1Y3YA

Trypsin inhibitor complex
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
223
structure length
223
Chain Sequence
b'IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Trypsin, cationic
publication title A simple protocol to estimate differences in protein binding affinity for enantiomers without prior resolution of racemates.
pubmed doi rcsb
molecule tags Hydrolase
total genus 58
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2004-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1y3yA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1y3yA02
4Y0ZE 2STAE 2ANKH 2UWLA 2GT8A 3TJUA 1HPGA 1Y5AT 1LQEA 1C5SA 1TRYA 2HRVA 2QYIA 2OQ5A 4ISHH 5DP4A 3U8RH 2WV5A 4ABDA 3TVJB 4CRCA 1GI9B 4FU8A 5E2PA 5I25A 1AVWA 3A85A 1TA2A 2TRMA 5HMAA 2A4RA 1S85A 2F3CE 3RXLA 2FOBA 1CSOE 1FY4A 3F9HA 4X6OA 4D9RA 2BQ7B 1O5BB 1NU7B 2SNVA 1DWDH 3MOCA 3CS0A 2ZCHP 3EYDA 3OY5U 1NFUA 1KTSB 5FHTA 5DP3A 4A1XA 2C4FH 2J92A 2BDAA 1MAYA 3LC3A 4GHQA 2PSYA 2BOHB 1FZZA 1FNIA 1O3NA 3UFAA 2GKVE 1HGTH 1PPCE 2A45B 1T4UH 2QXJA 2HNTC 3SHCH 1RD3B 4A5TS 3SJ9A 1UCYK 3E1XB 4FUJA 1UTNA 2BVXH 2R0LA 3BTDE 3HKIB 1LVMA 1O3KA 1EZSC 5JDUB 1GI5A 3FFGA 2IOTA 3RXGA 2BVRH 3F6UH 1LHDH 3ZZDA 1S6FA 2GMTC 2H6MA 4OS5A 2EI6A 1NRQH 1CHOF 3HKJB 1V2WT 1WUNH 1Z8IB 1Z6EA 1OP0A 1GMDF 1MCTA 1ELAA 1MBQA 3EAJA 4B2CA 5SGAE 1TBZH 1VR1H 3QDZB 3SV9A 2YOLA 4I31A 1EKBB 4DIHH 1P01A 1F0TA 3P8GA 1DWEH 2AMQA 3SV7A 3EA9A 2FS9A 3PTNA 1RIWC 1ZMNA 1P9UA 3UR6A 3BTTE 1EJMA 1ELBA 3MU4A 3EE0B 2NU4E 1S84A 1VJ9U 4YZUA 1C5LH 4Y0YE 4BXSA 3A81A 3S69A 3LGTA 3QTOH 1BRCE 1CBWC 1XUJA 4UEHH 4IBLH 1UVPA 4FUBA 2ZHQH 3D49H 3A8AA 3ZVCA 2WPLS 4U2WA 3A7ZA 1DT2A 5EG4A 1SPJA 1OWJA 4FUCA 1YC0A 4XBDA 5C1UA 3M7UA 4MLFB 1A46H 4NWKA 1OP8A 4IS5A 2VVUA 1TX7A 4FUDA 3O8DA 4H6SB 3ESTA 1TQ0B 3MU1A 1MKXH 2ZHDA 5CMXH 5JYIA 4AORA 3FZDA 5FPYA 2ODPA 2QXIA 1Z8GA 2ILNA 4WF8A 3M3TA 5E2OA 1QGFA 3SNEA 5EPYA 3RMNH 1LVBA 4MNYA 1K1NA 1GBHA 3RLWH 2W5EA 2RCEA 1Y5BT 1J14A 3SV2H 4OGXA 2XC0A 1DM4B 3PO1B 5T3HA 1L4ZA 1ZMJA 3PLBA 3WY8A 4CH8B 1THSH 1K1JA 1QA7A 2JH0D 2PLXA 1EJNA 3SJ8A 2G8TA 3UREA 1GHVH 3S0NA 2FESH 4AX9H 2Y5HA 1RFNA 1H1BA 5I46H 2WUCA 3HK3B 1GHBG 2V3HH 5E0JA 5EW2H 4NIVA 4X1RU 2R3YA 3GCHC 4X6PA 1V2QT 3TH2H 4TPYA 2FXRA 2QAAA 1GBCA 1SGNE 2FIRH 2PGBB 3P92A 5F03A 2G52A 2Z9JA 1JRSA 1DXWA 1O2OA 4FXGH 4NA7A 4ISOA 1F5KU 2SFAA 3ZVBA 1HAVB 4CHAB 1O30A 1INCA 4ABGA 1DICA 4UE7H 1AO5A 1AVGH 1V2NT 2PKSC 3SGBE 3BTWE 4NWLA 1TRMA 3E16B 4DJZB 2ANYA 3NCLA 3T28A 1X7AC 2PV9B 1ZSKA 4NCYA 3LH1A 1HAXB 1EZQA 1LHFH 1C5UA 1L1GA 3HATH 1P11E 4FUIA 4AB9A 4X6NA 2RDLA 3KQCA 3AASA 2F9UA 1P2IA 1QJ6B 2PWXA 4AFUA 2JETC 2O8MA 4ZMAH 1IQJA 2FTMA 4A92A 2XCFA 2XRCA 2ZC9H 1GDUA 1KXBA 5C1YA 5EXMA 4CRAA 9LPRA 3A83A 5GIBA 2PUXB 2VWOA 3V7TA 2Y81A 2A7CA 4XOJA 2FLRH 1MZAA 1SGFG 1SLVB 2GD4B 2GCHG 3PROA 2I6QA 4UFFH 4RSPA 5FBEA 2R2MB 3A8DA 4YOGA 3L3TA 3ENSB 4TWYA 1UTJA 3RXDA 3NK8A 6LPRA 2GX4A 3T29A 4DVAU 4MG3A 2Q6GA 5HYOA 1MH0A 4JZDH 4ABHA 2P3TB 5JPMH 1O3MA 1ACBE 2BHGA 1LO6A 2VVVA 1C5QA 1FY8E 1QB9A 2F9OA 4YTAA 3M37A 1O37A 3V0XA 2QA9E 1ZHMA 3GY7A 2BD7A 2P8OC 4HZHA 4MPUA 4Y7BA 3C1KA 3Q77A 1A7SA 3GY6A 4IC6A 5CHAB 3SV6A 1W8BH 1EZUC 2G00A 1ZZZA 2VIQA 2D1JA 1BUIA 4WH8A 1EPTB 1SGDE 3URDA 1NY22 4Z0KA 1YCPH 1DWCH 1BMLA 1NTPA 2QCYA 2VJ1A 5IDKA 2FMJA 1Z1IA 1S0RA 3MWIU 3JZ2B 2ZU3A 2BB4A 1DITH 1ZSLA 1ABJH 1GI4A 3BG4B 1IAUA 3A86A 3P70B 1GVZA 2ZGBH 4FU7A 4DW2U 1B5GH 4WMDA 4BAMB 1J15A 1QRWA 1AE8H 3BF6H 2C8YB 3MH4A 1MAXA 3BEIB 1LHGH 1WTGH 1TLDA 3PWBA 3VB6A 2G4UA 3RMOH 1C9TA 2J9NA 1EP6A 1SSXA 2GTBA 3MO9A 3NXPA 4MPWA 1BTPA 1BOQA 3GCTF 1C4V2 1XUFA 3RP2A 1KXDA 4F4OC 3ODDA 2UWOA 1GHXH 1SGQE 3SU3A 1B0EA 1XKBC 1AQ7A 3GOVB 1GBTA 1TGTA 3SUFA 1O38A 1L1NA 2A5IA 2VWLA 3OY6U 2GT7A 3TGIE 1ZR0A 1A0JA 5A8ZA 1O2PA 1SGIB 2CN0H 3LGWA 2XBYA 2FI4E 3T27A 1QBOA 1T32A 3LIWA 4K2YA 1F92A 1K1OA 1MTNB 1C2DA 2GVFA 3ATWA 3PMAB 1NROH 2FX4A 1T4VH 1GI1A 1UCYH 1HBTH 1GG6B 1YGCH 5FAHA 1O2ZA 4R0IA 1TX8A 1THRH 3H5CB 1P04A 2FI5E 4M7GA 4UFGH 3P17H 3ZZ9A 1VCPA 3N7OA 1H9LB 4ASHA 1DUEA 4A1VA 3SI3H 1IQKA 1TNKA 2FOHA 1DWBH 2ZZUH 1ESAA 4GLYA 5IYTA 3F68H 1TPAE 1BJVA 1D6WA 1CQQA 1K22H 2ZTYA 4NSVA 2A4GA 1DLEA 1GGDC 1QJ7B 4GCHF 1P2KA 1SGFA 3FZZA 1NU9A 1ESTA 3FP6E 1O2WA 1S82A 2KAIB 3U9AH 2HGTH 5LH8A 3H7TA 2NU2E 1KLJH 3BTQE 1W12U 4I8GA 4I8KA 3P6ZB 2GGVB 1FV9A 1P57B 3M36A 3TGKE 1QNJA 4X2YA 1O2GH 2QF0A 1QQUA 1PPEE 2FI3E 1MD7A 3SBKA 6CHAB 5EQRA 1XVOA 2TGTA 1O2NA 3AAUA 1O2KA 1O3DA 3E0NB 4VGCC 1BMMH 1F5LA 1V2JT 2PTNA 4Y10E 5EOKA 4AFZA 3U98H 3MHWU 2GV6A 2ZDVH 3K65B 1LMWB 2HOBA 1CVWH 5AHGH 4X1PU 2OC0A 2PFEA 3MTYA 2BQWB 2VWNA 1EX3A 2QC2A 2SGFE 1TGBA 5DJ7A 1P0SH 4JZEH 1GJ9B 1CT0E 2BD8A 1TX6A 1O5CB 2VIVA 2ZCKP 1A3EH 1P05A 5GCHG 1A1RA 1O2SA 1RTLA 1XUKA 5AFZH 2F9VA 2SNWA 4BOHA 2BY5X 3SQHE 3QZQA 1BRAA 1TBRH 3F1SB 3LJJA 2H9TH 1M9UA 3A84A 3SHAH 3MO3A 2OBOA 1TPOA 1O5FH 4X2WA 1LTOA 1VGCC 2RG3A 1TNIA 1NFWA 3LGUA 3KL6A 1C1UH 3A7WA 4JZIA 1O33A 1AZ8A 4TY7A 1BTUA 3QGNB 1T8MA 1GI3A 1NN6A 1W7XH 3RXJA 3M5MA 3ZYDA 5BRRE 1LKAA 1NRPH 5FBIA 1HLTH 3BTME 4KTCA 1XX9A 2Z6BD 1GBKA 3TLOA 1GMCF 2XWAA 2CGAA 2ZKSA 1C1TA 3LGVA 1EAUA 3V12A 2EA3A 1ELGA 2OINA 5LGOA 1O3CA 1UHBA 3RXKA 3BG8A 2EI8A 1OWDA 2LNCA 2V35A 1AB9B 3SQEE 3BTHE 3A87A 9ESTA 5AFYH 1SOTA 1C2GA 4SGAE 1D3DB 2C8XB 2P59A 5DP7A 2ZPQA 1AHTH 1FPCH 1GVLA 4I7YH 4LZ4B 2A5AA 3PM3A 1H8IH 1HRTH 1G9IE 4O03A 1SGRE 4IN2A 2IPHA 4THNH 3RC6A 3RXVA 3V3MA 1F0SA 1HJ9A 3GDSA 4K60A 4BTIB 4FVDA 3BEUA 3TJVA 5E0GA 3NKKA 4ZKSU 1S0QA 1C1VH 1L2EA 3T25A 3QLPH 1BTWA 2JKHA 1WOFA 4HFPB 2Y6TA 3RU4T 1U6QA 3C27B 5TJXA 1TIOA 3VB5A 1O3OA 2XBVA 2ZNKH 1V2UT 2HNTE 3RM2H 2J4IA 1GJCB 1UVOA 4WMFA 3SGQE 2LPRA 5L30H 4LOYH 1P3CA 2H9HA 2PUQH 2C8ZB 3TK6A 8LPRA 1H8DH 4X1NU 1F0RA 1GJ8B 4NA9H 2O8UA 5AF9H 1BZXE 2ZFRH 2B8OH 1MTUA 4NFFA 2AMPA 1AIXH 4A6LA 1DOJA 1P2OA 1FQ3A 2BDCA 1GVKB 1S83A 4E7RG 1UVSH 3FAOA 1N6XA 4D7FA 3STIA 1C5NH 1EUFA 3ZVFA 3PMHB 2ZDAH 1RGQA 3GCOA 1B7XB 1AI8H 1SLUB 5JB8S 3B9FH 2PR3A 1GHYH 1O2UA 2GMTB 3GDVA 2B9LA 3GICB 5EQQA 2SGEE 4LXBH 2SGDE 2A0QB 1XMNB 1XXFA 1EAIA 3OYPA 1Y3WA 3RU4E 2F9BH 1B0FA 7LPRA 1DPOA 3PYHA 4INHA 3Q00A 3GYMA 1TOMH 3F9FA 3UWJH 2GCTC 1TFXA 2PKAB 1RIWB 1C5ZB 1PFXC 2V0BA 1O2MA 3K2UA 1AE5A 1ORFA 4JCNA 1W0ZU 4K1EA 4ZXXH 1IQLA 5JB9S 2Z3CA 1CBWB 1AGJA 4NIXA 1ZTKA 1YM0A 5JBBS 2THFB 1Y8TA 2FM2A 2QXGA 2STBE 3F9EA 4FUHA 3RMMH 2OCVB 5GCHF 2K1QA 2WINI 1BHXB 2G5VA 1KXFA 4AGJA 1O36A 4DOQA 3PLPA 3RXOA 1ARBA 1GBIA 4E7NA 1SGPE 4YO9A 3ZVAA 4B1TA 8GCHG 1NS3A 1UK4A 1HIAA 1O2HA 2BM2A 2JH6D 5ESBA 1P2MA 1VCQA 3KCGH 1ZGVA 2O8WA 4AZ2B 3KIDU 1AUTC 3L33A 4ZH8A 4CR5A 1KTTB 1W0YH 3SU5A 2XBXA 5DPAA 1GBFA 1SLWB 1KSNA 4U01A 2ZFQH 4OS4A 1A5GH 1GWAA 1HYLA 3RXIA 1O2VA 2R2WU 3UOUA 2OP9A 3Q76A 2F83A 1P09A 4GSOA 1OYTH 1SMFE 3EDXB 5EU8A 4WH6A 1C1WH 5LPEA 1YF4A 1XUIA 1O3AA 1SFQB 3PLKA 1V2LT 4U32A 1EAWA 3GCHB 3QN7A 3UNSA 1OYQA 4Y11E 2AMDA 1WTHD 2G51A 1EOJA 2IN2A 3URCA 2ZU5A 1FAKH 2OC7A 2FOAA 1PPFE 1ETSH 4Y7AA 3UR9A 3GCTG 1THPB 4Y71A 3SNDA 2ZFTA 2R3UA 2ZHFH 1S5SA 4INKA 3U1JB 1SFIA 2PKSB 4IGDA 3ZV9A 3Q3KA 2QIQA 2BLOA 1MD8A 1MTVA 4I8HA 2Y82A 1DLKB 5EW1H 1PPBH 4ISNA 4GPGA 1JIMA 1W7GH 2F9PA 3GY2A 3E3TA 4WJG2 1OX1A 2HLCA 5K0HA 4ZXYH 3SUEA 2JETB 1IQEA 1GBMA 2AH4X 2WPMS 4K8YA 3M5OA 1GI8B 1PYTC 1C5OH 3UWIA 1GJ5H 1HJAC 3ZVDA 3BTGE 2ANWA 4CRBA 2VGCC 3OSYA 3SW2B 1UTOA 3SNAA 1FIWA 3PB1E 3IG6B 1A5HA 3UQVA 1HUTH 1O2XA 3ZYEA 3IITA 1K1PA 2ZDKA 4IN1A 1S6HA 2NU1E 2SGPE 4GCHG 3RDZA 4ABEA 1KDQB 1ANEA 1L4DA 1HDTH 4TWWA 1DX5M 3VXFH 1KIGH 1ZTLA 4F49A 1BMAA 3M3SA 1JRTA 1FPHH 4JK6A 2AGEX 3VGCC 2ASUB 2Q6FA 1O0DH 2RA0A 2Y80A 5A0BA 2D26C 2CF8H 4CBNA 1ANBA 1GBBA 4MNVA 2PSXA 4BTTB 2ZHWH 1QRZA 1J8AA 2GZ7A 2P8OB 3RXTA 1C5XB 1OP2A 3FANA 2A7JA 4CRGA 1ANCA 1E38B 2BDGA 1DDJA 3TGJE 2XC5A 3A7XA 1HXEH 3UUZA 4I33A 3VXEH 3ZZAA 1IQIA 1O3EA 4RN6A 5FPSA 2VIWA 2C90B 3MH7A 4SGBE 2BX4A 3Q3XA 3SI4H 1SBWA 3CENA 2FOEA 1YPMH 1YPKH 5GDSH 3DHKH 1BRUP 4FUGA 3A8CA 1P12E 3D62A 3U8OH 3TU7H 5TCCA 1E34B 2VIDA 8GCHF 2OC1A 3GY8A 3S7KB 1RTFB 2W26A 4X1SU 1AN1E 1TNLA 3VB7A 1T8NA 5C5OA 4B2AA 2EEKA 1EXFA 2ZWLH 2XCNA 1LDTT 4XBCA 1A61H 1O5EH 7KMEH 4D9QA 2HVXA 2ZGJA 2ESTE 3D65E 2DE9A 5A0CA 2AS9A 2ULLA 3K6YA 1YLDA 1NT1A 1GCTC 3SZNA 3O8CA 1EQ9A 2QGRA 1SGTA 2Y5FA 1C1SA 1P2NA 2VINA 1YBWA 4INLA 1AVXA 1GMHG 1QURH 2VH0A 2HWLB 1DFPA 1GJ6A 2J34A 4I32A 2FYQA 1CT2E 4O3UA 2Z9GA 2H5CA 1MZDA 4CRFA 4MTBA 3DT0H 3QK1A 1JWTA 2EC9H 2O8LA 4BXWA 1O3FA 1UVTH 1GMCG 4X8VH 1C2MA 4X0WU 4FU9A 3CS7A 1BBRE 2W3IA 3TNSA 1P2JA 3LOXA 5ABWA 3NWUA 2ZU4A 3ZVEA 1AU8A 4K3JA 1FY5A 1A2CH 2TGPZ 1AKSA 4Y79A 4X8UH 1ELDE 2HALA 3S7HB 3LU9B 1C5MD 3ZZ4A 1C1QA 1PQAA 1MTSA 1FLEE 1NESE 2BLQA 1IOEA 2G55A 1GHAF 2BD3A 1GGDB 1T7CA 1YPEH 1K1LA 4CREA 1UO6A 1QR3E 4UFEH 3VEQB 4DG4A 5E8EH 3E6PH 1V2RT 2EI7A 3SOSA 1BJUA 1JOUB 4K1TA 3R0FA 2BDBA 2BD2A 4RKJB 1HFDA 2XBWA 1DVAH 1ZJKA 1ARCA 2ODYB 4DIIH 3QWCH 2GDEH 2ZU2A 1JMOH 1SQTA 1GHZA 5EQSA 2O8TA 3TPIZ 4OS7A 1UTLM 1ZRKA 3UNQA 1BBRK 2QN5T 2ZIQH 3SGAE 4WY3A 3A80A 2B0FA 2Z9LA 1A4WH 4FUFA 3MU0A 1CA0C 2ALVA 1C5WB 1GHWH 1EOLA 4VGCB 2F91A 2Z9KA 2FEQH 5EXNA 4FVBA 7GCHG 2A4QA 1K1MA 7ESTE 1ZRBA 1OSSA 2VIOA 3P95A 4Y76A 1AWHB 1PQ7A 1FN6A 3LH3A 4B71A 1WBGB 2ZFPH 3KN2A 1AZZA 4O9VA 3L6PA 4KP0A 3SO3A 3FP7E 2GZ9A 1WQVH 3SUGA 2ZEBA 1G37A 2A1DB 3SJKA 3RXMA 3LT3A 3M3VA 2P93A 2CJIA 1MKXK 4DGJA 1P9SA 1GDNA 4NIYA 2ZU1A 1E37B 1C9PA 3G01A 1Y5UT 3TK9A 2ZGCA 3MNXA 3OTJE 2BTCE 1VGCB 4DT7B 5T6GA 2ZCLP 1QBNA 2O9QA 1QFKH 2XTTB 2ZF0H 4UONA 1FI8A 1UJ1A 4TPIZ 1IHTH 5FCKA 2BD4A 2OBQA 1VCWA 4I8JA 4O97A 3ZVGA 1DY8A 2FTLE 3RXBA 3A82A 1WV7H 1VITH 1TMUH 3A7YA 1HAHH 1G3EA 2PHBA 5DGJA 5FX6A 1C2EA 2BZ6H 4PROA 2CHAC 3LDXH 1EASA 1YYY1 1A0LA 1Y3XA 3UQOA 3MH6A 1D4PB 3PWCA 1CT4E 1N8OC 1TGNA 1GJ7B 4ZAEA 5T6FA 2BY7X 3KQEA 4ZHAA 3HGPA 1N6YA 4IC5A 3EA7A 3RXPA 1GJBB 3DFJA 1D6RA 4JZ1A 1H4WA 2TIOA 4B76A 4AFQA 3TIUA 1HB0B 4Q7YA 1K2I1 3SU6A 5PTPA 4D8NA 3GYLB 1O3IA 3A7VA 4K8BA 2ALPA 3Q3YA 3E8LA 3M7QA 1GMHF 1KYNA 4YESB 4YOIA 2GDDA 3KGPA 4ESTE 1P2QA 1RXPA 3QO6A 5LPFA 2A31A 1G2LA 2YNAA 2VH6A 3GY4A 4Y8ZA 1NPMA 5JBAS 4ABAA 1QIXB 4B73A 2Q1JA 2BY6X 4Q7ZA 4K5ZA 2ZA5A 1TYNA 4H4FA 2BVSH 3BTEE 1V2ST 4XDEA 2BXTH 1E36B 3QX5H 2GV7A 2J94A 5GJ4B 4FUEA 1HAIH 3D23A 1G30B 2AIQA 2SGQE 3ZV8A 1QJ1B 2P3FH 1GI6A 1Y59T 2FP7B 3M5LA 1WYKA 5FXLA 3ZZ8A 1EP5A 2XC4A 5DO4H 5EGMA 1GI0A 1G32B 3H7OA 2ZI2H 4ZHLU 4Y6DA 4X6MA 4MPVA 5JBTA 1W2KH 1TPPA 3SNCA 4MQAA 4ABFA 3ATKA 3HGNA 1BTYA 8KME2 4ZKRU 3EQ0H 4AG2A 1Z8RA 3HPTB 2AYWA 3JZ1B 3RUOA 3MFJA 3VB4A 1V2MT 1C2LA 3O8BA 2UWPA 1C4U2 1HAVA 3GDUA 1P8VC 1HV7A 3HK6B 3MU8A 1O35A 4UD9H 1SC8U 2ZTZA 2CMYA 4AG1A 4A7IB 1ZPCA 3P8FA 4E06H 4BNRA 1VZQH 1Z7KA 2QXHA 1OS8A 1AUJA 4BAKB 2UUFB 2C8WB 4OS2A 2WPIS 1C5TA 2BX3A 1ANDA 2GCTB 7GCHF 1QB6A 3SN8A 2Z3DA 1L0ZA 4KTSA 1VJAU 4IW4E 3UY9A 5L2ZH 2DE8A 1BTXA 2UUKB 2VNTA 2D8WA 1AWFH 1HAYB 2AERH 1ELFA 4MVNA 2BY9X 3I78A 3M61U 2BMGB 3LJOA 3EA8A 1AY6H 3QZRA 1ZJDA 1PJPA 4LZ1H 5C3NA 2M5TA 1E35B 4Q2KA 3TK5A 1UTQA 2BD5A 1UCYE 2AGIX 3P8OA 1CU1A 3P8NA 1QL8A 1UK3A 1F2SE 1XM1A 5L2YH 3SU2A 1GL0E 1ETRH 3MNSA 1WCZA 1DS2E 1LPKB 2BDIA 1Q31A 2FZZA 1UTMA 1ZPZA 4KGAA 2R0KA 3TJNA 1GJ4H 1GPZA 3M7TA 1QHRB 1WSSH 1FN8A 1TWXB 3K9XB 4YLQH 1TAWA 5E0HA 4JZFH 2B7DH 1C1MA 3RLYH 8ESTE 1HJ8A 3R3GB 1MU6B 4J1YA 2FOGA 1L1JA 1OWIA 1CGJE 2OC8A 2AEIH 2VIPA 1IQHA 2FDAA 1O5DH 1SLXB 2W7SA 1BITA 3UTUH 3ATIA 1BTZA 3NPSA 1IQFA 1YPLH 1C2FA 4HI3A 4JMYA 4WWYA 1ZSJA 1UTKA 1EPTA 2BQ6B 4JK5A 1LQDB 5HGGA 2WYGA 1SI5H 1V6DA 6GCHG 5DP5A 1AFQB 5FX5A 1TGCA 1K21H 3SJIA 2B5TB 4CBOA 1Z6JH 4D7GA 1G3CA 1UMAH 3PV4A 1IQNA 4JYTA 5TCAA 5A0AE 3AW1A 1BBRH 5DKMA 4Q7XA 3OU0A 1TA6A 3BIUH 1BT7A 1MQ6A 2XW9A 3UIRA 5C20A 2R9PA 3TITA 2CV3A 1MU8B 3TNTA 1PPZA 3K6ZA 2H1UA 5ESTE 3E91A 1HAZB 3A7TA 3CP7A 4CH2B 1FUJA 1O3LA 2Y5GA 2Z3EA 3MU5A 3ZZ7A 1TQ7B 3VPKA 1D3PB 1HAPH 2VVCA 3SORA 5A8XA 3SU1A 1Y3UA 3T26A 4YT7H 4XFQA 1XUGA 2FODA 4NSYA 1C2JA 2ANMH 3SNBA 2ZECA 4CR9A 1F0UA 1BMNH 1TABE 1SB1H 2BLWA 1AFQC 2PTCE 1C5PA 1QY6A 1GJAB 1H9HE 1QL9A 3STJA 1W11U 2J95A 1NFXA 1RJXB 5EXLA 1C1PA 2ZQ1A 1AFEH 1HJAB 5J4SA 1C2HA 1TB6H 3RU4D 1LPGB 1O3PB 2VGCB 1ZMLA 3T62A 1O2RA 1P06A 2TPIZ 1LCYA 1MQ5A 3M5NA 4NG9H 5A8YA 1BIOA 3LONA 1PPGE 2ZGXH 3ZZ6A 4Y8YA 1GHAG 1UHBB 4WXVA 2AFQB 1RTKA 1Y3VA 2Y7ZA 4WXIA 2QY0B 3RXSA 1MUEB 1GI7B 4HTCH 3RM0H 3VGCB 2A2QH 4UFDH 5GXPA 4NA8A 5HXFA 1SVPA 1A3BH 1K28D 1UK2A 1EAXA 3E0PB 1PPHE 1G2MA 2HPPH 2V3OH 1V2TT 1XXDA 2H5DA 3RXCA 2KAIA 2OQUA 1CHGA 1NM6A 3AW0A 1O3GA 2P95A 2ZG0H 2GP9B 1Z8JB 1HAGE 3ELAH 4XSKU 1OPHB 1DY9A 1MBMA 3KHVA 4U30A 4B74A 3QUMP 4AFSA 4GVUA 1FJSA 4WVPE 2FOMB 1DE7H 1Q3XA 1SHYA 3AAVA 1TNGA 1P10A 4OS1A 3PO1C 2G5NA 2FX6A 1G36A 4ABIA 3SU0A 1DSUA 4BTUB 1FONA 4BAHB 1HAOH 4KTUA 4AB8A 4I8LA 4AGKA 1DSTA 3DFLA 2BXUH 4YM9A 1Z71A 3FVFB 2FOCA 2UUYA 1DUAA 1Z1JA 1MTWA 1F7ZA 1SL3A 1O2IA 1P3EA 1PYTD 1MCVA 1QRXA 3PTBA 5G4BA 3M35A 1WU1A 4NZQA 4AYVB 2C93B 3E90B 2ZTXA 1SHHB 2IJOB 3ODFA 5C67A 1MKWK 3LPRA 3IWMA 1SQAA 3RXUA 3ITIA 2OTVA 3MH5A 4CHAC 1W13U 1GCTB 1YPGH 1CGHA 2TGAA 1G3DA 4ZHMU 4ZUHA 2XNIA 1GBLA 3F9GA 3MNCA 5EODA 1J16A 1BQYA 4A1TA 4GAWA 4YT6H 1T31A 1YP9A 1YPHE 1D9IA 1QL7A 4X8SH 4H6TA 1W10U 3A89A 4AYYB 1SGEE 4XE4A 3MI4A 3RMLH 6GCHF 3ZZ5A 4LK4A 1TRNA 2ZDLA 1NZQH 4YOJA 1AMHA 4X2VA 4BAQB 4DURA 5C1XA 1T8LA 5HM2A 3O8RA 1O5GH 3LKWA 2V6NA 5A09A 2A7HA 1KY9A 2AGGX 5F8ZA 5FPTA 3LGYA 1EJAA 2A4OA 1ZHRA 5L6NH 4MPXA 4AOQA 1IQMA 2OUAA 1C5VA 1BTHH 1DXPA 1TBQH 1C2IA 3MMGA 2ZPSA 5DP9A 1QQ4A 1V2OT 3S9AA 1O2LA 2XWBI 2VB0A 1O5AB 1N1LA 1MMJN 5LPRA 2W7UA 4BAOB 1JXPA 1NO9H 2ZFSA 1J9CH 5DP6A 1ELCA 2NWNA 1CGIE 3A8BA 1CA8B 1TGSZ 3TJOA 1ZGIA 1HIAB 1GJDB 3MYWA 1DANH 5CE1A 1FDPA 1CO7E 1O3BA 1OWKA 2J2UA 1C4Y2 1RS0A 3SUDA 4HGCA 3RXQA 2BDHA 3AVZA 1YPHC 1LPZB 1S81A 2ZDNA 3KNXA 1SG8B 3PMJA 3RXEA 2PGQB 4NFEA 1VITG 4X2XA 4XBBA 4AN7A 4ZKNU 2RA3A 2ZQ2A 5FCRA 1XVMA 2BZAA 4KKDA 3PMBB 3BEFB 1ETTH 1ELEE 1CA0B 2Z7FE 4JYUH 5CHAC 1YKTA 2W3KA 2XXLA 3BTKE 4DCDA 2SGAA 4YLUA 1PQ8A 2FS8A 1EPTC 2QV1A 3BTFE 2BD9A 3SU4A 1RRKA 2CF9H 3VFEA 5HM9A 2Z94A 5DG6A 3RC5A 2FOFA 4NIWA 2H9EH 1GDQA 2UUJB 1WQSA 4X8TH 1G3BA 3DD2H 3A88A 1ESBA 3BG4C 5EPNA 2BOKA 2P94A 1CE5A 3UPEA 1GBEA 3MNBA 2OXSA 1GHBF 1JBUH 5F8TA 5GPIB 3W94A 1A0HB 1FAXA 3GY3A 3KF2A 1EATA 1ELVA 4IMZA 1LHCH 5JBCS 2Q6DA 1LHEH 1GCDA 1K1IA 4H42U 4ISIH 4UDWH 1P02A 6ESTA 4B75A 4WMEA 1TMBH 1O39A 3U8TH 2J38A 3T5FH 2GZ8A 2A32A 3DUXH 1C1OA 4K1SA 2ODQA 4TYDA 2DUCA 4ZROA 5ETXA 3RXRA 2HNTF 1H9IE 1NRRH 3UNRA 3VB3A 2VU8E 1QCPA 1YCPM 1TALA 2JH5D 2BDYA 1GL1A 1EZXC 2CHAB 1D3TB 1V2PT 1NRNH 1MTNC 2PKAA 3KEEA 1BA8B 1F5RA 3BIVH 1XUHA 1N8OB 1V3XA 4B2BA 3BN9A 1O2TA 4JYVH 2I6SA 1KLTA 4Y8XA 3SJOA 2WUBA 1SR5C 2WPJS 3S9BA 1GG6C 1C5RA 2G4TA 2HPQH 3GCNA 3U1IB 3I77A 1EB2A 4QT8C 3UOPA 4MNXA 2TGDA 3BSQA 2BYAX 3KQBA 4E05H 1K9OE 1TE0A 1TOCB 3ZZ3A 1ZHPA 1QB1A 1HCGA 4GUXA 4NZLA 3BV9B 3S9CA 3TH3H 3GISB 1OOKB 1J17T 2A5KA 1P03A 1V2VT 4IMQA 2GCHF 1HNEE 2WPKS 2F9NA 4CRDA 1FY3A 3ATLA 4Z6AH 4ABJA 4R8TB 4OS6A 1GBAA 1FY1A 3B8JA 3ZZBA 3QTVH 4DY7B 1QTFA 3GY5A 1BHXF 1Y3YA 1YLCA 3QGJA 1O3JA 1LVOA 1V2KT 1O31A 1IHSH 2ZFFH 1PQ5A 2OD3B 1C5YB 1ELTA 1W14U 1HXFH 1O2YA 3B23B 3ATMA 1KXAA 4MDSA 2ZO3H 3RXAA 5C5NA 1CHOG 1C1NA 1TNHA 1ZLRA 1FXYA 5AVDA 3OX7U 2P16A 4RKOB 1GMDG 4KELA 6CHAC 2C3SA 3ZZCA 3EGKH 1NFYA 1O2JA 2G81E 1ABIH 2ZPRA 5B6OA 1NRSH 1XKAC 1LKBA 3NUMA 1FIZA 5C2ZA 1OXGA 2ZP0H 1C1RA 1GBJA 3V13A 1TNJA 1E0FD 1ZYOA 1AD8H 3I29A 1ZOMA 1LVYA 2CXVA 2WPHS 4BANB 4D76A 2FYRA 1VITF 2FO9A 5GWZA 1ID5H 1ZPBA 4ISLA 2TBSA 1BDAA 1QA0A 1TPSA 2FWWA 1W3CA 3W95A 4OGYA 1SOZA 2WYJA 4MNWA 2AIPA 2VWMA 1C2KA 4Q80A 3TH4H 2P3UB 3DA9B 2NU0E 1OWEA 1ZTJA 1EB1H 1O3HA 1O2QA 1A5IA 4ZKOU 1UTPA 1IQGA 1FMGA 5A2MH 1GI2A 1OWHA 2OLGA 1YPJH 3RXHA 2Y7XA 3NZIA 1MKWH 2ZHEH 4X1QU 1BRBE 1Q2WA 5DK1A 1BCUH 1SQOA 4O3TA 4TY6A 1JIRA 1T8OA 2WV4A 1TONA 3RC4A 2QF3A 2FPZA 4GHTA 3LGIA 5K7RA 1KXEA 1D3QB 5H4IB 2ZGHA 2FLBH 1SGYE 1BB0B 5F8XA 5DP8A 1AKSB 2ZDMA 1OKXA 3RXFA 1QBVH 5BPEA 2NU3E 3U69H 1WAYB 4NGAH 5J4QA 1KXCA 3T2NA 1O34A 2BY8X 1O32A 2YNBA 1SGCA 2A2XH 3SV8A 2H2ZA 3LC5A 2Z9IA 3FP8E 5F6MA 1KLIH 4J2YB 1NC6A 1GBDA 2PW8H 2BLVA 1KDQA 1AB9C 1YCPK 4ABBA 4K69A 1TMTH 3KQDA 1UVUH 2D2DA 2XYAA 3MO6A 5T6DA
chains in the Genus database with same CATH superfamily
4Y0ZE 1NBME 2STAE 2ANKH 2UWLA 2GT8A 3TJUA 1HPGA 3AK5A 1Y5AT 1LQEA 1C5SA 1TRYA 2HRVA 2QYIA 2OQ5A 4ISHH 5DP4A 3U8RH 2WV5A 4ABDA 3TVJB 4CRCA 1GI9B 4FU8A 5E2PA 5I25A 1AVWA 3A85A 1TA2A 2TRMA 5HMAA 1EFRD 2A4RA 3F0OA 1S85A 2F3CE 3RXLA 2K8IA 2FOBA 1CSOE 1FY4A 3F9HA 4X6OA 4D9RA 2BQ7B 1O5BB 1NU7B 2SNVA 1DWDH 3MOCA 3CS0A 2ZCHP 3EYDA 3OY5U 1NFUA 1KTSB 3MQKC 5FHTA 5DP3A 4A1XA 2C4FH 2J92A 2BDAA 1MAYA 3LC3A 4GHQA 2PSYA 2BOHB 1FZZA 1FNIA 5DN6D 1O3NA 3UFAA 2GKVE 1HGTH 1PPCE 2A45B 1T4UH 2QXJA 2HNTC 3SHCH 1RD3B 4A5TS 3SJ9A 1UCYK 3E1XB 4FUJA 1UTNA 2BVXH 2R0LA 3BTDE 3HKIB 1LVMA 1O3KA 1EZSC 3FO8D 1GI5A 3FFGA 5JDUB 2IOTA 3RXGA 2BVRH 3F6UH 1LHDH 3CNRA 3DSGA 3ZZDA 1S6FA 2GMTC 2H6MA 4OS5A 2EI6A 1NRQH 1CHOF 3HKJB 1V2WT 1WUNH 1Z8IB 1Z6EA 1OP0A 1GMDF 1MCTA 1ELAA 1MBQA 3EAJA 4B2CA 5SGAE 1TBZH 1VR1H 3QDZB 3SV9A 2YOLA 4I31A 1EKBB 4DIHH 1P01A 4Q4LA 1F0TA 3P8GA 1DWEH 2AMQA 3SV7A 3EA9A 2FS9A 3PTNA 1RIWC 1ZMNA 1P9UA 3UR6A 3BTTE 1EJMA 1ELBA 3MU4A 3EE0B 2NU4E 1S84A 1VJ9U 4YZUA 1C5LH 4Y0YE 4BXSA 3A81A 3S69A 3LGTA 3QTOH 1BRCE 1CBWC 1XUJA 4UEHH 4IBLH 1UVPA 4FUBA 2ZHQH 3D49H 3A8AA 3ZVCA 2WPLS 4U2WA 3A7ZA 1DT2A 5EG4A 1SPJA 1OWJA 4FUCA 1YC0A 4XBDA 5C1UA 3M7UA 4MLFB 1A46H 4NWKA 1OP8A 4IS5A 2VVUA 1TX7A 4FUDA 3O8DA 4H6SB 3ESTA 1TQ0B 3MU1A 4RT0A 3DSOA 1MKXH 2ZHDA 5CMXH 5JYIA 4AORA 3FZDA 5FPYA 2ODPA 2QXIA 1Z8GA 2ILNA 4WF8A 3FOAA 3M3TA 5E2OA 1QGFA 3SNEA 5EPYA 3RMNH 1LVBA 4MNYA 1K1NA 1GBHA 3RLWH 2W5EA 2RCEA 1Y5BT 1J14A 3SV2H 4OGXA 2XC0A 1DM4B 3PO1B 5T3HA 1L4ZA 5EIYA 1ZMJA 3PLBA 3WY8A 4CH8B 1THSH 1K1JA 1QA7A 2JH0D 2PLXA 1EJNA 3SJ8A 2G8TA 3UREA 3PRBA 1GHVH 3S0NA 2FESH 4AX9H 2Y5HA 1RFNA 1H1BA 5I46H 2WUCA 3HK3B 1GHBG 2V3HH 5E0JA 5EW2H 4NIVA 4X1RU 2R3YA 3GCHC 4X6PA 1V2QT 3TH2H 4TPYA 2FXRA 2QAAA 1E1RD 1GBCA 1SGNE 2FIRH 2PGBB 3P92A 5F03A 2G52A 2Z9JA 1JRSA 1DXWA 1O2OA 4FXGH 4NA7A 4ISOA 2GJGA 4B6FA 1F5KU 2SFAA 3ZVBA 1HAVB 4CHAB 1O30A 1INCA 4ABGA 1DICA 4UE7H 1AO5A 1AVGH 1V2NT 2PKSC 3SGBE 3BTWE 4NWLA 1TRMA 3E16B 4DJZB 2ANYA 3NCLA 3T28A 1X7AC 2PV9B 1ZSKA 4NCYA 3LH1A 1HAXB 1EZQA 1LHFH 1C5UA 1L1GA 3HATH 1P11E 5T1VA 4FUIA 4AB9A 4X6NA 2RDLA 3KQCA 3AASA 2F9UA 1P2IA 1QJ6B 2PWXA 4AFUA 2JETC 2O8MA 4ZMAH 1IQJA 2FTMA 4A92A 2XCFA 2XRCA 2ZC9H 1GDUA 1KXBA 5C1YA 5EXMA 4CRAA 9LPRA 3A83A 5GIBA 2PUXB 3U28C 2J98A 2VWOA 1YWUA 3V7TA 2Y81A 2A7CA 4XOJA 2FLRH 1MZAA 1SGFG 4F48B 1SLVB 2GD4B 2GCHG 3PROA 2I6QA 1H8HD 4RSPA 4UFFH 5FBEA 2R2MB 3A8DA 4YOGA 3L3TA 3OE7D 3ENSB 4TWYA 1UTJA 3RXDA 3NK8A 6LPRA 4P00A 2GX4A 3T29A 4DVAU 4MG3A 3N99A 2Q6GA 5HYOA 1MH0A 4JZDH 4ABHA 2KX4A 2J97A 1UW7A 2P3TB 5JPMH 1O3MA 1ACBE 2BHGA 1LO6A 2VVVA 2KCOA 1C5QA 1FY8E 1QB9A 2F9OA 4YTAA 3M37A 1O37A 3V0XA 2QA9E 1ZHMA 3GY7A 2BD7A 2P8OC 4HZHA 4MPUA 4Y7BA 3C1KA 3Q77A 1A7SA 3GY6A 4IC6A 5CHAB 3SV6A 1W8BH 1EZUC 2G00A 1ZZZA 2VIQA 2D1JA 1BUIA 4WH8A 1EPTB 1SGDE 3URDA 1NY22 4Z0KA 1YCPH 1DWCH 1BMLA 1NTPA 2QCYA 2VJ1A 2YMSB 5IDKA 2FMJA 1Z1IA 1S0RA 3MWIU 3JZ2B 2ZU3A 2BB4A 1DITH 1ZSLA 1ABJH 1GI4A 3BG4B 1IAUA 3A86A 3P70B 1GVZA 2ZGBH 4FU7A 4DW2U 1B5GH 4WMDA 4BAMB 1J15A 1QRWA 1AE8H 3BF6H 2C8YB 3MH4A 1MAXA 3BEIB 1LHGH 1WTGH 1TLDA 3PWBA 3VB6A 2G4UA 3RMOH 1C9TA 2J9NA 1EP6A 1SSXA 2GTBA 3MO9A 3NXPA 4MPWA 1BTPA 1BOQA 3GCTF 1C4V2 1XUFA 3RP2A 1KXDA 4F4OC 3ODDA 2UWOA 1GHXH 1SGQE 3SU3A 1B0EA 1XKBC 1AQ7A 3GOVB 1GBTA 1TGTA 3SUFA 1O38A 1L1NA 2A5IA 2VWLA 3OY6U 2GT7A 3TGIE 2LELA 1ZR0A 1A0JA 5A8ZA 1O2PA 1SGIB 2CN0H 3LGWA 2XBYA 2FI4E 3T27A 1QBOA 1T32A 3LIWA 4K2YA 1F92A 1K1OA 1MTNB 1C2DA 2GVFA 3ATWA 3PMAB 1NROH 2FX4A 1T4VH 1GI1A 1UCYH 1HBTH 1GG6B 1YGCH 5FAHA 1O2ZA 4R0IA 1TX8A 1THRH 3H5CB 1P04A 1OHHD 2FI5E 4M7GA 4UFGH 3P17H 3ZZ9A 1VCPA 3N7OA 1H9LB 4ASHA 1DUEA 4A1VA 3SI3H 1IQKA 1TNKA 2FOHA 2YMSD 1DWBH 2V3MA 1ESAA 2ZZUH 4GLYA 5IYTA 3F68H 1TPAE 1BJVA 1D6WA 1CQQA 1K22H 2ZTYA 4NSVA 2A4GA 1DLEA 1GGDC 1QJ7B 4GCHF 1P2KA 2PP6A 2HLDD 1SGFA 3FZZA 1NU9A 1ESTA 3FP6E 1O2WA 1S82A 2KAIB 3U9AH 2HGTH 5LH8A 3H7TA 2NU2E 1KLJH 3BTQE 1W12U 4I8GA 4YXWD 4I8KA 3P6ZB 2GGVB 1FV9A 1P57B 3M36A 3TGKE 1QNJA 4X2YA 1O2GH 3OAAD 2QF0A 1QQUA 1PPEE 2FI3E 1MD7A 3SBKA 6CHAB 5EQRA 1XVOA 2TGTA 1O2NA 3AAUA 1O2KA 1O3DA 3E0NB 4VGCC 1BMMH 1F5LA 1V2JT 2PTNA 4Y10E 5EOKA 4AFZA 3U98H 3MHWU 2GV6A 2ZDVH 3K65B 1LMWB 2HOBA 1CVWH 5AHGH 4X1PU 2OC0A 2PFEA 3MTYA 2BQWB 2VWNA 1EX3A 4ACAA 2QC2A 2SGFE 1TGBA 5DJ7A 1P0SH 4JZEH 1GJ9B 1CT0E 2BD8A 1TX6A 5C0TA 1O5CB 2VIVA 2ZCKP 1A3EH 5KGOA 1P05A 5GCHG 1A1RA 1O2SA 1RTLA 1XUKA 5AFZH 2F9VA 2SNWA 4BOHA 2BY5X 3SQHE 3QZQA 1BRAA 1TBRH 3F1SB 3LJJA 2H9TH 1M9UA 3A84A 3SHAH 3MO3A 2OBOA 1TPOA 1O5FH 2WPDD 4X2WA 1LTOA 1VGCC 2RG3A 1TNIA 1NFWA 3LGUA 3KL6A 1C1UH 3A7WA 4JZIA 1O33A 1AZ8A 4TY7A 1BTUA 2EY4C 1T8MA 1GI3A 3QGNB 1NN6A 1W7XH 3RXJA 3M5MA 3ZYDA 5HKKD 5BRRE 1LKAA 1NRPH 5FBIA 1HLTH 3BTME 4KTCA 1XX9A 2Z6BD 1GBKA 3TLOA 1GMCF 2XWAA 2CGAA 2ZKSA 1C1TA 3LGVA 1EAUA 3V12A 2EA3A 1ELGA 2OINA 5LGOA 1O3CA 1UHBA 3RXKA 3BG8A 2RDEA 2EI8A 1OWDA 2LNCA 2V35A 1AB9B 3SQEE 3BTHE 3A87A 2XOKD 9ESTA 2WSSD 5AFYH 1SOTA 1C2GA 4SGAE 1D3DB 2C8XB 2P59A 5DP7A 2ZPQA 1AHTH 1FPCH 1GVLA 4I7YH 4LZ4B 3WWBA 2A5AA 3PM3A 1H8IH 1HRTH 1G9IE 4O03A 1SGRE 4IN2A 2IPHA 4THNH 3RC6A 3RXVA 3V3MA 1F0SA 1HJ9A 3GDSA 4K60A 4BTIB 4FVDA 3BEUA 3TJVA 5E0GA 3NKKA 4ZKSU 1S0QA 1C1VH 1L2EA 3T25A 3QLPH 1BTWA 2JKHA 1WOFA 2KCAA 4HFPB 2Y6TA 3RU4T 1U6QA 5C94A 3C27B 5TJXA 1TIOA 3VB5A 1O3OA 2XBVA 2ZNKH 1V2UT 2HNTE 3RM2H 2J4IA 1KMHB 1YY3A 1GJCB 1UVOA 4WMFA 3SGQE 2LPRA 5L30H 4LOYH 1P3CA 2H9HA 2PUQH 2C8ZB 3TK6A 8LPRA 1H8DH 4X1NU 1F0RA 1GJ8B 4NA9H 2O8UA 1YLNA 5AF9H 1BZXE 2ZFRH 2B8OH 1MTUA 4NFFA 2AMPA 1AIXH 3DCLA 3PV5A 4A6LA 1DOJA 1P2OA 1FQ3A 2BDCA 1GVKB 1S83A 4E7RG 1UVSH 3FAOA 1N6XA 4D7FA 3STIA 1C5NH 1EUFA 3ZVFA 3PMHB 2ZDAH 1RGQA 3GCOA 1B7XB 1AI8H 1SLUB 5JB8S 3B9FH 2PR3A 1GHYH 1O2UA 2GMTB 3GDVA 2B9LA 3GICB 5EQQA 2SGEE 4LXBH 2SGDE 2A0QB 1XMNB 1XXFA 1EAIA 3DSPA 3OYPA 1Y3WA 3RU4E 2F9BH 1B0FA 7LPRA 1DPOA 3PYHA 4INHA 3Q00A 3GYMA 1TOMH 3F9FA 3UWJH 2GCTC 1TFXA 3KQ5A 2PKAB 1RIWB 1C5ZB 1PFXC 2V0BA 1O2MA 3K2UA 1AE5A 1ORFA 4JCNA 1W0ZU 4K1EA 4ZXXH 1IQLA 5JB9S 2Z3CA 1CBWB 1AGJA 5HIYA 4NIXA 1ZTKA 1YM0A 5JBBS 2THFB 1Y8TA 2FM2A 2QXGA 2STBE 3F9EA 4FUHA 3RMMH 2OCVB 5GCHF 2K1QA 2WINI 1BHXB 2G5VA 1KXFA 4AGJA 1O36A 2QE7D 4DOQA 3PLPA 1E79D 3RXOA 1ARBA 1GBIA 4E7NA 1SGPE 4YO9A 3ZVAA 4B1TA 8GCHG 1NS3A 1UK4A 1HIAA 1O2HA 2BM2A 2JH6D 5ESBA 1P2MA 1VCQA 3KCGH 1ZGVA 2O8WA 4AZ2B 3KIDU 1AUTC 3L33A 4ZH8A 4CR5A 1KTTB 1W0YH 3SU5A 2XBXA 4XRNA 5KEDA 3KYFA 5DPAA 4FOUC 3UB0A 3SZEA 1GBFA 1SLWB 1KSNA 1NBMD 4U01A 2ZFQH 4OS4A 1A5GH 1GWAA 1HYLA 3RXIA 1O2VA 2R2WU 3UOUA 2OP9A 3Q76A 2F83A 1P09A 4GSOA 1OYTH 1SMFE 3EDXB 5EU8A 4WH6A 1C1WH 3F2FA 5LPEA 1YF4A 1XUIA 1O3AA 1SFQB 3PLKA 1V2LT 4U32A 1EAWA 3GCHB 3QN7A 3UNSA 1OYQA 4Y11E 2AMDA 1WTHD 2G51A 1EOJA 2IN2A 3URCA 2ZU5A 1FAKH 2OC7A 2FOAA 1PPFE 1ETSH 4Y7AA 3UR9A 3GCTG 1THPB 4Y71A 3SNDA 2ZFTA 2R3UA 2ZHFH 1S5SA 4INKA 3U1JB 1SFIA 2PKSB 4IGDA 3NRLA 4ZCNA 3ZV9A 3Q3KA 2QIQA 2BLOA 1MD8A 1MTVA 4I8HA 2Y82A 1DLKB 5EW1H 1PPBH 4ISNA 4GPGA 1JIMA 1W7GH 2F9PA 3GY2A 3E3TA 4WJG2 1OX1A 2HLCA 5K0HA 4ZXYH 3SUEA 1SKYE 2JETB 1IQEA 1GBMA 2AH4X 2WPMS 4K8YA 3M5OA 1GI8B 1PYTC 1C5OH 1H8ED 2EQNA 3UWIA 1GJ5H 1HJAC 3ZVDA 3BTGE 2ANWA 4CRBA 2VGCC 1SQRA 3OSYA 3SW2B 1UTOA 5C0UA 3SNAA 1FIWA 3PB1E 3IG6B 1A5HA 3UQVA 1HUTH 1O2XA 2CK3D 3ZYEA 3IITA 1K1PA 1W0JD 2ZDKA 1S6HA 4IN1A 2NU1E 2SGPE 4GCHG 3RDZA 4ABEA 1KDQB 1ANEA 1L4DA 1HDTH 4TWWA 1DX5M 3VXFH 1KIGH 1ZTLA 4F49A 1BMAA 3M3SA 1JRTA 1FPHH 4JK6A 2AHME 2AGEX 3VGCC 2ASUB 2Q6FA 3KYGA 1O0DH 2RA0A 2Y80A 5A0BA 2D26C 2CF8H 4CBNA 1ANBA 1GBBA 4MNVA 2PSXA 4BTTB 2ZHWH 1QRZA 1J8AA 2GZ7A 2P8OB 3RXTA 1C5XB 1OP2A 3FANA 2A7JA 4CRGA 1ANCA 1E38B 2BDGA 2K0QA 1DDJA 3TGJE 2XC5A 3A7XA 1HXEH 3UUZA 4I33A 3VXEH 3ZZAA 1IQIA 1O3EA 4RN6A 5FPSA 2VIWA 2C90B 3MH7A 4SGBE 2BX4A 3Q3XA 3SI4H 1SBWA 3CENA 2FOEA 1YPMH 1YPKH 5GDSH 3DHKH 1BRUP 4FUGA 3A8CA 1P12E 3D62A 3U8OH 3TU7H 5TCCA 1E34B 2VIDA 8GCHF 2OC1A 3GY8A 3S7KB 1RTFB 2W26A 4X1SU 1AN1E 1TNLA 3VB7A 1T8NA 5C5OA 4B2AA 2EEKA 1EXFA 2ZWLH 2XCNA 1LDTT 4XBCA 1A61H 1O5EH 7KMEH 4D9QA 2HVXA 2ZGJA 2ESTE 3D65E 2DE9A 5A0CA 2AS9A 2ULLA 3K6YA 1YLDA 1NT1A 1GCTC 2JJ2D 3SZNA 3O8CA 1EQ9A 2QGRA 1SGTA 2Y5FA 1C1SA 1P2NA 2VINA 1YBWA 4INLA 4ASUD 1AVXA 1GMHG 1QURH 2VH0A 2HWLB 1DFPA 1GJ6A 2J34A 4I32A 2FYQA 1CT2E 4O3UA 2Z9GA 2H5CA 1MZDA 4CRFA 4MTBA 3DT0H 3QK1A 1JWTA 2EC9H 2O8LA 4BXWA 1O3FA 1UVTH 1GMCG 4X8VH 1C2MA 4X0WU 4FU9A 3CS7A 1BBRE 2W3IA 3TNSA 1P2JA 4ACBA 3LOXA 5ABWA 3NWUA 2ZU4A 3ZVEA 1AU8A 4K3JA 1FY5A 1A2CH 2TGPZ 1AKSA 4Y79A 4X8UH 1ELDE 2HALA 3S7HB 3LU9B 1C5MD 3ZZ4A 1C1QA 1PQAA 1MTSA 1FLEE 1NESE 2BLQA 1IOEA 2G55A 1GHAF 2BD3A 1GGDB 1T7CA 1YPEH 1K1LA 4Q63A 4CREA 1UO6A 1QR3E 4UFEH 3VEQB 4DG4A 5E8EH 3E6PH 1V2RT 2EI7A 3SOSA 1BJUA 1JOUB 3WW7A 4K1TA 3R0FA 2BDBA 2BD2A 4RKJB 1HFDA 2XBWA 3F0PA 4B6EA 1DVAH 1ZJKA 1ARCA 2ODYB 4DIIH 3QWCH 2GDEH 2ZU2A 1JMOH 1SQTA 1GHZA 5EQSA 2O8TA 3TPIZ 4OS7A 1UTLM 1ZRKA 3UNQA 1BBRK 2QN5T 2ZIQH 3SGAE 4WY3A 3A80A 2B0FA 2Z9LA 1A4WH 5C17A 4FUFA 3MU0A 1CA0C 2ALVA 4OM9A 1C5WB 1GHWH 1EOLA 4VGCB 2F91A 2Z9KA 2FEQH 5EXNA 4FVBA 7GCHG 2A4QA 1K1MA 3OFND 7ESTE 1ZRBA 1OSSA 2VIOA 2L6OA 3P95A 4Y76A 1AWHB 1PQ7A 1FN6A 3LH3A 4B71A 1WBGB 2ZFPH 3KN2A 3UAIC 1AZZA 4O9VA 4TT3D 3L6PA 4KP0A 3SO3A 3FP7E 2GZ9A 1WQVH 3SUGA 2ZEBA 1G37A 2A1DB 2IPQX 3SJKA 3RXMA 5FL7D 1WDIA 3F2HA 3LT3A 3M3VA 2P93A 2CJIA 1MKXK 4DGJA 1P9SA 1GDNA 4NIYA 2ZU1A 1E37B 1C9PA 3G01A 1Y5UT 3TK9A 2ZGCA 3MNXA 3OTJE 2BTCE 1VGCB 4DT7B 5T6GA 2ZCLP 1QBNA 2O9QA 3OTPA 1QFKH 2XTTB 2ZF0H 4UONA 1FI8A 1UJ1A 4TPIZ 1IHTH 5FCKA 2BD4A 2OBQA 1VCWA 4I8JA 4O97A 3ZVGA 1DY8A 3F2GA 2FTLE 3RXBA 3A82A 1WV7H 1VITH 1TMUH 3A7YA 1HAHH 1G3EA 2PHBA 5DGJA 5FX6A 1C2EA 2BZ6H 4PROA 2CHAC 3LDXH 1EASA 1YYY1 1A0LA 1Y3XA 3UQOA 1QZ8A 3MH6A 2RFKC 1D4PB 3PWCA 1CT4E 1N8OC 1TGNA 1GJ7B 2J98B 4ZAEA 5T6FA 2BY7X 3KQEA 4ZHAA 3HGPA 1N6YA 4IC5A 3EA7A 3RXPA 1GJBB 3DFJA 1D6RA 4JZ1A 1H4WA 2TIOA 4B76A 4AFQA 3TIUA 1HB0B 4Q7YA 1K2I1 3SU6A 5PTPA 4D8NA 3GYLB 1O3IA 1MABB 3A7VA 4K8BA 2ALPA 3Q3YA 3E8LA 3M7QA 1GMHF 1KYNA 4YESB 4YOIA 2GDDA 3KGPA 4ESTE 1P2QA 1RXPA 3QO6A 3F3BA 2IJD1 5LPFA 2A31A 2KCYA 3W1EA 1G2LA 2VBCA 2YNAA 2VH6A 3GY4A 4Y8ZA 1NPMA 5JBAS 4ABAA 1QIXB 4B73A 2Q1JA 5IK2D 2BY6X 4Q7ZA 4K5ZA 2ZA5A 1TYNA 4H4FA 2BVSH 2M2AA 3BTEE 1V2ST 4XDEA 2L74A 2BXTH 1E36B 3QX5H 2GV7A 2J94A 4XD7D 5GJ4B 4FUEA 1HAIH 3D23A 1G30B 2AIQA 2SGQE 3ZV8A 1QJ1B 2P3FH 1GI6A 1Y59T 2FP7B 3M5LA 1WYKA 5FXLA 3ZZ8A 1EP5A 2XC4A 5DO4H 5EGMA 1GI0A 1G32B 3H7OA 2ZI2H 4ZHLU 5EJ1A 4Y6DA 4X6MA 4MPVA 5JBTA 2JIZD 1W2KH 1TPPA 3SNCA 4MQAA 4ABFA 3ATKA 3HGNA 1BTYA 8KME2 2V7QD 4ZKRU 3EQ0H 4AG2A 1Z8RA 3ZIAD 3HPTB 2AYWA 3JZ1B 3RUOA 3FN8A 3MFJA 1V2MT 3VB4A 1C2LA 3O8BA 2UWPA 3OEHD 1C4U2 1HAVA 3GDUA 1P8VC 1HV7A 3HK6B 3MU8A 1O35A 3N7EA 1SC8U 4UD9H 2ZTZA 2CMYA 4AG1A 4A7IB 4TSFD 1ZPCA 3P8FA 4M9FA 4E06H 4BNRA 1VZQH 1Z7KA 2QXHA 1OS8A 1AUJA 4BAKB 2UUFB 2C8WB 4OS2A 2WPIS 2XNDD 1C5TA 2BX3A 1ANDA 2GCTB 7GCHF 1QB6A 3SN8A 2Z3DA 1L0ZA 4KTSA 1VJAU 4IW4E 3UY9A 5L2ZH 2DE8A 1BTXA 2UUKB 2VNTA 2D8WA 1AWFH 1HAYB 2AERH 1ELFA 4MVNA 2BY9X 3I78A 3M61U 2BMGB 3LJOA 3EA8A 1AY6H 3QZRA 1ZJDA 1PJPA 4LZ1H 5C3NA 2M5TA 1E35B 4Q2KA 3TK5A 1UTQA 2BD5A 1UCYE 2AGIX 3P8OA 1CU1A 3P8NA 1QL8A 1UK3A 1F2SE 1XM1A 5L2YH 3SU2A 1GL0E 1ETRH 3MNSA 1WCZA 1DS2E 1LPKB 2BDIA 4P02A 1Q31A 2FZZA 1UTMA 5B6LA 1ZPZA 4KGAA 2R0KA 3TJNA 1GJ4H 1GPZA 3M7TA 1QHRB 1WSSH 1FN8A 1TWXB 3K9XB 4YLQH 4DT4A 1TAWA 5E0HA 4JZFH 2B7DH 1C1MA 3RLYH 8ESTE 1HJ8A 3R3GB 1MU6B 4J1YA 3WWFA 5GNDA 2FOGA 1L1JA 1OWIA 1CGJE 2OC8A 5KECA 2AEIH 2VIPA 1IQHA 2FDAA 1O5DH 1SLXB 2W7SA 1BITA 3UTUH 3ATIA 1BTZA 2LP6A 3NPSA 1IQFA 1YPLH 1C2FA 4HI3A 4JMYA 4WWYA 1ZSJA 1UTKA 1EPTA 2BQ6B 4JK5A 1LQDB 5HGGA 2WYGA 1SI5H 1V6DA 6GCHG 5DP5A 1AFQB 5FX5A 1TGCA 1K21H 3SJIA 2B5TB 4CBOA 1Z6JH 4D7GA 1G3CA 1UMAH 3PV4A 1IQNA 4JYTA 5TCAA 5A0AE 3AW1A 1BBRH 5DKMA 4Q7XA 3OU0A 1TA6A 3BIUH 1BT7A 1MQ6A 2XW9A 3UIRA 5C20A 2R9PA 3TITA 2CV3A 1MU8B 3TNTA 1PPZA 3K6ZA 2H1UA 5ESTE 3E91A 1HAZB 3A7TA 3CP7A 3H09A 4CH2B 1FUJA 1O3LA 2Y5GA 2Z3EA 3MU5A 3ZZ7A 1TQ7B 3VPKA 1D3PB 1HAPH 2VVCA 3SORA 5A8XA 3SU1A 1Y3UA 3T26A 4YT7H 2QF5A 4XFQA 1XUGA 2FODA 4NSYA 1C2JA 2ANMH 3SNBA 2ZECA 4CR9A 1F0UA 1BMNH 1TABE 1SB1H 2BLWA 1AFQC 2PTCE 1C5PA 1QY6A 1GJAB 1H9HE 1QL9A 3STJA 1W11U 2J95A 1NFXA 2KR7A 1RJXB 5EXLA 1C1PA 2ZQ1A 1AFEH 1HJAB 5J4SA 1C2HA 1TB6H 3RU4D 1LPGB 1O3PB 2VGCB 1ZMLA 3T62A 1O2RA 1COWD 1P06A 2TPIZ 1LCYA 1MQ5A 3M5NA 4NG9H 5A8YA 1BIOA 3LONA 2F4LA 1E1QD 1PPGE 2ZGXH 3ZZ6A 4Y8YA 1GHAG 1UHBB 4WXVA 2AFQB 1RTKA 1Y3VA 2Y7ZA 4WXIA 2QY0B 3RXSA 1MUEB 1GI7B 4FETA 4HTCH 3RM0H 3VGCB 2A2QH 4UFDH 5GXPA 4NA8A 5HXFA 1SVPA 1A3BH 1K28D 1UK2A 1EAXA 3E0PB 1PPHE 4I86A 1G2MA 2HPPH 2V3OH 1V2TT 1XXDA 2H5DA 3EE7A 3RXCA 2KAIA 2OQUA 1CHGA 1NM6A 3AW0A 1O3GA 2P95A 2ZG0H 2GP9B 1Z8JB 2J5UA 1HAGE 2WZQA 3ELAH 4XSKU 1OPHB 1DY9A 1MBMA 3KHVA 4U30A 4B74A 3QUMP 4AFSA 4GVUA 1FJSA 4WVPE 2FOMB 1DE7H 1Q3XA 1SHYA 3AAVA 1TNGA 1P10A 4OS1A 3PO1C 2G5NA 2FX6A 3N7DA 1G36A 4ABIA 3SU0A 1DSUA 4BTUB 1FONA 5CDFE 4BAHB 1HAOH 4KTUA 4AB8A 4I8LA 4AGKA 1DSTA 3DFLA 2BXUH 4YM9A 1Z71A 3FVFB 2FOCA 2UUYA 1DUAA 1Z1JA 1MTWA 1F7ZA 5CHBA 1SL3A 1O2IA 1P3EA 1PYTD 1MCVA 1QRXA 3PTBA 5G4BA 3M35A 1WU1A 4NZQA 4AYVB 2C93B 3E90B 2ZTXA 1SHHB 2IJOB 3ODFA 5C67A 1MKWK 3LPRA 3IWMA 1SQAA 3RXUA 3ITIA 2OTVA 3MH5A 4CHAC 1W13U 1GCTB 1YPGH 1CGHA 2TGAA 1G3DA 4ZHMU 4ZUHA 2XNIA 1GBLA 3F9GA 3MNCA 5EODA 1J16A 1BQYA 4A1TA 4GAWA 4YT6H 1T31A 1YP9A 1YPHE 1D9IA 1QL7A 4X8SH 4H6TA 1W10U 3A89A 4AYYB 1SGEE 4XE4A 5HIZA 3MI4A 3RMLH 6GCHF 3ZZ5A 4LK4A 1TRNA 2ZDLA 1NZQH 4YOJA 1AMHA 4X2VA 4BAQB 4DURA 5C1XA 1T8LA 5HM2A 3O8RA 1O5GH 3LKWA 2V6NA 5A09A 2A7HA 1KY9A 2AGGX 5F8ZA 5FPTA 3LGYA 1EJAA 2A4OA 1ZHRA 5L6NH 4MPXA 4AOQA 1IQMA 2OUAA 1C5VA 1BTHH 1DXPA 1TBQH 1C2IA 3MMGA 2ZPSA 5DP9A 1QQ4A 1V2OT 3S9AA 1O2LA 1VKYA 2XWBI 2VB0A 1O5AB 1N1LA 1MMJN 5LPRA 2W7UA 4BAOB 1JXPA 1NO9H 2ZFSA 1J9CH 5DP6A 1ELCA 2NWNA 1CGIE 3A8BA 1CA8B 1TGSZ 3TJOA 1ZGIA 1HIAB 1GJDB 3MYWA 1DANH 5CE1A 1FDPA 1CO7E 1O3BA 1OWKA 2J2UA 1C4Y2 1RS0A 3SUDA 4HGCA 3RXQA 2BDHA 3AVZA 4AC9A 4Z1MD 1YPHC 1LPZB 1S81A 2ZDNA 3KNXA 1SG8B 3PMJA 3RXEA 2PGQB 4NFEA 1VITG 2W6ID 4X2XA 4XBBA 4AN7A 3PV2A 5DSFA 4ZKNU 2RA3A 2ZQ2A 5FCRA 1XVMA 2BZAA 4KKDA 3PMBB 3BEFB 4HG6A 1ETTH 5F53A 1ELEE 1CA0B 2Z7FE 1BMFD 4JYUH 5CHAC 1YKTA 2W3KA 2XXLA 3BTKE 4DCDA 2SGAA 4YLUA 1PQ8A 2FS8A 1EPTC 2JJ1D 2QV1A 3BTFE 2BD9A 3SU4A 1RRKA 2CF9H 2YMSC 3VFEA 5HM9A 2Z94A 5DG6A 3RC5A 2FOFA 4NIWA 2H9EH 1GDQA 2UUJB 1WQSA 4X8TH 1G3BA 3DD2H 3A88A 1ESBA 3BG4C 5EPNA 2BOKA 2P94A 1CE5A 3UPEA 1GBEA 3MNBA 2OXSA 1GHBF 1JBUH 5F8TA 5GPIB 3W94A 1A0HB 1FAXA 3GY3A 3KF2A 1EATA 1ELVA 4IMZA 1LHCH 5JBCS 2Q6DA 1LHEH 1GCDA 1K1IA 4H42U 4ISIH 4UDWH 1P02A 6ESTA 2WV9A 4B75A 4WMEA 1TMBH 1O39A 3VG8A 3U8TH 2J38A 3T5FH 2GZ8A 2A32A 3DUXH 1C1OA 4K1SA 2ODQA 4TYDA 2DUCA 4ZROA 5ETXA 3RXRA 2HNTF 1H9IE 1NRRH 5EJLA 3UNRA 3VB3A 2VU8E 1QCPA 1YCPM 2WHXA 1TALA 2JH5D 2BDYA 1GL1A 1EZXC 2CHAB 1D3TB 1V2PT 1NRNH 3FKSD 1MTNC 2PKAA 3KEEA 1BA8B 1F5RA 3BIVH 1XUHA 1N8OB 1V3XA 4B2BA 3BN9A 1O2TA 4JYVH 2I6SA 1KLTA 4Y8XA 3SJOA 2WUBA 1SR5C 2WPJS 2KFWA 3S9BA 1GG6C 2HPQH 1C5RA 1W0KD 2G4TA 3GCNA 3I77A 1EB2A 4QT8C 3U1IB 3UOPA 4MNXA 2TGDA 3BSQA 2BYAX 3KQBA 4E05H 1K9OE 1TE0A 1TOCB 3ZZ3A 1ZHPA 1QB1A 1HCGA 2W6JD 4GUXA 3BV9B 4NZLA 3S9CA 3TH3H 3GISB 1OOKB 1J17T 2A5KA 1P03A 2HVYB 1V2VT 4IMQA 2GCHF 1HNEE 2WPKS 2F9NA 4CRDA 1FY3A 3ATLA 4Z6AH 4ABJA 4R8TB 4OS6A 1GBAA 1FY1A 3B8JA 3GS9A 3ZZBA 3QTVH 4DY7B 1QTFA 3GY5A 1BHXF 1Y3YA 1YLCA 2KZ4A 3QGJA 1O3JA 1LVOA 1V2KT 1O31A 1IHSH 2ZFFH 1PQ5A 2OD3B 1C5YB 1FX0B 1ELTA 3OEED 1W14U 1K0HA 1HXFH 1O2YA 3B23B 3ATMA 1KXAA 4MDSA 2ZO3H 3RXAA 5C5NA 1CHOG 1C1NA 1TNHA 1ZLRA 1FXYA 5AVDA 2JDID 3OX7U 2P16A 4RKOB 1GMDG 4KELA 6CHAC 2C3SA 3ZZCA 3EGKH 1NFYA 1O2JA 2G81E 1ABIH 2ZPRA 5B6OA 1NRSH 1XKAC 1LKBA 3NUMA 1FIZA 5C2ZA 1OXGA 2ZP0H 1C1RA 1GBJA 3V13A 1TNJA 1E0FD 1ZYOA 3PRDA 1WXRA 1AD8H 3I29A 1ZOMA 1LVYA 2CXVA 2WPHS 4BANB 4D76A 2FYRA 1VITF 2FO9A 5GWZA 1ID5H 1ZPBA 4ISLA 2TBSA 1BDAA 1QA0A 1TPSA 2FWWA 1W3CA 3W95A 4OGYA 1SOZA 2WYJA 4MNWA 2AIPA 2VWMA 1C2KA 4Q80A 3TH4H 2P3UB 3DA9B 2NU0E 1OWEA 1ZTJA 1EB1H 1O3HA 1O2QA 1A5IA 5EJZA 4ZKOU 1UTPA 2OK5A 1IQGA 2F43B 1FMGA 5A2MH 1GI2A 1OWHA 2OLGA 1YPJH 2KCPA 3RXHA 2Y7XA 3NZIA 1MKWH 2ZHEH 4X1QU 1BRBE 1Q2WA 5DK1A 1BCUH 1SQOA 4O3TA 4TY6A 1JIRA 1T8OA 2WV4A 1TONA 3RC4A 2QF3A 2FPZA 4GHTA 3LGIA 5K7RA 1KXEA 1D3QB 5H4IB 2ZGHA 2FLBH 1SGYE 2QF4A 1BB0B 5F8XA 5DP8A 1AKSB 2ZDMA 1OKXA 3RXFA 1QBVH 5BPEA 2NU3E 3U69H 1WAYB 4NGAH 2KM0A 5J4QA 4F55A 1KXCA 3T2NA 1O34A 2BY8X 1O32A 2YNBA 1SGCA 2A2XH 3SV8A 2H2ZA 3LC5A 2Z9IA 3FP8E 5F6MA 1KLIH 4J2YB 4RT1A 1NC6A 1GBDA 2PW8H 2BLVA 1KDQA 4RI0A 1AB9C 1YCPK 4ABBA 3SYJA 4K69A 1TMTH 3KQDA 1UVUH 2D2DA 1S6LA 2XYAA 3MO6A 5T6DA
chains in the Genus database with same CATH topology
4Y0ZE 2STAE 2ANKH 2UWLA 2GT8A 3TJUA 1HPGA 1Y5AT 1LQEA 1C5SA 1TRYA 2HRVA 2QYIA 2OQ5A 4ISHH 5DP4A 3U8RH 2WV5A 4ABDA 3TVJB 4CRCA 1GI9B 4FU8A 5E2PA 5I25A 1AVWA 3A85A 1TA2A 2TRMA 5HMAA 2A4RA 1S85A 2F3CE 3RXLA 2FOBA 1CSOE 1FY4A 3F9HA 4X6OA 4D9RA 2BQ7B 1O5BB 1NU7B 2SNVA 1DWDH 3MOCA 3CS0A 2ZCHP 3EYDA 3OY5U 1NFUA 1KTSB 5FHTA 5DP3A 4A1XA 2C4FH 2J92A 2BDAA 1MAYA 3LC3A 4GHQA 2PSYA 2BOHB 1FZZA 1FNIA 1O3NA 3UFAA 2GKVE 1HGTH 1PPCE 2A45B 1T4UH 2QXJA 2HNTC 3SHCH 1RD3B 4A5TS 3SJ9A 1UCYK 3E1XB 4FUJA 1UTNA 2BVXH 2R0LA 3BTDE 3HKIB 1LVMA 1O3KA 1EZSC 5JDUB 1GI5A 3FFGA 2IOTA 3RXGA 2BVRH 3F6UH 1LHDH 3ZZDA 1S6FA 2GMTC 2H6MA 4OS5A 2EI6A 1NRQH 1CHOF 3HKJB 1V2WT 1WUNH 1Z8IB 1Z6EA 1OP0A 1GMDF 1MCTA 1ELAA 1MBQA 3EAJA 4B2CA 5SGAE 1TBZH 1VR1H 3QDZB 3SV9A 2YOLA 4I31A 1EKBB 4DIHH 1P01A 1F0TA 3P8GA 1DWEH 2AMQA 3SV7A 3EA9A 2FS9A 3PTNA 1RIWC 1ZMNA 1P9UA 3UR6A 3BTTE 1EJMA 1ELBA 3MU4A 3EE0B 2NU4E 1S84A 1VJ9U 4YZUA 1C5LH 4Y0YE 4BXSA 3A81A 3S69A 3LGTA 3QTOH 1BRCE 1CBWC 1XUJA 4UEHH 4IBLH 1UVPA 4FUBA 2ZHQH 3D49H 3A8AA 3ZVCA 2WPLS 4U2WA 3A7ZA 1DT2A 5EG4A 1SPJA 1OWJA 4FUCA 1YC0A 4XBDA 5C1UA 3M7UA 4MLFB 1A46H 4NWKA 1OP8A 4IS5A 2VVUA 1TX7A 4FUDA 3O8DA 4H6SB 3ESTA 1TQ0B 3MU1A 1MKXH 2ZHDA 5CMXH 5JYIA 4AORA 3FZDA 5FPYA 2ODPA 2QXIA 1Z8GA 2ILNA 4WF8A 3M3TA 5E2OA 1QGFA 3SNEA 5EPYA 3RMNH 1LVBA 4MNYA 1K1NA 1GBHA 3RLWH 2W5EA 2RCEA 1Y5BT 1J14A 3SV2H 4OGXA 2XC0A 1DM4B 3PO1B 5T3HA 1L4ZA 1ZMJA 3PLBA 3WY8A 4CH8B 1THSH 1K1JA 1QA7A 2JH0D 2PLXA 1EJNA 3SJ8A 2G8TA 3UREA 1GHVH 3S0NA 2FESH 4AX9H 2Y5HA 1RFNA 1H1BA 5I46H 2WUCA 3HK3B 1GHBG 2V3HH 5E0JA 5EW2H 4NIVA 4X1RU 2R3YA 3GCHC 4X6PA 1V2QT 3TH2H 4TPYA 2FXRA 2QAAA 1GBCA 1SGNE 2FIRH 2PGBB 3P92A 5F03A 2G52A 2Z9JA 1JRSA 1DXWA 1O2OA 4FXGH 4NA7A 4ISOA 1F5KU 2SFAA 3ZVBA 1HAVB 4CHAB 1O30A 1INCA 4ABGA 1DICA 4UE7H 1AO5A 1AVGH 1V2NT 2PKSC 3SGBE 3BTWE 4NWLA 1TRMA 3E16B 4DJZB 2ANYA 3NCLA 3T28A 1X7AC 2PV9B 1ZSKA 4NCYA 3LH1A 1HAXB 1EZQA 1LHFH 1C5UA 1L1GA 3HATH 1P11E 4FUIA 4AB9A 4X6NA 2RDLA 3KQCA 3AASA 2F9UA 1P2IA 1QJ6B 2PWXA 4AFUA 2JETC 2O8MA 4ZMAH 1IQJA 2FTMA 4A92A 2XCFA 2XRCA 2ZC9H 1GDUA 1KXBA 5C1YA 5EXMA 4CRAA 9LPRA 3A83A 5GIBA 2PUXB 2VWOA 3V7TA 2Y81A 2A7CA 4XOJA 2FLRH 1MZAA 1SGFG 1SLVB 2GD4B 2GCHG 3PROA 2I6QA 4UFFH 4RSPA 5FBEA 2R2MB 3A8DA 4YOGA 3L3TA 3ENSB 4TWYA 1UTJA 3RXDA 3NK8A 6LPRA 2GX4A 3T29A 4DVAU 4MG3A 2Q6GA 5HYOA 1MH0A 4JZDH 4ABHA 2P3TB 5JPMH 1O3MA 1ACBE 2BHGA 1LO6A 2VVVA 1C5QA 1FY8E 1QB9A 2F9OA 4YTAA 3M37A 1O37A 3V0XA 2QA9E 1ZHMA 3GY7A 2BD7A 2P8OC 4HZHA 4MPUA 4Y7BA 3C1KA 3Q77A 1A7SA 3GY6A 4IC6A 5CHAB 3SV6A 1W8BH 1EZUC 2G00A 1ZZZA 2VIQA 2D1JA 1BUIA 4WH8A 1EPTB 1SGDE 3URDA 1NY22 4Z0KA 1YCPH 1DWCH 1BMLA 1NTPA 2QCYA 2VJ1A 5IDKA 2FMJA 1Z1IA 1S0RA 3MWIU 3JZ2B 2ZU3A 2BB4A 1DITH 1ZSLA 1ABJH 1GI4A 3BG4B 1IAUA 3A86A 3P70B 1GVZA 2ZGBH 4FU7A 4DW2U 1B5GH 4WMDA 4BAMB 1J15A 1QRWA 1AE8H 3BF6H 2C8YB 3MH4A 1MAXA 3BEIB 1LHGH 1WTGH 1TLDA 3PWBA 3VB6A 2G4UA 3RMOH 1C9TA 2J9NA 1EP6A 1SSXA 2GTBA 3MO9A 3NXPA 4MPWA 1BTPA 1BOQA 3GCTF 1C4V2 1XUFA 3RP2A 1KXDA 4F4OC 3ODDA 2UWOA 1GHXH 1SGQE 3SU3A 1B0EA 1XKBC 1AQ7A 3GOVB 1GBTA 1TGTA 3SUFA 1O38A 1L1NA 2A5IA 2VWLA 3OY6U 2GT7A 3TGIE 1ZR0A 1A0JA 5A8ZA 1O2PA 1SGIB 2CN0H 3LGWA 2XBYA 2FI4E 3T27A 1QBOA 1T32A 3LIWA 4K2YA 1F92A 1K1OA 1MTNB 1C2DA 2GVFA 3ATWA 3PMAB 1NROH 2FX4A 1T4VH 1GI1A 1UCYH 1HBTH 1GG6B 1YGCH 5FAHA 1O2ZA 4R0IA 1TX8A 1THRH 3H5CB 1P04A 2FI5E 4M7GA 4UFGH 3P17H 3ZZ9A 1VCPA 3N7OA 1H9LB 4ASHA 1DUEA 4A1VA 3SI3H 1IQKA 1TNKA 2FOHA 1DWBH 2ZZUH 1ESAA 4GLYA 5IYTA 3F68H 1TPAE 1BJVA 1D6WA 1CQQA 1K22H 2ZTYA 4NSVA 2A4GA 1DLEA 1GGDC 1QJ7B 4GCHF 1P2KA 1SGFA 3FZZA 1NU9A 1ESTA 3FP6E 1O2WA 1S82A 2KAIB 3U9AH 2HGTH 5LH8A 3H7TA 2NU2E 1KLJH 3BTQE 1W12U 4I8GA 4I8KA 3P6ZB 2GGVB 1FV9A 1P57B 3M36A 3TGKE 1QNJA 4X2YA 1O2GH 2QF0A 1QQUA 1PPEE 2FI3E 1MD7A 3SBKA 6CHAB 5EQRA 1XVOA 2TGTA 1O2NA 3AAUA 1O2KA 1O3DA 3E0NB 4VGCC 1BMMH 1F5LA 1V2JT 2PTNA 4Y10E 5EOKA 4AFZA 3U98H 3MHWU 2GV6A 2ZDVH 3K65B 1LMWB 2HOBA 1CVWH 5AHGH 4X1PU 2OC0A 2PFEA 3MTYA 2BQWB 2VWNA 1EX3A 2QC2A 2SGFE 1TGBA 5DJ7A 1P0SH 4JZEH 1GJ9B 1CT0E 2BD8A 1TX6A 1O5CB 2VIVA 2ZCKP 1A3EH 1P05A 5GCHG 1A1RA 1O2SA 1RTLA 1XUKA 5AFZH 2F9VA 2SNWA 4BOHA 2BY5X 3SQHE 3QZQA 1BRAA 1TBRH 3F1SB 3LJJA 2H9TH 1M9UA 3A84A 3SHAH 3MO3A 2OBOA 1TPOA 1O5FH 4X2WA 1LTOA 1VGCC 2RG3A 1TNIA 1NFWA 3LGUA 3KL6A 1C1UH 3A7WA 4JZIA 1O33A 1AZ8A 4TY7A 1BTUA 3QGNB 1T8MA 1GI3A 1NN6A 1W7XH 3RXJA 3M5MA 3ZYDA 5BRRE 1LKAA 1NRPH 5FBIA 1HLTH 3BTME 4KTCA 1XX9A 2Z6BD 1GBKA 3TLOA 1GMCF 2XWAA 2CGAA 2ZKSA 1C1TA 3LGVA 1EAUA 3V12A 2EA3A 1ELGA 2OINA 5LGOA 1O3CA 1UHBA 3RXKA 3BG8A 2EI8A 1OWDA 2LNCA 2V35A 1AB9B 3SQEE 3BTHE 3A87A 9ESTA 5AFYH 1SOTA 1C2GA 4SGAE 1D3DB 2C8XB 2P59A 5DP7A 2ZPQA 1AHTH 1FPCH 1GVLA 4I7YH 4LZ4B 2A5AA 3PM3A 1H8IH 1HRTH 1G9IE 4O03A 1SGRE 4IN2A 2IPHA 4THNH 3RC6A 3RXVA 3V3MA 1F0SA 1HJ9A 3GDSA 4K60A 4BTIB 4FVDA 3BEUA 3TJVA 5E0GA 3NKKA 4ZKSU 1S0QA 1C1VH 1L2EA 3T25A 3QLPH 1BTWA 2JKHA 1WOFA 4HFPB 2Y6TA 3RU4T 1U6QA 3C27B 5TJXA 1TIOA 3VB5A 1O3OA 2XBVA 2ZNKH 1V2UT 2HNTE 3RM2H 2J4IA 1GJCB 1UVOA 4WMFA 3SGQE 2LPRA 5L30H 4LOYH 1P3CA 2H9HA 2PUQH 2C8ZB 3TK6A 8LPRA 1H8DH 4X1NU 1F0RA 1GJ8B 4NA9H 2O8UA 5AF9H 1BZXE 2ZFRH 2B8OH 1MTUA 4NFFA 2AMPA 1AIXH 4A6LA 1DOJA 1P2OA 1FQ3A 2BDCA 1GVKB 1S83A 4E7RG 1UVSH 3FAOA 1N6XA 4D7FA 3STIA 1C5NH 1EUFA 3ZVFA 3PMHB 2ZDAH 1RGQA 3GCOA 1B7XB 1AI8H 1SLUB 5JB8S 3B9FH 2PR3A 1GHYH 1O2UA 2GMTB 3GDVA 2B9LA 3GICB 5EQQA 2SGEE 4LXBH 2SGDE 2A0QB 1XMNB 1XXFA 1EAIA 3OYPA 1Y3WA 3RU4E 2F9BH 1B0FA 7LPRA 1DPOA 3PYHA 4INHA 3Q00A 3GYMA 1TOMH 3F9FA 3UWJH 2GCTC 1TFXA 2PKAB 1RIWB 1C5ZB 1PFXC 2V0BA 1O2MA 3K2UA 1AE5A 1ORFA 4JCNA 1W0ZU 4K1EA 4ZXXH 1IQLA 5JB9S 2Z3CA 1CBWB 1AGJA 4NIXA 1ZTKA 1YM0A 5JBBS 2THFB 1Y8TA 2FM2A 2QXGA 2STBE 3F9EA 4FUHA 3RMMH 2OCVB 5GCHF 2K1QA 2WINI 1BHXB 2G5VA 1KXFA 4AGJA 1O36A 4DOQA 3PLPA 3RXOA 1ARBA 1GBIA 4E7NA 1SGPE 4YO9A 3ZVAA 4B1TA 8GCHG 1NS3A 1UK4A 1HIAA 1O2HA 2BM2A 2JH6D 5ESBA 1P2MA 1VCQA 3KCGH 1ZGVA 2O8WA 4AZ2B 3KIDU 1AUTC 3L33A 4ZH8A 4CR5A 1KTTB 1W0YH 3SU5A 2XBXA 5DPAA 1GBFA 1SLWB 1KSNA 4U01A 2ZFQH 4OS4A 1A5GH 1GWAA 1HYLA 3RXIA 1O2VA 2R2WU 3UOUA 2OP9A 3Q76A 2F83A 1P09A 4GSOA 1OYTH 1SMFE 3EDXB 5EU8A 4WH6A 1C1WH 5LPEA 1YF4A 1XUIA 1O3AA 1SFQB 3PLKA 1V2LT 4U32A 1EAWA 3GCHB 3QN7A 3UNSA 1OYQA 4Y11E 2AMDA 1WTHD 2G51A 1EOJA 2IN2A 3URCA 2ZU5A 1FAKH 2OC7A 2FOAA 1PPFE 1ETSH 4Y7AA 3UR9A 3GCTG 1THPB 4Y71A 3SNDA 2ZFTA 2R3UA 2ZHFH 1S5SA 4INKA 3U1JB 1SFIA 2PKSB 4IGDA 3ZV9A 3Q3KA 2QIQA 2BLOA 1MD8A 1MTVA 4I8HA 2Y82A 1DLKB 5EW1H 1PPBH 4ISNA 4GPGA 1JIMA 1W7GH 2F9PA 3GY2A 3E3TA 4WJG2 1OX1A 2HLCA 5K0HA 4ZXYH 3SUEA 2JETB 1IQEA 1GBMA 2AH4X 2WPMS 4K8YA 3M5OA 1GI8B 1PYTC 1C5OH 3UWIA 1GJ5H 1HJAC 3ZVDA 3BTGE 2ANWA 4CRBA 2VGCC 3OSYA 3SW2B 1UTOA 3SNAA 1FIWA 3PB1E 3IG6B 1A5HA 3UQVA 1HUTH 1O2XA 3ZYEA 3IITA 1K1PA 2ZDKA 4IN1A 1S6HA 2NU1E 2SGPE 4GCHG 3RDZA 4ABEA 1KDQB 1ANEA 1L4DA 1HDTH 4TWWA 1DX5M 3VXFH 1KIGH 1ZTLA 4F49A 1BMAA 3M3SA 1JRTA 1FPHH 4JK6A 2AGEX 3VGCC 2ASUB 2Q6FA 1O0DH 2RA0A 2Y80A 5A0BA 2D26C 2CF8H 4CBNA 1ANBA 1GBBA 4MNVA 2PSXA 4BTTB 2ZHWH 1QRZA 1J8AA 2GZ7A 2P8OB 3RXTA 1C5XB 1OP2A 3FANA 2A7JA 4CRGA 1ANCA 1E38B 2BDGA 1DDJA 3TGJE 2XC5A 3A7XA 1HXEH 3UUZA 4I33A 3VXEH 3ZZAA 1IQIA 1O3EA 4RN6A 5FPSA 2VIWA 2C90B 3MH7A 4SGBE 2BX4A 3Q3XA 3SI4H 1SBWA 3CENA 2FOEA 1YPMH 1YPKH 5GDSH 3DHKH 1BRUP 4FUGA 3A8CA 1P12E 3D62A 3U8OH 3TU7H 5TCCA 1E34B 2VIDA 8GCHF 2OC1A 3GY8A 3S7KB 1RTFB 2W26A 4X1SU 1AN1E 1TNLA 3VB7A 1T8NA 5C5OA 4B2AA 2EEKA 1EXFA 2ZWLH 2XCNA 1LDTT 4XBCA 1A61H 1O5EH 7KMEH 4D9QA 2HVXA 2ZGJA 2ESTE 3D65E 2DE9A 5A0CA 2AS9A 2ULLA 3K6YA 1YLDA 1NT1A 1GCTC 3SZNA 3O8CA 1EQ9A 2QGRA 1SGTA 2Y5FA 1C1SA 1P2NA 2VINA 1YBWA 4INLA 1AVXA 1GMHG 1QURH 2VH0A 2HWLB 1DFPA 1GJ6A 2J34A 4I32A 2FYQA 1CT2E 4O3UA 2Z9GA 2H5CA 1MZDA 4CRFA 4MTBA 3DT0H 3QK1A 1JWTA 2EC9H 2O8LA 4BXWA 1O3FA 1UVTH 1GMCG 4X8VH 1C2MA 4X0WU 4FU9A 3CS7A 1BBRE 2W3IA 3TNSA 1P2JA 3LOXA 5ABWA 3NWUA 2ZU4A 3ZVEA 1AU8A 4K3JA 1FY5A 1A2CH 2TGPZ 1AKSA