AA 1SI5H 2FO9A 4ISHH 3RC5A 3RM0H 4BOHA 1UVUH 1NFUA 2GMTC 5A09A 3V3MA 3L6PA 1UHBB 2BD3A 2H9HA 3S9BA 1W7GH 4GLYA 1QB1A 1XXFA 2CN0H 2A5IA 4Z0KA 3VB4A 1NRNH 3RDZA 3AAVA 4AX9H 1DUEA 1EJMA 4GUXA 3RC6A 2BX4A 3I78A 5C5OA 5DP9A 2BLWA 1ZMJA 2H5CA 4KELA 1IQEA 2J92A 5DP3A 1P2KA 1ZPCA 1K1JA 1D6RA 1SFQB 2UWLA 1A0JA 4X6MA 1SLWB 1C5YB 2F9PA 1UVPA 4VGCB 1HJ9A 3MU8A 1HYLA 1V2LT 2VVUA 3SU5A 3QTVH 1O3IA 1WQVH 1O3LA 3SV2H 2G8TA 1ZRKA 1G9IE 5F8ZA 3P6ZB 1O3CA 4SGBE 4UONA 3ZZDA 3VB7A 1C1MA 1E0FD 1MH0A 2ZU1A 2HPPH 4B76A 4UFFH 1C1UH 1BRBE 1QQUA 3SI3H 3TGJE 3BTDE 1EZQA 1S85A 1O3NA 4K69A 2VWLA 2GCHG 4HZHA 1CO7E 1GJ7B 2QF0A 2BB4A 2XRCA 2WPHS 3TK5A 1Z1IA 1EAXA 1W10U 2FOMB 2QXHA 1UCYH 2VGCC 3GCHC 2XBWA 2FOGA 1GHBG 1GHZA 2H5DA 3H5CB 1MD7A 3RXJA 1GBJA 3SZNA 1OPHB 1S6FA 3URDA 3E90B 1QRXA 2ZGCA 1ELDE 3TH4H 2JH0D 1GI3A 4ZKRU 2J94A 2PW8H 2VIDA 3S7HB 4A1XA 1BITA 1IQJA 1H8IH 1CGIE 1GI1A 3RXEA 1HXFH 2ZQ1A 1O3EA 2A45B 1GI6A 3U69H 1ZYOA 2H2ZA 2ZQ2A 1KXFA 1RIWB 1RTKA 2FI5E 3S69A 4O3UA 1FLEE 1TPPA 2W3KA 3LT3A 1DDJA 3SW2B 1F5RA 4WWYA 1P2IA 3DA9B 4OGYA 1IQHA 1LO6A 4IN1A 1WUNH 4XDEA 3BEUA 2NU3E 1C5WB 2QXIA 1SC8U 1LVMA 2OQ5A 3BEFB 3GYLB 1OWDA 1LPKB 3SU3A 1YCPH 3U8OH 5A8YA 1L4DA 2XYAA 1L1NA 1QHRB 4Y71A 1RTLA 3PB1E 1P2OA 2ZP0H 4ZH8A 3T5FH 2BY8X 2WUBA 5HGGA 4TYDA 2Y5FA 1IQKA 2BM2A 3A7WA 3NXPA 1KLTA 1ZPBA 1MKWK 2WPLS 5JBTA 4WH8A 1BTYA 1QIXB 1V2JT 1SHYA 3MO6A 3NKKA 3TJUA 4AB9A 1C2EA 1HJ8A 1ZHRA 1UMAH 4FVDA 3BTME 5AVDA 1DVAH 2Y5HA 1WTGH 2IJOB 1V2VT 2F9UA 1GGDC 1MUEB 1ZLRA 1C1NA 4GCHG 4K1TA 5CMXH 2O9QA 1CGHA 1QBNA 1BIOA 2ULLA 2GCTC 4WMDA 1P3CA 1KSNA 2VWOA 2FX4A 4VGCC 1GMCG 2BDAA 4PROA 1GVKB 1SOTA 4XE4A 1IQLA 5J4QA 1O5GH 3A7ZA 1XUHA 1FPCH 4JK5A 3Q3KA 4KKDA 1ANEA 1K22H 1PPBH 2Z3DA 4JCNA 2TGTA 1ELAA 4I8JA 2BY9X 3DT0H 1TALA 1C2IA 1L1JA 1O3JA 1AB9B 2ODQA 2DE9A 3T29A 1O5CB 4B74A 1L0ZA 3A8AA 2PKAB 3MNSA 3GISB 1LQDB 4MPVA 2XCFA 2BX3A 4O03A 5A8ZA 1O3PB 3MI4A 2BQ7B 2BY5X 1Z1JA 1A0HB 3T25A 1GDNA 3ODFA 1F0TA 1O38A 1DWBH 4WH6A 1Z8IB 3B8JA 2GVFA 3QN7A 3RU4E 3SNCA 4Y7AA 1Y3VA 1O2YA 3CENA 2GCHF 1BRUP 2OCVB 4F4OC 4Y7BA 4NWKA 4U30A 1GJ6A 1CSOE 2BDHA 4MNVA 1DICA 4B2CA 2A0QB 1LMWB 1TQ0B 2DE8A 1C5VA 1HDTH 1SGYE 3LGVA 2FEQH 2F91A 1LPGB 2BMGB 4FUJA 1F5KU 2OC1A 1MKXH 4O97A 1EATA 1O2PA 1O3FA 5GCHF 4IMQA 2BY6X 2FOBA 4Y8ZA 2AGGX 1O3BA 3KQCA 4FU9A 3JZ1B 3SU4A 4D8NA 3P8OA 3PYHA 2UUJB 5EU8A 3NCLA 1F0SA 1C2GA 3UNSA 2BDYA 1FDPA 1LHDH 1XXDA 3UQOA 2VWNA 1WSSH 3ELAH 1CU1A 1BJVA 1O2TA 1NFXA 6CHAB 5FBIA 2FX6A 1O5DH 4ZROA 1YPHC 2FESH 2P8OC 2W26A 3VB3A 1YP9A 1BMMH 1G3BA 1OYQA 1NRRH 4JZ1A 1C4U2 1S6HA 3BIVH 4YTAA 1DXPA 1C5ZB 1N1LA 3RM2H 3C1KA 3TGIE 1NROH 2ZDKA 1V2WT 3NUMA 4IS5A 3DFJA 3FANA 3PLKA 1VGCC 4DJZB 1RTFB 3SU0A 1GI0A 1K1MA 1ZJKA 1GJ5H 1W12U 4GHTA 3TK9A 3TNTA 1BBRK 1VJAU 3BIUH 3D62A 1T32A 1O3KA 3RMMH 1A46H 4NA9H 5TCAA 4CRDA 4DIIH 1AVGH 3E16B 2AFQB 3M5NA 3ZZBA 1HXEH 3SGBE 1ELFA 1G3EA 4BXSA 4AN7A 1ELEE 1G30B 5T3HA 1TNHA 1L1GA 2ZDNA 1OP2A 1FJSA 2BOHB 5JB9S 2ZHWH 1W13U 2G55A 3M7QA 1BQYA 4UFGH 3QUMP 1LKBA 1DOJA 1QRZA 2CMYA 4ZHAA 2ZFSA 4J1YA 3H7TA 1A5GH 4YOJA 1UTJA 1AKSA 2A5KA 5EODA 1EZSC 3VGCC 2P3FH 4GPGA 1UO6A 3KN2A 1TGBA 4E05H 4Y11E 1QGFA 2ALPA 5DG6A 5DP5A 3UOPA 2ANKH 3KEEA 1HLTH 4I8GA 5DK1A 1P9UA 1SGTA 4NA8A 1SQAA 4X6OA 1GCTC 2Z7FE 3A87A 2OLGA 4YZUA 1F5LA 5AFYH 1O2LA 3HKIB 1C2HA 1FY4A 4K8YA 1MAXA 2QN5T 1IQMA 4BAMB 2HGTH 5EPYA 2ZHFH 2AEIH 3RXOA 3R0FA 1PFXC 2WV5A 3SU6A 1K28D 1Z6JH 2O8WA 1LHFH 1JIMA 2BD4A 1TPSA 3A8CA 2D8WA 2FS8A 4JYVH 1BTUA 4ISOA 2VB0A 1B0FA 1ETSH 2THFB 2OINA 3LJOA 1O2NA 4WXVA 2ZKSA 3U1IB 1ELGA 1OS8A 1VCQA 1HAPH 2F3CE 1THSH 1MZDA 1QBOA 3M7TA 2OQUA 4NIWA 5A2MH 1B0EA 1ABJH 3Q00A 2ZF0H 1GJBB 1TFXA 1Z7KA 3S9CA 3MOCA 4CR9A 8KME2 1NM6A 4X1QU 1PQ8A 3MU0A 4MNYA 1C2MA 2BLQA 2QY0B 1OX1A 4Q7XA 4TWWA 2Z9JA 1T8NA 2BQ6B 5C3NA 2O8UA 4DURA 1SVPA 1TWXB 5E0JA 4AOQA 2F9OA 2P16A 3SJKA 1Y3YA 1ELTA 3ZZ3A 2A7JA 3K6ZA 4OS7A 4K1EA 1OOKB 2FOCA 2B0FA 4E7RG 4ESTE 4DCDA 1W14U 3SI4H 6CHAC 2FOHA 1FY5A 1PPFE 1FN6A 2ESTE 1KIGH 1G37A 4XFQA 2XBXA 1YYY1 2WPMS 1TLDA 1KDQA 5JBAS 3BTQE 3E1XB 4JYTA 3CP7A 3F1SB 3FVFB 3A8DA 3PROA 5EG4A 4X8TH 1OKXA 3RXRA 2XBYA 1TAWA 4BTUB 3GICB 1O2QA 3LGWA 4AZ2B 1NRQH 1QQ4A 2BDGA 4B75A 1SLUB 2HPQH 1S0RA 3LONA 1BRCE 5I46H 2XWBI 1FNIA 1XKAC 4FUFA 1X7AC 1C2LA 2BVXH 1CQQA 2W3IA 2PR3A 1O2IA 3MO3A 1P9SA 2VIVA 1BUIA 1MZAA 3QLPH 1TNLA 2NU0E 2ZI2H 2SGEE 5FCRA 4YLUA 5CHAB 4LZ4B 1ZTLA 1H9LB 3EQ0H 4GSOA 1YPLH 1K1PA 1S81A 3A89A 2ZDMA 3ITIA 4A92A 1C1RA 3K2UA 4XBBA 5GXPA 3LPRA 1SSXA 2ZZUH 3ZZ4A 1HPGA 1C2KA 2V3OH 4AYVB 3ZZ9A 1KXAA 2P3UB 4KTCA 3TJVA 3BTTE 3EAJA 1QL7A 1O39A 2Q1JA 1BTXA 1T8OA 3QZRA 1YPMH 1QJ7B 2BYAX 3PTNA 2CHAB 3A7XA 4JK6A 4UE7H 1NN6A 3TPIZ 3QGNB 1E37B 3LOXA 5K7RA 3PWCA 5EQRA 3GDUA 4RSPA 3D49H 4CHAC 2ZCKP 2O8MA 1DX5M 5DO4H 1HAHH 1O5EH 5HM9A 3BTEE 2XNIA 3MMGA 4CRAA 1K9OE 1ANBA 2FPZA 3MU4A 3A86A 5A0BA 4ISIH 3SOSA 2ZNKH 1MTNB 3KCGH 1GG6C 1BMLA 3SHCH 5GJ4B 2VVVA 3ZYDA 4FU7A 4I8LA 1SGNE 2JETB 1F92A 2BVSH 1EKBB 2R2MB 1NS3A 4JYUH 2FP7B 1HJAC 5ETXA 3PLBA 1CHOF 3TNSA 2OXSA 4K1SA 1HIAA 4Y0ZE 1P12E 3OY5U 2P95A 3P17H 3M3VA 1TGNA 1GBKA 3BG4B 2H6MA 2AMPA 2DUCA 1O30A 4Y6DA 2G5VA 9LPRA 4AB8A 2ZGXH 1Y8TA 2Y7XA 2ZHQH 3RXVA 1JBUH 3ZVGA 2PUXB 2FIRH 3D65E 2P93A 3RXHA 1GJ9B 1MTSA 4JZEH 1LPZB 1P57B 3SGAE 4X1RU 3IWMA 3L3TA 4TY7A 4X1NU 3UQVA 1AE5A 3RXMA 2Q6DA 1FAXA 4ZUHA 7GCHG 1C2FA 1Z6EA 2D1JA 4IW4E 3UR9A 1P01A 3ENSB 1BJUA 4YO9A 2ZPRA 3VXFH 1A5HA 3A88A 1GBIA 1E38B 1CA0C 1ESBA 4UEHH 1GPZA 4OS2A 4X6PA 1HFDA 3A84A 2ZEBA 1GVLA 3ZVBA 2VINA 4OGXA 1AMHA 1OWHA 4NCYA 2GTBA 2CJIA 4BNRA 4CRFA 8GCHF 3GCNA 1V6DA 3PLPA 3P8FA 3FP7E 1WU1A 1ZPZA 2ZGBH 1TGSZ 1K1IA 2A2XH 1SQOA 1DPOA 2K1QA 3URCA 3F9HA 4AFUA 1EXFA 4HGCA 4I7YH 1PPHE 4CRGA 1KY9A 3UWJH 3ZZ6A 2H9TH 4O3TA 1LTOA 1THPB 1SGQE 5EXMA 4AG2A 2C8YB 3VEQB 1ZRBA 1O3AA 5LPEA 1JXPA 1HRTH 1O2SA 3A83A 1F7ZA 4WF8A 1BTZA 4INLA 1W3CA 3CS0A 1XM1A 2Z94A 3BTGE 1C5XB 1TONA 1ZZZA 5CHAC 2Z9LA 3SN8A 2WYJA 4E06H 3MU1A 2B7DH 3SUDA 1BMNH 2G5NA 5T6GA 1EOLA 1C4Y2 3KQBA 3BTWE 4MTBA 2OTVA 1AU8A 3TJOA 2C3SA 1VITG 3TIUA 2BLVA 1HAVA 5JB8S 1WAYB 1W8BH 2SGDE 4NGAH 3RP2A 1PQAA 3SNAA 4AGJA 2QCYA 1K2I1 4BAKB 4I33A 2OUAA 1OXGA 4HTCH 4IMZA 1QL9A 2YNBA 4X8VH 2TBSA 5C20A 1QRWA 2GV7A 3V7TA 1W7XH 3SJIA 2ZG0H 2SGAA 2YNAA 1MTNC 1N6YA 1SOZA 1GHYH 1A3EH 1GBMA 2WPKS 2BD2A 1XVMA 2A2QH 3ATKA 1Z8JB 4BTTB 1C1OA 3V0XA 4TWYA 3EDXB 1ACBE 1C5MD 1GWAA 4FUHA 2PTCE 1TA6A 2GD4B 3N7OA 1O5FH 3RC4A 2BXTH 5FAHA 3GCTG 1VITH 1G3CA 2BTCE 3E3TA 2ZO3H 1GJAB 2ZTXA 5GIBA 5K0HA 1MMJN 1TABE 3MO9A 2A4RA 1FAKH 1EPTB 1GBDA 3BG4C 1C1PA 4FVBA 3MYWA 4IBLH 2FXRA 2AGIX 2J4IA 1LQEA 1C5UA 4UFDH 6GCHG 4NIVA 3WY8A 4A6LA 1GJ8B 1C5PA 1TA2A 1ZMNA 3EA9A 1A4WH 1SGFG 3SV6A 2WINI 2HNTC 2FLBH 3MH6A 5C5NA 4IC5A 3RMNH 3UY9A 4A5TS 1C1QA 1UTMA 5E0HA 2CXVA 3VB6A 2VWMA 5F8TA 5EW2H 1C5RA 2A32A 1EASA 3EE0B 3RXGA 3E0PB 3SUEA 1QFKH 4LZ1H 3P8NA 1Q3XA 3A81A 2VIOA 1AD8H 2OP9A 3ZZCA 1YKTA 5E2PA 1GBEA 5FBEA 3VFEA 1F0UA 3ODDA 1GDQA 1H9IE 1HAYB 2SNWA 4QT8C 2CGAA 2QAAA 3HKJB 3UWIA 1DLKB 3OU0A 2PV9B 1BHXF 3SO3A 1L2EA 4B2BA 1CT4E 1NRSH 4MPWA 2RDLA 1TNGA 1NT1A 1XUJA 1HAOH 3A7YA 2Z9IA 2SGPE 4I32A 5FPSA 3RMLH 2XWAA 4ABIA 3DD2H 1H1BA 1C1VH 2TPIZ 1D6WA 2ANMH 1EZXC 4YM9A 1DY8A 3EGKH 3UNRA 4RKJB 2VJ1A 1P2QA 2GKVE 1IQIA 1MQ6A 1NFWA 1BB0B 3UOUA 1UTLM 2PWXA 4X2XA 5GPIB 1XX9A 2XW9A 3MNBA 5A0AE 1GHBF 1VCWA 1P2JA 5JBBS 1KXDA 4KTUA 4Y0YE 1VJ9U 1W0ZU 1RIWC 2IPHA 1Q31A 2RCEA 1G32B 2EI6A 1ID5H 2ZWLH 1GI9B 4U2WA 2AYWA 2LPRA 5AHGH 1NRPH 4MQAA 4A7IB 2JKHA 3RXIA 1MCTA 2ASUB 5FX6A 1GL1A 1RFNA 5PTPA 2OD3B 1AFQB 1JIRA 4YT7H 1O2GH 1GL0E 4XBCA 5F8XA 4AFSA 1HUTH 3DHKH 3QK1A 1MKWH 1BMAA 2FI4E 2CF8H 1TOMH 2ZFTA 1VCPA 1OSSA 1O33A 2EA3A 1EUFA 3TVJB 1BA8B 2V35A 4AYYB 1AWFH 3LIWA 2ILNA 4CBNA 2A7CA 3AAUA 2XC4A 2IOTA 1GMDG 2BOKA 5FPTA 1WCZA 5IYTA 5A8XA 2XBVA 4R8TB 1O3HA 4ZHLU 5H4IB 1P06A 2QXGA 3AVZA 3E8LA 2HLCA 2G00A 2FTMA 3B23B 4OS4A 1MTUA 3GY7A 1GMHG 2KAIB 3RU4T 3VB5A 1FIWA 1TRMA 1GHWH 4Y76A 1NC6A 1EPTC 1TMTH 4Q80A 2FZZA 1AZ8A 1V3XA 1J16A 3DFLA 1B7XB 3UNQA 1CHGA 2OBOA 1HBTH 1IQNA 1SPJA 3ATWA 5AF9H 1C5LH 4B71A 1LHCH 1AVXA 1YGCH 3GCTF 4GHQA 3HK3B 3ZZ7A 1TNKA 1YF4A 1FIZA 3ESTA 2ANWA 2PGBB 3C27B 2M5TA 1GDUA 2PUQH 1WV7H 1SGDE 1P10A 2PKSB 4GCHF 3O8CA 1O2ZA 4KTSA 1ZSJA 2FYRA 4NG9H 1T7CA 1UTOA 4A1TA 4MVNA 1HAGE 1GMCF 2ZU5A 1AQ7A 2BDCA 2GX4A 5SGAE 1ZTKA 2V0BA 3RXUA 2GDDA 1AFEH 1BTWA 1O2WA 3MU5A 1AB9C 5C2ZA 3PV4A 1KLIH 4X2YA 5LGOA 4MNWA 1WQSA 3ZVFA 4FXGH 1ORFA 3IG6B 4D7GA 1OP8A 1XUGA 2QV1A 1T8MA 3SV9A 4DY7B 5ESBA 4ISNA 3F6UH 2W7SA 3SV7A 3Q3YA 1SLVB 3SUFA 2GZ9A 4HI3A 1SGRE 2R2WU 1Z8RA 1O3OA 1XMNB 3EA7A 3GOVB 1V2OT 1LVBA 2ZCHP 1O3DA 1SFIA 2AS9A 3PM3A 1ZGIA 3ZV8A 2FS9A 4K3JA 1BBRE 3HGNA 2QXJA 4X8UH 1GBFA 3PMJA 3MTYA 3MWIU 2V6NA 1P11E 5C1XA 1LDTT 1UK3A 1UTPA 1V2UT 3QWCH 1GHXH 3NK8A 2A31A 1ZSKA 1O2RA 3SUGA 1TBQH 1UHBA 2XTTB 3AW1A 1FPHH 4TPYA 4FUDA 4TY6A 1O0DH 1XVOA 1SGCA 5HMAA 3UIRA 1OWEA 1SBWA 1LCYA 1G2MA 4OS1A 4WVPE 1KLJH 4INHA 3K6YA 4H6SB 5TJXA 3ATLA 2XXLA 3LH1A 1AFQC 1O2VA 1O5AB 1QB6A 3O8RA 1HV7A 2AGEX 3ZV9A 4XSKU 1IQFA 1EAUA 2ZGHA 4I8HA 1B5GH 2V3HH 3U1JB 4FUCA 1DT2A 2C4FH 3LGYA 3I29A 1J8AA 1WYKA 1BBRH 5LPFA 1NO9H 3T26A 3E0NB 2R0KA 1BDAA 8ESTE 3P70B 1XUKA 2ANYA 3LGUA 2EC9H 1SHHB 3P92A 3TITA 7ESTE 3KGPA 1AO5A 3IITA 5EXNA 4Y8YA 2JH6D 2AIPA 1JWTA 1FMGA 1HAIH 3SU2A 3NPSA 4H42U 1QJ1B 1DFPA 3FP6E 2TGDA 2ZCLP 2ZU3A 1D3PB 4KP0A 1QL8A 4K2YA 3BG8A 1AGJA 4Z6AH 1DANH 3RXAA 1Y59T 1LHEH 1GBCA 1Y3WA 2RA0A 2ZFPH 1DY9A 1UVOA 2QGRA 2FMJA 1GMDF 1P05A 2OBQA 4MPUA 1TE0A 2QA9E 1EOJA 4RN6A 2VGCB 3GCHB 4YESB 1V2ST 1AE8H 4Y79A 3SBKA 1C5OH 3GY3A 4X0WU 5JPMH 4GAWA 1G2LA 9ESTA 5G4BA 1V2RT 1C5NH 4MG3A 1TGCA 3A80A 1PPZA 1GJ4H 1AKSB 1BOQA 3LC3A 3PWBA 2WV4A 1J17T 1GI7B 2C93B 3LGIA 1P04A 4AG1A 2STBE 2ZFQH 1FV9A 2P3TB 2FLRH 3MFJA 3FAOA 3BEIB 1NU7B 2FTLE 4X6NA 1ARCA 1KXCA 2ZA5A 4NFFA 1UCYK 5C67A 1NU9A 3MH5A 1RS0A 1Y5AT 1O35A 3SV8A 1PPCE 5DJ7A 4NIYA 1LVOA 5DP4A 1GBBA 4K8BA 3P8GA 4B73A 1Y5BT 1K1LA 3KNXA 4FUIA 4BAOB 1DITH 4J2YB 1O34A 5T6DA 4U32A 3A85A 3RXBA 3M7UA 1JRTA 1PJPA 1S82A 2ZIQH 1E35B 1TOCB 2FOAA 1DSTA 2BVRH 1MBMA 1TNJA 3T28A 3RLWH 4YOGA 5L6NH 1YPEH 1GI5A 1P2MA 1N8OB 1SL3A 1THRH 1BT7A 3OTJE 1NPMA 3FZZA 2FOEA 1PQ5A 1MAYA 3GY6A 2FYQA 2GT7A 3QDZB 4ABGA 4DGJA 3AW0A 2ZDLA 3F9EA 1W11U 2RG3A 2Z9GA 1Z71A 4F49A 3RXCA 3HK6B 2BD7A 1NZQH 3RXDA 1YCPK 2ZC9H 3BTKE 1YPHE 1ZSLA 3BSQA 1L4ZA 2OC7A 3M3SA 2VH6A 3G01A 3OX7U 5DKMA 3P95A 3SHAH 1D4PB 1GGDB 5GWZA 2EI8A 1GHVH 2UUKB 4INKA 1EPTA 4FU8A 1FY3A 1U6QA 1Z8GA 2SFAA 2VVCA 3ZVDA 3MH4A 1UCYE 3LKWA 4BAQB 5A0CA 5EGMA 2GCTB 1YC0A 4THNH 2TGPZ 3RXSA 2VIQA 1K21H 1C9TA 1SGPE 5DP6A 1DXWA 1SQTA 1SG8B 4YT6H 1ETRH 1M9UA 2FI3E 2FODA 1KDQB 2J95A 3FZDA 2W7UA 1C5QA 4ABAA 1FI8A 1QJ6B 3M5MA 3BTHE 3I77A 1LHGH 3TLOA 4K60A 2BLOA 2H1UA 1RD3B 4CREA 2XC0A 3QX5H 3SQEE 7KMEH 2ZU4A 2FOFA 1BRAA 1DLEA 1MU8B 2HNTF 2R3YA 4CRBA 4UFEH 3RUOA 2PKAA 1WOFA 4MPXA 1C5TA 4H6TA 1UTQA 1CA8B 4D76A 1TMUH 2J2UA 5EOKA 1EB2A 2C8WB 1AWHB 2HWLB 1TQ7B 1INCA 4I8KA 1ZOMA 1AVWA 4H4FA 2F83A 2BDBA 5GCHG 2PLXA 1O2JA 4ZKSU 1DE7H 1QURH 3Q3XA 1IOEA 1HNEE 2FDAA 2JH5D 2UUFB 3RXTA 2QF3A 2PSYA 4X2WA 3OSYA 4LOYH 1EAIA 4X2VA 4Q2KA 3RMOH 1O3GA 2F9BH 2VIPA 1SMFE 3DUXH 3PO1B 2CHAC 1W0YH 2VNTA 4XOJA 3LH3A 4BAHB 2Q6GA 3QO6A 4D9RA 2VH0A 1SGIB 1KYNA 1V2KT 3EA8A 1SGEE 3SORA 1GI2A 2PGQB 1XUFA 1ETTH 3TGKE 2PFEA 2BQWB 4AORA 2ZU2A 5FHTA 1D3DB 2Y5GA 2H9EH 1MKXK 1YBWA 3D23A 2NU4E 2XC5A 2JETC 4I31A 4K5ZA 5DP8A 3R3GB 3KQEA 2P8OB 5EQSA 3T2NA 1GBLA 2G4UA 1H9HE 4UD9H 3U8RH 4D7FA 5L30H 1HIAB 2IN2A 3M61U 3SJ8A 2C8ZB 3RU4D 1UTKA 1N8OC 2WPJS 1GHAG 5L2ZH 3FP8E 2A4OA 3M5LA 3PTBA 3TH2H 1O2KA 1PYTC 1NY22 2GT8A 3ATIA 3F68H 1DSUA 1CBWB 3OYPA 4UDWH 1VGCB 2AMQA 1EX3A 3K65B 1FXYA 1YM0A 3LDXH 2AMDA 4AFQA 1QB9A 3SNBA 1S83A 1TX8A 2PSXA 1PPEE 1SGFA 3KQDA 5E2OA 1CGJE 4ASHA 2BHGA 3T62A 1P09A 2SNVA 1DWDH 1YPGH 3HATH 1GJDB 2ZFRH 3W95A 2B9LA 2KAIA 2ZECA 2P59A 3Q76A 4YOIA 3RXKA 2TIOA 1ESTA 3M36A 2ODYB 1OWJA 4KGAA 1BHXB 3SJ9A 1P0SH 2Y82A 1UK2A 3ZVAA 1DWEH 4MLFB 2Y7ZA 5I25A 3BN9A 1BCUH 1CVWH 1Q2WA 2VIWA 3TK6A 5F6MA 2QYIA 3S0NA 2D2DA 3VGCB 2NU1E 1C4V2 4TPIZ 1C1WH 3STJA 3VPKA 2Z3EA 1RRKA 7LPRA 1EZUC 1GI4A 1QR3E 5LPRA 3S7KB 1AZZA 3TH3H 4DOQA 1D3QB 7GCHF 5JYIA 1LVYA 2UWOA 4CH2B 2BZAA 2ZTYA 1EB1H 1GCTB 1T8LA 4NWLA 4NIXA 1O3MA 2A1DB 5L2YH 2HRVA 2STAE 4OS6A 3U8TH 4XBDA 1VZQH 1KTSB 1S84A 3K9XB 1TGTA 4DT7B 3MHWU 4JZIA 5DGJA 1T4VH 2A4QA 3V13A 3F9GA 5EPNA 5EW1H 1F2SE 1E34B 1UVSH 1AY6H 1EJNA 3QGJA 4CRCA 1P2NA 1QY6A 4BANB 2R0LA 4DVAU 2BD8A 2ALVA 1YPKH 2FWWA 4AFZA 2J38A 1C9PA 1VR1H 5JBCS 2EEKA 4X8SH 5HM2A 1UVTH 1DWCH 1ELVA 4WY3A 2BDIA 4ABDA 3O8DA 4NSVA 4NSYA 2C8XB 1K1OA 1HAZB 1OYTH 2PHBA 3E91A 1GBAA 2ODPA 2ZHEH 3HGPA 1UTNA 1HAVB 1J9CH 1ZHMA 2ZDVH 5C1UA 1ANCA 1NESE 4E7NA 2Z9KA 4NZLA 3V12A 5DPAA 1UK4A 4A1VA 2EI7A 4ABJA 1AUJA 3PO1C 1EAWA 4WMFA 1MQ5A 1Y3UA 2B5TB 4U01A 1TBZH 3GYMA 1V2QT 1MBQA 1QA0A 1IHTH 2ZGJA 3A8BA 3PMBB 3S9AA 5EXLA 2GV6A 2QIQA 1VITF 5IDKA 1PPGE 1FY1A 1V2PT 3MNCA 1D9IA 4NFEA 1G36A 3A7TA 2OC8A 1TB6H 4Y8XA 2ZTZA 6LPRA 2VU8E 1W2KH 1O2OA 1TRNA 1KXEA 2OC0A 3A82A 4FUGA 1QA7A 1MU6B 2QC2A 3KF2A 1AIXH 1V2NT 4WXIA 3ZVEA 1O2UA 4BTIB 1MD8A 1ZR0A 2YOLA 4RKOB 5E0GA 1HAXB 3MNXA 4OS5A 1JRSA 2UWPA 5F03A 2F9NA 1YLCA 3E6PH 4JZFH 2WUCA 2B8OH 1DM4B 1RGQA 5HYOA 1CBWC 1IHSH 1ZHPA 4FUBA 3STIA 1E36B 4X1SU 1H4WA 1H8DH 2CF9H 4IN2A 1MTWA 3GDSA 2G4TA 1GHAF 2A7HA 4IC6A 1ZMLA 1O36A 4ZKNU 5BPEA 1AI8H 1YCPM 3O8BA 1OWKA 5BRRE 1T4UH 1MCVA 2WPIS 2HALA 3UREA 4ABEA 1J14A 1D3TB 2A4GA 4B2AA 4ZAEA 6GCHF 2GGVB 1LKAA 1FONA 3LGTA 3A7VA 3HPTB 1PYTD 2BZ6H 1UJ1A 1A3BH 1BTPA 1CT2E 2R9PA 2Y81A 1ZJDA 1GBHA 4HFPB 3ZYEA 1IAUA 5FCKA 1BTHH 1N6XA 3ZVCA 1TPOA 3AASA 1TPAE 1FN8A 1DUAA 2HOBA 1YPJH 2CV3A 4CBOA 3M37A 4ABHA 1QNJA 2C90B 1TIOA 1O2XA 2RA3A 4ISLA 3Q77A 4YLQH 2O8TA 3CS7A 4BXWA 2J9NA 3M3TA 2LNCA 3VXEH 2WYGA 3W94A 4CHAB 4B1TA 2FM2A 4MDSA 5ESTE 1CHOG 4ABFA 1NFYA 3GDVA 2HVXA 4MNXA 1YLDA 3SGQE 1EQ9A 3RXQA 2XCNA 5C1YA 1RJXB 4O9VA 2BD5A 1GG6B 4IGDA 3U9AH 2GMTB 2I6QA 2Z3CA 3SNDA 3ZZAA 1S5SA 2Y6TA 3SQHE 3ZZ8A 3U98H 4ZKOU 3EYDA 1AHTH 1IQGA 1Y3XA 1HJAB 5FX5A 3B9FH 1A61H 1WTHD 1F0RA 4WMEA 1O32A 2PTNA 2G81E 1C1SA 1EJAA 4Q7YA 1SB1H 2ZFFH 3QTOH 3LU9B 1NTPA 3GY2A 1O31A 5FXLA 1S0QA 1J15A 2BXUH 2ZPQA 3MH7A 5E8EH 3TU7H 3LC5A 5AFZH 4JZDH 1DS2E 2GDEH 1FQ3A 1P03A 8LPRA 1JOUB 2TGAA 3JZ2B 2AERH 4DIHH 1P02A 1TMBH 1KXBA 2SGFE 1QTFA 3F9FA 4GVUA 5J4SA 2AH4X 2NWNA 3OY6U 1C5SA 3UUZA 3BTFE 1V2TT 2P94A 4Q7ZA 3UR6A 1ARBA 8GCHG 1HGTH 1ZGVA 1C2JA 1OWIA 1GJCB 2ZDAH 4ZMAH 1K1NA 1Y5UT 1SR5C 1EP6A 1FZZA 2G52A 4ZHMU 1JMOH 1CA0B 2HNTE 4ZXXH 1A0LA 1MTVA 3KIDU
chains in the Genus database with same CATH superfamily
5LH8A 3GY8A 1QCPA 3LJJA 1FUJA 3M5OA 3RXPA 3N7DA 1ABIH 1P8VC 4Y10E 1TNIA 1A7SA 4LK4A 1XUIA 5B6OA 3PMHB 2ZHDA 5HXFA 1GI8B 1TX7A 2GZ7A 2J34A 3GY4A 4ABBA 3PMAB 2R3UA 5ABWA 1CT0E 3QZQA 1A1RA 1BZXE 5FPYA 3H7OA 3RLYH 2GP9B 3SNEA 3BV9B 1C2DA 3RXFA 3UPEA 2F9VA 4B6FA 4B6EA 1HB0B 4DG4A 2TRMA 1GMHF 4D9QA 1QBVH 1ANDA 1O2HA 4CR5A 1G3DA 2Q6FA 4ZXYH 1SLXB 2G51A 3M35A 3NWUA 5EQQA 4YXWD 3SJOA 4CH8B 1GCDA 1O37A 2PKSC 1RXPA 3UFAA 2GZ8A 4NZQA 4XRNA 6ESTA 2I6SA 1WBGB 3ZZ5A 3GY5A 1AUTC 2BD9A 5EJLA 2Z6BD 3KHVA 5T6FA 3ATMA 1TRYA 2D26C 2Y80A 4R0IA 1ESAA 5DP7A 3BF6H 1GVZA 1T31A 4M7GA 2AIQA 1FY8E 3T27A 4TSFD 1AN1E 3L33A 1CE5A 3GCOA 2W5EA 1ELBA 1ELCA 4NA7A 4SGAE 4X1PU 2NU2E 4DW2U 5JDUB 4JMYA 1WXRA 1C1TA 5GDSH 2IJD1 3FFGA 1TBRH 1KTTB 4FUEA 1GBTA 4M9FA 1V2MT 2O8LA 1FX0B 3KL6A 1A2CH 1XKBC 2V7QD 3TJNA 2BY7X 1ZTJA 1P3EA 1O2MA 2ZPSA 4LXBH 1EP5A 3SU1A 3UTUH 2UUYA 5TCCA 1HCGA 1PQ7A 3NZIA 1A5IA 1OP0A 1TX6A 3KQ5A 4WJG2 3RXLA 4AGKA 1TYNA 2SGQE 5CE1A 1O5BB 2A5AA 1SI5H 2FO9A 4ISHH 3RC5A 3RM0H 4BOHA 1UVUH 1NFUA 2GMTC 5A09A 3V3MA 3L6PA 1UHBB 2BD3A 2H9HA 3S9BA 1W7GH 4GLYA 1QB1A 1XXFA 2CN0H 2A5IA 4Z0KA 3VB4A 1NRNH 2WZQA 1NBME 3RDZA 3AAVA 4AX9H 1DUEA 1EJMA 4GUXA 3RC6A 2BX4A 3I78A 5C5OA 5DP9A 2BLWA 1ZMJA 2H5CA 4KELA 1IQEA 2J92A 5DP3A 1P2KA 1ZPCA 1K1JA 1D6RA 1SFQB 2UWLA 1A0JA 4X6MA 1SLWB 1C5YB 2F9PA 2RFKC 1UVPA 4VGCB 1HJ9A 3MU8A 1HYLA 1V2LT 2VVUA 3SU5A 3QTVH 5F53A 1O3IA 5CHBA 1WQVH 1O3LA 3SV2H 2G8TA 1ZRKA 1G9IE 5F8ZA 3P6ZB 1O3CA 4SGBE 4UONA 3ZZDA 3VB7A 4DT4A 1C1MA 1E0FD 1MH0A 2ZU1A 2HPPH 4B76A 4F48B 4UFFH 1C1UH 1BRBE 1QQUA 3SI3H 3TGJE 3BTDE 1EZQA 1S85A 1O3NA 4K69A 2VWLA 2GCHG 4HZHA 1CO7E 1GJ7B 2QF0A 2BB4A 2XRCA 2WPHS 3TK5A 1Z1IA 1EAXA 1W10U 2FOMB 2QXHA 3OFND 1UCYH 2VGCC 3GCHC 2XBWA 2FOGA 1GHBG 1GHZA 2H5DA 3H5CB 1MD7A 3RXJA 1GBJA 3SZNA 1OPHB 1S6FA 3URDA 3E90B 1QRXA 2ZGCA 1ELDE 3TH4H 2JH0D 1GI3A 4ZKRU 2J94A 2PW8H 2VIDA 3S7HB 4A1XA 1BITA 1IQJA 1H8IH 1CGIE 1GI1A 3RXEA 1HXFH 2ZQ1A 1O3EA 2A45B 1GI6A 3U69H 1ZYOA 2H2ZA 2ZQ2A 1KXFA 1RIWB 1RTKA 2FI5E 3S69A 4O3UA 1FLEE 1TPPA 2W3KA 3LT3A 1DDJA 3SW2B 1F5RA 4WWYA 2VBCA 1P2IA 4TT3D 3DA9B 4OGYA 1IQHA 1LO6A 4IN1A 1WUNH 4XDEA 3BEUA 2NU3E 1C5WB 2QXIA 3PRBA 1SC8U 1LVMA 2OQ5A 3BEFB 3GYLB 1OWDA 1LPKB 3SU3A 1YCPH 3U8OH 5A8YA 1L4DA 2XYAA 1L1NA 1QHRB 4Y71A 1RTLA 3PB1E 1P2OA 2ZP0H 4ZH8A 3T5FH 2BY8X 2WUBA 5HGGA 4TYDA 2Y5FA 1IQKA 2BM2A 3A7WA 3NXPA 1KLTA 1ZPBA 1MKWK 2WPLS 5JBTA 4WH8A 1BTYA 1QIXB 1V2JT 1SHYA 3MO6A 3NKKA 3TJUA 4AB9A 1C2EA 1HJ8A 1ZHRA 3DSOA 1UMAH 4FVDA 3BTME 5AVDA 1DVAH 2Y5HA 2KR7A 1WTGH 2IJOB 1V2VT 2F9UA 1GGDC 1MUEB 1ZLRA 1C1NA 4GCHG 4K1TA 5CMXH 2O9QA 1CGHA 1QBNA 1BIOA 2ULLA 2GCTC 4WMDA 1P3CA 1KSNA 2VWOA 2FX4A 4VGCC 1GMCG 2BDAA 4PROA 1GVKB 1SOTA 4XE4A 5DN6D 1IQLA 5J4QA 1O5GH 1YLNA 3A7ZA 5T1VA 1XUHA 1H8HD 1FPCH 4JK5A 3Q3KA 4KKDA 3U28C 2EQNA 1E1RD 1ANEA 1K22H 1PPBH 2Z3DA 4JCNA 2TGTA 1ELAA 4I8JA 2BY9X 3DT0H 1TALA 1C2IA 1L1JA 1O3JA 1AB9B 2ODQA 2DE9A 3T29A 1O5CB 2WV9A 4B74A 1L0ZA 3A8AA 2PKAB 3MNSA 3GISB 1LQDB 4MPVA 2XCFA 5KEDA 2BX3A 4O03A 5A8ZA 1O3PB 3MI4A 2BQ7B 2BY5X 1QZ8A 1Z1JA 1A0HB 3T25A 1GDNA 3ODFA 2HLDD 1F0TA 1O38A 1DWBH 4WH6A 1Z8IB 3B8JA 2GVFA 3QN7A 3RU4E 2RDEA 3SNCA 4Y7AA 1Y3VA 1O2YA 3CENA 2GCHF 2QE7D 1BRUP 2OCVB 4F4OC 4Y7BA 4NWKA 4U30A 1GJ6A 1CSOE 2BDHA 4MNVA 1DICA 4B2CA 2A0QB 1LMWB 1TQ0B 2DE8A 1C5VA 1HDTH 1SGYE 3LGVA 1W0JD 2FEQH 2F91A 1LPGB 2BMGB 4FUJA 1F5KU 2OC1A 1MKXH 4O97A 1EATA 1O2PA 1O3FA 5GCHF 4IMQA 2BY6X 2FOBA 4Y8ZA 5IK2D 2AGGX 1O3BA 3KQCA 4FU9A 3JZ1B 3SU4A 1UW7A 4D8NA 3P8OA 3PYHA 2UUJB 5EU8A 2KX4A 3NCLA 1F0SA 1C2GA 3UNSA 2BDYA 1FDPA 1LHDH 1XXDA 3UQOA 2VWNA 1WSSH 3ELAH 5KGOA 1CU1A 1BJVA 1O2TA 1NFXA 6CHAB 5FBIA 2FX6A 1O5DH 4ZROA 1YPHC 2FESH 2P8OC 2W26A 3VB3A 1YP9A 1BMMH 1G3BA 1OYQA 1NRRH 4JZ1A 1C4U2 1S6HA 3BIVH 4YTAA 1DXPA 1C5ZB 1N1LA 3RM2H 2J97A 3C1KA 3TGIE 1NROH 2ZDKA 1V2WT 3NUMA 4IS5A 3DFJA 3FANA 3PLKA 1VGCC 4DJZB 1RTFB 3SU0A 1GI0A 1BMFD 1K1MA 1ZJKA 1GJ5H 1W12U 3DSPA 4GHTA 3TK9A 3TNTA 1BBRK 1VJAU 3BIUH 3D62A 1T32A 1O3KA 3RMMH 1A46H 4NA9H 5TCAA 4CRDA 4DIIH 1AVGH 1W0KD 3E16B 2AFQB 3M5NA 3ZZBA 1HXEH 3SGBE 1ELFA 1G3EA 4BXSA 4AN7A 1ELEE 1G30B 5T3HA 1TNHA 1L1GA 2ZDNA 1OP2A 1FJSA 2BOHB 5JB9S 2ZHWH 1W13U 2G55A 3PV5A 3M7QA 1BQYA 4UFGH 3QUMP 1LKBA 1DOJA 1QRZA 2CMYA 4ZHAA 2ZFSA 4J1YA 3H7TA 1A5GH 4YOJA 1UTJA 1AKSA 2A5KA 5EODA 1EZSC 3VGCC 2P3FH 4GPGA 1UO6A 3KN2A 1TGBA 4E05H 4Y11E 1QGFA 2ALPA 5DG6A 5DP5A 3UOPA 2ANKH 2J98B 3KEEA 1HLTH 4I8GA 3FN8A 5DK1A 1P9UA 1SGTA 4NA8A 1SQAA 1H8ED 4X6OA 1GCTC 2Z7FE 3A87A 2OLGA 4YZUA 1F5LA 5AFYH 3ZIAD 1O2LA 3HKIB 1C2HA 3FO8D 1FY4A 4K8YA 1MAXA 2QN5T 1IQMA 4BAMB 2HGTH 5EPYA 2ZHFH 2AEIH 3RXOA 3R0FA 1PFXC 2WV5A 3SU6A 1K28D 1Z6JH 2O8WA 1LHFH 1JIMA 2BD4A 1TPSA 3A8CA 2D8WA 2FS8A 4JYVH 1BTUA 4ISOA 2VB0A 1B0FA 1ETSH 2THFB 2OINA 3LJOA 1O2NA 4WXVA 2ZKSA 2LELA 3U1IB 1ELGA 1OS8A 1VCQA 1HAPH 2F3CE 1THSH 1MZDA 1QBOA 3M7TA 2OQUA 4NIWA 5A2MH 1B0EA 1ABJH 3Q00A 2ZF0H 1GJBB 1TFXA 1Z7KA 3S9CA 3MOCA 4CR9A 8KME2 1NM6A 4X1QU 1PQ8A 3MU0A 4MNYA 1C2MA 2BLQA 2QY0B 1OX1A 4Q7XA 4TWWA 2Z9JA 1T8NA 2BQ6B 5C3NA 2O8UA 4DURA 1SVPA 1TWXB 5E0JA 4AOQA 2F9OA 2P16A 3SJKA 1Y3YA 1ELTA 3ZZ3A 2A7JA 3K6ZA 4OS7A 4K1EA 1OOKB 2FOCA 2B0FA 4E7RG 4ESTE 4DCDA 1W14U 3SI4H 6CHAC 2FOHA 1FY5A 1PPFE 1FN6A 2ESTE 1KIGH 1G37A 4XFQA 2XBXA 1YYY1 2WPMS 1TLDA 1KDQA 5JBAS 3BTQE 3E1XB 4JYTA 3CP7A 3F1SB 3FOAA 3FVFB 3A8DA 3PROA 2L6OA 5EG4A 3WW7A 4X8TH 1OKXA 3RXRA 2XBYA 1TAWA 4BTUB 3GICB 1O2QA 3LGWA 4AZ2B 1NRQH 1QQ4A 2BDGA 4B75A 1SLUB 2HPQH 1S0RA 3LONA 1BRCE 5I46H 3WWFA 2XWBI 1FNIA 1XKAC 4FUFA 1X7AC 1C2LA 2BVXH 1CQQA 2W3IA 2PR3A 1O2IA 3MO3A 2CK3D 1P9SA 2VIVA 1BUIA 1MZAA 3QLPH 1TNLA 2NU0E 2ZI2H 2SGEE 5FCRA 4YLUA 2XOKD 2JJ1D 5CHAB 4LZ4B 1ZTLA 1H9LB 3EQ0H 4GSOA 1YPLH 3W1EA 1K1PA 1S81A 3A89A 2ZDMA 3ITIA 4A92A 1C1RA 3K2UA 4XBBA 5GXPA 2YMSD 3LPRA 1SSXA 2ZZUH 3ZZ4A 1HPGA 1C2KA 2V3OH 4AYVB 2K8IA 3ZZ9A 1KXAA 2P3UB 4KTCA 3TJVA 3BTTE 3EAJA 1QL7A 1O39A 2Q1JA 1BTXA 1T8OA 3KYGA 3QZRA 1YPMH 1QJ7B 2BYAX 3PTNA 2CHAB 3A7XA 4JK6A 4UE7H 1NN6A 3TPIZ 3QGNB 1E37B 3LOXA 5K7RA 4Q63A 3PWCA 5EQRA 3GDUA 4RSPA 3D49H 4CHAC 2ZCKP 2O8MA 1DX5M 5DO4H 1HAHH 1O5EH 5HM9A 3BTEE 2XNIA 3MMGA 4CRAA 1K9OE 1ANBA 2FPZA 3MU4A 3A86A 5A0BA 4ISIH 3SOSA 2ZNKH 1E79D 1MTNB 4Q4LA 5EIYA 3KCGH 1GG6C 1BMLA 3SHCH 5GJ4B 2VVVA 3ZYDA 4FU7A 4I8LA 1SGNE 2JETB 3CNRA 1F92A 2BVSH 3OEED 1EKBB 2R2MB 1NS3A 4JYUH 2FP7B 1HJAC 5ETXA 3PLBA 2AHME 1CHOF 3TNSA 2OXSA 4K1SA 1HIAA 4Y0ZE 1P12E 3OY5U 2P95A 3P17H 3M3VA 1TGNA 1GBKA 3BG4B 2H6MA 2AMPA 2DUCA 1O30A 4Y6DA 2G5VA 9LPRA 4AB8A 2ZGXH 1Y8TA 2Y7XA 2ZHQH 3RXVA 1JBUH 3F2FA 3ZVGA 2PUXB 2FIRH 3D65E 2P93A 3F0PA 3RXHA 1GJ9B 1MTSA 1S6LA 3F0OA 3PRDA 4JZEH 1LPZB 1P57B 3SGAE 4X1RU 3IWMA 3L3TA 4TY7A 4X1NU 3UQVA 1AE5A 3RXMA 2Q6DA 1FAXA 4ZUHA 7GCHG 1C2FA 1Z6EA 2D1JA 4IW4E 3UR9A 1P01A 3ENSB 1BJUA 4YO9A 2ZPRA 3VXFH 1A5HA 3A88A 1E38B 1ESBA 2KFWA 1CA0C 1GBIA 4UEHH 1GPZA 4OS2A 4X6PA 1HFDA 3A84A 2ZEBA 1GVLA 3ZVBA 2VINA 4OGXA 1AMHA 5C94A 1OWHA 4NCYA 2GTBA 2CJIA 4BNRA 4CRFA 8GCHF 3GCNA 1V6DA 3PLPA 3P8FA 3FP7E 1WU1A 1ZPZA 2ZGBH 1TGSZ 5EJZA 1K1IA 2A2XH 1SQOA 1DPOA 2K1QA 3URCA 3F9HA 4AFUA 1EXFA 4HGCA 4I7YH 1PPHE 4CRGA 1KY9A 3UWJH 3ZZ6A 2H9TH 4O3TA 1LTOA 1THPB 1SGQE 3FKSD 5EXMA 4AG2A 2C8YB 3VEQB 1ZRBA 1O3AA 5LPEA 1JXPA 1HRTH 1O2SA 3A83A 1F7ZA 4WF8A 1BTZA 4INLA 1W3CA 3CS0A 1XM1A 2Z94A 2KCPA 3BTGE 1C5XB 1TONA 1ZZZA 5CHAC 4Z1MD 2Z9LA 3SN8A 2WYJA 4E06H 3MU1A 2B7DH 3SUDA 1BMNH 2G5NA 5T6GA 1EOLA 1C4Y2 3KQBA 3BTWE 4MTBA 2OTVA 1AU8A 3TJOA 2C3SA 1VITG 3TIUA 2BLVA 1HAVA 5JB8S 1WAYB 1W8BH 2SGDE 4NGAH 3RP2A 1PQAA 3SNAA 5HIZA 4AGJA 2QCYA 1K2I1 4BAKB 3NRLA 4I33A 2OUAA 1OXGA 4HTCH 4IMZA 1QL9A 2YNBA 4X8VH 2TBSA 5C20A 1QRWA 2GV7A 3V7TA 1W7XH 3SJIA 2ZG0H 2SGAA 2YNAA 1MTNC 1N6YA 1SOZA 1GHYH 1A3EH 1GBMA 2WPKS 2BD2A 1XVMA 2A2QH 3ATKA 1Z8JB 4BTTB 3GS9A 1C1OA 3V0XA 4TWYA 3EDXB 1ACBE 1C5MD 5C0TA 1GWAA 4FUHA 5KECA 2PTCE 1TA6A 2GD4B 3N7OA 1O5FH 3RC4A 2BXTH 5FAHA 3GCTG 1VITH 1G3CA 2BTCE 3E3TA 2ZO3H 1GJAB 2ZTXA 5GIBA 5K0HA 1MMJN 1TABE 3MO9A 2A4RA 1FAKH 1EPTB 1GBDA 3BG4C 1C1PA 4FVBA 2KCAA 2YMSB 3MYWA 4IBLH 2FXRA 2AGIX 2J4IA 1LQEA 1C5UA 4UFDH 3AK5A 6GCHG 4NIVA 3WY8A 4A6LA 1GJ8B 1C5PA 3SZEA 2IPQX 1TA2A 1ZMNA 3EA9A 1A4WH 1SGFG 3SV6A 2WINI 2HNTC 3VG8A 2FLBH 3MH6A 5C5NA 4IC5A 3RMNH 3UY9A 5GNDA 1C1QA 4A5TS 1UTMA 5E0HA 2CXVA 3VB6A 4FETA 2VWMA 5F8TA 5EW2H 1C5RA 2A32A 1EASA 3EE0B 3RXGA 3E0PB 3SUEA 1QFKH 2JDID 4LZ1H 3P8NA 1Q3XA 3A81A 2VIOA 1AD8H 2OP9A 3ZZCA 1YKTA 5E2PA 1GBEA 5FBEA 3VFEA 1F0UA 3ODDA 4HG6A 1GDQA 1H9IE 1HAYB 2SNWA 4QT8C 2CGAA 2QAAA 3HKJB 3UWIA 1DLKB 3OU0A 2PV9B 1BHXF 3SO3A 2QF5A 1L2EA 4B2BA 1CT4E 1NRSH 4MPWA 2RDLA 1TNGA 3F3BA 1NT1A 1XUJA 1HAOH 3A7YA 2Z9IA 2SGPE 4I32A 5FPSA 3RMLH 2XWAA 4ABIA 3DD2H 3OAAD 1H1BA 2K0QA 1C1VH 2TPIZ 1D6WA 2ANMH 1EZXC 4YM9A 1DY8A 3EE7A 3EGKH 3UNRA 4RKJB 2VJ1A 1P2QA 2GKVE 1IQIA 1MQ6A 1NFWA 1BB0B 3UOUA 1UTLM 2PWXA 4X2XA 5GPIB 1XX9A 2XW9A 3MNBA 5A0AE 1GHBF 2W6ID 1VCWA 1P2JA 5JBBS 1KXDA 4KTUA 4Y0YE 1VJ9U 1W0ZU 2JIZD 1RIWC 2IPHA 1Q31A 2RCEA 1G32B 2EI6A 1ID5H 2ZWLH 1GI9B 4U2WA 2AYWA 2LPRA 5AHGH 1NRPH 4MQAA 4A7IB 2JKHA 3RXIA 1MCTA 2ASUB 5FX6A 1GL1A 1RFNA 5PTPA 2OD3B 1AFQB 1JIRA 4YT7H 1O2GH 1GL0E 4XBCA 5F8XA 4AFSA 1HUTH 3DHKH 2KM0A 3QK1A 1MKWH 1BMAA 2FI4E 2CF8H 1TOMH 2ZFTA 1VCPA 1OSSA 1O33A 2EA3A 1EUFA 2WPDD 3TVJB 1BA8B 2V35A 4AYYB 2XNDD 1AWFH 3LIWA 2ILNA 4CBNA 2A7CA 3AAUA 2XC4A 2IOTA 1GMDG 2BOKA 5FPTA 1WCZA 5IYTA 5A8XA 2XBVA 4R8TB 1O3HA 4ZHLU 5H4IB 1P06A 2QXGA 3AVZA 3E8LA 2HLCA 2G00A 2FTMA 3B23B 4OS4A 1MTUA 3GY7A 1GMHG 2KAIB 3RU4T 3VB5A 1FIWA 1TRMA 2QF4A 1GHWH 4Y76A 1NC6A 1EPTC 1TMTH 4Q80A 2FZZA 3UB0A 1AZ8A 1V3XA 1J16A 3DFLA 1B7XB 3UNQA 1CHGA 2OBOA 1HBTH 1IQNA 1SPJA 3ATWA 5AF9H 1C5LH 4B71A 4ZCNA 1LHCH 3F2HA 1AVXA 1YGCH 3GCTF 4GHQA 3HK3B 3ZZ7A 1TNKA 1YF4A 1FIZA 1OHHD 2ANWA 2PGBB 3C27B 2M5TA 3ESTA 5HIYA 1GDUA 2PUQH 1WV7H 1SGDE 1P10A 2PKSB 3H09A 4GCHF 3O8CA 3N99A 1O2ZA 4KTSA 1ZSJA 2FYRA 4NG9H 1T7CA 1YWUA 1UTOA 4A1TA 4MVNA 1HAGE 1GMCF 2ZU5A 1AQ7A 2BDCA 2GJGA 2GX4A 5SGAE 1ZTKA 2V0BA 3RXUA 2GDDA 1AFEH 1BTWA 1O2WA 3MU5A 1AB9C 5C2ZA 3PV4A 1KLIH 4X2YA 5LGOA 4MNWA 1WQSA 3ZVFA 4FXGH 1ORFA 3IG6B 4D7GA 3PV2A 1OP8A 1XUGA 2QV1A 1T8MA 3SV9A 4DY7B 5ESBA 4ISNA 4I86A 2PP6A 3F6UH 2W7SA 3Q3YA 1SLVB 3SV7A 3SUFA 2GZ9A 4HI3A 1SGRE 2R2WU 3UAIC 1Z8RA 1O3OA 1XMNB 3EA7A 3GOVB 1V2OT 1LVBA 2ZCHP 1O3DA 1SFIA 2AS9A 3PM3A 4RI0A 1ZGIA 3ZV8A 2FS9A 4K3JA 1BBRE 3HGNA 2QXJA 4X8UH 1GBFA 4RT1A 3PMJA 3MTYA 3MWIU 2V6NA 1P11E 5EJ1A 2F4LA 5C1XA 1LDTT 1UK3A 1UTPA 1V2UT 3N7EA 3QWCH 3KYFA 1GHXH 3NK8A 2A31A 1ZSKA 1O2RA 3SUGA 1TBQH 1UHBA 2XTTB 3AW1A 1FPHH 4TPYA 4FUDA 4TY6A 1O0DH 1XVOA 1SGCA 5HMAA 3UIRA 1OWEA 1SBWA 1LCYA 1G2MA 4OS1A 2KCOA 2M2AA 4WVPE 1KLJH 4INHA 3K6YA 4H6SB 5TJXA 3ATLA 2XXLA 3LH1A 1AFQC 1O2VA 1O5AB 1QB6A 3O8RA 1HV7A 2AGEX 3ZV9A 4XSKU 3SYJA 1IQFA 2LP6A 1EAUA 2ZGHA 4I8HA 1B5GH 2V3HH 3U1JB 4FUCA 1DT2A 2C4FH 3LGYA 3I29A 1J8AA 1MABB 1WYKA 1BBRH 2KZ4A 5LPFA 1NO9H 3T26A 3E0NB 2R0KA 1BDAA 8ESTE 3P70B 1XUKA 2ANYA 3LGUA 2EC9H 1SHHB 3P92A 3TITA 7ESTE 3KGPA 1AO5A 3IITA 5EXNA 4Y8YA 2JH6D 2AIPA 1JWTA 1FMGA 1HAIH 3SU2A 3NPSA 4H42U 1QJ1B 1DFPA 3FP6E 2TGDA 2ZCLP 2ZU3A 1D3PB 4KP0A 1QL8A 4K2YA 3BG8A 1AGJA 4Z6AH 1DANH 3RXAA 3WWBA 1Y59T 1LHEH 1GBCA 1Y3WA 2RA0A 2ZFPH 1DY9A 1UVOA 2QGRA 2FMJA 4ACAA 1GMDF 1P05A 2OBQA 4MPUA 1TE0A 2QA9E 1EOJA 2HVYB 4RN6A 2VGCB 3GCHB 4YESB 1NBMD 1V2ST 4ASUD 1AE8H 4Y79A 3SBKA 1C5OH 3GY3A 4X0WU 5JPMH 4GAWA 1G2LA 9ESTA 5G4BA 1V2RT 1C5NH 4MG3A 1TGCA 3A80A 1PPZA 1GJ4H 1AKSB 1BOQA 3LC3A 3PWBA 2WV4A 1J17T 1GI7B 2C93B 3LGIA 4P02A 1P04A 4AG1A 2STBE 2ZFQH 1FV9A 2P3TB 2FLRH 3MFJA 3OEHD 3FAOA 3BEIB 1NU7B 2FTLE 4X6NA 1ARCA 1KXCA 2ZA5A 4NFFA 1UCYK 5C67A 1NU9A 3MH5A 1RS0A 1Y5AT 1O35A 3SV8A 1PPCE 5DJ7A 4NIYA 1LVOA 5DP4A 1GBBA 4K8BA 5C17A 3P8GA 4B73A 1Y5BT 1K1LA 3KNXA 4FUIA 4BAOB 1DITH 4J2YB 1O34A 5T6DA 4U32A 3A85A 3RXBA 3M7UA 1JRTA 1PJPA 1S82A 2ZIQH 1E35B 1TOCB 2FOAA 1DSTA 1E1QD 1MBMA 1TNJA 2BVRH 3T28A 3RLWH 4YOGA 5L6NH 1YPEH 1GI5A 1P2MA 1N8OB 1SL3A 1THRH 1BT7A 3OTJE 1NPMA 3FZZA 2FOEA 1PQ5A 1MAYA 3GY6A 2FYQA 2GT7A 3QDZB 4ABGA 4DGJA 3AW0A 5DSFA 2ZDLA 3F9EA 1W11U 2RG3A 2Z9GA 3OE7D 1Z71A 4F49A 3RXCA 3MQKC 3HK6B 2BD7A 1NZQH 4RT0A 3RXDA 1YCPK 2ZC9H 3BTKE 1YPHE 1ZSLA 3BSQA 3F2GA 1L4ZA 2OC7A 3M3SA 2VH6A 3G01A 3OX7U 5DKMA 3P95A 3SHAH 1D4PB 2V3MA 1GGDB 5GWZA 2EI8A 1GHVH 2UUKB 4INKA 1EPTA 4FU8A 1FY3A 1U6QA 1Z8GA 2SFAA 2VVCA 4AC9A 3ZVDA 3MH4A 1UCYE 3LKWA 4BAQB 5CDFE 5A0CA 5EGMA 2GCTB 1YC0A 4THNH 2TGPZ 3RXSA 2VIQA 1K21H 1C9TA 1SGPE 5DP6A 1DXWA 1SQTA 1SG8B 4YT6H 1ETRH 1M9UA 2FI3E 2FODA 1KDQB 1EFRD 2J95A 3FZDA 2W7UA 1C5QA 4ABAA 1FI8A 1QJ6B 3M5MA 3BTHE 3I77A 1LHGH 3TLOA 4K60A 2BLOA 2H1UA 1RD3B 4CREA 2XC0A 3QX5H 3SQEE 7KMEH 2ZU4A 2FOFA 1BRAA 1DLEA 1MU8B 2HNTF 2R3YA 4CRBA 4UFEH 3RUOA 2PKAA 1WOFA 4MPXA 1C5TA 4H6TA 1UTQA 5C0UA 1CA8B 4D76A 1TMUH 2J2UA 5EOKA 1EB2A 2C8WB 1AWHB 2HWLB 1TQ7B 1INCA 4I8KA 1ZOMA 1AVWA 4H4FA 2F83A 2BDBA 5GCHG 2PLXA 1O2JA 4ZKSU 1DE7H 1QURH 3Q3XA 1IOEA 1HNEE 2FDAA 2JH5D 2UUFB 3RXTA 2QF3A 2PSYA 4X2WA 3OSYA 4LOYH 1EAIA 4X2VA 4Q2KA 3RMOH 1O3GA 2F9BH 2VIPA 1SMFE 3DUXH 3PO1B 2CHAC 1W0YH 2VNTA 4XOJA 3LH3A 4BAHB 2Q6GA 3QO6A 4D9RA 2VH0A 1SGIB 1KYNA 1V2KT 3EA8A 1SGEE 4XD7D 3SORA 1GI2A 2PGQB 1XUFA 1ETTH 3TGKE 2PFEA 2BQWB 4AORA 2ZU2A 5FHTA 1D3DB 2Y5GA 2H9EH 1MKXK 1YBWA 3D23A 2NU4E 2XC5A 2JETC 4I31A 4K5ZA 5DP8A 3R3GB 3KQEA 2P8OB 5EQSA 3T2NA 1GBLA 2G4UA 1H9HE 4UD9H 3U8RH 4D7FA 5L30H 5FL7D 1HIAB 2IN2A 3M61U 3SJ8A 2C8ZB 3RU4D 1UTKA 1N8OC 2WPJS 1GHAG 5L2ZH 3FP8E 2A4OA 3M5LA 3PTBA 3TH2H 1O2KA 1PYTC 1NY22 2GT8A 3ATIA 3F68H 1DSUA 2J5UA 1CBWB 3OYPA 1SKYE 4UDWH 1VGCB 2AMQA 2L74A 1EX3A 3K65B 1FXYA 1YM0A 3LDXH 2AMDA 5B6LA 4AFQA 1YY3A 1QB9A 3SNBA 1S83A 1TX8A 2PSXA 1PPEE 1SGFA 3KQDA 2F43B 5E2OA 1CGJE 4ASHA 2BHGA 3T62A 1P09A 2SNVA 1DWDH 3DCLA 1YPGH 3HATH 1GJDB 2ZFRH 3W95A 2B9LA 2KAIA 2ZECA 2P59A 3Q76A 4YOIA 3RXKA 2TIOA 1ESTA 3M36A 2ODYB 1OWJA 4KGAA 1BHXB 3SJ9A 1P0SH 2Y82A 1UK2A 3ZVAA 1DWEH 4MLFB 2Y7ZA 5I25A 3BN9A 1BCUH 1CVWH 1Q2WA 2VIWA 3TK6A 5F6MA 2QYIA 3S0NA 2D2DA 3VGCB 2NU1E 1C4V2 4TPIZ 1C1WH 3STJA 3VPKA 2Z3EA 1RRKA 7LPRA 1EZUC 1GI4A 1QR3E 2J98A 5LPRA 3S7KB 1AZZA 3TH3H 4DOQA 1D3QB 7GCHF 5JYIA 1LVYA 2UWOA 4CH2B 2BZAA 2ZTYA 1EB1H 1GCTB 1T8LA 4NWLA 4NIXA 1O3MA 2A1DB 5L2YH 2HRVA 2STAE 4OS6A 3U8TH 4XBDA 1VZQH 1KTSB 1S84A 3K9XB 1TGTA 4DT7B 3MHWU 4JZIA 5DGJA 1T4VH 2A4QA 3V13A 3F9GA 5EPNA 5EW1H 2WSSD 1F2SE 1E34B 1UVSH 1AY6H 1EJNA 3QGJA 4CRCA 1P2NA 1QY6A 4BANB 2R0LA 4DVAU 2BD8A 2ALVA 1YPKH 2FWWA 4AFZA 2J38A 1C9PA 1VR1H 5JBCS 2EEKA 4X8SH 5HM2A 1UVTH 2W6JD 1DWCH 1ELVA 4WY3A 2BDIA 4ABDA 3O8DA 4NSVA 4NSYA 2C8XB 1K1OA 1HAZB 1OYTH 2PHBA 3E91A 1GBAA 2KCYA 2ODPA 1K0HA 2ZHEH 3HGPA 1UTNA 1HAVB 1J9CH 1ZHMA 2ZDVH 5C1UA 1ANCA 1NESE 4E7NA 2Z9KA 4NZLA 3V12A 5DPAA 1UK4A 4A1VA 2EI7A 4FOUC 4ABJA 1AUJA 3PO1C 1EAWA 4WMFA 1MQ5A 1Y3UA 2B5TB 4U01A 1TBZH 3GYMA 1V2QT 1MBQA 1QA0A 1IHTH 2ZGJA 3A8BA 3PMBB 3S9AA 5EXLA 2GV6A 2QIQA 1VITF 5IDKA 1PPGE 1FY1A 1V2PT 4ACBA 4OM9A 3MNCA 1D9IA 4NFEA 1G36A 3A7TA 2OC8A 1TB6H 4Y8XA 2ZTZA 6LPRA 2VU8E 1W2KH 1O2OA 1TRNA 1KMHB 1KXEA 2OC0A 3A82A 4FUGA 1QA7A 1MU6B 2QC2A 3KF2A 1AIXH 1V2NT 4WXIA 3ZVEA 1O2UA 2OK5A 4BTIB 1MD8A 1ZR0A 2YOLA 4RKOB 5E0GA 1HAXB 3MNXA 4OS5A 1JRSA 2UWPA 5F03A 2F9NA 3DSGA 1YLCA 3E6PH 4JZFH 1VKYA 1WDIA 2WUCA 2B8OH 1DM4B 1RGQA 5HYOA 1CBWC 1IHSH 5HKKD 2YMSC 1ZHPA 4FUBA 3STIA 1E36B 4X1SU 1H4WA 1H8DH 2CF9H 4IN2A 1MTWA 2JJ2D 3GDSA 2G4TA 1GHAF 2A7HA 4IC6A 1ZMLA 1O36A 4ZKNU 5BPEA 1AI8H 1YCPM 3O8BA 1OWKA 3OTPA 5BRRE 1T4UH 1MCVA 2WPIS 2HALA 3UREA 4ABEA 1J14A 1D3TB 1SQRA 2A4GA 4ZAEA 4B2AA 2GGVB 6GCHF 1LKAA 1FONA 3LGTA 3A7VA 3HPTB 1PYTD 2BZ6H 1UJ1A 1A3BH 1BTPA 1CT2E 2R9PA 2Y81A 1ZJDA 1GBHA 4HFPB 3ZYEA 1IAUA 5FCKA 1BTHH 1N6XA 3ZVCA 1TPOA 3AASA 1TPAE 1FN8A 1DUAA 2HOBA 1YPJH 2CV3A 4CBOA 3M37A 4ABHA 1QNJA 2C90B 1TIOA 1O2XA 2RA3A 4ISLA 3Q77A 4YLQH 2O8TA 3CS7A 4BXWA 2J9NA 3M3TA 2LNCA 3VXEH 2WYGA 3W94A 4CHAB 4B1TA 2FM2A 4MDSA 5ESTE 1CHOG 4ABFA 1NFYA 3GDVA 2HVXA 4MNXA 1YLDA 3SGQE 1EQ9A 3RXQA 2XCNA 5C1YA 1RJXB 4O9VA 2BD5A 1GG6B 4IGDA 3U9AH 2GMTB 2I6QA 2Z3CA 3SNDA 3ZZAA 1S5SA 2Y6TA 3SQHE 3ZZ8A 3U98H 4ZKOU 3EYDA 1AHTH 1IQGA 1Y3XA 1HJAB 5FX5A 3B9FH 1A61H 1WTHD 1F0RA 4WMEA 1O32A 2PTNA 2G81E 1C1SA 1EJAA 4Q7YA 1SB1H 2ZFFH 3QTOH 3LU9B 1NTPA 3GY2A 1O31A 2EY4C 5FXLA 1S0QA 1J15A 2BXUH 2ZPQA 3MH7A 5E8EH 3TU7H 3LC5A 5AFZH 4JZDH 1DS2E 2GDEH 1FQ3A 1P03A 8LPRA 1JOUB 2TGAA 3JZ2B 2AERH 4DIHH 1P02A 1TMBH 1KXBA 2SGFE 1QTFA 3F9FA 4GVUA 5J4SA 2AH4X 1COWD 2NWNA 4F55A 3OY6U 1C5SA 3UUZA 3BTFE 1V2TT 2P94A 4Q7ZA 3UR6A 2WHXA 4P00A 1ARBA 8GCHG 1HGTH 1ZGVA 1C2JA 1OWIA 1GJCB 2ZDAH 4ZMAH 1K1NA 1Y5UT 1SR5C 1EP6A 1FZZA 2G52A 4ZHMU 1JMOH 1CA0B 2HNTE 4ZXXH 1A0LA 1MTVA 3KIDU
chains in the Genus database with same CATH topology
5LH8A 3GY8A 1QCPA 3LJJA 1FUJA 3M5OA 3RXPA 1ABIH 1P8VC 4Y10E 1TNIA 1A7SA 4LK4A 1XUIA 5B6OA 3PMHB 2ZHDA 5HXFA 1GI8B 1TX7A 2GZ7A 2J34A 3GY4A 4ABBA 3PMAB 2R3UA 5ABWA 1CT0E 3QZQA 1A1RA 1BZXE 5FPYA 3H7OA 3RLYH 2GP9B 3SNEA 3BV9B 1C2DA 3RXFA 3UPEA 2F9VA 1HB0B 4DG4A 2TRMA 1GMHF 4D9QA 1QBVH 1ANDA 1O2HA 4CR5A 1G3DA 2Q6FA 4ZXYH 1SLXB 2G51A 3M35A 3NWUA 5EQQA 3SJOA 4CH8B 1GCDA 1O37A 2PKSC 1RXPA 3UFAA 2GZ8A 4NZQA 6ESTA 2I6SA 1WBGB 3ZZ5A 3GY5A 1AUTC 2BD9A 2Z6BD 3KHVA 5T6FA 3ATMA 1TRYA 2D26C 2Y80A 4R0IA 1ESAA 5DP7A 3BF6H 1GVZA 1T31A 4M7GA 2AIQA 1FY8E 3T27A 1AN1E 3L33A 1CE5A 3GCOA 2W5EA 1ELBA 1ELCA 4NA7A 4SGAE 4X1PU 2NU2E 4DW2U 5JDUB 4JMYA 1C1TA 5GDSH 3FFGA 1TBRH 1KTTB 4FUEA 1GBTA 1V2MT 2O8LA 3KL6A 1A2CH 1XKBC 3TJNA 2BY7X 1ZTJA 1P3EA 1O2MA 2ZPSA 4LXBH 1EP5A 3SU1A 3UTUH 2UUYA 5TCCA 1HCGA 1PQ7A 3NZIA 1A5IA 1OP0A 1TX6A 4WJG2 3RXLA 4AGKA 1TYNA 2SGQE 5CE1A 1O5BB 2A5AA 1SI5H 2FO9A 4ISHH 3RC5A 3RM0H 4BOHA 1UVUH 1NFUA 2GMTC 5A09A 3V3MA 3L6PA 1UHBB 2BD3A 2H9HA 3S9BA 1W7GH 4GLYA 1QB1A 1XXFA 2CN0H 2A5IA 4Z0KA 3VB4A 1NRNH 3RDZA 3AAVA 4AX9H 1DUEA 1EJMA 4GUXA 3RC6A 2BX4A 3I78A 5C5OA 5DP9A 2BLWA 1ZMJA 2H5CA 4KELA 1IQEA 2J92A 5DP3A 1P2KA 1ZPCA 1K1JA 1D6RA 1SFQB 2UWLA 1A0JA 4X6MA 1SLWB 1C5YB 2F9PA 1UVPA 4VGCB 1HJ9A 3MU8A 1HYLA 1V2LT 2VVUA 3SU5A 3QTVH 1O3IA 1WQVH 1O3LA 3SV2H 2G8TA 1ZRKA 1G9IE 5F8ZA 3P6ZB 1O3CA 4SGBE 4UONA 3ZZDA 3VB7A 1C1MA 1E0FD 1MH0A 2ZU1A 2HPPH 4B76A 4UFFH 1C1UH 1BRBE 1QQUA 3SI3H 3TGJE 3BTDE 1EZQA 1S85A 1O3NA 4K69A 2VWLA 2GCHG 4HZHA 1CO7E 1GJ7B 2QF0A 2BB4A 2XRCA 2WPHS 3TK5A 1Z1IA 1EAXA 1W10U 2FOMB 2QXHA 1UCYH 2VGCC 3GCHC 2XBWA 2FOGA 1GHBG 1GHZA 2H5DA 3H5CB 1MD7A 3RXJA 1GBJA 3SZNA 1OPHB 1S6FA 3URDA 3E90B 1QRXA 2ZGCA 1ELDE 3TH4H 2JH0D 1GI3A 4ZKRU 2J94A 2PW8H 2VIDA 3S7HB 4A1XA 1BITA 1IQJA 1H8IH 1CGIE 1GI1A 3RXEA 1HXFH 2ZQ1A 1O3EA 2A45B 1GI6A 3U69H 1ZYOA 2H2ZA 2ZQ2A 1KXFA 1RIWB 1RTKA 2FI5E 3S69A 4O3UA 1FLEE 1TPPA 2W3KA 3LT3A 1DDJA 3SW2B 1F5RA 4WWYA 1P2IA 3DA9B 4OGYA 1IQHA 1LO6A 4IN1A 1WUNH 4XDEA 3BEUA 2NU3E 1C5WB 2QXIA 1SC8U 1LVMA 2OQ5A 3BEFB 3GYLB 1OWDA 1LPKB 3SU3A 1YCPH 3U8OH 5A8YA 1L4DA 2XYAA 1L1NA 1QHRB 4Y71A 1RTLA 3PB1E 1P2OA 2ZP0H 4ZH8A 3T5FH 2BY8X 2WUBA 5HGGA 4TYDA 2Y5FA 1IQKA 2BM2A 3A7WA 3NXPA 1KLTA 1ZPBA 1MKWK 2WPLS 5JBTA 4WH8A 1BTYA 1QIXB 1V2JT 1SHYA 3MO6A 3NKKA 3TJUA 4AB9A 1C2EA 1HJ8A 1ZHRA 1UMAH 4FVDA 3BTME 5AVDA 1DVAH 2Y5HA 1WTGH 2IJOB 1V2VT 2F9UA 1GGDC 1MUEB 1ZLRA 1C1NA 4GCHG 4K1TA 5CMXH 2O9QA 1CGHA 1QBNA 1BIOA 2ULLA 2GCTC 4WMDA 1P3CA 1KSNA 2VWOA 2FX4A 4VGCC 1GMCG 2BDAA 4PROA 1GVKB 1SOTA 4XE4A 1IQLA 5J4QA 1O5GH 3A7ZA 1XUHA 1FPCH 4JK5A 3Q3KA 4KKDA 1ANEA 1K22H 1PPBH 2Z3DA 4JCNA 2TGTA 1ELAA 4I8JA 2BY9X 3DT0H 1TALA 1C2IA 1L1JA 1O3JA 1AB9B 2ODQA 2DE9A 3T29A 1O5CB 4B74A 1L0ZA 3A8AA 2PKAB 3MNSA 3GISB 1LQDB 4MPVA 2XCFA 2BX3A 4O03A 5A8ZA 1O3PB 3MI4A 2BQ7B 2BY5X 1Z1JA 1A0HB 3T25A 1GDNA 3ODFA 1F0TA 1O38A 1DWBH 4WH6A 1Z8IB 3B8JA 2GVFA 3QN7A 3RU4E 3SNCA 4Y7AA 1Y3VA 1O2YA 3CENA 2GCHF 1BRUP 2OCVB 4F4OC 4Y7BA 4NWKA 4U30A 1GJ6A 1CSOE 2BDHA 4MNVA 1DICA 4B2CA 2A0QB 1LMWB 1TQ0B 2DE8A 1C5VA 1HDTH 1SGYE 3LGVA 2FEQH 2F91A 1LPGB 2BMGB 4FUJA 1F5KU 2OC1A 1MKXH 4O97A 1EATA 1O2PA 1O3FA 5GCHF 4IMQA 2BY6X 2FOBA 4Y8ZA 2AGGX 1O3BA 3KQCA 4FU9A 3JZ1B 3SU4A 4D8NA 3P8OA 3PYHA 2UUJB 5EU8A 3NCLA 1F0SA 1C2GA 3UNSA 2BDYA 1FDPA 1LHDH 1XXDA 3UQOA 2VWNA 1WSSH 3ELAH 1CU1A 1BJVA 1O2TA 1NFXA 6CHAB 5FBIA 2FX6A 1O5DH 4ZROA 1YPHC 2FESH 2P8OC 2W26A 3VB3A 1YP9A 1BMMH 1G3BA 1OYQA 1NRRH 4JZ1A 1C4U2 1S6HA 3BIVH 4YTAA 1DXPA 1C5ZB 1N1LA 3RM2H 3C1KA 3TGIE 1NROH 2ZDKA 1V2WT 3NUMA 4IS5A 3DFJA 3FANA 3PLKA 1VGCC 4DJZB 1RTFB 3SU0A 1GI0A 1K1MA 1ZJKA 1GJ5H 1W12U 4GHTA 3TK9A 3TNTA 1BBRK 1VJAU 3BIUH 3D62A 1T32A 1O3KA 3RMMH 1A46H 4NA9H 5TCAA 4CRDA 4DIIH 1AVGH 3E16B 2AFQB 3M5NA 3ZZBA 1HXEH 3SGBE 1ELFA 1G3EA 4BXSA 4AN7A 1ELEE 1G30B 5T3HA 1TNHA 1L1GA 2ZDNA 1OP2A 1FJSA 2BOHB 5JB9S 2ZHWH 1W13U 2G55A 3M7QA 1BQYA 4UFGH 3QUMP 1LKBA 1DOJA 1QRZA 2CMYA 4ZHAA 2ZFSA 4J1YA 3H7TA 1A5GH 4YOJA 1UTJA 1AKSA 2A5KA 5EODA 1EZSC 3VGCC 2P3FH 4GPGA 1UO6A 3KN2A 1TGBA 4E05H 4Y11E 1QGFA 2ALPA 5DG6A 5DP5A 3UOPA 2ANKH 3KEEA 1HLTH 4I8GA 5DK1A 1P9UA 1SGTA 4NA8A 1SQAA 4X6OA 1GCTC 2Z7FE 3A87A 2OLGA 4YZUA 1F5LA 5AFYH 1O2LA 3HKIB 1C2HA 1FY4A 4K8YA 1MAXA 2QN5T 1IQMA 4BAMB 2HGTH 5EPYA 2ZHFH 2AEIH 3RXOA 3R0FA 1PFXC 2WV5A 3SU6A 1K28D 1Z6JH 2O8WA 1LHFH 1JIMA 2BD4A 1TPSA 3A8CA 2D8WA 2FS8A 4JYVH 1BTUA 4ISOA 2VB0A 1B0FA 1ETSH 2THFB 2OINA 3LJOA 1O2NA 4WXVA 2ZKSA 3U1IB 1ELGA 1OS8A 1VCQA 1HAPH 2F3CE 1THSH 1MZDA 1QBOA 3M7TA 2OQUA 4NIWA 5A2MH 1B0EA 1ABJH 3Q00A 2ZF0H 1GJBB 1TFXA 1Z7KA 3S9CA 3MOCA 4CR9A 8KME2 1NM6A 4X1QU 1PQ8A 3MU0A 4MNYA 1C2MA 2BLQA 2QY0B 1OX1A 4Q7XA 4TWWA 2Z9JA 1T8NA 2BQ6B 5C3NA 2O8UA 4DURA 1SVPA 1TWXB 5E0JA 4AOQA 2F9OA 2P16A 3SJKA 1Y3YA 1ELTA 3ZZ3A 2A7JA 3K6ZA 4OS7A 4K1EA 1OOKB 2FOCA 2B0FA 4E7RG 4ESTE 4DCDA 1W14U 3SI4H 6CHAC 2FOHA 1FY5A 1PPFE 1FN6A 2ESTE 1KIGH 1G37A 4XFQA 2XBXA 1YYY1 2WPMS 1TLDA 1KDQA 5JBAS 3BTQE 3E1XB 4JYTA 3CP7A 3F1SB 3FVFB 3A8DA 3PROA 5EG4A 4X8TH 1OKXA 3RXRA 2XBYA 1TAWA 4BTUB 3GICB 1O2QA 3LGWA 4AZ2B 1NRQH 1QQ4A 2BDGA 4B75A 1SLUB 2HPQH 1S0RA 3LONA 1BRCE 5I46H 2XWBI 1FNIA 1XKAC 4FUFA 1X7AC 1C2LA 2BVXH 1CQQA 2W3IA 2PR3A 1O2IA 3MO3A 1P9SA 2VIVA 1BUIA 1MZAA 3QLPH 1TNLA 2NU0E 2ZI2H 2SGEE 5FCRA 4YLUA 5CHAB 4LZ4B 1ZTLA 1H9LB 3EQ0H 4GSOA 1YPLH 1K1PA 1S81A 3A89A 2ZDMA 3ITIA 4A92A 1C1RA 3K2UA 4XBBA 5GXPA 3LPRA 1SSXA 2ZZUH 3ZZ4A 1HPGA 1C2KA 2V3OH 4AYVB 3ZZ9A 1KXAA 2P3UB 4KTCA 3TJVA 3BTTE 3EAJA 1QL7A 1O39A 2Q1JA 1BTXA 1T8OA 3QZRA 1YPMH 1QJ7B 2BYAX 3PTNA 2CHAB 3A7XA 4JK6A 4UE7H 1NN6A 3TPIZ 3QGNB 1E37B 3LOXA 5K7RA 3PWCA 5EQRA 3GDUA 4RSPA 3D49H 4CHAC 2ZCKP 2O8MA 1DX5M 5DO4H 1HAHH 1O5EH 5HM9A 3BTEE 2XNIA 3MMGA 4CRAA 1K9OE 1ANBA 2FPZA 3MU4A 3A86A 5A0BA 4ISIH 3SOSA 2ZNKH 1MTNB 3KCGH 1GG6C 1BMLA 3SHCH 5GJ4B 2VVVA 3ZYDA 4FU7A 4I8LA 1SGNE 2JETB 1F92A 2BVSH 1EKBB 2R2MB 1NS3A 4JYUH 2FP7B 1HJAC 5ETXA 3PLBA 1CHOF 3TNSA 2OXSA 4K1SA 1HIAA 4Y0ZE 1P12E 3OY5U 2P95A 3P17H 3M3VA 1TGNA 1GBKA 3BG4B 2H6MA 2AMPA 2DUCA 1O30A 4Y6DA 2G5VA 9LPRA 4AB8A 2ZGXH 1Y8TA 2Y7XA 2ZHQH 3RXVA 1JBUH 3ZVGA 2PUXB 2FIRH 3D65E 2P93A 3RXHA 1GJ9B 1MTSA 4JZEH 1LPZB 1P57B 3SGAE 4X1RU 3IWMA 3L3TA 4TY7A 4X1NU 3UQVA 1AE5A 3RXMA 2Q6DA 1FAXA 4ZUHA 7GCHG 1C2FA 1Z6EA 2D1JA 4IW4E 3UR9A 1P01A 3ENSB 1BJUA 4YO9A 2ZPRA 3VXFH 1A5HA 3A88A 1GBIA 1E38B 1CA0C 1ESBA 4UEHH 1GPZA 4OS2A 4X6PA 1HFDA 3A84A 2ZEBA 1GVLA 3ZVBA 2VINA 4OGXA 1AMHA 1OWHA 4NCYA 2GTBA 2CJIA 4BNRA 4CRFA 8GCHF 3GCNA 1V6DA 3PLPA 3P8FA 3FP7E 1WU1A 1ZPZA 2ZGBH 1TGSZ 1K1IA 2A2XH 1SQOA 1DPOA 2K1QA 3URCA 3F9HA 4AFUA 1EXFA 4HGCA 4I7YH 1PPHE 4CRGA 1KY9A 3UWJH 3ZZ6A 2H9TH 4O3TA 1LTOA 1THPB 1SGQE 5EXMA 4AG2A 2C8YB 3VEQB 1ZRBA 1O3AA 5LPEA 1JXPA 1HRTH 1O2SA 3A83A 1F7ZA 4WF8A 1BTZA 4INLA 1W3CA 3CS0A 1XM1A 2Z94A 3BTGE 1C5XB 1TONA 1ZZZA 5CHAC 2Z9LA 3SN8A 2WYJA 4E06H 3MU1A 2B7DH 3SUDA 1BMNH 2G5NA 5T6GA 1EOLA 1C4Y2 3KQBA 3BTWE 4MTBA 2OTVA 1AU8A 3TJOA 2C3SA 1VITG 3TIUA 2BLVA 1HAVA 5JB8S 1WAYB 1W8BH 2SGDE 4NGAH 3RP2A 1PQAA 3SNAA 4AGJA 2QCYA 1K2I1 4BAKB 4I33A 2OUAA 1OXGA 4HTCH 4IMZA 1QL9A 2YNBA 4X8VH 2TBSA 5C20A 1QRWA 2GV7A 3V7TA 1W7XH 3SJIA 2ZG0H 2SGAA 2YNAA 1MTNC 1N6YA 1SOZA 1GHYH 1A3EH 1GBMA 2WPKS 2BD2A 1XVMA 2A2QH 3ATKA 1Z8JB 4BTTB 1C1OA 3V0XA 4TWYA 3EDXB 1ACBE 1C5MD 1GWAA 4FUHA 2PTCE 1TA6A 2GD4B 3N7OA 1O5FH 3RC4A 2BXTH 5FAHA 3GCTG 1VITH 1G3CA 2BTCE 3E3TA 2ZO3H 1GJAB 2ZTXA 5GIBA 5K0HA 1MMJN 1TABE 3MO9A 2A4RA 1FAKH 1EPTB 1GBDA 3BG4C 1C1PA 4FVBA 3MYWA 4IBLH 2FXRA 2AGIX 2J4IA 1LQEA 1C5UA 4UFDH 6GCHG 4NIVA 3WY8A 4A6LA 1GJ8B 1C5PA 1TA2A 1ZMNA 3EA9A 1A4WH 1SGFG 3SV6A 2WINI 2HNTC 2FLBH 3MH6A 5C5NA 4IC5A 3RMNH 3UY9A 4A5TS 1C1QA 1UTMA 5E0HA 2CXVA 3VB6A 2VWMA 5F8TA 5EW2H 1C5RA 2A32A 1EASA 3EE0B 3RXGA 3E0PB 3SUEA 1QFKH 4LZ1H 3P8NA 1Q3XA 3A81A 2VIOA 1AD8H 2OP9A 3ZZCA 1YKTA 5E2PA 1GBEA 5FBEA 3VFEA 1F0UA 3ODDA 1GDQA 1H9IE 1HAYB 2SNWA 4QT8C 2CGAA 2QAAA 3HKJB 3UWIA 1DLKB 3OU0A 2PV9B 1BHXF