1Y3YA

Trypsin inhibitor complex
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A simple protocol to estimate differences in protein binding affinity for enantiomers without prior resolution of racemates.
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords Trypsin, cationic
total genus 58
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2004-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1y3yA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1y3yA02
3K6ZA 4BAQB 4X1PU 1T31A 1FIZA 3SUEA 4XBBA 1N8OC 2BD9A 4WH6A 4ISIH 2ZU3A 1SFIA 1NM6A 1QCPA 1LHEH 4O3TA 3MH4A 3FFGA 3RXBA 2QIQA 3ZZ9A 1XUHA 2J38A 1UTKA 3SGQE 4ZKRU 1K21H 4Y7AA 5EODA 2FTLE 1VJ9U 1H9IE 2XRCA 1L1GA 3NPSA 1SGQE 1SLVB 3VB6A 2PGBB 4D9QA 1UTMA 1KXBA 1HJAB 3Q00A 4MDSA 3OX7U 1O5GH 2Z9IA 4WH8A 1OP0A 2ZEBA 3LGTA 2FLBH 3RXDA 1YM0A 2OD3B 3UIRA 3QX5H 1A2CH 4I8HA 3FP6E 1C5QA 4R0IA 5FBIA 1BMNH 2D8WA 2STAE 1G2MA 1DM4B 4JZIA 2Q6FA 4CRAA 1LVMA 2ZP0H 3A8DA 2ALVA 2GMTB 3QGJA 1QJ1B 3T5FH 1K1NA 2BTCE 1VITG 1CE5A 1S85A 3A7XA 2BLWA 3UNRA 1CT2E 1G37A 1PPZA 1AFQB 1L4DA 4Y0ZE 5AVDA 4ESTE 5ESTE 3UFAA 1C2EA 1LHFH 2A7CA 1C2JA 2A7HA 4KELA 5T3HA 3T29A 2Z6BD 4OS5A 3E1XB 3ODDA 1P3CA 1RTKA 1INCA 1B5GH 1HUTH 2A4QA 2BY7X 1YPHE 2WPLS 1GHAF 1GBFA 3PWCA 2ZHFH 2Z9GA 1QIXB 3LH3A 3Q76A 2BVRH 1CHOG 3SNBA 1P11E 4OGXA 1A61H 1DXWA 2GMTC 3QTVH 3ZVEA 1SG8B 1NRRH 2FX6A 4UDWH 2PUXB 3ZZ7A 2ZTZA 4JZ1A 2ANKH 2A7JA 1C1OA 2ZGCA 5SGAE 1H8IH 1SOTA 3QDZB 2NU4E 3VGCC 3SJIA 1S82A 1CGJE 2W3IA 1GI4A 4YOJA 2Y5HA 1A46H 1ZZZA 2OQUA 1KXCA 1W8BH 5F8XA 1FUJA 1XXFA 1C9PA 2OBQA 2VIDA 3ZVGA 1EPTB 1ZRBA 1W13U 5EPYA 1ZLRA 4JZEH 1THPB 1C5XB 1HXEH 3UNQA 1GGDB 4XBDA 1FXYA 3A7WA 4NWKA 1KSNA 3P17H 1H8DH 3QZRA 1NRSH 3RXMA 3BN9A 2G8TA 1UTJA 5E0JA 4D8NA 5DK1A 6GCHG 3HKIB 2G81E 1O32A 2UWLA 2VIOA 1O3IA 3BG8A 2O8MA 1GI8B 3RXOA 4Y8ZA 3RU4D 2BXUH 1P3EA 3AVZA 4CR5A 1OP8A 3V12A 1AO5A 2CF8H 1UCYK 4Z6AH 2XC0A 1ESBA 4WWYA 2F9OA 4IGDA 1ANBA 1AE8H 3RXSA 5EOKA 2THFB 4XSKU 1UCYE 1BTXA 1P2MA 2SGFE 3BTEE 4NSVA 2ZGJA 2H2ZA 1FJSA 3DFLA 2RG3A 2AMQA 1FPCH 3TJVA 1J14A 1P9UA 1V2PT 2UUFB 1BRUP 2OXSA 3BTME 1XMNB 2FIRH 2F91A 5A09A 4Y8YA 1UK3A 4I8JA 4AYYB 1ZMNA 1MMJN 4ZUHA 2JETC 1CT0E 4BANB 1C5WB 1O2PA 1O5AB 1YC0A 1F5RA 3SNCA 2BOHB 1LQDB 1TONA 1C5SA 1O2RA 5FPSA 1O5BB 3A85A 1CO7E 3TH2H 2ESTE 2PW8H 4MPWA 3A8BA 1TLDA 2BLOA 3K65B 3RXPA 5HM9A 1TFXA 1O5EH 2ZPSA 4AFZA 2ZDLA 2Z94A 3TH4H 2W7UA 1FN8A 3TPIZ 3ITIA 4BXWA 1C2HA 4H42U 1H9LB 2BD4A 1BOQA 2XTTB 4GLYA 2QF3A 2FESH 4FVDA 4SGAE 1D6WA 1QB1A 1OWKA 1Q2WA 2HRVA 1CT4E 2C8ZB 1GBIA 1HXFH 1O2IA 1OSSA 3M7TA 1F0SA 4GHTA 3PM3A 3MH6A 1C1MA 1BRCE 5GIBA 1GI0A 3KL6A 4WVPE 7GCHF 2SGPE 2P8OC 1RXPA 3A7TA 8LPRA 1FIWA 2PFEA 1L0ZA 4CRCA 1O3MA 1TYNA 3MNXA 1NT1A 5C2ZA 2WPJS 5DO4H 1V2JT 2Y82A 3U9AH 1GWAA 3SJKA 3QLPH 5EG4A 2ZDVH 3GY6A 5EXMA 2C8XB 1FDPA 3A86A 1MKXH 1UK4A 1UO6A 1A5IA 5L2YH 2FOBA 3TITA 4X6NA 1C2KA 1O3NA 2PKAB 5C5NA 3PMBB 4GPGA 3ELAH 4CREA 2QV1A 4OS7A 3STIA 4XOJA 2BDIA 4NIXA 1TNIA 1F5LA 1V2OT 2QCYA 1ZSKA 3SW2B 3MFJA 3MU4A 1A3EH 1AI8H 1GBHA 1FY5A 3URCA 2ZFTA 2ZQ1A 1THRH 4MQAA 1ABJH 3PLKA 1AFQC 2ANMH 3LGIA 5DP7A 3BIUH 1SB1H 4GCHG 4YESB 2BOKA 4UEHH 1HRTH 5C5OA 1O5CB 2A32A 4E05H 4BTUB 1BBRH 2HGTH 4VGCB 1RTLA 2F3CE 1BTPA 1BMMH 3BTFE 5EPNA 2XCFA 1AD8H 1GPZA 3OYPA 5JBAS 2HALA 1WAYB 2QYIA 4IC6A 3UWIA 2ZU4A 3L6PA 4IBLH 2ZNKH 4K5ZA 1SL3A 2CXVA 3D23A 1G9IE 1O39A 2V3HH 1A0LA 1O31A 2NU0E 3ZZ6A 5HGGA 1ARCA 2BX4A 1GMCF 1NRQH 1W0ZU 1UVOA 4D9RA 3H7TA 1AIXH 3SORA 3EYDA 2H5CA 1TGTA 1OYTH 3S7HB 1A0JA 1SLXB 2ZHWH 2YOLA 3A8AA 2ZECA 4KTCA 1MTSA 1O3PB 5BPEA 1CA0B 1E38B 4CRFA 1S6HA 2B0FA 6CHAC 2CF9H 3RP2A 2A2QH 2OCVB 1O3JA 4BTIB 1GVKB 3AW0A 1EZUC 3SU5A 2BMGB 1GBDA 1HAXB 4NA7A 3TNTA 4K2YA 5GWZA 3ZVAA 2QXJA 4ABGA 4I8LA 1KDQB 1IQIA 3SV6A 4MVNA 4DG4A 2DE8A 1A5HA 4FVBA 1C5UA 1EAXA 3SQEE 2GV6A 1KLTA 1O2WA 1UHBA 3A84A 5EQQA 3PROA 4I8KA 4LOYH 1O3BA 2OC8A 1DSUA 3RU4T 1XXDA 4XDEA 4ZKOU 1WV7H 1Z8RA 4RKJB 2VU8E 1OWIA 1GDQA 1GBCA 1K1LA 2P94A 1PPEE 3T26A 1PPBH 2FS8A 1EAIA 3CP7A 3VGCB 1HAZB 4FUHA 1S84A 1Z6JH 3GYLB 3SNDA 2TGAA 1TPAE 1AE5A 3SQHE 1H4WA 5EU8A 1YPLH 4ISHH 2C3SA 4AX9H 4CHAB 1MBMA 1MKXK 3P8FA 1V2UT 1MCVA 4XE4A 4X1QU 4Y79A 3ZVBA 2VINA 1Z71A 1K1IA 3TNSA 1BMLA 3I78A 2BXTH 1LTOA 4X1RU 1ZMLA 3LU9B 5FX6A 2ZFRH 3NUMA 3AAUA 1ZSJA 1ZTJA 4ZKNU 1O2YA 1SQAA 2TGTA 4RSPA 1LKAA 1GL1A 3SUGA 3VB4A 1P0SH 1TNLA 2ALPA 1BT7A 3ZZBA 1O2TA 1Z6EA 2B7DH 1TMTH 1CGIE 3W94A 1YPEH 5HXFA 3MOCA 4MPXA 1SGYE 2ZO3H 3A87A 1O2MA 3DD2H 2ZHQH 1PPHE 1L1JA 2V35A 3HK3B 4A5TS 5AF9H 1SHYA 1MH0A 3V0XA 1KYNA 2G4TA 1IQLA 4YTAA 1NROH 1EKBB 2ZGHA 4BAKB 1DUAA 1C2FA 2B8OH 2J9NA 2VGCB 3STJA 2EI7A 1YPKH 2PKAA 2GKVE 5E8EH 2HNTF 1GJ6A 1C5ZB 1O3OA 4DCDA 1FY3A 4MNXA 1DOJA 2KAIB 2QAAA 4ABDA 4UD9H 1BBRE 1BMAA 3KQDA 1Y59T 8GCHF 1OWJA 3BEFB 1GBMA 1ZOMA 3M36A 3MU8A 3SJOA 3UREA 1GHYH 2GVFA 3P8OA 4BAMB 5A0AE 1XUKA 1G3DA 2TRMA 2VIVA 4HZHA 3IITA 3BEUA 3BEIB 1HCGA 2OTVA 1IAUA 4Q80A 2P3UB 1AN1E 5JBTA 3GICB 5EW2H 1EJMA 1LVBA 2H9TH 1BB0B 3SI4H 1WTGH 2GGVB 3A8CA 1FY4A 3QUMP 2VVVA 2GX4A 1C4Y2 4ZKSU 1JRSA 2NU3E 3O8BA 3F1SB 3RU4E 1SLWB 3VB7A 4MNYA 1DLKB 2A4RA 1O2ZA 3TGJE 1HAPH 4ZXXH 5JB9S 3RMNH 3DT0H 1VITH 1GHXH 1M9UA 2F83A 2SGQE 4X6PA 5JDUB 3RXHA 2HOBA 3U8TH 2C90B 3TLOA 1YLCA 2ZU5A 1AY6H 2ZU1A 5FCRA 3PMHB 3T28A 4TWYA 2BQWB 2EC9H 5C20A 5LPEA 2ZDKA 1O2XA 1JMOH 3QGNB 1DUEA 1MTVA 3T2NA 2BD2A 1Z8JB 1CGHA 1AWFH 1YLDA 4ISOA 3Q77A 1H9HE 2Q6DA 4FUGA 2BD3A 1O3FA 3MH7A 1ZPZA 4NIWA 4NA9H 5DP6A 1AB9B 1K2I1 1YF4A 4KTSA 1YP9A 1SC8U 1T8NA 1QL7A 3FP7E 1GMHG 5TCAA 1EZSC 2ZTXA 1MTWA 1HB0B 4X2WA 4OS6A 1MTNB 1CU1A 1V2LT 2TBSA 3GY8A 3CS0A 1MUEB 4FU9A 4Y8XA 2BY8X 1B0FA 3TGKE 1YCPH 3UQVA 3KN2A 1HBTH 4IC5A 1TBRH 1W10U 2B5TB 3SN8A 1EATA 2JETB 1OPHB 4U32A 3MO9A 4U2WA 1ELFA 1K28D 4D7FA 1UCYH 1V6DA 2EI6A 4IMZA 5T6DA 2JH0D 3SNAA 1VGCC 3AASA 4O03A 1BTWA 1WBGB 3JZ1B 4AG1A 1O2UA 4E06H 4CRBA 6LPRA 1DANH 1YCPK 3PLBA 4DW2U 3M5MA 1KXDA 1O37A 1JBUH 3QZQA 1FNIA 2Z3EA 2BZ6H 3HGPA 1ARBA 1XKBC 3B23B 2ZFQH 5E2PA 1J16A 4FU7A 1P2OA 2V6NA 2ZGXH 5F8ZA 1S5SA 1A0HB 1PJPA 4Y7BA 1WUNH 4DOQA 4Q7XA 2TIOA 1E34B 4ABIA 3UUZA 4CR9A 4WY3A 4OS1A 1G3CA 3TK6A 1YPGH 2ZQ2A 3EGKH 1GBLA 1V2KT 2VJ1A 5AFYH 4X8SH 1T7CA 4RKOB 1F0RA 1ELCA 1BHXF 1SHHB 4JCNA 1LVOA 2UWOA 4MPUA 1YGCH 1C2LA 1SI5H 4WJG2 4K1SA 4K3JA 3VB5A 1DY8A 2FOHA 1C1PA 3TIUA 5LPRA 1TNGA 2VWOA 4OS4A 1LMWB 1GJ7B 2GDEH 2H1UA 3O8RA 3LGYA 1V2ST 3RXCA 3SU3A 3E16B 3F9HA 1QHRB 1TGCA 2UUJB 2ZF0H 3PV4A 2R9PA 2P8OB 5HM2A 3NXPA 3CS7A 3ATLA 4HFPB 1ETSH 3LGUA 1OWHA 2CHAC 1MQ5A 1DFPA 3RXAA 4HI3A 3L33A 2ODYB 1TRNA 3MH5A 3G01A 4LZ1H 2UUKB 1S83A 4LXBH 1YPHC 5JPMH 1TGBA 2KAIA 1QA0A 3TK9A 4D76A 2B9LA 2A4GA 1FAKH 1EQ9A 1D3DB 1ETTH 2BDBA 1C1RA 1EP6A 1ZJKA 1F0TA 2FX4A 1A1RA 2QGRA 1ELTA 5E0HA 3SU4A 1AKSB 2ZZUH 1HNEE 5DKMA 1HDTH 2W5EA 2FO9A 2ZFFH 1HAHH 2Y80A 2ZCLP 4AB8A 1LDTT 1NRPH 1VR1H 3E90B 1C1NA 4FXGH 4X8VH 2FYQA 1SLUB 4DY7B 4CH2B 2PLXA 4GHQA 1HYLA 3BTGE 3MU5A 3C1KA 1JIRA 3SNEA 3ATIA 1O2NA 4X1NU 3UOUA 2BDCA 2XXLA 2ILNA 4U30A 1IQKA 1Z1IA 3GCOA 2CMYA 4IN1A 1C1VH 2GZ8A 4GVUA 2VIQA 1IHSH 1C1SA 1O2SA 1TPOA 2O8LA 2UWPA 3GCTF 1LHGH 3HGNA 1XUGA 5C1UA 1W7XH 4XBCA 3ZVFA 3EA8A 2GTBA 1JIMA 3UPEA 5A2MH 4E7NA 1PQ8A 2QA9E 1DVAH 1PQ7A 4FUDA 1GCDA 1TNHA 1Q31A 1OOKB 1UTLM 2GT7A 1F5KU 1IHTH 2O8WA 4H4FA 3UTUH 3ZZ3A 2ZCKP 1RTFB 3ODFA 1C1QA 3SGBE 5PTPA 5IYTA 1QQUA 2CJIA 4M7GA 3M35A 2A2XH 4ZHAA 2Y7XA 2SGDE 5LPFA 5A0CA 3QN7A 1FV9A 1GHVH 1C2IA 2A4OA 4FUFA 4JYTA 5BRRE 3A7YA 2Z3CA 2OQ5A 1OWDA 3KQBA 2FTMA 1QQ4A 4AORA 3MNBA 4O9VA 2BDHA 1D6RA 3FVFB 2M5TA 4LK4A 5K7RA 1MQ6A 1MBQA 2ZHDA 3A82A 1HV7A 2Z9LA 1E36B 4UFEH 1W0YH 2BDGA 2J2UA 3U98H 1P04A 1IQEA 5EXNA 3M3VA 2F9VA 1NS3A 4FUCA 1TBZH 1DY9A 1DS2E 2OC1A 4MPVA 2W7SA 1TALA 2ODPA 2R0KA 5EW1H 1EUFA 1L1NA 2GD4B 3VB3A 3BTHE 3GYMA 2A5IA 1KTSB 3A7VA 3V13A 1V2MT 2QN5T 4AZ2B 3FAOA 4WXVA 5I46H 5A8XA 1LPZB 1UMAH 2H9HA 3FZZA 3D65E 1XUFA 6ESTA 5CMXH 1XUJA 1K9OE 3HATH 1KTTB 2HWLB 2AH4X 1O3EA 3FZDA 1YYY1 1BTYA 3SJ9A 1TPPA 1V3XA 1P06A 1H1BA 1JRTA 1VITF 1O2OA 1G36A 5A0BA 1D4PB 1TMBH 4CHAC 2OUAA 3S69A 2ASUB 1C5VA 1C2DA 3PYHA 1C9TA 1Z8GA 2FOFA 1O3KA 1SGEE 2WYGA 1PQ5A 5EQRA 4ISNA 2G51A 6GCHF 3RC4A 1YPMH 2Y7ZA 3KQCA 1CA8B 3AAVA 1GHAG 1IQHA 1ELEE 1EZQA 3PMAB 1MTUA 4IS5A 3A80A 1C1WH 1GMDG 5DG6A 1GI7B 2LPRA 1FQ3A 1TGNA 4Q7YA 1UVSH 1BBRK 2A5KA 1SQOA 1ELGA 4NIVA 1QY6A 4NCYA 5DP5A 2FM2A 3BF6H 2H6MA 1FI8A 1ZHPA 3BV9B 3MTYA 1WU1A 2ANYA 1WCZA 1MKWK 1AQ7A 3P95A 1S6FA 2ZPQA 3MNSA 3LGVA 1HAGE 3OY6U 1WSSH 3RDZA 3LOXA 2FOCA 4FUJA 1C4V2 1UVPA 3MU0A 1TE0A 1PYTD 3ZZAA 2K1QA 4AOQA 2CHAB 1UK2A 2VWLA 3O8DA 3S9CA 1LVYA 2BDAA 4DIHH 2XBVA 1GCTC 1GJDB 3T27A 1WQSA 3SBKA 4DT7B 3ZVCA 1GI3A 1E0FD 1P09A 3RMMH 3SU0A 1N6XA 1O0DH 3MU1A 1TA6A 1KY9A 1W12U 3RMOH 3UR6A 1TNKA 1G2LA 2Q1JA 1HAVA 1HJ9A 5T6GA 1QURH 3BTQE 4BOHA 1LO6A 3NKKA 1PPFE 1AVXA 1SGDE 2O9QA 3D62A 4INHA 1K1OA 1SR5C 3KQEA 2AGIX 5ETXA 3BG4B 3M3TA 1E37B 7LPRA 2D26C 3ENSB 2VWMA 1GJ5H 1LPKB 3LDXH 1O38A 1ELAA 5L6NH 1BZXE 1TX7A 4X6MA 5F6MA 1P03A 4B2BA 1GJ8B 1SVPA 3P8GA 3SV7A 1EAUA 4A1VA 1FZZA 2BLVA 5TJXA 4H6SB 1V2WT 4B74A 2W26A 1NFUA 1T8LA 2VWNA 1TBQH 2R0LA 1VCPA 3MWIU 1G30B 2DE9A 1MZAA 1TX6A 2Q6GA 2QXHA 2ZHEH 5DGJA 4J2YB 4UFDH 4JMYA 1L4ZA 4K8BA 5E0GA 3LONA 1CQQA 1QTFA 3VXFH 2Z3DA 1GBBA 1GJBB 2VIPA 3E3TA 3KHVA 4Y76A 1ZPBA 5LGOA 2G4UA 4K1EA 1NU7B 1ZYOA 3A83A 1GI6A 1K1MA 1TQ7B 4KGAA 4UFFH 2VIWA 1TRMA 1NFWA 5HYOA 4K69A 3KGPA 4NG9H 1ELVA 1GJ9B 1GBEA 1RIWB 3RMLH 1BRBE 3NK8A 1GG6C 4I8GA 1QRXA 3D49H 1HPGA 2ODQA 1P9SA 3OY5U 1TMUH 1AZ8A 2VH0A 3Q3XA 1NPMA 3PO1C 3GY3A 2ZPRA 2P93A 4YT6H 1FAXA 3IWMA 2VB0A 3E6PH 2ZCHP 1EOJA 4NFEA 1TNJA 3A81A 1GJ4H 2BY6X 2O8UA 1P12E 5FPYA 3GCHB 3GCTG 1MCTA 3ZZ8A 2G5NA 1GL0E 3KNXA 3SV9A 1BDAA 3A88A 4Q7ZA 1FMGA 3U8RH 1C2MA 1HAIH 2I6SA 1Z1JA 2CGAA 1C5NH 1P2QA 1GGDC 2VH6A 2BQ6B 4AFQA 4JZDH 1DICA 3SUDA 2FZZA 3GDVA 1V2TT 3ZYDA 2FOGA 1DWBH 2J4IA 2Y6TA 1F0UA 1BITA 1SGPE 2FLRH 1O2JA 1XKAC 4GAWA 2PHBA 5K0HA 9ESTA 4A1TA 2Z9JA 3B9FH 3E0NB 2J34A 1AWHB 1P01A 2R3UA 1AUTC 1NC6A 3FP8E 1IQJA 3SU2A 1CVWH 3LJJA 1PPCE 1O2QA 1ZSLA 4JK6A 4KTUA 3GDSA 3R3GB 1AVGH 4MLFB 1DPOA 4QT8C 1JXPA 2A1DB 2HVXA 4AG2A 2ZWLH 1NFYA 1L2EA 2GCTC 1CHGA 2QXIA 4R8TB 2J95A 2V3OH 4GCHF 3NCLA 1DLEA 5HMAA 3MHWU 3SHCH 1ESTA 1ZTLA 5EGMA 3A7ZA 3L3TA 5DP3A 2BDYA 4WMDA 2QXGA 2PTNA 1V2QT 1BHXB 1PQAA 4FUIA 1QB6A 1BIOA 3ATWA 1IQNA 4UONA 3DUXH 1O3HA 2IPHA 2QC2A 4X6OA 4ABBA 2OINA 2H9EH 2ZA5A 2GT8A 3LIWA 3SJ8A 3RXFA 4AYVB 2Y5FA 1O3GA 1D9IA 4NIYA 2FPZA 3RXVA 3T62A 3WY8A 1FN6A 4AB9A 2F9NA 1YBWA 1E35B 2ZI2H 1KDQA 1SSXA 2ZGBH 2VVCA 1KLJH 4WXIA 3M5OA 1G3EA 4TPIZ 3RLYH 3SU6A 1Z8IB 1VGCB 3C27B 3SV8A 4AGKA 1DDJA 4OGYA 3M7UA 1F92A 1SGNE 2BD8A 1NN6A 1PFXC 1VCQA 2O8TA 3SHAH 2ZU2A 1SGIB 4KKDA 1ZR0A 4INKA 2LNCA 2TGDA 2Z9KA 3PTBA 1GHZA 3SU1A 1HJ8A 5F8TA 5GXPA 1BA8B 5J4SA 2BY5X 2GCHF 3GOVB 3H7OA 1ID5H 1AU8A 1LCYA 1V2RT 5C67A 3RM0H 4X8TH 2OP9A 4WMFA 5C1XA 3ESTA 1MD7A 1ZPCA 2P95A 1KIGH 2PSXA 3BTDE 5C3NA 4Y71A 2P3TB 2ZFPH 1GHWH 1WYKA 2IOTA 2PSYA 4CH8B 1W3CA 4JK5A 4AN7A 1SQTA 3IG6B 2WYJA 3KIDU 1EOLA 3SV2H 3F68H 1DWEH 1PYTC 4NGAH 2A31A 1EJAA 5FAHA 4A6LA 1ZHMA 1Z7KA 5G4BA 1SMFE 2AIQA 2BZAA 1GI5A 2G5VA 2GCTB 2R2MB 4ZHLU 3N7OA 3KCGH 4JZFH 2XBXA 3I77A 1TX8A 2A0QB 1C5PA 2FOEA 4F49A 1ZGVA 4Y10E 4WMEA 2PKSC 1KXAA 2FOAA 3DA9B 1TIOA 1AB9C 4OS2A 5L2ZH 4BNRA 3S9AA 1F2SE 2A45B 2PR3A 5T6FA 2ZDNA 4DGJA 4JYVH 1IQFA 4YLQH 2AFQB 1KXEA 1QBNA 2XWBI 3B8JA 4YOIA 3JZ2B 1GBAA 1P2IA 2XC4A 5FXLA 4GSOA 2FEQH 3A89A 3BSQA 2AYWA 1B0EA 1MAYA 1PPGE 1VJAU 3EA9A 1NO9H 4BXSA 7GCHG 4ZH8A 1ELBA 1O5FH 1O3DA 2G52A 4IN2A 4CBNA 1ZMJA 2JH6D 3MYWA 1BJUA 1MU6B 3E91A 2PGQB 2RA0A 2WINI 3EA7A 3TJUA 2R2WU 1W7GH 2FI5E 1UVUH 4YO9A 5CHAC 1Y3UA 1NFXA 3DHKH 1NTPA 1QB9A 1ETRH 5DP9A 1BRAA 4ZROA 2BHGA 2WUCA 3BTWE 4K8YA 3RXEA 1S0RA 4DJZB 4B76A 8KME2 3LGWA 1SOZA 1JOUB 4B2AA 1ACBE 1BTZA 1NESE 5FPTA 3LJOA 2AGEX 5AFZH 8GCHG 2XW9A 2OC7A 5FBEA 2HPQH 4YLUA 1O36A 3HPTB 2IJOB 4Y11E 2ZTYA 4VGCC 2P3FH 4YOGA 3PLPA 1YCPM 1YPJH 4NSYA 5DPAA 3URDA 1K22H 2C8YB 2FI4E 2Z7FE 2EA3A 3U1JB 2BD7A 1N6YA 1XVMA 2FMJA 4A92A 2BVSH 4O97A 4LZ4B 1D3TB 1NZQH 2BQ7B 2VGCC 2YNBA 2IN2A 2F9PA 5E2OA 1CA0C 4TY7A 1O30A 1LKBA 2I6QA 4A7IB 4ZAEA 1QFKH 5L30H 3RUOA 4B71A 4ISLA 1GI1A 2FS9A 3O8CA 8ESTE 1TPSA 2FP7B 1A7SA 1XVOA 1MAXA 4FUEA 3GISB 1THSH 4MTBA 4UE7H 3MO3A 1EASA 1HIAB 1KLIH 1GMCG 1ORFA 1AUJA 2VVUA 1BUIA 3S7KB 3R0FA 2V0BA 4I33A 1AKSA 1W14U 3EE0B 2WV5A 3RM2H 1TABE 1SGRE 1VZQH 1T4UH 3RXLA 1XM1A 1P2JA 2BB4A 2J94A 1EP5A 2XNIA 3QK1A 3SI3H 3TU7H 1GBTA 1BTUA 2FYRA 1BQYA 1OWEA 2NU2E 5CHAB 3OTJE 1WOFA 1RS0A 3M5NA 1ELDE 2XC5A 1O3AA 1S0QA 3HKJB 2JKHA 5EQSA 2D1JA 1W2KH 1GI9B 4AFSA 4WF8A 1ZTKA 1UJ1A 3RXRA 1X7AC 5ESBA 3SO3A 2RCEA 1J9CH 1ESAA 2ULLA 3EQ0H 2WPHS 1P02A 1DITH 1DSTA 1UVTH 3VPKA 3U69H 3ZZCA 1N8OB 2H5DA 1RIWC 1G32B 3FANA 4B1TA 1JWTA 1DX5M 4B75A 2PTCE 4X2VA 1LPGB 5GJ4B 1P2KA 3QWCH 4ZXYH 1TAWA 1QJ7B 2BX3A 7KMEH 4ABEA 3ZZ4A 4Q2KA 1J15A 1Y3XA 4X8UH 2SNWA 4I31A 3Q3KA 2OC0A 1GBKA 1A4WH 2BLQA 4DVAU 1GDNA 1O33A 1C1TA 1AGJA 1TRYA 1P8VC 5H4IB 1HAYB 1LHDH 3I29A 1S81A 5FX5A 3HK6B 2QF0A 1B7XB 2FWWA 3LT3A 4YM9A 1MKWH 1GBJA 1QBOA 2WPIS 3ZV9A 3UNSA 1P2NA 4BAHB 3AW1A 2C4FH 5ABWA 3E8LA 3M61U 2XCNA 4INLA 5IDKA 3OU0A 5A8ZA 1AZZA 4MNVA 1D3PB 4ZMAH 1WQVH 1U6QA 2BM2A 3UQOA 4F4OC 3RC5A 1K1JA 4U01A 3TVJB 1ANDA 3ATMA 3RXUA 2AS9A 5FHTA 1QRZA 1TOCB 1O2GH 3M3SA 3S9BA 2AEIH 4ASHA 7ESTE 1GI2A 2P16A 1QNJA 1AVWA 5A8YA 2GCHG 3RXIA 4NZQA 4DIIH 5JYIA 3V3MA 1QR3E 1TB6H 4Y0YE 1MU8B 3U1IB 3LC5A 3RXTA 3P92A 3VFEA 1J8AA 2STBE 1UHBB 4I7YH 1IOEA 2CV3A 1Q3XA 1TWXB 2C93B 1SFQB 1G3BA 2CN0H 3UR9A 5JB8S 1GCTB 1TQ0B 3PB1E 4BTTB 1EB1H 3ZVDA 4B73A 2A5AA 3QO6A 2AIPA 1OS8A 1HLTH 1RJXB 3RXGA 5I25A 1Y3VA 1HAVB 2EI8A 2WUBA 1MZDA 5J4QA 2NWNA 3PTNA 1AFEH 3TGIE 2AERH 1AHTH 3UY9A 1FONA 3MO6A 4RN6A 2JH5D 2NU1E 4IW4E 3RXJA 5FCKA 1ANCA 1ZJDA 1RRKA 2XBYA 4MG3A 4J1YA 3ZYEA 4AFUA 1HFDA 1V2VT 4NFFA 5TCCA 1CSOE 2C8WB 1W11U 2RDLA 3Q3YA 1D3QB 4NWLA 3ZZ5A 4NZLA 1RFNA 1FLEE 4TYDA 1ANEA 2FXRA 3P6ZB 1HIAA 2P59A 2BVXH 2UUYA 4HGCA 1VCWA 1TA2A 3LH1A 1Y3WA 1EZXC 1SBWA 3BTTE 2GP9B 1O3LA 3M7QA 3UWJH 1BTHH 3S0NA 2VNTA 1O2KA 1OP2A 5B6OA 1C5TA 3T25A 4ABFA 4ABAA 1CHOF 1UTPA 2AMDA 1C2GA 4PROA 2ANWA 3GY4A 4IMQA 1OXGA 4X2XA 1AMHA 4YT7H 2ZC9H 2ZDMA 3SOSA 1N1LA 2ZG0H 1GMHF 1A5GH 1V2NT 4X1SU 1NRNH 1SPJA 2ZDAH 1SGFA 2YNAA 4FUBA 1BJVA 2J92A 4I32A 1GVZA 1ZGIA 2PUQH 1QL9A 3M5LA 2XWAA 3OSYA 1MD8A 4MNWA 1OKXA 1SGFG 3MNCA 5GPIB 3F9GA 2RA3A 4KP0A 1NU9A 5LH8A 4TY6A 3BTKE 2PV9B 1C1UH 1EXFA 1DWDH 1EJNA 3PMJA 1Y8TA 4GUXA 3V7TA 1QL8A 3F9FA 2SGAA 2HPPH 1KXFA 1O2VA 2F9UA 2HLCA 4E7RG 2W3KA 4TPYA 3TJNA 2PKSB 4AGJA 3GY5A 3GDUA 1EPTC 1DT2A 1ZRKA 1Y3YA 3LPRA 3KF2A 2ZFSA 3M37A 3BG4C 2SFAA 2BY9X 5CE1A 4NA8A 2FI3E 3EAJA 3DFJA 2SNVA 1FY8E 1EX3A 3GCHC 3SUFA 1LHCH 3MI4A 1Y5AT 1A3BH 3RC6A 1EAWA 4CRGA 2EEKA 4TWWA 1FY1A 2HNTC 1XUIA 2XYAA 4H6TA 4X0WU 3H5CB 1O2HA 3P70B 2BYAX 4ABJA 4FU8A 5GCHG 5DJ7A 1LQEA 1O3CA 1J17T 2TGPZ 5JBCS 1QRWA 4Z0KA 1HJAC 1GJCB 2QY0B 2HNTE 1GMDF 1GG6B 1C5RA 2WV4A 4BAOB 4DURA 1UTQA 4X2YA 2OLGA 1WTHD 1O34A 2G55A 3TK5A 2R3YA 4A1XA 2ZIQH 1NY22 3TJOA 1ABIH 1C4U2 3PO1B 2AMPA 3K2UA 3QTOH 2Y5GA 1O2LA 1Y5UT 2BD5A 1DWCH 1QJ6B 5GCHF 1CBWC 4O3UA 5C1YA 2SGEE 2G00A 2FODA 5AHGH 4Y6DA 1C5MD 3NZIA 4B2CA 1P57B 2FDAA 1K1PA 1QGFA 4HTCH 4THNH 5F03A 1DXPA 1GJAB 4CBOA 1GDUA 1QA7A 1O5DH 2GZ7A 2WPKS 1HAOH 1IQGA 1UTOA 4UFGH 4ZHMU 1HGTH 1GHBF 3VEQB 3U8OH 1C5LH 3CENA 3LC3A 3SZNA 5DP8A 1EPTA 4K60A 3K6YA 1T32A 5GDSH 1UTNA 2OBOA 1CBWB 2ZKSA 1DE7H 3PWBA 2WPMS 3GCNA 1C5OH 1BCUH 2F9BH 3NWUA 6CHAB 2D2DA 3P8NA 3VXEH 2GZ9A 3GY7A 4SGBE 1RD3B 3ATKA 1TGSZ 2GDDA 1FPHH 3TH3H 4D7GA 3W95A 1EB2A 1P05A 2AGGX 1XX9A 4XFQA 1T8OA 3GY2A 1Y5BT 3KEEA 3ZZDA 3EDXB 1C5YB 2PWXA 3K9XB 1T8MA 1P10A 1RGQA 3E0PB 3UOPA 1T4VH 4K1TA 1GHBG 3SGAE 4JYUH 3LKWA 1OYQA 1OX1A 5JBBS 3RXKA 3RLWH 4ABHA 1GVLA 2GV7A 2DUCA 5EXLA 1IQMA 1O35A 1ZHRA 3RXQA 1TOMH 3BIVH 2Y81A 3ZV8A 4CRDA 1YKTA 2TPIZ 2XBWA 3F6UH 3MMGA 3F9EA 1SGTA 1F7ZA 9LPRA 1SGCA 5DP4A 1MTNC 2FOMB 4YZUA 1QBVH
chains in the Genus database with same CATH superfamily
3K6ZA 4BAQB 4X1PU 1T31A 1FIZA 3SUEA 4XBBA 1N8OC 2BD9A 4WH6A 4ISIH 2ZU3A 1SFIA 1NM6A 1QCPA 3KYFA 1LHEH 4O3TA 3MH4A 3FFGA 3RXBA 2QIQA 3ZZ9A 1XUHA 2J38A 1UTKA 3SGQE 4ZKRU 1K21H 4Y7AA 5EODA 2FTLE 1VJ9U 1H9IE 2XRCA 1L1GA 3NPSA 1SGQE 2XOKD 1MABB 1SLVB 4ACBA 3VB6A 2PGBB 4D9QA 1UTMA 2KCAA 1KXBA 1HJAB 3Q00A 4MDSA 3OX7U 1O5GH 2Z9IA 4WH8A 1OP0A 2ZEBA 3LGTA 2FLBH 3RXDA 1YM0A 2OD3B 3UIRA 3QX5H 1A2CH 4I8HA 3OTPA 3FP6E 1C5QA 4R0IA 2KX4A 5FBIA 1BMNH 2D8WA 3EE7A 3GS9A 2STAE 1G2MA 1DM4B 4JZIA 2Q6FA 4CRAA 1LVMA 2ZP0H 3A8DA 2ALVA 2GMTB 3QGJA 1QJ1B 3T5FH 1K1NA 2BTCE 1VITG 1CE5A 1S85A 3A7XA 2BLWA 3UB0A 3UNRA 1CT2E 1G37A 1PPZA 1AFQB 1L4DA 2L74A 4Y0ZE 5AVDA 4ESTE 5ESTE 3UFAA 1C2EA 1E1QD 1LHFH 2A7CA 1C2JA 2A7HA 4KELA 5T3HA 3T29A 2Z6BD 4OS5A 3E1XB 3ODDA 1P3CA 1RTKA 1INCA 1B5GH 1HUTH 2A4QA 2BY7X 1YPHE 2WPLS 1GHAF 1GBFA 3PWCA 2ZHFH 2Z9GA 1QIXB 3LH3A 3Q76A 2BVRH 1CHOG 3SNBA 1P11E 4OGXA 1A61H 1DXWA 2GMTC 3QTVH 3ZVEA 1SG8B 1NRRH 2FX6A 4UDWH 2PUXB 3ZZ7A 2QF5A 2ZTZA 4JZ1A 2ANKH 2A7JA 1C1OA 2ZGCA 5SGAE 1H8IH 1SOTA 3QDZB 2NU4E 3VGCC 3SJIA 1S82A 1CGJE 2W3IA 1GI4A 4YOJA 4F55A 2Y5HA 1A46H 1ZZZA 2OQUA 1KXCA 1W8BH 5F8XA 1FUJA 1XXFA 1C9PA 2OBQA 2VIDA 3ZVGA 1EPTB 1ZRBA 1W13U 5EPYA 1ZLRA 4JZEH 1THPB 1C5XB 1HXEH 3UNQA 1GGDB 4XBDA 1FXYA 3A7WA 4NWKA 1KSNA 3P17H 1H8DH 3QZRA 1NRSH 3RXMA 3BN9A 2G8TA 1UTJA 5E0JA 4D8NA 5DK1A 6GCHG 4RT0A 3HKIB 2G81E 1O32A 2UWLA 2VIOA 1O3IA 3BG8A 2O8MA 1GI8B 3RXOA 4Y8ZA 3RU4D 2BXUH 1P3EA 3AVZA 4CR5A 1OP8A 3V12A 1AO5A 2CF8H 1UCYK 4Z6AH 2XC0A 1ESBA 2QF4A 4WWYA 2F9OA 4AC9A 4IGDA 1ANBA 1AE8H 3RXSA 5EOKA 2THFB 4XSKU 4Z1MD 1UCYE 1BTXA 1P2MA 2SGFE 3BTEE 4NSVA 2ZGJA 2H2ZA 1FJSA 4RI0A 2WHXA 3DFLA 2RG3A 2AMQA 1FPCH 3TJVA 1J14A 1P9UA 1V2PT 2UUFB 1BRUP 2OXSA 3BTME 1XMNB 2FIRH 2F91A 5A09A 4Y8YA 1UK3A 4I8JA 4AYYB 1ZMNA 1MMJN 4ZUHA 2JETC 1CT0E 4BANB 3OE7D 1C5WB 1O2PA 1O5AB 1YC0A 1F5RA 3SNCA 2BOHB 1LQDB 1TONA 1C5SA 1O2RA 5FPSA 1O5BB 4P00A 3A85A 1CO7E 3TH2H 3OEHD 2ESTE 2PW8H 4MPWA 3A8BA 1TLDA 2BLOA 3K65B 3RXPA 5HM9A 1TFXA 1O5EH 2ZPSA 3CNRA 2ZDLA 2Z94A 4AFZA 3TH4H 2W7UA 1FN8A 3TPIZ 3ITIA 4BXWA 1C2HA 4H42U 1H9LB 2BD4A 1BOQA 5GNDA 2XTTB 4GLYA 2QF3A 2FESH 5HIZA 4FVDA 4SGAE 1D6WA 1QB1A 1OWKA 1Q2WA 2HRVA 1CT4E 2C8ZB 1GBIA 1HXFH 1O2IA 1OSSA 3M7TA 1F0SA 4GHTA 3PM3A 3MH6A 1C1MA 1BRCE 5GIBA 1GI0A 3KL6A 4WVPE 7GCHF 2SGPE 2P8OC 1RXPA 3A7TA 8LPRA 1FIWA 2PFEA 1L0ZA 4CRCA 1O3MA 3AK5A 1TYNA 3MNXA 1NT1A 5C2ZA 2WPJS 5DO4H 1V2JT 2Y82A 2LELA 3U9AH 2F4LA 1GWAA 3SJKA 3QLPH 3N7DA 5EG4A 2ZDVH 3GY6A 5EXMA 2C8XB 1FDPA 3A86A 1MKXH 1UK4A 1UO6A 1A5IA 5L2YH 2FOBA 3TITA 4X6NA 1C2KA 1O3NA 2KCOA 2PKAB 5C5NA 3PMBB 4GPGA 3ELAH 4CREA 2QV1A 4OS7A 3STIA 4XOJA 2BDIA 5CHBA 2HLDD 1TNIA 1F5LA 1V2OT 4NIXA 2QCYA 1ZSKA 3F2GA 3SW2B 2W6JD 3MFJA 3MU4A 1A3EH 1AI8H 1GBHA 1FY5A 3URCA 2ZFTA 2ZQ1A 1THRH 4MQAA 1ABJH 3PLKA 1AFQC 2ANMH 3LGIA 5DP7A 3BIUH 1SB1H 4GCHG 4YESB 2BOKA 4UEHH 1HRTH 5C5OA 1O5CB 2A32A 4E05H 4BTUB 1BBRH 2HGTH 4VGCB 1RTLA 2F3CE 1BTPA 1BMMH 3BTFE 5EPNA 2XCFA 1AD8H 1GPZA 3OYPA 5JBAS 2HALA 1WAYB 2QYIA 4IC6A 3UWIA 2ZU4A 3L6PA 4IBLH 2ZNKH 4K5ZA 1SL3A 2CXVA 3D23A 1G9IE 1O39A 3F0PA 2V3HH 1A0LA 1O31A 2NU0E 3ZZ6A 5HGGA 1ARCA 3DSOA 2BX4A 1GMCF 1NRQH 5FL7D 1W0ZU 1UVOA 4D9RA 3H7TA 1AIXH 3SORA 3EYDA 2H5CA 1TGTA 1OYTH 3S7HB 4RT1A 1A0JA 1SLXB 2ZHWH 2YOLA 3A8AA 2ZECA 4KTCA 1MTSA 1O3PB 5BPEA 1CA0B 1E38B 4CRFA 1S6HA 2B0FA 6CHAC 2CF9H 3RP2A 2A2QH 2OCVB 1O3JA 4BTIB 1GVKB 3AW0A 1EZUC 3SU5A 2BMGB 1GBDA 1HAXB 4NA7A 3TNTA 4K2YA 5GWZA 3ZVAA 2QXJA 4ABGA 4I8LA 1KDQB 1IQIA 3SV6A 4MVNA 4DG4A 2DE8A 1A5HA 4FVBA 1C5UA 1EAXA 3PV2A 3SQEE 2GV6A 1KLTA 1O2WA 1UHBA 3A84A 5EQQA 1VKYA 3PROA 4I8KA 4LOYH 1O3BA 2OC8A 2VBCA 1DSUA 3RU4T 1XXDA 4XDEA 4ZKOU 1WV7H 1Z8RA 4RKJB 2VU8E 1OWIA 1GDQA 1GBCA 1K1LA 2P94A 1PPEE 3T26A 1PPBH 2FS8A 5EJ1A 1EAIA 3CP7A 3VGCB 1HAZB 4FUHA 1S84A 1Z6JH 3GYLB 3SNDA 5C94A 2TGAA 1TPAE 1AE5A 3SQHE 1H4WA 5EU8A 1YPLH 4ISHH 2C3SA 4AX9H 4CHAB 1MBMA 1MKXK 3P8FA 1V2UT 1MCVA 4XE4A 4X1QU 4Y79A 3ZVBA 2VINA 1Z71A 1K1IA 3TNSA 1BMLA 3I78A 2BXTH 1LTOA 4X1RU 1ZMLA 3LU9B 5FX6A 2ZFRH 3NUMA 3AAUA 3FO8D 1ZSJA 1ZTJA 4ZKNU 1O2YA 1SQAA 2TGTA 4RSPA 1LKAA 1GL1A 3SUGA 3VB4A 1P0SH 1TNLA 2ALPA 1BT7A 3ZZBA 1O2TA 1Z6EA 2B7DH 1TMTH 1CGIE 3W94A 1YPEH 5HXFA 3MOCA 4MPXA 1SGYE 2ZO3H 3A87A 1O2MA 3DD2H 2ZHQH 1PPHE 1L1JA 2V35A 3HK3B 4A5TS 5AF9H 1SHYA 1MH0A 3V0XA 1KYNA 2G4TA 1IQLA 4YTAA 1NROH 1EKBB 2ZGHA 4BAKB 1DUAA 1C2FA 2B8OH 2J9NA 2VGCB 3STJA 2EI7A 1YPKH 2PKAA 2GKVE 5E8EH 2HNTF 1GJ6A 1C5ZB 1O3OA 4DCDA 1FY3A 4MNXA 1DOJA 2EQNA 2KAIB 2QAAA 4ABDA 4UD9H 1BBRE 1BMAA 3KQDA 1Y59T 8GCHF 1OWJA 3BEFB 1GBMA 1ZOMA 3M36A 3MU8A 3SJOA 3UREA 1GHYH 2JJ1D 2GVFA 3P8OA 4BAMB 5A0AE 1XUKA 1G3DA 2TRMA 2VIVA 4HZHA 3IITA 3BEUA 3BEIB 1HCGA 2OTVA 1IAUA 4Q80A 2P3UB 1AN1E 5JBTA 3GICB 5EW2H 1EJMA 1LVBA 2H9TH 1BB0B 3SI4H 1WTGH 2GGVB 3A8CA 1FY4A 3QUMP 4TT3D 2VVVA 2GX4A 3DSGA 1C4Y2 4ZKSU 1JRSA 2NU3E 3O8BA 3F1SB 3RU4E 1SLWB 3VB7A 4MNYA 1DLKB 2A4RA 1O2ZA 3TGJE 1HAPH 4ZXXH 5JB9S 3RMNH 3DT0H 1VITH 1GHXH 1M9UA 2F83A 2SGQE 4X6PA 5JDUB 3RXHA 2HOBA 3U8TH 2C90B 3TLOA 1YLCA 2ZU5A 1AY6H 2ZU1A 5FCRA 3PMHB 3T28A 4TWYA 2BQWB 2EC9H 5C20A 5LPEA 2ZDKA 1O2XA 1JMOH 3QGNB 1DUEA 1MTVA 3T2NA 2BD2A 1Z8JB 1CGHA 1AWFH 1YLDA 4ISOA 3Q77A 1H9HE 2Q6DA 4FUGA 2BD3A 1O3FA 3MH7A 1ZPZA 4NIWA 4NA9H 4ACAA 5DP6A 1AB9B 1K2I1 1YF4A 4KTSA 1YP9A 1SC8U 1T8NA 1QL7A 3FP7E 1GMHG 5TCAA 3WWFA 1EZSC 2ZTXA 1MTWA 1HB0B 4X2WA 4OS6A 4I86A 1MTNB 1CU1A 1V2LT 2TBSA 3GY8A 3CS0A 1MUEB 4FU9A 4Y8XA 2BY8X 1B0FA 3TGKE 1YCPH 3UQVA 3KN2A 1HBTH 4IC5A 1TBRH 1W10U 2B5TB 3SN8A 1EATA 2JETB 1OPHB 4U32A 3MO9A 5DSFA 4U2WA 1ELFA 1K28D 4D7FA 1UCYH 1V6DA 2EI6A 4IMZA 5EJZA 5T6DA 2JH0D 3SNAA 1VGCC 3AASA 4O03A 1BTWA 1WBGB 3JZ1B 4AG1A 3WW7A 1O2UA 4E06H 4CRBA 6LPRA 1DANH 1YCPK 3PLBA 4DW2U 3M5MA 1KXDA 1O37A 1JBUH 3QZQA 1FNIA 2Z3EA 2J97A 2BZ6H 3HGPA 1ARBA 1XKBC 3B23B 2ZFQH 5E2PA 1J16A 4FU7A 1P2OA 2V6NA 2ZGXH 5F8ZA 5CDFE 1H8ED 1S5SA 1A0HB 2OK5A 1PJPA 4Y7BA 2F43B 1WUNH 4DOQA 4Q7XA 2TIOA 1BMFD 1E34B 4HG6A 4ABIA 3UUZA 4CR9A 4WY3A 4OS1A 1G3CA 3TK6A 1YPGH 2ZQ2A 3EGKH 1GBLA 1V2KT 2VJ1A 5AFYH 4X8SH 1T7CA 1SKYE 4RKOB 1F0RA 1ELCA 1BHXF 1SHHB 4JCNA 1LVOA 1YY3A 2UWOA 4MPUA 1YGCH 4XRNA 1C2LA 1SI5H 2JDID 4WJG2 4K1SA 4K3JA 3VB5A 1DY8A 2FOHA 1C1PA 3TIUA 5LPRA 1TNGA 2VWOA 4OS4A 1LMWB 1GJ7B 2GDEH 2H1UA 3O8RA 3LGYA 1V2ST 3RXCA 3SU3A 3E16B 3F9HA 1QHRB 1TGCA 2UUJB 2ZF0H 3PV4A 2R9PA 2P8OB 5HM2A 3NXPA 3CS7A 3ATLA 4HFPB 1ETSH 3LGUA 1OWHA 3F3BA 2CHAC 1MQ5A 1DFPA 3RXAA 4HI3A 3L33A 2ODYB 1TRNA 3MH5A 3G01A 4LZ1H 2UUKB 1S83A 4LXBH 1YPHC 5JPMH 1TGBA 2KAIA 1QA0A 3TK9A 4D76A 1WDIA 1H8HD 2B9LA 2A4GA 4Q4LA 1FAKH 1EQ9A 1D3DB 2HVYB 1ETTH 2BDBA 1C1RA 1EP6A 1ZJKA 1F0TA 2FX4A 1A1RA 2QGRA 1ELTA 5E0HA 3SU4A 1AKSB 2ZZUH 1HNEE 1W0JD 5DKMA 1HDTH 2W5EA 2FO9A 2ZFFH 1HAHH 2Y80A 2ZCLP 4AB8A 1LDTT 1NRPH 1VR1H 3E90B 1C1NA 4FXGH 4X8VH 2FYQA 2QE7D 1SLUB 4F48B 4DY7B 4CH2B 2PLXA 4GHQA 1HYLA 3BTGE 3MU5A 3C1KA 1JIRA 3SNEA 3ATIA 1O2NA 1KMHB 4X1NU 3UOUA 2BDCA 2XXLA 2ILNA 4U30A 1IQKA 1Z1IA 3GCOA 2CMYA 4IN1A 1C1VH 2GZ8A 4GVUA 2VIQA 1IHSH 1C1SA 1O2SA 1TPOA 2O8LA 2UWPA 3GCTF 1LHGH 3HGNA 1XUGA 5C1UA 1W7XH 4XBCA 3ZVFA 3EA8A 2GTBA 1JIMA 3UPEA 5A2MH 4E7NA 1PQ8A 2QA9E 1DVAH 1PQ7A 4FUDA 1GCDA 1TNHA 1Q31A 1OOKB 1UTLM 2GT7A 1F5KU 1IHTH 2O8WA 4H4FA 3UTUH 3ZZ3A 2ZCKP 1RTFB 3ODFA 1C1QA 3SGBE 5PTPA 5IYTA 1QQUA 2CJIA 4M7GA 3M35A 2A2XH 3N99A 2AHME 4ZHAA 2Y7XA 2SGDE 5LPFA 5A0CA 3QN7A 1FV9A 1GHVH 1C2IA 2A4OA 2RFKC 4FUFA 4JYTA 5BRRE 3UAIC 3A7YA 3PRBA 2Z3CA 2OQ5A 1OWDA 3KQBA 2FTMA 2K0QA 1QQ4A 5B6LA 4AORA 3MNBA 4O9VA 2BDHA 1D6RA 3FVFB 2M5TA 3NRLA 4LK4A 5K7RA 1MQ6A 1MBQA 2ZHDA 3A82A 1HV7A 2Z9LA 1E36B 4UFEH 1W0YH 5HKKD 2BDGA 2J2UA 3U98H 1P04A 1IQEA 5EXNA 3M3VA 2F9VA 1NS3A 4FUCA 1TBZH 3PRDA 1DY9A 1FX0B 1DS2E 2OC1A 4MPVA 2W7SA 1TALA 2ODPA 2R0KA 5EW1H 2L6OA 1EUFA 1L1NA 2GD4B 3VB3A 3BTHE 3GYMA 5HIYA 2A5IA 1KTSB 3A7VA 3V13A 1EFRD 2KCPA 1V2MT 2QN5T 4AZ2B 3FAOA 4WXVA 5I46H 5A8XA 1LPZB 4YXWD 1UMAH 2H9HA 3FZZA 4OM9A 3D65E 1XUFA 6ESTA 5CMXH 5EIYA 1XUJA 1K9OE 3HATH 1KTTB 2HWLB 2AH4X 1O3EA 3FZDA 1YYY1 1BTYA 3SJ9A 1TPPA 1V3XA 1P06A 2EY4C 3H09A 1H1BA 1JRTA 1VITF 1O2OA 2IJD1 1G36A 5A0BA 1D4PB 1TMBH 4CHAC 2OUAA 3S69A 2ASUB 1C5VA 2WZQA 1C2DA 3PYHA 1C9TA 1Z8GA 2FOFA 1O3KA 1SGEE 2WYGA 1PQ5A 5EQRA 4ISNA 2G51A 6GCHF 3RC4A 1YPMH 2Y7ZA 3KQCA 4XD7D 1CA8B 3AAVA 1GHAG 1IQHA 1ELEE 1EZQA 3PMAB 1MTUA 4IS5A 3A80A 1C1WH 1GMDG 5DG6A 1GI7B 2LPRA 1FQ3A 1TGNA 4Q7YA 1UVSH 1BBRK 2A5KA 1SQOA 1ELGA 4NIVA 1QY6A 4NCYA 5DP5A 2FM2A 3BF6H 2H6MA 1FI8A 1ZHPA 3BV9B 3MTYA 1WU1A 2ANYA 1WCZA 1MKWK 1AQ7A 3P95A 1S6FA 2ZPQA 3MNSA 3LGVA 1HAGE 3OY6U 3SZEA 1WSSH 3RDZA 3LOXA 2FOCA 4FUJA 1C4V2 1UVPA 3MU0A 1TE0A 1PYTD 3ZZAA 2K1QA 4AOQA 2CHAB 1UK2A 2VWLA 3O8DA 3S9CA 1LVYA 2BDAA 4DIHH 2XBVA 1GCTC 1GJDB 3T27A 1WQSA 3SBKA 4DT7B 3ZVCA 1GI3A 1E0FD 1P09A 3RMMH 3SU0A 1N6XA 1O0DH 3MU1A 1TA6A 1KY9A 1W12U 3F2HA 3RMOH 3UR6A 1TNKA 1G2LA 2Q1JA 2K8IA 1HAVA 1HJ9A 5T6GA 1QURH 3BTQE 4BOHA 1LO6A 3NKKA 1PPFE 1AVXA 3OEED 1SGDE 2O9QA 3D62A 4INHA 1K1OA 1SR5C 3KQEA 2AGIX 5ETXA 3BG4B 2YMSB 3M3TA 1E37B 7LPRA 2D26C 3ENSB 1GJ5H 1LPKB 2VWMA 3LDXH 1O38A 1ELAA 5L6NH 1BZXE 1TX7A 4X6MA 5F6MA 1P03A 4B2BA 1GJ8B 1SVPA 3P8GA 3SV7A 1EAUA 4A1VA 5F53A 1FZZA 2V3MA 2BLVA 5TJXA 4H6SB 1V2WT 4B74A 2W26A 1NFUA 1T8LA 2VWNA 1TBQH 2R0LA 3WWBA 1VCPA 3MWIU 1G30B 2DE9A 1MZAA 1TX6A 2Q6GA 2QXHA 2ZHEH 5DGJA 4J2YB 4UFDH 4JMYA 1L4ZA 4K8BA 5E0GA 3LONA 1CQQA 1QTFA 3VXFH 2Z3DA 1GBBA 1GJBB 2VIPA 3E3TA 3KHVA 4Y76A 1ZPBA 5LGOA 2G4UA 4K1EA 1NU7B 1ZYOA 3A83A 1GI6A 1K1MA 1TQ7B 4KGAA 4UFFH 2VIWA 1TRMA 2WV9A 4M9FA 1NFWA 5HYOA 4K69A 3KGPA 4NG9H 1ELVA 1GJ9B 1GBEA 1RIWB 3RMLH 1BRBE 3NK8A 1GG6C 4I8GA 1QRXA 3D49H 1HPGA 2ODQA 1P9SA 3OY5U 1TMUH 1AZ8A 2VH0A 3Q3XA 1NPMA 3PO1C 3GY3A 1E79D 3OAAD 2ZPRA 2P93A 4YT6H 1FAXA 3IWMA 2VB0A 3E6PH 2ZCHP 1EOJA 4NFEA 1TNJA 3A81A 1GJ4H 2BY6X 2O8UA 1P12E 5FPYA 3GCHB 3GCTG 1MCTA 3ZZ8A 2G5NA 1GL0E 3KNXA 3SV9A 1BDAA 3A88A 4Q7ZA 1FMGA 3U8RH 1C2MA 2V7QD 1HAIH 2I6SA 1Z1JA 2CGAA 1C5NH 1P2QA 1GGDC 2BQ6B 2VH6A 4AFQA 4JZDH 1DICA 3SUDA 2FZZA 3GDVA 1V2TT 3ZYDA 2FOGA 1DWBH 2J4IA 2Y6TA 1F0UA 1BITA 2KZ4A 1SGPE 2FLRH 1O2JA 1XKAC 4GAWA 2PHBA 5K0HA 9ESTA 4A1TA 2Z9JA 3B9FH 3E0NB 2J34A 1AWHB 1P01A 2R3UA 1AUTC 1NC6A 3FP8E 1IQJA 3SU2A 1CVWH 3LJJA 1PPCE 1O2QA 1ZSLA 4JK6A 4KTUA 3GDSA 3R3GB 1AVGH 3U28C 4MLFB 1DPOA 4QT8C 1JXPA 2A1DB 2HVXA 4AG2A 2ZWLH 1NFYA 1L2EA 2GCTC 1CHGA 2QXIA 4R8TB 2J95A 2V3OH 4GCHF 3NCLA 1DLEA 5HMAA 3MHWU 3PV5A 1ESTA 3SHCH 1ZTLA 5EGMA 3A7ZA 3L3TA 5DP3A 1WXRA 2BDYA 4WMDA 2QXGA 2PTNA 1V2QT 1BHXB 1PQAA 4FUIA 1QB6A 1BIOA 3ATWA 5IK2D 1E1RD 1IQNA 4UONA 3DUXH 1NBME 1O3HA 2IPHA 2QC2A 4X6OA 4ABBA 2OINA 2J98A 2H9EH 2ZA5A 2GT8A 3LIWA 3SJ8A 3RXFA 4AYVB 2Y5FA 1O3GA 1D9IA 4NIYA 2FPZA 3RXVA 3T62A 3WY8A 1FN6A 4AB9A 2F9NA 1YBWA 1E35B 2ZI2H 1KDQA 1SSXA 2ZGBH 2VVCA 1KLJH 4WXIA 3M5OA 1G3EA 2JJ2D 4TPIZ 3RLYH 1Z8IB 1VGCB 3C27B 3SU6A 3SV8A 4AGKA 1DDJA 4OGYA 3M7UA 2RDEA 1F92A 1SGNE 2BD8A 1NN6A 1PFXC 1VCQA 2O8TA 2XNDD 3SHAH 2ZU2A 1SGIB 4KKDA 1ZR0A 4INKA 2LNCA 2TGDA 2Z9KA 3PTBA 1GHZA 3SU1A 1HJ8A 5F8TA 4P02A 5GXPA 1BA8B 5J4SA 2BY5X 2GCHF 3GOVB 3H7OA 1ID5H 1AU8A 1LCYA 3DSPA 1V2RT 5C67A 3RM0H 4X8TH 2OP9A 4WMFA 5C1XA 3ESTA 1MD7A 1ZPCA 2P95A 1KIGH 3DCLA 2PSXA 3BTDE 5C3NA 1UW7A 4Y71A 2P3TB 2ZFPH 1GHWH 1WYKA 2IOTA 2PSYA 4CH8B 5T1VA 1W3CA 4DT4A 4JK5A 4AN7A 1S6LA 1SQTA 3IG6B 2WYJA 3KIDU 1EOLA 3SV2H 3F68H 1K0HA 1DWEH 1PYTC 4NGAH 2A31A 1EJAA 5FAHA 4A6LA 1ZHMA 1Z7KA 5G4BA 1SMFE 2AIQA 2BZAA 1GI5A 2G5VA 2GCTB 2R2MB 4ZHLU 3N7OA 3KCGH 4JZFH 2XBXA 3I77A 1TX8A 2A0QB 1C5PA 2FOEA 4F49A 1ZGVA 4Y10E 4WMEA 2PKSC 1KXAA 5KEDA 2FOAA 3DA9B 1TIOA 1AB9C 4OS2A 5L2ZH 4BNRA 3S9AA 1F2SE 2A45B 2PR3A 5T6FA 2ZDNA 4DGJA 4JYVH 1IQFA 4YLQH 2AFQB 1KXEA 1QBNA 2XWBI 3B8JA 4YOIA 3JZ2B 1GBAA 1P2IA 2XC4A 5FXLA 4GSOA 2FEQH 3A89A 3BSQA 2AYWA 1B0EA 1MAYA 1PPGE 1VJAU 2IPQX 3EA9A 1NO9H 4BXSA 3KYGA 7GCHG 4ZH8A 1ELBA 1O5FH 1O3DA 2G52A 4IN2A 4CBNA 1ZMJA 3KQ5A 2JH6D 3MYWA 1BJUA 1MU6B 3E91A 2PGQB 2RA0A 2WINI 3EA7A 3TJUA 2R2WU 1W7GH 2FI5E 1UVUH 4YO9A 5CHAC 1Y3UA 1NFXA 3DHKH 1NTPA 1QB9A 1ETRH 5DP9A 1BRAA 4ZROA 2BHGA 2WUCA 3BTWE 4K8YA 3RXEA 1S0RA 4DJZB 4B76A 8KME2 3LGWA 1SOZA 1JOUB 4B2AA 1ACBE 1BTZA 1NESE 5FPTA 3LJOA 2AGEX 5AFZH 8GCHG 2XW9A 2OC7A 5FBEA 2HPQH 4YLUA 1O36A 3HPTB 2IJOB 4Y11E 2ZTYA 4VGCC 2P3FH 4YOGA 3PLPA 1YCPM 1YPJH 4NSYA 5DPAA 3URDA 1K22H 2C8YB 2FI4E 2Z7FE 2EA3A 3N7EA 3U1JB 2BD7A 1N6YA 1XVMA 2FMJA 4A92A 2BVSH 4O97A 4LZ4B 1D3TB 1NZQH 2BQ7B 2VGCC 2YNBA 2IN2A 2F9PA 5E2OA 1CA0C 4TY7A 1O30A 1LKBA 2I6QA 5KGOA 4A7IB 3MQKC 4ZAEA 1QFKH 5L30H 3RUOA 4B71A 4ISLA 1GI1A 2FS9A 3O8CA 2J98B 8ESTE 1TPSA 2WPDD 2YMSC 2FP7B 1A7SA 1XVOA 1MAXA 4FUEA 3GISB 1THSH 4MTBA 4UE7H 3MO3A 1EASA 1HIAB 1KLIH 3F2FA 1GMCG 2KM0A 1ORFA 1YLNA 1AUJA 2VVUA 1BUIA 3S7KB 3R0FA 2V0BA 4I33A 1AKSA 1W14U 3EE0B 2WV5A 3RM2H 1TABE 2J5UA 1SGRE 1VZQH 1T4UH 3RXLA 1XM1A 1P2JA 2BB4A 2J94A 1EP5A 2XNIA 3QK1A 3SI3H 3TU7H 1GBTA 1BTUA 3FOAA 2FYRA 1BQYA 1OWEA 2NU2E 5CHAB 3OTJE 1WOFA 1RS0A 3M5NA 1ELDE 2XC5A 1O3AA 1S0QA 3HKJB 2JKHA 5EQSA 2D1JA 1W2KH 1GI9B 4AFSA 4WF8A 1ZTKA 1UJ1A 3RXRA 1X7AC 5ESBA 3SO3A 2RCEA 1J9CH 1ESAA 2ULLA 3EQ0H 2WPHS 1P02A 1DITH 1DSTA 2PP6A 1UVTH 3VPKA 3U69H 3ZZCA 1N8OB 2H5DA 1RIWC 1G32B 3FANA 4B1TA 1JWTA 3W1EA 2GJGA 1DX5M 4B75A 2PTCE 4X2VA 1LPGB 5GJ4B 1P2KA 3QWCH 4ZXYH 1TAWA 1QJ7B 2BX3A 5C17A 7KMEH 4ABEA 3ZZ4A 4Q2KA 1J15A 1Y3XA 4X8UH 2SNWA 4I31A 3Q3KA 2OC0A 1GBKA 1A4WH 2BLQA 4DVAU 1GDNA 1O33A 1C1TA 1AGJA 1TRYA 1P8VC 5H4IB 1HAYB 1LHDH 3I29A 1S81A 5FX5A 3HK6B 2QF0A 1B7XB 2FWWA 3LT3A 4YM9A 1MKWH 3F0OA 1GBJA 1QBOA 2WPIS 3ZV9A 4B6EA 4TSFD 3UNSA 1P2NA 4BAHB 3AW1A 2C4FH 5ABWA 3E8LA 3M61U 2XCNA 4INLA 5IDKA 3OU0A 5A8ZA 1AZZA 4MNVA 1D3PB 4ZMAH 1WQVH 1U6QA 2BM2A 3UQOA 4F4OC 3RC5A 2WSSD 1K1JA 4U01A 3TVJB 1ANDA 3ATMA 3RXUA 4B6FA 2CK3D 2AS9A 5FHTA 1QRZA 1TOCB 1O2GH 3M3SA 3S9BA 2AEIH 4ASHA 7ESTE 2JIZD 1GI2A 2P16A 1QNJA 1AVWA 1NBMD 5A8YA 2GCHG 3RXIA 4NZQA 4DIIH 5JYIA 3V3MA 1QR3E 1TB6H 4Y0YE 1MU8B 3U1IB 3LC5A 3RXTA 3P92A 3VFEA 1J8AA 2STBE 2KCYA 1UHBB 4I7YH 1IOEA 2CV3A 1Q3XA 1TWXB 2C93B 1SFQB 1G3BA 2CN0H 3UR9A 5JB8S 1GCTB 1TQ0B 5C0TA 3PB1E 4BTTB 1EB1H 3ZVDA 4B73A 1YWUA 2A5AA 3QO6A 2AIPA 1OS8A 1HLTH 1RJXB 3RXGA 5I25A 1Y3VA 1HAVB 2EI8A 2WUBA 1MZDA 5J4QA 2NWNA 3PTNA 1AFEH 3TGIE 2AERH 1AHTH 3UY9A 1FONA 3MO6A 4RN6A 2JH5D 2NU1E 3FN8A 4IW4E 1SQRA 3RXJA 5FCKA 1ANCA 1ZJDA 1RRKA 2XBYA 4MG3A 4J1YA 3ZYEA 4AFUA 1HFDA 1V2VT 4NFFA 5TCCA 1CSOE 2C8WB 1W11U 2RDLA 3Q3YA 1D3QB 4NWLA 1W0KD 3ZZ5A 4NZLA 1RFNA 1FLEE 4TYDA 2M2AA 1ANEA 2FXRA 3P6ZB 1HIAA 2P59A 2BVXH 2UUYA 4HGCA 1VCWA 1TA2A 3LH1A 1Y3WA 1EZXC 1SBWA 3BTTE 5DN6D 2GP9B 3OFND 1O3LA 3M7QA 3UWJH 1BTHH 3S0NA 2VNTA 1O2KA 1OP2A 5B6OA 1C5TA 3T25A 3SYJA 3FKSD 4ABFA 4ABAA 1CHOF 1UTPA 2AMDA 1C2GA 4PROA 2ANWA 3GY4A 4IMQA 1OXGA 4X2XA 1AMHA 4YT7H 2ZC9H 2ZDMA 3SOSA 1N1LA 2ZG0H 1GMHF 1A5GH 1V2NT 4X1SU 1OHHD 1NRNH 1SPJA 2W6ID 2ZDAH 4Q63A 1SGFA 2YNAA 4FUBA 1BJVA 2J92A 4I32A 1GVZA 1ZGIA 2PUQH 1QL9A 3M5LA 2XWAA 3OSYA 1MD8A 4MNWA 1OKXA 1SGFG 3MNCA 4ZCNA 5GPIB 3F9GA 2RA3A 4KP0A 1NU9A 5LH8A 2KR7A 4TY6A 3BTKE 2PV9B 1C1UH 1EXFA 1DWDH 1EJNA 3PMJA 1Y8TA 3VG8A 4GUXA 3V7TA 1QL8A 3F9FA 5EJLA 2SGAA 2HPPH 1KXFA 1O2VA 2F9UA 2HLCA 4E7RG 2W3KA 4TPYA 3TJNA 2PKSB 4AGJA 3GY5A 3GDUA 1EPTC 1DT2A 1ZRKA 1Y3YA 3LPRA 3KF2A 2ZFSA 3M37A 3BG4C 2SFAA 2BY9X 5CE1A 4NA8A 2FI3E 3EAJA 3DFJA 4FOUC 2SNVA 1FY8E 1EX3A 3GCHC 3SUFA 1LHCH 3MI4A 1Y5AT 1A3BH 3RC6A 1EAWA 4CRGA 2EEKA 4TWWA 1FY1A 2HNTC 1XUIA 2XYAA 4H6TA 4X0WU 3H5CB 1O2HA 3P70B 2BYAX 3ZIAD 4ABJA 4FU8A 5GCHG 5DJ7A 1LQEA 1O3CA 1J17T 1COWD 2TGPZ 5JBCS 1QRWA 4Z0KA 1HJAC 1GJCB 2QY0B 2HNTE 1GMDF 1GG6B 1C5RA 2WV4A 4BAOB 4DURA 1UTQA 1QZ8A 4X2YA 2OLGA 1WTHD 1O34A 2G55A 3TK5A 2R3YA 4A1XA 2ZIQH 5C0UA 1NY22 3TJOA 1ABIH 1C4U2 3PO1B 2AMPA 3K2UA 3QTOH 2Y5GA 1O2LA 1Y5UT 2BD5A 1DWCH 1QJ6B 2KFWA 5GCHF 1CBWC 4O3UA 5C1YA 2SGEE 2G00A 2FODA 5AHGH 4Y6DA 1C5MD 3NZIA 4B2CA 1P57B 2FDAA 1K1PA 1QGFA 4HTCH 4THNH 5F03A 1DXPA 1GJAB 4CBOA 1GDUA 1QA7A 1O5DH 2GZ7A 2WPKS 4ASUD 1HAOH 1IQGA 1UTOA 4UFGH 4ZHMU 1HGTH 1GHBF 3VEQB 3U8OH 1C5LH 3CENA 3LC3A 3SZNA 5DP8A 1EPTA 2LP6A 4K60A 3K6YA 1T32A 5GDSH 1UTNA 2OBOA 1CBWB 2ZKSA 1DE7H 3PWBA 2WPMS 3GCNA 1C5OH 1BCUH 2F9BH 3NWUA 6CHAB 2D2DA 3P8NA 3VXEH 2GZ9A 3GY7A 4SGBE 1RD3B 3ATKA 1TGSZ 2GDDA 1FPHH 3TH3H 4D7GA 3W95A 1EB2A 1P05A 2AGGX 1XX9A 4XFQA 1T8OA 3GY2A 1Y5BT 3KEEA 3ZZDA 3EDXB 5KECA 1C5YB 2PWXA 3K9XB 1T8MA 1P10A 1RGQA 3E0PB 3UOPA 1T4VH 4K1TA 1GHBG 3SGAE 4JYUH 3LKWA 1OYQA 1OX1A 5JBBS 3RXKA 3RLWH 4ABHA 1GVLA 2GV7A 2DUCA 5EXLA 1IQMA 1O35A 1ZHRA 3RXQA 2YMSD 1TOMH 3BIVH 2Y81A 3ZV8A 4CRDA 1YKTA 2TPIZ 2XBWA 3F6UH 3MMGA 3F9EA 1SGTA 4FETA 1F7ZA 9LPRA 1SGCA 5DP4A 1MTNC 2FOMB 4YZUA 1QBVH
chains in the Genus database with same CATH topology
3K6ZA 4BAQB 4X1PU 1T31A 1FIZA 3SUEA 4XBBA 1N8OC 2BD9A 4WH6A 4ISIH 2ZU3A 1SFIA 1NM6A 1QCPA 1LHEH 4O3TA 3MH4A 3FFGA 3RXBA 2QIQA 3ZZ9A 1XUHA 2J38A 1UTKA 3SGQE 4ZKRU 1K21H 4Y7AA 5EODA 2FTLE 1VJ9U 1H9IE 2XRCA 1L1GA 3NPSA 1SGQE 1SLVB 3VB6A 2PGBB 4D9QA 1UTMA 1KXBA 1HJAB 3Q00A 4MDSA 3OX7U 1O5GH 2Z9IA 4WH8A 1OP0A 2ZEBA 3LGTA 2FLBH 3RXDA 1YM0A 2OD3B 3UIRA 3QX5H 1A2CH 4I8HA 3FP6E 1C5QA 4R0IA 5FBIA 1BMNH 2D8WA 2STAE 1G2MA 1DM4B 4JZIA 2Q6FA 4CRAA 1LVMA 2ZP0H 3A8DA 2ALVA 2GMTB 3QGJA 1QJ1B 3T5FH 1K1NA 2BTCE 1VITG 1CE5A 1S85A 3A7XA 2BLWA 3UNRA 1CT2E 1G37A 1PPZA 1AFQB 1L4DA 4Y0ZE 5AVDA 4ESTE 5ESTE 3UFAA 1C2EA 1LHFH 2A7CA 1C2JA 2A7HA 4KELA 5T3HA 3T29A 2Z6BD 4OS5A 3E1XB 3ODDA 1P3CA 1RTKA 1INCA 1B5GH 1HUTH 2A4QA 2BY7X 1YPHE 2WPLS 1GHAF 1GBFA 3PWCA 2ZHFH 2Z9GA 1QIXB 3LH3A 3Q76A 2BVRH 1CHOG 3SNBA 1P11E 4OGXA 1A61H 1DXWA 2GMTC 3QTVH 3ZVEA 1SG8B 1NRRH 2FX6A 4UDWH 2PUXB 3ZZ7A 2ZTZA 4JZ1A 2ANKH 2A7JA 1C1OA 2ZGCA 5SGAE 1H8IH 1SOTA 3QDZB 2NU4E 3VGCC 3SJIA 1S82A 1CGJE 2W3IA 1GI4A 4YOJA 2Y5HA 1A46H 1ZZZA 2OQUA 1KXCA 1W8BH 5F8XA 1FUJA 1XXFA 1C9PA 2OBQA 2VIDA 3ZVGA 1EPTB 1ZRBA 1W13U 5EPYA 1ZLRA 4JZEH 1THPB 1C5XB 1HXEH 3UNQA 1GGDB 4XBDA 1FXYA 3A7WA 4NWKA 1KSNA 3P17H 1H8DH 3QZRA 1NRSH 3RXMA 3BN9A 2G8TA 1UTJA 5E0JA 4D8NA 5DK1A 6GCHG 3HKIB 2G81E 1O32A 2UWLA 2VIOA 1O3IA 3BG8A 2O8MA 1GI8B 3RXOA 4Y8ZA 3RU4D 2BXUH 1P3EA 3AVZA 4CR5A 1OP8A 3V12A 1AO5A 2CF8H 1UCYK 4Z6AH 2XC0A 1ESBA 4WWYA 2F9OA 4IGDA 1ANBA 1AE8H 3RXSA 5EOKA 2THFB 4XSKU 1UCYE 1BTXA 1P2MA 2SGFE 3BTEE 4NSVA 2ZGJA 2H2ZA 1FJSA 3DFLA 2RG3A 2AMQA 1FPCH 3TJVA 1J14A 1P9UA 1V2PT 2UUFB 1BRUP 2OXSA 3BTME 1XMNB 2FIRH 2F91A 5A09A 4Y8YA 1UK3A 4I8JA 4AYYB 1ZMNA 1MMJN 4ZUHA 2JETC 1CT0E 4BANB 1C5WB 1O2PA 1O5AB 1YC0A 1F5RA 3SNCA 2BOHB 1LQDB 1TONA 1C5SA 1O2RA 5FPSA 1O5BB 3A85A 1CO7E 3TH2H 2ESTE 2PW8H 4MPWA 3A8BA 1TLDA 2BLOA 3K65B 3RXPA 5HM9A 1TFXA 1O5EH 2ZPSA 4AFZA 2ZDLA 2Z94A 3TH4H 2W7UA 1FN8A 3TPIZ 3ITIA 4BXWA 1C2HA 4H42U 1H9LB 2BD4A 1BOQA 2XTTB 4GLYA 2QF3A 2FESH 4FVDA 4SGAE 1D6WA 1QB1A 1OWKA 1Q2WA 2HRVA 1CT4E 2C8ZB 1GBIA 1HXFH 1O2IA 1OSSA 3M7TA 1F0SA 4GHTA 3PM3A 3MH6A 1C1MA 1BRCE 5GIBA 1GI0A 3KL6A 4WVPE 7GCHF 2SGPE 2P8OC 1RXPA 3A7TA 8LPRA 1FIWA 2PFEA 1L0ZA 4CRCA 1O3MA 1TYNA 3MNXA 1NT1A 5C2ZA 2WPJS 5DO4H 1V2JT 2Y82A 3U9AH 1GWAA 3SJKA 3QLPH 5EG4A 2ZDVH 3GY6A 5EXMA 2C8XB 1FDPA 3A86A 1MKXH 1UK4A 1UO6A 1A5IA 5L2YH 2FOBA 3TITA 4X6NA 1C2KA 1O3NA 2PKAB 5C5NA 3PMBB 4GPGA 3ELAH 4CREA 2QV1A 4OS7A 3STIA 4XOJA 2BDIA 4NIXA 1TNIA 1F5LA 1V2OT 2QCYA 1ZSKA 3SW2B 3MFJA 3MU4A 1A3EH 1AI8H 1GBHA 1FY5A 3URCA 2ZFTA 2ZQ1A 1THRH 4MQAA 1ABJH 3PLKA 1AFQC 2ANMH 3LGIA 5DP7A 3BIUH 1SB1H 4GCHG 4YESB 2BOKA 4UEHH 1HRTH 5C5OA 1O5CB 2A32A 4E05H 4BTUB 1BBRH 2HGTH 4VGCB 1RTLA 2F3CE 1BTPA 1BMMH 3BTFE 5EPNA 2XCFA 1AD8H 1GPZA 3OYPA 5JBAS 2HALA 1WAYB 2QYIA 4IC6A 3UWIA 2ZU4A 3L6PA 4IBLH 2ZNKH 4K5ZA 1SL3A 2CXVA 3D23A 1G9IE 1O39A 2V3HH 1A0LA 1O31A 2NU0E 3ZZ6A 5HGGA 1ARCA 2BX4A 1GMCF 1NRQH 1W0ZU 1UVOA 4D9RA 3H7TA 1AIXH 3SORA 3EYDA 2H5CA 1TGTA 1OYTH 3S7HB 1A0JA 1SLXB 2ZHWH 2YOLA 3A8AA 2ZECA 4KTCA 1MTSA 1O3PB 5BPEA 1CA0B 1E38B 4CRFA 1S6HA 2B0FA 6CHAC 2CF9H 3RP2A 2A2QH 2OCVB 1O3JA 4BTIB 1GVKB 3AW0A 1EZUC 3SU5A 2BMGB 1GBDA 1HAXB 4NA7A 3TNTA 4K2YA 5GWZA 3ZVAA 2QXJA 4ABGA 4I8LA 1KDQB 1IQIA 3SV6A 4MVNA 4DG4A 2DE8A 1A5HA 4FVBA 1C5UA 1EAXA 3SQEE 2GV6A 1KLTA 1O2WA 1UHBA 3A84A 5EQQA 3PROA 4I8KA 4LOYH 1O3BA 2OC8A 1DSUA 3RU4T 1XXDA 4XDEA 4ZKOU 1WV7H 1Z8RA 4RKJB 2VU8E 1OWIA 1GDQA 1GBCA 1K1LA 2P94A 1PPEE 3T26A 1PPBH 2FS8A 1EAIA 3CP7A 3VGCB 1HAZB 4FUHA 1S84A 1Z6JH 3GYLB 3SNDA 2TGAA 1TPAE 1AE5A 3SQHE 1H4WA 5EU8A 1YPLH 4ISHH 2C3SA 4AX9H 4CHAB 1MBMA 1MKXK 3P8FA 1V2UT 1MCVA 4XE4A 4X1QU 4Y79A 3ZVBA 2VINA 1Z71A 1K1IA 3TNSA 1BMLA 3I78A 2BXTH 1LTOA 4X1RU 1ZMLA 3LU9B 5FX6A 2ZFRH 3NUMA 3AAUA 1ZSJA 1ZTJA 4ZKNU 1O2YA 1SQAA 2TGTA 4RSPA 1LKAA 1GL1A 3SUGA 3VB4A 1P0SH 1TNLA 2ALPA 1BT7A 3ZZBA 1O2TA 1Z6EA 2B7DH 1TMTH 1CGIE 3W94A 1YPEH 5HXFA 3MOCA 4MPXA 1SGYE 2ZO3H 3A87A 1O2MA 3DD2H 2ZHQH 1PPHE 1L1JA 2V35A 3HK3B 4A5TS 5AF9H 1SHYA 1MH0A 3V0XA 1KYNA 2G4TA 1IQLA 4YTAA 1NROH 1EKBB 2ZGHA 4BAKB 1DUAA 1C2FA 2B8OH 2J9NA 2VGCB 3STJA 2EI7A 1YPKH 2PKAA 2GKVE 5E8EH 2HNTF 1GJ6A 1C5ZB 1O3OA 4DCDA 1FY3A 4MNXA 1DOJA 2KAIB 2QAAA 4ABDA 4UD9H 1BBRE 1BMAA 3KQDA 1Y59T 8GCHF 1OWJA 3BEFB 1GBMA 1ZOMA 3M36A 3MU8A 3SJOA 3UREA 1GHYH 2GVFA 3P8OA 4BAMB 5A0AE 1XUKA 1G3DA 2TRMA 2VIVA 4HZHA 3IITA 3BEUA 3BEIB 1HCGA 2OTVA 1IAUA 4Q80A 2P3UB 1AN1E 5JBTA 3GICB 5EW2H 1EJMA 1LVBA 2H9TH 1BB0B 3SI4H 1WTGH 2GGVB 3A8CA 1FY4A 3QUMP 2VVVA 2GX4A 1C4Y2 4ZKSU 1JRSA 2NU3E 3O8BA 3F1SB 3RU4E 1SLWB 3VB7A 4MNYA 1DLKB 2A4RA 1O2ZA 3TGJE 1HAPH 4ZXXH 5JB9S 3RMNH 3DT0H 1VITH 1GHXH 1M9UA 2F83A 2SGQE 4X6PA 5JDUB 3RXHA 2HOBA 3U8TH 2C90B 3TLOA 1YLCA 2ZU5A 1AY6H 2ZU1A 5FCRA 3PMHB 3T28A 4TWYA 2BQWB 2EC9H 5C20A 5LPEA 2ZDKA 1O2XA 1JMOH 3QGNB 1DUEA 1MTVA 3T2NA 2BD2A 1Z8JB 1CGHA 1AWFH 1YLDA 4ISOA 3Q77A 1H9HE 2Q6DA 4FUGA 2BD3A 1O3FA 3MH7A 1ZPZA 4NIWA 4NA9H 5DP6A 1AB9B 1K2I1 1YF4A 4KTSA 1YP9A 1SC8U 1T8NA 1QL7A 3FP7E 1GMHG 5TCAA 1EZSC 2ZTXA 1MTWA 1HB0B 4X2WA 4OS6A 1MTNB 1CU1A 1V2LT 2TBSA 3GY8A 3CS0A 1MUEB 4FU9A 4Y8XA 2BY8X 1B0FA 3TGKE 1YCPH 3UQVA 3KN2A 1HBTH 4IC5A 1TBRH 1W10U 2B5TB 3SN8A 1EATA 2JETB 1OPHB 4U32A 3MO9A 4U2WA 1ELFA 1K28D 4D7FA 1UCYH 1V6DA 2EI6A 4IMZA 5T6DA 2JH0D 3SNAA 1VGCC 3AASA 4O03A 1BTWA 1WBGB 3JZ1B 4AG1A 1O2UA 4E06H 4CRBA 6LPRA 1DANH 1YCPK 3PLBA 4DW2U 3M5MA 1KXDA 1O37A 1JBUH 3QZQA 1FNIA 2Z3EA 2BZ6H 3HGPA 1ARBA 1XKBC 3B23B 2ZFQH 5E2PA 1J16A 4FU7A 1P2OA 2V6NA 2ZGXH 5F8ZA 1S5SA 1A0HB 1PJPA 4Y7BA 1WUNH 4DOQA 4Q7XA 2TIOA 1E34B 4ABIA 3UUZA 4CR9A 4WY3A 4OS1A 1G3CA 3TK6A 1YPGH 2ZQ2A 3EGKH 1GBLA 1V2KT 2VJ1A 5AFYH 4X8SH 1T7CA 4RKOB 1F0RA 1ELCA 1BHXF 1SHHB 4JCNA 1LVOA 2UWOA 4MPUA 1YGCH 1C2LA 1SI5H 4WJG2 4K1SA 4K3JA 3VB5A 1DY8A 2FOHA 1C1PA 3TIUA 5LPRA 1TNGA 2VWOA 4OS4A 1LMWB 1GJ7B 2GDEH 2H1UA 3O8RA 3LGYA 1V2ST 3RXCA 3SU3A 3E16B 3F9HA 1QHRB 1TGCA 2UUJB 2ZF0H 3PV4A 2R9PA 2P8OB 5HM2A 3NXPA 3CS7A 3ATLA 4HFPB 1ETSH 3LGUA 1OWHA 2CHAC 1MQ5A 1DFPA 3RXAA 4HI3A 3L33A 2ODYB 1TRNA 3MH5A 3G01A 4LZ1H 2UUKB 1S83A 4LXBH 1YPHC 5JPMH 1TGBA 2KAIA 1QA0A 3TK9A 4D76A 2B9LA 2A4GA 1FAKH 1EQ9A 1D3DB 1ETTH 2BDBA 1C1RA 1EP6A 1ZJKA 1F0TA 2FX4A 1A1RA 2QGRA 1ELTA 5E0HA 3SU4A 1AKSB 2ZZUH 1HNEE 5DKMA 1HDTH 2W5EA 2FO9A 2ZFFH 1HAHH 2Y80A 2ZCLP 4AB8A 1LDTT 1NRPH 1VR1H 3E90B 1C1NA 4FXGH 4X8VH 2FYQA 1SLUB 4DY7B 4CH2B 2PLXA 4GHQA 1HYLA 3BTGE 3MU5A 3C1KA 1JIRA 3SNEA 3ATIA 1O2NA 4X1NU 3UOUA 2BDCA 2XXLA 2ILNA 4U30A 1IQKA 1Z1IA 3GCOA 2CMYA 4IN1A 1C1VH 2GZ8A 4GVUA 2VIQA 1IHSH 1C1SA 1O2SA 1TPOA 2O8LA 2UWPA 3GCTF 1LHGH 3HGNA 1XUGA 5C1UA 1W7XH 4XBCA 3ZVFA 3EA8A 2GTBA 1JIMA 3UPEA 5A2MH 4E7NA 1PQ8A 2QA9E 1DVAH 1PQ7A 4FUDA 1GCDA 1TNHA 1Q31A 1OOKB 1UTLM 2GT7A 1F5KU 1IHTH 2O8WA 4H4FA 3UTUH 3ZZ3A 2ZCKP 1RTFB 3ODFA 1C1QA 3SGBE 5PTPA 5IYTA 1QQUA 2CJIA 4M7GA 3M35A 2A2XH 4ZHAA 2Y7XA 2SGDE 5LPFA 5A0CA 3QN7A 1FV9A 1GHVH 1C2IA 2A4OA 4FUFA 4JYTA 5BRRE 3A7YA 2Z3CA 2OQ5A 1OWDA 3KQBA 2FTMA 1QQ4A 4AORA 3MNBA 4O9VA 2BDHA 1D6RA 3FVFB 2M5TA 4LK4A 5K7RA 1MQ6A 1MBQA 2ZHDA 3A82A 1HV7A 2Z9LA 1E36B 4UFEH 1W0YH 2BDGA 2J2UA 3U98H 1P04A 1IQEA 5EXNA 3M3VA 2F9VA 1NS3A 4FUCA 1TBZH 1DY9A 1DS2E 2OC1A 4MPVA 2W7SA 1TALA 2ODPA 2R0KA 5EW1H 1EUFA 1L1NA 2GD4B 3VB3A 3BTHE 3GYMA 2A5IA 1KTSB 3A7VA 3V13A 1V2MT 2QN5T 4AZ2B 3FAOA 4WXVA 5I46H 5A8XA 1LPZB 1UMAH 2H9HA 3FZZA 3D65E 1XUFA 6ESTA 5CMXH 1XUJA 1K9OE 3HATH 1KTTB 2HWLB 2AH4X 1O3EA 3FZDA 1YYY1 1BTYA 3SJ9A 1TPPA 1V3XA 1P06A 1H1BA 1JRTA 1VITF 1O2OA 1G36A 5A0BA 1D4PB 1TMBH 4CHAC 2OUAA 3S69A 2ASUB 1C5VA 1C2DA 3PYHA 1C9TA 1Z8GA 2FOFA 1O3KA 1SGEE 2WYGA 1PQ5A 5EQRA 4ISNA 2G51A 6GCHF 3RC4A 1YPMH 2Y7ZA 3KQCA 1CA8B 3AAVA 1GHAG 1IQHA 1ELEE 1EZQA 3PMAB 1MTUA 4IS5A 3A80A 1C1WH 1GMDG 5DG6A 1GI7B 2LPRA 1FQ3A 1TGNA 4Q7YA 1UVSH 1BBRK 2A5KA 1SQOA 1ELGA 4NIVA 1QY6A 4NCYA 5DP5A 2FM2A 3BF6H 2H6MA 1FI8A 1ZHPA 3BV9B 3MTYA 1WU1A 2ANYA 1WCZA 1MKWK 1AQ7A 3P95A