3UQVA

Bovine trypsin variant x(triplephe227) in complex with small molecule inhibitor
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSETYNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSASSFIITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGFYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Correlating structure and ligand affinity in drug discovery: a cautionary tale involving second shell residues.
pubmed doi rcsb
source organism Bos taurus
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Cationic trypsin
total genus 53
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2011-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3uqvA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3uqvA02
1W10U 1TOMH 2VVCA 2D1JA 1O2VA 1PYTC 1SL3A 1KXAA 3RMNH 2JH5D 1ZSJA 2ZDVH 3U9AH 1Z6EA 5A8YA 1IAUA 1CU1A 1S84A 1RTFB 4Y0YE 3ZZ6A 4ZH8A 1O2KA 3F9EA 1O2IA 3BTGE 3SNCA 2XBYA 2VWOA 1TRMA 1UK4A 1YCPH 2NU0E 3Q76A 4B2AA 1SFIA 2PSXA 3KHVA 1T8NA 2R3UA 3BG4C 1BTUA 3TU7H 1GHVH 3B8JA 1G32B 2HNTF 3GY2A 1GG6B 3M3VA 4FUDA 3SU1A 1MTVA 2ZEBA 1O3LA 3PV4A 1EPTC 1ARBA 4MNVA 3FP7E 3M61U 3T29A 2WPHS 1HAGE 2G5VA 1W7XH 4FUBA 4JYTA 3SI3H 3P6ZB 1RFNA 1HBTH 1C2JA 2QIQA 2PV9B 1GMCG 1T8LA 1UJ1A 2GX4A 2EEKA 1V6DA 3V13A 1BTZA 2V3OH 3T2NA 1GBHA 3ZZDA 1CO7E 1OKXA 3QDZB 4I32A 4CR9A 4FUGA 3RMOH 2F9BH 1NFXA 1KXFA 2XWBI 1QIXB 2ZHEH 2ALPA 2NU1E 5EOKA 5J4SA 1AB9C 1HJAC 3PB1E 1E35B 4SGAE 2J94A 1D6RA 1UTQA 4DIIH 3F1SB 1MD8A 2GT7A 1VR1H 1T8MA 2C8XB 5B6OA 2A4GA 1NO9H 3ZZ3A 2QXIA 1NRRH 1GI9B 1LHGH 1N8OB 1QBNA 2BY6X 1TPAE 3QZRA 4A1XA 1GJAB 2PKAA 1AUJA 2PW8H 5L6NH 5DP5A 4Y79A 1ID5H 1WTHD 4TPIZ 1AKSA 1GCTB 3FZZA 1BTPA 4YTAA 5L2YH 2AERH 1O39A 1S81A 3M7UA 1ZJKA 3W95A 1DLKB 4ISLA 3TLOA 1OP8A 5JYIA 5C5OA 1GMDG 1T32A 3A87A 1MZDA 1GI7B 1PPHE 5HXFA 1L4ZA 2ZQ2A 1BBRK 2A7HA 3JZ1B 5DPAA 1C2GA 3GCOA 2UWLA 1P05A 1W11U 3RMMH 1P2QA 1OWEA 1VJAU 5E8EH 2FDAA 1DWEH 1HAHH 1Y5UT 2HGTH 3GCTG 4I31A 2ZPQA 2BDGA 1K2I1 1L0ZA 1BJUA 1WAYB 4AB9A 4INHA 4NIXA 1EAIA 3ZVDA 1GBCA 2ANWA 2FOBA 4I8GA 1IHTH 4ZUHA 3KIDU 1K21H 2BQ7B 5AFYH 2FOAA 1NU9A 3ZZAA 4UONA 3BTWE 1MTUA 5T6FA 1YLCA 3N7OA 1A5GH 3A8DA 4Q80A 1DX5M 5FHTA 1C9PA 5DP9A 2XBXA 4DJZB 1V2OT 3GCTF 1Y5AT 1BJVA 4JZEH 1QGFA 4FUCA 1P57B 1O2RA 2PSYA 3UQVA 4ABAA 4B2BA 4ISHH 1O34A 8KME2 2V0BA 4DG4A 1GJ7B 2BOKA 2ZQ1A 1JIMA 1QCPA 3Q3YA 1UO6A 2H1UA 1AZZA 1P10A 2Z9IA 1C5TA 3T25A 4XSKU 5CE1A 3EDXB 1HAOH 3A7VA 1MU6B 3LT3A 2XBWA 1OPHB 1JMOH 1H9HE 2ZKSA 3A81A 2BQWB 4GPGA 4OS1A 4CHAB 1TAWA 1Y3YA 1JRTA 1O30A 3S9AA 2F83A 1THPB 4K5ZA 2B5TB 1A1RA 3UUZA 1LPKB 2VH6A 3R0FA 3PO1C 4IN1A 1AVWA 4RKOB 2O9QA 1O3CA 1JOUB 1GBDA 4X2VA 3QX5H 1LHEH 1VITF 3GYMA 2GCTB 5FPYA 1ESTA 1GI1A 2V3HH 4ESTE 5GWZA 4IMQA 1GBIA 2BB4A 1YPMH 2ZHWH 2ZECA 2UUYA 3VXEH 5DG6A 4CRCA 1ZYOA 2BM2A 1AFQC 4ABIA 2ALVA 4ZROA 1Z71A 3A8BA 3G01A 1NN6A 1PQ8A 1BQYA 1C2EA 3M7TA 4CR5A 2ZIQH 3UR6A 2Z3CA 1LTOA 4AOQA 2O8MA 4NCYA 3NUMA 1NU7B 1BBRH 3A80A 3DA9B 3S69A 1LVOA 2SNVA 2A4RA 1XMNB 1JWTA 3RXSA 1ZJDA 1O2UA 2OBOA 3BTTE 2VWNA 4KTUA 3BTME 1GL1A 1Z6JH 4AGJA 2DUCA 4X1QU 3E1XB 1NESE 5EXNA 2VWLA 2ODPA 3L6PA 1K1NA 1TNJA 1DY8A 2GT8A 2AGGX 2ZFRH 3SU6A 1TNLA 4YT6H 3SQEE 4NWLA 7GCHG 4UEHH 1SGRE 1HJ8A 4Q7XA 3DT0H 4NZLA 2W26A 1LO6A 1LCYA 2P3TB 1CA0C 4FUIA 4WY3A 3I29A 4Y8YA 5JB8S 1UVSH 1VGCC 2ZDNA 3E6PH 1C5NH 5BPEA 2ZFTA 1XXFA 3RU4D 5LPFA 2BDAA 4IS5A 1PQ5A 4BNRA 4HTCH 5GJ4B 4CBOA 3ZVBA 1PPEE 4OS7A 1EJNA 1O3PB 3B23B 4U32A 1KY9A 1C5PA 3SJIA 1CVWH 3FAOA 3KCGH 1OWIA 1C5RA 3VGCC 2BYAX 3U8RH 2Z6BD 1P06A 2VH0A 1QQ4A 2ZCHP 1Y3WA 1V2ST 4DIHH 2PUQH 2HPPH 4TY6A 1O5CB 3MNCA 4H6TA 1ETSH 1PPZA 4MNWA 3HKJB 1Y8TA 1MCVA 5GPIB 4BOHA 3ESTA 2Y5GA 1SQOA 3E8LA 5FX5A 4X6PA 1O32A 2A7JA 4LZ1H 5DJ7A 3UNSA 5JDUB 1VITG 2J9NA 1O3FA 2D2DA 1QB1A 4ABJA 1PPGE 3ODDA 1TWXB 1ESBA 1XUFA 3NPSA 5FX6A 1DWCH 4I33A 5DO4H 3RM2H 1IHSH 3A89A 4IW4E 1TMBH 1BBRE 2CN0H 4A5TS 4I7YH 1SQAA 2O8UA 1AE5A 1MBQA 2BXTH 7LPRA 3M5OA 1HPGA 2HNTC 1HAVA 2FI4E 1ZLRA 5L2ZH 2VIWA 1D3PB 1Z8RA 3CP7A 2FOFA 2FTLE 1Q3XA 4FUHA 5DP3A 1V2UT 4FVDA 2O8LA 2H6MA 4IGDA 1O5AB 1SB1H 4JCNA 1LVMA 2TRMA 2ZCKP 1BMMH 5ESBA 2G81E 2P94A 2BD9A 9LPRA 1LVBA 2LNCA 4YT7H 4K1SA 5E0JA 5ETXA 1E37B 2QXGA 1W0ZU 1YYY1 1SGFG 2ODYB 3M5NA 1IQHA 3RU4E 1V2VT 1C4U2 1J8AA 3TK5A 2F3CE 1G3EA 1K1IA 1XKBC 2AMPA 3SOSA 4THNH 5FPSA 1OYTH 1TPSA 1UCYK 3UPEA 3UIRA 2Z9KA 1O5EH 1L1JA 3RLWH 1G9IE 3UY9A 1CBWB 1KXEA 1TBZH 1MKWH 1HYLA 4NZQA 1GGDC 4H42U 7ESTE 1MKXK 4IBLH 2SNWA 1O31A 5H4IB 1DITH 4KKDA 2A5KA 1O3GA 5A8ZA 3SN8A 4JYUH 1SVPA 1V2MT 1NT1A 1MCTA 3O8RA 4BANB 1AHTH 1TB6H 2G52A 1G2LA 4K1TA 2PTNA 3MH6A 4OS6A 2UUJB 4AN7A 1QA0A 3T28A 1DXWA 3BEUA 3BTFE 1LDTT 2EA3A 2GV7A 1MZAA 1ZTJA 5C5NA 2AIQA 1FLEE 4BTTB 3NWUA 2Y80A 1TA2A 3O8DA 1AFQB 1EP6A 5EGMA 2VIVA 1O2LA 1L1GA 2F91A 3GDVA 6GCHF 1C1NA 2FMJA 3BG8A 1FY8E 1P2KA 1O2GH 2PKSB 3NCLA 2GTBA 2BD4A 2STBE 5JBCS 1WV7H 4AG1A 4ABBA 1CHOG 3KNXA 2G5NA 1H9IE 3SGQE 1EJAA 1AKSB 1THRH 1TGSZ 3SHAH 5DP8A 5C1YA 3PTNA 1HAVB 1EB2A 3SNEA 1SGCA 4CRDA 1GHYH 5A0CA 4VGCB 3JZ2B 1GJDB 1W7GH 3NKKA 4WWYA 1PQ7A 1O3HA 3TH3H 3A84A 4ZAEA 3GDUA 1ORFA 1EPTB 3RXTA 1JBUH 1PFXC 2D26C 1O3IA 3SZNA 3QGJA 4OS4A 2Z9JA 1FZZA 2BD2A 4ZHAA 1NZQH 3RXFA 4X1PU 1QR3E 3BG4B 1O5GH 1IQKA 1A61H 1ARCA 2HRVA 4A92A 1HAIH 2STAE 1QA7A 3B9FH 3S9CA 1EB1H 4BXWA 2VIPA 3LGUA 2ESTE 2PGBB 1THSH 1UTJA 2Y82A 1QRWA 1TA6A 3RXAA 3WY8A 1FDPA 2Y81A 4B74A 1ZTLA 4X0WU 4ZMAH 2F9VA 3T27A 1H8DH 2QCYA 1ELDE 1RTLA 2XC0A 1CHGA 1AB9B 1HJAB 1SGYE 3RXOA 3EAJA 4X8SH 3GOVB 3P95A 3S7KB 1ANEA 2FLRH 2BLQA 2ZDAH 4CH2B 1TNGA 3GICB 2OQUA 4A7IB 3SV9A 2ZP0H 3EA8A 4CHAC 1GBAA 4R8TB 1FN6A 1HRTH 4AB8A 3KQDA 5FPTA 1LVYA 4IC6A 3Q3KA 2A4QA 1P2NA 3U69H 2BX3A 1ZHPA 3RUOA 1SLVB 2R3YA 1YKTA 4WMDA 2RA3A 4I8HA 1D3DB 5EG4A 3BTEE 3P8FA 1UTMA 8LPRA 3D23A 3CENA 1N1LA 3LKWA 4IMZA 4RSPA 2G55A 2A31A 1JIRA 4O3TA 1O3MA 2FI5E 1BDAA 3K65B 3ZVEA 1GBFA 3R3GB 5DK1A 1AIXH 4LOYH 2W3KA 4WJG2 4TYDA 2W5EA 1ZPCA 4B1TA 8GCHF 5JBAS 1KIGH 1C1PA 3C1KA 1YPGH 1GVKB 1P2MA 3BSQA 4R0IA 4MLFB 1NFWA 1S6HA 3SV2H 1GJBB 2VGCC 5EXMA 4X2XA 4K8BA 4FUJA 1OWDA 2BVRH 1B5GH 4INLA 1ANDA 4TWWA 1NFUA 2WV5A 3SBKA 5DP4A 5C1UA 3NK8A 2Z94A 2Q6FA 1UVOA 1EP5A 4BAHB 1B0EA 1RXPA 3LOXA 1O3JA 1F0UA 1JRSA 2OQ5A 1XX9A 2NWNA 3K2UA 4LK4A 1MMJN 3A7XA 3F9GA 3TJOA 1SGTA 4I8LA 1UTOA 1DM4B 1RTKA 1BMLA 1GDNA 2ZHQH 4WXVA 2R2WU 3MWIU 3LGWA 1G30B 1NC6A 4WMFA 2BDHA 1Y3XA 3O8BA 2ULLA 4JK6A 1HXFH 1YPLH 1SGPE 3RP2A 2BLOA 2SGEE 1QJ1B 3HGPA 1P9UA 2AEIH 2ZTYA 1OWKA 4NA7A 3RM0H 1INCA 1FN8A 2F9OA 4MDSA 1CQQA 1FJSA 2WPKS 1LPGB 2QXHA 1EAWA 1P9SA 5F6MA 3RC4A 2JETC 1D3QB 4DURA 1P3EA 3ENSB 4ISOA 4J2YB 2CHAC 1NS3A 2C3SA 3U8OH 1KYNA 4K8YA 4D7FA 1A3BH 4K60A 2ZZUH 2AMQA 1GMDF 3KQEA 4ISIH 1YPKH 6CHAB 1F5KU 1EZXC 2XYAA 4BAKB 1O2NA 2ZCLP 1DT2A 1GI5A 1VCWA 1PQAA 1CGHA 3SJOA 1P12E 3RXEA 1F0TA 3S9BA 1TX7A 4GCHF 4LXBH 2RA0A 1UCYE 2FWWA 1AMHA 5FBIA 1ZSLA 2B7DH 1V2RT 1K1PA 1HNEE 1A5IA 1D3TB 2CXVA 2ANMH 1GI4A 3RXMA 1TX6A 4ZKNU 4XOJA 4OS2A 2GGVB 3ATWA 2WV4A 3K6YA 2FO9A 1SC8U 5EPYA 1P8VC 4B75A 1BRUP 2GVFA 2G4TA 2I6SA 3AVZA 5FAHA 3A7TA 3SUFA 3SU3A 1GHZA 3FVFB 1VJ9U 1FY1A 3MU1A 1A7SA 1C1MA 4BAQB 3QTOH 4Y11E 1QJ7B 1BHXB 4SGBE 1K9OE 5DP7A 4Q7ZA 3SUEA 3TIUA 3D49H 5CHAC 4NGAH 5DGJA 3TH4H 3M36A 4X1NU 4ABDA 4MG3A 1C1UH 1GJ4H 8GCHG 1KSNA 1KDQA 3PLKA 3ELAH 2Z9LA 4DY7B 2VIOA 3UQOA 1T31A 1WQVH 4MNYA 4X8UH 1SSXA 3O8CA 3URCA 4D7GA 1W12U 4NA9H 2FS8A 4AG2A 1GCDA 3LC5A 4X1RU 3SU5A 3RXUA 4BTUB 1ANBA 1GHXH 1CA0B 5F8TA 1FPCH 2AFQB 2QYIA 3LDXH 1H1BA 3OY6U 4AGKA 1FXYA 1OOKB 2FXRA 1CE5A 2OC7A 2AS9A 3PWBA 2ZTXA 4RN6A 4GLYA 2FI3E 2OXSA 1XM1A 2TPIZ 1GVLA 5EW1H 1EX3A 5F8ZA 3D65E 3GY7A 1IQEA 2JKHA 1P04A 1TNIA 2VIQA 2BY7X 3BIUH 3QGNB 1HAZB 4CRFA 3PWCA 1AN1E 1MQ5A 3SJKA 5EW2H 3LC3A 2OD3B 3SJ8A 1A0JA 2VIDA 1Q2WA 3MU5A 1AQ7A 3MYWA 1L2EA 3VPKA 4Q7YA 1EKBB 1UHBA 2ZHDA 2FODA 4ABFA 1C1VH 2ZGBH 2XCNA 3MH7A 3M7QA 1DS2E 3MO9A 3UR9A 1FI8A 1C2KA 1MQ6A 1YLDA 3HKIB 3TGJE 2QA9E 1M9UA 4MPUA 1ELEE 1WU1A 1LKBA 1C1WH 1SR5C 2YOLA 1ELAA 1BRBE 1ELTA 1TGNA 3LPRA 3M37A 4ZKOU 1W13U 2H2ZA 1ZRBA 1SBWA 1WYKA 1V2LT 4AYYB 1A0LA 2H9EH 2GZ7A 4E05H 1AWHB 1BMAA 1LKAA 1Z1JA 5E0HA 2BMGB 3VB6A 2FLBH 1G3CA 3LJJA 2CV3A 3D62A 5PTPA 3MO6A 2FOMB 2JH0D 1UVUH 1RJXB 3PMHB 1GCTC 4Y8XA 1E34B 1RIWB 1ETTH 1O2ZA 2ZGHA 2BTCE 2Y5FA 3E0PB 1CGJE 5C20A 4WMEA 1O35A 1O2PA 3VEQB 1D4PB 2BOHB 4TY7A 2TBSA 4OS5A 4B71A 4YOGA 4CRAA 3AASA 5IDKA 1LQDB 2DE8A 1HJ9A 1N6XA 3BV9B 1LMWB 3FP6E 3IG6B 3PMBB 4UFEH 1BUIA 4DVAU 1GJ9B 1GJ5H 4Y6DA 1A2CH 3BTKE 2C8YB 4FU9A 1SGQE 1GHWH 3MO3A 2PUXB 2ZFQH 3RXPA 4FU8A 3A7WA 3OU0A 1BHXF 4AORA 1YPHE 1CGIE 3OX7U 1P0SH 5AFZH 3RXBA 4X8VH 4YO9A 2J92A 2WINI 3Q00A 2QXJA 4X8TH 3RXLA 2B8OH 5FXLA 3KQBA 3GY3A 4FXGH 1C5SA 1Y59T 1OYQA 4AX9H 1DXPA 1V2TT 1XVMA 2FEQH 3EYDA 4NIYA 1NTPA 3ITIA 4U2WA 1FY4A 4ZHLU 1OP2A 1BMNH 3MU0A 1C5WB 1YCPK 2BXUH 3E16B 2Y5HA 1ETRH 1ESAA 4MPWA 3VB5A 5TCAA 2OBQA 1VZQH 3M5LA 4GVUA 1D6WA 2A2XH 3K6ZA 1HIAA 5T3HA 1IQGA 3OYPA 3KF2A 3EQ0H 2VGCB 4AFSA 2GMTB 2ZDKA 5TJXA 1EZQA 1IOEA 1NROH 2UUKB 1TALA 2SGPE 2VVUA 1DANH 1BTHH 4NSYA 1PJPA 1J14A 1FV9A 3M35A 1O3DA 1X7AC 1CT4E 3H5CB 4B2CA 2GP9B 4KELA 2BY5X 1ABJH 2C8WB 3IWMA 2W7SA 3DUXH 1LQEA 2BY8X 3LH1A 4OGXA 3MI4A 3SV8A 5A2MH 1AD8H 3P8OA 1J16A 3SU4A 1GBTA 4HGCA 1MH0A 3SORA 4ZKRU 5C3NA 2OLGA 3PO1B 1WTGH 1F0SA 2BD3A 1C1OA 1OWHA 3E0NB 1GI8B 1O2SA 1O3NA 3MHWU 2TGPZ 3SGBE 4E7NA 4Y71A 1TGCA 2P95A 3F6UH 2F9NA 4ZXYH 1ZGIA 3SNBA 3TJNA 2O8WA 4X2YA 2PR3A 1O3OA 3TK6A 3AW0A 1BIOA 1VCPA 3F68H 3M3SA 2TGAA 2ANKH 2XC4A 2ZA5A 4HI3A 1GBEA 1S6FA 2ODQA 4JZIA 2QF0A 1O3AA 2CF9H 1ZRKA 2J2UA 4M7GA 1GI2A 3QO6A 6LPRA 2ZDMA 3EA7A 1P3CA 3ZZ5A 1D9IA 3VB4A 1ELGA 5F8XA 1SFQB 1QBOA 1KLJH 3RC6A 3SUDA 1QRZA 1C1RA 4MQAA 2H5CA 1K1OA 2G51A 2J34A 1GBKA 2J38A 1TMUH 2BD5A 1SGNE 2ZNKH 2A2QH 3EA9A 2ZGJA 1TABE 1SPJA 3QUMP 1GVZA 4DOQA 2IPHA 1ELCA 1NM6A 5HM2A 4D76A 4E06H 1DE7H 4DGJA 2GCHF 3ZV8A 1HIAB 3TJUA 1QURH 1OS8A 2VINA 1F92A 4FUFA 1AGJA 4GUXA 4WH8A 3ZZCA 4YLUA 4WVPE 1C4Y2 2EI6A 3UFAA 1FPHH 3TITA 2J95A 3GY4A 5ABWA 4JK5A 3LH3A 1TPOA 1O5FH 2FM2A 1FQ3A 4D9RA 2PGQB 1BTXA 1C5ZB 2QV1A 2F9PA 5JPMH 3P70B 3P8GA 1TRYA 1EZUC 2HOBA 1TRNA 1QY6A 2ILNA 1GI3A 1LPZB 3TPIZ 2Q6DA 3MNSA 3UNQA 5LGOA 1SGIB 3MU4A 1ZHRA 3U1JB 5HMAA 4CRBA 4TPYA 1DY9A 1SG8B 1QB9A 3KL6A 2GKVE 2BDYA 3VB3A 3ZZ9A 1G37A 1GJCB 1P11E 1QB6A 2CGAA 5IYTA 1KXDA 1EAUA 3EGKH 3T26A 4NA8A 4X6MA 3CS0A 3BTDE 4GCHG 3F9FA 3Q3XA 3PMAB 3LGVA 2OTVA 2R2MB 3E3TA 4HFPB 3TVJB 3SNAA 2ZO3H 1C2MA 4YESB 2XW9A 3FFGA 3C27B 1A0HB 5FBEA 2FP7B 5A0BA 1Z8JB 4D8NA 1AI8H 1EJMA 3S7HB 2C90B 1EXFA 1WOFA 4INKA 2B0FA 1TOCB 2AH4X 3MOCA 4O9VA 2HVXA 2XWAA 4Z6AH 2P93A 2CHAB 3UREA 1UTKA 4GHQA 1C5UA 3NXPA 3A83A 4WF8A 1EATA 1LHFH 2OC0A 1DDJA 4K2YA 1VCQA 2A5IA 2GD4B 3E91A 1YF4A 1TE0A 1V2KT 2QC2A 3U1IB 3GCHB 3RMLH 6CHAC 1DSTA 1C5LH 1ANCA 2FYRA 2AGIX 1GHAG 4O97A 2C93B 5A8XA 2PKAB 1AZ8A 1A5HA 7KMEH 2GV6A 1UVPA 1A46H 1CHOF 1RD3B 2ZI2H 2P16A 2SGQE 3I77A 3QN7A 3KEEA 4Q2KA 1DFPA 2THFB 2UWOA 1AE8H 1H4WA 1MU8B 5GIBA 4YM9A 1W2KH 3KQCA 1EASA 9ESTA 2PLXA 2ZU1A 2H5DA 5E0GA 5HM9A 1O33A 3RXCA 3ATIA 3ZZ4A 3U8TH 1S5SA 2VJ1A 1DUAA 3ATMA 5I25A 2YNAA 3RXHA 2WPLS 5GXPA 2ZGXH 1ACBE 1AVXA 5LH8A 3IITA 5C67A 1C5XB 1T8OA 3A88A 1V2NT 1FAKH 3ZV9A 1GDQA 2OUAA 4KTSA 1P02A 5LPEA 1TFXA 4XBBA 3SV6A 3OSYA 1HCGA 3ZVFA 5FCKA 1NRSH 2B9LA 1SGDE 1O5BB 4CBNA 1PYTD 2SFAA 4OGYA 2NU4E 3MTYA 3V12A 3GY5A 5CMXH 3SGAE 4F4OC 1QNJA 1XKAC 1C1QA 1ZMLA 2FTMA 3BTHE 5K0HA 5AF9H 5GCHF 1GJ8B 3SJ9A 1GJ6A 1SMFE 2ZTZA 3RXVA 3SHCH 1TQ0B 1L1NA 3A7YA 3U98H 1K1JA 2QF3A 4AFQA 3ZZBA 1WCZA 4YOJA 1MTSA 1TIOA 5A09A 1P2OA 2K1QA 2Z3DA 5E2PA 5HGGA 2FS9A 1FY5A 1ZPBA 1F0RA 2FOEA 1C2HA 4H4FA 3QWCH 2WPJS 1DICA 1MAXA 1OX1A 1UK3A 2WPMS 4AFZA 3ZVAA 1K22H 2BLWA 1PPCE 4ZXXH 3TNTA 1O2WA 1ZZZA 2V35A 3BEIB 4BTIB 1O3KA 1S83A 2BD8A 2FYQA 2GCTC 2ZFFH 5ESTE 2IN2A 1T4UH 1CSOE 4NIWA 4K1EA 3W94A 2GCHG 1K28D 1GL0E 4XFQA 3ZZ8A 1ELVA 3LGTA 3RXJA 3SQHE 1SOZA 4KGAA 5EQQA 4DT7B 1PPBH 5DKMA 3AAVA 3ZYDA 3FP8E 2Z7FE 2JETB 5L30H 3DD2H 1EOJA 4A1VA 4U30A 1BRCE 3SW2B 3A82A 4I8JA 1O38A 1C5YB 1NPMA 3BIVH 2D8WA 3V3MA 1O2YA 1H8IH 4UDWH 4NWKA 4QT8C 3RC5A 2RG3A 2TGDA 4JZFH 5TCCA 2G8TA 1WSSH 1C5OH 1HDTH 1TNHA 3L33A 5FCRA 3RLYH 2VNTA 3RU4T 4LZ4B 1UTLM 1KXCA 1HB0B 2XTTB 3RXRA 2IJOB 1TQ7B 3TK9A 2PFEA 1NRNH 2FZZA 4IN2A 1B0FA 1O2XA 2YNBA 4A6LA 5JBBS 1HLTH 2G4UA 6GCHG 4B76A 1O5DH 1YC0A 3LONA 3BTQE 4A1TA 1AU8A 4Z0KA 1GI6A 2A1DB 3SU2A 2FOGA 1EPTA 1S0RA 1Z1IA 3HK6B 4Y0ZE 1O36A 1HV7A 1KXBA 1AUTC 1XVOA 1S85A 1YPJH 5EODA 1MBMA 1GMHG 1G2MA 3GYLB 2Q6GA 2V6NA 1YCPM 4MPXA 1EAXA 3SU0A 2XCFA 1E0FD 2GZ8A 1HFDA 1V2PT 4BAMB 5JB9S 1C2FA 2FIRH 1G36A 3UTUH 1O3EA 1UVTH 3F9HA 1ZOMA 1QL7A 1P09A 4K3JA 2FOCA 3P8NA 4YOIA 1KLIH 5G4BA 1F2SE 1QBVH 1RIWC 2CF8H 1XUHA 2AIPA 1C9TA 3RDZA 1P2JA 1BCUH 3MFJA 3VGCB 4KTCA 2ZG0H 2Y7ZA 1Z8IB 1LHCH 4D9QA 1AO5A 4KP0A 2AMDA 2FPZA 4ABGA 4JZDH 4NFEA 3GCHC 2W3IA 1UTPA 3GCNA 2DE9A 1QHRB 1TYNA 1T7CA 4GAWA 3VFEA 5EU8A 2WYJA 4ABEA 3LU9B 3MNBA 4GSOA 3PMJA 4XDEA 4JYVH 1OSSA 4X6OA 2ZGCA 2ZPRA 7GCHF 3FANA 3V0XA 4AFUA 3GY8A 3RXGA 4ABHA 1MKXH 2ZFSA 1O2MA 3MH4A 1SHYA 1QFKH 1QTFA 1TX8A 2VVVA 1TBRH 1P03A 1UCYH 2WUBA 2Y7XA 3MNXA 1DLEA 2EI8A 1QJ6B 3HGNA 1NY22 1S82A 1IQNA 3Q77A 3EE0B 1RS0A 1NFYA 2EC9H 1CT2E 2R0LA 3PYHA 3LIWA 4WXIA 2OCVB 3P92A 4MNXA 4AYVB 2PHBA 4DW2U 4O3UA 1Y3UA 5EQSA 3CS7A 3DFLA 3DHKH 1W8BH 3TH2H 4MVNA 2ZPSA 1FY3A 2P8OB 1HAYB 1KTSB 3H7OA 5HYOA 2HLCA 4UFFH 1F5RA 1FNIA 1GHBF 1WBGB 2WYGA 2FOHA 3VB7A 2P59A 2GZ9A 2P3FH 4XE4A 5A0AE 2H9TH 2P3UB 1GBLA 1ELFA 3V7TA 2AGEX 1F7ZA 1FIWA 4AZ2B 3PLPA 3AAUA 2BLVA 4Y8ZA 1ABIH 3NZIA 2Q1JA 1GBBA 1E36B 2GDDA 4FVBA 4BXSA 3MMGA 1GGDB 1B7XB 3QK1A 2XXLA 2Y6TA 3STJA 2OP9A 1SLWB 1SHHB 1J17T 5AHGH 2XNIA 1VGCB 1BB0B 3A8CA 1BRAA 1MD7A 5CHAB 2OC1A 5EXLA 2CMYA 2BVXH 1J15A 1EQ9A 1BZXE 1DSUA 3HPTB 3KGPA 3RXIA 3A8AA 1YM0A 1LHDH 1SOTA 1W3CA 1KTTB 2BQ6B 4JMYA 1UK2A 3SV7A 2ZWLH 1DUEA 3P17H 1JXPA 3E90B 3I78A 4GHTA 4CRGA 2BY9X 3HATH 1DVAH 4FU7A 1ZSKA 1C5QA 3H7TA 1Y3VA 1W0YH 3UOPA 5C2ZA 1KDQB 3LJOA 1BTYA 3GDSA 2HPQH 1Q31A 2JH6D 4NG9H 1QRXA 3TGIE 3BEFB 2UUFB 1EUFA 4ZKSU 1K1MA 2QGRA 1N8OC 1UHBB 4X6NA 1V2JT 1O2JA 4VGCC 1XUGA 4HZHA 2PWXA 5GDSH 2BX4A 1FONA 1MKWK 4ASHA 1SQTA 2R9PA 2QY0B 1G3BA 1TLDA 2M5TA 1QL9A 5T6GA 1C5MD 4NSVA 3URDA 3AW1A 1TPPA 1PPFE 1H9LB 3OY5U 2ANYA 3STIA 2WPIS 3SUGA 2SGAA 1IQJA 2ZF0H 2BDCA 2SGDE 3RXDA 4CREA 3DFJA 1C4V2 1GDUA 5T6DA 1DPOA 1AVGH 2XRCA 1BT7A 1GBJA 2OC8A 3TNSA 5DP6A 4DCDA 1CA8B 1L4DA 2HALA 2HWLB 1C5VA 1SLXB 1MUEB 2XBVA 1TNKA 2VWMA 1E38B 3QTVH 5SGAE 1A3EH 1SI5H 1V2QT 3M3TA 4F49A 1MAYA 4NFFA 2ZHFH 3KN2A 1ZMJA 4MPVA 1P01A 1ZGVA 1V3XA 3PROA 2C4FH 3T5FH 3A7ZA 1YPHC 1XXDA 1GPZA 1ZMNA 3PM3A 5LPRA 1GMHF 3GISB 3HK3B 1TGBA 2AYWA 1FMGA 1YBWA 1O2QA 1IQIA 2KAIB 3ZZ7A 1MTNC 2VB0A 2EI7A 3ODFA 1BA8B 1EOLA 2GDEH 2LPRA 2H9HA 1EZSC 2G00A 2O8TA 3BF6H 1OP0A 1GG6C 2ZDLA 4BAOB 1GMCF 1OXGA 1WUNH 1UTNA 1BTWA 4I8KA 1J9CH 1FIZA 4UFGH 4TWYA 3FZDA 1ZTKA 2IOTA 2C8ZB 2RCEA 2ZU5A 5JBTA 3GY6A 2Z9GA 1HXEH 1U6QA 1TMTH 1P2IA 2ASUB 1XUIA 3ATLA 1G3DA 3SNDA 1YP9A 5K7RA 2OINA 5J4QA 4FUEA 2BDIA 2P8OC 3PTBA 1HAXB 1ZHMA 2CJIA 3ZVGA 1HGTH 2I6QA 4PROA 1IQMA 1WQSA 1GI0A 3RXKA 1AY6H 4WH6A 1T4VH 1TGTA 4U01A 1AWFH 5EQRA 2NU3E 5F03A 3ZVCA 4YLQH 1NRPH 1HUTH 4XBCA 3VXFH 1BITA 2PTCE 1MTWA 3OTJE 3ATKA 1GHBG 3QLPH 2J4IA 4Y76A 1C2LA 2TIOA 4UE7H 2Z3EA 1GBMA 1YGCH 4Y7AA 3LGIA 1NRQH 1CT0E 2A4OA 1KLTA 3T62A 1SLUB 2BZ6H 1MTNB 3UWJH 6ESTA 2KAIA 3MU8A 3QZQA 4Y7BA 5E2OA 3TJVA 2R0KA 4E7RG 4CH8B 3PLBA 1S0QA 2GMTC 3RXQA 1C1TA 2ZFPH 1FAXA 1DWDH 1N6YA 1SGEE 4ZHMU 2BVSH 1W14U 5EPNA 5GCHG 3SO3A 1O3BA 3A86A 2BZAA 2HNTE 1Z7KA 4K69A 1Y5BT 8ESTE 2A45B 1IQFA 1RGQA 2W7UA 4MTBA 1QL8A 1VITH 3TGKE 1XUKA 3UWIA 3LGYA 5C1XA 1DWBH 1YPEH 3K9XB 4Y10E 2F9UA 2ZU4A 2BHGA 4JZ1A 1HAPH 2XC5A 3MH5A 3A85A 1ELBA 1QQUA 1A4WH 2FX6A 1BOQA 4X2WA 5I46H 1O2TA 1TONA 1O0DH 1O37A 4O03A 1C2IA 4H6SB 1AFEH 2WUCA 1OWJA 2RDLA 1O2HA 2NU2E 2A0QB 3SI4H 3S0NA 4IC5A 4RKJB 1UMAH 4NIVA 1GWAA 4UFDH 4XBDA 5AVDA 2BDBA 1XUJA 1RRKA 2QAAA 4X1SU 1SGFA 3BN9A 2TGTA 1TBQH 2QN5T 3UNRA 2VU8E 1V2WT 2ZC9H 2A5AA 1CBWC 2FESH 1C1SA 1F5LA 4UD9H 3L3TA 2A32A 4J1YA 1O2OA 1FUJA 1ZPZA 4B73A 4ISNA 3UOUA 2ZU3A 1GHAF 2FX4A 1IQLA 4YZUA 1C2DA 1Z8GA 2A7CA 2UWPA 1DOJA 5BRRE 1ZR0A 1K1LA 2ZU2A 2BD7A 3M5MA 2SGFE 3ZYEA 2PKSC
chains in the Genus database with same CATH superfamily
1W10U 1TOMH 2VVCA 2D1JA 1O2VA 1PYTC 1SL3A 1KXAA 3RMNH 2JH5D 5B6LA 1ZSJA 2ZDVH 2JJ1D 3U9AH 1Z6EA 5A8YA 1IAUA 1CU1A 1S84A 1RTFB 4Y0YE 3ZZ6A 4ZH8A 1O2KA 3F9EA 1O2IA 3BTGE 3SNCA 2XBYA 2VWOA 1TRMA 1EFRD 1UK4A 1YCPH 2NU0E 3Q76A 4B2AA 1SFIA 2PSXA 3KHVA 1T8NA 2R3UA 3BG4C 1BTUA 3TU7H 1GHVH 3B8JA 1G32B 1YWUA 2HNTF 3GY2A 1GG6B 3M3VA 4FUDA 3SU1A 1MTVA 2ZEBA 1O3LA 3PV4A 1EPTC 1ARBA 4MNVA 3FP7E 3M61U 3T29A 2WPHS 1HAGE 3GS9A 2G5VA 1W7XH 4FUBA 4JYTA 3SI3H 3P6ZB 1RFNA 1HBTH 1C2JA 2QIQA 2PV9B 1GMCG 1T8LA 1UJ1A 2GX4A 2EEKA 1V6DA 3V13A 1BTZA 2V3OH 3T2NA 1GBHA 3ZZDA 1CO7E 1OKXA 3QDZB 4I32A 4CR9A 4FUGA 3RMOH 2F9BH 1NFXA 1KXFA 2XWBI 1QIXB 2ZHEH 2ALPA 2LP6A 2NU1E 5EOKA 5J4SA 1AB9C 1HJAC 3PB1E 1E35B 4SGAE 2J94A 1D6RA 1UTQA 4DIIH 3F1SB 1MD8A 2GT7A 1VR1H 1T8MA 2C8XB 5B6OA 2A4GA 1NO9H 3ZZ3A 2QXIA 1NRRH 1GI9B 1LHGH 1N8OB 1QBNA 2BY6X 1TPAE 3QZRA 4A1XA 1GJAB 2PKAA 1AUJA 2PW8H 5L6NH 5DP5A 4Y79A 1ID5H 1WTHD 4TPIZ 1AKSA 1GCTB 3FZZA 1BTPA 4YTAA 5L2YH 2AERH 4FOUC 1O39A 1S81A 3M7UA 1ZJKA 3W95A 1DLKB 4ISLA 3TLOA 1OP8A 3W1EA 5JYIA 5C5OA 1GMDG 1T32A 3A87A 1MZDA 1GI7B 1PPHE 5HXFA 1L4ZA 2ZQ2A 1BBRK 2A7HA 3JZ1B 5DPAA 1C2GA 3FKSD 3GCOA 2UWLA 1P05A 1W11U 2L6OA 3RMMH 1P2QA 1OWEA 1VJAU 5E8EH 2FDAA 1DWEH 1HAHH 1Y5UT 2HGTH 3GCTG 4I31A 2ZPQA 2BDGA 1K2I1 1L0ZA 1BJUA 1WAYB 4AB9A 4INHA 4NIXA 1EAIA 3ZVDA 1GBCA 2ANWA 2FOBA 4I8GA 1IHTH 4ZUHA 3KIDU 1K21H 2BQ7B 5AFYH 2FOAA 1NU9A 3ZZAA 4UONA 3BTWE 1MTUA 5T6FA 1YLCA 3N7OA 1A5GH 3A8DA 4Q80A 1DX5M 5FHTA 4HG6A 1C9PA 5DP9A 2XBXA 3OAAD 4DJZB 2YMSB 1V2OT 3GCTF 1Y5AT 1BJVA 4JZEH 1QGFA 4FUCA 1P57B 1O2RA 2PSYA 5C17A 3UQVA 4ABAA 4B2BA 4ISHH 1O34A 8KME2 5T1VA 2V0BA 5C0TA 4DG4A 1GJ7B 2BOKA 2ZQ1A 1NBMD 1JIMA 1QCPA 3Q3YA 1UO6A 2H1UA 1AZZA 1P10A 2Z9IA 1C5TA 3T25A 4XSKU 5CE1A 3EDXB 1HAOH 3A7VA 1MU6B 3LT3A 2XBWA 1OPHB 1JMOH 1H9HE 2ZKSA 3A81A 2BQWB 4GPGA 4OS1A 4CHAB 1TAWA 1Y3YA 1JRTA 1O30A 3S9AA 2F83A 1THPB 4K5ZA 2KZ4A 2B5TB 1A1RA 1SKYE 3UUZA 3N7DA 1LPKB 2VH6A 3R0FA 3PO1C 4IN1A 2J98B 1AVWA 4RKOB 2O9QA 1O3CA 1JOUB 1GBDA 4X2VA 3QX5H 1LHEH 1VITF 3GYMA 2GCTB 5FPYA 1ESTA 1GI1A 2V3HH 4ESTE 5GWZA 4IMQA 1GBIA 2BB4A 1YPMH 2ZHWH 2ZECA 2UUYA 3VXEH 5DG6A 4CRCA 1ZYOA 2BM2A 1AFQC 4ABIA 2ALVA 4ZROA 1Z71A 3A8BA 3G01A 1NN6A 4F48B 1PQ8A 1BQYA 1C2EA 3M7TA 4CR5A 2ZIQH 3UR6A 2Z3CA 1LTOA 4AOQA 2O8MA 4NCYA 3NUMA 1NU7B 1BBRH 3A80A 3DA9B 3S69A 1LVOA 2SNVA 2A4RA 1XMNB 1JWTA 3RXSA 1ZJDA 3DCLA 2HVYB 1O2UA 2OBOA 3BTTE 2VWNA 4KTUA 3BTME 1GL1A 1Z6JH 4AGJA 2DUCA 4X1QU 3E1XB 1NESE 5EXNA 2KX4A 2VWLA 2ODPA 3L6PA 1K1NA 1TNJA 1DY8A 2GT8A 2AGGX 2ZFRH 3SU6A 1TNLA 4YT6H 3SQEE 4NWLA 7GCHG 4UEHH 1SGRE 1HJ8A 4Q7XA 3DT0H 4NZLA 1COWD 2W26A 1LO6A 1LCYA 2P3TB 1CA0C 4FUIA 4WY3A 2EQNA 3I29A 4Y8YA 5FL7D 4Z1MD 5JB8S 1UVSH 1VGCC 2ZDNA 3E6PH 1C5NH 5BPEA 2ZFTA 1XXFA 3RU4D 5LPFA 2JJ2D 2BDAA 4IS5A 1PQ5A 4BNRA 4HTCH 5GJ4B 2V7QD 4CBOA 3ZVBA 1PPEE 4OS7A 1EJNA 1O3PB 3B23B 4U32A 1KY9A 1C5PA 3SJIA 1CVWH 3FAOA 3KCGH 1OWIA 1C5RA 3VGCC 2BYAX 3U8RH 2Z6BD 1P06A 2VH0A 1QQ4A 2ZCHP 2RDEA 1Y3WA 1V2ST 4DIHH 2PUQH 2HPPH 4TY6A 1O5CB 3MNCA 4H6TA 1ETSH 1PPZA 2J98A 4MNWA 3HKJB 1Y8TA 1MCVA 5GPIB 4BOHA 3ESTA 2Y5GA 1SQOA 3E8LA 5FX5A 4X6PA 1O32A 2A7JA 4LZ1H 5DJ7A 3UNSA 5JDUB 1VITG 2J9NA 1O3FA 2D2DA 1QB1A 4Q4LA 4ABJA 1PPGE 3ODDA 1TWXB 1ESBA 1XUFA 3NPSA 5FX6A 1DWCH 4I33A 5DO4H 3RM2H 1IHSH 3A89A 4IW4E 1TMBH 5KGOA 1OHHD 1BBRE 2CN0H 4A5TS 4I7YH 1SQAA 2O8UA 1AE5A 1MBQA 1MABB 4AC9A 2BXTH 7LPRA 3M5OA 1HPGA 2HNTC 1HAVA 2FI4E 1ZLRA 5L2ZH 2VIWA 1D3PB 1Z8RA 3CP7A 2FOFA 2FTLE 1Q3XA 4FUHA 5DP3A 1V2UT 4FVDA 2RFKC 2O8LA 2H6MA 4IGDA 1O5AB 1SB1H 4JCNA 1LVMA 2TRMA 2ZCKP 1BMMH 3F0OA 5ESBA 2G81E 2P94A 2BD9A 9LPRA 1LVBA 2LNCA 4YT7H 4K1SA 5E0JA 5ETXA 1E37B 2QXGA 1W0ZU 1YYY1 1SGFG 2ODYB 3M5NA 1IQHA 3RU4E 1V2VT 1C4U2 1J8AA 3TK5A 2F3CE 1G3EA 1K1IA 1FX0B 1XKBC 2AMPA 3SOSA 4THNH 5FPSA 1OYTH 1TPSA 1UCYK 3UPEA 3UIRA 2Z9KA 1O5EH 1L1JA 3RLWH 1G9IE 3UY9A 1CBWB 1KXEA 1TBZH 1MKWH 1HYLA 3OE7D 4NZQA 1GGDC 3SZEA 4H42U 7ESTE 1MKXK 4IBLH 2SNWA 1O31A 5H4IB 1DITH 4KKDA 2A5KA 1O3GA 5A8ZA 3SN8A 4JYUH 1SVPA 1V2MT 1NT1A 1MCTA 3O8RA 4BANB 1AHTH 1TB6H 2G52A 1G2LA 4K1TA 2PTNA 3MH6A 4OS6A 2UUJB 4AN7A 1QA0A 3T28A 5C0UA 1DXWA 3BEUA 3BTFE 1LDTT 2EA3A 2GV7A 1MZAA 1ZTJA 3PV2A 5C5NA 2AIQA 1FLEE 4BTTB 3NWUA 2Y80A 1TA2A 3O8DA 1AFQB 1EP6A 5EGMA 2VIVA 1O2LA 1L1GA 2F91A 3GDVA 6GCHF 1C1NA 2FMJA 3BG8A 1FY8E 1P2KA 1O2GH 2PKSB 1QZ8A 3NCLA 2GTBA 2BD4A 2STBE 5JBCS 1WV7H 4AG1A 2WPDD 4ABBA 1CHOG 1WDIA 3KNXA 2G5NA 1H9IE 3SGQE 1EJAA 1AKSB 1THRH 1TGSZ 3SHAH 5DP8A 5C1YA 4ACAA 3PTNA 1HAVB 1EB2A 3SNEA 1SGCA 4CRDA 1GHYH 5A0CA 4VGCB 3JZ2B 1GJDB 1W7GH 3NKKA 3H09A 4WWYA 1PQ7A 1O3HA 3TH3H 3A84A 4ZAEA 3GDUA 1ORFA 1EPTB 3RXTA 1JBUH 1PFXC 2D26C 1O3IA 3SZNA 3QGJA 4OS4A 2Z9JA 1FZZA 2BD2A 4ZHAA 1NZQH 3RXFA 4X1PU 3SYJA 1QR3E 3BG4B 1O5GH 1IQKA 1A61H 1ARCA 2HRVA 4A92A 1HAIH 2STAE 1QA7A 3B9FH 3S9CA 1EB1H 4BXWA 2VIPA 3LGUA 3UB0A 2ESTE 2KCOA 2PGBB 1THSH 1UTJA 2Y82A 1QRWA 1TA6A 3RXAA 3WY8A 2J97A 1FDPA 4ZCNA 2Y81A 4B74A 1ZTLA 3OFND 4X0WU 1BMFD 4ZMAH 2F9VA 3T27A 1H8DH 2QCYA 1ELDE 1RTLA 2XC0A 1CHGA 1AB9B 1HJAB 1SGYE 3RXOA 3EAJA 4X8SH 3GOVB 3P95A 3S7KB 1ANEA 2FLRH 4XRNA 2BLQA 2ZDAH 4CH2B 1TNGA 3GICB 2OQUA 4A7IB 3SV9A 2ZP0H 3EA8A 4CHAC 1GBAA 4R8TB 1FN6A 1HRTH 4AB8A 3KQDA 5FPTA 1LVYA 4IC6A 3Q3KA 2A4QA 1P2NA 3U69H 2BX3A 1ZHPA 3RUOA 1SLVB 4P02A 2R3YA 4FETA 5DSFA 1YKTA 1E1RD 4WMDA 2RA3A 4I8HA 1D3DB 5EG4A 3BTEE 3P8FA 1UTMA 8LPRA 3D23A 3CENA 1N1LA 3LKWA 4IMZA 4RSPA 2G55A 2A31A 1JIRA 4O3TA 1O3MA 2FI5E 1BDAA 3K65B 3ZVEA 1GBFA 3R3GB 5DK1A 1AIXH 4LOYH 2W3KA 4WJG2 4TYDA 2W5EA 1ZPCA 4B1TA 8GCHF 5JBAS 1KIGH 1C1PA 5EJLA 3C1KA 1YPGH 1GVKB 1P2MA 3BSQA 4R0IA 4MLFB 1NFWA 1S6HA 3SV2H 1GJBB 2VGCC 5EXMA 4X2XA 4K8BA 4FUJA 1OWDA 2BVRH 1B5GH 4INLA 1ANDA 4TWWA 1NFUA 2WV5A 3SBKA 5DP4A 5C1UA 3NK8A 2Z94A 2Q6FA 1UVOA 1EP5A 4BAHB 1B0EA 1RXPA 3LOXA 1O3JA 1F0UA 1JRSA 2OQ5A 1XX9A 2NWNA 3K2UA 4LK4A 1MMJN 3A7XA 3F9GA 4OM9A 3TJOA 1SGTA 4I8LA 1UTOA 1DM4B 1RTKA 3ZIAD 1BMLA 1GDNA 2ZHQH 4WXVA 2R2WU 3MWIU 3LGWA 1G30B 1NC6A 4WMFA 2BDHA 1Y3XA 3O8BA 2ULLA 4JK6A 1HXFH 1YPLH 1SGPE 3RP2A 2BLOA 2SGEE 1QJ1B 3OEHD 3HGPA 1P9UA 2AEIH 2ZTYA 1OWKA 4NA7A 3RM0H 1INCA 1FN8A 2F9OA 4MDSA 1CQQA 3N7EA 1FJSA 2WPKS 1LPGB 2QXHA 1EAWA 1P9SA 5F6MA 3RC4A 2JETC 1D3QB 4DURA 1P3EA 3ENSB 4ISOA 4J2YB 2CHAC 1NS3A 2C3SA 1VKYA 3U8OH 1KYNA 4K8YA 4D7FA 1A3BH 4K60A 2QF4A 2ZZUH 2AMQA 1GMDF 3KQEA 4ISIH 1YPKH 6CHAB 1F5KU 1EZXC 2XYAA 4BAKB 1O2NA 2ZCLP 1DT2A 1GI5A 1VCWA 1PQAA 1CGHA 3SJOA 1P12E 3RXEA 1F0TA 3S9BA 1TX7A 4GCHF 4LXBH 2RA0A 1UCYE 2FWWA 1AMHA 5FBIA 1ZSLA 2B7DH 1V2RT 1K1PA 1HNEE 1A5IA 1D3TB 2CXVA 2ANMH 3WWBA 1GI4A 3RXMA 1TX6A 4ZKNU 4XOJA 4OS2A 2GGVB 3ATWA 2WV4A 3K6YA 2FO9A 1SC8U 5EPYA 1P8VC 4B75A 4I86A 1BRUP 2GVFA 2G4TA 2I6SA 3F2HA 3AVZA 5FAHA 3A7TA 3SUFA 3SU3A 1GHZA 3FVFB 1VJ9U 2IJD1 1FY1A 2K0QA 3MU1A 1A7SA 1C1MA 4BAQB 3QTOH 4Y11E 1QJ7B 1BHXB 4SGBE 3MQKC 1K9OE 5DP7A 3PRBA 4Q7ZA 3SUEA 3TIUA 3D49H 5CHAC 4RI0A 4NGAH 5DGJA 3TH4H 3M36A 4X1NU 4ABDA 4MG3A 1C1UH 1GJ4H 8GCHG 1KSNA 1KDQA 3PLKA 3ELAH 2Z9LA 4DY7B 2VIOA 3UQOA 1T31A 1WQVH 4MNYA 4X8UH 1SSXA 3O8CA 3URCA 4D7GA 1W12U 4NA9H 2FS8A 4AG2A 1GCDA 3LC5A 4X1RU 3SU5A 3RXUA 4BTUB 1ANBA 1GHXH 1CA0B 5F8TA 1FPCH 2AFQB 2QYIA 3LDXH 1H1BA 3OY6U 4AGKA 1FXYA 1OOKB 3PRDA 2FXRA 1CE5A 2OC7A 2AS9A 3PWBA 2ZTXA 4RN6A 4GLYA 2FI3E 2OXSA 5EJ1A 1XM1A 2TPIZ 1GVLA 5EW1H 1WXRA 1EX3A 5F8ZA 3D65E 3GY7A 1IQEA 2JKHA 1P04A 1TNIA 2VIQA 2BY7X 3BIUH 3QGNB 1H8ED 1HAZB 4CRFA 3PWCA 1AN1E 1MQ5A 3SJKA 5EW2H 3LC3A 2OD3B 3SJ8A 1A0JA 2VIDA 1Q2WA 3MU5A 1AQ7A 3MYWA 1L2EA 3VPKA 4Q7YA 1EKBB 1UHBA 2LELA 2KCPA 2ZHDA 2FODA 4ABFA 1C1VH 2ZGBH 2XCNA 3MH7A 3M7QA 1DS2E 3MO9A 3UR9A 1FI8A 1C2KA 1MQ6A 1YLDA 3HKIB 3TGJE 2QA9E 1M9UA 4MPUA 1ELEE 1WU1A 1LKBA 1C1WH 1SR5C 2YOLA 1ELAA 1BRBE 1ELTA 1TGNA 3LPRA 3M37A 4ZKOU 1W13U 2H2ZA 1ZRBA 1SBWA 3FO8D 1WYKA 1V2LT 4AYYB 1A0LA 2H9EH 2GZ7A 4E05H 1AWHB 1BMAA 1LKAA 1Z1JA 5E0HA 2BMGB 3VB6A 2FLBH 1G3CA 2W6JD 3LJJA 2CV3A 3D62A 5PTPA 3MO6A 2FOMB 2JH0D 1UVUH 1RJXB 3PMHB 1GCTC 4Y8XA 1E34B 1RIWB 1ETTH 1O2ZA 2ZGHA 2BTCE 4ACBA 2Y5FA 3E0PB 1CGJE 5C20A 4WMEA 1O35A 1O2PA 3VEQB 1D4PB 2BOHB 4TY7A 2TBSA 3OTPA 4OS5A 1H8HD 4B71A 4YOGA 4CRAA 3AASA 5IDKA 1LQDB 2DE8A 1HJ9A 1N6XA 3BV9B 1LMWB 3FP6E 3IG6B 3PMBB 4UFEH 1BUIA 4DVAU 1GJ9B 1GJ5H 4Y6DA 1A2CH 3BTKE 2C8YB 4FU9A 1SGQE 1GHWH 3MO3A 2PUXB 2ZFQH 3RXPA 4FU8A 3A7WA 3OU0A 1BHXF 4AORA 1YPHE 1CGIE 3OX7U 1P0SH 5AFZH 3RXBA 4X8VH 4YO9A 2J92A 2WINI 3Q00A 2QXJA 4X8TH 3RXLA 2B8OH 5FXLA 3KQBA 3GY3A 4FXGH 1C5SA 2AHME 3U28C 1Y59T 5DN6D 1OYQA 4AX9H 1DXPA 1V2TT 1XVMA 2FEQH 3EYDA 4NIYA 1NTPA 3ITIA 4U2WA 1FY4A 4ZHLU 3VG8A 1OP2A 1BMNH 3MU0A 1C5WB 1YCPK 2BXUH 3E16B 2Y5HA 1ETRH 1ESAA 4MPWA 3VB5A 5TCAA 2OBQA 1VZQH 3M5LA 4GVUA 1D6WA 2A2XH 3K6ZA 1HIAA 5T3HA 1IQGA 3OYPA 3KF2A 3EQ0H 1UW7A 2VGCB 4AFSA 2GMTB 2ZDKA 5TJXA 1EZQA 1IOEA 1NROH 2UUKB 1TALA 2SGPE 2VVUA 1DANH 1BTHH 4NSYA 1PJPA 1J14A 1FV9A 3M35A 1O3DA 1X7AC 1CT4E 3H5CB 2KCAA 4B2CA 2GP9B 4KELA 1K0HA 2BY5X 1ABJH 2C8WB 3IWMA 2W7SA 3DUXH 1LQEA 2BY8X 3LH1A 4M9FA 3MI4A 4OGXA 3SV8A 5A2MH 1AD8H 3P8OA 1J16A 3SU4A 1GBTA 4HGCA 1MH0A 3SORA 3OEED 5F53A 4ZKRU 5C3NA 2OLGA 3PO1B 1WTGH 1F0SA 2BD3A 1C1OA 1OWHA 3E0NB 1GI8B 1O2SA 1O3NA 3MHWU 2TGPZ 3SGBE 4E7NA 4Y71A 1TGCA 2P95A 3F6UH 2F9NA 4ZXYH 1ZGIA 3SNBA 3DSOA 3TJNA 2O8WA 4X2YA 2PR3A 1O3OA 3TK6A 3AW0A 1BIOA 1VCPA 3F68H 3M3SA 2TGAA 2ANKH 2XC4A 2ZA5A 4HI3A 1GBEA 1S6FA 2ODQA 4JZIA 2QF0A 1O3AA 2CF9H 2IPQX 1ZRKA 2J2UA 4M7GA 1GI2A 3QO6A 6LPRA 2ZDMA 3EA7A 1P3CA 3ZZ5A 1D9IA 3VB4A 1ELGA 5F8XA 1SFQB 1QBOA 5GNDA 1KLJH 5HKKD 3RC6A 3SUDA 1QRZA 1C1RA 4MQAA 2H5CA 1K1OA 2G51A 2J34A 1GBKA 2J38A 1TMUH 2BD5A 1SGNE 2ZNKH 2A2QH 3EA9A 2ZGJA 1TABE 1SPJA 3QUMP 1GVZA 4DOQA 2IPHA 1ELCA 1NM6A 5HM2A 4D76A 1YLNA 5HIYA 4E06H 1DE7H 4DGJA 2GCHF 3ZV8A 1HIAB 3TJUA 1QURH 1OS8A 2F43B 2VINA 1F92A 4FUFA 1AGJA 4GUXA 4WH8A 3ZZCA 4YLUA 4WVPE 1C4Y2 2EI6A 3UFAA 1FPHH 3TITA 2J95A 3GY4A 3WWFA 2L74A 5ABWA 4JK5A 3LH3A 1TPOA 1O5FH 2FM2A 1FQ3A 4D9RA 2PGQB 1BTXA 1C5ZB 2QV1A 2F9PA 5JPMH 3P70B 3P8GA 1TRYA 1EZUC 2HOBA 1TRNA 1QY6A 2ILNA 1GI3A 1LPZB 3TPIZ 2Q6DA 3MNSA 3UNQA 5LGOA 1SGIB 3MU4A 1ZHRA 3U1JB 5HMAA 4CRBA 4TPYA 1DY9A 1SG8B 1QB9A 3KL6A 2GKVE 2BDYA 3VB3A 3ZZ9A 1G37A 1GJCB 4RT0A 1P11E 1QB6A 2CGAA 5IYTA 1KXDA 2QF5A 1EAUA 3EGKH 3T26A 4NA8A 4X6MA 3CS0A 2JIZD 3BTDE 4GCHG 3F9FA 3Q3XA 3PMAB 3LGVA 2OTVA 2R2MB 3E3TA 4HFPB 3TVJB 3SNAA 2ZO3H 1C2MA 4YESB 2XW9A 1W0KD 3FFGA 3C27B 1A0HB 5FBEA 2FP7B 5A0BA 1Z8JB 4D8NA 1AI8H 1EJMA 5CHBA 3S7HB 2C90B 1EXFA 1WOFA 4INKA 2B0FA 1TOCB 2AH4X 3MOCA 4O9VA 2HVXA 2XWAA 4Z6AH 2P93A 2CHAB 3UREA 1UTKA 4GHQA 1C5UA 3NXPA 3A83A 4WF8A 1EATA 1LHFH 2OC0A 1DDJA 4K2YA 1VCQA 2A5IA 2GD4B 3E91A 1YF4A 2OK5A 5IK2D 1TE0A 1V2KT 2QC2A 3U1IB 3GCHB 3RMLH 6CHAC 1DSTA 1C5LH 1ANCA 2FYRA 2AGIX 1GHAG 4O97A 2C93B 2KFWA 5A8XA 2PKAB 1AZ8A 1A5HA 7KMEH 2GV6A 1UVPA 1A46H 1CHOF 1RD3B 2ZI2H 2P16A 2SGQE 3I77A 3QN7A 2J5UA 3KEEA 4Q2KA 1DFPA 2THFB 2UWOA 1AE8H 1H4WA 1MU8B 5GIBA 4YM9A 1W2KH 3KQCA 1EASA 9ESTA 2PLXA 2ZU1A 2H5DA 5E0GA 5HM9A 1O33A 3RXCA 3ATIA 3ZZ4A 3U8TH 1S5SA 2VJ1A 1DUAA 3ATMA 5I25A 2YNAA 3RXHA 2WPLS 5GXPA 2ZGXH 1ACBE 1AVXA 5LH8A 3IITA 5C67A 1C5XB 1T8OA 3A88A 1V2NT 1FAKH 3ZV9A 1GDQA 2OUAA 4KTSA 1P02A 5LPEA 1TFXA 4XBBA 3SV6A 3OSYA 1HCGA 3N99A 3ZVFA 5FCKA 1NRSH 2B9LA 1KMHB 1SGDE 1O5BB 5CDFE 4CBNA 1PYTD 2SFAA 3NRLA 4OGYA 2NU4E 3MTYA 3V12A 3GY5A 5CMXH 3SGAE 4F4OC 1QNJA 1XKAC 1C1QA 1ZMLA 2FTMA 3BTHE 5K0HA 5AF9H 5GCHF 1GJ8B 3SJ9A 1GJ6A 1SMFE 2ZTZA 3RXVA 3SHCH 1TQ0B 1L1NA 3A7YA 3U98H 1K1JA 2QF3A 4AFQA 3ZZBA 1WCZA 4YOJA 1MTSA 1TIOA 5A09A 2WSSD 1P2OA 2K1QA 2Z3DA 5E2PA 5HGGA 2FS9A 1FY5A 1ZPBA 1F0RA 2FOEA 1C2HA 4H4FA 3QWCH 2WPJS 1DICA 1MAXA 1OX1A 1UK3A 2WPMS 4AFZA 3ZVAA 1K22H 2BLWA 1PPCE 4ZXXH 3TNTA 1O2WA 1ZZZA 2V35A 3BEIB 4BTIB 1O3KA 1S83A 2BD8A 2FYQA 2GCTC 2ZFFH 5ESTE 2IN2A 1T4UH 1CSOE 4NIWA 4K1EA 3W94A 2GCHG 1K28D 1GL0E 4XFQA 3ZZ8A 1ELVA 3LGTA 3RXJA 3SQHE 1SOZA 4KGAA 5EQQA 4DT7B 1PPBH 5DKMA 3AAVA 3ZYDA 3FP8E 2Z7FE 2JETB 5L30H 3DD2H 1EOJA 4A1VA 4U30A 1BRCE 3SW2B 3A82A 4I8JA 1O38A 1C5YB 1NPMA 3BIVH 2D8WA 3V3MA 1O2YA 1H8IH 4UDWH 4NWKA 4QT8C 3RC5A 2K8IA 2RG3A 2TGDA 4JZFH 5TCCA 2G8TA 1WSSH 3EE7A 1C5OH 1HDTH 1TNHA 3L33A 5FCRA 3RLYH 2VNTA 3RU4T 1NBME 4LZ4B 1UTLM 1KXCA 1HB0B 2XTTB 3RXRA 2IJOB 1TQ7B 3TK9A 2PFEA 1NRNH 2FZZA 4IN2A 1B0FA 1O2XA 2YNBA 4A6LA 5JBBS 1HLTH 2G4UA 6GCHG 4B76A 1O5DH 1YC0A 3LONA 3BTQE 4A1TA 1AU8A 4Z0KA 1GI6A 2A1DB 3SU2A 2FOGA 1EPTA 1S0RA 1Z1IA 3HK6B 4Y0ZE 1O36A 1HV7A 1KXBA 1AUTC 1XVOA 1S85A 1YPJH 5EODA 1MBMA 1GMHG 1G2MA 3GYLB 2Q6GA 2V6NA 1YCPM 4MPXA 2EY4C 1EAXA 3SU0A 1E0FD 2GZ8A 2XCFA 1HFDA 1V2PT 4BAMB 5JB9S 3F2GA 1C2FA 2FIRH 1G36A 3UTUH 4YXWD 1O3EA 1UVTH 3F9HA 1ZOMA 1QL7A 1P09A 4K3JA 2FOCA 3P8NA 4YOIA 1KLIH 5G4BA 1F2SE 1QBVH 1RIWC 2CF8H 1XUHA 2AIPA 1C9TA 3RDZA 1P2JA 1BCUH 3MFJA 3VGCB 5KEDA 4KTCA 2ZG0H 2Y7ZA 1Z8IB 1LHCH 4D9QA 1AO5A 1E1QD 4KP0A 2AMDA 2FPZA 4ABGA 4JZDH 4NFEA 4XD7D 3GCHC 2W3IA 1UTPA 3GCNA 2DE9A 1QHRB 1TYNA 3DSGA 1T7CA 4GAWA 3VFEA 3F2FA 2WYJA 5EU8A 2KCYA 4ABEA 3LU9B 3AK5A 3MNBA 4GSOA 3PMJA 5EJZA 2XNDD 4XDEA 4JYVH 1OSSA 4X6OA 2ZGCA 2ZPRA 7GCHF 3FANA 3V0XA 4AFUA 3GY8A 4RT1A 3RXGA 4ABHA 1MKXH 2ZFSA 1O2MA 3MH4A 1SHYA 1QFKH 1QTFA 1TX8A 2VVVA 1TBRH 1P03A 1UCYH 2WUBA 2Y7XA 3MNXA 1DLEA 3FOAA 2EI8A 1QJ6B 3HGNA 1NY22 1S82A 1IQNA 3Q77A 3EE0B 1RS0A 1NFYA 2EC9H 1CT2E 2R0LA 3PYHA 3LIWA 4WXIA 2OCVB 3P92A 4MNXA 4AYVB 2PHBA 4DW2U 3PV5A 4O3UA 1Y3UA 5EQSA 3CS7A 3DFLA 5KECA 3DHKH 1W8BH 3TH2H 5C94A 5EIYA 4MVNA 2ZPSA 3F0PA 1FY3A 2P8OB 1HAYB 1KTSB 3H7OA 5HYOA 2HLCA 4UFFH 1F5RA 1FNIA 1GHBF 2M2AA 2W6ID 1WBGB 2WYGA 2FOHA 3VB7A 2P59A 2GZ9A 2P3FH 4XE4A 5A0AE 2H9TH 2P3UB 1GBLA 1ELFA 3V7TA 2AGEX 1F7ZA 1FIWA 2YMSD 4AZ2B 3PLPA 3AAUA 2BLVA 4Y8ZA 1ABIH 3NZIA 2Q1JA 1GBBA 1E36B 2GDDA 4FVBA 4BXSA 3MMGA 1GGDB 1B7XB 3QK1A 2XXLA 2Y6TA 3STJA 2OP9A 2PP6A 1SLWB 1SHHB 1J17T 5AHGH 2XNIA 2WZQA 1VGCB 1BB0B 3A8CA 2WV9A 1BRAA 1MD7A 5CHAB 2OC1A 2V3MA 5EXLA 2CMYA 2BVXH 1J15A 1EQ9A 1BZXE 2GJGA 1DSUA 3HPTB 3KGPA 3RXIA 3A8AA 1YM0A 1LHDH 1SOTA 1W3CA 4DT4A 1KTTB 2BQ6B 4JMYA 1UK2A 3SV7A 2ZWLH 1DUEA 3P17H 1JXPA 1SQRA 3E90B 3I78A 4GHTA 4CRGA 4Q63A 2BY9X 3HATH 1DVAH 4FU7A 1ZSKA 3DSPA 1C5QA 3H7TA 1Y3VA 1W0YH 3UOPA 5C2ZA 1KDQB 3LJOA 1BTYA 3GDSA 2HPQH 1Q31A 2JH6D 4NG9H 1QRXA 3TGIE 3BEFB 2UUFB 1EUFA 4ZKSU 1K1MA 2QGRA 1N8OC 1UHBB 4X6NA 1V2JT 1O2JA 4VGCC 1XUGA 4ASUD 4HZHA 2PWXA 5GDSH 2BX4A 1FONA 1MKWK 4ASHA 1SQTA 2R9PA 2QY0B 1G3BA 1TLDA 2M5TA 1QL9A 5T6GA 1C5MD 4NSVA 3URDA 3AW1A 1TPPA 1PPFE 1H9LB 3OY5U 2ANYA 2F4LA 3STIA 2WPIS 3SUGA 2SGAA 1IQJA 2ZF0H 2BDCA 2SGDE 3CNRA 3RXDA 4CREA 3DFJA 4B6FA 1C4V2 2KR7A 1GDUA 3FN8A 5T6DA 3KYFA 1DPOA 1AVGH 2XRCA 1BT7A 1GBJA 2OC8A 3TNSA 5DP6A 4DCDA 1CA8B 1L4DA 2HALA 2VBCA 3KQ5A 2HWLB 1C5VA 1SLXB 1MUEB 2XBVA 1TNKA 2VWMA 1E38B 3QTVH 5SGAE 1A3EH 1SI5H 1V2QT 3M3TA 4F49A 1MAYA 4NFFA 2ZHFH 3KN2A 1ZMJA 4MPVA 1P01A 1ZGVA 1V3XA 3PROA 2C4FH 3T5FH 3KYGA 3A7ZA 1YPHC 1XXDA 1GPZA 1ZMNA 3PM3A 4F55A 5LPRA 1GMHF 3GISB 3HK3B 1TGBA 2AYWA 1FMGA 1YBWA 1O2QA 4TT3D 1IQIA 2KAIB 3ZZ7A 1MTNC 2VB0A 2WHXA 2EI7A 3ODFA 1BA8B 1EOLA 2GDEH 2LPRA 2H9HA 1EZSC 2G00A 2O8TA 3BF6H 1OP0A 1GG6C 2ZDLA 4BAOB 1GMCF 1OXGA 1WUNH 1UTNA 1BTWA 4I8KA 1J9CH 3UAIC 5HIZA 1FIZA 4UFGH 4TWYA 3FZDA 2CK3D 1ZTKA 2IOTA 2C8ZB 2RCEA 2ZU5A 5JBTA 4B6EA 3GY6A 2Z9GA 1HXEH 1U6QA 1TMTH 1P2IA 2ASUB 1XUIA 3ATLA 1G3DA 3SNDA 1YP9A 5K7RA 2OINA 5J4QA 4FUEA 2BDIA 2P8OC 3PTBA 1HAXB 1ZHMA 2CJIA 3ZVGA 1HGTH 2I6QA 4PROA 1IQMA 1WQSA 1GI0A 3RXKA 1AY6H 4WH6A 1T4VH 1TGTA 4U01A 1AWFH 1YY3A 5EQRA 3WW7A 2NU3E 5F03A 3ZVCA 4YLQH 1NRPH 1HUTH 4XBCA 3VXFH 1BITA 2PTCE 1W0JD 1MTWA 3OTJE 3ATKA 1GHBG 3QLPH 2J4IA 4Y76A 1C2LA 4P00A 2TIOA 4UE7H 2Z3EA 1GBMA 1YGCH 4Y7AA 3LGIA 1NRQH 1CT0E 2A4OA 1KLTA 3T62A 1SLUB 2JDID 2BZ6H 1MTNB 3UWJH 6ESTA 2KAIA 2QE7D 3MU8A 3QZQA 4Y7BA 2KM0A 5E2OA 3TJVA 2R0KA 4E7RG 4CH8B 3PLBA 1S0QA 3F3BA 2HLDD 2GMTC 3RXQA 1C1TA 2ZFPH 1FAXA 1DWDH 1N6YA 1SGEE 4ZHMU 2BVSH 1W14U 5EPNA 5GCHG 3SO3A 1O3BA 3A86A 2BZAA 2HNTE 1Z7KA 4K69A 1Y5BT 8ESTE 2A45B 1IQFA 1RGQA 2W7UA 4MTBA 1QL8A 1VITH 3TGKE 1XUKA 3UWIA 3LGYA 5C1XA 1DWBH 1YPEH 3K9XB 4Y10E 2F9UA 2ZU4A 2BHGA 4JZ1A 2XOKD 1HAPH 2XC5A 3MH5A 3A85A 1E79D 2YMSC 1ELBA 1QQUA 1A4WH 2FX6A 1BOQA 4X2WA 5I46H 1O2TA 1TONA 1O0DH 1O37A 4O03A 1C2IA 4H6SB 1AFEH 2WUCA 1OWJA 2RDLA 1O2HA 2NU2E 2A0QB 3SI4H 3S0NA 1S6LA 4IC5A 4RKJB 1UMAH 4NIVA 1GWAA 4UFDH 4XBDA 5AVDA 2BDBA 1XUJA 1RRKA 2QAAA 4X1SU 1SGFA 3BN9A 2TGTA 1TBQH 2QN5T 3UNRA 2VU8E 1V2WT 2ZC9H 2A5AA 1CBWC 2FESH 1C1SA 1F5LA 4UD9H 3L3TA 2A32A 4J1YA 1O2OA 1FUJA 1ZPZA 4B73A 4ISNA 3UOUA 2ZU3A 1GHAF 2FX4A 1IQLA 4YZUA 1C2DA 1Z8GA 4TSFD 2UWPA 2A7CA 1DOJA 5BRRE 1ZR0A 1K1LA 2ZU2A 2BD7A 3M5MA 2SGFE 3ZYEA 2PKSC
chains in the Genus database with same CATH topology
1W10U 1TOMH 2VVCA 2D1JA 1O2VA 1PYTC 1SL3A 1KXAA 3RMNH 2JH5D 1ZSJA 2ZDVH 3U9AH 1Z6EA 5A8YA 1IAUA 1CU1A 1S84A 1RTFB 4Y0YE 3ZZ6A 4ZH8A 1O2KA 3F9EA 1O2IA 3BTGE 3SNCA 2XBYA 2VWOA 1TRMA 1UK4A 1YCPH 2NU0E 3Q76A 4B2AA 1SFIA 2PSXA 3KHVA 1T8NA 2R3UA 3BG4C 1BTUA 3TU7H 1GHVH 3B8JA 1G32B 2HNTF 3GY2A 1GG6B 3M3VA 4FUDA 3SU1A 1MTVA 2ZEBA 1O3LA 3PV4A 1EPTC 1ARBA 4MNVA 3FP7E 3M61U 3T29A 2WPHS 1HAGE 2G5VA 1W7XH 4FUBA 4JYTA 3SI3H 3P6ZB 1RFNA 1HBTH 1C2JA 2QIQA 2PV9B 1GMCG 1T8LA 1UJ1A 2GX4A 2EEKA 1V6DA 3V13A 1BTZA 2V3OH 3T2NA 1GBHA 3ZZDA 1CO7E 1OKXA 3QDZB 4I32A 4CR9A 4FUGA 3RMOH 2F9BH 1NFXA 1KXFA 2XWBI 1QIXB 2ZHEH 2ALPA 2NU1E 5EOKA 5J4SA 1AB9C 1HJAC 3PB1E 1E35B 4SGAE 2J94A 1D6RA 1UTQA 4DIIH 3F1SB 1MD8A 2GT7A 1VR1H 1T8MA 2C8XB 5B6OA 2A4GA 1NO9H 3ZZ3A 2QXIA 1NRRH 1GI9B 1LHGH 1N8OB 1QBNA 2BY6X 1TPAE 3QZRA 4A1XA 1GJAB 2PKAA 1AUJA 2PW8H 5L6NH 5DP5A 4Y79A 1ID5H 1WTHD 4TPIZ 1AKSA 1GCTB 3FZZA 1BTPA 4YTAA 5L2YH 2AERH 1O39A 1S81A 3M7UA 1ZJKA 3W95A 1DLKB 4ISLA 3TLOA 1OP8A 5JYIA 5C5OA 1GMDG 1T32A 3A87A 1MZDA 1GI7B 1PPHE 5HXFA 1L4ZA 2ZQ2A 1BBRK 2A7HA 3JZ1B 5DPAA 1C2GA 3GCOA 2UWLA 1P05A 1W11U 3RMMH 1P2QA 1OWEA 1VJAU 5E8EH 2FDAA 1DWEH 1HAHH 1Y5UT 2HGTH 3GCTG 4I31A 2ZPQA 2BDGA 1K2I1 1L0ZA 1BJUA 1WAYB 4AB9A 4INHA 4NIXA 1EAIA 3ZVDA 1GBCA 2ANWA 2FOBA 4I8GA 1IHTH 4ZUHA 3KIDU 1K21H 2BQ7B 5AFYH 2FOAA 1NU9A 3ZZAA 4UONA 3BTWE 1MTUA 5T6FA 1YLCA 3N7OA 1A5GH 3A8DA 4Q80A 1DX5M 5FHTA 1C9PA 5DP9A 2XBXA 4DJZB 1V2OT 3GCTF 1Y5AT 1BJVA 4JZEH 1QGFA 4FUCA 1P57B 1O2RA 2PSYA 3UQVA 4ABAA 4B2BA 4ISHH 1O34A 8KME2 2V0BA 4DG4A 1GJ7B 2BOKA 2ZQ1A 1JIMA 1QCPA 3Q3YA 1UO6A 2H1UA 1AZZA 1P10A 2Z9IA 1C5TA 3T25A 4XSKU 5CE1A 3EDXB 1HAOH 3A7VA 1MU6B 3LT3A 2XBWA 1OPHB 1JMOH 1H9HE 2ZKSA 3A81A 2BQWB 4GPGA 4OS1A 4CHAB 1TAWA 1Y3YA 1JRTA 1O30A 3S9AA 2F83A 1THPB 4K5ZA 2B5TB 1A1RA 3UUZA 1LPKB 2VH6A 3R0FA 3PO1C 4IN1A 1AVWA 4RKOB 2O9QA 1O3CA 1JOUB 1GBDA 4X2VA 3QX5H 1LHEH 1VITF 3GYMA 2GCTB 5FPYA 1ESTA 1GI1A 2V3HH 4ESTE 5GWZA 4IMQA 1GBIA 2BB4A 1YPMH 2ZHWH 2ZECA 2UUYA 3VXEH 5DG6A 4CRCA 1ZYOA 2BM2A 1AFQC 4ABIA 2ALVA 4ZROA 1Z71A 3A8BA 3G01A 1NN6A 1PQ8A 1BQYA 1C2EA 3M7TA 4CR5A 2ZIQH 3UR6A 2Z3CA 1LTOA 4AOQA 2O8MA 4NCYA 3NUMA 1NU7B 1BBRH 3A80A 3DA9B 3S69A 1LVOA 2SNVA 2A4RA 1XMNB 1JWTA 3RXSA 1ZJDA 1O2UA 2OBOA 3BTTE 2VWNA 4KTUA 3BTME 1GL1A 1Z6JH 4AGJA 2DUCA 4X1QU 3E1XB 1NESE 5EXNA 2VWLA 2ODPA 3L6PA 1K1NA 1TNJA 1DY8A 2GT8A 2AGGX 2ZFRH 3SU6A 1TNLA 4YT6H 3SQEE 4NWLA 7GCHG 4UEHH 1SGRE 1HJ8A 4Q7XA 3DT0H 4NZLA 2W26A 1LO6A 1LCYA 2P3TB 1CA0C 4FUIA 4WY3A 3I29A 4Y8YA 5JB8S 1UVSH 1VGCC 2ZDNA 3E6PH 1C5NH 5BPEA 2ZFTA 1XXFA 3RU4D 5LPFA 2BDAA 4IS5A 1PQ5A 4BNRA 4HTCH 5GJ4B 4CBOA 3ZVBA 1PPEE 4OS7A 1EJNA 1O3PB 3B23B 4U32A 1KY9A 1C5PA 3SJIA 1CVWH 3FAOA 3KCGH 1OWIA 1C5RA 3VGCC 2BYAX 3U8RH 2Z6BD 1P06A 2VH0A 1QQ4A 2ZCHP 1Y3WA 1V2ST 4DIHH 2PUQH 2HPPH 4TY6A 1O5CB 3MNCA 4H6TA 1ETSH 1PPZA 4MNWA 3HKJB 1Y8TA 1MCVA 5GPIB 4BOHA 3ESTA 2Y5GA 1SQOA 3E8LA 5FX5A 4X6PA 1O32A 2A7JA 4LZ1H 5DJ7A 3UNSA 5JDUB 1VITG 2J9NA 1O3FA 2D2DA 1QB1A 4ABJA 1PPGE 3ODDA 1TWXB 1ESBA 1XUFA 3NPSA 5FX6A 1DWCH 4I33A 5DO4H 3RM2H 1IHSH 3A89A 4IW4E 1TMBH 1BBRE 2CN0H 4A5TS 4I7YH 1SQAA 2O8UA 1AE5A 1MBQA 2BXTH 7LPRA 3M5OA 1HPGA 2HNTC 1HAVA 2FI4E 1ZLRA 5L2ZH 2VIWA 1D3PB 1Z8RA 3CP7A 2FOFA 2FTLE 1Q3XA 4FUHA 5DP3A 1V2UT 4FVDA 2O8LA 2H6MA 4IGDA 1O5AB 1SB1H 4JCNA 1LVMA 2TRMA 2ZCKP 1BMMH 5ESBA 2G81E 2P94A 2BD9A 9LPRA 1LVBA 2LNCA 4YT7H 4K1SA 5E0JA 5ETXA 1E37B 2QXGA 1W0ZU 1YYY1 1SGFG 2ODYB 3M5NA 1IQHA 3RU4E 1V2VT 1C4U2 1J8AA 3TK5A 2F3CE 1G3EA 1K1IA 1XKBC 2AMPA 3SOSA 4THNH 5FPSA 1OYTH 1TPSA 1UCYK 3UPEA 3UIRA 2Z9KA 1O5EH 1L1JA 3RLWH 1G9IE 3UY9A 1CBWB 1KXEA 1TBZH 1MKWH 1HYLA 4NZQA 1GGDC 4H42U 7ESTE 1MKXK 4IBLH 2SNWA 1O31A 5H4IB 1DITH 4KKDA 2A5KA 1O3GA 5A8ZA 3SN8A 4JYUH 1SVPA 1V2MT 1NT1A 1MCTA 3O8RA 4BANB 1AHTH 1TB6H 2G52A 1G2LA 4K1TA 2PTNA 3MH6A 4OS6A 2UUJB 4AN7A 1QA0A 3T28A 1DXWA 3BEUA 3BTFE 1LDTT 2EA3A 2GV7A 1MZAA 1ZTJA 5C5NA 2AIQA 1FLEE 4BTTB 3NWUA 2Y80A 1TA2A 3O8DA 1AFQB 1EP6A 5EGMA 2VIVA 1O2LA 1L1GA 2F91A 3GDVA 6GCHF 1C1NA 2FMJA 3BG8A 1FY8E 1P2KA 1O2GH 2PKSB 3NCLA 2GTBA 2BD4A 2STBE 5JBCS 1WV7H 4AG1A 4ABBA 1CHOG 3KNXA 2G5NA 1H9IE 3SGQE 1EJAA 1AKSB 1THRH 1TGSZ 3SHAH 5DP8A 5C1YA 3PTNA 1HAVB 1EB2A 3SNEA 1SGCA 4CRDA 1GHYH 5A0CA 4VGCB 3JZ2B 1GJDB 1W7GH 3NKKA 4WWYA 1PQ7A 1O3HA 3TH3H 3A84A 4ZAEA 3GDUA 1ORFA 1EPTB 3RXTA 1JBUH 1PFXC 2D26C 1O3IA 3SZNA 3QGJA 4OS4A 2Z9JA 1FZZA 2BD2A 4ZHAA 1NZQH 3RXFA 4X1PU 1QR3E 3BG4B 1O5GH 1IQKA 1A61H 1ARCA 2HRVA 4A92A 1HAIH 2STAE 1QA7A 3B9FH 3S9CA 1EB1H 4BXWA 2VIPA 3LGUA 2ESTE 2PGBB 1THSH 1UTJA 2Y82A 1QRWA 1TA6A 3RXAA 3WY8A 1FDPA 2Y81A 4B74A 1ZTLA 4X0WU 4ZMAH 2F9VA 3T27A 1H8DH 2QCYA 1ELDE 1RTLA 2XC0A 1CHGA 1AB9B 1HJAB 1SGYE 3RXOA 3EAJA 4X8SH 3GOVB 3P95A 3S7KB 1ANEA 2FLRH 2BLQA 2ZDAH 4CH2B 1TNGA 3GICB 2OQUA 4A7IB 3SV9A 2ZP0H 3EA8A 4CHAC 1GBAA 4R8TB 1FN6A 1HRTH 4AB8A 3KQDA 5FPTA 1LVYA 4IC6A 3Q3KA 2A4QA 1P2NA 3U69H 2BX3A 1ZHPA 3RUOA 1SLVB 2R3YA 1YKTA 4WMDA 2RA3A 4I8HA 1D3DB 5EG4A 3BTEE 3P8FA 1UTMA 8LPRA 3D23A 3CENA 1N1LA 3LKWA 4IMZA 4RSPA 2G55A 2A31A 1JIRA 4O3TA 1O3MA 2FI5E 1BDAA 3K65B 3ZVEA 1GBFA 3R3GB 5DK1A 1AIXH 4LOYH 2W3KA 4WJG2 4TYDA 2W5EA 1ZPCA 4B1TA 8GCHF 5JBAS 1KIGH 1C1PA 3C1KA 1YPGH 1GVKB 1P2MA 3BSQA 4R0IA 4MLFB 1NFWA 1S6HA 3SV2H 1GJBB 2VGCC 5EXMA 4X2XA 4K8BA 4FUJA 1OWDA 2BVRH 1B5GH 4INLA 1ANDA 4TWWA 1NFUA 2WV5A 3SBKA 5DP4A 5C1UA 3NK8A 2Z94A 2Q6FA 1UVOA 1EP5A 4BAHB 1B0EA 1RXPA 3LOXA 1O3JA 1F0UA 1JRSA 2OQ5A 1XX9A 2NWNA 3K2UA 4LK4A 1MMJN 3A7XA 3F9GA 3TJOA 1SGTA 4I8LA 1UTOA 1DM4B 1RTKA 1BMLA 1GDNA 2ZHQH 4WXVA 2R2WU 3MWIU 3LGWA 1G30B 1NC6A 4WMFA 2BDHA 1Y3XA 3O8BA 2ULLA 4JK6A 1HXFH 1YPLH 1SGPE 3RP2A 2BLOA 2SGEE 1QJ1B 3HGPA 1P9UA 2AEIH 2ZTYA 1OWKA 4NA7A 3RM0H 1INCA 1FN8A 2F9OA 4MDSA 1CQQA 1FJSA 2WPKS 1LPGB 2QXHA 1EAWA 1P9SA 5F6MA 3RC4A 2JETC 1D3QB 4DURA 1P3EA 3ENSB 4ISOA 4J2YB 2CHAC 1NS3A 2C3SA 3U8OH 1KYNA 4K8YA 4D7FA 1A3BH 4K60A 2ZZUH 2AMQA 1GMDF 3KQEA 4ISIH 1YPKH 6CHAB 1F5KU 1EZXC 2XYAA 4BAKB 1O2NA 2ZCLP 1DT2A 1GI5A 1VCWA 1PQAA 1CGHA 3SJOA 1P12E 3RXEA 1F0TA 3S9BA 1TX7A 4GCHF 4LXBH 2RA0A 1UCYE 2FWWA 1AMHA 5FBIA 1ZSLA 2B7DH 1V2RT 1K1PA 1HNEE 1A5IA 1D3TB 2CXVA 2ANMH 1GI4A 3RXMA 1TX6A 4ZKNU 4XOJA 4OS2A 2GGVB 3ATWA 2WV4A 3K6YA 2FO9A 1SC8U 5EPYA 1P8VC 4B75A 1BRUP 2GVFA 2G4TA 2I6SA 3AVZA 5FAHA 3A7TA 3SUFA 3SU3A 1GHZA 3FVFB 1VJ9U 1FY1A 3MU1A 1A7SA 1C1MA 4BAQB 3QTOH 4Y11E 1QJ7B 1BHXB 4SGBE 1K9OE 5DP7A 4Q7ZA 3SUEA 3TIUA 3D49H 5CHAC 4NGAH 5DGJA 3TH4H 3M36A 4X1NU 4ABDA 4MG3A 1C1UH 1GJ4H 8GCHG 1KSNA 1KDQA 3PLKA 3ELAH 2Z9LA 4DY7B 2VIOA 3UQOA 1T31A 1WQVH 4MNYA 4X8UH 1SSXA 3O8CA 3URCA 4D7GA 1W12U 4NA9H 2FS8A 4AG2A 1GCDA 3LC5A 4X1RU 3SU5A 3RXUA 4BTUB 1ANBA 1GHXH 1CA0B 5F8TA 1FPCH 2AFQB 2QYIA 3LDXH 1H1BA 3OY6U 4AGKA 1FXYA 1OOKB 2FXRA 1CE5A 2OC7A 2AS9A 3PWBA 2ZTXA 4RN6A 4GLYA 2FI3E 2OXSA 1XM1A 2TPIZ 1GVLA 5EW1H 1EX3A 5F8ZA 3D65E 3GY7A 1IQEA 2JKHA 1P04A 1TNIA 2VIQA 2BY7X 3BIUH 3QGNB 1HAZB 4CRFA 3PWCA 1AN1E 1MQ5A 3SJKA 5EW2H 3LC3A 2OD3B 3SJ8A 1A0JA 2VIDA 1Q2WA 3MU5A 1AQ7A 3MYWA 1L2EA 3VPKA 4Q7YA 1EKBB 1UHBA 2ZHDA 2FODA 4ABFA 1C1VH 2ZGBH 2XCNA 3MH7A 3M7QA 1DS2E 3MO9A 3UR9A 1FI8A 1C2KA 1MQ6A 1YLDA 3HKIB 3TGJE 2QA9E 1M9UA 4MPUA 1ELEE 1WU1A 1LKBA 1C1WH 1SR5C 2YOLA 1ELAA 1BRBE 1ELTA 1TGNA 3LPRA 3M37A 4ZKOU 1W13U 2H2ZA 1ZRBA 1SBWA 1WYKA 1V2LT 4AYYB 1A0LA 2H9EH 2GZ7A 4E05H 1AWHB 1BMAA 1LKAA 1Z1JA 5E0HA 2BMGB 3VB6A 2FLBH 1G3CA 3LJJA 2CV3A 3D62A 5PTPA 3MO6A 2FOMB 2JH0D 1UVUH 1RJXB 3PMHB 1GCTC 4Y8XA 1E34B 1RIWB 1ETTH 1O2ZA 2ZGHA 2BTCE 2Y5FA 3E0PB 1CGJE 5C20A 4WMEA 1O35A 1O2PA 3VEQB 1D4PB 2BOHB 4TY7A 2TBSA 4OS5A 4B71A 4YOGA 4CRAA 3AASA 5IDKA 1LQDB 2DE8A 1HJ9A 1N6XA 3BV9B 1LMWB 3FP6E 3IG6B 3PMBB 4UFEH 1BUIA 4DVAU 1GJ9B 1GJ5H 4Y6DA 1A2CH 3BTKE 2C8YB 4FU9A 1SGQE 1GHWH 3MO3A 2PUXB 2ZFQH 3RXPA 4FU8A 3A7WA 3OU0A 1BHXF 4AORA 1YPHE 1CGIE 3OX7U 1P0SH 5AFZH 3RXBA 4X8VH 4YO9A 2J92A 2WINI 3Q00A 2QXJA 4X8TH 3RXLA 2B8OH 5FXLA 3KQBA 3GY3