3UQVA

Bovine trypsin variant x(triplephe227) in complex with small molecule inhibitor
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSETYNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSASSFIITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGFYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cationic trypsin
publication title Correlating structure and ligand affinity in drug discovery: a cautionary tale involving second shell residues.
pubmed doi rcsb
source organism Bos taurus
molecule tags Hydrolase/hydrolase inhibitor
total genus 53
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2011-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3uqvA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3uqvA02
1O2XA 1O34A 1KY9A 3F9HA 1YYY1 3ZVFA 1C5PA 2SGEE 1A3BH 1G3BA 2ZGJA 5EOKA 3H7TA 3GCTG 2GTBA 1C5TA 3PMBB 1TE0A 2TIOA 4FUEA 3LH3A 3SZNA 2EI7A 1C5WB 1W12U 2SGQE 1FPHH 3EA8A 4UFDH 3W94A 1ELAA 5EW2H 3TVJB 4PROA 1PPHE 1SLUB 5ESBA 4WWYA 3VB6A 5K0HA 1O2IA 1OWJA 2RA3A 1Y59T 2A4OA 4OS4A 1D3DB 2JKHA 2WPJS 4VGCC 1V2PT 2BD5A 5JBCS 1PQ8A 1TGSZ 2BQ6B 1TWXB 4JYVH 4CBOA 1LO6A 1YF4A 2BDAA 3M5LA 4O9VA 3TNSA 3VXEH 1TALA 3MO9A 3LGTA 3SJ8A 2OC0A 3TJOA 3AASA 1LMWB 3GY7A 3LDXH 4JZDH 1FY5A 2FM2A 2H2ZA 4OS7A 3ELAH 2QA9E 3GISB 3QDZB 1O2SA 1AKSB 1BRBE 3SU2A 1AUJA 4ISHH 2A7JA 3RM0H 2A1DB 1IQNA 1QIXB 1AFQB 1LHEH 3VB4A 1MCVA 4BAOB 1AMHA 1HBTH 2ZI2H 4SGBE 1C5ZB 1JIRA 1WQVH 1P2MA 1YPKH 2D2DA 1NESE 2G8TA 2GZ7A 1MMJN 1NU7B 2AS9A 1FNIA 5AHGH 1QURH 3LONA 4A1TA 1O2TA 1A0JA 4ABAA 4OS1A 1ZLRA 1IQEA 3UFAA 2PWXA 1NC6A 1CT4E 1S85A 1MKWK 3RXGA 1UTJA 1ZTLA 1TRNA 3RXHA 1AUTC 1NTPA 1LPKB 2R2MB 1RIWC 4UFFH 3TJUA 3MU0A 3HKJB 1FY8E 1O3DA 4MNVA 5JBTA 3FP7E 1SGTA 3AW1A 1HDTH 1O2UA 1RJXB 5GCHG 3TH2H 3LC5A 5L2ZH 1QGFA 1O3MA 3KQEA 1GJ4H 1BUIA 4GPGA 3RXLA 3U1IB 1OOKB 1BIOA 2YOLA 2WPKS 1WAYB 1J17T 1AVXA 2BY7X 2GZ8A 2BQWB 2FOAA 3ODFA 3TIUA 1V2QT 1TAWA 2BHGA 3T29A 1G30B 3QWCH 3Q3XA 3RXDA 2A0QB 2IN2A 4ISLA 1QRZA 1C5SA 1O3OA 2GP9B 1C5OH 1GI9B 2BYAX 1O2YA 3K65B 2H9TH 4U30A 5CE1A 1BRCE 3DT0H 1DITH 1P06A 5AF9H 4BOHA 3P92A 1INCA 4LOYH 2R0LA 4ZHAA 3TK9A 1C2KA 1EPTC 2FOCA 1HAPH 1GJAB 2ZGBH 5G4BA 3SNCA 4ISNA 2BDYA 3BEUA 1HNEE 1FUJA 4NA8A 1ANDA 3TGJE 1EAIA 2Y81A 2HPPH 2ZTXA 2ANKH 1DX5M 6GCHF 1GDQA 1CQQA 3KNXA 1V2UT 2XC0A 3GDUA 4RKJB 4A1VA 1SFQB 1EX3A 1QTFA 1YPLH 1BITA 2FMJA 5GJ4B 4CRCA 1O38A 4Y8ZA 2OLGA 3SU4A 3U8RH 4AYYB 9LPRA 2FS9A 2FYQA 1O5DH 4AB9A 5EW1H 1DVAH 1YM0A 1ELTA 2BD3A 2D26C 4B76A 2YNAA 1EZQA 1TPOA 4I8LA 2VWLA 1VGCC 1E36B 3DFJA 1UTKA 1GWAA 1PPGE 3HPTB 3ZV8A 1S6FA 3M5NA 3PLKA 2D1JA 2ZEBA 2P3UB 3A7ZA 3KHVA 4ISIH 4AYVB 3I77A 1TONA 1DUAA 1XKAC 5DP3A 2OINA 1F0SA 1HJ9A 4D9RA 1ELDE 1Z6EA 1XUKA 1K1IA 1TIOA 3MU1A 3EYDA 2GCTC 4MPVA 1RFNA 2ZWLH 4Y79A 1SLXB 3ATKA 1YPHC 3TNTA 4YM9A 1C2GA 2UWLA 1GG6B 2VU8E 4FU8A 4K60A 3KN2A 5ETXA 1WSSH 4ESTE 1FV9A 3ATIA 1MBQA 2QXHA 1MQ6A 3FAOA 5F8XA 4AG1A 5CHAB 1LKAA 3HGPA 1C1MA 1GBIA 2BD8A 2O9QA 4X8VH 4KELA 1LPGB 1VITF 4GCHF 4TPIZ 1E0FD 1A3EH 2Y6TA 1HIAB 3GY8A 5C20A 3BTKE 4K3JA 1RS0A 4X2WA 1LVOA 2Z6BD 1HLTH 1P2QA 1F7ZA 3DHKH 4NIVA 3UR9A 3AVZA 3QK1A 2BZAA 3ZZDA 2GV6A 2BZ6H 6CHAC 1KXDA 1ZMJA 1MKXH 4K2YA 2GCHF 3UTUH 3D49H 5PTPA 4ABDA 1SGNE 4X6MA 4D7FA 1ZJDA 1BTXA 1ESAA 4CR9A 5C1YA 1XKBC 4NSYA 1SSXA 4SGAE 1GMDF 5AVDA 2H9EH 2P59A 3M5MA 1P2JA 2ZPQA 1BZXE 2ZHEH 1K21H 3QGJA 3NXPA 3PROA 2R0KA 4Y8XA 3SU1A 3ATMA 1QBVH 1LHCH 1EATA 1O2KA 2XBXA 1TFXA 3BTGE 1SB1H 1UHBB 5A2MH 3SJ9A 1V2LT 3TGKE 2A4RA 1TBRH 1QB9A 2FO9A 1NU9A 1P04A 3A84A 4Q7YA 1NRQH 2RDLA 3A8CA 1GJ5H 1HPGA 1LQDB 1MZAA 2Q6DA 1AFQC 3RXOA 1P3EA 3T28A 4ZXXH 1LKBA 4Y71A 1GL1A 2XYAA 1TQ0B 1EUFA 1TNHA 2HPQH 3KL6A 2PKAB 5JBBS 5A0CA 1GI2A 2AMQA 1NO9H 3HGNA 4K5ZA 2Y7XA 3VGCB 3T62A 5A0BA 1Z7KA 3U8TH 2SNVA 1PPFE 2WPHS 1QA7A 1T8MA 2A5KA 1O3EA 3LOXA 3V7TA 3RXBA 1AY6H 1ESTA 4ZHLU 1OYTH 3IWMA 3RXFA 3BEIB 2FDAA 4JZIA 1YLCA 1J9CH 4U01A 2ZG0H 2P94A 3HK6B 1A46H 1Q2WA 4JK5A 1Q3XA 1O2QA 2XBVA 6GCHG 4FUCA 5LH8A 1ZGIA 2HGTH 2G00A 2QY0B 3BIVH 4DGJA 3U8OH 1MAXA 2VH6A 2Z9IA 3M7TA 1C2IA 3CS7A 1SGRE 2OD3B 4XOJA 2BDGA 1BMMH 3OX7U 2V3HH 1NFYA 4IS5A 1C4Y2 1G3EA 2QXIA 1W8BH 4M7GA 5EXLA 1BCUH 1WTHD 1AE5A 1TGNA 1HB0B 2OC1A 1IQIA 2ILNA 2ZFFH 1MUEB 2FOEA 3L3TA 2UWPA 1EAWA 1UVTH 2W3KA 2ALVA 2G55A 3SU3A 4A92A 3S9AA 1T32A 2P8OB 2ZZUH 1OS8A 1CU1A 1NM6A 1C5RA 1YBWA 3UREA 4WMEA 2QC2A 3SQHE 1G9IE 1V2JT 4WXVA 2JH0D 4Q7XA 2CF8H 2ZHQH 2ZCLP 1O2LA 3P17H 1D9IA 3NKKA 2ANYA 1UK2A 5L6NH 1H8IH 3BTWE 2VWNA 1HV7A 1C1OA 4DOQA 3GCTF 3LGYA 1TLDA 1O3LA 1PJPA 2NU2E 3MO6A 1GBEA 1DY8A 1ZSJA 1Z8GA 1CGIE 4IBLH 4WVPE 4KTCA 1A1RA 3BG8A 4FUHA 3RXCA 2VINA 4YESB 1J15A 1IHTH 1O2OA 3LJJA 4AFQA 2PHBA 2C4FH 4YT7H 1QNJA 2TPIZ 4WMFA 2AGGX 2ZU1A 1XXDA 3NUMA 2R3YA 4CRGA 8LPRA 1FAKH 1TMBH 2XCFA 2BLQA 3FZDA 1C5QA 1GBLA 2EEKA 3T25A 1LHFH 1S5SA 1VCWA 3M3SA 3P8FA 1MTVA 1ZOMA 5EQSA 2WUBA 1EOLA 4D9QA 5C67A 1KSNA 1TPPA 1BT7A 2DUCA 3UOUA 1H9IE 2PLXA 1PPCE 2NU1E 1T7CA 1UCYE 3T2NA 4CR5A 2C8XB 5ABWA 1ZPCA 3RC4A 3SGAE 4Y10E 1SQTA 1HAIH 2G4UA 3LGVA 1RXPA 2PGQB 5DK1A 1VZQH 1UTQA 2ZPSA 3UPEA 1YGCH 3UQOA 5JB8S 5GPIB 1GHVH 1QJ1B 2OCVB 2CHAC 1O3JA 1A5IA 4MTBA 1GMCG 2VVCA 1VJAU 4JZFH 5AFYH 1TBZH 4ZKOU 2V3OH 2W3IA 5E0GA 1K1JA 1PFXC 3LT3A 2VWOA 1XVMA 3MH6A 2M5TA 1GBMA 5EG4A 1GCTC 1GHZA 4KTUA 4NFEA 2BD7A 1TX8A 1X7AC 3F9EA 4X2VA 2P95A 4MNWA 1GBFA 2FTMA 3TK5A 2XXLA 1DWBH 2SFAA 2A5IA 2Q1JA 2ZDNA 2OUAA 3KQCA 4UDWH 2QXJA 2O8TA 2FXRA 1F0UA 1ZPBA 3GCHB 1EJAA 1QB1A 1P01A 2Y5FA 5DJ7A 1QRXA 3STIA 2F9VA 1V2OT 2THFB 3BTME 4U32A 5GCHF 1P2OA 6ESTA 2BY8X 3GICB 1SHHB 1HFDA 3O8DA 4E05H 1F0TA 1ETTH 2HVXA 4HFPB 1YLDA 4F49A 2RA0A 2W7UA 1IQFA 4BTTB 2O8MA 1L2EA 2EI8A 1CO7E 1EAXA 1UCYH 3ZVBA 2QIQA 1K1MA 1NT1A 1HAVB 1QY6A 4HTCH 4FU9A 2Z9LA 1AO5A 3M7QA 3GDSA 2LPRA 1C2DA 1TNJA 1AWFH 2ZIQH 3NCLA 2BX4A 3E6PH 3RXEA 4ZAEA 3ZZ9A 2BD4A 4Y6DA 1P3CA 2F3CE 1E34B 4AGJA 1P09A 1Y8TA 4AB8A 5I25A 2J38A 3OY6U 4ZKRU 1O32A 3EGKH 2J9NA 4IC6A 4XBBA 3U9AH 2PKSB 1HAZB 1AQ7A 2ZPRA 3BF6H 1LQEA 3CP7A 2ZGHA 4X1SU 5TJXA 4DCDA 1ETRH 2GDEH 4H6TA 5A0AE 2ESTE 3L33A 1ZRBA 3I78A 3ZVCA 5HYOA 3SUFA 5LPFA 1C5NH 3GYLB 5DP5A 5HM2A 1HGTH 2GDDA 2ZTZA 4E06H 1XUHA 2GT7A 3OU0A 3BIUH 1K1LA 3BV9B 5FX6A 3VPKA 1Y3UA 2ZTYA 5E2OA 2BXTH 3RXTA 4AOQA 4X1PU 1O2PA 2J34A 1RRKA 1AU8A 4AORA 1AZZA 5EXMA 2ZDAH 1EZXC 5FPTA 1AGJA 1AVGH 1HCGA 1TNIA 3NZIA 3OYPA 3K2UA 1AB9C 1XXFA 3K9XB 1KTTB 4WXIA 5HXFA 2AEIH 3QUMP 4AFZA 4K1EA 1BTUA 4K8BA 1YCPK 3GY5A 1GI4A 3Q3KA 1VCQA 4DY7B 3QTOH 5K7RA 3MWIU 3ZZAA 2BOHB 1UTOA 4CH8B 1TABE 2XCNA 4X0WU 1A0LA 4J1YA 1DUEA 2Y5GA 3SUDA 1G2LA 2EA3A 1AVWA 1QL9A 1YPHE 4JMYA 1O5FH 2ZU4A 1UTMA 2TBSA 3A8AA 1O36A 1KDQA 3RLYH 1OP8A 1IOEA 1Z1IA 1OPHB 3SI3H 2FOGA 2FI4E 4RKOB 4Q2KA 1DANH 1THRH 2F9OA 2K1QA 2BXUH 1C2FA 1SC8U 2TGPZ 3RP2A 4OGXA 2V35A 2ZGXH 1BBRK 1P2KA 1TPSA 3GY6A 2VGCC 3N7OA 4ZXYH 2SGAA 1HAXB 3DFLA 1VITH 4Y7BA 2FOMB 3T26A 1LCYA 2ZU2A 2PW8H 2BVSH 4UONA 1F5KU 1LTOA 1P2IA 2ASUB 4YTAA 2FS8A 1ESBA 2ODPA 2JH6D 3EAJA 3SU0A 3M3TA 2B9LA 1NRPH 1CHGA 3QZRA 1WUNH 2B5TB 2BLOA 3RM2H 1T8NA 4GLYA 3URCA 4GAWA 4A6LA 4JYUH 1UO6A 1P11E 2BDHA 1S0QA 1GBCA 1GGDC 3QZQA 1JRSA 5FCRA 2BVXH 2QXGA 4INLA 1HRTH 4TWYA 1LVYA 3F1SB 5EPNA 3TITA 1V2KT 1TBQH 3V0XA 1T4VH 4XBDA 2WUCA 3F9GA 4I33A 3ZZ6A 1RTKA 1TNGA 2B8OH 3SBKA 1O3FA 1MCTA 1YPEH 1UVOA 3RMNH 3ZVDA 1OWHA 1CA0B 5DP4A 4O3TA 3FP6E 1DXWA 3JZ2B 1GI7B 3ITIA 1LVMA 3PMAB 3SV2H 2GX4A 5DP6A 1AD8H 1JRTA 1MTNC 1H1BA 1ARCA 4I31A 1DS2E 2BTCE 2F9UA 1S6HA 4HI3A 2RG3A 1NN6A 1C5MD 3S69A 1N6XA 3GDVA 5LPRA 1AFEH 1E38B 1O31A 2F9BH 1DOJA 1PQ7A 1OXGA 1PQAA 3AAVA 4YLUA 5BPEA 1FIWA 3BG4C 3M3VA 2FOFA 3SU5A 1GJ6A 3G01A 1UTLM 3MI4A 4BTIB 1Z1JA 1BTYA 1NFXA 2OXSA 3RC5A 3Q76A 1YPMH 4OS6A 4CHAC 3LPRA 1KLTA 3A81A 1ANCA 5JPMH 3A88A 4IC5A 2P93A 3SOSA 3F68H 1SG8B 4D8NA 5I46H 1TYNA 4WH6A 1TGCA 2A5AA 4TWWA 1IQHA 3E91A 2BDCA 4X1RU 3RLWH 3BN9A 1IHSH 1OP2A 2GKVE 3PWBA 5IYTA 3A7VA 1GI6A 2H5CA 1PPZA 4O97A 1G36A 4BANB 1IQMA 4IN1A 1SGQE 2YNBA 3BTTE 1XVOA 4A7IB 1SGFA 2O8LA 1O3BA 3PO1B 3RU4T 1MQ5A 3LKWA 2C93B 2VJ1A 5FPSA 2TGAA 7GCHG 3TK6A 4GSOA 3KGPA 1BA8B 1TRMA 1S0RA 3A8DA 3DD2H 5EXNA 1TNLA 3V12A 1C1TA 3P6ZB 3HK3B 1AWHB 1YCPM 4YLQH 4MVNA 4XFQA 1SQOA 2OQUA 4CREA 1S82A 1D3QB 2CV3A 3SJIA 2QV1A 3MH4A 2A45B 1EPTA 2GGVB 2UUKB 1VCPA 1GDUA 2XRCA 2BDBA 4B2AA 5EGMA 2FIRH 4MG3A 1Y5AT 2A2XH 4INKA 3M36A 4YZUA 3TJNA 1WTGH 2FODA 5T3HA 5EPYA 2HNTE 4MNYA 1J8AA 1A0HB 1ETSH 5BRRE 3BTFE 3E16B 2DE8A 2ZCHP 1C5XB 1OSSA 1K22H 5EQRA 3R3GB 5JB9S 2OC7A 2QCYA 4FVBA 1LHGH 3KEEA 1DLEA 3A8BA 4I8KA 5HMAA 1GJCB 1DICA 1GMCF 2ZFSA 2SGDE 1C2MA 1LDTT 2PGBB 3M35A 1K9OE 1AN1E 3SO3A 5A8ZA 1OP0A 4NSVA 8ESTE 2KAIA 1EJMA 2Y7ZA 3FVFB 1GHBG 5T6FA 1ABIH 1SLVB 1ELBA 1HAHH 1MAYA 5E8EH 1W0YH 1H9HE 2AFQB 3AAUA 3K6YA 1UK4A 3S7HB 2ZDKA 3C27B 2ZKSA 1O30A 4GHQA 2PUQH 5FBIA 1RGQA 4YOJA 4DIIH 1N1LA 1E37B 2A31A 1ELCA 1DSUA 1O2VA 2QAAA 3LGUA 2BD9A 3ATLA 2G52A 4TY6A 1FAXA 1ID5H 3A85A 1G32B 1BOQA 4K8YA 2WPMS 2OP9A 1O5GH 1QBNA 3RU4E 4ABIA 2W5EA 1WYKA 1KIGH 2PV9B 2JETB 4ZROA 2BQ7B 1TMUH 4X2XA 3WY8A 1V2NT 4CRDA 2VB0A 5EU8A 2A2QH 3TH4H 3TLOA 1CBWB 1LHDH 3E1XB 1DWDH 3ZVGA 1BMAA 3LC3A 2ZQ2A 4XBCA 1N8OB 2FLRH 1H9LB 1JBUH 1K2I1 1V6DA 2FZZA 1BRAA 3RXIA 2HLCA 3CS0A 4Z0KA 1GI3A 1HJAB 3P95A 8GCHF 5DG6A 2XBWA 2GD4B 1C5LH 1QFKH 4HZHA 1CT0E 1UVSH 1Y3VA 2PUXB 1SOTA 1O5AB 5J4QA 1P8VC 4AX9H 1C1PA 3HKIB 3NPSA 1VR1H 2Y80A 1DFPA 1KXEA 4B71A 1ZTKA 5TCAA 1NRNH 4Q80A 1BQYA 1GJBB 1AZ8A 2ZQ1A 1O5CB 2VIQA 4Y7AA 1AKSA 1EQ9A 4VGCB 2IOTA 5C5NA 4A5TS 1MKWH 4O3UA 3EA7A 1IQGA 2ALPA 3B9FH 3TPIZ 4MPUA 1XM1A 1QHRB 1TA6A 1QJ7B 3VB5A 4Y76A 3S7KB 3BTEE 1FXYA 1MU8B 4X6OA 1D6WA 5T6DA 2C8YB 1C9PA 5EQQA 1GJ7B 1MH0A 1FY4A 3GY4A 1G3CA 3PWCA 4X6PA 2ZP0H 1ORFA 4B73A 3SGBE 4Y0ZE 1F92A 2CJIA 2GV7A 2FOHA 2ULLA 1NRSH 3UWJH 4JCNA 2VIWA 3MMGA 4BXWA 1TMTH 6LPRA 3RXMA 3ENSB 3D65E 2O8WA 2WPIS 3FFGA 4YT6H 1BJVA 1XUFA 4A1XA 4BTUB 1P02A 2FX6A 1SOZA 1GBBA 3GCOA 1GBJA 1P0SH 2A4QA 3ZZ3A 3UNQA 4ABBA 2GVFA 1BTHH 1RIWB 1GG6C 2G81E 4NA9H 2W7SA 2ODQA 1L0ZA 1V2ST 1WU1A 1QCPA 4B75A 1ABJH 2QF3A 1GBKA 3I29A 1JOUB 4KTSA 4CH2B 1O3GA 3PLBA 1S83A 1EKBB 3VEQB 1MU6B 3MHWU 5CHAC 1QB6A 5FBEA 2WV5A 1HAYB 1SLWB 1QL7A 3E0PB 2CN0H 1CT2E 1ACBE 3RXPA 2NU4E 3MNCA 1D6RA 2NU0E 2EC9H 4U2WA 3SV6A 1F2SE 1QR3E 1GVZA 1O3PB 1PQ5A 2R9PA 3SJKA 1SVPA 3SORA 1DY9A 3U69H 1O3NA 3RXJA 1H8DH 2Q6GA 1A61H 2SNWA 2ZFPH 2C8WB 1TNKA 1W7GH 4ZUHA 1G37A 4B74A 2PSYA 3KF2A 2Z9GA 3KIDU 1V2RT 3RXAA 1CHOG 1B0FA 2UUJB 1O3CA 1O5EH 4DVAU 1JWTA 2VIVA 3SNEA 2NU3E 1OWEA 2BY9X 1C5UA 3PMJA 1A5HA 1OX1A 3VB7A 5TCCA 5AFZH 3SNDA 1GBTA 1ZPZA 4AN7A 3SUGA 3KQDA 1EASA 2ZNKH 4FUBA 3BTDE 1SGYE 1GL0E 2GT8A 3B23B 1PPBH 3PLPA 1HXEH 3FZZA 8GCHG 4R0IA 2AERH 1NFWA 4OGYA 1K1PA 3MOCA 2XC5A 1O5BB 1HUTH 1FI8A 3O8CA 2Q6FA 3SHAH 1VGCB 1Q31A 1RTLA 2Y5HA 4I8GA 2H1UA 2PFEA 3PB1E 2BLVA 1P12E 3ZVAA 3E0NB 2AGEX 2STBE 2ZU3A 3BTHE 2ZA5A 2RCEA 1O3KA 1QBOA 5GIBA 3VGCC 2FYRA 4BAMB 4NZLA 2SGFE 1OWDA 1W0ZU 2GCTB 4ZH8A 2J2UA 1HIAA 1G2MA 1UVUH 1NROH 1DT2A 1Z8IB 1ZSKA 1SL3A 5IDKA 1FY3A 4CRBA 2BOKA 3QX5H 4FUJA 1UVPA 1KXAA 3KCGH 1F5LA 1S81A 3QN7A 4KGAA 5FHTA 1SQAA 5C3NA 4JK6A 2PTCE 3M5OA 3SV9A 3RXQA 3JZ1B 2A32A 1FLEE 2HOBA 1C1QA 1N6YA 1A5GH 4YOGA 1HJAC 1GJ8B 5H4IB 1CSOE 3PM3A 3FP8E 2CMYA 3P8NA 1EP5A 4FVDA 2I6SA 3P8GA 1S84A 2STAE 3UR6A 3T27A 1GBAA 4K1TA 1O3AA 6CHAB 7ESTE 1MTWA 1ZSLA 1H4WA 1O39A 4TY7A 4TYDA 2J4IA 3MNSA 4IMZA 2WYJA 5GDSH 3IG6B 5DKMA 1BMLA 1GHAG 1UHBA 1Z71A 2Z7FE 1QA0A 3A82A 3E8LA 2CF9H 7GCHF 1BTZA 3MNBA 1GBHA 1W14U 2ZDLA 1F0RA 4AFSA 2P8OC 2ZFRH 3E3TA 1MTUA 3OSYA 3QTVH 1ZR0A 2FEQH 3AW0A 1CVWH 4NIXA 2F9NA 3VFEA 1GCDA 4FXGH 2P16A 5A8YA 5GWZA 1PYTD 1Y3YA 4IW4E 1DM4B 5E0HA 4ISOA 1KXCA 1J16A 2BX3A 3URDA 1PPEE 2PKAA 4X1NU 4AG2A 1L1JA 1O2GH 4FUIA 2UUYA 3O8RA 2IPHA 1P03A 1ZRKA 1W13U 3QO6A 1OWIA 3TJVA 5C2ZA 1FPCH 1BRUP 3P70B 2J92A 1TQ7B 1GHXH 3ZV9A 1O37A 1O2MA 3U98H 1EOJA 2Z3CA 1Z8JB 4MLFB 1V3XA 1W11U 1TRYA 4WJG2 3U1JB 2ZGCA 2OBOA 3RU4D 4ZHMU 2XBYA 3GCNA 4NWKA 1L1NA 1NY22 2FI5E 4Y0YE 3MFJA 1XUJA 2G51A 3MTYA 1FN6A 4I8JA 5DPAA 1V2MT 4R8TB 1UMAH 3EE0B 3ZZCA 1GI8B 4DURA 1W10U 4E7RG 1O0DH 1TX7A 2H5DA 4E7NA 4BXSA 4Y8YA 1ZHPA 1O2NA 4AZ2B 3RMOH 1GHBF 1IQKA 1W3CA 4CRAA 1K1OA 5L2YH 1LVBA 1P05A 2UUFB 2B0FA 3P8OA 3MYWA 1P9UA 4K1SA 4UFEH 4LK4A 1V2TT 3LGIA 1GHWH 1P9SA 4ABJA 4B2BA 2AH4X 2P3TB 2F91A 1C1VH 1SGCA 1ZZZA 2BMGB 2ODYB 1FQ3A 4DIHH 4NIYA 1ZMLA 2ANMH 4DW2U 1C2HA 2VIOA 4KP0A 3RXKA 4XDEA 3ZZ4A 1SGPE 1ELEE 3H5CB 1C4U2 3GCHC 2IJOB 3UNSA 3NK8A 1RTFB 1KTSB 3MU8A 2ZHWH 4IGDA 3ODDA 4X6NA 2BLWA 4LXBH 4X8TH 2ZU5A 4Y11E 1BJUA 5DP9A 2ZHFH 1P57B 1IAUA 2GMTB 2A4GA 2BVRH 4NWLA 4INHA 1AI8H 4D76A 1J14A 2BDIA 3RMMH 3MH7A 3GYMA 3SV7A 5A8XA 2D8WA 2BY6X 3SHCH 2OQ5A 1XUIA 4NCYA 3RXVA 4MQAA 3VB3A 1C4V2 1GI1A 1SPJA 1QL8A 3D62A 5HM9A 2FWWA 1SMFE 1AIXH 1NRRH 1B0EA 1O2WA 1XMNB 3RUOA 1V2VT 4UD9H 3ZZ5A 1E35B 2I6QA 1BTPA 2G5VA 1MD7A 1A4WH 3RXSA 1D3PB 1EZUC 1EB1H 5DP7A 4GUXA 1DE7H 4MNXA 1EB2A 1TA2A 4H42U 1NPMA 3GY2A 4H4FA 4NZQA 5B6OA 1ELFA 1W2KH 1K1NA 1ANBA 2PKSC 1MZDA 2HWLB 1T8OA 1CGHA 2QGRA 3NWUA 3ESTA 4WMDA 2VIPA 1Y5BT 2Z9KA 2A7CA 1O33A 1DPOA 1KXFA 1L4ZA 1O3IA 3A89A 2H6MA 2SGPE 3CENA 1UCYK 4FUFA 3SUEA 1C9TA 4ZKNU 2CHAB 4GHTA 3RMLH 2OC8A 4O03A 3ATWA 3S9CA 4AFUA 2HALA 2FPZA 2FOBA 1OYQA 1BHXB 1GCTB 1KXBA 2A7HA 4WF8A 2FI3E 2XWBI 3S9BA 1DXPA 5GXPA 1EAUA 5DP8A 2ZFQH 3A7YA 1IQLA 3MH5A 3PV4A 4ABGA 5L30H 1HJ8A 3PYHA 4XE4A 1YC0A 5C1UA 2AGIX 4HGCA 1MD8A 2ZCKP 1ZYOA 1NZQH 1TPAE 3V13A 3PTBA 1T8LA 1ZGVA 5SGAE 4LZ4B 3HATH 4Q7ZA 4FU7A 1MTSA 2H9HA 2P3FH 3SNAA 2XC4A 1HAVA 1KLJH 4UFGH 3A7TA 4X8UH 3TGIE 4UE7H 1GHYH 3VXFH 2QF0A 3UNRA 1NS3A 2J95A 2WPLS 3RXUA 4XSKU 3F6UH 1WQSA 2WV4A 2PTNA 5ESTE 5FXLA 1HAOH 1GDNA 2ANWA 3B8JA 3C1KA 4K69A 2WINI 1TB6H 3TH3H 3QLPH 3RC6A 4YOIA 5F8ZA 2CGAA 2HRVA 2XTTB 2ZHDA 3UIRA 5C1XA 1GMHF 3M7UA 1BBRE 1LPZB 3ZYEA 3ZYDA 2B7DH 1A2CH 1B5GH 1C5YB 2FESH 1GI5A 2AIQA 4CBNA 4OS5A 1JXPA 1KDQB 2VH0A 1T4UH 2Z9JA 4MPXA 7LPRA 3O8BA 1AE8H 3F9FA 1CHOF 3MO3A 3QGNB 1JIMA 3MNXA 1UK3A 1D4PB 4IN2A 1SGIB 1EJNA 5F6MA 1OWKA 1Y5UT 1UTNA 2ZO3H 1YCPH 2ZC9H 1SI5H 4ZKSU 3ZVEA 3SI4H 2TGDA 2AMDA 2ZECA 3MU5A 2UWOA 2R3UA 2G4TA 4IMQA 2Z3EA 1A7SA 5JBAS 3M37A 4OS2A 5LPEA 1EP6A 3Q00A 4X2YA 1C1UH 1MBMA 1O35A 2OTVA 2VWMA 3EDXB 3SJOA 5J4SA 3DA9B 3GOVB 4BAQB 3R0FA 1BDAA 1C1RA 3UUZA 4BNRA 3K6ZA 9ESTA 1BTWA 4ABFA 1HYLA 5EODA 1C2LA 1YPGH 4BAHB 2CXVA 5F03A 1C2EA 8KME2 4WY3A 1SGFG 1BBRH 2AMPA 4DG4A 3S0NA 1CA0C 3BTQE 1B7XB 3LJOA 1DWEH 4TPYA 4BAKB 1AB9B 1DSTA 1C1WH 1U6QA 5FCKA 2FTLE 3Q3YA 1GJDB 5DGJA 1C1SA 2QN5T 1QQUA 4X8SH 2LNCA 4D7GA 1BB0B 1SBWA 4KKDA 3MU4A 1WBGB 2Y82A 1K28D 1O2HA 3D23A 3H7OA 1THSH 1CE5A 2VVUA 1P10A 1DLKB 2G5NA 3OTJE 2XNIA 1TOMH 1WV7H 1QJ6B 5FPYA 2GMTC 4NA7A 3ZZ7A 3ZZ8A 1SR5C 2TRMA 5A09A 2ZDVH 4CRFA 3UQVA 1TGTA 1O3HA 3BSQA 3LU9B 1ZTJA 5C5OA 1CGJE 1SGEE 1IQJA 1SFIA 4JYTA 1NFUA 1C5VA 4ABHA 2FP7B 1XX9A 1RD3B 1HAGE 2C90B 3TU7H 3UY9A 4GVUA 1VITG 4GCHG 2Z3DA 3A7XA 1KYNA 2VGCB 3DUXH 1GJ9B 1GHAF 4YO9A 1FMGA 1ZHRA 2HNTC 3PTNA 1EZSC 1UTPA 4UEHH 1TX6A 3LGWA 3BEFB 4DT7B 1ZMNA 3A7WA 3OY5U 3E90B 2GCHG 1WOFA 5E2PA 1W7XH 1ARBA 3PO1C 3UWIA 3KQBA 1FZZA 1WCZA 1XUGA 2PSXA 3SQEE 1FN8A 2XW9A 3PMHB 1GPZA 1GMDG 3A86A 5HGGA 1PYTC 1EXFA 2XWAA 2FLBH 4J2YB 4JZEH 1L4DA 3LH1A 5CMXH 1GGDB 1D3TB 1TGBA 1CA8B 1SGDE 1C2JA 4I8HA 5JDUB 5FX5A 1GVKB 3EQ0H 1SHYA 1ANEA 2NWNA 5LGOA 2BD2A 1JMOH 1GMHG 1M9UA 3STJA 3EA9A 4H6SB 2BM2A 4I32A 1FJSA 1YPJH 2VIDA 3SGQE 1FONA 1Z8RA 2FX4A 2GZ9A 1BMNH 4X1QU 2C8ZB 4NFFA 2ZFTA 4DJZB 1TOCB 2TGTA 2F83A 4F4OC 3SW2B 1FDPA 2HNTF 4Z6AH 2ZF0H 3A87A 3FANA 1ELGA 4MDSA 5E0JA 2EI6A 3V3MA 1EPTB 3Q77A 1ELVA 1UJ1A 1O2RA 4MPWA 2PR3A 1ZHMA 3IITA 4RN6A 1MTNB 4JZ1A 3SN8A 2QYIA 1F5RA 2C3SA 1AHTH 4ABEA 4ZMAH 4FUDA 5FAHA 1Y3XA 3BG4B 4FUGA 1KLIH 2BB4A 3LIWA 1OKXA 4NG9H 1HXFH 3SU6A 1FY1A 5F8TA 4I7YH 1L1GA 4NGAH 3M61U 2BY5X 2AYWA 1Y3WA 4CHAB 2V0BA 3RDZA 1GI0A 5DO4H 2OBQA 1MKXK 4AGKA 4NIWA 1YKTA 1VJ9U 5T6GA 3A83A 1O2JA 1QRWA 1ZJKA 3RXRA 1C1NA 1THPB 1BHXF 3GY3A 2KAIB 3SV8A 3T5FH 4RSPA 7KMEH 3SNBA 1GBDA 3UOPA 3W95A 4QT8C 4ASHA 2VVVA 4WH8A 4THNH 1V2WT 1T31A 2JETC 2ZDMA 2V6NA 1GVLA 2J94A 1Z6JH 1FIZA 2JH5D 2VNTA 3L6PA 1CBWC 4B1TA 2DE9A 2AIPA 2WYGA 2W26A 5JYIA 2O8UA 1O2ZA 1N8OC 3ZZBA 2R2WU 1QQ4A 1YP9A 1P2NA 4B2CA 3A80A 1DDJA 2Z94A 1DWCH 1G3DA 4LZ1H 2F9PA
chains in the Genus database with same CATH superfamily
1O2XA 1O34A 1KY9A 3F9HA 1YYY1 3ZVFA 1C5PA 2SGEE 3DCLA 1A3BH 2KCPA 1G3BA 2ZGJA 5EOKA 2HVYB 3H7TA 3GCTG 2GTBA 1C5TA 4P00A 3PMBB 1TE0A 2TIOA 4FUEA 3LH3A 3SZNA 2EI7A 3FO8D 1C5WB 1W12U 2SGQE 1FPHH 3EA8A 4UFDH 3W94A 1ELAA 5EW2H 3TVJB 4PROA 1PPHE 1SLUB 5ESBA 4WWYA 3VB6A 5K0HA 1O2IA 1OWJA 2RA3A 1Y59T 2A4OA 4OS4A 1D3DB 2JKHA 2WPJS 4VGCC 1SQRA 1V2PT 4Z1MD 2BD5A 5JBCS 1PQ8A 1TGSZ 2BQ6B 1TWXB 4JYVH 4CBOA 1LO6A 1YF4A 2BDAA 3M5LA 4O9VA 4RT1A 3TNSA 3VXEH 1TALA 3MO9A 3LGTA 3SJ8A 2OC0A 3TJOA 3AASA 1LMWB 3GY7A 3LDXH 4JZDH 3SYJA 2YMSB 1FY5A 2FM2A 2H2ZA 2K8IA 4OS7A 3ELAH 2QA9E 3GISB 3QDZB 1O2SA 1AKSB 1BRBE 3SU2A 1AUJA 4ISHH 2A7JA 3RM0H 2A1DB 1IQNA 1QIXB 1AFQB 1LHEH 3VB4A 1MCVA 4BAOB 1AMHA 1HBTH 2ZI2H 4SGBE 1C5ZB 1JIRA 1WQVH 1P2MA 1YPKH 2D2DA 1NESE 2G8TA 2GZ7A 1MMJN 1NU7B 5C0TA 2AS9A 1FNIA 5AHGH 1QURH 3LONA 4A1TA 1O2TA 1A0JA 4ABAA 4OS1A 1ZLRA 1IQEA 3UFAA 2PWXA 1NC6A 2KM0A 1CT4E 1S85A 1MKWK 3RXGA 1UTJA 3OEHD 1ZTLA 1TRNA 3RXHA 1AUTC 1NTPA 1LPKB 2R2MB 1RIWC 4UFFH 3TJUA 3MU0A 3HKJB 1FY8E 1COWD 1O3DA 4MNVA 5JBTA 3FP7E 1SGTA 3AW1A 1HDTH 1O2UA 1RJXB 5GCHG 4ASUD 3TH2H 3LC5A 5L2ZH 1QGFA 1O3MA 3KQEA 1GJ4H 1BUIA 4GPGA 3RXLA 3U1IB 1OOKB 1BIOA 2YOLA 2WPKS 2K0QA 1WAYB 1J17T 1AVXA 3FKSD 2BY7X 2GZ8A 1KMHB 2BQWB 2FOAA 3ODFA 3TIUA 3WW7A 1V2QT 1TAWA 2BHGA 3T29A 1G30B 3QWCH 3Q3XA 3RXDA 3ZIAD 2A0QB 2IN2A 4ISLA 1QRZA 1C5SA 1O3OA 2GP9B 1C5OH 1GI9B 2BYAX 1O2YA 3K65B 2H9TH 4U30A 5CE1A 1BRCE 3DT0H 1DITH 1P06A 5GNDA 5AF9H 5C17A 4BOHA 3P92A 1INCA 4LOYH 2R0LA 3F3BA 4ZHAA 3TK9A 1C2KA 1EPTC 2FOCA 1HAPH 1GJAB 2ZGBH 5G4BA 3SNCA 4ISNA 2BDYA 3BEUA 1HNEE 1FUJA 4NA8A 1ANDA 3TGJE 1EAIA 2Y81A 1NBME 2HPPH 2ZTXA 2ANKH 1DX5M 6GCHF 1GDQA 1CQQA 3KNXA 1V2UT 2XC0A 3GDUA 4RKJB 4A1VA 1SFQB 1EX3A 1QTFA 1YPLH 1BITA 2FMJA 5GJ4B 4CRCA 1O38A 4Y8ZA 2OLGA 3SU4A 3U8RH 4AYYB 9LPRA 2FS9A 2FYQA 1SKYE 1O5DH 4AB9A 5EW1H 2J98A 1DVAH 1YM0A 1ELTA 2BD3A 2D26C 4B76A 2YNAA 1EZQA 1TPOA 4I8LA 2VWLA 1VGCC 1E36B 3DFJA 1UTKA 1GWAA 1PPGE 3HPTB 3ZV8A 1S6FA 3M5NA 3PLKA 2D1JA 2ZEBA 2P3UB 3A7ZA 3UAIC 3KHVA 4ISIH 5HIYA 4AYVB 3I77A 1TONA 1DUAA 1XKAC 5KGOA 5DP3A 2OINA 1F0SA 1HJ9A 4D9RA 1ELDE 1Z6EA 1XUKA 1K1IA 1TIOA 3MU1A 3EYDA 2GCTC 4MPVA 1RFNA 2ZWLH 2HLDD 1SLXB 3ATKA 1YPHC 4Y79A 3TNTA 1C2GA 4YM9A 2UWLA 1GG6B 2VU8E 4FU8A 4K60A 3KN2A 5ETXA 1WSSH 4ESTE 1FV9A 4ZCNA 3ATIA 1MBQA 2QXHA 1MQ6A 3FAOA 5F8XA 4AG1A 5CHAB 2F4LA 1LKAA 3HGPA 1C1MA 1GBIA 2BD8A 2O9QA 4X8VH 4KELA 1LPGB 1VITF 4GCHF 4TPIZ 1E0FD 1A3EH 2Y6TA 1HIAB 3GY8A 5C20A 3BTKE 5HKKD 4K3JA 1RS0A 4X2WA 1LVOA 2Z6BD 1HLTH 1P2QA 1F7ZA 3DHKH 4NIVA 3UR9A 3AVZA 2PP6A 3QK1A 2BZAA 3ZZDA 2GV6A 2BZ6H 6CHAC 1KXDA 1ZMJA 1MKXH 4K2YA 2GCHF 3UTUH 3NRLA 3D49H 5PTPA 4ABDA 1SGNE 4X6MA 4D7FA 1ZJDA 1BTXA 1ESAA 4CR9A 5C1YA 1XKBC 4NSYA 1SSXA 4SGAE 1GMDF 5AVDA 2H9EH 2P59A 3M5MA 1P2JA 2ZPQA 1BZXE 2ZHEH 1K21H 3QGJA 3NXPA 3PROA 2R0KA 3N7DA 4Y8XA 3SU1A 3ATMA 1QBVH 1H8HD 1LHCH 1EATA 1O2KA 2XBXA 1TFXA 3BTGE 1SB1H 1UHBB 5A2MH 3SJ9A 1V2LT 3TGKE 2A4RA 1TBRH 1QB9A 2FO9A 1NU9A 4F48B 1P04A 3A84A 4Q7YA 1NRQH 2RDLA 3A8CA 1GJ5H 1HPGA 1LQDB 1MZAA 2Q6DA 1AFQC 3RXOA 1P3EA 3T28A 3GS9A 1E79D 4ZXXH 1LKBA 4Y71A 1GL1A 2XYAA 1TQ0B 1EUFA 1TNHA 2HPQH 3KL6A 2PKAB 5JBBS 5A0CA 1GI2A 2AMQA 1NO9H 3HGNA 4K5ZA 2Y7XA 3VGCB 3T62A 5A0BA 2IPQX 1Z7KA 3U8TH 2V7QD 2J5UA 2SNVA 1PPFE 3F0PA 2WPHS 1QA7A 3EE7A 1T8MA 2A5KA 1O3EA 3LOXA 3V7TA 3RXBA 1AY6H 1ESTA 4ZHLU 1OYTH 3IWMA 3RXFA 3BEIB 2FDAA 4JZIA 1YLCA 1J9CH 4U01A 2ZG0H 4TSFD 1UW7A 2P94A 3HK6B 1A46H 1Q2WA 4JK5A 5KECA 1Q3XA 1QZ8A 1O2QA 2XBVA 6GCHG 4FUCA 5LH8A 1ZGIA 2HGTH 2G00A 2QY0B 3BIVH 4DGJA 3PV2A 1MAXA 2VH6A 2Z9IA 3M7TA 3U8OH 1C2IA 3CS7A 1SGRE 2OD3B 4XOJA 2BDGA 1BMMH 3OX7U 2V3HH 1NFYA 4IS5A 1C4Y2 1G3EA 2QXIA 1W8BH 4M7GA 5EXLA 1BCUH 1WTHD 1AE5A 1TGNA 1HB0B 2OC1A 1IQIA 2ILNA 2ZFFH 1MUEB 2FOEA 3L3TA 2UWPA 1EAWA 1UVTH 2W3KA 2ALVA 2G55A 3SU3A 4A92A 3S9AA 1T32A 2P8OB 2ZZUH 1OS8A 1CU1A 1NM6A 1C5RA 1YBWA 3UREA 4WMEA 4XRNA 2QC2A 3SQHE 1G9IE 1V2JT 4WXVA 2JH0D 4Q7XA 2CF8H 2ZHQH 2ZCLP 1O2LA 3P17H 1D9IA 3NKKA 2ANYA 1UK2A 5L6NH 1H8IH 3BTWE 2VWNA 1HV7A 1C1OA 4DOQA 3GCTF 3LGYA 1TLDA 1O3LA 1PJPA 2NU2E 3MO6A 1GBEA 1DY8A 1ZSJA 1Z8GA 1CGIE 4IBLH 4WVPE 4KTCA 1A1RA 3BG8A 4FUHA 3RXCA 2VINA 4YESB 1YLNA 1J15A 1IHTH 1O2OA 1K0HA 3LJJA 4AFQA 2PHBA 2C4FH 4YT7H 1QNJA 2TPIZ 4WMFA 2AGGX 2ZU1A 1XXDA 3NUMA 2R3YA 4CRGA 8LPRA 1FAKH 1TMBH 2XCFA 2BLQA 3FZDA 1C5QA 1GBLA 2EEKA 3T25A 1LHFH 1S5SA 1VCWA 3M3SA 3P8FA 1MTVA 1ZOMA 5EQSA 2WUBA 1EOLA 4ACBA 4D9QA 5C67A 1KSNA 1TPPA 1BT7A 2DUCA 3UOUA 1H9IE 2PLXA 1PPCE 2NU1E 1T7CA 1UCYE 3T2NA 4CR5A 2C8XB 5ABWA 1ZPCA 2KX4A 3RC4A 3SGAE 4Y10E 1SQTA 1HAIH 2G4UA 1OHHD 3LGVA 1RXPA 2KZ4A 2PGQB 5DK1A 1VZQH 1UTQA 2ZPSA 3UPEA 1YGCH 3UQOA 5JB8S 2YMSD 1GHVH 5GPIB 1QJ1B 2OCVB 2CHAC 1O3JA 1A5IA 4M9FA 4MTBA 1GMCG 2VVCA 1VJAU 4JZFH 5AFYH 1TBZH 4ZKOU 2V3OH 2W3IA 5E0GA 1K1JA 1PFXC 3F2FA 1WDIA 3LT3A 2VWOA 1XVMA 3MH6A 2M5TA 1GBMA 5EG4A 1GCTC 1GHZA 4KTUA 4NFEA 2BD7A 1TX8A 1X7AC 3F9EA 4X2VA 2P95A 4MNWA 1GBFA 2FTMA 3TK5A 2XXLA 1DWBH 2LP6A 2SFAA 2A5IA 2Q1JA 2ZDNA 2OUAA 3KQCA 4UDWH 2QXJA 2O8TA 2FXRA 1F0UA 1ZPBA 3GCHB 1EJAA 1QB1A 1P01A 2Y5FA 5DJ7A 1QRXA 3STIA 2F9VA 1V2OT 2THFB 3BTME 4U32A 5GCHF 1P2OA 6ESTA 2BY8X 3GICB 1SHHB 1HFDA 3O8DA 4E05H 2QF5A 1F0TA 1ETTH 2HVXA 4HFPB 1YLDA 3DSPA 4F49A 2RA0A 2W7UA 1IQFA 4BTTB 2O8MA 1L2EA 2EI8A 1CO7E 1EAXA 1UCYH 3ZVBA 2QIQA 1K1MA 1NT1A 1HAVB 1QY6A 4HTCH 4FU9A 2Z9LA 5CDFE 1AO5A 3M7QA 3GDSA 2LPRA 1C2DA 1TNJA 2LELA 1AWFH 1VKYA 2ZIQH 3NCLA 2BX4A 2WV9A 3E6PH 3RXEA 2WPDD 4ZAEA 3ZZ9A 2BD4A 4Y6DA 1P3CA 2F3CE 1E34B 4AGJA 1P09A 1Y8TA 4AB8A 5I25A 2J38A 3OY6U 4ZKRU 1O32A 3EGKH 2J9NA 4IC6A 4XBBA 3U9AH 5IK2D 2PKSB 1HAZB 1AQ7A 2XNDD 2ZPRA 3BF6H 2EQNA 1LQEA 3CP7A 2ZGHA 4X1SU 5TJXA 4DCDA 1ETRH 2GDEH 4H6TA 5A0AE 2ESTE 3L33A 1ZRBA 3I78A 3ZVCA 5HYOA 4Q4LA 3SUFA 5LPFA 1C5NH 3GYLB 5DP5A 3PRDA 5HM2A 1HGTH 2GDDA 2ZTZA 4E06H 1XUHA 2GT7A 3OU0A 3BIUH 1K1LA 3BV9B 5FX6A 3VPKA 1Y3UA 2ZTYA 5E2OA 2BXTH 3RXTA 4AOQA 4X1PU 1O2PA 2J34A 1RRKA 1AU8A 4AORA 1AZZA 5EXMA 2CK3D 2ZDAH 1EZXC 5FPTA 1AGJA 1AVGH 1HCGA 1TNIA 3NZIA 3WWFA 3OYPA 3K2UA 1AB9C 1XXFA 3K9XB 1KTTB 4WXIA 5HXFA 2AEIH 3QUMP 4AFZA 4K1EA 1BTUA 4K8BA 1YCPK 3GY5A 1GI4A 3Q3KA 1VCQA 4DY7B 3QTOH 5K7RA 3MWIU 3ZZAA 2BOHB 1UTOA 4CH8B 1TABE 2XCNA 4X0WU 1A0LA 4J1YA 1DUEA 2Y5GA 3SUDA 1G2LA 3KQ5A 2EA3A 1AVWA 1QL9A 1YPHE 4JMYA 1O5FH 2ZU4A 1UTMA 2TBSA 3A8AA 1O36A 1KDQA 3RLYH 1OP8A 1IOEA 1Z1IA 1OPHB 3SI3H 2FOGA 2FI4E 4RKOB 4Q2KA 1DANH 1THRH 2F9OA 2K1QA 2BXUH 1C2FA 1SC8U 2TGPZ 3RP2A 4OGXA 2V35A 2ZGXH 1BBRK 1P2KA 1TPSA 3GY6A 2VGCC 3N7OA 4ZXYH 2SGAA 1HAXB 3DFLA 1VITH 4Y7BA 2FOMB 3T26A 1LCYA 2ZU2A 2PW8H 2BVSH 4UONA 1F5KU 1LTOA 1P2IA 2ASUB 4YTAA 2FS8A 2OK5A 1ESBA 2ODPA 2JH6D 3KYFA 3EAJA 3SU0A 5HIZA 3M3TA 2B9LA 1NRPH 1CHGA 3QZRA 1WUNH 2B5TB 2BLOA 3RM2H 1T8NA 4GLYA 3URCA 4GAWA 4A6LA 5C0UA 4JYUH 1UO6A 1P11E 2BDHA 1S0QA 1GBCA 1GGDC 3QZQA 1JRSA 5FCRA 2BVXH 2QXGA 3H09A 4INLA 1HRTH 4TWYA 1LVYA 3F1SB 5EPNA 3TITA 1V2KT 1TBQH 3V0XA 1T4VH 2EY4C 4XBDA 5DN6D 2WUCA 3F9GA 4I33A 3ZZ6A 1RTKA 1TNGA 2B8OH 3SBKA 1O3FA 1MCTA 1YPEH 1UVOA 3RMNH 3ZVDA 1OWHA 1CA0B 5DP4A 4O3TA 3FP6E 1DXWA 3AK5A 3JZ2B 1GI7B 3ITIA 1LVMA 3PMAB 3SV2H 2GX4A 5DP6A 1AD8H 1JRTA 1MTNC 1H1BA 1ARCA 1MABB 4I31A 1DS2E 2BTCE 2F9UA 1S6HA 4HI3A 2RG3A 1NN6A 1C5MD 3S69A 5B6LA 1N6XA 3GDVA 5LPRA 1AFEH 1E38B 1O31A 2F9BH 1DOJA 1PQ7A 1OXGA 1PQAA 3AAVA 4YLUA 5BPEA 1FIWA 3BG4C 3M3VA 2FOFA 3SU5A 1GJ6A 5EJZA 4P02A 3G01A 1UTLM 3MI4A 4BTIB 1Z1JA 1BTYA 1NFXA 2OXSA 2W6ID 3RC5A 3Q76A 1YPMH 4OS6A 4CHAC 2RFKC 3LPRA 1KLTA 3A81A 1ANCA 5JPMH 3A88A 4IC5A 2P93A 3SOSA 3F68H 1SG8B 4D8NA 5I46H 1TYNA 4WH6A 1TGCA 2A5AA 4TWWA 1IQHA 3E91A 2BDCA 4X1RU 3RLWH 3BN9A 1IHSH 1OP2A 2GKVE 3PWBA 5IYTA 3A7VA 1GI6A 2H5CA 1PPZA 4O97A 1G36A 4BANB 1IQMA 4IN1A 1SGQE 2YNBA 3BTTE 1XVOA 4A7IB 1SGFA 2O8LA 1O3BA 3PO1B 3RU4T 1MQ5A 3LKWA 2C93B 2VJ1A 5FPSA 2TGAA 7GCHG 2KR7A 3TK6A 4GSOA 3KGPA 1BA8B 1TRMA 1S0RA 3A8DA 3DD2H 5EXNA 1TNLA 3V12A 1C1TA 3P6ZB 3HK3B 1AWHB 1YCPM 4YLQH 4MVNA 4XFQA 1SQOA 2OQUA 4CREA 1S82A 1D3QB 2CV3A 3SJIA 2QV1A 3MH4A 2A45B 1EPTA 2GGVB 2UUKB 1VCPA 1GDUA 2XRCA 2BDBA 4B2AA 5EGMA 2FIRH 4MG3A 1Y5AT 2A2XH 4INKA 3M36A 4YZUA 3TJNA 1WTGH 2FODA 5T3HA 5EPYA 2HNTE 4MNYA 1J8AA 1A0HB 1ETSH 5BRRE 3BTFE 3E16B 2DE8A 2ZCHP 1C5XB 1OSSA 1K22H 5EQRA 3R3GB 5JB9S 2OC7A 2QCYA 4FVBA 5EJ1A 1LHGH 2WSSD 3KEEA 3UB0A 1DLEA 3A8BA 4I8KA 5HMAA 1GJCB 1DICA 1GMCF 2ZFSA 2SGDE 1C2MA 1LDTT 2PGBB 3M35A 1K9OE 1AN1E 3SO3A 5A8ZA 1OP0A 4NSVA 2YMSC 8ESTE 2KAIA 1EJMA 2Y7ZA 3FVFB 1GHBG 3DSOA 5T6FA 1ABIH 1SLVB 2KCOA 1ELBA 1HAHH 1MAYA 5E8EH 1W0YH 1H9HE 3DSGA 2AFQB 2JJ1D 3AAUA 3K6YA 1UK4A 3S7HB 2ZDKA 3C27B 2ZKSA 1O30A 4GHQA 2PUQH 5FBIA 1RGQA 4YOJA 4DIIH 2KCAA 1N1LA 1E37B 2A31A 1ELCA 1DSUA 1O2VA 2QAAA 3LGUA 2BD9A 3ATLA 3OFND 2G52A 4TY6A 1FAXA 1ID5H 2AHME 3A85A 1G32B 1BOQA 4K8YA 2WPMS 2OP9A 1O5GH 1QBNA 3RU4E 2IJD1 4ABIA 2W5EA 1WYKA 1KIGH 2PV9B 2JETB 4ZROA 2BQ7B 1TMUH 4X2XA 3WY8A 1V2NT 4CRDA 2VB0A 5EU8A 2A2QH 3TH4H 3TLOA 1CBWB 1LHDH 3E1XB 1DWDH 3ZVGA 1BMAA 3LC3A 2ZQ2A 4XBCA 1N8OB 2FLRH 1H9LB 1JBUH 1K2I1 1V6DA 2FZZA 1BRAA 3RXIA 2HLCA 3CS0A 4Z0KA 1GI3A 1HJAB 3P95A 8GCHF 5DG6A 2XBWA 2GD4B 1C5LH 1QFKH 4HZHA 1CT0E 1UVSH 1Y3VA 2PUXB 5T1VA 1SOTA 1O5AB 5J4QA 1P8VC 3MQKC 4AX9H 1C1PA 3HKIB 3NPSA 1VR1H 2Y80A 1DFPA 1KXEA 4B71A 1ZTKA 5TCAA 1NRNH 4Q80A 1BQYA 1GJBB 1AZ8A 2ZQ1A 1O5CB 1W0JD 2VIQA 4Y7AA 1AKSA 1EQ9A 4VGCB 2IOTA 5C5NA 4A5TS 1MKWH 4O3UA 3PV5A 3EA7A 1IQGA 2ALPA 3B9FH 3TPIZ 4MPUA 1XM1A 2JJ2D 1QHRB 1TA6A 1QJ7B 3VB5A 4Y76A 3S7KB 3BTEE 1FXYA 1MU8B 4X6OA 4XD7D 1D6WA 5T6DA 2C8YB 1C9PA 5EQQA 1GJ7B 1MH0A 1FY4A 3GY4A 1G3CA 4I86A 3PWCA 4X6PA 2ZP0H 1ORFA 4B73A 3SGBE 4Y0ZE 1F92A 2CJIA 2GV7A 2FOHA 2ULLA 1NRSH 3UWJH 1YY3A 4JCNA 2VIWA 3MMGA 4BXWA 1TMTH 6LPRA 3RXMA 3ENSB 3D65E 2O8WA 2WPIS 3FFGA 4YT6H 1BJVA 1XUFA 4A1XA 4BTUB 1P02A 2FX6A 1SOZA 1GBBA 3GCOA 1GBJA 1P0SH 2A4QA 3ZZ3A 3UNQA 4ABBA 2GVFA 1BTHH 1RIWB 1GG6C 2G81E 4NA9H 2W7SA 2ODQA 1L0ZA 1V2ST 1WU1A 1QCPA 4B75A 1ABJH 2QF3A 1GBKA 2J97A 3I29A 1JOUB 4KTSA 4CH2B 1O3GA 3PLBA 1S83A 1EKBB 3VEQB 1MU6B 3MHWU 5CHAC 1QB6A 5FBEA 4RT0A 2WV5A 1HAYB 1SLWB 1QL7A 3E0PB 2CN0H 1CT2E 1ACBE 3RXPA 2NU4E 3MNCA 1D6RA 2NU0E 2EC9H 4U2WA 3SV6A 1F2SE 1QR3E 1GVZA 2V3MA 3OE7D 1O3PB 1PQ5A 2R9PA 3SJKA 1SVPA 3SORA 1DY9A 3U69H 1O3NA 3RXJA 1H8DH 2Q6GA 1A61H 2SNWA 2ZFPH 2C8WB 1TNKA 1W7GH 4ZUHA 1G37A 4B74A 2PSYA 3KF2A 2Z9GA 3KIDU 1V2RT 3RXAA 1CHOG 1B0FA 2UUJB 1O3CA 1O5EH 4B6EA 4DVAU 1JWTA 1NBMD 2VIVA 3SNEA 2NU3E 1OWEA 2BY9X 1C5UA 3PMJA 1A5HA 3F2GA 1OX1A 3VB7A 5TCCA 5AFZH 3SNDA 1GBTA 1ZPZA 4AN7A 2XOKD 3SUGA 3KQDA 1EASA 2ZNKH 4FUBA 3BTDE 1SGYE 1GL0E 2GT8A 3B23B 1PPBH 3PLPA 1HXEH 3FZZA 8GCHG 4R0IA 2AERH 1NFWA 4OGYA 1K1PA 3MOCA 2XC5A 1O5BB 1HUTH 2VBCA 1FI8A 3O8CA 2Q6FA 3SHAH 1VGCB 1Q31A 1RTLA 2Y5HA 4I8GA 2H1UA 2PFEA 3PB1E 2BLVA 1P12E 3ZVAA 3E0NB 2AGEX 2RDEA 2STBE 2ZU3A 3BTHE 2ZA5A 2RCEA 1O3KA 1QBOA 3CNRA 5GIBA 3VGCC 2FYRA 4BAMB 4NZLA 2SGFE 1OWDA 1W0ZU 2GCTB 4ZH8A 2J2UA 1HIAA 1G2MA 1UVUH 1NROH 1DT2A 4FETA 1Z8IB 1ZSKA 1SL3A 5IDKA 1FY3A 4CRBA 2BOKA 3QX5H 4FUJA 1UVPA 1KXAA 3KCGH 1F5LA 1S81A 3QN7A 4KGAA 5FHTA 1SQAA 5C3NA 4JK6A 2PTCE 3M5OA 3SV9A 3RXQA 3JZ1B 2A32A 1FLEE 2HOBA 1C1QA 1N6YA 1A5GH 4YOGA 1HJAC 4FOUC 1GJ8B 5H4IB 1CSOE 3PM3A 3FP8E 4TT3D 2CMYA 3P8NA 1EP5A 4FVDA 2I6SA 3P8GA 1S84A 2STAE 3UR6A 3T27A 1GBAA 4K1TA 1O3AA 6CHAB 7ESTE 1MTWA 5CHBA 1ZSLA 1H4WA 1O39A 4TY7A 4TYDA 2J4IA 3MNSA 4IMZA 2WYJA 5GDSH 3IG6B 5DKMA 1BMLA 1GHAG 1UHBA 1Z71A 2Z7FE 1QA0A 3A82A 3E8LA 2CF9H 7GCHF 3PRBA 1BTZA 3MNBA 1GBHA 1W14U 2ZDLA 1F0RA 4AFSA 2P8OC 2ZFRH 3E3TA 1MTUA 3OSYA 3QTVH 1ZR0A 2FEQH 3AW0A 1CVWH 3OAAD 4NIXA 2F9NA 3VFEA 1GCDA 4FXGH 2P16A 5A8YA 5GWZA 5C94A 1PYTD 1Y3YA 4IW4E 2L74A 5DSFA 1DM4B 5E0HA 4ISOA 1KXCA 1J16A 2BX3A 3URDA 1PPEE 2PKAA 4X1NU 4AG2A 1L1JA 1O2GH 4FUIA 2UUYA 3O8RA 2IPHA 2GJGA 1P03A 1ZRKA 1W13U 3QO6A 1OWIA 3TJVA 5C2ZA 1FPCH 1BRUP 3P70B 2J92A 1TQ7B 1GHXH 3ZV9A 1O37A 1O2MA 3U98H 1EOJA 2Z3CA 1Z8JB 4MLFB 1V3XA 1W11U 1TRYA 4WJG2 3U1JB 2ZGCA 2OBOA 3RU4D 4ZHMU 2XBYA 3GCNA 4NWKA 1L1NA 1NY22 2FI5E 4Y0YE 3MFJA 1XUJA 2G51A 3MTYA 1FN6A 4I8JA 5DPAA 1V2MT 4AC9A 4R8TB 1UMAH 3EE0B 3ZZCA 1GI8B 4DURA 1W10U 4E7RG 1O0DH 1TX7A 2H5DA 4E7NA 4BXSA 4Y8YA 1ZHPA 1O2NA 4AZ2B 3RMOH 1FX0B 1GHBF 1S6LA 1IQKA 1W3CA 4CRAA 1K1OA 5L2YH 1LVBA 1P05A 2UUFB 4B6FA 2B0FA 3P8OA 3MYWA 1P9UA 4K1SA 4UFEH 4LK4A 1V2TT 3OTPA 3OEED 3LGIA 1GHWH 1P9SA 4ABJA 4B2BA 2AH4X 2P3TB 2F91A 1C1VH 1SGCA 1ZZZA 2BMGB 2ODYB 1FQ3A 2L6OA 4DIHH 4NIYA 1ZMLA 2ANMH 4DW2U 1C2HA 2VIOA 4KP0A 3RXKA 4XDEA 3ZZ4A 1SGPE 1ELEE 3H5CB 1C4U2 3GCHC 2IJOB 3UNSA 3NK8A 4Q63A 1RTFB 1KTSB 3MU8A 2ZHWH 4IGDA 3ODDA 4X6NA 2BLWA 4LXBH 4X8TH 2ZU5A 4Y11E 1BJUA 5DP9A 4HG6A 5F53A 2ZHFH 1P57B 1IAUA 2GMTB 2A4GA 2BVRH 4NWLA 4INHA 1AI8H 4D76A 4RI0A 1J14A 2BDIA 3RMMH 3MH7A 3GYMA 3SV7A 5A8XA 2D8WA 2BY6X 3SHCH 2OQ5A 1XUIA 4NCYA 3RXVA 4MQAA 3VB3A 1C4V2 1GI1A 1SPJA 1QL8A 3D62A 5HM9A 2FWWA 1SMFE 1AIXH 1NRRH 1B0EA 1O2WA 1XMNB 3RUOA 1V2VT 4UD9H 3ZZ5A 1E35B 2I6QA 1BTPA 2G5VA 1MD7A 1A4WH 3RXSA 3VG8A 1D3PB 1EZUC 2QE7D 1EB1H 5DP7A 4GUXA 1DE7H 4MNXA 1EB2A 1TA2A 4H42U 1NPMA 3GY2A 4H4FA 4NZQA 5B6OA 1ELFA 1W2KH 1K1NA 1ANBA 2PKSC 1MZDA 2HWLB 1T8OA 1CGHA 2QGRA 3NWUA 3ESTA 4WMDA 2VIPA 1Y5BT 2Z9KA 2A7CA 1O33A 1DPOA 1KXFA 1L4ZA 1O3IA 3A89A 2H6MA 2SGPE 3CENA 1UCYK 4FUFA 2M2AA 3SUEA 1C9TA 4ZKNU 2CHAB 4GHTA 3RMLH 2OC8A 4O03A 1W0KD 3ATWA 3S9CA 4AFUA 2HALA 2FPZA 2FOBA 1OYQA 1BHXB 1GCTB 1KXBA 2A7HA 4WF8A 2FI3E 2XWBI 3S9BA 1DXPA 3F2HA 5GXPA 1E1QD 1EAUA 5DP8A 2ZFQH 3A7YA 5EJLA 1IQLA 3MH5A 3PV4A 4ABGA 5EIYA 5L30H 1HJ8A 3PYHA 4XE4A 1YC0A 5C1UA 2AGIX 4HGCA 1MD8A 2ZCKP 1ZYOA 1NZQH 1TPAE 3V13A 3PTBA 1T8LA 1ZGVA 5SGAE 4LZ4B 3HATH 4Q7ZA 4FU7A 1MTSA 2H9HA 2P3FH 3SNAA 2XC4A 1HAVA 1KLJH 4UFGH 3A7TA 4X8UH 3TGIE 4UE7H 1GHYH 4YXWD 3VXFH 2QF0A 3UNRA 1NS3A 2J95A 2WPLS 3RXUA 4XSKU 3F6UH 1WQSA 2WV4A 2PTNA 5ESTE 5FXLA 1HAOH 1GDNA 2ANWA 4F55A 3B8JA 3C1KA 4K69A 2WINI 1TB6H 3TH3H 3QLPH 3RC6A 4YOIA 5F8ZA 2CGAA 2HRVA 2XTTB 2ZHDA 3UIRA 4DT4A 5C1XA 1GMHF 3M7UA 1BBRE 1LPZB 3ZYEA 3ZYDA 2B7DH 1A2CH 1B5GH 1C5YB 2FESH 1GI5A 2AIQA 4CBNA 2WZQA 2QF4A 4OS5A 1JXPA 1KDQB 2VH0A 1T4UH 2Z9JA 4MPXA 7LPRA 3O8BA 1AE8H 2JIZD 3F9FA 1CHOF 3MO3A 3QGNB 1JIMA 3MNXA 4ACAA 1UK3A 1D4PB 4IN2A 1SGIB 2W6JD 1EJNA 5F6MA 1OWKA 1Y5UT 5KEDA 4OM9A 3FOAA 1UTNA 2ZO3H 1YCPH 2ZC9H 1SI5H 4ZKSU 3ZVEA 3SI4H 2TGDA 3WWBA 2AMDA 2ZECA 3MU5A 2UWOA 2R3UA 2G4TA 4IMQA 1H8ED 2Z3EA 1A7SA 5JBAS 3M37A 4OS2A 5LPEA 1EP6A 3Q00A 4X2YA 1C1UH 1MBMA 1O35A 2OTVA 2VWMA 3EDXB 3SJOA 3FN8A 5J4SA 3DA9B 3GOVB 4BAQB 3R0FA 1BDAA 1C1RA 3UUZA 4BNRA 3K6ZA 9ESTA 1BTWA 4ABFA 1HYLA 5EODA 1C2LA 1YPGH 4BAHB 2CXVA 5F03A 1C2EA 3SZEA 8KME2 4WY3A 1SGFG 1BBRH 2AMPA 4DG4A 3S0NA 1CA0C 3BTQE 1B7XB 3LJOA 1DWEH 4TPYA 4BAKB 1AB9B 3W1EA 1DSTA 1C1WH 1U6QA 5FCKA 2FTLE 3Q3YA 1GJDB 5DGJA 1C1SA 2QN5T 1QQUA 4X8SH 2LNCA 4D7GA 1BB0B 1SBWA 4KKDA 3MU4A 1WBGB 2Y82A 1K28D 1O2HA 3D23A 3H7OA 1THSH 1CE5A 2VVUA 1P10A 1DLKB 2G5NA 3OTJE 2XNIA 1TOMH 1WV7H 1QJ6B 5FPYA 2GMTC 4NA7A 3ZZ7A 3ZZ8A 1SR5C 2TRMA 5A09A 2ZDVH 4CRFA 3UQVA 1TGTA 1O3HA 3BSQA 3LU9B 1ZTJA 5C5OA 1CGJE 1SGEE 1IQJA 1SFIA 4JYTA 1NFUA 1C5VA 4ABHA 2FP7B 1XX9A 1YWUA 1RD3B 1EFRD 1HAGE 2C90B 3TU7H 3UY9A 4GVUA 1VITG 4GCHG 2Z3DA 3A7XA 1KYNA 2VGCB 3DUXH 1GJ9B 1GHAF 4YO9A 1FMGA 1ZHRA 2HNTC 3PTNA 1EZSC 1UTPA 4UEHH 1TX6A 2J98B 3LGWA 3BEFB 4DT7B 1ZMNA 3A7WA 3OY5U 3E90B 2GCHG 1WOFA 5E2PA 5FL7D 1W7XH 1ARBA 3PO1C 3UWIA 3KQBA 1FZZA 1WCZA 1XUGA 2PSXA 3SQEE 1FN8A 2XW9A 3PMHB 1GPZA 1GMDG 3A86A 5HGGA 1PYTC 1EXFA 2XWAA 2FLBH 4J2YB 4JZEH 1L4DA 3LH1A 5CMXH 1GGDB 1D3TB 1TGBA 1CA8B 1SGDE 1C2JA 4I8HA 5JDUB 5FX5A 1GVKB 3EQ0H 1SHYA 2JDID 1ANEA 2WHXA 2NWNA 5LGOA 2BD2A 1JMOH 1GMHG 1M9UA 3STJA 3EA9A 4H6SB 2BM2A 4I32A 1FJSA 1YPJH 2VIDA 3SGQE 1FONA 1Z8RA 2FX4A 2GZ9A 1BMNH 4X1QU 2C8ZB 4NFFA 2ZFTA 4DJZB 1TOCB 2TGTA 2F83A 4F4OC 3SW2B 1FDPA 2HNTF 4Z6AH 2ZF0H 3A87A 3FANA 1ELGA 4MDSA 5E0JA 3U28C 2EI6A 3V3MA 1EPTB 3Q77A 1ELVA 3N7EA 1UJ1A 1O2RA 4MPWA 2PR3A 1ZHMA 3IITA 4RN6A 1MTNB 4JZ1A 2F43B 2KCYA 3SN8A 2QYIA 1F5RA 2C3SA 2KFWA 1AHTH 4ABEA 4ZMAH 4FUDA 5FAHA 1Y3XA 3N99A 3BG4B 4FUGA 1BMFD 1KLIH 2BB4A 3LIWA 1OKXA 4NG9H 1WXRA 1E1RD 1HXFH 3F0OA 3SU6A 1FY1A 5F8TA 4I7YH 1L1GA 4NGAH 3M61U 2BY5X 2AYWA 1Y3WA 4CHAB 2V0BA 3RDZA 1GI0A 5DO4H 2OBQA 1MKXK 4AGKA 4NIWA 1YKTA 1VJ9U 5T6GA 3A83A 1O2JA 1QRWA 1ZJKA 3RXRA 1C1NA 1THPB 1BHXF 3GY3A 2KAIB 3KYGA 3SV8A 3T5FH 4RSPA 7KMEH 3SNBA 1GBDA 3UOPA 3W95A 4QT8C 4ASHA 2VVVA 4WH8A 4THNH 1V2WT 1T31A 2JETC 2ZDMA 2V6NA 1GVLA 2J94A 1Z6JH 1FIZA 2JH5D 2VNTA 3L6PA 1CBWC 4B1TA 2DE9A 2AIPA 2WYGA 2W26A 5JYIA 2O8UA 1O2ZA 1N8OC 3ZZBA 2R2WU 1QQ4A 1YP9A 1P2NA 4B2CA 3A80A 1DDJA 2Z94A 1DWCH 1G3DA 4LZ1H 2F9PA
chains in the Genus database with same CATH topology
1O2XA 1O34A 1KY9A 3F9HA 1YYY1 3ZVFA 1C5PA 2SGEE 1A3BH 1G3BA 2ZGJA 5EOKA 3H7TA 3GCTG 2GTBA 1C5TA 3PMBB 1TE0A 2TIOA 4FUEA 3LH3A 3SZNA 2EI7A 1C5WB 1W12U 2SGQE 1FPHH 3EA8A 4UFDH 3W94A 1ELAA 5EW2H 3TVJB 4PROA 1PPHE 1SLUB 5ESBA 4WWYA 3VB6A 5K0HA 1O2IA 1OWJA 2RA3A 1Y59T 2A4OA 4OS4A 1D3DB 2JKHA 2WPJS 4VGCC 1V2PT 2BD5A 5JBCS 1PQ8A 1TGSZ 2BQ6B 1TWXB 4JYVH 4CBOA 1LO6A 1YF4A 2BDAA 3M5LA 4O9VA 3TNSA 3VXEH 1TALA 3MO9A 3LGTA 3SJ8A 2OC0A 3TJOA 3AASA 1LMWB 3GY7A 3LDXH 4JZDH 1FY5A 2FM2A 2H2ZA 4OS7A 3ELAH 2QA9E 3GISB 3QDZB 1O2SA 1AKSB 1BRBE 3SU2A 1AUJA 4ISHH 2A7JA 3RM0H 2A1DB 1IQNA 1QIXB 1AFQB 1LHEH 3VB4A 1MCVA 4BAOB 1AMHA 1HBTH 2ZI2H 4SGBE 1C5ZB 1JIRA 1WQVH 1P2MA 1YPKH 2D2DA 1NESE 2G8TA 2GZ7A 1MMJN 1NU7B 2AS9A 1FNIA 5AHGH 1QURH 3LONA 4A1TA 1O2TA 1A0JA 4ABAA 4OS1A 1ZLRA 1IQEA 3UFAA 2PWXA 1NC6A 1CT4E 1S85A 1MKWK 3RXGA 1UTJA 1ZTLA 1TRNA 3RXHA 1AUTC 1NTPA 1LPKB 2R2MB 1RIWC 4UFFH 3TJUA 3MU0A 3HKJB 1FY8E 1O3DA 4MNVA 5JBTA 3FP7E 1SGTA 3AW1A 1HDTH 1O2UA 1RJXB 5GCHG 3TH2H 3LC5A 5L2ZH 1QGFA 1O3MA 3KQEA 1GJ4H 1BUIA 4GPGA 3RXLA 3U1IB 1OOKB 1BIOA 2YOLA 2WPKS 1WAYB 1J17T 1AVXA 2BY7X 2GZ8A 2BQWB 2FOAA 3ODFA 3TIUA 1V2QT 1TAWA 2BHGA 3T29A 1G30B 3QWCH 3Q3XA 3RXDA 2A0QB 2IN2A 4ISLA 1QRZA 1C5SA 1O3OA 2GP9B 1C5OH 1GI9B 2BYAX 1O2YA 3K65B 2H9TH 4U30A 5CE1A 1BRCE 3DT0H 1DITH 1P06A 5AF9H 4BOHA 3P92A 1INCA 4LOYH 2R0LA 4ZHAA 3TK9A 1C2KA 1EPTC 2FOCA 1HAPH 1GJAB 2ZGBH 5G4BA 3SNCA 4ISNA 2BDYA 3BEUA 1HNEE 1FUJA 4NA8A 1ANDA 3TGJE 1EAIA 2Y81A 2HPPH 2ZTXA 2ANKH 1DX5M 6GCHF 1GDQA 1CQQA 3KNXA 1V2UT 2XC0A 3GDUA 4RKJB 4A1VA 1SFQB 1EX3A 1QTFA 1YPLH 1BITA 2FMJA 5GJ4B 4CRCA 1O38A 4Y8ZA 2OLGA 3SU4A 3U8RH 4AYYB 9LPRA 2FS9A 2FYQA 1O5DH 4AB9A 5EW1H 1DVAH 1YM0A 1ELTA 2BD3A 2D26C 4B76A 2YNAA 1EZQA 1TPOA 4I8LA 2VWLA 1VGCC 1E36B 3DFJA 1UTKA 1GWAA 1PPGE 3HPTB 3ZV8A 1S6FA 3M5NA 3PLKA 2D1JA 2ZEBA 2P3UB 3A7ZA 3KHVA 4ISIH 4AYVB 3I77A 1TONA 1DUAA 1XKAC 5DP3A 2OINA 1F0SA 1HJ9A 4D9RA 1ELDE 1Z6EA 1XUKA 1K1IA 1TIOA 3MU1A 3EYDA 2GCTC 4MPVA 1RFNA 2ZWLH 4Y79A 1SLXB 3ATKA 1YPHC 3TNTA 4YM9A 1C2GA 2UWLA 1GG6B 2VU8E 4FU8A 4K60A 3KN2A 5ETXA 1WSSH 4ESTE 1FV9A 3ATIA 1MBQA 2QXHA 1MQ6A 3FAOA 5F8XA 4AG1A 5CHAB 1LKAA 3HGPA 1C1MA 1GBIA 2BD8A 2O9QA 4X8VH 4KELA 1LPGB 1VITF 4GCHF 4TPIZ 1E0FD 1A3EH 2Y6TA 1HIAB 3GY8A 5C20A 3BTKE 4K3JA 1RS0A 4X2WA 1LVOA 2Z6BD 1HLTH 1P2QA 1F7ZA 3DHKH 4NIVA 3UR9A 3AVZA 3QK1A 2BZAA 3ZZDA 2GV6A 2BZ6H 6CHAC 1KXDA 1ZMJA 1MKXH 4K2YA 2GCHF 3UTUH 3D49H 5PTPA 4ABDA 1SGNE 4X6MA 4D7FA 1ZJDA 1BTXA 1ESAA 4CR9A 5C1YA 1XKBC 4NSYA 1SSXA 4SGAE 1GMDF 5AVDA 2H9EH 2P59A 3M5MA 1P2JA 2ZPQA 1BZXE 2ZHEH 1K21H 3QGJA 3NXPA 3PROA 2R0KA 4Y8XA 3SU1A 3ATMA 1QBVH 1LHCH 1EATA 1O2KA 2XBXA 1TFXA 3BTGE 1SB1H 1UHBB 5A2MH 3SJ9A 1V2LT 3TGKE 2A4RA 1TBRH 1QB9A 2FO9A 1NU9A 1P04A 3A84A 4Q7YA 1NRQH 2RDLA 3A8CA 1GJ5H 1HPGA 1LQDB 1MZAA 2Q6DA 1AFQC 3RXOA 1P3EA 3T28A 4ZXXH 1LKBA 4Y71A 1GL1A 2XYAA 1TQ0B 1EUFA 1TNHA 2HPQH 3KL6A 2PKAB 5JBBS 5A0CA 1GI2A 2AMQA 1NO9H 3HGNA 4K5ZA 2Y7XA 3VGCB 3T62A 5A0BA 1Z7KA 3U8TH 2SNVA 1PPFE 2WPHS 1QA7A 1T8MA 2A5KA 1O3EA 3LOXA 3V7TA 3RXBA 1AY6H 1ESTA 4ZHLU 1OYTH 3IWMA 3RXFA 3BEIB 2FDAA 4JZIA 1YLCA 1J9CH 4U01A 2ZG0H 2P94A 3HK6B 1A46H 1Q2WA 4JK5A 1Q3XA 1O2QA 2XBVA 6GCHG 4FUCA 5LH8A 1ZGIA 2HGTH 2G00A 2QY0B 3BIVH 4DGJA 3U8OH 1MAXA 2VH6A 2Z9IA 3M7TA 1C2IA 3CS7A 1SGRE 2OD3B 4XOJA 2BDGA 1BMMH 3OX7U 2V3HH 1NFYA 4IS5A 1C4Y2 1G3EA 2QXIA 1W8BH 4M7GA 5EXLA 1BCUH 1WTHD 1AE5A 1TGNA 1HB0B 2OC1A 1IQIA 2ILNA 2ZFFH 1MUEB 2FOEA 3L3TA 2UWPA 1EAWA 1UVTH 2W3KA 2ALVA 2G55A 3SU3A 4A92A 3S9AA 1T32A 2P8OB 2ZZUH 1OS8A 1CU1A 1NM6A 1C5RA 1YBWA 3UREA 4WMEA 2QC2A 3SQHE 1G9IE 1V2JT 4WXVA 2JH0D 4Q7XA 2CF8H 2ZHQH 2ZCLP 1O2LA 3P17H 1D9IA 3NKKA 2ANYA 1UK2A 5L6NH 1H8IH 3BTWE 2VWNA 1HV7A 1C1OA 4DOQA 3GCTF 3LGYA 1TLDA 1O3LA 1PJPA 2NU2E 3MO6A 1GBEA 1DY8A 1ZSJA 1Z8GA 1CGIE 4IBLH 4WVPE 4KTCA 1A1RA 3BG8A 4FUHA 3RXCA 2VINA 4YESB 1J15A 1IHTH 1O2OA 3LJJA 4AFQA 2PHBA 2C4FH 4YT7H 1QNJA 2TPIZ 4WMFA 2AGGX 2ZU1A 1XXDA 3NUMA 2R3YA 4CRGA 8LPRA 1FAKH 1TMBH 2XCFA 2BLQA 3FZDA 1C5QA 1GBLA 2EEKA 3T25A 1LHFH 1S5SA 1VCWA 3M3SA 3P8FA 1MTVA 1ZOMA 5EQSA 2WUBA 1EOLA 4D9QA 5C67A 1KSNA 1TPPA 1BT7A 2DUCA 3UOUA 1H9IE 2PLXA 1PPCE 2NU1E 1T7CA 1UCYE 3T2NA 4CR5A 2C8XB 5ABWA 1ZPCA 3RC4A 3SGAE 4Y10E 1SQTA 1HAIH 2G4UA 3LGVA 1RXPA 2PGQB 5DK1A 1VZQH 1UTQA 2ZPSA 3UPEA 1YGCH 3UQOA 5JB8S 5GPIB 1GHVH 1QJ1B 2OCVB 2CHAC 1O3JA 1A5IA 4MTBA 1GMCG 2VVCA 1VJAU 4JZFH 5AFYH 1TBZH 4ZKOU 2V3OH 2W3IA 5E0GA 1K1JA 1PFXC 3LT3A 2VWOA 1XVMA 3MH6A 2M5TA 1GBMA 5EG4A 1GCTC 1GHZA 4KTUA 4NFEA 2BD7A 1TX8A 1X7AC 3F9EA 4X2VA 2P95A 4MNWA 1GBFA 2FTMA 3TK5A 2XXLA 1DWBH 2SFAA 2A5IA 2Q1JA 2ZDNA 2OUAA 3KQCA 4UDWH 2QXJA 2O8TA 2FXRA 1F0UA 1ZPBA 3GCHB 1EJAA 1QB1A 1P01A 2Y5FA 5DJ7A 1QRXA 3STIA 2F9VA 1V2OT 2THFB 3BTME 4U32A 5GCHF 1P2OA 6ESTA 2BY8X 3GICB 1SHHB 1HFDA 3O8DA 4E05H 1F0TA 1ETTH 2HVXA 4HFPB 1YLDA 4F49A 2RA0A 2W7UA 1IQFA 4BTTB 2O8MA 1L2EA 2EI8A 1CO7E 1EAXA 1UCYH 3ZVBA 2QIQA 1K1MA 1NT1A 1HAVB 1QY6A 4HTCH 4FU9A 2Z9LA 1AO5A 3M7QA 3GDSA 2LPRA 1C2DA 1TNJA 1AWFH 2ZIQH 3NCLA 2BX4A 3E6PH 3RXEA 4ZAEA 3ZZ9A 2BD4A 4Y6DA 1P3CA 2F3CE 1E34B 4AGJA 1P09A 1Y8TA 4AB8A 5I25A 2J38A 3OY6U 4ZKRU 1O32A 3EGKH 2J9NA 4IC6A 4XBBA 3U9AH 2PKSB 1HAZB 1AQ7A 2ZPRA 3BF6H 1LQEA 3CP7A 2ZGHA 4X1SU 5TJXA 4DCDA 1ETRH 2GDEH 4H6TA 5A0AE 2ESTE 3L33A 1ZRBA 3I78A 3ZVCA 5HYOA 3SUFA 5LPFA 1C5NH 3GYLB 5DP5A 5HM2A 1HGTH 2GDDA 2ZTZA 4E06H 1XUHA 2GT7A 3OU0A 3BIUH 1K1LA 3BV9B 5FX6A 3VPKA 1Y3UA 2ZTYA 5E2OA 2BXTH 3RXTA 4AOQA 4X1PU 1O2PA 2J34A 1RRKA 1AU8A 4AORA 1AZZA 5EXMA 2ZDAH 1EZXC 5FPTA 1AGJA 1AVGH 1HCGA 1TNIA 3NZIA 3OYPA 3K2UA 1AB9C 1XXFA 3K9XB 1KTTB 4WXIA 5HXFA 2AEIH 3QUMP 4AFZA 4K1EA 1BTUA 4K8BA 1YCPK 3GY5A 1GI4A 3Q3KA 1VCQA 4DY7B 3QTOH 5K7RA 3MWIU 3ZZAA 2BOHB 1UTOA 4CH8B 1TABE 2XCNA 4X0WU 1A0LA 4J1YA 1DUEA 2Y5GA 3SUDA 1G2LA 2EA3A 1AVWA 1QL9A 1YPHE 4JMYA 1O5FH 2ZU4A 1UTMA 2TBSA 3A8AA 1O36A 1KDQA 3RLYH 1OP8A 1IOEA 1Z1IA 1OPHB 3SI3H 2FOGA 2FI4E 4RKOB 4Q2KA 1DANH 1THRH 2F9OA 2K1QA 2BXUH 1C2FA 1SC8U 2TGPZ 3RP2A 4OGXA 2V35A 2ZGXH 1BBRK 1P2KA 1TPSA 3GY6A 2VGCC 3N7OA 4ZXYH 2SGAA 1HAXB 3DFLA 1VITH 4Y7BA 2FOMB 3T26A 1LCYA 2ZU2A 2PW8H 2BVSH 4UONA 1F5KU 1LTOA 1P2IA 2ASUB 4YTAA 2FS8A 1ESBA 2ODPA 2JH6D 3EAJA 3SU0A 3M3TA 2B9LA 1NRPH 1CHGA 3QZRA 1WUNH 2B5TB 2BLOA 3RM2H 1T8NA 4GLYA 3URCA 4GAWA 4A6LA 4JYUH 1UO6A 1P11E 2BDHA 1S0QA 1GBCA 1GGDC 3QZQA 1JRSA 5FCRA 2BVXH 2QXGA 4INLA 1HRTH 4TWYA 1LVYA 3F1SB 5EPNA 3TITA 1V2KT 1TBQH 3V0XA 1T4VH 4XBDA 2WUCA 3F9GA 4I33A 3ZZ6A 1RTKA 1TNGA 2B8OH 3SBKA 1O3FA 1MCTA 1YPEH 1UVOA 3RMNH 3ZVDA 1OWHA 1CA0B 5DP4A 4O3TA 3FP6E 1DXWA 3JZ2B 1GI7B 3ITIA 1LVMA 3PMAB 3SV2H 2GX4A 5DP6A 1AD8H 1JRTA 1MTNC 1H1BA 1ARCA 4I31A 1DS2E 2BTCE 2F9UA 1S6HA 4HI3A 2RG3A 1NN6A 1C5MD 3S69A 1N6XA 3GDVA 5LPRA 1AFEH 1E38B 1O31A 2F9BH 1DOJA 1PQ7A 1OXGA 1PQAA 3AAVA 4YLUA 5BPEA 1FIWA 3BG4C 3M3VA 2FOFA 3SU5A 1GJ6A 3G01A 1UTLM 3MI4A 4BTIB 1Z1JA 1BTYA 1NFXA 2OXSA 3RC5A 3Q76A 1YPMH 4OS6A 4CHAC 3LPRA 1KLTA 3A81A 1ANCA 5JPMH 3A88A 4IC5A 2P93A 3SOSA 3F68H 1SG8B 4D8NA 5I46H 1TYNA 4WH6A 1TGCA 2A5AA 4TWWA 1IQHA 3E91A 2BDCA 4X1RU 3RLWH 3BN9A 1IHSH 1OP2A 2GKVE 3PWBA 5IYTA 3A7VA 1GI6A 2H5CA 1PPZA 4O97A 1G36A 4BANB 1IQMA 4IN1A 1SGQE 2YNBA 3BTTE 1XVOA 4A7IB 1SGFA 2O8LA 1O3BA 3PO1B 3RU4T 1MQ5A 3LKWA 2C93B 2VJ1A 5FPSA 2TGAA 7GCHG 3TK6A 4GSOA 3KGPA 1BA8B 1TRMA 1S0RA 3A8DA 3DD2H 5EXNA 1TNLA 3V12A 1C1TA 3P6ZB 3HK3B 1AWHB 1YCPM 4YLQH 4MVNA 4XFQA 1SQOA 2OQUA 4CREA 1S82A 1D3QB 2CV3A 3SJIA 2QV1A 3MH4A 2A45B 1EPTA 2GGVB 2UUKB 1VCPA 1GDUA 2XRCA 2BDBA 4B2AA 5EGMA 2FIRH 4MG3A 1Y5AT 2A2XH 4INKA 3M36A 4YZUA 3TJNA 1WTGH 2FODA 5T3HA 5EPYA 2HNTE 4MNYA 1J8AA 1A0HB 1ETSH 5BRRE 3BTFE 3E16B 2DE8A 2ZCHP 1C5XB 1OSSA 1K22H 5EQRA 3R3GB 5JB9S 2OC7A 2QCYA 4FVBA 1LHGH 3KEEA 1DLEA 3A8BA 4I8KA 5HMAA 1GJCB 1DICA 1GMCF 2ZFSA 2SGDE 1C2MA 1LDTT 2PGBB 3M35A 1K9OE 1AN1E 3SO3A 5A8ZA 1OP0A 4NSVA 8ESTE 2KAIA 1EJMA 2Y7ZA 3FVFB 1GHBG 5T6FA 1ABIH 1SLVB