2XCNA

Crystal structure of hcv ns3 protease with a boronate inhibitor
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
180
structure length
180
Chain Sequence
APITAYAQQTRGLLGCIITSLTGRDKNQVEGEVQIVSTATQTFLATCINGVCWTVYHGAGTRTIASPKGPVIQMYTNVDQDLVGWPAPQGSRSLTPCTCGSSDLYLVTRHADVIPVRRRGDSRGSLLSPRPISYLKGSSGGPLLCPAGHAVGLFRAAVCTRGVAKAVDFIPVENLETTMR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords NS3 PROTEASE
publication title Synthesis and Evaluation of Novel Alpha-Amino Cyclic Boronates as Inhibitors of Hcv Ns3 Protease.
pubmed doi rcsb
source organism Hepatitis c virus
total genus 43
structure length 180
sequence length 180
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02907 Peptidase_S29 Hepatitis C virus NS3 protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2xcnA02
2.40.10.120 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 2xcnA01
2VGCC 3K6ZA 1TPSA 2CHAC 5GJ4B 1MU8B 1C5XB 1GJAB 5L2YH 4X6NA 2G4UA 1GDQA 1HRTH 1ZRKA 1OP2A 3ZVGA 2XCFA 2ODPA 1UTLM 3GYMA 5GNDA 3RXTA 1HFDA 3EYDA 4WMEA 3ZVBA 2V3HH 1FLEE 1GG6C 1K1IA 1D4PB 3QGJA 2G52A 1BITA 3RXUA 4BTUB 4VGCB 1QBVH 1VJ9U 4ZXYH 2Z3EA 4NWLA 1C5TA 3GCOA 2C8XB 5C5OA 1J17T 2BD7A 3TJOA 3UNSA 1O32A 1EPTA 1O2YA 4Q2KA 1C5PA 1GHBG 1ANBA 2FEQH 1LKAA 2UUJB 3BSQA 4I8GA 1C2IA 3HK6B 2QY0B 1A61H 3DD2H 2QGRA 1SPJA 3FFGA 3NK8A 3ATMA 4HZHA 4JK5A 1O31A 1OPHB 5HMAA 2ZEBA 3EE0B 1RGQA 1NFWA 1YCPK 3P17H 1GI1A 2A0QB 5SGAE 3AK5A 4DVAU 3V0XA 2Z9GA 1B7XB 5EXLA 1ZHPA 5FPYA 5EXNA 1SGFG 3D65E 2ZHEH 2YNBA 4MQAA 5A8XA 4FUJA 4FVBA 2RA3A 3O8RA 2FYQA 1P2QA 1AMHA 2BDHA 2VJ1A 1GJ4H 2H5CA 1HAVA 1QJ1B 3UQOA 1G36A 1W2KH 2VIPA 2OC7A 3AAUA 1L2EA 1O2HA 3OSYA 3MYWA 3SUGA 1UVSH 5IDKA 1TNHA 1E0FD 1NRRH 1C1MA 1K21H 2ALVA 1GJ5H 1VZQH 2A5AA 2Z7FE 2O8LA 2UWPA 3K2UA 4ABEA 4NA9H 1GHBF 1SGQE 3RMLH 3RLYH 1ELTA 1GMCG 2ZGBH 1QB1A 3LJOA 1SQAA 1S85A 1A7SA 3MH6A 4J1YA 2BLWA 4Y8XA 2XCNA 4B6FA 4INLA 1SLVB 2ZFQH 1NO9H 1MH0A 2VVVA 3T25A 1G9IE 2FTMA 3MU5A 2XYAA 3G01A 4WF8A 3SBKA 1N1LA 3RXBA 5A0CA 8KME2 2R9PA 3VB6A 3BTQE 3SNCA 1ETRH 2YOLA 1KXFA 1KLIH 2OQUA 2QV1A 5DP5A 5JBTA 3HKIB 1SLUB 1HV7A 3RXEA 4XBCA 1AWFH 2ZDNA 1V2LT 3PMHB 1O2OA 2PW8H 1BBRH 5CMXH 1GJ6A 3B8JA 8GCHF 2D2DA 3BF6H 3LDXH 3DUXH 3OYPA 1FV9A 2AMQA 5DG6A 4B74A 5HM9A 2G00A 3E90B 4ZAEA 3LGYA 1GVKB 2ZFSA 3PV5A 1BRCE 2BDBA 1GBCA 1OX1A 3PWBA 4U2WA 1EATA 4AFZA 1Y3VA 3ZYDA 3KQEA 1TNJA 1GMCF 1J9CH 1W13U 1QL7A 4KKDA 2G5NA 3GYLB 3I78A 1EP6A 1DSTA 4NCYA 1MTWA 5DO4H 6GCHG 2H9TH 1O3LA 3GOVB 3T62A 3GCHC 3RM0H 1NTPA 4DGJA 1C2JA 4K1TA 2Y5HA 1AKSA 3T27A 1RRKA 3ZZCA 5FAHA 4CRBA 2BXUH 4MNXA 2WPLS 1Y3YA 3GCTG 1EZUC 4ZHMU 2ZDVH 1MKWK 2XRCA 1O30A 1CHGA 1PQ5A 3HGNA 3A86A 4IW4E 3SN8A 4QT8C 1HCGA 4CH8B 1NY22 3GDUA 3SJOA 1IHSH 2JKHA 1C2LA 3LGWA 3CP7A 3SNBA 1ARCA 1GJ9B 3E0PB 1Q31A 1TPAE 2CJIA 1KXEA 1TGTA 1O3PB 2AGGX 2OCVB 2IN2A 4ZKRU 1OYQA 1W10U 5DKMA 2FOBA 1ZMNA 1GHWH 1SB1H 2Z3DA 1C1OA 1UHBA 2RDLA 1MZAA 1BMLA 1BIOA 2WPHS 1KDQB 2XC0A 2OINA 1O5EH 4ISOA 4K1SA 3SYJA 6GCHF 1AKSB 4A1VA 1QA0A 1GCTC 3BTDE 1FMGA 1H1BA 1KSNA 3KL6A 4X1PU 1JOUB 2BM2A 1MKXH 3M3SA 5BRRE 2VIVA 1Z6EA 2R3UA 3ENSB 4B76A 2ANYA 5C67A 4KTSA 1NN6A 2FI4E 1BB0B 1LVMA 1UTJA 1SGRE 5F8ZA 3VB5A 1BTWA 1PQ7A 1P06A 1BMNH 3QWCH 3SUDA 2XBYA 3SJKA 2ZGCA 3EDXB 1ELFA 1S6HA 3RU4D 2PTCE 3M5NA 2F9UA 4JYTA 1W14U 4ISLA 2AMDA 1AN1E 1O34A 4AORA 1OP0A 1TBRH 3UTUH 3A83A 1DM4B 2AYWA 1GBEA 1A3EH 1EZSC 3AAVA 5B6OA 1TRMA 1FZZA 2A45B 1HUTH 4XDEA 4BAMB 5DP6A 1TX7A 1KLJH 3E8LA 2ZFFH 4I8HA 1V2TT 2CF8H 1TQ0B 2EI7A 3RMOH 4O97A 3TK9A 2W3KA 4D76A 1IQFA 2BB4A 2NU3E 2HRVA 3MH7A 3RXDA 2A5IA 1SSXA 4UE7H 1LHDH 1Y3UA 1HAHH 5JB9S 1W12U 2O8WA 4AB9A 5F8TA 4INHA 3DFJA 5EQQA 3SORA 2UWOA 2GT7A 1W7XH 4FUDA 1IHTH 1ZTJA 2JETB 3FP6E 1L1NA 9ESTA 2XBXA 2F9VA 2OP9A 4RI0A 1TA2A 5JBCS 1EJMA 1F7ZA 1C5WB 1CSOE 1UTPA 2VIQA 3VGCB 1O2GH 1JIRA 3SGQE 1D6WA 1SLWB 1K9OE 3EA9A 2VWOA 3LONA 1QL9A 1AUJA 1IOEA 3U8RH 2NU1E 3NXPA 2EA3A 2A2QH 2IPHA 2XBVA 1WU1A 2PGBB 3W95A 7ESTE 2FX4A 3A85A 3T26A 1BBRK 2GD4B 2FMJA 2TGPZ 2ZIQH 3QGNB 2ZDMA 2ZKSA 3ATKA 1UVUH 1P04A 1BTHH 1FDPA 4OGYA 2Z6BD 1AB9B 5LH8A 4NFFA 1SGPE 1GGDC 1SBWA 4E05H 3BG8A 2Q1JA 2JH5D 2GP9B 2PWXA 3K6YA 1W7GH 3S69A 2ILNA 1TMUH 1DANH 1H9LB 3MO6A 3W94A 2F83A 1AVGH 2A4OA 2VWNA 3SHAH 2WPIS 4X1SU 1WOFA 4B71A 3PV2A 1CU1A 3QLPH 1BA8B 2VH6A 1IQKA 1O3BA 1AE8H 2ZU2A 3F9HA 4O3TA 3NZIA 2AGEX 1GGDB 5I25A 4IN1A 3UWJH 5EPNA 3A88A 4LXBH 2R2WU 4H42U 5CE1A 3SV2H 3P92A 1O2QA 2XTTB 1V2UT 3UNRA 4X2YA 1P2KA 2ZNKH 3TNTA 3TH4H 1QL8A 1O2WA 1AFQC 2ZA5A 1QTFA 1EZXC 2HALA 4UDWH 2KAIA 1CO7E 1P11E 1B0FA 2TGDA 3QO6A 5C20A 1QRXA 4ZKOU 1FY1A 4ABAA 1SGCA 1UJ1A 1P9UA 1FXYA 2TPIZ 1OYTH 2BLOA 3O8DA 2BD5A 4E7RG 2ZF0H 1C5ZB 2HOBA 3SJ9A 1O3CA 4CBOA 4X1QU 3LT3A 4NA7A 3M5MA 2LNCA 2F9NA 3QN7A 1C5QA 1GI3A 2BVXH 3ZZ8A 4I31A 5EW2H 1O2ZA 3MH4A 2F91A 2Y7XA 1EASA 1GJ7B 1MKXK 3URCA 1QRWA 1MD8A 1S84A 4TY7A 5DJ7A 5JPMH 1HXEH 5E2PA 3LKWA 1VITG 1AZZA 3E3TA 1GBBA 1YPEH 5LPFA 3ODFA 4NIVA 4ZHAA 3SGAE 1J15A 5EW1H 1NFXA 4YT7H 5DP9A 1NZQH 2GTBA 2ZCHP 1HAXB 4K60A 4I33A 2Z9KA 1LQEA 2GT8A 2Y80A 3EGKH 1JBUH 4ZUHA 4AYVB 2AERH 3B23B 1BRUP 2C8ZB 3BTME 3ZZ4A 1BZXE 1F0SA 2WUBA 4UFFH 1BRBE 4ZKSU 3ZZ5A 1QHRB 3A82A 1HAIH 1E36B 2XBWA 2FI3E 3NPSA 1MCVA 3RXKA 1EJNA 3F9GA 3O8BA 4K5ZA 5HM2A 2XXLA 4GHTA 3BEUA 3UY9A 1A0JA 1UK3A 3DT0H 2YNAA 1H9IE 1K28D 2QIQA 2ZFPH 2BDAA 3LGIA 4XSKU 1EAXA 1C2HA 2AMPA 1KXBA 1E37B 3MOCA 4KELA 5F6MA 2SGEE 3MU0A 1M9UA 2V0BA 4AFUA 1SGNE 1LPGB 4LK4A 1CT0E 3IG6B 1ZMLA 4A5TS 5HGGA 2M5TA 4Y11E 1ESTA 4CR5A 3PB1E 1WBGB 2NU4E 2PUXB 4AN7A 1GCDA 3HK3B 1A5IA 2A4RA 4FU8A 5FHTA 4GCHG 4WJG2 4FU9A 4IMZA 1SOZA 2GX4A 3ZYEA 1DWEH 2H9EH 1G32B 5E0GA 4Y79A 2P3UB 1AFEH 1S82A 3OTJE 2GCHG 4GVUA 3GY3A 4Z6AH 1ABJH 4AZ2B 1T8OA 2STBE 3V12A 1QB6A 1FN8A 1DVAH 1N8OB 2BY7X 5EODA 3BG4C 4NG9H 4AYYB 3PMAB 2B9LA 2TRMA 1ZLRA 5GCHG 1ELCA 1MAXA 3F1SB 1LDTT 1H8DH 4YT6H 1FPCH 4CRCA 2TIOA 2H5DA 1BBRE 1J16A 2VVUA 3U8TH 3JZ2B 3SV8A 2FOAA 1P09A 2WV4A 2WPJS 2Z9JA 4MNYA 2FS9A 5GXPA 1VJAU 1YC0A 1V2OT 1ZYOA 2K1QA 1L4ZA 1W0YH 1PPGE 4X2WA 3D49H 4ABHA 3SO3A 3VB7A 1SQOA 2ZFRH 4JCNA 4GCHF 2VWMA 3M7QA 2FIRH 2ZHWH 2PV9B 4UEHH 4KTCA 1O2XA 3GICB 1AQ7A 2ZU5A 4Y7BA 2UUFB 2QAAA 2GCHF 4Q7XA 1K1LA 1LKBA 5T1VA 2A7CA 5FX5A 2Y81A 3TK6A 1CGHA 3AVZA 1IAUA 2P8OB 3LC3A 1TGCA 1GI8B 2SFAA 4A6LA 2XC5A 3F9FA 4ESTE 1DPOA 1ZOMA 4OM9A 1ELDE 3RMMH 2BOHB 5GCHF 3RU4T 4B2BA 1P0SH 3MFJA 4X2VA 2PGQB 4DURA 3MO3A 2O8MA 1C2MA 1F5KU 1FQ3A 1KTTB 2F9BH 1YGCH 1IQJA 1ANEA 3T5FH 2ZDAH 3GY5A 1KTSB 3D62A 4CRFA 1SOTA 3RXCA 3O8CA 3T29A 5EPYA 1PPCE 1DFPA 2A4QA 2PSYA 5C3NA 2IJD1 5B6LA 1Z71A 1P05A 2FP7B 2OUAA 2QYIA 4ZXXH 1C5UA 1LVOA 1H9HE 1FJSA 4BANB 3GY6A 4I32A 1DX5M 3SI3H 1K1PA 4K1EA 6ESTA 6CHAC 3NWUA 1TPPA 1WQVH 1WTGH 2ZHFH 1G2MA 5BPEA 1O3GA 1C5OH 4FUFA 4GUXA 2CGAA 2B5TB 1C5YB 1ANCA 3GY4A 1OWIA 5EQRA 2QF3A 9LPRA 1JXPA 1G30B 2FOCA 3N7OA 1GVLA 2GV6A 3K65B 3K9XB 3UFAA 3EA7A 1TAWA 2AEIH 3QDZB 4GLYA 4DOQA 4MTBA 1SG8B 2A4GA 1QR3E 5JDUB 2ZPQA 1C1TA 3GISB 8GCHG 1EOJA 1EPTB 1B0EA 1QURH 1A5GH 4JK6A 1GPZA 5FBEA 6CHAB 1ANDA 4NA8A 3SHCH 3KQDA 1Y3WA 1GI0A 4NIXA 2J95A 3RXOA 2FM2A 1TOCB 4GPGA 2WV5A 1L1JA 1SHYA 2CXVA 1JMOH 2W3IA 1P8VC 3OX7U 1ZJKA 1IQHA 2FESH 2ZG0H 1DICA 3UWIA 1C5NH 2AIQA 2DE9A 1LHGH 2JH0D 3A7TA 2UUKB 3TH3H 3PO1C 1O2NA 1HAVB 2A5KA 1Y3XA 1T8MA 1VGCB 2C8YB 1GJCB 1MBQA 1BMMH 1NM6A 4R8TB 2PKSB 2RA0A 1NC6A 4ABBA 2PTNA 1AE5A 1LCYA 1SGFA 1D3TB 4RSPA 2XNIA 3RM2H 1C1PA 3QK1A 4AFQA 3R0FA 3ZZ9A 4FUCA 5ETXA 1LVBA 2HGTH 4X8TH 4BXWA 3SU6A 1GI6A 4YESB 1HJAC 4CH2B 3PO1B 2ZPRA 1ZGIA 2VIWA 1A0LA 1F0UA 2AFQB 1OWDA 4D7FA 3VPKA 3RC4A 2BDCA 2ZGXH 2VIOA 3I77A 1WV7H 1TX8A 2BZAA 2PKAA 3BTKE 1O3OA 3RXFA 2RCEA 1RS0A 2C93B 2BLQA 2WHXA 1AWHB 1S83A 1O3DA 1T4UH 1T4VH 1UCYH 1G3BA 4KTUA 3SNEA 2CMYA 5ESTE 5T6FA 1HJAB 1NU7B 3BN9A 4FUHA 4NZQA 1W11U 3F68H 2BQWB 4NGAH 1GDUA 3CS7A 4X8VH 5C1XA 1AD8H 3KQCA 1O3HA 3U98H 2GDEH 1OSSA 4AOQA 4I8LA 1GHVH 1TMBH 1P3CA 2G81E 3TVJB 1YYY1 4UFDH 1TX6A 3KEEA 1AZ8A 2BHGA 1JWTA 1V2PT 3P6ZB 2OK5A 5A8YA 1O2MA 1C1RA 3Q3YA 2FLBH 2VBCA 3SOSA 2C8WB 1JIMA 1QNJA 1MQ6A 1SGTA 1TA6A 1DE7H 1TRYA 3L6PA 1NRNH 1C5SA 4XE4A 4Q7YA 4ZMAH 1C5MD 2ZP0H 2NWNA 1QGFA 2A32A 4DIIH 5E0JA 1MTNC 1FY8E 1C4Y2 2Z94A 5T6GA 1K1NA 4YOJA 1KXDA 2QXIA 1NS3A 3PWCA 1XM1A 3NKKA 4ZHLU 1NFYA 1D3PB 1F92A 1O5AB 2AS9A 5H4IB 2D8WA 4RKOB 4YM9A 3TJUA 2VVCA 1DOJA 1FNIA 1EB1H 1O33A 1A2CH 1Q3XA 4WXVA 1W8BH 5F8XA 3RU4E 1ELAA 5G4BA 5FXLA 1QQUA 3FVFB 5TCCA 3I29A 3TNSA 1GI2A 3ZVAA 1NPMA 3FZDA 2XW9A 4WH8A 4KP0A 1Z7KA 1GI5A 4JZDH 1MTNB 1CBWB 4X8SH 3IWMA 2SGAA 3LGVA 2G8TA 3S9CA 7GCHG 1TNKA 2JETC 3RUOA 1UHBB 2WINI 2VWLA 2BY8X 3SU0A 1QJ7B 1PPBH 1AUTC 1A5HA 1GL1A 3RMNH 1TGBA 3VGCC 4TWYA 1XMNB 1YPKH 3ZZ3A 3SU3A 1DS2E 1GI9B 3LH3A 1S0RA 3PMBB 3MU8A 5T3HA 3SUEA 4RKJB 1GBIA 1CE5A 2AH4X 1LPKB 3GY8A 3BTHE 1S0QA 2ZHDA 3A7VA 1AB9C 1XUIA 5EXMA 2SGDE 1GHZA 5C1UA 3ITIA 3PMJA 3S7KB 2VU8E 3RXSA 1X7AC 5ABWA 2ZFTA 2ODYB 3FZZA 1FPHH 1TOMH 4FVDA 1O3FA 1KLTA 4H6SB 5A09A 2XWBI 3LH1A 2WPKS 5GWZA 1TGSZ 1SGYE 1C9TA 2P3TB 4XBBA 2F9OA 1V2JT 4YLQH 2XC4A 2RG3A 7GCHF 1MTSA 4O9VA 4Y0ZE 2O9QA 2WUCA 4OS1A 4A1TA 3VB3A 4ISNA 1N6YA 4TYDA 3U9AH 1QFKH 4BXSA 1RTKA 2ZTXA 3A89A 3NUMA 4D8NA 1O2JA 3QZRA 4X6PA 3HGPA 1PPFE 4WMFA 3ZVDA 1XXFA 5K7RA 4X2XA 1HAGE 4GHQA 2Q6DA 1PPEE 1F5RA 4K69A 2GGVB 2FS8A 5CHAB 1O38A 1L1GA 3E6PH 1J8AA 1TONA 4FUEA 2FXRA 3LIWA 4FUBA 1A3BH 3NCLA 4B6EA 3SU4A 1P12E 3TGIE 2GMTC 2OBOA 1CA8B 1UCYK 1FUJA 1WAYB 1G3DA 2EI6A 3KGPA 4WXIA 1EAUA 1YLDA 3PLBA 2OC8A 5DP3A 3U8OH 2CV3A 1NRSH 1HDTH 4ABFA 2TGTA 2OLGA 4X1RU 2WYJA 4Y8YA 1BDAA 3SUFA 1CT4E 4BTTB 3V13A 1THPB 2BY9X 5JBBS 5EG4A 1C5LH 4ZKNU 1BTZA 1LHEH 3ELAH 3Q3XA 1C2FA 2Y5FA 3A84A 3RXVA 2O8UA 1GHXH 1XX9A 5J4SA 1O2TA 1RTLA 1WTHD 2GMTB 2BY5X 4CHAB 4Q7ZA 2ZTZA 5LPRA 4ZROA 1BHXF 1QB9A 5K0HA 3SQHE 1RTFB 2C4FH 2Z9LA 5HYOA 1XUGA 1K1OA 4CRDA 1V2KT 4ABJA 3GDVA 4X6OA 2I6SA 2O8TA 2FYRA 3CS0A 1SFQB 3KCGH 4J2YB 3VB4A 2NU0E 4AGKA 1JRSA 4LZ4B 1T8LA 1ZTKA 1O5BB 5IYTA 5AHGH 1O5GH 1ZTLA 1QRZA 3HATH 1MBMA 2OXSA 3P95A 1EP5A 1BTXA 2Q6FA 1YBWA 3SZNA 4AG2A 1MTUA 2BX4A 4OS5A 4B1TA 3H5CB 2QC2A 1IQGA 1AVXA 2HNTE 1LPZB 2W7UA 2TGAA 4WWYA 4NSYA 4YZUA 6LPRA 2ZU3A 2G4TA 2GV7A 3SU5A 5E2OA 5DGJA 1BTUA 1PYTD 1AGJA 1ID5H 2J34A 1MUEB 4MG3A 1P02A 2SGPE 5FPTA 4WVPE 5L2ZH 3STIA 3EA8A 1RJXB 4WH6A 3ZZ6A 3ATWA 4IBLH 4M7GA 2KAIB 1TE0A 3CENA 3P8OA 3QX5H 2GZ8A 2GVFA 1ABIH 4ISIH 3VFEA 4XBDA 2VINA 1GBFA 1O37A 1ACBE 1TLDA 3HPTB 2J38A 3LJJA 1YCPM 1CGIE 1TBQH 7KMEH 1V2VT 4ASHA 2LPRA 1BUIA 2OQ5A 1O2SA 2PFEA 2BTCE 2BYAX 1XVMA 4UFEH 1AY6H 3BTEE 4Y6DA 3F9EA 5A0BA 1V2QT 2FX6A 1SQTA 1GBKA 1Z8GA 3SQEE 3U1JB 3JZ1B 1L4DA 2HNTF 3A8CA 1N8OC 4K8BA 1T7CA 3KF2A 1XUKA 3M7UA 1AHTH 3AW1A 3ZVEA 1OXGA 1SLXB 1G2LA 1ELGA 4IS5A 2SNVA 2HNTC 1P2JA 1C1NA 1VCPA 2SNWA 1YPHC 1F0RA 3VXFH 1E38B 1CHOG 3U69H 1GJDB 1OKXA 1S81A 1LMWB 3RXJA 2FI5E 4F49A 1QCPA 3PYHA 4I7YH 2QN5T 1YPGH 1O3MA 2V6NA 3M5OA 5EGMA 2FOMB 1CA0B 1VCWA 1UTOA 5E0HA 2OC1A 4O3UA 3LGUA 1O3IA 3E0NB 3A7XA 3MH5A 3QZQA 2BQ6B 1FY4A 2F4LA 1EUFA 5EQSA 1CQQA 3GDSA 4B75A 2PUQH 1OS8A 4FU7A 1DWDH 1BTPA 5FBIA 1XXDA 1TNLA 2ANMH 1XKAC 2BQ7B 2P8OC 4M9FA 4DCDA 4IMQA 5E8EH 4X0WU 1TIOA 4FUGA 2J94A 2Z9IA 1THRH 4TY6A 3S9AA 3A7WA 4NIWA 3H09A 3ATLA 4BOHA 4I8KA 3QTOH 3GY7A 4K2YA 3Q77A 1CHOF 3BIUH 1OWEA 3STJA 3LGTA 1O2RA 1V2ST 3TLOA 1G37A 2OTVA 1UCYE 4D7GA 4HTCH 1L0ZA 3EQ0H 1QA7A 3SZEA 2XWAA 2G5VA 2P16A 3MU1A 1WSSH 3DA9B 3P8GA 3RC5A 2ZTYA 3RXRA 1Z6JH 1GVZA 1Y59T 3R3GB 2R3YA 2FOFA 3M37A 1LTOA 3TJVA 1C1QA 3V3MA 1P03A 4MPVA 1SMFE 2Y5GA 5L30H 1HLTH 1DITH 4X1NU 5FX6A 3ODDA 5A0AE 1D6RA 1DUAA 2FLRH 1MZDA 4U30A 2FOHA 1RFNA 2QA9E 3UIRA 1ZSKA 2V35A 1HBTH 1K1JA 3E1XB 1HAOH 2ASUB 1EPTC 1Z8RA 2VGCB 1GBTA 1O2VA 4NIYA 1EQ9A 1SVPA 2CHAB 5C1YA 1VITH 3SV7A 4OGXA 4OS2A 1S5SA 1D3DB 2P95A 2HWLB 1C5VA 1MQ5A 1NRPH 1TGNA 1INCA 1LHCH 2HPQH 4H6TA 4GSOA 5EOKA 1Y5AT 3UR9A 4A7IB 3GY2A 1K22H 5C2ZA 2AGIX 4ZH8A 1ESBA 2GZ9A 2P94A 3M3VA 1GG6B 4DIHH 3TITA 1WQSA 5DP8A 3UUZA 1HGTH 3MNXA 4CR9A 1SGIB 2ZU1A 4F4OC 5C5NA 1MMJN 2ZGHA 4MNVA 4LOYH 2ZGJA 3A8BA 2PR3A 1VGCC 4X6MA 1F0TA 1BJUA 1YPLH 4JZ1A 2FPZA 2I6QA 4LZ1H 5J4QA 1F5LA 2PKSC 5FCRA 1Y8TA 5FPSA 3P8FA 1MU6B 3L33A 2V3OH 5T6DA 3A7YA 1TALA 3RXPA 1S6FA 1EJAA 1TFXA 4BAHB 2THFB 3D23A 1DWCH 1DXPA 1KYNA 1QBNA 1O0DH 1FY3A 2PLXA 3TGJE 3KHVA 1EAWA 4Y0YE 1HPGA 1GI7B 2BY6X 1GBDA 1BCUH 1Y5UT 1O5FH 5GDSH 2FZZA 1E35B 3PTNA 1QIXB 1NRQH 1HXFH 1ZSJA 4ABGA 1KIGH 4D9QA 2GCTC 3ZV8A 2ZPSA 1HNEE 4YTAA 2BD3A 2ZZUH 2ANWA 1JRTA 4HGCA 4MNWA 4IC6A 1ZHMA 1UTNA 4INKA 1OWHA 1O2PA 2QXHA 1ZRBA 3P70B 3C1KA 1ORFA 3KQBA 2GKVE 3BTWE 1HAZB 1TBZH 2Q6GA 1F2SE 3FANA 3M3TA 4U32A 3VEQB 3SV6A 3M5LA 3F6UH 5JB8S 2A7HA 2C3SA 2GCTB 4DT7B 3SU2A 2VH0A 4MVNA 1B5GH 2QF0A 1UVPA 2FOEA 5DK1A 4Y7AA 5AF9H 1SC8U 4B2AA 3KN2A 4JZEH 4AB8A 4Z0KA 4MPXA 2H9HA 1BMAA 1YPMH 4YLUA 3A8DA 2STAE 2D26C 3ESTA 3L3TA 3AW0A 4UFGH 2OD3B 2ZECA 1QBOA 1WUNH 5EU8A 3HKJB 3MWIU 2BXTH 3V7TA 2A2XH 1TWXB 1CVWH 1RIWC 4MPWA 2PHBA 3ZVFA 2BLVA 3BV9B 2GZ7A 3TIUA 4Q80A 1FIWA 3SJ8A 2G55A 1Q2WA 1KDQA 1BT7A 1LVYA 1V2RT 1FN6A 1P9SA 4JZFH 2A1DB 3VXEH 1WXRA 2WV9A 3ZV9A 1T31A 1Z1IA 4HFPB 1O5DH 1PFXC 3DFLA 1HIAA 4ISHH 1XUHA 2FTLE 1CT2E 2ZCKP 3MMGA 4R0IA 2PSXA 4CBNA 1D3QB 5FCKA 1ZPCA 3ATIA 3U1IB 1IQNA 3BTTE 1ARBA 4TWWA 3MNBA 1C1SA 1DY8A 1YPJH 2PKAB 4JZIA 1QY6A 1EXFA 4I8JA 1RIWB 1Z8IB 2FWWA 1FONA 1IQEA 3H7OA 5AFYH 1C1VH 4E7NA 1TB6H 4WMDA 1O39A 3GCHB 1NROH 3RP2A 3PTBA 2H1UA 4TPYA 2ZDKA 2ODQA 3AASA 3Q3KA 3TGKE 4BAQB 8ESTE 1CBWC 1KXCA 1O3KA 3A81A 1C2DA 2CF9H 5JBAS 2DUCA 1OWKA 1ZGVA 5A2MH 5JYIA 1HJ8A 3WY8A 1HB0B 1SGEE 4B2CA 1C2GA 4NZLA 3TJNA 3A7ZA 2ZQ1A 3BTFE 1C9PA 2B0FA 1FAKH 1HIAB 1C5RA 1ELBA 2ULLA 2UUYA 3RXGA 3P8NA 1O35A 2BVRH 3RXLA 4BAOB 1MTVA 3KNXA 2WZQA 3PM3A 4UONA 4DG4A 1H4WA 2ZCLP 2HLCA 3GCTF 1IQLA 1E34B 2G51A 4RN6A 1PPHE 3T2NA 8LPRA 1P57B 1UMAH 2P93A 1O2KA 2FO9A 3M35A 2FODA 4ABDA 2HVXA 2BDGA 3OTPA 4MLFB 4BNRA 2BD2A 5PTPA 4HI3A 2J2UA 1GCTB 3URDA 4CRAA 3UOPA 4A1XA 1QQ4A 3MO9A 4Y8ZA 3PLPA 1LQDB 1XVOA 3ZZBA 4U01A 4CRGA 1V2WT 1UVTH 4NSVA 2BVSH 4JYVH 2SGFE 4H4FA 4Y76A 1EX3A 2BD8A 4TPIZ 1IQIA 4A92A 1ZMJA 1G3CA 2BX3A 4AX9H 4DJZB 3TU7H 1EZQA 2ESTE 4JYUH 1GBMA 4YO9A 5I46H 1C4U2 1OOKB 1AVWA 1TPOA 1AO5A 2W5EA 5CHAC 1MD7A 1BRAA 3Q00A 1SL3A 1A4WH 5DP7A 1EOLA 4KGAA 2ALPA 4K8YA 1G3EA 1UVOA 1TRNA 4IC5A 1U6QA 3S7HB 1OP8A 3TK5A 3IITA 1ELVA 4K3JA 1O3JA 4JMYA 4AFSA 2BMGB 2ZQ2A 3M36A 1YF4A 4FXGH 1UTKA 3TPIZ 1NESE 4THNH 1GMHG 4ABIA 1FY5A 1UK4A 3RXQA 3UOUA 1CGJE 1WYKA 1P3EA 1ESAA 1EB2A 4O03A 1ZJDA 1K2I1 2TBSA 1ZPBA 3OU0A 1PQAA 1VR1H 1ZZZA 1O3NA 2JH6D 2R0LA 2FOGA 3RC6A 1A46H 1HJ9A 1THSH 1SFIA 1HAYB 2HPPH 4MPUA 3PLKA 1GI4A 4AG1A 1NT1A 2AIPA 4CHAC 1AI8H 1GBAA 1UO6A 1P01A 3MNCA 3QTVH 2BZ6H 1GJ8B 2VNTA 2IOTA 1TNIA 4XFQA 1DY9A 1YLCA 4IGDA 2QCYA 1DXWA 1P2OA 2B7DH 1GWAA 4YOIA 2H2ZA 3MU4A 2GDDA 1XKBC 2FDAA 3OY6U 1D9IA 2ZHQH 1SR5C 5TCAA 2DE8A 1T8NA 1DLEA 3RDZA 1C1WH 1V6DA 4SGAE 3LC5A 2Y6TA 1YP9A 3BEIB 3M61U 3RXMA 1BTYA 2ZO3H 1DT2A 1WCZA 2A7JA 1LHFH 3LPRA 1TMTH 3FP8E 3QUMP 5GPIB 1GMHF 3MTYA 3SV9A 1ZHRA 1P10A 2OBQA 2WYGA 3BTGE 3ZZDA 3PV4A 1TABE 1EAIA 2J4IA 2P3FH 3MNSA 4Y71A 2B8OH 1V2NT 1N6XA 3MHWU 1IQMA 2EC9H 1GJBB 5GIBA 2Y7ZA 4FUIA 2EI8A 1FI8A 3BEFB 4CREA 3RXAA 2J92A 2ZI2H 1O3EA 1GDNA 1RD3B 3ZZAA 1GBJA 3A80A 1YPHE 4OS6A 2WPMS 3E16B 5AVDA 3ZVCA 1MAYA 1SI5H 5HXFA 5F03A 1O36A 2BOKA 5L6NH 2CN0H 1XUJA 1GL0E 1GHAG 3SNAA 4BAKB 1KY9A 2VIDA 1YKTA 2ZC9H 2ZDLA 1Y5BT 1AFQB 1YCPH 3SJIA 3UQVA 2BDYA 7LPRA 3PROA 1C4V2 1O2UA 1H8IH 1BJVA 3EAJA 1C2EA 1QJ6B 1W3CA 3M7TA 4Y10E 1DWBH 3FAOA 1UTQA 2NU2E 4XOJA 4X8UH 2Z3CA 1W0ZU 5AFZH 2BD9A 3Q76A 3SNDA 2D1JA 2C90B 2SGQE 4NFEA 1BHXB 1TNGA 2P59A 1DDJA 1GMDG 2BD4A 1RXPA 3A87A 4UD9H 3LU9B 2QXJA 2Y82A 3SGBE 1CA0C 2BDIA 3TH2H 2F3CE 2ZU4A 5TJXA 3T28A 3ZZ7A 2ANKH 3UNQA 3BIVH 1C1UH 1O5CB 3A8AA 1AU8A 2OC0A 5DPAA 1GBHA 1P2NA 3E91A 1GHAF 1A0HB 2QXGA 2IJOB 1C2KA 1NU9A 2VB0A 1XUFA 1LO6A 1OWJA 1PYTC 1DLKB 1Z1JA 2R2MB 2ZWLH 3RXIA 4AGJA 3UR6A 3MI4A 1BOQA 4DY7B 3C27B 2EEKA 3SI4H 1T32A 1VCQA 4D9RA 2A31A 1SGDE 1VITF 5LGOA 3B9FH 1O2LA 3RLWH 2W26A 4DW2U 3S0NA 1PJPA 1ETSH 1ETTH 1GBLA 1GHYH 4E06H 1K1MA 1BQYA 1DUEA 3LOXA 4PROA 3UPEA 2F9PA 1GMDF 1O2IA 1PQ8A 3KIDU 1P2MA 4BTIB 1NFUA 1ZSLA 1SHHB 3DHKH 1V3XA 4GAWA 1HAPH 2J9NA 1EKBB 1J14A 1ZR0A 1FAXA 1YM0A 4IN2A 3H7TA 5A8ZA 4B73A 2UWLA 1KXAA 3SU1A 1DSUA 1Z8JB 5DP4A 5ESBA 1P2IA 1MCTA 2H6MA 4WY3A 3RXHA 1O3AA 1TYNA 1UTMA 3GCNA 4OS7A 2W7SA 1A1RA 3OY5U 4SGBE 1PPZA 1TQ7B 5LPEA 1UK2A 4NWKA 4OS4A 4YOGA 1FIZA 1ELEE 3BG4B 2R0KA 3UREA 1HYLA 1V2MT 4MDSA 3S9BA 4VGCC 1MKWH 3FP7E 1AIXH 3SW2B 1ZPZA
chains in the Genus database with same CATH superfamily
2VGCC 3K6ZA 1TPSA 2CHAC 5GJ4B 1MU8B 1C5XB 1GJAB 5L2YH 3N99A 4X6NA 2G4UA 1GDQA 1HRTH 1ZRKA 1OP2A 3ZVGA 2XCFA 2ODPA 1UTLM 3GYMA 5GNDA 1E1RD 3RXTA 1HFDA 3EYDA 4WMEA 3ZVBA 2V3HH 1FLEE 1GG6C 1K1IA 1D4PB 3QGJA 2G52A 1BITA 3RXUA 4BTUB 4VGCB 1QBVH 1VJ9U 4ZXYH 2Z3EA 4NWLA 1C5TA 3GCOA 2C8XB 5C5OA 1J17T 2BD7A 3TJOA 3UNSA 1O32A 1EPTA 1O2YA 4Q2KA 1C5PA 1GHBG 1ANBA 2FEQH 1LKAA 2UUJB 3BSQA 4I8GA 1C2IA 3HK6B 2QY0B 1A61H 3DD2H 2QGRA 1SPJA 3FFGA 3NK8A 3ATMA 4HZHA 4JK5A 1O31A 1OPHB 3OAAD 2ZEBA 5HMAA 3EE0B 1RGQA 1NFWA 1YCPK 3P17H 1GI1A 2A0QB 5SGAE 3AK5A 4DVAU 3V0XA 2Z9GA 1B7XB 5EXLA 1ZHPA 5FPYA 5EXNA 1SGFG 3D65E 2ZHEH 2YNBA 4MQAA 5A8XA 2EY4C 4FUJA 4FVBA 3NRLA 2RA3A 3O8RA 2FYQA 1P2QA 1AMHA 2BDHA 2VJ1A 1GJ4H 2H5CA 1HAVA 1QJ1B 3UQOA 3W1EA 1G36A 1W2KH 2VIPA 2OC7A 3AAUA 4TT3D 1L2EA 1O2HA 3OSYA 3MYWA 3SUGA 1UVSH 5IDKA 1TNHA 1E0FD 1NRRH 1C1MA 1K21H 2ALVA 1GJ5H 1VZQH 2A5AA 2Z7FE 2O8LA 2UWPA 3K2UA 4ABEA 4NA9H 1GHBF 1SGQE 3RMLH 3RLYH 1ELTA 1GMCG 2ZGBH 1QB1A 3LJOA 3MQKC 1SQAA 1S85A 1A7SA 3MH6A 4J1YA 2BLWA 4Y8XA 2XCNA 4B6FA 4INLA 1SLVB 2ZFQH 1NO9H 1MH0A 2VVVA 3T25A 1G9IE 2FTMA 3MU5A 2XYAA 3G01A 4WF8A 3SBKA 1N1LA 3RXBA 5A0CA 8KME2 2R9PA 3VB6A 3BTQE 3SNCA 1ETRH 2YOLA 1KXFA 1KLIH 2OQUA 2QV1A 5DP5A 5JBTA 3HKIB 1SLUB 1HV7A 3RXEA 4XBCA 1AWFH 3U28C 2ZDNA 1V2LT 3PMHB 1O2OA 2PW8H 1BBRH 1S6LA 5CMXH 1GJ6A 3B8JA 8GCHF 2D2DA 3BF6H 3LDXH 3DUXH 3OYPA 1FV9A 2AMQA 5DG6A 2HVYB 4B74A 5HM9A 2G00A 3F0PA 3E90B 4ZAEA 3LGYA 1GVKB 2ZFSA 3PV5A 1BRCE 2BDBA 1GBCA 1OX1A 3PWBA 4U2WA 1EATA 1QZ8A 4AFZA 2RFKC 1Y3VA 3ZYDA 3KQEA 1TNJA 1GMCF 1J9CH 1W13U 3KQ5A 1QL7A 4KKDA 2G5NA 3GYLB 3I78A 1EP6A 1DSTA 4NCYA 1MTWA 5DO4H 6GCHG 2H9TH 4XD7D 1O3LA 3GOVB 3T62A 3GCHC 3RM0H 1NTPA 4DGJA 1C2JA 4K1TA 2Y5HA 1AKSA 3T27A 1RRKA 3ZZCA 5FAHA 4CRBA 2BXUH 4MNXA 2WPLS 1Y3YA 3GCTG 1EZUC 4ZHMU 2ZDVH 1E79D 1MKWK 2XRCA 1O30A 1CHGA 1PQ5A 2QF5A 3HGNA 3A86A 4IW4E 3SN8A 4QT8C 1HCGA 5HIZA 4CH8B 1NY22 3GDUA 3SJOA 1IHSH 2JKHA 1C2LA 3LGWA 3CP7A 3SNBA 1ARCA 1GJ9B 3E0PB 1Q31A 1TPAE 2CJIA 1KXEA 1TGTA 1O3PB 2JDID 2AGGX 2OCVB 2IN2A 3FOAA 3OE7D 4ZKRU 1OYQA 2J98A 3FN8A 1W10U 5DKMA 2FOBA 1ZMNA 1GHWH 1SB1H 2Z3DA 1C1OA 1UHBA 2RDLA 1MZAA 1BMLA 1BIOA 2WPHS 1KDQB 2XC0A 2OINA 1O5EH 4ISOA 4K1SA 3SYJA 6GCHF 1AKSB 4RT0A 4A1VA 1QA0A 1GCTC 3BTDE 1FMGA 1H1BA 1KSNA 3KL6A 4X1PU 1JOUB 2BM2A 1MKXH 3M3SA 5BRRE 2VIVA 1Z6EA 2R3UA 3ENSB 4B76A 2ANYA 5C67A 4KTSA 1NN6A 2FI4E 1BB0B 1LVMA 1UTJA 1SGRE 5F8ZA 3VB5A 1BTWA 1PQ7A 1P06A 1BMNH 3QWCH 3SUDA 2XBYA 3SJKA 2ZGCA 3EDXB 1ELFA 1S6HA 5CHBA 3RU4D 2PTCE 3M5NA 2F9UA 4JYTA 1W14U 4ISLA 2AMDA 1AN1E 1O34A 4AORA 1OP0A 1TBRH 3UTUH 3A83A 1DM4B 2AYWA 1GBEA 1A3EH 1EZSC 3AAVA 5B6OA 1TRMA 1FZZA 2A45B 1HUTH 4XDEA 4BAMB 5DP6A 1TX7A 1KLJH 3E8LA 2ZFFH 4I8HA 1V2TT 2CF8H 1TQ0B 2EI7A 3RMOH 4O97A 3TK9A 2W3KA 4D76A 1IQFA 2BB4A 2NU3E 2HRVA 3MH7A 3RXDA 2A5IA 1SSXA 4UE7H 1LHDH 1Y3UA 1HAHH 5JB9S 1W12U 2O8WA 4AB9A 5F8TA 4INHA 3DFJA 5EQQA 3SORA 2UWOA 2GT7A 1W7XH 4FUDA 1IHTH 1ZTJA 2JETB 3FP6E 1L1NA 9ESTA 2XBXA 2F9VA 2OP9A 4RI0A 1TA2A 5JBCS 1EJMA 1F7ZA 1C5WB 1CSOE 1UTPA 2VIQA 1H8ED 3VGCB 1O2GH 1JIRA 3SGQE 1D6WA 1SLWB 1K9OE 3EA9A 2YMSD 2VWOA 3LONA 1QL9A 1AUJA 1IOEA 2F43B 3U8RH 2NU1E 3NXPA 2EA3A 2A2QH 2IPHA 2XBVA 1WU1A 2PGBB 3W95A 7ESTE 2FX4A 3A85A 3T26A 1BBRK 2GD4B 2FMJA 2TGPZ 2ZIQH 3QGNB 2ZDMA 2ZKSA 3ATKA 1UVUH 1P04A 1BTHH 1FDPA 4OGYA 2Z6BD 1AB9B 5LH8A 4NFFA 1SGPE 1GGDC 1SBWA 4E05H 3BG8A 2Q1JA 2KCOA 1NBMD 2JH5D 2GP9B 2PWXA 3K6YA 1W7GH 3S69A 2ILNA 1TMUH 1DANH 1H9LB 3MO6A 3W94A 2F83A 1AVGH 2A4OA 2VWNA 3SHAH 2WPIS 4X1SU 1WOFA 4B71A 3PV2A 2XOKD 1CU1A 3QLPH 1BA8B 2L74A 1IQKA 2VH6A 1O3BA 1AE8H 2ZU2A 3F9HA 4O3TA 1YY3A 3NZIA 2AGEX 1VKYA 1GGDB 5I25A 4IN1A 3UWJH 5EPNA 3A88A 4LXBH 2R2WU 4H42U 5CE1A 1KMHB 3P92A 1O2QA 2XTTB 3SV2H 1V2UT 3UNRA 4X2YA 1P2KA 2ZNKH 3TNTA 3TH4H 1QL8A 1O2WA 1AFQC 2ZA5A 1QTFA 1EZXC 2HALA 4UDWH 2KAIA 1CO7E 1P11E 1B0FA 2TGDA 3QO6A 5C20A 1QRXA 4ZKOU 1FY1A 4ABAA 1SGCA 1UW7A 1UJ1A 1P9UA 1FXYA 2TPIZ 1OYTH 2BLOA 3O8DA 2BD5A 4E7RG 2ZF0H 1C5ZB 3FKSD 2HOBA 3SJ9A 1O3CA 4CBOA 2YMSB 4X1QU 3LT3A 4NA7A 3M5MA 2LNCA 2F9NA 3QN7A 1C5QA 1GI3A 2BVXH 3ZZ8A 4I31A 5EW2H 1O2ZA 3MH4A 2F91A 2Y7XA 1EASA 1GJ7B 1MKXK 3URCA 1QRWA 1MD8A 1S84A 1WDIA 4TY7A 5DJ7A 1HXEH 5JPMH 5E2PA 3LKWA 1VITG 1AZZA 3E3TA 1GBBA 1YPEH 5LPFA 3ODFA 4NIVA 2KM0A 4ZHAA 3SGAE 1J15A 5EW1H 1NFXA 4YT7H 5DP9A 1NZQH 2GTBA 2ZCHP 1HAXB 4K60A 4I33A 2Z9KA 1LQEA 2GT8A 2Y80A 3EGKH 1JBUH 4ZUHA 4AYVB 2AERH 3B23B 1BRUP 2C8ZB 3BTME 3ZZ4A 1BZXE 1F0SA 2WUBA 4UFFH 1BRBE 4ZKSU 3ZZ5A 1QHRB 3A82A 1HAIH 1E36B 2XBWA 2FI3E 3NPSA 1MCVA 3RXKA 1EJNA 3F9GA 3O8BA 4K5ZA 5HM2A 2XXLA 4GHTA 3BEUA 3UY9A 1A0JA 1UK3A 1EFRD 3DT0H 2YNAA 1H9IE 1K28D 2CK3D 2QIQA 2BDAA 2ZFPH 3LGIA 4XSKU 1EAXA 3DSGA 1C2HA 2AMPA 1KXBA 1E37B 3MOCA 4KELA 5F6MA 2SGEE 3MU0A 1M9UA 2V0BA 4AFUA 1SGNE 1LPGB 4LK4A 1CT0E 3IG6B 1ZMLA 4A5TS 5HGGA 2M5TA 4Y11E 1ESTA 2KCAA 5IK2D 4CR5A 3PB1E 1WBGB 2NU4E 2PUXB 4AN7A 1GCDA 3HK3B 1A5IA 2A4RA 4FU8A 5FHTA 4GCHG 4WJG2 4FU9A 4IMZA 1SOZA 2GX4A 3ZYEA 4ACAA 1DWEH 2H9EH 1G32B 5E0GA 4Y79A 2P3UB 1AFEH 1S82A 3OTJE 2GCHG 4GVUA 3GY3A 4Z6AH 1ABJH 4AZ2B 1T8OA 2STBE 3V12A 1QB6A 1FN8A 1DVAH 1N8OB 2BY7X 5EODA 3BG4C 4NG9H 4AYYB 3PMAB 2B9LA 2TRMA 1ZLRA 5GCHG 1ELCA 1MAXA 3F1SB 1LDTT 1H8DH 4YT6H 1FPCH 4CRCA 2TIOA 2H5DA 1BBRE 3N7DA 1J16A 2VVUA 3U8TH 3JZ2B 3SV8A 2FOAA 3F0OA 1P09A 2WV4A 2WPJS 2Z9JA 4MNYA 5C0UA 2FS9A 5GXPA 1VJAU 1YC0A 1V2OT 1ZYOA 2K1QA 1L4ZA 1W0YH 1PPGE 4X2WA 3D49H 4ABHA 3SO3A 3VB7A 1SQOA 2ZFRH 4JCNA 4GCHF 2VWMA 3M7QA 2FIRH 2ZHWH 2PV9B 4UEHH 4KTCA 1O2XA 3GICB 1AQ7A 2ZU5A 4Y7BA 2UUFB 3KYFA 2QAAA 2GCHF 4Q7XA 1K1LA 1LKBA 5T1VA 2A7CA 5FX5A 2KCYA 2Y81A 3TK6A 1CGHA 3AVZA 1IAUA 2P8OB 3LC3A 1BMFD 1TGCA 1GI8B 2SFAA 4A6LA 2XC5A 3F9FA 4ESTE 1DPOA 1ZOMA 1K0HA 4OM9A 1ELDE 3RMMH 2BOHB 5GCHF 3GS9A 3RU4T 4B2BA 1P0SH 3MFJA 4X2VA 2PGQB 4DURA 3MO3A 2O8MA 1C2MA 1F5KU 1FQ3A 1E1QD 1KTTB 2F9BH 1YGCH 1IQJA 1ANEA 5C94A 3T5FH 2ZDAH 3GY5A 1KTSB 3D62A 4AC9A 4CRFA 1SOTA 3RXCA 5EJZA 3O8CA 3T29A 5EPYA 1PPCE 1DFPA 2A4QA 2PSYA 5C3NA 2IJD1 5B6LA 1Z71A 1P05A 2FP7B 2OUAA 2QYIA 4ZXXH 1C5UA 1LVOA 1H9HE 1FJSA 4BANB 3GY6A 4I32A 1DX5M 4ASUD 3SI3H 1K1PA 1YLNA 4K1EA 6ESTA 6CHAC 3NWUA 1TPPA 1WQVH 1WTGH 2IPQX 2ZHFH 3WWBA 1G2MA 5BPEA 1O3GA 1C5OH 4FUFA 4GUXA 2CGAA 2B5TB 1C5YB 1ANCA 3GY4A 1OWIA 5EQRA 2QF3A 9LPRA 1JXPA 1G30B 2FOCA 3N7OA 1GVLA 2GV6A 3K65B 3K9XB 1COWD 3EA7A 3UFAA 1TAWA 2AEIH 3QDZB 4GLYA 4DOQA 1SQRA 1SG8B 2A4GA 4MTBA 1QR3E 5JDUB 2ZPQA 1C1TA 3GISB 8GCHG 1EOJA 1EPTB 1B0EA 1QURH 1A5GH 4JK6A 1GPZA 5FBEA 6CHAB 1ANDA 4NA8A 3SHCH 3KQDA 1Y3WA 1GI0A 4NIXA 2J95A 3RXOA 2FM2A 1TOCB 4GPGA 2WV5A 1L1JA 1SHYA 2CXVA 1JMOH 2W3IA 1P8VC 3OX7U 1ZJKA 1IQHA 2FESH 2ZG0H 1DICA 3UWIA 1C5NH 2AIQA 2DE9A 1LHGH 2JH0D 3A7TA 2UUKB 3TH3H 3PO1C 1O2NA 3F3BA 1HAVB 2A5KA 1Y3XA 1T8MA 1VGCB 2C8YB 1GJCB 1MBQA 1BMMH 1NM6A 2J97A 4R8TB 2PKSB 2RA0A 1NC6A 4ABBA 2PTNA 1AE5A 1LCYA 1SGFA 1D3TB 4RSPA 2XNIA 3RM2H 1C1PA 3QK1A 4AFQA 5EIYA 3R0FA 3ZZ9A 4FUCA 5ETXA 1LVBA 2HGTH 4X8TH 3N7EA 4BXWA 3SU6A 1GI6A 4YESB 1HJAC 4CH2B 3PO1B 2ZPRA 1ZGIA 2VIWA 1A0LA 1F0UA 2AFQB 1OWDA 3CNRA 4D7FA 3VPKA 3RC4A 2BDCA 2ZGXH 2VIOA 3I77A 1WV7H 4P02A 1TX8A 2BZAA 2PKAA 3BTKE 1O3OA 3RXFA 2RCEA 1RS0A 2C93B 2BLQA 2WHXA 1AWHB 1S83A 1O3DA 1T4UH 1T4VH 1UCYH 2JJ2D 1G3BA 4KTUA 3SNEA 2JIZD 2CMYA 5ESTE 5T6FA 1HJAB 1NU7B 3BN9A 4FUHA 4NZQA 1W11U 3F68H 2BQWB 4NGAH 1GDUA 3CS7A 4X8VH 5C1XA 1AD8H 3KQCA 1O3HA 3U98H 2GDEH 1OSSA 4AOQA 4I8LA 1GHVH 1TMBH 1P3CA 2G81E 3TVJB 1YYY1 4UFDH 1TX6A 3KEEA 1AZ8A 2BHGA 1JWTA 1V2PT 3P6ZB 2OK5A 5A8YA 1O2MA 1C1RA 3Q3YA 2FLBH 2VBCA 3SOSA 2C8WB 1JIMA 3EE7A 1QNJA 1MQ6A 1SGTA 1TA6A 1DE7H 1TRYA 3L6PA 1NRNH 1C5SA 2J5UA 4XE4A 4Q7YA 4ZMAH 1C5MD 2ZP0H 2NWNA 1QGFA 2A32A 4DIIH 5E0JA 1MTNC 1FY8E 1W0KD 1C4Y2 2Z94A 5T6GA 1K1NA 4YOJA 1KXDA 2QXIA 1NS3A 3PWCA 1XM1A 3NKKA 4ZHLU 1NFYA 1D3PB 1F92A 1O5AB 2AS9A 5H4IB 2D8WA 4RKOB 4YM9A 3TJUA 2VVCA 1DOJA 1FNIA 1EB1H 1O33A 1A2CH 1Q3XA 4WXVA 1W8BH 5F8XA 3RU4E 1ELAA 5G4BA 5FXLA 1QQUA 3FVFB 5TCCA 3I29A 3TNSA 1GI2A 3ZVAA 1NPMA 4ACBA 3FZDA 2XW9A 4WH8A 4KP0A 1Z7KA 1GI5A 4JZDH 1MTNB 2J98B 5HIYA 1CBWB 4X8SH 3IWMA 2SGAA 3LGVA 2G8TA 3S9CA 7GCHG 1TNKA 2JETC 3RUOA 1UHBB 2WINI 2KZ4A 2VWLA 2BY8X 5KECA 3SU0A 1QJ7B 1PPBH 1AUTC 1A5HA 1GL1A 3RMNH 1TGBA 3VGCC 4TWYA 1XMNB 1YPKH 3ZZ3A 3SU3A 1DS2E 1GI9B 3LH3A 1S0RA 3PMBB 3MU8A 5T3HA 3DSPA 3SUEA 4RKJB 1GBIA 5F53A 1CE5A 2AH4X 5DSFA 1LPKB 3GY8A 3BTHE 1S0QA 2ZHDA 3A7VA 1AB9C 1XUIA 5EXMA 2SGDE 1GHZA 5C1UA 3ITIA 3PMJA 3S7KB 2VU8E 3RXSA 1X7AC 5ABWA 2ZFTA 2ODYB 3FZZA 1FPHH 1TOMH 4FVDA 1O3FA 1KLTA 4H6SB 5A09A 2XWBI 3LH1A 2WPKS 5GWZA 1TGSZ 1SGYE 1C9TA 2P3TB 4XBBA 2F9OA 1V2JT 2M2AA 4YLQH 2XC4A 2RG3A 7GCHF 1MTSA 4O9VA 4Y0ZE 2O9QA 2WUCA 4OS1A 4A1TA 3VB3A 4ISNA 1N6YA 4TYDA 3U9AH 1QFKH 4BXSA 1RTKA 2ZTXA 3A89A 3NUMA 4D8NA 1O2JA 3QZRA 4X6PA 3HGPA 1PPFE 4WMFA 3ZVDA 1XXFA 5K7RA 4X2XA 1HAGE 4GHQA 3FO8D 2Q6DA 1NBME 1PPEE 1F5RA 4K69A 2GGVB 2FS8A 5CHAB 1O38A 1L1GA 3E6PH 1J8AA 1TONA 4FUEA 2FXRA 4XRNA 3LIWA 4FUBA 1A3BH 3NCLA 4B6EA 3SU4A 1P12E 3TGIE 2GMTC 2OBOA 1CA8B 1UCYK 1FUJA 2PP6A 1WAYB 1G3DA 2EI6A 3KGPA 4WXIA 1EAUA 1YLDA 3PLBA 2OC8A 5DP3A 3U8OH 2CV3A 1NRSH 1HDTH 4ABFA 2TGTA 2OLGA 2XNDD 4X1RU 2WYJA 4Y8YA 1BDAA 3SUFA 1CT4E 4BTTB 2YMSC 3V13A 1THPB 2BY9X 5JBBS 5EG4A 1C5LH 4ZKNU 1BTZA 1LHEH 3ELAH 3Q3XA 1C2FA 2Y5FA 3A84A 4P00A 2O8UA 3RXVA 1GHXH 1XX9A 5J4SA 5EJ1A 1O2TA 1RTLA 1WTHD 2GMTB 2BY5X 4CHAB 4Q7ZA 2ZTZA 5LPRA 4ZROA 1BHXF 1QB9A 5K0HA 3SQHE 1RTFB 2C4FH 2Z9LA 5HYOA 1XUGA 1K1OA 4CRDA 1V2KT 4ABJA 3GDVA 4X6OA 2I6SA 2O8TA 2FYRA 3CS0A 1SFQB 3KCGH 4J2YB 3VB4A 2NU0E 4AGKA 1JRSA 4LZ4B 1T8LA 1ZTKA 1O5BB 5IYTA 5AHGH 1O5GH 1ZTLA 1QRZA 3HATH 1MBMA 2OXSA 3P95A 1EP5A 1BTXA 2Q6FA 1YBWA 3SZNA 4AG2A 1MTUA 2BX4A 4OS5A 4B1TA 5DN6D 3H5CB 2QC2A 1IQGA 5C17A 1AVXA 2HNTE 1LPZB 2W7UA 2TGAA 4WWYA 4NSYA 2K0QA 4YZUA 6LPRA 2ZU3A 2G4TA 2GV7A 3SU5A 5E2OA 5DGJA 1BTUA 1PYTD 1AGJA 1ID5H 2J34A 1MUEB 4MG3A 1P02A 2SGPE 5FPTA 4WVPE 5L2ZH 3STIA 3EA8A 1RJXB 4WH6A 3ZZ6A 3ATWA 4IBLH 4M7GA 2KAIB 1TE0A 3CENA 3P8OA 3QX5H 2GZ8A 2GVFA 1ABIH 4FETA 4ISIH 3VFEA 4XBDA 2VINA 1GBFA 1O37A 1ACBE 1TLDA 3HPTB 2J38A 3LJJA 1YCPM 1CGIE 1TBQH 7KMEH 1V2VT 4ASHA 2GJGA 2LPRA 1BUIA 2OQ5A 1O2SA 2PFEA 2BTCE 2BYAX 1XVMA 4UFEH 1AY6H 3BTEE 4Y6DA 3F9EA 5A0BA 1V2QT 2FX6A 1SQTA 1GBKA 2KR7A 1Z8GA 3SQEE 3U1JB 3JZ1B 1L4DA 2HNTF 3A8CA 1N8OC 4K8BA 1T7CA 3KF2A 1XUKA 3F2GA 3M7UA 1AHTH 3AW1A 3ZVEA 1OXGA 1SLXB 1G2LA 1ELGA 4IS5A 2SNVA 2HNTC 1P2JA 1C1NA 1VCPA 2SNWA 1YPHC 1F0RA 3VXFH 1E38B 1CHOG 3U69H 1GJDB 1OKXA 1H8HD 1S81A 1LMWB 3RXJA 2K8IA 2FI5E 4F49A 1QCPA 3PYHA 4I7YH 2QN5T 1YPGH 1O3MA 2V6NA 3M5OA 5EGMA 3UB0A 2FOMB 4HG6A 1CA0B 1VCWA 1UTOA 5E0HA 2OC1A 4O3UA 3LGUA 1O3IA 3E0NB 3A7XA 3MH5A 3QZQA 2BQ6B 1FY4A 2F4LA 1EUFA 5EQSA 1CQQA 3GDSA 4B75A 2PUQH 2EQNA 1OS8A 4FU7A 1DWDH 1BTPA 5FBIA 1XXDA 1TNLA 2ANMH 1XKAC 2BQ7B 2P8OC 4M9FA 4DCDA 4IMQA 5E8EH 4X0WU 1TIOA 4FUGA 2J94A 2Z9IA 1THRH 4TY6A 3S9AA 3A7WA 4NIWA 3H09A 3ATLA 4BOHA 4I8KA 3QTOH 3GY7A 3WWFA 4K2YA 3Q77A 1CHOF 3BIUH 1OWEA 3STJA 3LGTA 1O2RA 1V2ST 3TLOA 1G37A 2OTVA 1UCYE 4D7GA 4HTCH 1L0ZA 3EQ0H 1QA7A 3SZEA 2XWAA 2G5VA 2P16A 3MU1A 1WSSH 3DA9B 3P8GA 3RC5A 2ZTYA 3RXRA 1Z6JH 1GVZA 1Y59T 3R3GB 2R3YA 2FOFA 3M37A 1LTOA 3TJVA 1C1QA 3V3MA 4DT4A 1P03A 4MPVA 1SMFE 2Y5GA 5L30H 1HLTH 1DITH 4X1NU 5FX6A 3ODDA 2QE7D 5A0AE 1D6RA 1DUAA 2FLRH 1MZDA 4U30A 2FOHA 1RFNA 2QA9E 3UIRA 1ZSKA 2V35A 1HBTH 1K1JA 3E1XB 1HAOH 2ASUB 1EPTC 1Z8RA 2VGCB 1GBTA 1O2VA 4NIYA 1EQ9A 1SVPA 2CHAB 5C1YA 1VITH 3SV7A 4OGXA 4OS2A 1S5SA 1D3DB 2P95A 2HWLB 1C5VA 1MQ5A 1NRPH 1TGNA 1INCA 1LHCH 2HPQH 4H6TA 4GSOA 5EOKA 1Y5AT 3UR9A 4A7IB 3GY2A 1K22H 5C2ZA 2AGIX 4ZH8A 1ESBA 2GZ9A 2P94A 3M3VA 1GG6B 4DIHH 3TITA 1WQSA 5DP8A 3UUZA 1HGTH 3MNXA 4CR9A 1SGIB 2ZU1A 4F4OC 5C5NA 1MMJN 2ZGHA 4MNVA 4LOYH 2ZGJA 2W6ID 3A8BA 2PR3A 3OEED 1VGCC 4X6MA 1F0TA 1BJUA 1YPLH 4JZ1A 2FPZA 2I6QA 4LZ1H 5J4QA 1F5LA 2PKSC 5FCRA 1Y8TA 5FPSA 3P8FA 1MU6B 3L33A 2V3OH 5T6DA 3A7YA 5CDFE 1TALA 3RXPA 1S6FA 2W6JD 1EJAA 1TFXA 4BAHB 2THFB 3D23A 1DWCH 1DXPA 1KYNA 1QBNA 1O0DH 1FY3A 2PLXA 3TGJE 3KHVA 1EAWA 4Y0YE 1HPGA 1GI7B 2BY6X 1GBDA 1BCUH 1Y5UT 3UAIC 1O5FH 5GDSH 2FZZA 1E35B 3DCLA 3PTNA 1QIXB 5EJLA 2WPDD 1NRQH 1HXFH 1ZSJA 4ABGA 1KIGH 4D9QA 2GCTC 3ZV8A 4Q63A 2ZPSA 1HNEE 4YTAA 2BD3A 2ZZUH 4ZCNA 2ANWA 1JRTA 4HGCA 4MNWA 4IC6A 1ZHMA 1UTNA 4INKA 1OWHA 1O2PA 2QXHA 1ZRBA 3P70B 3C1KA 1ORFA 3KQBA 2GKVE 3BTWE 1OHHD 1HAZB 1TBZH 2Q6GA 1F2SE 3FANA 3M3TA 4U32A 3VEQB 3SV6A 3M5LA 3F6UH 5JB8S 2A7HA 2C3SA 2GCTB 4DT7B 3SU2A 2VH0A 4MVNA 1B5GH 2QF0A 1UVPA 2FOEA 5DK1A 4Y7AA 5AF9H 1SC8U 4B2AA 3KN2A 4JZEH 4AB8A 4Z0KA 4MPXA 3F2HA 2H9HA 1BMAA 1YPMH 4YLUA 3A8DA 2STAE 2D26C 3ESTA 3L3TA 3AW0A 4UFGH 2OD3B 2ZECA 1QBOA 1WUNH 5EU8A 2WSSD 3HKJB 3MWIU 2BXTH 3V7TA 2A2XH 1TWXB 1CVWH 1RIWC 4MPWA 2PHBA 3ZVFA 2BLVA 2AHME 3BV9B 2GZ7A 3TIUA 4Q80A 1FIWA 3SJ8A 2G55A 1Q2WA 1KDQA 1BT7A 1LVYA 1V2RT 1FN6A 1P9SA 4JZFH 2A1DB 3VXEH 5KEDA 2WV9A 1WXRA 3ZV9A 1T31A 1Z1IA 4HFPB 1O5DH 1PFXC 3DFLA 1HIAA 4ISHH 1XUHA 2FTLE 1CT2E 2ZCKP 3MMGA 4R0IA 2PSXA 4CBNA 1D3QB 5FCKA 1ZPCA 3ATIA 3U1IB 1IQNA 3BTTE 4RT1A 1ARBA 4TWWA 3MNBA 1C1SA 1DY8A 1YPJH 2PKAB 4JZIA 1QY6A 1EXFA 4I8JA 1RIWB 1Z8IB 2FWWA 1FONA 1IQEA 4F55A 3H7OA 5AFYH 1C1VH 4E7NA 1TB6H 4WMDA 1O39A 3GCHB 1NROH 5FL7D 3RP2A 3PTBA 2H1UA 4TPYA 2ZDKA 2ODQA 3AASA 3Q3KA 3TGKE 4BAQB 8ESTE 1CBWC 1KXCA 1O3KA 3A81A 1C2DA 2CF9H 5JBAS 2DUCA 1OWKA 1ZGVA 4I86A 5A2MH 5JYIA 1HJ8A 3WY8A 1HB0B 1SGEE 4B2CA 1C2GA 4NZLA 3TJNA 3A7ZA 2ZQ1A 3BTFE 1C9PA 2B0FA 1FAKH 3OFND 1HIAB 1C5RA 1ELBA 2ULLA 2UUYA 3RXGA 3P8NA 1O35A 2BVRH 3RXLA 4BAOB 1MTVA 3KNXA 2WZQA 3PM3A 4UONA 4DG4A 1H4WA 2ZCLP 2HLCA 3GCTF 1IQLA 1E34B 2G51A 4RN6A 1PPHE 3T2NA 8LPRA 1P57B 3PRBA 1UMAH 2P93A 2HLDD 1O2KA 2FO9A 3ZIAD 3M35A 2FODA 4ABDA 2HVXA 2BDGA 3OTPA 4MLFB 4BNRA 2BD2A 5PTPA 4HI3A 2J2UA 1GCTB 3URDA 4CRAA 2LELA 3UOPA 4A1XA 1QQ4A 3MO9A 4Y8ZA 3PLPA 1LQDB 1XVOA 2RDEA 3ZZBA 4U01A 4CRGA 1V2WT 1UVTH 4NSVA 2BVSH 4JYVH 2SGFE 4H4FA 4Y76A 3OEHD 1EX3A 2BD8A 4TPIZ 1IQIA 4A92A 1ZMJA 1G3CA 2BX3A 4AX9H 4DJZB 3TU7H 1EZQA 2ESTE 4JYUH 1GBMA 4YO9A 3WW7A 5I46H 1C4U2 1OOKB 1AVWA 1TPOA 1AO5A 2W5EA 5CHAC 1MD7A 1BRAA 3Q00A 1SL3A 1A4WH 5DP7A 1EOLA 4KGAA 2ALPA 4K8YA 1G3EA 1UVOA 4YXWD 1TRNA 4IC5A 1U6QA 3S7HB 1OP8A 3TK5A 3IITA 1ELVA 4K3JA 1O3JA 4JMYA 4AFSA 2BMGB 2ZQ2A 3M36A 1YF4A 4FXGH 1UTKA 3TPIZ 1NESE 4THNH 1GMHG 4ABIA 1FY5A 1UK4A 3RXQA 3UOUA 1CGJE 1WYKA 1P3EA 1ESAA 1EB2A 4O03A 1ZJDA 1K2I1 2TBSA 2V7QD 1ZPBA 3OU0A 1PQAA 1VR1H 1ZZZA 1O3NA 2JH6D 2R0LA 2FOGA 3RC6A 1A46H 1HJ9A 1THSH 1SFIA 1HAYB 2HPPH 4MPUA 3PLKA 3PRDA 1GI4A 4AG1A 1NT1A 2AIPA 4CHAC 1AI8H 1GBAA 1UO6A 1P01A 3MNCA 3QTVH 2BZ6H 1GJ8B 2VNTA 2IOTA 1TNIA 4XFQA 1DY9A 1YLCA 4IGDA 2QCYA 1DXWA 1P2OA 2B7DH 1GWAA 4YOIA 2H2ZA 3MU4A 2GDDA 1XKBC 2FDAA 3OY6U 1D9IA 2ZHQH 1SR5C 5TCAA 2DE8A 3F2FA 1T8NA 1DLEA 3RDZA 1C1WH 1V6DA 4SGAE 3LC5A 2JJ1D 2Y6TA 1YP9A 3BEIB 3M61U 3RXMA 1BTYA 2ZO3H 1DT2A 1WCZA 2A7JA 1LHFH 3LPRA 1TMTH 3FP8E 3QUMP 5GPIB 1GMHF 3MTYA 3SV9A 1ZHRA 1P10A 2OBQA 2WYGA 3BTGE 3ZZDA 3PV4A 1TABE 1EAIA 2J4IA 2P3FH 3MNSA 4Y71A 2B8OH 1V2NT 1N6XA 3MHWU 1IQMA 2EC9H 1GJBB 5GIBA 2Y7ZA 4FOUC 4FUIA 2EI8A 2QF4A 1FI8A 3BEFB 4CREA 3RXAA 2J92A 2ZI2H 1O3EA 1GDNA 1RD3B 3ZZAA 1GBJA 3A80A 1YPHE 4OS6A 2WPMS 3E16B 5AVDA 3ZVCA 1MAYA 4F48B 1SI5H 5HXFA 5F03A 1O36A 2BOKA 5L6NH 2CN0H 1XUJA 2KCPA 1GL0E 1GHAG 3SNAA 3VG8A 1KY9A 2VIDA 4BAKB 1YKTA 2ZC9H 2ZDLA 1Y5BT 1AFQB 1YCPH 3SJIA 3UQVA 2BDYA 7LPRA 3PROA 1C4V2 1O2UA 1H8IH 1BJVA 3EAJA 1C2EA 1QJ6B 1W3CA 3M7TA 4Y10E 1DWBH 3FAOA 1UTQA 2NU2E 4XOJA 4X8UH 2Z3CA 1W0ZU 5AFZH 2BD9A 3Q76A 3SNDA 2D1JA 2C90B 2SGQE 4NFEA 1BHXB 4Z1MD 1TNGA 2P59A 1DDJA 1GMDG 2BD4A 1RXPA 3A87A 1SKYE 4UD9H 3LU9B 2QXJA 2Y82A 4TSFD 3SGBE 1W0JD 1CA0C 2BDIA 2V3MA 3TH2H 2F3CE 2ZU4A 5TJXA 3T28A 3ZZ7A 2ANKH 3UNQA 3BIVH 1C1UH 1O5CB 3A8AA 5KGOA 1AU8A 2OC0A 5DPAA 1GBHA 1P2NA 5C0TA 3E91A 1GHAF 1A0HB 2QXGA 2IJOB 1C2KA 3DSOA 1NU9A 2VB0A 1XUFA 1LO6A 1OWJA 1PYTC 1DLKB 1Z1JA 2R2MB 2ZWLH 3RXIA 4AGJA 3UR6A 3MI4A 1BOQA 4DY7B 3C27B 2EEKA 3SI4H 1T32A 1VCQA 4D9RA 2A31A 1SGDE 1VITF 5LGOA 3B9FH 1O2LA 3RLWH 5HKKD 1FX0B 4Q4LA 2W26A 4DW2U 3S0NA 1PJPA 1ETSH 1ETTH 1GBLA 1GHYH 4E06H 1K1MA 1BQYA 1DUEA 3LOXA 4PROA 2LP6A 3UPEA 2F9PA 1GMDF 1O2IA 1PQ8A 3KIDU 1P2MA 3KYGA 4BTIB 1NFUA 1ZSLA 1SHHB 3DHKH 2L6OA 1V3XA 4GAWA 1HAPH 2J9NA 1EKBB 1J14A 1ZR0A 1FAXA 1YM0A 4IN2A 3H7TA 2KFWA 5A8ZA 4B73A 2UWLA 1KXAA 3SU1A 1DSUA 1Z8JB 5DP4A 5ESBA 1P2IA 1MCTA 2H6MA 1YWUA 4WY3A 3RXHA 1O3AA 1TYNA 1MABB 1UTMA 3GCNA 4OS7A 2W7SA 1A1RA 2KX4A 3OY5U 4SGBE 1PPZA 1TQ7B 5LPEA 1UK2A 4NWKA 4OS4A 4YOGA 1FIZA 1ELEE 3BG4B 2R0KA 3UREA 1HYLA 1V2MT 4MDSA 3S9BA 4VGCC 1MKWH 3FP7E 1AIXH 3SW2B 1ZPZA
chains in the Genus database with same CATH topology
2VGCC 3K6ZA 1TPSA 2CHAC 5GJ4B 1MU8B 1C5XB 1GJAB 5L2YH 4X6NA 3N99A 2G4UA 1GDQA 1HRTH 1ZRKA 1OP2A 3ZVGA 2XCFA 2ODPA 1UTLM 3GYMA 5GNDA 3RXTA 1E1RD 1HFDA 3EYDA 4WMEA 3ZVBA 2V3HH 1FLEE 1GG6C 1K1IA 1D4PB 3QGJA 2G52A 1BITA 3RXUA 4BTUB 4VGCB 1QBVH 1VJ9U 4ZXYH 2Z3EA 4NWLA 1C5TA 3GCOA 2C8XB 5C5OA 1J17T 2BD7A 3TJOA 3UNSA 1O32A 1EPTA 1O2YA 4Q2KA 1C5PA 1GHBG 1ANBA 2FEQH 1LKAA 2UUJB 3BSQA 4I8GA 1C2IA 3HK6B 2QY0B 1A61H 3DD2H 2QGRA 1SPJA 3FFGA 3NK8A 3ATMA 4HZHA 4JK5A 1O31A 1OPHB 5HMAA 2ZEBA 3OAAD 3EE0B 1RGQA 1NFWA 1YCPK 3P17H 1GI1A 2A0QB 5SGAE 3AK5A 4DVAU 3V0XA 2Z9GA 1B7XB 5EXLA 1ZHPA 5FPYA 5EXNA 1SGFG 3D65E 2ZHEH 2YNBA 4MQAA 5A8XA 4FUJA 4FVBA 3NRLA 2RA3A 3O8RA 2FYQA 1P2QA 1AMHA 2BDHA 2VJ1A 1GJ4H 2H5CA 1HAVA 1QJ1B 3UQOA 3W1EA 1G36A 1W2KH 2VIPA 2OC7A 3AAUA 4TT3D 1L2EA 1O2HA 3OSYA 3MYWA 3SUGA 1UVSH 5IDKA 1TNHA 1E0FD 1NRRH 1C1MA 1K21H 2ALVA 1GJ5H 1VZQH 2A5AA 2Z7FE 2O8LA 2UWPA 3K2UA 4ABEA 4NA9H 1GHBF 1SGQE 3RMLH 3RLYH 1ELTA 1GMCG 2ZGBH 1QB1A 3LJOA 1SQAA 1S85A 1A7SA 3MH6A 4J1YA 2BLWA 4Y8XA 2XCNA 4B6FA 4INLA 1SLVB 2ZFQH 1NO9H 1MH0A 2VVVA 3T25A 1G9IE 2FTMA 3MU5A 2XYAA 3G01A 4WF8A 3SBKA 1N1LA 3RXBA 5A0CA 8KME2 2R9PA 3VB6A 3BTQE 3SNCA 1ETRH 2YOLA 1KXFA 1KLIH 2OQUA 2QV1A 5DP5A 5JBTA 3HKIB 1SLUB 1HV7A 3RXEA 4XBCA 1AWFH 2ZDNA 1V2LT 3PMHB 1O2OA 2PW8H 1BBRH 1S6LA 5CMXH 1GJ6A 3B8JA 8GCHF 2D2DA 3BF6H 3LDXH 3DUXH 3OYPA 1FV9A 2AMQA 5DG6A 4B74A 5HM9A 2G00A 3F0PA 3E90B 4ZAEA 3LGYA 1GVKB 2ZFSA 3PV5A 1BRCE 2BDBA 1GBCA 1OX1A 3PWBA 4U2WA 1EATA 4AFZA 1Y3VA 3ZYDA 3KQEA 1TNJA 1GMCF 1J9CH 1W13U 1QL7A 4KKDA 2G5NA 3GYLB 3I78A 1EP6A 1DSTA 4NCYA 1MTWA 5DO4H 6GCHG 2H9TH 4XD7D 1O3LA 3GOVB 3T62A 3GCHC 3RM0H 1NTPA 4DGJA 1C2JA 4K1TA 2Y5HA 1AKSA 3T27A 1RRKA 3ZZCA 5FAHA 4CRBA 2BXUH 4MNXA 2WPLS 1Y3YA 3GCTG 1EZUC 4ZHMU 2ZDVH 1E79D 1MKWK 2XRCA 1O30A 1CHGA 1PQ5A 2QF5A 3HGNA 3A86A 4IW4E 3SN8A 4QT8C 1HCGA 4CH8B 1NY22 3GDUA 3SJOA 1IHSH 2JKHA 1C2LA 3LGWA 3CP7A 3SNBA 1ARCA 1GJ9B 3E0PB 1Q31A 1TPAE 2CJIA 1KXEA 1TGTA 1O3PB 2JDID 2AGGX 2OCVB 2IN2A 3FOAA 3OE7D 4ZKRU 1OYQA 3FN8A 1W10U 5DKMA 2FOBA 1ZMNA 1GHWH 1SB1H 2Z3DA 1C1OA 1UHBA 2RDLA 1MZAA 1BMLA 1BIOA 2WPHS 1KDQB 2XC0A 2OINA 1O5EH 4ISOA 4K1SA 3SYJA 6GCHF 1AKSB 4A1VA 1QA0A 1GCTC 3BTDE 1FMGA 1H1BA 1KSNA 3KL6A 4X1PU 1JOUB 2BM2A 1MKXH 3M3SA 5BRRE 2VIVA 1Z6EA 2R3UA 3ENSB 4B76A 2ANYA 5C67A 4KTSA 1NN6A 2FI4E 1BB0B 1LVMA 1UTJA 1SGRE 5F8ZA 3VB5A 1BTWA 1PQ7A 1P06A 1BMNH 3QWCH 3SUDA 2XBYA 3SJKA 2ZGCA 3EDXB 1ELFA 1S6HA 5CHBA 3RU4D 2PTCE 3M5NA 2F9UA 4JYTA 1W14U 4ISLA 2AMDA 1AN1E 1O34A 4AORA 1OP0A 1TBRH 3UTUH 3A83A 1DM4B 2AYWA 1GBEA 1A3EH 1EZSC 3AAVA 5B6OA 1TRMA 1FZZA 2A45B 1HUTH 4XDEA 4BAMB 5DP6A 1TX7A 1KLJH 3E8LA 2ZFFH 4I8HA 1V2TT 2CF8H 1TQ0B 2EI7A 3RMOH 4O97A 3TK9A 2W3KA 4D76A 1IQFA 2BB4A 2NU3E 2HRVA 3MH7A 3RXDA 2A5IA 1SSXA 4UE7H 1LHDH 1Y3UA 1HAHH 5JB9S 1W12U 2O8WA 4AB9A 5F8TA 4INHA 3DFJA 5EQQA 3SORA 2UWOA 2GT7A 1W7XH 4FUDA 1IHTH 1ZTJA 2JETB 3FP6E 1L1NA 9ESTA 2XBXA 2F9VA 2OP9A 4RI0A 1TA2A 5JBCS 1EJMA 1F7ZA 1C5WB 1CSOE 1UTPA 2VIQA 1H8ED 3VGCB 1O2GH 1JIRA 3SGQE 1D6WA 1SLWB 1K9OE 3EA9A 2YMSD 2VWOA 3LONA 1QL9A 1AUJA 1IOEA 3U8RH 2F43B 2NU1E 3NXPA 2EA3A 2A2QH 2IPHA 2XBVA 1WU1A 2PGBB 3W95A 7ESTE 2FX4A 3A85A 3T26A 1BBRK 2GD4B 2FMJA 2TGPZ 2ZIQH 3QGNB 2ZDMA 2ZKSA 3ATKA 1UVUH 1P04A 1BTHH 1FDPA 4OGYA 2Z6BD 1AB9B 5LH8A 4NFFA 1SGPE 1GGDC 1SBWA 4E05H 3BG8A 2Q1JA 2KCOA 1NBMD 2JH5D 2GP9B 2PWXA 3K6YA 1W7GH 3S69A 2ILNA 1TMUH 1DANH 1H9LB 3MO6A 3W94A 2F83A 1AVGH 2A4OA 2VWNA 3SHAH 2WPIS 4X1SU 1WOFA 4B71A 3PV2A 2XOKD 1CU1A 3QLPH 1BA8B 2VH6A 1IQKA 1O3BA 1AE8H 2ZU2A 3F9HA 4O3TA 3NZIA 2AGEX 1GGDB 5I25A 4IN1A 3UWJH 5EPNA 3A88A 4LXBH 2R2WU 4H42U 5CE1A 3SV2H 3P92A 1O2QA 2XTTB 1KMHB 1V2UT 3UNRA 4X2YA 1P2KA 2ZNKH 3TNTA 3TH4H 1QL8A 1O2WA 1AFQC 2ZA5A 1QTFA 1EZXC 2HALA 4UDWH 2KAIA 1CO7E 1P11E 1B0FA 2TGDA 3QO6A 5C20A 1QRXA 4ZKOU 1FY1A 4ABAA 1SGCA 1UJ1A 1P9UA 1FXYA 2TPIZ 1OYTH 2BLOA 3O8DA 2BD5A 4E7RG 2ZF0H 1C5ZB 3FKSD 2HOBA 3SJ9A 1O3CA 4CBOA 2YMSB 4X1QU 3LT3A 4NA7A 3M5MA 2LNCA 2F9NA 3QN7A 1C5QA 1GI3A 2BVXH 3ZZ8A 4I31A 5EW2H 1O2ZA 3MH4A 2F91A 2Y7XA 1EASA 1GJ7B 1MKXK 3URCA 1QRWA 1MD8A 1S84A 4TY7A 5DJ7A 5JPMH 1HXEH 5E2PA 3LKWA 1VITG 1AZZA 3E3TA 1GBBA 1YPEH 5LPFA 3ODFA 4NIVA 2KM0A 4ZHAA 3SGAE 1J15A 5EW1H 1NFXA 4YT7H 5DP9A 1NZQH 2GTBA 2ZCHP 1HAXB 4K60A 4I33A 2Z9KA 1LQEA 2GT8A 2Y80A 3EGKH 1JBUH 4ZUHA 4AYVB 2AERH 3B23B 1BRUP 2C8ZB 3BTME 3ZZ4A 1BZXE 1F0SA 2WUBA 4UFFH 1BRBE 4ZKSU 3ZZ5A 1QHRB 3A82A 1HAIH 1E36B 2XBWA 2FI3E 3NPSA 1MCVA 3RXKA 1EJNA 3F9GA 3O8BA 4K5ZA 5HM2A 2XXLA 4GHTA 3BEUA 3UY9A 1A0JA 1UK3A 1EFRD 3DT0H 2YNAA 1H9IE 1K28D 2QIQA 2ZFPH 2BDAA 3LGIA 4XSKU 2CK3D 1EAXA 1C2HA 2AMPA 1KXBA 1E37B 3MOCA 4KELA 5F6MA 2SGEE 3MU0A 1M9UA 2V0BA 4AFUA 1SGNE 1LPGB 4LK4A 1CT0E 3IG6B 1ZMLA 4A5TS 5HGGA 2M5TA 4Y11E 1ESTA 2KCAA 5IK2D 4CR5A 3PB1E 1WBGB 2NU4E 2PUXB 4AN7A 1GCDA 3HK3B 1A5IA 2A4RA 4FU8A 5FHTA 4GCHG 4WJG2 4FU9A 4IMZA 1SOZA 2GX4A 3ZYEA 1DWEH 2H9EH 1G32B 5E0GA 4Y79A 2P3UB 1AFEH 1S82A 3OTJE 2GCHG 4GVUA 3GY3A 4Z6AH 1ABJH 4AZ2B 1T8OA 2STBE 3V12A 1QB6A 1FN8A 1DVAH 1N8OB 2BY7X 5EODA 3BG4C 4NG9H 4AYYB 3PMAB 2B9LA 2TRMA 1ZLRA 5GCHG 1ELCA 1MAXA 3F1SB 1LDTT 1H8DH 4YT6H 1FPCH 4CRCA 2TIOA 2H5DA 1BBRE 3N7DA 1J16A 2VVUA 3U8TH 3JZ2B 3SV8A 2FOAA 3F0OA 1P09A 2WV4A 2WPJS 2Z9JA 4MNYA 5C0UA 2FS9A 5GXPA 1VJAU 1YC0A 1V2OT 1ZYOA 2K1QA 1L4ZA 1W0YH 1PPGE 4X2WA 3D49H 4ABHA 3SO3A 3VB7A 1SQOA 2ZFRH 4JCNA 4GCHF 2VWMA 3M7QA 2FIRH 2ZHWH 2PV9B 4UEHH 4KTCA 1O2XA 3GICB 1AQ7A 2ZU5A 4Y7BA 2UUFB 2QAAA 2GCHF 4Q7XA 1K1LA 1LKBA 5T1VA 2A7CA 5FX5A 2KCYA 2Y81A 3TK6A 1CGHA 3AVZA 1IAUA 2P8OB 3LC3A 1BMFD 1TGCA 1GI8B 2SFAA 4A6LA 2XC5A 3F9FA 4ESTE 1DPOA 1ZOMA 4OM9A 1ELDE 3RMMH 2BOHB 5GCHF 3GS9A 3RU4T 4B2BA 1P0SH 3MFJA 4X2VA 2PGQB 4DURA 3MO3A 2O8MA 1C2MA 1F5KU 1FQ3A 1E1QD 1KTTB 2F9BH 1YGCH 1IQJA 1ANEA 3T5FH 2ZDAH 3GY5A 1KTSB 3D62A 4CRFA 1SOTA 3RXCA 3O8CA 3T29A 5EPYA 1PPCE 1DFPA 2A4QA 2PSYA 5C3NA 2IJD1 5B6LA 1Z71A 1P05A 2FP7B 2OUAA 2QYIA 4ZXXH 1C5UA 1LVOA 1H9HE 1FJSA 4BANB 3GY6A 4I32A 1DX5M 4ASUD 3SI3H 1K1PA 4K1EA 6ESTA 6CHAC 3NWUA 1TPPA 1WQVH 1WTGH 2ZHFH 3WWBA 1G2MA 5BPEA 1O3GA 1C5OH 4FUFA 4GUXA 2CGAA 2B5TB 1C5YB 1ANCA 3GY4A 1OWIA 5EQRA 2QF3A 9LPRA 1JXPA 1G30B 2FOCA 3N7OA 1GVLA 2GV6A 3K65B 3K9XB 3UFAA 3EA7A 1COWD 1TAWA 2AEIH 3QDZB 4GLYA 4DOQA 4MTBA 1SG8B 2A4GA 1QR3E 5JDUB 2ZPQA 1C1TA 3GISB 8GCHG 1EOJA 1EPTB 1B0EA 1QURH 1A5GH 4JK6A 1GPZA 5FBEA 6CHAB 1ANDA 4NA8A 3SHCH 3KQDA 1Y3WA 1GI0A 4NIXA 2J95A 3RXOA 2FM2A 1TOCB 4GPGA 2WV5A 1L1JA 1SHYA 2CXVA 1JMOH 2W3IA 1P8VC 3OX7U 1ZJKA 1IQHA 2FESH 2ZG0H 1DICA 3UWIA 1C5NH 2AIQA 2DE9A 1LHGH 2JH0D 3A7TA 2UUKB 3TH3H 3PO1C 1O2NA 3F3BA 1HAVB 2A5KA 1Y3XA 1T8MA 1VGCB 2C8YB 1GJCB 1MBQA 1BMMH 1NM6A 4R8TB 2PKSB 2RA0A 1NC6A 4ABBA 2PTNA 1AE5A 1LCYA 1SGFA 1D3TB 4RSPA 2XNIA 3RM2H 1C1PA 3QK1A 4AFQA 3R0FA 3ZZ9A 4FUCA 5ETXA 1LVBA 2HGTH 4X8TH 4BXWA 3N7EA 3SU6A 1GI6A 4YESB 1HJAC 4CH2B 3PO1B 2ZPRA 1ZGIA 2VIWA 1A0LA 1F0UA 2AFQB 1OWDA 4D7FA 3VPKA 3RC4A 2BDCA 2ZGXH 2VIOA 3I77A 1WV7H 1TX8A 2BZAA 2PKAA 3BTKE 1O3OA 3RXFA 2RCEA 1RS0A 2C93B 2BLQA 2WHXA 1AWHB 1S83A 1O3DA 1T4UH 1T4VH 1UCYH 2JJ2D 1G3BA 4KTUA 3SNEA 2JIZD 2CMYA 5ESTE 5T6FA 1HJAB 1NU7B 3BN9A 4FUHA 4NZQA 1W11U 3F68H 2BQWB 4NGAH 1GDUA 3CS7A 4X8VH 5C1XA 1AD8H 3KQCA 1O3HA 3U98H 2GDEH 1OSSA 4AOQA 4I8LA 1GHVH 1TMBH 1P3CA 2G81E 3TVJB 1YYY1 4UFDH 1TX6A 3KEEA 1AZ8A 2BHGA 1JWTA 1V2PT 3P6ZB 2OK5A 5A8YA 1O2MA 1C1RA 3Q3YA 2FLBH 2VBCA 3SOSA 2C8WB 1JIMA 1QNJA 1MQ6A 1SGTA 1TA6A 1DE7H 1TRYA 3L6PA 1NRNH 1C5SA 2J5UA 4XE4A 4Q7YA 4ZMAH 1C5MD 2ZP0H 2NWNA 1QGFA 2A32A 4DIIH 5E0JA 1MTNC 1FY8E 1W0KD 1C4Y2 2Z94A 5T6GA 1K1NA 4YOJA 1KXDA 2QXIA 1NS3A 3PWCA 1XM1A 3NKKA 4ZHLU 1NFYA 1D3PB 1F92A 1O5AB 2AS9A 5H4IB 2D8WA 4RKOB 4YM9A 3TJUA 2VVCA 1DOJA 1FNIA 1EB1H 1O33A 1A2CH 1Q3XA 4WXVA 1W8BH 5F8XA