1Y3YA

Trypsin inhibitor complex
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Trypsin, cationic
publication title A simple protocol to estimate differences in protein binding affinity for enantiomers without prior resolution of racemates.
pubmed doi rcsb
total genus 58
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2004-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1y3yA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1y3yA02
1S82A 3LDXH 1TNLA 2G55A 1LPZB 5F8ZA 5JBCS 1E38B 1V2ST 4A1VA 1QB9A 3A89A 3ZZ9A 2BD9A 2FWWA 1DDJA 4Y8YA 1PPZA 3RXAA 3B9FH 5DKMA 4NSVA 5A0CA 1ELEE 1P2MA 1O2QA 4DOQA 6GCHG 3LGUA 4MNWA 1P9UA 1YCPH 1GMDF 3HPTB 3ITIA 2F3CE 1XMNB 4NIXA 1OWDA 2Z9IA 1P2IA 2A4GA 1X7AC 2WINI 1T8MA 3SNCA 1EKBB 1SGCA 5HMAA 1P2QA 1EOLA 5C2ZA 3BG8A 1QURH 2AYWA 5AF9H 2PGBB 3P8OA 2JETC 4NIVA 2BY7X 1BA8B 3E91A 4ISHH 4K69A 1P12E 2B8OH 1GMDG 1ELVA 1C5NH 1UTOA 2ZDLA 2PFEA 3PMBB 2UWPA 4ISLA 3M36A 1IQNA 2STAE 1O2IA 1KYNA 2Z9GA 5T3HA 1O5GH 1RTLA 1GCTB 2FLBH 2ZFTA 2ZC9H 1ZYOA 3Q3YA 1BBRH 3PTBA 1GI2A 1ZJKA 1WUNH 4NIYA 1AE5A 3KGPA 2P8OB 2V3HH 1NROH 1O2OA 4FVBA 1TPSA 1MKXK 3VB5A 1G3BA 1W14U 2V35A 1SG8B 5GWZA 1J16A 1TLDA 1GVZA 4X1PU 4WMEA 1JIMA 1OOKB 2QC2A 4MTBA 4WXIA 2SGAA 4MLFB 1S83A 2FESH 4DCDA 3MU4A 2ZU4A 1G3EA 5GCHF 3SUFA 2Q6GA 2H6MA 2QF0A 5C67A 1LPGB 1Z8RA 1LVMA 1IQJA 3A7YA 1FQ3A 1U6QA 4LZ4B 1TOCB 2BDYA 4E05H 2W5EA 1Z6EA 3E3TA 1M9UA 4HFPB 5HXFA 2GTBA 1MQ5A 1JIRA 1GCTC 3MMGA 5JYIA 5T6GA 1IQLA 2Q1JA 2EI6A 1NC6A 1O2TA 1T7CA 1V2RT 2P8OC 2HNTC 3TVJB 1PQAA 1MTSA 2OC7A 2GZ8A 2AH4X 1HB0B 1ABIH 1TMBH 1HV7A 2ZP0H 2H2ZA 1UMAH 4DG4A 5LGOA 1YCPM 1H9IE 5BPEA 1BJUA 1YGCH 4A5TS 3SUEA 1QIXB 4F4OC 1GBMA 1P2JA 4GAWA 3SNBA 4NA9H 4FUIA 1RXPA 1O2YA 4AX9H 1G30B 1MBMA 1BTUA 3AW1A 4OS1A 2BDBA 4JCNA 1BCUH 3SNAA 1D9IA 4AB9A 1NFYA 1ABJH 3IG6B 3BIUH 2ZKSA 3RMOH 4ISIH 1FY3A 4JZIA 2A7HA 1ZHRA 1DLEA 5FX6A 1HJ8A 1PYTD 1H8IH 1DY8A 1GBIA 5LH8A 5HM9A 1SFIA 2HPQH 3PYHA 1HAVB 4U2WA 3KN2A 4Y11E 1DWEH 1S85A 3SI4H 4D9QA 1JXPA 1O2HA 1EZSC 1QCPA 2GGVB 3TJVA 4Y6DA 2F91A 3GICB 1EATA 2ZZUH 1S5SA 1EASA 1FAXA 3SU4A 4OS6A 1ELAA 1ANCA 1IQHA 1PPEE 4Q7XA 5CMXH 1ETRH 2CF8H 4YO9A 1UVSH 4BAKB 1AFEH 1A5IA 4DJZB 3CP7A 1CA0B 1QL8A 1O3OA 2ZGHA 1A0HB 2FYQA 3P8NA 4ZAEA 1NESE 3D65E 3PLBA 1HXFH 1P9SA 1ZJDA 1KIGH 4CRDA 4HI3A 1EJNA 2ZU5A 2UUYA 2ZCLP 1CU1A 1WYKA 4H42U 3GYMA 4YESB 3UQOA 1KXCA 2BLWA 2W26A 4KKDA 1ORFA 1C5SA 2OC1A 4CRGA 5EQSA 1EXFA 2FPZA 2JH0D 3ZZ5A 2BVRH 7LPRA 2VB0A 1XKAC 4CRFA 1O3NA 4ABGA 2EEKA 2AGEX 3ZZCA 1D3PB 5DP4A 4B1TA 4X6OA 4WXVA 1AD8H 2J34A 1TONA 2AGGX 2VWNA 1J15A 1QNJA 1W7XH 2CHAC 1CA0C 2PTCE 5JB9S 1P11E 2FI3E 1XUGA 2WPIS 4E7NA 1O3AA 3L33A 2ZHQH 3EA9A 3EAJA 3O8RA 1OYTH 1MTNB 1O3HA 1VCPA 1HUTH 2ZCKP 4NG9H 2HNTF 1B7XB 1Z7KA 1ZSJA 1RFNA 4GUXA 1LPKB 1AFQB 5SGAE 3QWCH 2XCNA 1AMHA 4OS4A 1FNIA 1SLWB 2I6QA 2J38A 1A2CH 5HYOA 1E35B 3DD2H 2PGQB 2A4QA 5L6NH 1KLJH 1HIAA 1MAXA 3S69A 1T4VH 2EI8A 1QBOA 4A6LA 4K2YA 5C5OA 1QBVH 1O2ZA 2AGIX 3RU4T 4JMYA 1LDTT 3FFGA 1SR5C 5FPTA 2R2WU 2ZHFH 5LPEA 5DG6A 2RDLA 2GP9B 2A31A 2A45B 3T2NA 3UNQA 1C5LH 3T27A 4A7IB 3LGVA 1QRWA 2FS8A 4I8JA 4THNH 1VGCB 3VB7A 4Q2KA 1GHYH 3MHWU 2FTMA 2J9NA 2SGQE 3RXPA 3MU5A 4XSKU 3A7TA 1YM0A 4FUJA 4JZDH 1BTPA 1O38A 3BTKE 4JZ1A 1ZGVA 2V0BA 3TJOA 2ZI2H 1GMHF 4X2VA 2ZFSA 1O2MA 1TIOA 5EOKA 2FODA 3LT3A 4Y8XA 2FM2A 1GHBG 3L6PA 1JMOH 2W3IA 9ESTA 1GBKA 2XC5A 2B7DH 3PV4A 1NO9H 1TNHA 1YPLH 2YNAA 2OC8A 1QHRB 2TGPZ 2WV5A 1O2VA 4O97A 2UUFB 1O2PA 2ZFPH 1GMHG 1MMJN 1ARBA 2I6SA 2BZ6H 5PTPA 3M7UA 3BSQA 3LONA 2C90B 3MYWA 1BIOA 7GCHF 1EAXA 1SQTA 1AVGH 1RJXB 5BRRE 5EXLA 1IHSH 1GCDA 1FY5A 1C2FA 2GMTB 3RC4A 3SUGA 1FAKH 1DLKB 2VH6A 2HPPH 4B2AA 5LPFA 1XXFA 4MPUA 1TE0A 4FU7A 1A0JA 1C1NA 1AIXH 2FZZA 3GOVB 4FUDA 4CRAA 2BHGA 2ZDVH 7GCHG 1GL1A 3TGJE 2KAIB 3A7XA 2F9OA 5DP7A 1L4ZA 2BTCE 2CF9H 1DITH 4YOGA 1AKSA 1DWBH 3RXBA 1C5UA 1ZPCA 1V2VT 4A1XA 1W0ZU 1K22H 1DM4B 5FX5A 3A84A 1T8LA 1H9HE 2OINA 1GWAA 1DOJA 4XE4A 1MH0A 4U01A 2BVXH 4Y79A 2Y82A 1YPHC 1C5QA 5EODA 1KXBA 1QQUA 2PWXA 2SNVA 3STJA 4B2CA 1NM6A 3SU1A 4X8UH 1O5AB 3KQBA 4UDWH 1W3CA 3BTME 2RCEA 4K60A 2B5TB 1G2MA 2PW8H 8ESTE 4ISNA 1Z8GA 1FJSA 3Q3KA 1L0ZA 4WJG2 1OP0A 4UONA 1CQQA 4YTAA 2STBE 1SVPA 1ANBA 3A88A 3HK6B 1NFXA 1C1OA 2VWMA 1FN8A 2RG3A 1F0RA 1KY9A 1AVXA 2ZEBA 3RXSA 1O30A 4I31A 4GLYA 3A7ZA 3KCGH 1C4Y2 1TGBA 2ZU3A 4LXBH 1WBGB 1YLDA 2JKHA 1BTHH 1Z6JH 4JYUH 1V6DA 2ZWLH 3K2UA 2VIPA 2ZDKA 1EJAA 2ZTXA 4DIHH 1L4DA 1MTUA 1A46H 1P3CA 2QA9E 1SB1H 2XWBI 1C9PA 2XNIA 3QO6A 2V6NA 2ZPRA 5A8YA 4NZLA 5DJ7A 1O3KA 1ELGA 4X2XA 5E0JA 1XKBC 2Z6BD 2A7JA 1TWXB 1MD7A 2OLGA 1MBQA 3TITA 2AERH 1FN6A 1WTHD 1TGSZ 1S81A 1Z1IA 1N6XA 1XVOA 1BRUP 2HLCA 4AYYB 1SPJA 3RMNH 4RSPA 2G4UA 1C5VA 3UWIA 1GBCA 1AWFH 1SGYE 2V3OH 3HGPA 4H6SB 2VIDA 1QRZA 1P2OA 4OS2A 1Y3WA 3RLYH 4FUEA 4IMZA 1AE8H 2FOEA 5I46H 3K6ZA 1TFXA 2C8ZB 3T5FH 3RXLA 2H9HA 1C1RA 1BRBE 3HATH 2CV3A 1EB2A 2GDDA 1SGFG 3RXUA 2BDCA 3UUZA 1EP5A 1O3LA 1Z8IB 4AG2A 2A5IA 1UVTH 7ESTE 4JYVH 2ANMH 2HRVA 1JWTA 2SGEE 3FZDA 4A92A 2NU0E 2FYRA 3KNXA 4Y10E 2PLXA 3ATWA 3PTNA 3RLWH 1ZTJA 1EZUC 4B2BA 1CT2E 3ZZ7A 2Q6DA 2F9PA 1AKSB 1Y5AT 1V2OT 3RXDA 1C1SA 3AAVA 5AFYH 3RXGA 2HALA 5C3NA 3G01A 1A61H 1N8OC 1YPJH 3EGKH 3F9GA 2J4IA 5HM2A 3SGAE 2BLQA 3SJOA 3P92A 3M3SA 5FBIA 1CSOE 2GKVE 4Q7YA 4INHA 3L3TA 6GCHF 4VGCB 4BTTB 4E7RG 1YBWA 1O3MA 2H1UA 2SGPE 1QB6A 2QIQA 4GVUA 3VEQB 1KTSB 4AB8A 3AW0A 4B74A 3MO3A 3SV2H 1HAGE 1UCYH 1JRSA 4YOIA 2BDGA 1VJAU 3LGYA 1DWDH 5G4BA 4BNRA 3W95A 1UHBB 2FOCA 1TGTA 1HJ9A 3EYDA 4CRCA 3VB3A 1ZMJA 3EA7A 4FUBA 2F9UA 5DK1A 1O2UA 3NKKA 4AGKA 4DIIH 2ZPSA 1O2RA 1ZGIA 1O3IA 4BAOB 4ABIA 4MPXA 1QL7A 3GY4A 2BQ7B 4ZKNU 1YPKH 3R0FA 3ZZ8A 2DUCA 3MU8A 1FPCH 1VITG 5ABWA 2UUJB 2ZQ2A 3KL6A 2WV4A 4D7GA 3RXQA 3MOCA 4NA8A 1O2JA 1UO6A 1A3EH 2GX4A 4Z6AH 4VGCC 3OY5U 3MH7A 1TBQH 4AYVB 1KSNA 5F8XA 2BYAX 3UOPA 2P3UB 3SNEA 2Z9LA 2VIWA 4X1NU 4NA7A 3T25A 1UJ1A 2M5TA 1BHXF 4MNYA 2FOAA 1W11U 2ZTZA 3DFJA 3F1SB 1XUIA 2BXUH 2ALVA 1H9LB 1SSXA 2J2UA 1D3QB 2FIRH 2NU4E 1CBWB 5JBAS 3U1JB 1Z8JB 1VR1H 3SV6A 1ETTH 1V2MT 1SC8U 4IN2A 1RD3B 4BAQB 1LO6A 2BD4A 3ATKA 3V13A 2SGFE 5A8ZA 3AAUA 2OP9A 3BG4C 4FVDA 3TNTA 1GBAA 1O2LA 1LKBA 1OWKA 2FTLE 4DW2U 3M5MA 3SOSA 2D8WA 4UFGH 3M3TA 4AOQA 1EQ9A 3VPKA 1TRNA 4GSOA 3RUOA 4X6MA 1SGRE 1AB9C 1O3CA 1THPB 3PROA 3ATLA 3UPEA 2FX6A 1DUEA 1J17T 1HPGA 3LU9B 1CT0E 4YT7H 2ZFFH 2ZF0H 1P05A 4NZQA 1HCGA 5J4SA 1RTFB 4NFFA 4ZUHA 3M5LA 2R0LA 2PUQH 3RU4D 3SGBE 1GI9B 1TX6A 1CBWC 2UUKB 1S84A 1CHOG 1GHVH 3A8AA 3SU3A 3T28A 3CS7A 4FXGH 2BXTH 5EW2H 1DVAH 1UVPA 2A4RA 1GHZA 3RXOA 2BY9X 1TPAE 1PPBH 1INCA 1ZRBA 1Q2WA 2TBSA 1UTQA 2HOBA 1H1BA 1OX1A 1V2QT 1PFXC 3A83A 1SOZA 1DXPA 1LCYA 4Y7BA 3H5CB 3KEEA 1P01A 3RXCA 1W12U 2GDEH 4H4FA 1SGFA 3GCHC 1T8NA 2A5KA 2GD4B 2BY8X 1C1UH 4IMQA 2P3TB 3QX5H 2Q6FA 3A85A 4MNVA 3SJ9A 3O8CA 4GCHF 3M7QA 4KTUA 2PSXA 8LPRA 3MH6A 1QTFA 3E8LA 2PTNA 3ZZDA 1O3BA 3R3GB 1GGDC 2OXSA 1E0FD 2BLVA 1C2JA 1G3CA 2NWNA 3M35A 1P3EA 3ZVAA 1O5FH 5ESBA 4LK4A 3A7VA 1FMGA 3UWJH 3P70B 3SV9A 1SLXB 2VGCB 2WPKS 3SV8A 1O2XA 4GCHG 4I8LA 1OWIA 4BAHB 1HGTH 1F5LA 2A2QH 3M5OA 3BEUA 1IQEA 2BD7A 3ZZAA 1D3TB 4I8KA 3ELAH 4KGAA 4AZ2B 1HAIH 1P2NA 5GPIB 5H4IB 3LGIA 2CXVA 2ZHEH 1GJ5H 1O32A 2A32A 1LHFH 1C1QA 4DVAU 1PQ8A 4XBBA 1F0UA 1HYLA 1AZ8A 5AHGH 4UD9H 1C5ZB 1A5GH 4K1TA 2CHAB 5DO4H 1T31A 3BIVH 1IOEA 1C5XB 1S0RA 3UOUA 3A8DA 3SNDA 2P16A 2ZDNA 3IWMA 4I8GA 2Z7FE 3H7TA 1WU1A 1XUFA 2BX4A 1FDPA 1O39A 4MDSA 5TCCA 3I29A 1EZXC 5EPYA 2VGCC 1P03A 1SFQB 1NT1A 3QN7A 5DP3A 4ASHA 1FY8E 3AASA 4H6TA 4Y0YE 2XC4A 3ZVBA 3S9AA 1FY1A 2ODQA 5E8EH 4XBCA 3GY2A 4J1YA 2ZA5A 4D76A 3F9HA 1ZMLA 3RXEA 2PHBA 5A8XA 1FZZA 1MTWA 1V3XA 1FXYA 1GBTA 4UEHH 5EXNA 4FUHA 4GPGA 2AFQB 6CHAB 1B5GH 1MD8A 1UTNA 1WCZA 5GJ4B 1BZXE 3BTFE 1TRYA 3A86A 3FAOA 2FXRA 3SHAH 3MU1A 3GY8A 1DUAA 2H5DA 2AIPA 1O3EA 3F68H 3F6UH 4MG3A 4PROA 3BTHE 2VVCA 2TGTA 1CA8B 1SGDE 1YKTA 4ZXYH 3U98H 1S0QA 2O8LA 2QXHA 1IQKA 3NK8A 4JK6A 2TPIZ 5DGJA 1WTGH 1SGQE 3V7TA 2HVXA 1DSTA 4BTUB 2C4FH 4JZEH 2WPLS 1C5MD 1GHBF 4XBDA 1H4WA 6CHAC 3D49H 3RXIA 1BUIA 1IQFA 1ANEA 3TGKE 2G5NA 2BX3A 1ANDA 3T62A 4KTCA 3RXHA 1LQEA 4DURA 5TJXA 1MKXH 5HGGA 2C8YB 1XUHA 4D7FA 4LOYH 2BB4A 3BTQE 1P2KA 2O8TA 1VCQA 1TQ7B 1C1WH 1FONA 1P57B 5TCAA 1EB1H 1C1MA 1K1LA 1C1VH 2FS9A 1GJDB 2XC0A 4XOJA 3U9AH 1J9CH 5FBEA 4I7YH 2WUCA 3S7KB 1GHAG 1L2EA 2QV1A 1AI8H 4ZH8A 1MKWK 4WMDA 1L1JA 3TJNA 4BTIB 3ZVGA 1SGEE 1AUJA 1WQVH 2H9TH 1BDAA 1GDUA 1BTWA 2XWAA 4Z0KA 3D62A 1V2KT 1DXWA 4B75A 2PKSC 1GI0A 2WUBA 1O5EH 1QQ4A 1KLIH 2XTTB 4R8TB 2AS9A 3ODDA 2F83A 3B8JA 1QR3E 3FP6E 3RXKA 1KDQA 6ESTA 1C2DA 1C5TA 1G9IE 1S6FA 3AVZA 1LMWB 2UWLA 4AORA 2P93A 3BTGE 1C2LA 1FI8A 3KQEA 1UTJA 1MZDA 4K8BA 2Z9JA 1YCPK 1GJ9B 2ZGBH 3E1XB 1QGFA 3UR9A 5JBTA 4DT7B 1BRCE 1V2WT 1O2SA 1PJPA 4MPVA 4TPYA 4IN1A 1O34A 2BDAA 3GISB 3QDZB 3E0NB 3PMJA 3RXTA 1W10U 3U1IB 3RXRA 1KXAA 1TX7A 3A87A 1LVBA 1C2HA 3GYLB 4WMFA 3MNCA 1GDNA 1WSSH 4X2WA 2GZ7A 1TAWA 3ZV9A 4ZKRU 4WVPE 1GHWH 1PYTC 1BT7A 1ESBA 1C5WB 1SLVB 4KTSA 3ATMA 1A5HA 5FAHA 2ODYB 1TBZH 3QGJA 1RTKA 1O2KA 4FUGA 4D9RA 1AVWA 1RS0A 3GCOA 4R0IA 3CS0A 1F0SA 2A1DB 3FP8E 4YOJA 3LKWA 1ZTLA 2Y5FA 3LGTA 1RIWC 1BBRK 2FX4A 5E0GA 5A0BA 3TNSA 4X1SU 2G81E 2PR3A 3PM3A 2BDHA 4X8VH 3RU4E 3A80A 9LPRA 3FP7E 1GBEA 3RXJA 2DE8A 1HIAB 2ZGCA 3EDXB 1BHXB 3W94A 1T8OA 1T32A 1Y5BT 2OD3B 2TIOA 1TABE 2GV7A 3E16B 1W7GH 3UY9A 3MH5A 2ZPQA 3EE0B 1K1OA 1HAOH 2XBWA 5DPAA 2BD8A 1SBWA 2ANKH 1MZAA 1BMMH 2ZDMA 3BN9A 1AZZA 1GDQA 1D4PB 1J8AA 1K28D 4IGDA 4TWYA 2G51A 3ZZBA 3MH4A 1HJAB 1NY22 2VIQA 4OS5A 1LTOA 3MNBA 2GV6A 1O3FA 3SQHE 2RA3A 2AIQA 1GI6A 4X6NA 1AHTH 2R3UA 1C5YB 2AEIH 3URDA 3GCTG 5FPSA 1GHXH 1OPHB 2C8XB 1LQDB 1MTVA 3WY8A 1BBRE 1C1TA 2A0QB 3S7HB 2Z3DA 5EW1H 3UR6A 1LKAA 2VNTA 2IPHA 1NU7B 1YPHE 1F0TA 4ABHA 5JPMH 1F5KU 1IQMA 2WYJA 4TY6A 4FU9A 1N8OB 2PV9B 1QA7A 1V2TT 2FP7B 5EPNA 3M3VA 3RXMA 4CHAB 1ELTA 1HBTH 3EA8A 2Z3EA 1HJAC 1SI5H 3SU2A 2CGAA 3VFEA 1Y3VA 1HLTH 3LJOA 1TRMA 2ZNKH 1FIZA 2AMDA 2EI7A 4BOHA 1V2PT 1AN1E 1NTPA 2YNBA 4CBOA 1H8DH 1KDQB 4U32A 5IDKA 4WY3A 1TMUH 1VJ9U 1NRPH 1ARCA 3MFJA 2ZG0H 2C93B 3F9FA 1IQGA 4MNXA 4O03A 3PWBA 4Y71A 4ABAA 4ABDA 2BM2A 1NZQH 3QK1A 3PO1C 2BLOA 1PQ5A 2Y5GA 3O8BA 2ZGJA 3NXPA 1C5RA 1TBRH 3UNRA 3NZIA 3URCA 1O36A 1O35A 2BY5X 1TQ0B 4CHAC 3OTJE 5DP8A 1HAYB 3GCNA 3SZNA 1V2UT 4KP0A 1Y3YA 2H9EH 1O33A 1ELBA 4AG1A 3QLPH 2IN2A 3KF2A 2VVUA 1VITF 5EU8A 1Y3XA 1EOJA 1OYQA 3A82A 2VWLA 3DHKH 2PSYA 2F9NA 2O8MA 4IW4E 1AY6H 1HDTH 1EZQA 1OP8A 3M7TA 2O8UA 4GHQA 5CHAC 1QBNA 1QRXA 3VB6A 2WYGA 3SGQE 4DY7B 1HAXB 1IHTH 4NCYA 1FIWA 3SU6A 4UE7H 1CGIE 1KXFA 1N1LA 1TPPA 2BMGB 1C4U2 4IC5A 3F9EA 1ELCA 2PKAA 1HAVA 3ODFA 3GY3A 2UWOA 1EPTA 2ILNA 1DFPA 3U8RH 3BG4B 2SFAA 1DPOA 4K8YA 3LGWA 1DICA 1SMFE 3VXEH 2GCTC 4UFEH 5IYTA 1FY4A 1GJ8B 3GDSA 4BANB 1UK2A 1QB1A 2J95A 1TX8A 1IAUA 1AWHB 2FMJA 5C1UA 1AB9B 2XRCA 1S6HA 3SU5A 3KIDU 1QL9A 4OS7A 3UFAA 4X8TH 5L2ZH 1HRTH 1DSUA 2B0FA 1TMTH 1MUEB 1QJ7B 4ZMAH 3D23A 1GBHA 1OXGA 1TA2A 2SGDE 1GMCF 1UVOA 3RC5A 2ZO3H 3A7WA 4Y8ZA 1QJ1B 1SHHB 3DUXH 1P04A 3O8DA 2D1JA 3ZZ3A 3OYPA 2W7SA 3UQVA 3I78A 1NRSH 2XBVA 4ABFA 1CGHA 2BD5A 2ZCHP 4O9VA 3DFLA 1HAPH 4Q7ZA 2NU2E 1WQSA 3QZRA 1YPGH 1FLEE 3UTUH 4I8HA 1CHOF 4Y7AA 1GG6B 4ZXXH 1UTKA 1GPZA 4JYTA 1C2KA 1GMCG 4ZHMU 2BDIA 3GCHB 3M61U 1CE5A 1GJ6A 3OY6U 2NU1E 2QCYA 1QY6A 2GT7A 3K65B 1C2MA 4JZFH 1YLCA 3MNSA 1V2LT 5E2OA 3ZZ6A 1KLTA 3ZVDA 3ZZ4A 4YM9A 1Q3XA 5T6FA 3BEIB 4BAMB 4UFFH 1GGDB 1O2WA 1VITH 3CENA 2BZAA 3ZVFA 3BTWE 4QT8C 2Y7XA 2K1QA 2OUAA 1ZZZA 3RXVA 1MCTA 2YOLA 5F8TA 3TPIZ 2XYAA 3PLPA 4GHTA 1YF4A 5EGMA 2XW9A 5I25A 3RMLH 1TNIA 3Q00A 1TNKA 2A4OA 2H5CA 1IQIA 3STIA 2Y7ZA 3SBKA 4K1EA 2TGDA 1DWCH 1C2GA 1GG6C 1NFUA 2EC9H 4FUFA 4IBLH 3ZV8A 1YYY1 2A5AA 4CR9A 4X8SH 1F92A 3MO9A 5GCHG 3TH2H 3TK9A 5EQRA 3S0NA 3OX7U 4BXWA 1EAUA 2JH6D 1UK3A 2OQ5A 5LPRA 1Z71A 2Z94A 3V12A 1T4UH 1GI1A 5EG4A 3LH3A 4XFQA 1OSSA 2OBQA 1WOFA 2Z3CA 1EP6A 4CH8B 3QGNB 1FUJA 4ZKOU 2RA0A 1MQ6A 6LPRA 1ID5H 3OSYA 4YZUA 1OWEA 5E2PA 3HKIB 4YLQH 4AFQA 2B9LA 1QJ6B 3P8GA 3RDZA 5L30H 4X2YA 2P95A 1O37A 1O5CB 2W7UA 2LNCA 1TGNA 1RGQA 3M37A 3NCLA 4XDEA 3B23B 1BMNH 4ISOA 2P3FH 3MI4A 1C5PA 1D3DB 2ANWA 2QXIA 2BOKA 2FOFA 3K9XB 1HNEE 3P17H 1O2GH 1ESTA 1GVKB 1ZSKA 3MTYA 2PKAB 1W2KH 2Z9KA 5A2MH 1A1RA 1EPTB 2IOTA 2BD2A 4IS5A 3HGNA 2VU8E 2J94A 5L2YH 4O3TA 1TGCA 1D6WA 5DP5A 5C1YA 2F9BH 1EX3A 3VB4A 2OBOA 1SGTA 2TGAA 4AFSA 2ZU2A 1KTTB 2QGRA 2ZHWH 1O2NA 4KELA 2OTVA 3TLOA 1FV9A 2W3KA 1ELDE 3A8BA 1THRH 1ZHPA 2F9VA 2HNTE 3BV9B 2FI5E 3RM2H 1FPHH 4SGAE 4MVNA 2FLRH 5DP6A 1ACBE 2A2XH 2ZHDA 1XM1A 4CBNA 3BEFB 4ZHLU 1LVYA 1G37A 2ZQ1A 4RKJB 3NUMA 4BXSA 2WPMS 3ZYDA 1TB6H 2O8WA 1UVUH 5GIBA 1OS8A 1W13U 2KAIA 1UTPA 4WH8A 1DS2E 1O3PB 1C1PA 1K1IA 2SNWA 3UIRA 3QUMP 1EPTC 4YT6H 4AFUA 2HGTH 2ZGXH 1DE7H 3SI3H 4ABJA 1ELFA 1LHCH 1W0YH 1BMAA 3Q76A 2ZDAH 2ALPA 2VVVA 2G8TA 1JBUH 2FOMB 3DA9B 3Q3XA 2QXGA 1YPMH 2GCHF 1CVWH 3KQDA 4INLA 1XUJA 2BQ6B 1W8BH 1DY9A 2AMQA 1ZLRA 5EQQA 1NRRH 1OP2A 4F49A 5A0AE 3SO3A 4WF8A 1ZSLA 2G00A 1K1JA 1CO7E 2G5VA 1WAYB 3FZZA 1BTXA 1GI5A 3VXFH 3RMMH 3VGCB 1P02A 1O31A 4Y0ZE 1OWJA 2GCHG 4INKA 1JRTA 1AO5A 1HXEH 1TNGA 4X6PA 1OWHA 1O0DH 4U30A 1HAHH 1ZMNA 1Y5UT 1VZQH 3U8TH 1GBBA 1NU9A 5JDUB 3SV7A 3MWIU 4X1RU 4SGBE 1N6YA 1NPMA 2VJ1A 4I32A 3SJ8A 2FDAA 3NPSA 3SUDA 1GBLA 3ESTA 2WPHS 2BQWB 5K7RA 1P0SH 3SU0A 1QA0A 2PKSB 3BTTE 2QF3A 3C1KA 3RP2A 1QFKH 3SORA 1GHAF 1SGIB 4K1SA 4NWKA 1J14A 3SQEE 3TJUA 4YLUA 3C27B 3V0XA 1Y59T 1OKXA 4TWWA 2VIOA 1MTNC 3QTVH 3KHVA 3UREA 1KXEA 1G3DA 1ETSH 1K9OE 2QY0B 4Q80A 2BY6X 3TH4H 1AFQC 2J92A 3VGCC 1C2IA 1F7ZA 3SHCH 1G32B 1UTMA 1XUKA 3MNXA 1AQ7A 4HTCH 4A1TA 1XX9A 1O3JA 3P6ZB 3V3MA 4FU8A 2R0KA 1BTYA 1SHYA 1Z1JA 2C8WB 5JBBS 3MO6A 4B71A 1AGJA 4RKOB 3PMAB 4E06H 4NSYA 1RRKA 1AUTC 2OC0A 1BMLA 2CN0H 1TOMH 4ZKSU 2R2MB 1Q31A 4ABBA 2GVFA 1HFDA 3HKJB 3T29A 3FANA 1AU8A 4CR5A 4ZHAA 1UCYK 3KQCA 2ANYA 1E36B 3TGIE 5AFZH 1NRNH 2VINA 3EQ0H 3A8CA 1TALA 2NU3E 2XBYA 2FO9A 5ESTE 1GBJA 5FHTA 5FCKA 1VGCC 3S9CA 2D2DA 4UFDH 2ODPA 3PWCA 5T6DA 2CJIA 3UNSA 2Y81A 4Y76A 3BTEE 5F03A 1RIWB 3S9BA 4LZ1H 2R9PA 1EAWA 2OCVB 4X1QU 3IITA 4AN7A 2GZ9A 1XXDA 1DANH 1PPGE 1BQYA 2ZIQH 2CMYA 2TRMA 1TNJA 1SQAA 1MU8B 1NRQH 4K3JA 1GL0E 4WH6A 4FUCA 1NS3A 1MCVA 1E34B 1BJVA 2XBXA 1GI3A 1P06A 4J2YB 1GJBB 1L1NA 2OQUA 1ESAA 1GJAB 1Y8TA 3BF6H 3Q77A 1JOUB 4NWLA 1K2I1 2DE9A 3E0PB 1PPCE 5FCRA 4HGCA 2PUXB 5GDSH 3LIWA 3GY5A 1BTZA 1K1NA 1TPOA 2G4TA 5F6MA 1YC0A 2R3YA 1UCYE 3PB1E 3TIUA 2Y5HA 5ETXA 1WV7H 3BTDE 3LOXA 4K5ZA 4MPWA 2GMTC 1F2SE 1C5OH 3ENSB 3SW2B 1GBFA 1GI4A 2JH5D 4RN6A 1GJ4H 1O3DA 4HZHA 4WWYA 1UHBA 2AMPA 4TYDA 3K6YA 4TPIZ 1LVOA 3N7OA 4I33A 3TH3H 1C9TA 1ZOMA 1SOTA 3E90B 2WPJS 1YP9A 3T26A 4JK5A 1GBDA 4B76A 2FEQH 3GCTF 2FI4E 1BITA 2XXLA 3LPRA 1K1PA 2C3SA 2EA3A 2ZECA 3TK5A 3OU0A 2D26C 2GT8A 1GI8B 3FVFB 1O5BB 5C5NA 1KXDA 1GJ7B 3SJKA 3U69H 2FOGA 5CE1A 4DGJA 3SN8A 5AVDA 1D6RA 1YPEH 1P09A 2O9QA 2Y80A 4ZROA 1P10A 2ZFRH 3PMHB 3TU7H 3ZYEA 2ASUB 2P59A 4OGYA 3DT0H 4NFEA 4NIWA 4AGJA 5FXLA 1VCWA 3PO1B 2QAAA 3QTOH 5J4QA 1A4WH 3GDUA 1F5RA 1PQ7A 4O3UA 1G36A 3TK6A 2FOHA 2QN5T 1TA6A 2IJOB 1SL3A 1BRAA 1DT2A 1PPFE 1UTLM 3GY7A 1O5DH 3HK3B 1EJMA 2BOHB 1MU6B 1ZHMA 5B6OA 1A7SA 3P8FA 4AFZA 1SLUB 1ZTKA 3ATIA 3ZVEA 3GY6A 5EXMA 3QZQA 1ZPBA 1B0EA 1GI7B 3NWUA 4M7GA 3P95A 1Y3UA 2QXJA 1HAZB 4ABEA 1PPHE 1THSH 2FOBA 2QYIA 1C4V2 2VIVA 1CHGA 2ZU1A 3RC6A 1BB0B 2THFB 5GXPA 2G52A 5CHAB 1NN6A 4X0WU 1A3BH 4B73A 5A09A 2VH0A 8GCHF 1EAIA 2VWOA 1GJCB 1NFWA 3SJIA 1XVMA 5FPYA 2LPRA 1ZR0A 2ZFQH 5C20A 1LHDH 2P94A 3I77A 1EUFA 1K1MA 2ESTE 4CREA 1ZPZA 4IC6A 2ULLA 3LH1A 4CRBA 4TY7A 1K21H 3U8OH 1DX5M 8KME2 1SGPE 5JB8S 3RM0H 4NGAH 3PLKA 3ZVCA 2GCTB 3RXFA 3E6PH 3M5NA 1E37B 3JZ2B 8GCHG 1SGNE 2BVSH 3JZ1B 1G2LA 5K0HA 1P8VC 1TYNA 3LC3A 1GVLA 1MKWH 1CGJE 1C2EA 2HWLB 1UK4A 2BD3A 3LJJA 3MU0A 1V2JT 1CT4E 1SQOA 3A81A 1V2NT 2XCFA 5E0HA 4ESTE 2Y6TA 1MAYA 1LHGH 2JETB 3LC5A 4OGXA 1LHEH 7KMEH 4D8NA 2A7CA 3GDVA 4MQAA 1BOQA 5DP9A 2ZTYA 3H7OA 1L1GA 1ZRKA 1A0LA 1O3GA 4CH2B 1B0FA 5C1XA
chains in the Genus database with same CATH superfamily
1S82A 3LDXH 1TNLA 2G55A 1LPZB 5F8ZA 5JBCS 1E38B 1V2ST 4A1VA 1QB9A 3A89A 3ZZ9A 2BD9A 2FWWA 1DDJA 4Y8YA 1PPZA 3F0PA 3RXAA 3B9FH 5DKMA 4NSVA 5A0CA 1ELEE 1P2MA 1O2QA 4DOQA 6GCHG 3LGUA 4MNWA 1P9UA 1YCPH 1GMDF 3HPTB 3F3BA 3ITIA 2F3CE 1XMNB 4NIXA 1OWDA 2Z9IA 1P2IA 2A4GA 1X7AC 2WINI 1T8MA 3SNCA 1EKBB 1SGCA 5HMAA 1P2QA 1EOLA 5C2ZA 3BG8A 1QURH 2AYWA 5AF9H 2PGBB 3P8OA 2JETC 4NIVA 2BY7X 1BA8B 3E91A 4ISHH 4K69A 1P12E 2B8OH 1GMDG 1ELVA 1NBMD 1C5NH 1UTOA 2ZDLA 2PFEA 3PMBB 2UWPA 4ISLA 3CNRA 3M36A 1IQNA 5FL7D 2STAE 1O2IA 1KYNA 2Z9GA 5T3HA 1O5GH 1RTLA 1GCTB 2FLBH 2ZFTA 2ZC9H 1ZYOA 3Q3YA 1BBRH 3PTBA 1GI2A 1ZJKA 5C94A 1WUNH 4NIYA 1AE5A 5F53A 3KGPA 2P8OB 2V3HH 1NROH 1O2OA 4FVBA 1TPSA 1MKXK 3VB5A 1G3BA 1W14U 2V35A 1SG8B 1E1QD 4XRNA 5GWZA 1J16A 1TLDA 1GVZA 4X1PU 4WMEA 2WV9A 1JIMA 1OOKB 2QC2A 4MTBA 4WXIA 2SGAA 4MLFB 1S83A 2FESH 4DCDA 3MU4A 2ZU4A 1G3EA 5GCHF 3SUFA 2Q6GA 2H6MA 2QF0A 5C67A 1LPGB 1Z8RA 1LVMA 1IQJA 4XD7D 3A7YA 1FQ3A 1U6QA 4LZ4B 1TOCB 2BDYA 4E05H 2W5EA 1Z6EA 3E3TA 1M9UA 4HFPB 5HXFA 2GTBA 1MQ5A 1JIRA 1GCTC 3MMGA 5JYIA 5T6GA 1IQLA 2Q1JA 2EI6A 1NC6A 1O2TA 1T7CA 2F4LA 1V2RT 2P8OC 2HNTC 3TVJB 1PQAA 1MTSA 5GNDA 2OC7A 2GZ8A 2AH4X 4AC9A 1HB0B 1ABIH 1TMBH 1HV7A 2ZP0H 2H2ZA 1UMAH 4DG4A 5LGOA 1YCPM 1H9IE 5BPEA 1BJUA 1YGCH 4A5TS 3SUEA 1QIXB 4F4OC 1GBMA 1P2JA 4GAWA 3SNBA 4NA9H 4FUIA 1RXPA 1O2YA 4AX9H 1G30B 1MBMA 1BTUA 3AW1A 4OS1A 2BDBA 4JCNA 1BCUH 5HIZA 3SNAA 1D9IA 4AB9A 1NFYA 1ABJH 1YLNA 3IG6B 3BIUH 2ZKSA 3RMOH 2K8IA 4ISIH 1FY3A 4JZIA 2A7HA 1ZHRA 1DLEA 5FX6A 1HJ8A 1PYTD 1H8IH 1DY8A 1GBIA 5LH8A 5HM9A 1SFIA 2HPQH 3PYHA 5CHBA 1HAVB 4U2WA 2LELA 3KN2A 4Y11E 1DWEH 1S85A 3SI4H 4D9QA 1JXPA 1O2HA 1EZSC 1QCPA 2GGVB 3TJVA 4Y6DA 3AK5A 2F91A 3GICB 1EATA 2ZZUH 1S5SA 4YXWD 1EASA 1FAXA 3SU4A 4OS6A 3SYJA 1ELAA 4TSFD 1ANCA 1IQHA 1PPEE 4Q7XA 5CMXH 3PRDA 1ETRH 2CF8H 4YO9A 1UVSH 4BAKB 5KECA 1AFEH 1A5IA 4DJZB 3CP7A 1CA0B 1QL8A 1O3OA 2ZGHA 1A0HB 2FYQA 3P8NA 4ZAEA 1NESE 3D65E 3PLBA 1HXFH 1P9SA 1ZJDA 1KIGH 4CRDA 4HI3A 1EJNA 2ZU5A 2UUYA 2ZCLP 1CU1A 1WYKA 1MABB 4H42U 3GYMA 4YESB 3UQOA 1KXCA 2BLWA 2W26A 4KKDA 1ORFA 1C5SA 2OC1A 4CRGA 5EQSA 1EXFA 2FPZA 2JH0D 3ZZ5A 2BVRH 7LPRA 2VB0A 1XKAC 4CRFA 1O3NA 4ABGA 2EEKA 3PRBA 2AGEX 3ZZCA 1D3PB 5DP4A 4ACBA 4B1TA 4X6OA 2KX4A 4WXVA 1AD8H 2J34A 1TONA 2AGGX 2RDEA 2VWNA 1J15A 2YMSB 1QNJA 1W7XH 2CHAC 1CA0C 2PTCE 5JB9S 1P11E 2FI3E 3U28C 1XUGA 2WPIS 4E7NA 1WXRA 1O3AA 3L33A 2ZHQH 3EA9A 3EAJA 3O8RA 1OYTH 1MTNB 1O3HA 1VCPA 1HUTH 2ZCKP 4NG9H 2HNTF 1B7XB 1Z7KA 1ZSJA 1RFNA 4GUXA 1LPKB 1AFQB 5SGAE 3QWCH 2XCNA 1AMHA 3OTPA 1FNIA 4OS4A 1SLWB 2I6QA 2J38A 1A2CH 5HYOA 1E35B 3DD2H 2WSSD 2PGQB 2A4QA 5L6NH 1KLJH 1HIAA 1MAXA 3S69A 1T4VH 2EI8A 1QBOA 4A6LA 4K2YA 5C5OA 1QBVH 1O2ZA 2AGIX 3RU4T 4JMYA 1LDTT 3FFGA 1SR5C 4P00A 5FPTA 2R2WU 2ZHFH 5LPEA 5DG6A 2RDLA 2GP9B 3F0OA 2A31A 2A45B 3T2NA 3UNQA 1C5LH 3T27A 4A7IB 3LGVA 1QRWA 2FS8A 4I8JA 4THNH 1VGCB 3VB7A 4Q2KA 1GHYH 3MHWU 2FTMA 2J9NA 2KZ4A 2SGQE 3RXPA 3MU5A 4XSKU 3A7TA 1YM0A 4FUJA 4JZDH 1BTPA 1O38A 3BTKE 4JZ1A 1ZGVA 2V0BA 3F2GA 3TJOA 2ZI2H 1GMHF 4X2VA 2ZFSA 1O2MA 1TIOA 5EOKA 2FODA 3LT3A 4Y8XA 2FM2A 1GHBG 3L6PA 1JMOH 2W3IA 9ESTA 1GBKA 2V3MA 2XC5A 2KR7A 2B7DH 3PV4A 3OAAD 1NO9H 1TNHA 1YPLH 5T1VA 2YNAA 2OC8A 1QHRB 2TGPZ 2WV5A 1O2VA 4O97A 2UUFB 1O2PA 2ZFPH 1GMHG 1MMJN 1ARBA 2I6SA 2BZ6H 5PTPA 3M7UA 3BSQA 3LONA 2C90B 3MYWA 1BIOA 7GCHF 1EAXA 1SQTA 1AVGH 1RJXB 5BRRE 5EXLA 3OFND 1IHSH 1GCDA 1FY5A 1C2FA 2GMTB 3RC4A 3SUGA 1FAKH 1DLKB 2VH6A 2HPPH 4B2AA 5LPFA 1XXFA 4MPUA 1TE0A 1FX0B 1NBME 4FU7A 1A0JA 1C1NA 1AIXH 2FZZA 3GOVB 4FUDA 4DT4A 4CRAA 2BHGA 2ZDVH 7GCHG 1GL1A 3F2HA 3TGJE 2KAIB 3A7XA 2F9OA 5DP7A 1L4ZA 2BTCE 2CF9H 1DITH 3DSGA 4YOGA 1AKSA 1DWBH 3RXBA 1C5UA 1ZPCA 1V2VT 2AHME 4A1XA 1W0ZU 1K22H 1DM4B 5FX5A 3A84A 1T8LA 1H9HE 2OINA 3N7DA 1GWAA 1DOJA 4XE4A 1MH0A 4U01A 2BVXH 4Y79A 2Y82A 2J97A 1YPHC 1C5QA 5EODA 1KXBA 1QQUA 2PWXA 2SNVA 3STJA 4B2CA 1NM6A 3SU1A 4X8UH 1O5AB 3KQBA 4UDWH 1W3CA 3BTME 2RCEA 4K60A 2B5TB 1G2MA 2PW8H 8ESTE 3MQKC 4ISNA 1Z8GA 1FJSA 3Q3KA 1L0ZA 4WJG2 1OP0A 4UONA 1CQQA 4YTAA 2STBE 1SVPA 1ANBA 3A88A 3HK6B 1NFXA 1C1OA 2VWMA 1FN8A 2RG3A 3W1EA 1F0RA 1KY9A 1AVXA 2ZEBA 3RXSA 1O30A 4I31A 4GLYA 3A7ZA 3KCGH 1C4Y2 2J98A 1TGBA 2ZU3A 4LXBH 1WBGB 1YLDA 2JKHA 1BTHH 1Z6JH 4JYUH 1V6DA 2ZWLH 3K2UA 2VIPA 2ZDKA 1EJAA 2ZTXA 4DIHH 1L4DA 1MTUA 1A46H 1P3CA 2QA9E 1SB1H 2XWBI 1C9PA 2XNIA 3QO6A 2V6NA 2ZPRA 5A8YA 4NZLA 5DN6D 5DJ7A 1O3KA 1ELGA 4X2XA 5E0JA 4B6EA 5CDFE 1XKBC 2Z6BD 2A7JA 1TWXB 1MD7A 2OLGA 1MBQA 3TITA 2AERH 1FN6A 1WTHD 1TGSZ 1S81A 1Z1IA 1N6XA 1SQRA 1XVOA 1BRUP 2HLCA 4AYYB 1SPJA 3RMNH 4RSPA 2G4UA 4ZCNA 1C5VA 3UWIA 1GBCA 1AWFH 1SGYE 2V3OH 3HGPA 4H6SB 2VIDA 1QRZA 1P2OA 4OS2A 1Y3WA 3RLYH 4ASUD 4FUEA 4IMZA 1AE8H 2FOEA 5I46H 3K6ZA 1TFXA 2C8ZB 3T5FH 3RXLA 3ZIAD 2H9HA 1C1RA 1BRBE 3NRLA 3HATH 2CV3A 1EB2A 2GDDA 1SGFG 3RXUA 2BDCA 3UUZA 1EP5A 1O3LA 1Z8IB 4AG2A 3FO8D 2A5IA 1UVTH 7ESTE 4JYVH 2ANMH 2HRVA 1JWTA 2RFKC 2SGEE 3FZDA 4A92A 2NU0E 2FYRA 3KNXA 4Y10E 2PLXA 3ATWA 3PTNA 3RLWH 1ZTJA 1EZUC 4B2BA 1CT2E 3ZZ7A 2Q6DA 2F9PA 1AKSB 1Y5AT 1V2OT 3RXDA 1C1SA 3AAVA 5AFYH 3RXGA 2HALA 5C3NA 3G01A 1A61H 1N8OC 1YPJH 3EGKH 3F9GA 2J4IA 5HM2A 3SGAE 2BLQA 3SJOA 3P92A 3M3SA 5FBIA 1CSOE 2GKVE 4Q7YA 4INHA 3L3TA 6GCHF 4VGCB 4BTTB 2KM0A 4E7RG 1YBWA 1O3MA 2H1UA 2SGPE 1QB6A 2QIQA 4GVUA 3OEED 1KTSB 3VEQB 3AW0A 4AB8A 3MO3A 3SV2H 1HAGE 1UCYH 1JRSA 4YOIA 4B74A 2HLDD 2BDGA 1VJAU 3LGYA 1DWDH 5G4BA 4BNRA 3W95A 1UHBB 2FOCA 1TGTA 1HJ9A 3EYDA 4CRCA 3VB3A 1ZMJA 3EA7A 4FUBA 2F9UA 5DK1A 1O2UA 3NKKA 4AGKA 4DIIH 2ZPSA 1O2RA 1ZGIA 2JJ2D 1O3IA 4BAOB 4ABIA 4MPXA 1QL7A 2VBCA 2BQ7B 3GY4A 4ZKNU 1YPKH 3R0FA 3ZZ8A 2DUCA 5EJLA 3MU8A 1FPCH 1VITG 5ABWA 2UUJB 2ZQ2A 3KL6A 2WV4A 4D7GA 3RXQA 3MOCA 4NA8A 1O2JA 1UO6A 1A3EH 2GX4A 4Z6AH 4VGCC 3OY5U 3MH7A 1TBQH 4AYVB 1KSNA 5F8XA 2BYAX 3UOPA 2P3UB 3SNEA 2Z9LA 2VIWA 4X1NU 4NA7A 3T25A 1UJ1A 2M5TA 1BHXF 2J5UA 4MNYA 2FOAA 1W11U 2ZTZA 3DFJA 3F1SB 1XUIA 3F2FA 2BXUH 2ALVA 1H9LB 1SSXA 2J2UA 2YMSD 1D3QB 2FIRH 2NU4E 1CBWB 2JJ1D 5JBAS 3U1JB 1YY3A 1Z8JB 1VR1H 3SV6A 1ETTH 1V2MT 1SC8U 4IN2A 1RD3B 4BAQB 1LO6A 2BD4A 3ATKA 3V13A 2SGFE 5A8ZA 3AAUA 2OP9A 3BG4C 4FVDA 3TNTA 1GBAA 1O2LA 1LKBA 1OWKA 2FTLE 2K0QA 4DW2U 3M5MA 3SOSA 2D8WA 4UFGH 3M3TA 4AOQA 1EQ9A 3VPKA 1TRNA 1OHHD 4GSOA 3RUOA 4X6MA 1SGRE 4RT0A 1AB9C 1O3CA 2IJD1 1THPB 3PROA 3ATLA 3UPEA 2FX6A 2V7QD 1DUEA 1J17T 1HPGA 3LU9B 1CT0E 4YT7H 2ZFFH 2ZF0H 1P05A 4NZQA 1HCGA 5J4SA 1RTFB 4NFFA 4ZUHA 3M5LA 2R0LA 2PUQH 3RU4D 3SGBE 1GI9B 1TX6A 1CBWC 2UUKB 1S84A 1CHOG 1GHVH 3A8AA 3SU3A 3T28A 3CS7A 4FXGH 2BXTH 4TT3D 1DVAH 1UVPA 5EW2H 2A4RA 1GHZA 3RXOA 2BY9X 1TPAE 1PPBH 1INCA 1ZRBA 1Q2WA 2TBSA 1UTQA 2HOBA 1H1BA 1OX1A 1V2QT 1PFXC 3A83A 1SOZA 1DXPA 1LCYA 4Y7BA 3H5CB 2WPDD 3KEEA 1P01A 3RXCA 1W12U 2GDEH 4H4FA 1SGFA 3GCHC 1T8NA 2A5KA 2GD4B 2BY8X 1C1UH 4IMQA 2P3TB 3QX5H 2Q6FA 3A85A 4MNVA 3SJ9A 3O8CA 4GCHF 3M7QA 4ACAA 4KTUA 2PSXA 8LPRA 3MH6A 1QTFA 3E8LA 2PTNA 3ZZDA 1O3BA 3R3GB 1GGDC 2OXSA 2L6OA 1E0FD 2BLVA 1C2JA 1G3CA 2NWNA 3M35A 1P3EA 3ZVAA 1O5FH 5ESBA 4LK4A 3A7VA 1FMGA 3UWJH 3P70B 3SV9A 1SLXB 2VGCB 2WPKS 3SV8A 1O2XA 4GCHG 4I8LA 1OWIA 4BAHB 1HGTH 1F5LA 2A2QH 3M5OA 3BEUA 1IQEA 2BD7A 3ZZAA 1D3TB 4I8KA 3ELAH 4KGAA 4AZ2B 1HAIH 1P2NA 5GPIB 5H4IB 3LGIA 2CXVA 2ZHEH 1GJ5H 1O32A 2A32A 1LHFH 1C1QA 4DVAU 1PQ8A 4XBBA 1F0UA 1HYLA 1AZ8A 5AHGH 4UD9H 1C5ZB 3FOAA 1A5GH 4K1TA 2CHAB 5DO4H 1T31A 3BIVH 1IOEA 1C5XB 1S0RA 3UOUA 3A8DA 3SNDA 2P16A 2ZDNA 3IWMA 4I8GA 2Z7FE 3H7TA 1WU1A 1XUFA 2BX4A 1FDPA 1O39A 4MDSA 5TCCA 3I29A 1EZXC 3SZEA 5EPYA 2VGCC 1P03A 1SFQB 1NT1A 3QN7A 5DP3A 4ASHA 1FY8E 3AASA 4Q4LA 4H6TA 2WHXA 4Y0YE 2XC4A 3ZVBA 3S9AA 1FY1A 2ODQA 5E8EH 4XBCA 3GY2A 4J1YA 2ZA5A 4D76A 3F9HA 1ZMLA 3RXEA 2PHBA 5A8XA 1FZZA 1MTWA 1V3XA 1FXYA 1GBTA 4UEHH 5EXNA 4FUHA 4GPGA 2AFQB 6CHAB 2HVYB 1B5GH 1MD8A 1UTNA 1WCZA 5GJ4B 4M9FA 1BZXE 3BTFE 1TRYA 3A86A 3FAOA 2FXRA 3SHAH 3MU1A 3GY8A 1DUAA 2H5DA 2AIPA 1O3EA 3F68H 3F6UH 4MG3A 4PROA 3BTHE 2VVCA 2TGTA 1CA8B 1SGDE 1YKTA 4ZXYH 3U98H 1S0QA 2O8LA 2QXHA 1IQKA 3NK8A 4JK6A 2TPIZ 5DGJA 1WTGH 2GJGA 1SGQE 3V7TA 1E79D 2HVXA 1DSTA 4BTUB 2C4FH 2F43B 4JZEH 2WPLS 5EJZA 1C5MD 1GHBF 4XBDA 1H4WA 6CHAC 3D49H 3RXIA 1BUIA 1IQFA 3KYGA 1ANEA 3TGKE 2G5NA 2BX3A 2QF5A 1ANDA 3T62A 4KTCA 3RXHA 1LQEA 4DURA 5TJXA 1MKXH 5HGGA 2C8YB 1XUHA 4D7FA 4LOYH 2BB4A 3BTQE 1P2KA 2O8TA 1VCQA 1TQ7B 1C1WH 1FONA 5HKKD 1P57B 5TCAA 1EB1H 1C1MA 1K1LA 1C1VH 2FS9A 1GJDB 2XC0A 4XOJA 3U9AH 1J9CH 5FBEA 4I7YH 2WUCA 3S7KB 1GHAG 1L2EA 2QV1A 1AI8H 4ZH8A 1MKWK 4WMDA 1L1JA 3H09A 3TJNA 1UW7A 4BTIB 3ZVGA 1SGEE 1AUJA 1WQVH 2H9TH 1BDAA 1GDUA 3DSPA 1BTWA 2XWAA 4Z0KA 3D62A 1V2KT 1DXWA 4B75A 2PKSC 1GI0A 3EE7A 2WUBA 1O5EH 1QQ4A 1KLIH 2XTTB 4R8TB 2AS9A 2IPQX 3ODDA 2F83A 3B8JA 1QR3E 3FP6E 3RXKA 1KDQA 6ESTA 1C2DA 1C5TA 1G9IE 1S6FA 3AVZA 1LMWB 2UWLA 4AORA 2P93A 1KMHB 3BTGE 1C2LA 1FI8A 3KQEA 1UTJA 1MZDA 4K8BA 2Z9JA 1YCPK 1GJ9B 2ZGBH 3E1XB 1QGFA 3UR9A 5JBTA 4DT7B 1BRCE 1V2WT 1O2SA 2W6ID 1PJPA 4MPVA 4TPYA 4IN1A 1O34A 2BDAA 3GISB 3QDZB 3E0NB 3PMJA 3RXTA 1W10U 3U1IB 3RXRA 1KXAA 1TX7A 3A87A 1LVBA 1C2HA 3GYLB 3WWBA 4WMFA 3MNCA 1GDNA 1WSSH 4X2WA 2GZ7A 1TAWA 2KCOA 3ZV9A 4ZKRU 4WVPE 1GHWH 1PYTC 1BT7A 1ESBA 1C5WB 1SLVB 2KCYA 4KTSA 3ATMA 1A5HA 5FAHA 3N7EA 4Q63A 2ODYB 1TBZH 3QGJA 1RTKA 1O2KA 4FUGA 4D9RA 1AVWA 1RS0A 3GCOA 4R0IA 3CS0A 1F0SA 2A1DB 3FP8E 4YOJA 3LKWA 1ZTLA 2Y5FA 3LGTA 1RIWC 1BBRK 2FX4A 5E0GA 5A0BA 3TNSA 4X1SU 2G81E 2PR3A 3PM3A 2BDHA 4X8VH 3RU4E 3A80A 9LPRA 3FP7E 1GBEA 3OE7D 3RXJA 2DE8A 2JDID 1HIAB 2ZGCA 3EDXB 1BHXB 3W94A 1T8OA 1T32A 1Y5BT 2OD3B 2TIOA 1TABE 2GV7A 3E16B 1W7GH 3UY9A 3DCLA 2JIZD 3MH5A 2ZPQA 3EE0B 1K1OA 1HAOH 2XBWA 5DPAA 1H8ED 2BD8A 1SBWA 2ANKH 1MZAA 1BMMH 2ZDMA 3BN9A 2M2AA 1AZZA 1GDQA 1D4PB 1J8AA 1K28D 4IGDA 4TWYA 2G51A 3ZZBA 3MH4A 1HJAB 1NY22 2VIQA 4OS5A 1LTOA 3MNBA 2GV6A 1O3FA 3SQHE 2RA3A 2AIQA 1GI6A 4X6NA 1AHTH 2R3UA 1C5YB 2AEIH 3URDA 3GCTG 5FPSA 1GHXH 1OPHB 2C8XB 1LQDB 1MTVA 2KCPA 3WY8A 1BBRE 1C1TA 2A0QB 3S7HB 2XOKD 2Z3DA 5EW1H 3UR6A 1LKAA 2VNTA 2IPHA 1NU7B 1YPHE 1F0TA 4ABHA 5JPMH 1F5KU 1IQMA 2WYJA 4TY6A 4FU9A 1N8OB 2PV9B 1QA7A 1V2TT 2FP7B 5EPNA 3M3VA 3RXMA 4CHAB 1ELTA 1HBTH 3EA8A 2Z3EA 5DSFA 1HJAC 1SI5H 3SU2A 2CGAA 3VFEA 1Y3VA 1HLTH 3LJOA 1TRMA 2ZNKH 1FIZA 2AMDA 2EI7A 4BOHA 1V2PT 1AN1E 1NTPA 1W0KD 2YNBA 4CBOA 5EJ1A 1H8DH 1KDQB 4U32A 5IDKA 3PV2A 4WY3A 1TMUH 1VJ9U 1NRPH 1ARCA 3MFJA 2ZG0H 2C93B 3F9FA 1IQGA 4MNXA 4O03A 3WWFA 3PWBA 4Y71A 4ABAA 4ABDA 2BM2A 1NZQH 3QK1A 3PO1C 2BLOA 1PQ5A 2Y5GA 3O8BA 2ZGJA 3NXPA 4OM9A 1C5RA 1TBRH 3UNRA 3NZIA 3URCA 1O36A 2CK3D 1O35A 2BY5X 1TQ0B 4CHAC 3OTJE 5C0UA 5DP8A 1HAYB 3GCNA 3SZNA 1V2UT 4KP0A 1Y3YA 2H9EH 1O33A 1ELBA 4B6FA 4AG1A 3QLPH 2IN2A 3KF2A 2VVUA 1VITF 5EU8A 1Y3XA 1EOJA 5C17A 1OYQA 3A82A 2VWLA 3DHKH 2PSYA 4P02A 2F9NA 2O8MA 4IW4E 1AY6H 1HDTH 1EZQA 1OP8A 3M7TA 4FOUC 2O8UA 4GHQA 5CHAC 1QBNA 5EIYA 1QRXA 3VB6A 2WYGA 3SGQE 4DY7B 4FETA 1HAXB 1IHTH 4NCYA 1FIWA 3SU6A 4UE7H 1CGIE 1KXFA 1N1LA 1TPPA 2BMGB 1C4U2 4IC5A 3F9EA 1ELCA 2PKAA 1HAVA 3ODFA 3GY3A 2J98B 2UWOA 1EPTA 2ILNA 1DFPA 3U8RH 3BG4B 2SFAA 1SKYE 1DPOA 4K8YA 3LGWA 1DICA 1SMFE 3VXEH 2GCTC 4UFEH 5IYTA 1FY4A 1GJ8B 3GDSA 2WZQA 4BANB 1UK2A 1QB1A 2J95A 1TX8A 1IAUA 1AWHB 2FMJA 5C1UA 1AB9B 2XRCA 1S6HA 3SU5A 3KIDU 1QL9A 4OS7A 3UFAA 4X8TH 2PP6A 5L2ZH 1HRTH 1DSUA 2B0FA 1TMTH 1MUEB 1QJ7B 4ZMAH 3D23A 1GBHA 1OXGA 1TA2A 2SGDE 1GMCF 1UVOA 3RC5A 2ZO3H 3A7WA 4Y8ZA 1QJ1B 1SHHB 3DUXH 1P04A 3O8DA 2D1JA 4F48B 3ZZ3A 3OYPA 2W7SA 3UQVA 3I78A 1NRSH 2XBVA 4ABFA 1CGHA 2BD5A 2ZCHP 4O9VA 3DFLA 1HAPH 4Q7ZA 2NU2E 1WQSA 3QZRA 1YPGH 5KGOA 1FLEE 3UTUH 4I8HA 2KCAA 1CHOF 4Y7AA 1GG6B 4ZXXH 1UTKA 1GPZA 4JYTA 1C2KA 1GMCG 4ZHMU 2BDIA 3GCHB 3M61U 1CE5A 1E1RD 1GJ6A 3OY6U 2NU1E 2EQNA 2QCYA 1QY6A 2GT7A 3K65B 1C2MA 4JZFH 1YLCA 3MNSA 4HG6A 1V2LT 5E2OA 3ZZ6A 1KLTA 3ZVDA 3ZZ4A 4YM9A 1Q3XA 5T6FA 3BEIB 4BAMB 4UFFH 1GGDB 1O2WA 1VITH 3CENA 2BZAA 3ZVFA 3GS9A 3BTWE 4QT8C 2Y7XA 2K1QA 3N99A 2OUAA 1ZZZA 3RXVA 1MCTA 2YOLA 5F8TA 3TPIZ 2XYAA 3PLPA 4GHTA 1YF4A 5EGMA 2XW9A 5I25A 3RMLH 1TNIA 3Q00A 1TNKA 2A4OA 2H5CA 1IQIA 3STIA 2Y7ZA 3SBKA 4K1EA 2TGDA 1DWCH 1C2GA 1GG6C 2QF4A 1NFUA 2EC9H 4FUFA 4IBLH 1BMFD 3ZV8A 1YYY1 2A5AA 4CR9A 4X8SH 1F92A 3MO9A 5GCHG 3TH2H 3TK9A 5EQRA 3S0NA 3OX7U 4BXWA 1EAUA 2JH6D 1UK3A 2OQ5A 5LPRA 1Z71A 2Z94A 3V12A 1T4UH 1GI1A 5EG4A 3LH3A 4XFQA 1OSSA 2OBQA 1WOFA 2Z3CA 1EP6A 4CH8B 3QGNB 3FKSD 1FUJA 4ZKOU 2RA0A 1MQ6A 6LPRA 1ID5H 3OSYA 4YZUA 1OWEA 5E2PA 3HKIB 4YLQH 4AFQA 4RT1A 2B9LA 1QJ6B 3P8GA 3RDZA 5L30H 4X2YA 2P95A 1O37A 1O5CB 1VKYA 2W7UA 2LNCA 1TGNA 1RGQA 3M37A 3NCLA 4XDEA 3B23B 1BMNH 4ISOA 2P3FH 3MI4A 1C5PA 1D3DB 2ANWA 2QXIA 2BOKA 2FOFA 3K9XB 1HNEE 3P17H 2EY4C 1O2GH 1ESTA 1GVKB 1ZSKA 3MTYA 2PKAB 1W2KH 2Z9KA 5A2MH 1A1RA 1EPTB 2IOTA 1WDIA 2BD2A 4IS5A 3HGNA 1H8HD 2VU8E 2J94A 5L2YH 1QZ8A 4O3TA 1TGCA 5IK2D 1D6WA 5DP5A 5C1YA 2F9BH 1EX3A 3VB4A 2OBOA 1SGTA 2TGAA 4AFSA 2ZU2A 1KTTB 2QGRA 2ZHWH 1W0JD 1O2NA 4KELA 2OTVA 3TLOA 2KFWA 1FV9A 2W3KA 1ELDE 3A8BA 1THRH 1ZHPA 2F9VA 2HNTE 3BV9B 2FI5E 3RM2H 1FPHH 4SGAE 4MVNA 2FLRH 5DP6A 1ACBE 2A2XH 2ZHDA 1XM1A 4CBNA 3BEFB 4ZHLU 1LVYA 1G37A 2ZQ1A 4RKJB 3NUMA 4BXSA 2WPMS 3ZYDA 1TB6H 2O8WA 1UVUH 5GIBA 5KEDA 1OS8A 1W13U 2KAIA 4I86A 1UTPA 4WH8A 1DS2E 1O3PB 1C1PA 1K1IA 2SNWA 3UIRA 3QUMP 1EPTC 4YT6H 4AFUA 2HGTH 2ZGXH 1DE7H 3SI3H 4ABJA 3DSOA 1ELFA 1LHCH 1W0YH 1BMAA 3Q76A 2ZDAH 2ALPA 2VVVA 2G8TA 1JBUH 2FOMB 3DA9B 3Q3XA 2QXGA 1YPMH 2GCHF 1CVWH 3KQDA 4INLA 1XUJA 2BQ6B 1W8BH 1DY9A 2AMQA 1ZLRA 5EQQA 1NRRH 1OP2A 4F49A 5A0AE 3SO3A 4WF8A 1ZSLA 2G00A 1K1JA 1CO7E 2G5VA 1WAYB 3FZZA 1BTXA 1GI5A 3VXFH 3RMMH 3VGCB 1P02A 1O31A 4Y0ZE 1OWJA 2GCHG 4INKA 1JRTA 1AO5A 1HXEH 1TNGA 4X6PA 4F55A 1OWHA 1O0DH 4U30A 1HAHH 1ZMNA 1Y5UT 1VZQH 3U8TH 1GBBA 1NU9A 5JDUB 3SV7A 3MWIU 4X1RU 4SGBE 1N6YA 1NPMA 2VJ1A 4I32A 3SJ8A 2FDAA 3NPSA 2QE7D 3SUDA 1GBLA 3ESTA 2WPHS 2BQWB 3WW7A 5K7RA 1P0SH 3SU0A 1QA0A 2PKSB 3BTTE 2QF3A 3C1KA 2YMSC 3RP2A 1QFKH 3SORA 1GHAF 1SGIB 4K1SA 4NWKA 1J14A 3SQEE 3TJUA 4YLUA 4RI0A 3C27B 3OEHD 3V0XA 1Y59T 1OKXA 4TWWA 2VIOA 1MTNC 3QTVH 3KHVA 3UREA 1KXEA 1G3DA 1ETSH 1K9OE 2QY0B 1S6LA 2BY6X 4Q80A 3TH4H 1AFQC 2J92A 3VGCC 1C2IA 1F7ZA 2W6JD 3SHCH 1G32B 1UTMA 1XUKA 3MNXA 1AQ7A 4HTCH 4A1TA 1XX9A 1O3JA 3P6ZB 3V3MA 4FU8A 2R0KA 1BTYA 1SHYA 1Z1JA 2C8WB 5JBBS 3MO6A 4B71A 1AGJA 4RKOB 3PMAB 4E06H 4NSYA 1RRKA 1AUTC 2OC0A 1BMLA 2CN0H 1TOMH 4ZKSU 2R2MB 1Q31A 1K0HA 4ABBA 2GVFA 1HFDA 3HKJB 3T29A 3FANA 1AU8A 4CR5A 4ZHAA 1UCYK 3KQCA 2ANYA 1E36B 3TGIE 5AFZH 1NRNH 2VINA 3EQ0H 3A8CA 1TALA 2NU3E 2XBYA 2FO9A 5ESTE 1GBJA 5FHTA 5FCKA 1VGCC 3S9CA 2D2DA 4UFDH 1COWD 2ODPA 3PWCA 4Z1MD 3KQ5A 5T6DA 2CJIA 3UNSA 2Y81A 4Y76A 3BTEE 5F03A 1RIWB 3S9BA 4LZ1H 2R9PA 1EAWA 2OCVB 5C0TA 4X1QU 3IITA 4AN7A 2GZ9A 1XXDA 1DANH 1PPGE 1BQYA 2ZIQH 2CMYA 2TRMA 1TNJA 1SQAA 1MU8B 1NRQH 4K3JA 1GL0E 4WH6A 4FUCA 1NS3A 1MCVA 1E34B 1BJVA 2XBXA 1GI3A 1P06A 4J2YB 1GJBB 1L1NA 2OQUA 1ESAA 1GJAB 1Y8TA 3BF6H 3Q77A 1JOUB 4NWLA 1K2I1 2DE9A 2L74A 3E0PB 1PPCE 5FCRA 4HGCA 2PUXB 5GDSH 3LIWA 3GY5A 1BTZA 1K1NA 1TPOA 2G4TA 5F6MA 1YC0A 2R3YA 1UCYE 3PB1E 3TIUA 2Y5HA 2LP6A 5ETXA 1WV7H 3BTDE 3LOXA 4K5ZA 4MPWA 2GMTC 1F2SE 1C5OH 3ENSB 3VG8A 3SW2B 1GBFA 1GI4A 2JH5D 4RN6A 1GJ4H 1O3DA 4HZHA 4WWYA 1UHBA 2AMPA 4TYDA 3K6YA 4TPIZ 1LVOA 3N7OA 4I33A 3TH3H 1C9TA 1YWUA 1ZOMA 1SOTA 3E90B 5HIYA 2WPJS 1YP9A 3T26A 4JK5A 1GBDA 4B76A 2FEQH 3GCTF 2FI4E 1BITA 2XXLA 3LPRA 1K1PA 2C3SA 2EA3A 2ZECA 3TK5A 2OK5A 3OU0A 2D26C 2GT8A 1GI8B 3FVFB 3UAIC 1O5BB 5C5NA 1KXDA 1GJ7B 3SJKA 3U69H 2FOGA 5CE1A 4DGJA 3SN8A 5AVDA 1D6RA 1YPEH 3PV5A 1P09A 2O9QA 2Y80A 4ZROA 1P10A 2ZFRH 3PMHB 3TU7H 3ZYEA 2ASUB 2P59A 4OGYA 3DT0H 4NFEA 4NIWA 4AGJA 5FXLA 1VCWA 3PO1B 2QAAA 3QTOH 5J4QA 1A4WH 3GDUA 1F5RA 1PQ7A 4O3UA 1G36A 3TK6A 2FOHA 2QN5T 1TA6A 2IJOB 1SL3A 1BRAA 1DT2A 1PPFE 1UTLM 3GY7A 1O5DH 3HK3B 1EFRD 1EJMA 2BOHB 1MU6B 1ZHMA 5B6OA 1A7SA 3P8FA 4AFZA 1SLUB 1ZTKA 3ATIA 3ZVEA 3GY6A 5EXMA 3QZQA 1ZPBA 1B0EA 1GI7B 3NWUA 4M7GA 3P95A 1Y3UA 2QXJA 1HAZB 4ABEA 1PPHE 1THSH 2FOBA 2QYIA 1C4V2 2VIVA 1CHGA 2ZU1A 3RC6A 1BB0B 2THFB 5GXPA 2G52A 5CHAB 1NN6A 4X0WU 1A3BH 4B73A 5A09A 2VH0A 8GCHF 1EAIA 2VWOA 1GJCB 1NFWA 3SJIA 1XVMA 5FPYA 2LPRA 1ZR0A 2ZFQH 5C20A 1LHDH 2P94A 3I77A 1EUFA 1K1MA 2ESTE 4CREA 1ZPZA 4IC6A 2ULLA 3LH1A 4CRBA 4TY7A 1K21H 3U8OH 1DX5M 8KME2 1SGPE 5JB8S 3RM0H 4NGAH 3PLKA 3ZVCA 2GCTB 3RXFA 3E6PH 3M5NA 1E37B 3JZ2B 8GCHG 1SGNE 2BVSH 3JZ1B 1G2LA 5K0HA 1P8VC 3UB0A 1TYNA 3LC3A 3KYFA 1GVLA 1MKWH 1CGJE 1C2EA 2XNDD 2HWLB 1UK4A 2BD3A 3LJJA 3MU0A 1V2JT 1CT4E 1SQOA 3A81A 1V2NT 2XCFA 5E0HA 4ESTE 2Y6TA 1MAYA 1LHGH 2JETB 3LC5A 4OGXA 5B6LA 1LHEH 7KMEH 4D8NA 2A7CA 3GDVA 4MQAA 1BOQA 5DP9A 2ZTYA 3H7OA 1L1GA 1ZRKA 1A0LA 1O3GA 4CH2B 1B0FA 3FN8A 5C1XA
chains in the Genus database with same CATH topology
1S82A 3LDXH 1TNLA 2G55A 1LPZB 5F8ZA 5JBCS 1E38B 1V2ST 4A1VA 1QB9A 3A89A 3ZZ9A 2BD9A 2FWWA 1DDJA 4Y8YA 1PPZA 3RXAA 3B9FH 5DKMA 4NSVA 5A0CA 1ELEE 1P2MA 1O2QA 4DOQA 6GCHG 3LGUA 4MNWA 1P9UA 1YCPH 1GMDF 3HPTB 3ITIA 2F3CE 1XMNB 4NIXA 1OWDA 2Z9IA 1P2IA 2A4GA 1X7AC 2WINI 1T8MA 3SNCA 1EKBB 1SGCA 5HMAA 1P2QA 1EOLA 5C2ZA 3BG8A 1QURH 2AYWA 5AF9H 2PGBB 3P8OA 2JETC 4NIVA 2BY7X 1BA8B 3E91A 4ISHH 4K69A 1P12E 2B8OH 1GMDG 1ELVA 1C5NH 1UTOA 2ZDLA 2PFEA 3PMBB 2UWPA 4ISLA 3M36A 1IQNA 2STAE 1O2IA 1KYNA 2Z9GA 5T3HA 1O5GH 1RTLA 1GCTB 2FLBH 2ZFTA 2ZC9H 1ZYOA 3Q3YA 1BBRH 3PTBA 1GI2A 1ZJKA 1WUNH 4NIYA 1AE5A 3KGPA 2P8OB 2V3HH 1NROH 1O2OA 4FVBA 1TPSA 1MKXK 3VB5A 1G3BA 1W14U 2V35A 1SG8B 5GWZA 1J16A 1TLDA 1GVZA 4X1PU 4WMEA 1JIMA 1OOKB 2QC2A 4MTBA 4WXIA 2SGAA 4MLFB 1S83A 2FESH 4DCDA 3MU4A 2ZU4A 1G3EA 5GCHF 3SUFA 2Q6GA 2H6MA 2QF0A 5C67A 1LPGB 1Z8RA 1LVMA 1IQJA 3A7YA 1FQ3A 1U6QA 4LZ4B 1TOCB 2BDYA 4E05H 2W5EA 1Z6EA 3E3TA 1M9UA 4HFPB 5HXFA 2GTBA 1MQ5A 1JIRA 1GCTC 3MMGA 5JYIA 5T6GA 1IQLA 2Q1JA 2EI6A 1NC6A 1O2TA 1T7CA 1V2RT 2P8OC 2HNTC 3TVJB 1PQAA 1MTSA 2OC7A 2GZ8A 2AH4X 1HB0B 1ABIH 1TMBH 1HV7A 2ZP0H 2H2ZA 1UMAH 4DG4A 5LGOA 1YCPM 1H9IE 5BPEA 1BJUA 1YGCH 4A5TS 3SUEA 1QIXB 4F4OC 1GBMA 1P2JA 4GAWA 3SNBA 4NA9H 4FUIA 1RXPA 1O2YA 4AX9H 1G30B 1MBMA 1BTUA 3AW1A 4OS1A 2BDBA 4JCNA 1BCUH 3SNAA 1D9IA 4AB9A 1NFYA 1ABJH 3IG6B 3BIUH 2ZKSA 3RMOH 4ISIH 1FY3A 4JZIA 2A7HA 1ZHRA 1DLEA 5FX6A 1HJ8A 1PYTD 1H8IH 1DY8A 1GBIA 5LH8A 5HM9A 1SFIA 2HPQH 3PYHA 1HAVB 4U2WA 3KN2A 4Y11E 1DWEH 1S85A 3SI4H 4D9QA 1JXPA 1O2HA 1EZSC 1QCPA 2GGVB 3TJVA 4Y6DA 2F91A 3GICB 1EATA 2ZZUH 1S5SA 1EASA 1FAXA 3SU4A 4OS6A 1ELAA 1ANCA 1IQHA 1PPEE 4Q7XA 5CMXH 1ETRH 2CF8H 4YO9A 1UVSH 4BAKB 1AFEH 1A5IA 4DJZB 3CP7A 1CA0B 1QL8A 1O3OA 2ZGHA 1A0HB 2FYQA 3P8NA 4ZAEA 1NESE 3D65E 3PLBA 1HXFH 1P9SA 1ZJDA 1KIGH 4CRDA 4HI3A 1EJNA 2ZU5A 2UUYA 2ZCLP 1CU1A 1WYKA 4H42U 3GYMA 4YESB 3UQOA 1KXCA 2BLWA 2W26A 4KKDA 1ORFA 1C5SA 2OC1A 4CRGA 5EQSA 1EXFA 2FPZA 2JH0D 3ZZ5A 2BVRH 7LPRA 2VB0A 1XKAC 4CRFA 1O3NA 4ABGA 2EEKA 2AGEX 3ZZCA 1D3PB 5DP4A 4B1TA 4X6OA 4WXVA 1AD8H 2J34A 1TONA 2AGGX 2VWNA 1J15A 1QNJA 1W7XH 2CHAC 1CA0C 2PTCE 5JB9S 1P11E 2FI3E 1XUGA 2WPIS 4E7NA 1O3AA 3L33A 2ZHQH 3EA9A 3EAJA 3O8RA 1OYTH 1MTNB 1O3HA 1VCPA 1HUTH 2ZCKP 4NG9H 2HNTF 1B7XB 1Z7KA 1ZSJA 1RFNA 4GUXA 1LPKB 1AFQB 5SGAE 3QWCH 2XCNA 1AMHA 4OS4A 1FNIA 1SLWB 2I6QA 2J38A 1A2CH 5HYOA 1E35B 3DD2H 2PGQB 2A4QA 5L6NH 1KLJH 1HIAA 1MAXA 3S69A 1T4VH 2EI8A 1QBOA 4A6LA 4K2YA 5C5OA 1QBVH 1O2ZA 2AGIX 3RU4T 4JMYA 1LDTT 3FFGA 1SR5C 5FPTA 2R2WU 2ZHFH 5LPEA 5DG6A 2RDLA 2GP9B 2A31A 2A45B 3T2NA 3UNQA 1C5LH 3T27A 4A7IB 3LGVA 1QRWA 2FS8A 4I8JA 4THNH 1VGCB 3VB7A 4Q2KA 1GHYH 3MHWU 2FTMA 2J9NA 2SGQE 3RXPA 3MU5A 4XSKU 3A7TA 1YM0A 4FUJA 4JZDH 1BTPA 1O38A 3BTKE 4JZ1A 1ZGVA 2V0BA 3TJOA 2ZI2H 1GMHF 4X2VA 2ZFSA 1O2MA 1TIOA 5EOKA 2FODA 3LT3A 4Y8XA 2FM2A 1GHBG 3L6PA 1JMOH 2W3IA 9ESTA 1GBKA 2XC5A 2B7DH 3PV4A 1NO9H 1TNHA 1YPLH 2YNAA 2OC8A 1QHRB 2TGPZ 2WV5A 1O2VA 4O97A 2UUFB 1O2PA 2ZFPH 1GMHG 1MMJN 1ARBA 2I6SA 2BZ6H 5PTPA 3M7UA 3BSQA 3LONA 2C90B 3MYWA 1BIOA 7GCHF 1EAXA 1SQTA 1AVGH 1RJXB 5BRRE 5EXLA 1IHSH 1GCDA 1FY5A 1C2FA 2GMTB 3RC4A 3SUGA 1FAKH 1DLKB 2VH6A 2HPPH 4B2AA 5LPFA 1XXFA 4MPUA 1TE0A 4FU7A 1A0JA 1C1NA 1AIXH 2FZZA 3GOVB 4FUDA 4CRAA 2BHGA 2ZDVH 7GCHG 1GL1A 3TGJE 2KAIB 3A7XA 2F9OA 5DP7A 1L4ZA 2BTCE 2CF9H 1DITH 4YOGA 1AKSA 1DWBH 3RXBA 1C5UA 1ZPCA 1V2VT 4A1XA 1W0ZU 1K22H 1DM4B 5FX5A 3A84A 1T8LA 1H9HE 2OINA 1GWAA 1DOJA 4XE4A 1MH0A 4U01A 2BVXH 4Y79A 2Y82A 1YPHC 1C5QA 5EODA 1KXBA 1QQUA 2PWXA 2SNVA 3STJA 4B2CA 1NM6A 3SU1A 4X8UH 1O5AB 3KQBA 4UDWH 1W3CA 3BTME 2RCEA 4K60A 2B5TB 1G2MA 2PW8H 8ESTE 4ISNA 1Z8GA 1FJSA 3Q3KA 1L0ZA 4WJG2 1OP0A 4UONA 1CQQA 4YTAA 2STBE 1SVPA 1ANBA 3A88A 3HK6B 1NFXA 1C1OA 2VWMA 1FN8A 2RG3A 1F0RA 1KY9A 1AVXA 2ZEBA 3RXSA 1O30A 4I31A 4GLYA 3A7ZA 3KCGH 1C4Y2 1TGBA 2ZU3A 4LXBH 1WBGB 1YLDA 2JKHA 1BTHH 1Z6JH 4JYUH 1V6DA 2ZWLH 3K2UA 2VIPA 2ZDKA 1EJAA 2ZTXA 4DIHH 1L4DA 1MTUA 1A46H 1P3CA 2QA9E 1SB1H 2XWBI 1C9PA 2XNIA 3QO6A 2V6NA 2ZPRA 5A8YA 4NZLA 5DJ7A 1O3KA 1ELGA 4X2XA 5E0JA 1XKBC 2Z6BD 2A7JA 1TWXB 1MD7A 2OLGA 1MBQA 3TITA 2AERH 1FN6A 1WTHD 1TGSZ 1S81A 1Z1IA 1N6XA 1XVOA 1BRUP 2HLCA 4AYYB 1SPJA 3RMNH 4RSPA 2G4UA 1C5VA 3UWIA 1GBCA 1AWFH 1SGYE 2V3OH 3HGPA 4H6SB 2VIDA 1QRZA 1P2OA 4OS2A 1Y3WA 3RLYH 4FUEA 4IMZA 1AE8H 2FOEA 5I46H 3K6ZA 1TFXA 2C8ZB 3T5FH 3RXLA 2H9HA 1C1RA 1BRBE 3HATH 2CV3A 1EB2A 2GDDA 1SGFG 3RXUA 2BDCA 3UUZA 1EP5A 1O3LA 1Z8IB 4AG2A 2A5IA 1UVTH 7ESTE 4JYVH 2ANMH 2HRVA 1JWTA 2SGEE 3FZDA 4A92A 2NU0E 2FYRA 3KNXA 4Y10E 2PLXA 3ATWA 3PTNA 3RLWH 1ZTJA 1EZUC 4B2BA 1CT2E 3ZZ7A 2Q6DA 2F9PA 1AKSB 1Y5AT 1V2OT 3RXDA 1C1SA 3AAVA 5AFYH 3RXGA 2HALA 5C3NA 3G01A 1A61H 1N8OC 1YPJH 3EGKH 3F9GA 2J4IA 5HM2A 3SGAE 2BLQA 3SJOA 3P92A 3M3SA 5FBIA 1CSOE 2GKVE 4Q7YA 4INHA 3L3TA 6GCHF 4VGCB 4BTTB 4E7RG 1YBWA 1O3MA 2H1UA 2SGPE 1QB6A 2QIQA 4GVUA 3VEQB 1KTSB 4AB8A 3AW0A 4B74A 3MO3A 3SV2H 1HAGE 1UCYH 1JRSA 4YOIA 2BDGA 1VJAU 3LGYA 1DWDH 5G4BA 4BNRA 3W95A 1UHBB 2FOCA 1TGTA 1HJ9A 3EYDA 4CRCA 3VB3A 1ZMJA 3EA7A 4FUBA 2F9UA 5DK1A 1O2UA 3NKKA 4AGKA 4DIIH 2ZPSA 1O2RA 1ZGIA 1O3IA 4BAOB 4ABIA 4MPXA 1QL7A 3GY4A 2BQ7B 4ZKNU 1YPKH 3R0FA 3ZZ8A 2DUCA 3MU8A 1FPCH 1VITG 5ABWA 2UUJB 2ZQ2A 3KL6A 2WV4A 4D7GA 3RXQA 3MOCA 4NA8A 1O2JA 1UO6A 1A3EH 2GX4A 4Z6AH 4VGCC 3OY5U 3MH7A 1TBQH 4AYVB 1KSNA 5F8XA 2BYAX 3UOPA 2P3UB 3SNEA 2Z9LA 2VIWA 4X1NU 4NA7A 3T25A 1UJ1A 2M5TA 1BHXF 4MNYA 2FOAA 1W11U 2ZTZA 3DFJA 3F1SB 1XUIA 2BXUH 2ALVA 1H9LB 1SSXA 2J2UA 1D3QB 2FIRH 2NU4E 1CBWB 5JBAS 3U1JB 1Z8JB 1VR1H 3SV6A 1ETTH 1V2MT 1SC8U 4IN2A 1RD3B 4BAQB 1LO6A 2BD4A 3ATKA 3V13A 2SGFE 5A8ZA 3AAUA 2OP9A 3BG4C 4FVDA 3TNTA 1GBAA 1O2LA 1LKBA 1OWKA 2FTLE 4DW2U 3M5MA 3SOSA 2D8WA 4UFGH 3M3TA 4AOQA 1EQ9A 3VPKA 1TRNA 4GSOA 3RUOA 4X6MA 1SGRE 1AB9C 1O3CA 1THPB 3PROA 3ATLA 3UPEA 2FX6A 1DUEA 1J17T 1HPGA 3LU9B 1CT0E 4YT7H 2ZFFH 2ZF0H 1P05A 4NZQA 1HCGA 5J4SA 1RTFB 4NFFA 4ZUHA 3M5LA 2R0LA 2PUQH 3RU4D 3SGBE 1GI9B 1TX6A 1CBWC 2UUKB 1S84A 1CHOG 1GHVH 3A8AA 3SU3A 3T28A 3CS7A 4FXGH 2BXTH 5EW2H 1DVAH 1UVPA 2A4RA 1GHZA 3RXOA 2BY9X 1TPAE 1PPBH 1INCA 1ZRBA 1Q2WA 2TBSA 1UTQA 2HOBA 1H1BA 1OX1A 1V2QT 1PFXC 3A83A 1SOZA 1DXPA 1LCYA 4Y7BA 3H5CB 3KEEA 1P01A 3RXCA 1W12U 2GDEH 4H4FA 1SGFA 3GCHC 1T8NA 2A5KA 2GD4B 2BY8X 1C1UH 4IMQA 2P3TB 3QX5H 2Q6FA 3A85A 4MNVA 3SJ9A 3O8CA 4GCHF 3M7QA 4KTUA 2PSXA 8LPRA 3MH6A 1QTFA 3E8LA 2PTNA 3ZZDA 1O3BA 3R3GB 1GGDC 2OXSA 1E0FD 2BLVA 1C2JA 1G3CA 2NWNA 3M35A 1P3EA 3ZVAA 1O5FH 5ESBA 4LK4A 3A7VA 1FMGA 3UWJH 3P70B 3SV9A 1SLXB 2VGCB 2WPKS 3SV8A 1O2XA 4GCHG 4I8LA 1OWIA 4BAHB 1HGTH 1F5LA 2A2QH 3M5OA 3BEUA 1IQEA 2BD7A 3ZZAA 1D3TB 4I8KA 3ELAH 4KGAA 4AZ2B 1HAIH 1P2NA 5GPIB 5H4IB 3LGIA 2CXVA 2ZHEH 1GJ5H 1O32A 2A32A 1LHFH 1C1QA 4DVAU 1PQ8A 4XBBA 1F0UA 1HYLA 1AZ8A 5AHGH 4UD9H 1C5ZB 1A5GH 4K1TA 2CHAB 5DO4H 1T31A 3BIVH 1IOEA 1C5XB 1S0RA 3UOUA 3A8DA 3SNDA 2P16A 2ZDNA 3IWMA 4I8GA 2Z7FE 3H7TA 1WU1A 1XUFA 2BX4A 1FDPA 1O39A 4MDSA 5TCCA 3I29A 1EZXC 5EPYA 2VGCC 1P03A 1SFQB 1NT1A 3QN7A 5DP3A 4ASHA 1FY8E 3AASA 4H6TA 4Y0YE 2XC4A 3ZVBA 3S9AA 1FY1A 2ODQA 5E8EH 4XBCA 3GY2A 4J1YA 2ZA5A 4D76A 3F9HA 1ZMLA 3RXEA 2PHBA 5A8XA 1FZZA 1MTWA 1V3XA 1FXYA 1GBTA 4UEHH 5EXNA 4FUHA 4GPGA 2AFQB 6CHAB 1B5GH 1MD8A 1UTNA 1WCZA 5GJ4B 1BZXE 3BTFE 1TRYA 3A86A 3FAOA 2FXRA 3SHAH 3MU1A 3GY8A 1DUAA 2H5DA 2AIPA 1O3EA 3F68H 3F6UH 4MG3A 4PROA 3BTHE 2VVCA 2TGTA 1CA8B 1SGDE 1YKTA 4ZXYH 3U98H 1S0QA 2O8LA 2QXHA 1IQKA 3NK8A 4JK6A 2TPIZ 5DGJA 1WTGH 1SGQE 3V7TA 2HVXA 1DSTA 4BTUB 2C4FH 4JZEH 2WPLS 1C5MD 1GHBF 4XBDA 1H4WA 6CHAC 3D49H 3RXIA 1BUIA 1IQFA 1ANEA 3TGKE 2G5NA 2BX3A 1ANDA 3T62A 4KTCA 3RXHA 1LQEA 4DURA 5TJXA 1MKXH 5HGGA 2C8YB 1XUHA 4D7FA 4LOYH 2BB4A 3BTQE 1P2KA 2O8TA 1VCQA 1TQ7B 1C1WH 1FONA 1P57B 5TCAA 1EB1H 1C1MA 1K1LA 1C1VH 2FS9A 1GJDB 2XC0A 4XOJA 3U9AH 1J9CH 5FBEA 4I7YH 2WUCA 3S7KB 1GHAG 1L2EA 2QV1A 1AI8H 4ZH8A 1MKWK 4WMDA 1L1JA 3TJNA 4BTIB 3ZVGA 1SGEE 1AUJA 1WQVH