3UQVA

Bovine trypsin variant x(triplephe227) in complex with small molecule inhibitor
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSETYNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSASSFIITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGFYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Cationic trypsin
publication title Correlating structure and ligand affinity in drug discovery: a cautionary tale involving second shell residues.
pubmed doi rcsb
source organism Bos taurus
total genus 53
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2011-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3uqvA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3uqvA02
1W2KH 1GI8B 1GBAA 3HPTB 1GI6A 1KSNA 1KY9A 3I78A 3SUFA 1YM0A 2FWWA 1TQ0B 1C2DA 4FU7A 3ATWA 7GCHF 2AFQB 4XBBA 4A5TS 5LPEA 2BY9X 4Q7YA 1SGNE 4TWWA 3PV4A 3K65B 1BHXF 2ZU5A 1YCPK 3QK1A 1O2XA 3SU4A 3SI4H 5JB9S 3A83A 1W0YH 1KLIH 2GZ9A 2XBVA 3MO3A 3P92A 1KIGH 1FY5A 3SU1A 4IS5A 2ZEBA 1Z8RA 2F9PA 1GMDF 2ZGBH 1J14A 3HK6B 1O2WA 1OXGA 2GDDA 1TGNA 1E36B 1BJVA 3GCOA 3LGTA 1MTWA 5T6DA 4A1XA 1S0QA 1ZRKA 1CE5A 4D8NA 1PQ7A 1PPHE 3A8AA 1XUFA 1P9UA 1HJAC 4X1SU 1A4WH 5ESTE 1N1LA 2JH0D 5TCAA 1V2VT 2P94A 4OS2A 5CE1A 1RS0A 1O3BA 1SL3A 2FS8A 3IITA 5T6FA 2R0LA 3UUZA 1LHCH 2VIWA 4BTUB 5TJXA 5JBCS 4F4OC 1KTTB 1D3QB 2RA0A 2FMJA 3LKWA 1C1UH 5LPFA 3RXBA 3PWBA 5GDSH 1C2MA 1P04A 2C8XB 5EGMA 1G2MA 3S9BA 3LONA 3MHWU 2FM2A 1SPJA 2O8MA 4VGCC 2PSXA 5EQQA 2CXVA 1BCUH 1WOFA 3SU2A 1AFEH 2PV9B 2WUCA 3F9EA 3P6ZB 4X0WU 1O30A 1UTKA 1SBWA 1GBEA 3T5FH 2HVXA 4KELA 4X1RU 1ELEE 1C5QA 4CRGA 2V0BA 3TVJB 1O3NA 1UK3A 1V2UT 3UFAA 3KCGH 1O2OA 1UTJA 1BDAA 2UWLA 1C2EA 5E2PA 3KEEA 1E35B 4NSYA 3DD2H 2WPHS 5GCHF 1A46H 1G36A 1RIWC 5FXLA 4ZHLU 4JYUH 1YLDA 1C1SA 1PQAA 3LGUA 1C1WH 3MU0A 1RGQA 2ANKH 2ZP0H 3K9XB 1TWXB 1AFQB 1P2JA 1SGIB 1ZMLA 3GCHC 1SQTA 1ESAA 3PMBB 2A7HA 1IQMA 4ISLA 1O36A 1TONA 3RC5A 2J38A 3E3TA 2JKHA 3A7TA 1ZSLA 2VU8E 2ODQA 1HAXB 4ISIH 1EP5A 1O5DH 3UWJH 1AE8H 4X6NA 3DHKH 1TAWA 2YNAA 1ZTLA 3Q00A 2Y81A 2OBOA 1G3BA 1DWDH 4NGAH 1KXAA 4INLA 4WJG2 3ATIA 3F9HA 4I33A 3EYDA 1BMMH 1SQAA 4LZ1H 1GI3A 1NFYA 1W0ZU 3UPEA 4J2YB 1D3DB 1MTNC 3QX5H 1ZLRA 4JZ1A 1MKWK 1OWJA 4WH8A 2FOEA 1IQJA 3ZZ3A 1LKAA 2BOKA 1GL0E 5ABWA 4HI3A 2O8UA 5SGAE 3NKKA 3U8TH 2BY6X 2Y7XA 2BHGA 1O31A 3RXEA 1NRQH 1OX1A 3MU4A 3EA9A 1B0FA 2ZFQH 4AX9H 2BZ6H 4NFEA 1GCTC 3ZVCA 1NO9H 3AVZA 1K21H 1MKXK 1C1OA 1CA0B 2F9UA 3TNTA 3RXPA 4ABAA 2Y7ZA 4RKJB 1P06A 3A8CA 3P17H 1C5NH 2OC0A 3PWCA 3RMNH 3BIUH 4A1VA 1FDPA 2AMQA 3ZZ7A 4GSOA 1LQDB 2NU3E 3SJ9A 2W26A 3OX7U 3GCTG 1TPSA 1Z1IA 1Z7KA 1ESTA 2BQ6B 1LVBA 1VGCC 1C5SA 1GHAF 5JPMH 4CHAC 3V13A 3ZZDA 5GXPA 3S9CA 3QZRA 1XVOA 3B23B 1BB0B 1TNKA 1X7AC 1O2TA 4Y76A 5FBEA 1OYTH 2C8YB 4TY7A 2FOMB 3U1IB 1ELGA 3GOVB 2AGEX 2JETB 1NESE 4THNH 2CJIA 1FQ3A 4B71A 1GMHF 3A89A 5A8ZA 2A4RA 1C1QA 5EG4A 5HYOA 4WXIA 1QRZA 3ATKA 1C5RA 1GBKA 1QL9A 1IHTH 4TY6A 3RXSA 2SFAA 3SOSA 4AFSA 8KME2 1YP9A 5FBIA 3M3TA 3MU8A 6LPRA 2ZCKP 4ZKNU 3U1JB 3S7HB 1C2JA 5C1UA 1C5TA 2HALA 3E0NB 1UHBA 2Z6BD 1A5GH 4ZKRU 3FANA 4FUDA 1GDQA 1ZPCA 3RMLH 1GBBA 4MPXA 5EOKA 1Z1JA 3Q77A 2VWNA 2O8WA 5C1XA 2LPRA 1EJAA 3RM0H 2G51A 2BZAA 1AVXA 4WWYA 1QL8A 1ABIH 3RXTA 2TGDA 2OUAA 1SGFA 1OWDA 4ZMAH 1O3EA 5DP5A 1AKSB 3E90B 2ZDMA 4ZHAA 2WINI 1C5WB 2OXSA 4BXSA 2P8OC 3GY2A 1CQQA 1LQEA 1TRMA 3M5LA 4JZDH 1BRAA 2EEKA 3QTOH 1RD3B 3MNCA 2BD4A 4KKDA 1EJNA 4JK6A 4GAWA 4BXWA 3BTWE 5EXLA 1N6XA 2Z9JA 2P59A 1HPGA 4B75A 1LVYA 2ZCLP 3RXRA 3MFJA 3ZZ4A 1O0DH 3SV6A 1EASA 1FMGA 1QQUA 3M61U 1SGPE 3TH4H 4CR5A 1IQIA 4D9RA 4GCHF 1RJXB 3B9FH 3MH5A 2QXHA 2QYIA 3BTEE 1TBZH 1C1TA 1AB9C 4UD9H 2PGBB 3S9AA 3NPSA 1BTZA 2FI4E 4A92A 1QBOA 2BVXH 1BMAA 3TGJE 2BX3A 5DJ7A 2ZPQA 2ZU1A 1DY9A 5HMAA 2Z9LA 1MD7A 1QJ6B 4HZHA 3QGJA 3RXIA 3U9AH 1UVSH 4XBDA 5E2OA 2OD3B 3TK9A 1DUEA 1ARBA 3ATLA 1EZQA 2BQWB 1WTGH 3D23A 1YCPH 1MZDA 4RKOB 1SLVB 4AZ2B 2FS9A 5DP6A 3LGWA 3MTYA 2FLBH 2GV6A 4CRAA 3MO6A 1DS2E 1PPGE 7GCHG 2BYAX 4DIIH 1V2PT 1SQOA 1YCPM 3UQVA 2QAAA 4HFPB 1D3PB 1J16A 5IDKA 1SSXA 1VZQH 3QN7A 5DP7A 1CA8B 1HDTH 1SGRE 4ZXXH 2H1UA 1OP0A 3RLWH 3PTBA 4O3TA 4X1NU 3ZZ6A 8LPRA 1J15A 1BMNH 8GCHG 1UVUH 2Q6DA 4UEHH 1MCVA 5CMXH 1P11E 1GMDG 4GHTA 2FTMA 1FPHH 4XFQA 5E0HA 1ARCA 5DK1A 1MD8A 2ESTE 1SOZA 3M36A 4XDEA 3ZVGA 4BTIB 1QA7A 2ZFRH 1WUNH 1N8OB 4DURA 1GBTA 1C2HA 1F0TA 1O38A 1MH0A 2Y5HA 3A84A 3HKIB 4NA9H 2ZU2A 3VXFH 3TU7H 3VB6A 3M7QA 1BRBE 1Z8IB 4HTCH 4NA8A 2IOTA 2C8ZB 1T4VH 2QA9E 1IQKA 2UWOA 1EX3A 1H1BA 1XUKA 3URCA 2TBSA 1XXDA 4KTUA 4Y11E 4D76A 1UVPA 1QB6A 2XYAA 2GCHG 1P01A 4BAHB 1SGTA 1C2FA 1EP6A 1NROH 3KQEA 1LMWB 1G2LA 1GWAA 1KXCA 3BTTE 1DVAH 1HLTH 1TNGA 2J4IA 4GLYA 1DLEA 2O8LA 4TPIZ 3SU6A 1ETRH 1T8NA 1O3CA 2G5VA 3M35A 1A0JA 1OWIA 5JBBS 2ZG0H 3KQDA 3MU5A 3RMMH 3S69A 3TGIE 2XWAA 1ZPBA 3SV7A 2XW9A 5GIBA 4YT7H 2B8OH 2D26C 2ZHEH 4MNYA 1E34B 1PPZA 2WUBA 1BRUP 1GHBF 1H8DH 2BD7A 2TRMA 5L6NH 2GGVB 1O5EH 1QR3E 2OQUA 3G01A 2G8TA 1MAXA 1BTPA 3MMGA 2ZKSA 4YZUA 1V3XA 4KGAA 3A87A 2BDHA 1O35A 4IC6A 5FX5A 1QB1A 4DW2U 1ZGIA 3RXGA 4NZLA 5EW1H 1P2OA 4O9VA 1NS3A 1PYTD 1NFXA 1HIAA 4CREA 1QY6A 2R0KA 1EPTC 2ZPSA 5L30H 1BQYA 1K1OA 1TNHA 2B5TB 3QO6A 1C5PA 3GISB 1MKWH 2FXRA 3ZVFA 1MBQA 1GDUA 2B0FA 1QBVH 3H7TA 1SOTA 5LPRA 5CHAB 1FY1A 1HAHH 1Y5AT 1L0ZA 2R3YA 1YPHC 4WMFA 2XTTB 4Y7AA 4NIVA 5A0CA 1GVKB 2ZZUH 3E1XB 1KXEA 1GBLA 4K1SA 1GG6C 1GI5A 4ABIA 1AD8H 1CT4E 2BD2A 3ITIA 2A7JA 3U69H 4ISOA 1ZPZA 2G4UA 3SNEA 1FZZA 2CHAC 1OOKB 2PKAB 3SBKA 1NM6A 1IQFA 2PUQH 1C5XB 1SFIA 1MKXH 1Z71A 1G32B 1TBRH 2FESH 3RU4D 2QV1A 4MNWA 5LGOA 2ZQ2A 4IMZA 4LOYH 4O97A 3ATMA 1TOMH 6CHAC 2J34A 4WVPE 2AEIH 1ANEA 1K1MA 1GCDA 1AVGH 1P10A 1WQSA 5AHGH 1CU1A 2UUJB 4O3UA 4AORA 1FN8A 2G4TA 1F92A 1O5GH 3A88A 4Q7XA 3RU4E 3BEFB 2ZHDA 1FAKH 3VB7A 4OS7A 1ZZZA 4Q80A 4BTTB 3NK8A 1C5ZB 1HYLA 1W3CA 4I32A 1Y3UA 2PR3A 1BTWA 1KYNA 2UUYA 1LDTT 2Z9KA 3BTME 4CRCA 5F8XA 3RXJA 1C1VH 5EXNA 1EUFA 2VIPA 4OS4A 3BG4C 4K5ZA 1TRNA 3SNBA 1C5MD 1GL1A 5G4BA 3UR6A 2Q6FA 1E37B 1O2IA 5H4IB 1GJ7B 1AIXH 3NXPA 1CO7E 4ZUHA 2O9QA 1OYQA 1GJ8B 2BMGB 1QJ7B 1B7XB 1TA6A 1NN6A 1EXFA 1Y8TA 4OS1A 1OPHB 2RDLA 4B2BA 1NC6A 3RC6A 3OY6U 5JB8S 3KQCA 4IGDA 4Y8XA 3UY9A 1HAPH 4IC5A 5FCRA 1GMHG 3RM2H 1UHBB 5C20A 3ZZAA 1HRTH 3H7OA 2AERH 3M7TA 2VGCC 2D1JA 3CENA 1A61H 1OWKA 3QZQA 2VH6A 1YPLH 2QN5T 3CS0A 5J4SA 3SGBE 3MNBA 2TIOA 1GJ4H 1GJBB 4XOJA 3PMJA 4M7GA 1CT0E 3MH7A 2H9HA 4D7FA 2EI7A 4JZEH 3F1SB 3RUOA 3GDUA 1S5SA 2ZDAH 3IWMA 5C5OA 3PLPA 1UCYE 3M3SA 1NRPH 2NU2E 1BITA 4IMQA 1AFQC 1FI8A 1XXFA 1WAYB 1ZYOA 4YTAA 1INCA 1DY8A 1THPB 3I77A 1G37A 3AASA 4B76A 2H9TH 2R2WU 2W5EA 3E8LA 1K22H 5PTPA 3UQOA 2WPMS 2HNTF 3F9FA 4I31A 4AOQA 5K7RA 2OTVA 3RXFA 1L1GA 1BTUA 5ESBA 1RFNA 3QDZB 3ZV8A 1GMCF 1PPEE 1C2LA 2A32A 2J2UA 1ELFA 1P8VC 1S6HA 2VH0A 2NU4E 4U01A 4WXVA 5C3NA 1J9CH 4JMYA 2F9VA 1FIWA 4Y0ZE 4Z0KA 3SNDA 1PPCE 1UJ1A 3TJVA 4DG4A 4IN2A 4DIHH 4CBNA 1O2GH 1U6QA 2ALVA 1LHDH 1GHVH 2NU0E 1TNJA 2XC0A 4YOGA 6GCHG 1CBWC 1DWBH 1O2NA 1BUIA 3UNQA 1OKXA 5T6GA 2Z9GA 2PKSB 2P95A 1MAYA 2XC5A 1HBTH 3T29A 1SHYA 2XWBI 2ZIQH 4XBCA 3A85A 3B8JA 4INHA 1K1IA 2FIRH 3EA8A 1YPHE 3T28A 1V2NT 2THFB 2GZ7A 2XCFA 2STAE 4X2XA 1H9IE 1PJPA 1TNIA 5DP9A 1O2UA 1RIWB 1NRNH 5L2ZH 2XC4A 5GWZA 3BTQE 1DXWA 1Q3XA 2BVRH 1S85A 3LGIA 3GY5A 3GY4A 3W94A 1O2YA 1TGSZ 3T26A 1IHSH 2WV4A 1C2GA 3L33A 1UTPA 2PUXB 3I29A 3RMOH 4DVAU 2R9PA 1JOUB 3NCLA 1P12E 4Y8YA 2HWLB 4MTBA 5FPSA 1IQLA 1S84A 3FZZA 4GPGA 1VJ9U 1EB2A 3BTDE 4I7YH 1QNJA 1ANBA 3RXMA 1YKTA 1UO6A 1EPTA 1GI9B 2ILNA 3H5CB 3MO9A 4Y7BA 3U8RH 3V3MA 2VJ1A 1GI7B 4YT6H 1O39A 1M9UA 1W10U 3ZYEA 2VB0A 1DWCH 1PPFE 2OBQA 1O3AA 1IOEA 3UREA 5EXMA 3FP6E 9ESTA 1XM1A 2AGIX 1O2HA 3UTUH 4KTCA 3MI4A 2M5TA 3P95A 4FXGH 2ZDLA 3RDZA 2XCNA 3LOXA 3AAVA 1T31A 2Z7FE 1IQHA 1MTUA 2H5CA 1V2RT 3LJJA 1IAUA 1TBQH 5C2ZA 2BDIA 5EU8A 2C3SA 3A7YA 4I8LA 1MQ5A 3SJ8A 1BOQA 1ZJKA 3QUMP 4IBLH 1QGFA 1XUGA 1FJSA 3PB1E 4I8GA 4JK5A 1P2IA 4AYVB 1KLTA 1GCTB 3CP7A 2J92A 1GGDC 1Y3YA 1FIZA 2WPJS 4BNRA 1TB6H 1ZSKA 4TYDA 3FAOA 1RTKA 1D6RA 1BRCE 1EOLA 3SV9A 5DP4A 3P8OA 5K0HA 1C1PA 1O2MA 1QRWA 2JH6D 3ZZ8A 4X8UH 3PLBA 5F8ZA 5GJ4B 1SGYE 1CHOG 1HV7A 2A7CA 1ELBA 1H9HE 1W12U 1WV7H 2H6MA 3A82A 2HPQH 2A4QA 3HGPA 2BDCA 1EAIA 4NZQA 3VGCB 5I46H 1DDJA 1DM4B 3BG8A 1QCPA 4B73A 1ZRBA 4DCDA 1JIMA 4FUJA 2PW8H 2ANWA 2VWOA 2ZA5A 1VITG 4I8JA 1VGCB 2IPHA 4CHAB 2VIVA 3TH2H 3RXUA 2FLRH 3ZZCA 5BPEA 1G3EA 2FOGA 2PGQB 4DY7B 2ZWLH 2VVUA 3RXHA 1GJCB 1HIAB 3LT3A 3LC5A 4OGXA 2ZU3A 4LZ4B 1C4V2 2J9NA 2OLGA 5FX6A 1OSSA 1MUEB 2BLOA 2KAIA 1Z6EA 1JRTA 1THSH 2C4FH 2UWPA 3SHCH 3A7XA 3DA9B 3Q3YA 2WYJA 1F2SE 3SI3H 1K1PA 2QCYA 4ASHA 4MPUA 1SG8B 1UCYK 3PM3A 1OP2A 1O2QA 4SGAE 1HNEE 1TGTA 4H6SB 1SGCA 2BXTH 1V2QT 1ABJH 1O5CB 2FOBA 4MNXA 1ZR0A 2AS9A 4J1YA 1A3BH 2C93B 1SLUB 3E6PH 4K60A 2VWLA 1PYTC 1V2JT 2ULLA 1BBRH 4X6PA 2W3KA 1SI5H 4AG1A 3M5NA 1XMNB 1QBNA 3D49H 4DGJA 3D62A 3KF2A 3R3GB 2GVFA 1SLWB 1WQVH 5DGJA 5JYIA 3HGNA 1ETSH 5GPIB 3LU9B 4MNVA 2QF3A 1F7ZA 1W7XH 4WH6A 3W95A 3ESTA 1VCWA 1TALA 1FNIA 1Y5BT 3LJOA 4ABEA 5C67A 2BM2A 1TPOA 1Y3VA 4Y8ZA 3GCNA 3SUDA 1UTOA 4U32A 1UMAH 4ZH8A 2ZU4A 2FI5E 2AIPA 4MLFB 2IN2A 1A2CH 4ABJA 5DG6A 1NZQH 4YOJA 3CS7A 2BDBA 2EI8A 1FAXA 3F9GA 3SJOA 1C2IA 7LPRA 1CHGA 1TX6A 2G5NA 4D9QA 2FX4A 4I8HA 3SN8A 1BZXE 4ESTE 2ANYA 2ZO3H 1V2MT 2FOCA 3P8GA 4KP0A 3TH3H 7KMEH 2BX4A 2NU1E 3HK3B 3ENSB 4Z6AH 3RXLA 2HLCA 4X8SH 9LPRA 3AW1A 5L2YH 2ZFTA 5AFZH 1T32A 2G81E 1EKBB 1YPMH 4BOHA 1A5HA 7ESTE 2VIOA 3TJNA 1TLDA 1LKBA 4DT7B 1AB9B 1T8LA 3VEQB 2LNCA 3VB3A 2H5DA 3A7VA 3HKJB 5ETXA 4GVUA 4JYVH 1QTFA 1A3EH 3OSYA 1DT2A 5DP8A 5C1YA 1CSOE 3EE0B 1O2PA 2A0QB 3P70B 1FY4A 2EC9H 2HGTH 4R8TB 2ZFPH 1G3CA 4OGYA 2ZGCA 1AU8A 2G55A 4X2WA 1IQEA 1GBJA 1P05A 1HAGE 2PLXA 2OQ5A 4YLUA 1H9LB 2GMTB 1FN6A 1LHFH 5LH8A 1ZMJA 1EOJA 1NPMA 1W14U 2OC7A 4H4FA 1JRSA 1F5LA 1UK2A 3AAUA 1RXPA 1P03A 1W7GH 1CT2E 3SUGA 1AN1E 1YPEH 1SMFE 1NTPA 2Q6GA 2ODPA 3F68H 4MPVA 1P9SA 2FP7B 1XX9A 1F0UA 2TGPZ 1FUJA 1ANDA 3U8OH 4NIYA 3SW2B 3GCTF 1FY3A 2DUCA 1K1NA 3IG6B 1THRH 2SGAA 2WV5A 1ZHPA 2Y80A 2ZDVH 3BSQA 4FVDA 1O2ZA 1DSUA 1TABE 1A0LA 3MWIU 3TK5A 2F9NA 4AN7A 4UFEH 5EPYA 1GHZA 3SV8A 4GUXA 2Q1JA 1O33A 2BVSH 1D4PB 2CF9H 4IN1A 5BRRE 3C27B 3SQHE 2GCTB 2GX4A 1D3TB 2CV3A 4JZIA 1ZHMA 1NRRH 2BD9A 5GCHG 1HUTH 4FUIA 3LGVA 3SJKA 2EI6A 1ORFA 2Z3DA 1AHTH 1G9IE 3F6UH 1SHHB 1TGCA 2BDAA 4ZHMU 4XE4A 2QXGA 1WSSH 1ZJDA 1AZZA 3T25A 5CHAC 2QY0B 3UR9A 1ACBE 1GBFA 2Y5FA 1XKAC 2BTCE 1BTYA 2D2DA 1BT7A 2P3TB 1DSTA 3SUEA 1E0FD 2O8TA 4BANB 1TX7A 1ZGVA 2Y6TA 4FU8A 1ELVA 1HAYB 2GD4B 2OC1A 2Z3EA 4AFQA 2BD8A 1BJUA 1TMTH 4AB9A 5EQRA 2VVCA 4K1TA 2FPZA 1P2MA 1V2WT 1OWEA 2ZI2H 1P2KA 1C4U2 3ZV9A 2RA3A 1HJ9A 3EAJA 1NY22 1SVPA 4F49A 2SNWA 4INKA 4NSVA 1JMOH 1TNLA 1TA2A 3M7UA 1QB9A 4U30A 3KHVA 1HAZB 1NT1A 2RG3A 1GJDB 1KDQA 3M3VA 1LPGB 1FXYA 1SFQB 3PROA 1GI1A 4K69A 2VWMA 5C5NA 5F6MA 3GICB 3FFGA 1F0SA 1J17T 1K28D 1XKBC 5EQSA 1EZXC 3A81A 1V2KT 5A09A 1Z8JB 1GBDA 1SR5C 3O8BA 5A8XA 2AYWA 4X2YA 4Y6DA 3DFJA 1O3OA 1GJ5H 1S83A 1C5VA 1WCZA 2CHAB 3PO1B 1QFKH 1V2TT 4NWLA 1N6YA 3E91A 1AUJA 3GYMA 3LIWA 1GHAG 3TGKE 2FO9A 1LHGH 1UTQA 2YNBA 4YLQH 4MQAA 2HOBA 4K1EA 1GHWH 1DPOA 1VJAU 2V3OH 1V6DA 1MTVA 1VITH 3TJOA 2ZTXA 1HXEH 1O3DA 3O8DA 6CHAB 1O3KA 1H8IH 3BN9A 4JCNA 4ZKOU 4U2WA 2ANMH 2PHBA 2XBYA 3SNCA 1GJ9B 4ABFA 1CGHA 3A7ZA 4WMEA 4X8TH 4E06H 1HAOH 1QA0A 1O3IA 2GV7A 4B2AA 2ASUB 1GI0A 3RXDA 1NRSH 2BDGA 2BQ7B 2HNTC 1AZ8A 3O8RA 3TIUA 4ZXYH 8GCHF 1S6FA 5HM2A 1TX8A 2FX6A 1GBCA 2AIQA 1C9TA 1BTHH 1TE0A 3BG4B 1FLEE 2RCEA 2KAIB 4X1PU 1NU7B 3PMHB 1UCYH 1C1MA 2I6SA 4HGCA 3MYWA 4AGKA 2VIQA 3NUMA 3L6PA 2FEQH 1EAWA 2VINA 1H4WA 1YF4A 1DANH 2FDAA 1T8OA 2XBWA 3WY8A 3LPRA 1PQ8A 3VPKA 5JBAS 1KTSB 5IYTA 2F9BH 2ZHQH 2G52A 1F5RA 1O5FH 1OWHA 4PROA 2F3CE 3DFLA 3SGAE 2ZDKA 1W13U 2VGCB 2GCHF 1SLXB 4GHQA 4KTSA 1HJAB 2BD3A 1FV9A 4ZROA 1JIRA 1Y59T 1MU8B 4O03A 4Y71A 2FI3E 1AWFH 1K1LA 2K1QA 1WYKA 2PKSC 1ZOMA 4A7IB 2B9LA 1A0HB 5EW2H 1L4DA 1EQ9A 1G3DA 3Q76A 4YESB 3UWIA 4FUHA 1O3MA 2GT8A 3SORA 4VGCB 1O3LA 4H42U 1CGIE 3UIRA 3RXAA 4GCHG 5T3HA 2TPIZ 5DO4H 4SGBE 1BTXA 4OS5A 1P2QA 2BY5X 2GT7A 4K3JA 1JBUH 3QGNB 3PYHA 2J94A 5FAHA 3FVFB 2H9EH 2BDYA 1QIXB 3SGQE 3ODDA 3EDXB 3VFEA 1AY6H 1DICA 4NFFA 1AO5A 1SB1H 2FOAA 2W3IA 4CRFA 3FZDA 3JZ1B 2WPLS 4NIWA 4OS6A 1KLJH 1A5IA 1QHRB 2QF0A 2XXLA 4UONA 1F5KU 3ELAH 1C5LH 2A5KA 2Y5GA 2VIDA 3ODFA 4Q2KA 1HAVA 4CH8B 4RSPA 2QGRA 3GCHB 3KQBA 1O3HA 4ABGA 3A7WA 3ZZ5A 2QC2A 2Z3CA 1P2NA 1DE7H 1O5BB 1S82A 4LK4A 5HGGA 3SQEE 2ZNKH 3RXQA 2V6NA 5F03A 4UDWH 1CA0C 1G30B 3BEUA 3KNXA 3SU0A 4X1QU 1CBWB 4X6MA 3A8BA 3STJA 1PQ5A 1P0SH 3T2NA 1WTHD 1RTLA 3E0PB 3OTJE 2CGAA 5JDUB 1TPAE 4D7GA 4R0IA 3URDA 3ZYDA 1EJMA 2DE9A 1DXPA 1EZUC 1GBIA 3MOCA 1C5UA 3BTHE 2SGQE 3SHAH 4Y0YE 4MPWA 3ZVDA 1Y3XA 3L3TA 2PKAA 3P8FA 3SV2H 1SGQE 2YOLA 4K2YA 1ZHRA 4CRDA 2F9OA 1O34A 3OU0A 1OS8A 1MTNB 2PWXA 3RXOA 3KL6A 4K8BA 1HGTH 3UNSA 2BD5A 5A0BA 1P09A 3K6YA 2JETC 3EQ0H 1UK4A 3RP2A 1YBWA 3PTNA 2GDEH 3GY8A 1S0RA 4FUEA 1B0EA 1NFWA 4CR9A 2ZDNA 1GI4A 2ZGJA 4B2CA 2H2ZA 1EZSC 5TCCA 1EATA 2BY8X 3VGCC 3RXVA 2XBXA 3MH4A 3QWCH 4YOIA 1SGEE 3K2UA 5FCKA 1ETTH 2ZTZA 5EODA 3QLPH 5B6OA 4AFZA 3MU1A 4DOQA 4MVNA 1KXBA 3SU5A 2W7SA 2BB4A 2I6QA 5FPYA 4UFFH 2ZHFH 3OYPA 1K2I1 3T27A 1LPZB 1YPJH 4ZKSU 2V35A 2AH4X 1WU1A 1GBHA 1AQ7A 2SGEE 5J4QA 2HNTE 2ZCHP 3RC4A 3UOPA 3NWUA 4X8VH 2HPPH 3S0NA 3M37A 3E16B 1AUTC 1GDNA 1ID5H 1IQGA 4CH2B 2A2XH 1RTFB 2CF8H 1C5OH 2A5IA 1ANCA 1GHXH 1ZSJA 2F91A 1XVMA 5I25A 2W7UA 3GY3A 2ZGHA 4BAOB 2PTNA 1Z8GA 2VNTA 4X6OA 1GHBG 1L2EA 3LDXH 1XUHA 4NWKA 3KN2A 3ZVBA 2D8WA 1GGDB 2ODYB 4FVBA 1ESBA 5FHTA 2FOFA 3SZNA 1O2RA 1O5AB 1GPZA 1LVMA 2ALPA 2QIQA 4E7NA 4B74A 3FP8E 1HFDA 2HRVA 1O32A 3M5MA 4X2VA 3A80A 5EPNA 3ZVAA 2B7DH 2ZGXH 3MNSA 3JZ2B 3TITA 1EAUA 1E38B 4QT8C 1TGBA 3A8DA 4TWYA 2UUKB 2OC8A 2A1DB 3D65E 1EAXA 1JWTA 1TMBH 4XSKU 2NWNA 3UOUA 4DJZB 1VR1H 4B1TA 3PLKA 1O37A 5A8YA 1TIOA 4ZAEA 1MBMA 4AG2A 1HB0B 1D6WA 2A4OA 2EA3A 1P3CA 3A86A 1V2ST 1MZAA 1O2JA 1AI8H 2ZPRA 4BAQB 3BTFE 3GDSA 1KDQB 1P3EA 3O8CA 3LH1A 2AMDA 2ZHWH 1L4ZA 2OCVB 1B5GH 1TYNA 1DUAA 1MQ6A 1PPBH 4UFDH 2ZF0H 3U98H 2SGFE 3N7OA 4E05H 3NZIA 2F83A 3MNXA 1TQ7B 1LVOA 2P8OB 2OINA 3EGKH 3VB4A 2OP9A 6GCHF 1BBRE 1LCYA 4CBOA 4Q7ZA 2BLVA 3FP7E 5DPAA 2P3FH 2SNVA 5FPTA 1AE5A 1KXDA 1LTOA 1C5YB 1TMUH 1NFUA 1NU9A 4WY3A 4AB8A 5JBTA 4K8YA 4NG9H 5DP3A 5F8TA 2BLWA 4CRBA 1CVWH 2GTBA 1EB1H 1P57B 1Y5UT 2BOHB 2GMTC 1RRKA 4WF8A 1Y3WA 1GVLA 1BMLA 1J8AA 3K6ZA 1AVWA 1ZTJA 1TOCB 1N8OC 2Z94A 3R0FA 5E0GA 3BTKE 1A7SA 3TPIZ 2AMPA 2ZQ1A 1UVTH 1GHYH 4AFUA 4WMDA 3M5OA 3SO3A 2GZ8A 4NCYA 3GY7A 1YPKH 1ZMNA 4A6LA 2TGAA 4ISNA 8ESTE 1YLCA 1KXFA 3RU4T 3ZVEA 2DE8A 4AYYB 1A1RA 1P02A 3BF6H 3BTGE 1O3JA 3GY6A 2AGGX 1DLKB 4FUCA 2R2MB 5A2MH 4NA7A 1ELTA 5A0AE 1O3PB 2Z9IA 4IW4E 1DWEH 2SGPE 1FPCH 3UNRA 1C4Y2 4FUGA 3S7KB 1DOJA 2QXJA 5AVDA 1O2LA 5E8EH 2A45B 4AGJA 1HAIH 3RXCA 1MU6B 3LC3A 1SGDE 2CN0H 2ZECA 3AW0A 4BAKB 4FUFA 2GCTC 2ZC9H 2WPKS 1XUJA 3BV9B 1O3FA 1VCQA 1DX5M 2GP9B 4UE7H 1V2OT 3QTVH 1HXFH 1DFPA 4ABHA 1LO6A 1ZTKA 1T4UH 1QRXA 3MH6A 1TPPA 3VB5A 4Y10E 5HXFA 1ELAA 3DUXH 1O2VA 2BXUH 1O3GA 2CMYA 2A31A 1Z6JH 3V12A 2PFEA 3ZZBA 4UFGH 1SGFG 2P3UB 1CHOF 3GYLB 1UTMA 4FU9A 3GDVA 1ELCA 4YM9A 1GMCG 1HJ8A 1D9IA 3TNSA 4LXBH 1OP8A 3KGPA 1UTLM 2XRCA 1K9OE 4YO9A 1K1JA 1O2SA 1TRYA 1VITF 2IJOB 1ELDE 2BY7X 2WPIS 2C8WB 1C1RA 1Q2WA 2SGDE 5AF9H 1W8BH 5E0JA 3T62A 3DT0H 3SJIA 3BEIB 4H6TA 1O2KA 1HCGA 1W11U 4Y79A 4JYTA 1BA8B 1GVZA 4BAMB 4RN6A 1T8MA 1C2KA 2UUFB 1GJ6A 5HM9A 2V3HH 1YC0A 3RLYH 1YGCH 2QXIA 3Q3KA 2FOHA 1HAVB 3Q3XA 6ESTA 4I8KA 1F0RA 4ABBA 3P8NA 3STIA 3LH3A 1GI2A 3TJUA 1PFXC 1LHEH 1DITH 1S81A 1AGJA 2A5AA 4JZFH 1T7CA 3RXKA 2C90B 2BLQA 1GBMA 4MDSA 4NIXA 1TFXA 4E7RG 3ZZ9A 2Y82A 1GJAB 3KIDU 4MG3A 1CGJE 1V2LT 2FTLE 3C1KA 3OY5U 1QURH 1C9PA 1BIOA 2ZTYA 2R3UA 1UTNA 5DKMA 3LGYA 3V0XA 1QL7A 3HATH 1AKSA 2A2QH 2PTCE 1EPTB 1IQNA 2FODA 1MMJN 1C1NA 3V7TA 3EA7A 5AFYH 2J95A 3VXEH 1JXPA 2FYQA 3PO1C 2P93A 2PSYA 1AWHB 1YPGH 1LPKB 1MCTA 3TLOA 2WYGA 2VVVA 4ABDA 2FZZA 1FY8E 1FONA 3SNAA 2A4GA 1BBRK 2STBE 2TGTA 1GG6B 1MTSA 1L1JA 4ISHH 4A1TA 2G00A 1L1NA 3PMAB 4TPYA 1UVOA 1VCPA 1QQ4A 1YYY1 2FYRA 2ZFSA 3SU3A 3TK6A 1SC8U 2JH5D 3BIVH 2P16A 4FUBA 1AMHA 1QJ1B 2XNIA 1WBGB 2GKVE 2ZFFH 1Q31A 1XUIA 1BHXB
chains in the Genus database with same CATH superfamily
1W2KH 1GI8B 1GBAA 3HPTB 1GI6A 1KSNA 1KY9A 3I78A 3SUFA 1YM0A 2FWWA 1TQ0B 1C2DA 4FU7A 3ATWA 7GCHF 2AFQB 4XBBA 4A5TS 5LPEA 2OK5A 2BY9X 4Q7YA 1SGNE 4TWWA 3PV4A 3K65B 1BHXF 2ZU5A 1YCPK 3QK1A 1O2XA 3SU4A 3SI4H 5JB9S 3A83A 1W0YH 1KLIH 2GZ9A 2XBVA 3MO3A 3P92A 1K0HA 1KIGH 1FY5A 3SU1A 4IS5A 2ZEBA 1Z8RA 5IK2D 2F9PA 1GMDF 2ZGBH 1J14A 3HK6B 1O2WA 1OXGA 2GDDA 1TGNA 1E36B 1BJVA 3GCOA 3LGTA 1MTWA 5T6DA 4A1XA 1S0QA 1ZRKA 1CE5A 4D8NA 1PQ7A 1PPHE 3A8AA 1XUFA 1P9UA 1HJAC 4X1SU 2K0QA 1A4WH 5ESTE 1N1LA 2JH0D 5TCAA 1V2VT 2P94A 4OS2A 5CE1A 1RS0A 1O3BA 1SL3A 2FS8A 3IITA 2F43B 5T6FA 2R0LA 3UUZA 1LHCH 2VIWA 3DSPA 4BTUB 5TJXA 5JBCS 4F4OC 1KTTB 1D3QB 2RA0A 2FMJA 3LKWA 1C1UH 5LPFA 3RXBA 3PWBA 5GDSH 1C2MA 1P04A 2C8XB 5EGMA 1G2MA 3S9BA 3LONA 3MHWU 2FM2A 1SPJA 2O8MA 4VGCC 2PSXA 5EQQA 2CXVA 2J98A 1BCUH 2WSSD 3DSGA 1WOFA 3SU2A 1AFEH 2PV9B 2WUCA 3F9EA 3P6ZB 4X0WU 1O30A 1UTKA 1SBWA 1GBEA 3T5FH 2HVXA 4KELA 4X1RU 1ELEE 1C5QA 4CRGA 2V0BA 3TVJB 1O3NA 1UK3A 1V2UT 3UFAA 3KCGH 1O2OA 1UTJA 1BDAA 2UWLA 2QE7D 1C2EA 5E2PA 3KEEA 1E35B 4NSYA 3DD2H 2WPHS 5GCHF 4ZCNA 1A46H 1G36A 1RIWC 5FXLA 4ZHLU 4JYUH 1YLDA 1C1SA 1PQAA 3LGUA 1C1WH 3MU0A 1RGQA 2ANKH 2ZP0H 3K9XB 1TWXB 1AFQB 3OE7D 1P2JA 1SGIB 1ZMLA 3GCHC 1SQTA 1ESAA 3PMBB 2A7HA 1IQMA 4ISLA 1O36A 1TONA 3RC5A 2J38A 3E3TA 2JKHA 3A7TA 1ZSLA 2VU8E 2ODQA 1HAXB 4ISIH 1EP5A 1FX0B 1O5DH 1YWUA 3UWJH 1AE8H 4X6NA 3DHKH 1TAWA 2YNAA 1ZTLA 3Q00A 2Y81A 2OBOA 1G3BA 4RI0A 1DWDH 4NGAH 1KXAA 4INLA 4WJG2 3ATIA 3F9HA 4I33A 3EYDA 1BMMH 1SQAA 4LZ1H 1GI3A 1NFYA 1W0ZU 3UPEA 4J2YB 1D3DB 1MTNC 3QX5H 1ZLRA 4JZ1A 1MKWK 1OWJA 4WH8A 2FOEA 1IQJA 3ZZ3A 1LKAA 2BOKA 1GL0E 5ABWA 4HI3A 2O8UA 5SGAE 3NKKA 3U8TH 2BY6X 2Y7XA 2BHGA 1O31A 3RXEA 1NRQH 1OX1A 3MU4A 3EA9A 1B0FA 2HLDD 2ZFQH 4I86A 4AX9H 2BZ6H 4NFEA 1GCTC 3ZVCA 4B6EA 1NO9H 3AVZA 5KGOA 1K21H 1MKXK 1C1OA 1CA0B 2F9UA 3TNTA 3RXPA 4ABAA 2Y7ZA 4RKJB 1P06A 3A8CA 3FN8A 3P17H 1C5NH 5C0UA 2OC0A 3PWCA 3RMNH 3BIUH 4A1VA 1FDPA 2AMQA 3ZZ7A 4GSOA 1LQDB 2NU3E 3SJ9A 2W26A 3OX7U 3GCTG 1TPSA 1Z1IA 1Z7KA 1ESTA 2BQ6B 1LVBA 1VGCC 1C5SA 1GHAF 5JPMH 3UB0A 4CHAC 3V13A 5C0TA 3ZZDA 5GXPA 3S9CA 3QZRA 1XVOA 3B23B 1BB0B 1TNKA 1X7AC 1O2TA 4Y76A 5FBEA 1OYTH 2C8YB 4TY7A 2FOMB 3U1IB 1ELGA 2KFWA 3GOVB 2AGEX 2JETB 1NESE 4THNH 2CJIA 1FQ3A 4B71A 1GMHF 3A89A 5A8ZA 2A4RA 1C1QA 5EG4A 5HYOA 4WXIA 1QRZA 3ATKA 1C5RA 1GBKA 1QL9A 1IHTH 4TY6A 3RXSA 2SFAA 3SOSA 4AFSA 8KME2 1YP9A 5FBIA 3M3TA 3MU8A 6LPRA 2ZCKP 4ZKNU 3U1JB 3S7HB 1C2JA 5C1UA 1C5TA 2HALA 3E0NB 1H8HD 1UHBA 2Z6BD 1A5GH 4ZKRU 3FANA 1NBMD 4FUDA 1GDQA 1ZPCA 3RMLH 1GBBA 4MPXA 5EOKA 1Z1JA 3Q77A 2VWNA 2O8WA 5C1XA 2LPRA 1EJAA 3RM0H 2G51A 2BZAA 1AVXA 4WWYA 1QL8A 1NBME 3DCLA 1ABIH 3RXTA 2TGDA 2OUAA 1SGFA 1OWDA 4ZMAH 1O3EA 5DP5A 1AKSB 3E90B 2ZDMA 4ZHAA 2WINI 1C5WB 2OXSA 4BXSA 2P8OC 3GY2A 3PV2A 1CQQA 1LQEA 1TRMA 3M5LA 4JZDH 1BRAA 2EEKA 3QTOH 1RD3B 3MNCA 2BD4A 4KKDA 1EJNA 4JK6A 4GAWA 4BXWA 3BTWE 5EXLA 1N6XA 2Z9JA 2P59A 1HPGA 4B75A 1LVYA 2ZCLP 3RXRA 3MFJA 3ZZ4A 1O0DH 3SV6A 1EASA 1FMGA 1QQUA 3M61U 1SGPE 3TH4H 4CR5A 1IQIA 4D9RA 4GCHF 1RJXB 3B9FH 3MH5A 2QXHA 2QYIA 3BTEE 1TBZH 1C1TA 1AB9C 3FOAA 4Q63A 4UD9H 2PGBB 3S9AA 3NPSA 1BTZA 2FI4E 4A92A 4DT4A 1QBOA 2BVXH 2EQNA 1BMAA 3TGJE 2BX3A 5DJ7A 2ZPQA 2ZU1A 1DY9A 5HMAA 2Z9LA 1MD7A 1QJ6B 4HZHA 3QGJA 3RXIA 3U9AH 1UVSH 3OEHD 4XBDA 5E2OA 2OD3B 3TK9A 1DUEA 1ARBA 3ATLA 1EZQA 2BQWB 1WTGH 3D23A 1YCPH 1MZDA 4RKOB 1SLVB 4AZ2B 2FS9A 5DP6A 3LGWA 3DSOA 3MTYA 2FLBH 2GV6A 4CRAA 3MO6A 1DS2E 1PPGE 7GCHG 2BYAX 4DIIH 1V2PT 1SQOA 1YCPM 3UQVA 2QAAA 4HFPB 1D3PB 1J16A 5IDKA 1SSXA 1VZQH 3QN7A 5DP7A 1CA8B 1HDTH 3OTPA 1SGRE 4ZXXH 2H1UA 1OP0A 3RLWH 3PTBA 4O3TA 4X1NU 3ZZ6A 8LPRA 1J15A 1BMNH 8GCHG 1UVUH 2Q6DA 4UEHH 1MCVA 5CMXH 1P11E 1GMDG 4GHTA 2FTMA 1FPHH 4XFQA 4F48B 5E0HA 1ARCA 5DK1A 1MD8A 2ESTE 1SOZA 3M36A 4XDEA 3ZVGA 4BTIB 1QA7A 2ZFRH 1WUNH 2W6ID 1N8OB 4DURA 1GBTA 1C2HA 1F0TA 1O38A 1MH0A 2Y5HA 3A84A 3HKIB 4NA9H 2ZU2A 3VXFH 3TU7H 3VB6A 3M7QA 3F0PA 1BRBE 1Z8IB 4HTCH 4NA8A 2IOTA 2C8ZB 1T4VH 2J98B 2QA9E 2YMSB 1EFRD 1IQKA 2UWOA 1EX3A 1H1BA 1XUKA 3URCA 2TBSA 1XXDA 4KTUA 4Y11E 4D76A 1UVPA 1QB6A 2XYAA 2GCHG 1P01A 4BAHB 1SGTA 1C2FA 1EP6A 1NROH 3KQEA 1LMWB 2V3MA 1G2LA 1GWAA 1KXCA 3BTTE 1DVAH 1HLTH 1TNGA 2J4IA 4GLYA 4P02A 1DLEA 2O8LA 4TPIZ 5EIYA 3SU6A 1ETRH 1T8NA 1O3CA 2G5VA 3M35A 1A0JA 1OWIA 5JBBS 2ZG0H 3KQDA 3MU5A 3RMMH 3S69A 3TGIE 2XWAA 1ZPBA 3SV7A 2XW9A 5GIBA 2KCOA 4YT7H 2B8OH 2D26C 2ZHEH 4MNYA 1E34B 1PPZA 1E1QD 2WUBA 1BRUP 1GHBF 1H8DH 2BD7A 2TRMA 5L6NH 2GGVB 1O5EH 1QR3E 1W0JD 2OQUA 3G01A 4Q4LA 2G8TA 1MAXA 1BTPA 3MMGA 2ZKSA 4YZUA 1V3XA 4KGAA 3A87A 2BDHA 1O35A 4IC6A 5FX5A 1QB1A 4DW2U 2J5UA 1ZGIA 3RXGA 4NZLA 5EW1H 1P2OA 4O9VA 1NS3A 1PYTD 1NFXA 1HIAA 4CREA 1QY6A 2R0KA 1EPTC 2ZPSA 5L30H 2IPQX 1BQYA 1K1OA 5CDFE 1TNHA 2B5TB 3QO6A 1C5PA 3GISB 1MKWH 2FXRA 3ZVFA 1MBQA 1GDUA 2B0FA 1QBVH 3H7TA 3N7EA 1SOTA 5LPRA 5CHAB 1FY1A 1HAHH 1Y5AT 1L0ZA 2R3YA 3OEED 1YPHC 4WMFA 2XTTB 4Y7AA 4NIVA 5A0CA 1GVKB 2ZZUH 2WV9A 3E1XB 1KXEA 1GBLA 4K1SA 1GG6C 1GI5A 4ABIA 1AD8H 1CT4E 2BD2A 3ITIA 2A7JA 3U69H 4ISOA 1ZPZA 2G4UA 3SNEA 1FZZA 2CHAC 1OOKB 2PKAB 2L6OA 3SBKA 5HKKD 1NM6A 2QF5A 1IQFA 2PUQH 1C5XB 1SFIA 1MKXH 1Z71A 1G32B 1TBRH 2FESH 3RU4D 2QV1A 4MNWA 5LGOA 2ZQ2A 4IMZA 4LOYH 4O97A 3ATMA 1TOMH 6CHAC 2J34A 4WVPE 2AEIH 1ANEA 1K1MA 1GCDA 1AVGH 1P10A 1WQSA 5AHGH 1CU1A 2UUJB 4O3UA 4AORA 1FN8A 2G4TA 1F92A 1O5GH 3A88A 4Q7XA 3RU4E 3BEFB 2ZHDA 1FAKH 3VB7A 4OS7A 2L74A 1ZZZA 4Q80A 4BTTB 3NK8A 1C5ZB 1HYLA 1W3CA 4I32A 1Y3UA 2PR3A 1BTWA 1KYNA 2UUYA 1LDTT 2Z9KA 3BTME 4CRCA 3PV5A 5F8XA 3RXJA 1C1VH 5EXNA 1EUFA 1WXRA 2VIPA 4OS4A 3BG4C 4K5ZA 1TRNA 3SNBA 1C5MD 1GL1A 5G4BA 3UR6A 2KCAA 1E37B 1O2IA 2Q6FA 5H4IB 1GJ7B 1AIXH 3NXPA 1CO7E 4ZUHA 2O9QA 1OYQA 1GJ8B 2BMGB 1QJ7B 1B7XB 1TA6A 1NN6A 1EXFA 1Y8TA 4OS1A 1OPHB 2RDLA 4B2BA 2KM0A 1NC6A 3RC6A 3OY6U 5JB8S 3KQCA 4IGDA 4Y8XA 3UY9A 1HAPH 4IC5A 1SKYE 5FCRA 1GMHG 3RM2H 1UHBB 5C20A 3ZZAA 1HRTH 3H7OA 2AERH 3M7TA 2VGCC 2D1JA 3CENA 1A61H 1OWKA 3QZQA 2VH6A 1YPLH 2QN5T 3CS0A 5J4SA 3SGBE 3MNBA 2TIOA 1GJ4H 1GJBB 4XOJA 3PMJA 4M7GA 1CT0E 3MH7A 2H9HA 4D7FA 2EI7A 4JZEH 3F1SB 3RUOA 3GDUA 4FETA 1S5SA 2ZDAH 3IWMA 5C5OA 3PLPA 1UCYE 3M3SA 1NRPH 2NU2E 1BITA 4IMQA 1AFQC 1FI8A 4F55A 1XXFA 1WAYB 1ZYOA 4YTAA 1INCA 1DY8A 1THPB 3I77A 1G37A 3AASA 4B76A 2H9TH 2R2WU 2W5EA 3E8LA 1K22H 3KQ5A 5PTPA 2WPMS 3UQOA 2V7QD 2HNTF 3F9FA 4I31A 4AOQA 5K7RA 2OTVA 3RXFA 1L1GA 1BTUA 5ESBA 3F2GA 1RFNA 3QDZB 3ZV8A 1GMCF 1PPEE 1C2LA 2A32A 5F53A 2J2UA 1ELFA 1P8VC 1S6HA 2VH0A 2NU4E 4U01A 4WXVA 5C3NA 1J9CH 1W0KD 4JMYA 2F9VA 4AC9A 1FIWA 4Y0ZE 4Z0KA 3SNDA 1PPCE 3KYGA 1UJ1A 3TJVA 4DG4A 4IN2A 4DIHH 4CBNA 1O2GH 1U6QA 2ALVA 1LHDH 4OM9A 1GHVH 1WDIA 1TNJA 2NU0E 2XC0A 4YOGA 6GCHG 1CBWC 1E1RD 1DWBH 1O2NA 1BUIA 3UNQA 1OKXA 5T6GA 2Z9GA 1E79D 2PKSB 2P95A 1MAYA 2XC5A 1HBTH 3WWBA 3T29A 1SHYA 2XWBI 2ZIQH 4XBCA 3A85A 3B8JA 4INHA 1K1IA 2FIRH 3EA8A 1YPHE 3T28A 1V2NT 2THFB 2GZ7A 2XCFA 2STAE 4X2XA 1H9IE 1PJPA 1TNIA 5DP9A 1O2UA 1RIWB 2WZQA 1NRNH 5L2ZH 2XC4A 5GWZA 3BTQE 1DXWA 1Q3XA 3FKSD 2BVRH 1S85A 3LGIA 3GY5A 3GY4A 3W94A 1O2YA 1TGSZ 3T26A 1IHSH 2WV4A 1C2GA 4RT0A 3L33A 1UTPA 2PUXB 3I29A 3RMOH 4DVAU 2R9PA 1JOUB 3NCLA 1P12E 4Y8YA 2HWLB 4MTBA 5FPSA 1IQLA 1S84A 3FZZA 4GPGA 1VJ9U 1EB2A 3BTDE 4I7YH 1QNJA 1ANBA 3CNRA 3RXMA 1YKTA 1UO6A 1EPTA 1GI9B 2ILNA 3H5CB 3MO9A 3PRBA 4Y7BA 3U8RH 2VJ1A 1GI7B 4YT6H 3V3MA 1O39A 1M9UA 1W10U 3ZYEA 2VB0A 1DWCH 1PPFE 2OBQA 1O3AA 1IOEA 3UREA 5EXMA 3FP6E 9ESTA 1XM1A 2AGIX 1O2HA 3UTUH 4YXWD 4KTCA 3MI4A 2M5TA 3P95A 4FXGH 2ZDLA 3RDZA 2XCNA 3LOXA 3AAVA 1T31A 2Z7FE 1IQHA 1MTUA 3SYJA 2H5CA 1V2RT 4P00A 2VBCA 3LJJA 1IAUA 1QZ8A 1TBQH 5C2ZA 2BDIA 5EU8A 2C3SA 3A7YA 4I8LA 1MQ5A 3SJ8A 1BOQA 1ZJKA 3QUMP 4IBLH 1QGFA 1XUGA 1FJSA 3PB1E 2K8IA 4I8GA 4JK5A 3OAAD 1P2IA 4AYVB 1KLTA 1GCTB 3CP7A 2J92A 1GGDC 1Y3YA 1FIZA 2WPJS 4BNRA 1TB6H 1ZSKA 4TYDA 3FAOA 1RTKA 1D6RA 1BRCE 1EOLA 3SV9A 5DP4A 2KCPA 3P8OA 5K0HA 1C1PA 1O2MA 1QRWA 2JH6D 3ZZ8A 4X8UH 3PLBA 5F8ZA 5GJ4B 1SGYE 1CHOG 1HV7A 2A7CA 1ELBA 1H9HE 1W12U 1WV7H 2H6MA 2IJD1 3A82A 2HPQH 2A4QA 3HGPA 2BDCA 1EAIA 4NZQA 3VGCB 5I46H 1DDJA 1DM4B 3BG8A 1QCPA 4B73A 1ZRBA 4DCDA 1JIMA 4FUJA 2PW8H 2ANWA 2VWOA 2ZA5A 1VITG 4I8JA 1VGCB 2IPHA 4CHAB 2VIVA 3TH2H 3RXUA 2FLRH 3ZZCA 5BPEA 1G3EA 2FOGA 2PGQB 4DY7B 2ZWLH 2VVUA 3RXHA 1GJCB 1HIAB 3LT3A 1SQRA 3LC5A 4OGXA 2ZU3A 1YLNA 4LZ4B 1C4V2 2J9NA 2OLGA 5FX6A 1OSSA 1MUEB 2BLOA 2KAIA 1Z6EA 1JRTA 1THSH 2C4FH 2UWPA 3SHCH 3A7XA 3DA9B 3Q3YA 2WYJA 1F2SE 3SI3H 3VG8A 1K1PA 2QCYA 4ASHA 4MPUA 1SG8B 1UCYK 3PM3A 1OP2A 1O2QA 4SGAE 1HNEE 1TGTA 4H6SB 1SGCA 2BXTH 1V2QT 4M9FA 1ABJH 1O5CB 2FOBA 4MNXA 1ZR0A 2AS9A 4J1YA 3SZEA 1A3BH 2C93B 1SLUB 4B6FA 3E6PH 4K60A 2VWLA 1PYTC 1V2JT 2ULLA 1BBRH 4X6PA 2W3KA 1SI5H 4AG1A 3M5NA 1XMNB 1QBNA 3D49H 4DGJA 3D62A 3KF2A 3R3GB 2GVFA 1SLWB 1WQVH 5DGJA 5JYIA 3HGNA 1ETSH 5GPIB 3LU9B 4MNVA 2QF3A 1F7ZA 1W7XH 3UAIC 4WH6A 3W95A 3ESTA 1VCWA 2KCYA 1TALA 1FNIA 1Y5BT 3LJOA 4ABEA 5C67A 2BM2A 1TPOA 1Y3VA 4Y8ZA 3GCNA 1VKYA 3SUDA 1UTOA 4U32A 1UMAH 4ZH8A 2ZU4A 2FI5E 2AIPA 4MLFB 2IN2A 1A2CH 4ABJA 5DG6A 2M2AA 1NZQH 4YOJA 3CS7A 2BDBA 2EI8A 1FAXA 3F9GA 3SJOA 1C2IA 7LPRA 1CHGA 1TX6A 2G5NA 4D9QA 2FX4A 4I8HA 3SN8A 1BZXE 4ESTE 2ANYA 2ZO3H 2GJGA 1V2MT 2FOCA 3P8GA 4KP0A 3TH3H 7KMEH 2BX4A 2NU1E 3HK3B 3ENSB 4Z6AH 4FOUC 3RXLA 2HLCA 4X8SH 9LPRA 3AW1A 5L2YH 2ZFTA 5AFZH 1T32A 2G81E 1EKBB 1YPMH 2RFKC 4BOHA 1A5HA 7ESTE 2VIOA 3TJNA 1TLDA 4Z1MD 1LKBA 4DT7B 1AB9B 1T8LA 3VEQB 2LNCA 3VB3A 2H5DA 3A7VA 3HKJB 5ETXA 4GVUA 4JYVH 1QTFA 1A3EH 3OSYA 1DT2A 5DP8A 5C1YA 1CSOE 3EE0B 1O2PA 2A0QB 3P70B 1FY4A 2EC9H 1S6LA 2HGTH 4R8TB 2ZFPH 1G3CA 4OGYA 2ZGCA 1AU8A 2G55A 4X2WA 1IQEA 1GBJA 1P05A 1HAGE 2PLXA 2OQ5A 4YLUA 1H9LB 2GMTB 1FN6A 1LHFH 5LH8A 1ZMJA 1EOJA 1NPMA 1W14U 2OC7A 3ZIAD 4H4FA 1JRSA 1F5LA 1UK2A 3AAUA 1RXPA 1P03A 1W7GH 1CT2E 3SUGA 1AN1E 1YPEH 1SMFE 1NTPA 2Q6GA 2ODPA 3F68H 4MPVA 1P9SA 2FP7B 1XX9A 1F0UA 2TGPZ 1FUJA 1ANDA 3U8OH 4NIYA 3SW2B 3GCTF 1FY3A 1OHHD 2DUCA 1K1NA 3IG6B 1THRH 2SGAA 2WV5A 1ZHPA 2Y80A 2ZDVH 3BSQA 4FVDA 1O2ZA 1DSUA 1TABE 1A0LA 3MWIU 3TK5A 2F9NA 4AN7A 4UFEH 5EPYA 1GHZA 3SV8A 4GUXA 2Q1JA 2LP6A 1O33A 3AK5A 2BVSH 1D4PB 2CF9H 4IN1A 5BRRE 3C27B 2JDID 3SQHE 2GCTB 2GX4A 1D3TB 2CV3A 4JZIA 1ZHMA 1NRRH 2BD9A 5GCHG 1HUTH 4FUIA 3LGVA 3SJKA 2EI6A 1ORFA 2Z3DA 1AHTH 1G9IE 2JJ1D 3F6UH 1SHHB 1TGCA 2BDAA 4ZHMU 4XE4A 3W1EA 2QXGA 1WSSH 1ZJDA 1AZZA 3T25A 5CHAC 2QY0B 3UR9A 1ACBE 1GBFA 2Y5FA 1XKAC 2BTCE 1BTYA 2D2DA 1BT7A 5C94A 2P3TB 1DSTA 3SUEA 1E0FD 2O8TA 4BANB 1TX7A 1ZGVA 2J97A 2Y6TA 4FU8A 1ELVA 1HAYB 2GD4B 2OC1A 2Z3EA 4AFQA 2BD8A 1BJUA 1KMHB 1TMTH 4AB9A 5EQRA 2VVCA 4K1TA 2FPZA 1P2MA 1V2WT 1OWEA 2ZI2H 1P2KA 1C4U2 3F0OA 2RA3A 3ZV9A 1HJ9A 3EAJA 1NY22 1SVPA 4F49A 2SNWA 4INKA 4NSVA 1JMOH 5HIZA 1TNLA 1TA2A 3M7UA 1QB9A 4U30A 3KHVA 1HAZB 5EJLA 1UW7A 1NT1A 2RG3A 1GJDB 1KDQA 3M3VA 3N99A 1LPGB 1FXYA 1SFQB 3PROA 1GI1A 4K69A 2VWMA 5C5NA 5F6MA 3GICB 3FFGA 1F0SA 1J17T 1K28D 1XKBC 4TT3D 5B6LA 5EQSA 1EZXC 3A81A 1V2KT 5A09A 1Z8JB 1GBDA 1SR5C 3O8BA 2HVYB 5A8XA 2AYWA 4X2YA 4Y6DA 3DFJA 1O3OA 3F2HA 1GJ5H 1S83A 1C5VA 1WCZA 2CHAB 3PO1B 1QFKH 1V2TT 4NWLA 1N6YA 3E91A 1AUJA 3GYMA 3LIWA 1GHAG 3TGKE 2FO9A 1LHGH 1UTQA 2YNBA 4YLQH 2YMSD 4MQAA 2HOBA 4K1EA 1GHWH 1DPOA 1VJAU 2V3OH 1V6DA 2KX4A 1MTVA 1VITH 3TJOA 2ZTXA 1HXEH 1O3DA 3O8DA 6CHAB 1O3KA 1H8IH 2JJ2D 3BN9A 4JCNA 5EJZA 4ZKOU 4U2WA 2ANMH 2PHBA 2XBYA 3SNCA 1GJ9B 4ABFA 3FO8D 5FL7D 1CGHA 3A7ZA 2KZ4A 4WMEA 4X8TH 4E06H 1HAOH 1QA0A 1O3IA 2GV7A 4B2AA 2ASUB 1GI0A 3RXDA 1NRSH 2BDGA 2BQ7B 2HNTC 1AZ8A 3O8RA 3TIUA 4ZXYH 8GCHF 1S6FA 5HM2A 1TX8A 2FX6A 1GBCA 2AIQA 1C9TA 1BTHH 1TE0A 3BG4B 1FLEE 2RCEA 2KAIB 4X1PU 1NU7B 3PMHB 1UCYH 1C1MA 2I6SA 3PRDA 4HGCA 3MYWA 4AGKA 2VIQA 3NUMA 3L6PA 2FEQH 1EAWA 2VINA 1H4WA 1YF4A 1DANH 2FDAA 1T8OA 2XBWA 3WY8A 5CHBA 4ACBA 3LPRA 2WPDD 1PQ8A 3VPKA 5JBAS 1KTSB 5IYTA 2F9BH 2ZHQH 2G52A 1F5RA 1O5FH 1OWHA 4PROA 2F3CE 3DFLA 3SGAE 2ZDKA 1W13U 2VGCB 2GCHF 1SLXB 4GHQA 4KTSA 1HJAB 2BD3A 1FV9A 1MABB 4ZROA 1JIRA 1Y59T 3MQKC 1MU8B 4O03A 4Y71A 2FI3E 1AWFH 4ACAA 3GS9A 1K1LA 2K1QA 1WYKA 3N7DA 2PKSC 1ZOMA 4A7IB 2B9LA 1A0HB 5EW2H 1L4DA 1EQ9A 1G3DA 3Q76A 4YESB 3UWIA 3WWFA 4FUHA 1O3MA 2GT8A 3SORA 4VGCB 1O3LA 4H42U 1CGIE 3UIRA 3RXAA 4GCHG 5T3HA 2TPIZ 5DO4H 4SGBE 1BTXA 4OS5A 1P2QA 2BY5X 2GT7A 4K3JA 1JBUH 3QGNB 3PYHA 2J94A 3OFND 5FAHA 3FVFB 2H9EH 2BDYA 1QIXB 3SGQE 3ODDA 3EDXB 3VFEA 1AY6H 1DICA 4NFFA 2XOKD 1AO5A 1SB1H 2FOAA 2W3IA 4CRFA 3FZDA 3JZ1B 2WPLS 4NIWA 4OS6A 1KLJH 1A5IA 1QHRB 2QF0A 2XXLA 4UONA 1F5KU 3ELAH 1C5LH 2A5KA 1COWD 2Y5GA 2VIDA 3ODFA 4Q2KA 1HAVA 4CH8B 4RSPA 2QGRA 3GCHB 3KQBA 1O3HA 4ABGA 3A7WA 3ZZ5A 2QC2A 2AHME 1P2NA 1DE7H 1O5BB 1S82A 2CK3D 2Z3CA 4LK4A 5HGGA 3SQEE 2ZNKH 3RXQA 2V6NA 5F03A 4UDWH 1CA0C 1G30B 3BEUA 3KNXA 3SU0A 4X1QU 1CBWB 4X6MA 3A8BA 3STJA 1PQ5A 1P0SH 3T2NA 1WTHD 1RTLA 3E0PB 3OTJE 2CGAA 5JDUB 1TPAE 4D7GA 4R0IA 3URDA 3ZYDA 1EJMA 2DE9A 1DXPA 1EZUC 1GBIA 3MOCA 1C5UA 3BTHE 2SGQE 3SHAH 4Y0YE 4MPWA 3ZVDA 1Y3XA 3L3TA 2PKAA 3P8FA 3SV2H 1SGQE 2YOLA 4K2YA 1ZHRA 4CRDA 2F9OA 1O34A 3OU0A 1OS8A 1MTNB 2PWXA 3RXOA 3KL6A 4K8BA 1HGTH 3UNSA 2BD5A 5A0BA 1P09A 3K6YA 2JETC 3EQ0H 1UK4A 3RP2A 1YBWA 3PTNA 2GDEH 3GY8A 1S0RA 4FUEA 1B0EA 1NFWA 4CR9A 2ZDNA 1GI4A 2ZGJA 4B2CA 2H2ZA 1EZSC 5TCCA 1EATA 2BY8X 3VGCC 3RXVA 2XBXA 3MH4A 3QWCH 4YOIA 1SGEE 3K2UA 5FCKA 1ETTH 2ZTZA 5EODA 3QLPH 5B6OA 4AFZA 3MU1A 3H09A 4DOQA 4MVNA 1KXBA 3SU5A 2W7SA 2BB4A 2I6QA 5FPYA 4UFFH 2ZHFH 3OYPA 1K2I1 3T27A 1LPZB 1YPJH 4RT1A 2V35A 2AH4X 1WU1A 4ZKSU 1GBHA 5DSFA 1AQ7A 2SGEE 5J4QA 2HNTE 2ZCHP 3RC4A 3U28C 3UOPA 3NWUA 2F4LA 4X8VH 2HPPH 3S0NA 3M37A 3E16B 1AUTC 5GNDA 1GDNA 1ID5H 1IQGA 4CH2B 2A2XH 1RTFB 2W6JD 2CF8H 3KYFA 1C5OH 2A5IA 1ANCA 1GHXH 4XRNA 1ZSJA 2F91A 1XVMA 5I25A 5DN6D 2W7UA 3GY3A 4ASUD 2ZGHA 4BAOB 2PTNA 1Z8GA 2VNTA 4X6OA 1GHBG 1L2EA 3LDXH 1XUHA 4NWKA 3KN2A 3ZVBA 2D8WA 1GGDB 2ODYB 4FVBA 1ESBA 5FHTA 2FOFA 3SZNA 1O2RA 1O5AB 1GPZA 1LVMA 2ALPA 2QIQA 4E7NA 4B74A 3FP8E 1HFDA 2HRVA 1O32A 3M5MA 5EJ1A 4X2VA 3A80A 5EPNA 3ZVAA 2B7DH 2ZGXH 3MNSA 3JZ2B 3TITA 1EAUA 1E38B 4QT8C 1TGBA 3A8DA 4TWYA 2UUKB 2OC8A 4HG6A 2A1DB 3D65E 5T1VA 1EAXA 1JWTA 1TMBH 4XSKU 2NWNA 3UOUA 4DJZB 1VR1H 4B1TA 3PLKA 1O37A 5A8YA 1TIOA 4ZAEA 1MBMA 4AG2A 1HB0B 1D6WA 2A4OA 2QF4A 2EA3A 1P3CA 3F2FA 3A86A 1V2ST 1MZAA 1O2JA 1AI8H 2ZPRA 4BAQB 3BTFE 3GDSA 1KDQB 1P3EA 3O8CA 3LH1A 2AMDA 2ZHWH 1L4ZA 2OCVB 1B5GH 1TYNA 1DUAA 1MQ6A 1PPBH 4TSFD 4UFDH 2ZF0H 3U98H 2SGFE 3N7OA 4E05H 3NZIA 2F83A 3MNXA 1TQ7B 1LVOA 2P8OB 2OINA 3EGKH 3VB4A 2OP9A 6GCHF 1BBRE 1LCYA 4CBOA 4Q7ZA 2BLVA 3FP7E 5DPAA 2P3FH 2SNVA 5FPTA 1AE5A 1KXDA 1LTOA 1C5YB 1TMUH 1NFUA 2PP6A 1NU9A 4WY3A 4AB8A 5JBTA 4K8YA 4NG9H 5DP3A 5F8TA 2BLWA 4CRBA 1CVWH 2GTBA 1EB1H 1P57B 1Y5UT 2BOHB 2GMTC 1RRKA 4WF8A 1Y3WA 1GVLA 1BMLA 1J8AA 3K6ZA 1AVWA 1ZTJA 1TOCB 1N8OC 2Z94A 3R0FA 5E0GA 3BTKE 1A7SA 3TPIZ 2WHXA 2AMPA 2ZQ1A 1UVTH 1GHYH 4AFUA 4WMDA 3M5OA 3SO3A 2GZ8A 4NCYA 3GY7A 1YPKH 2YMSC 5KECA 1ZMNA 4A6LA 2TGAA 4ISNA 8ESTE 1YLCA 3NRLA 1KXFA 3RU4T 3EE7A 3ZVEA 2DE8A 4AYYB 1A1RA 1P02A 3BF6H 3BTGE 1O3JA 3GY6A 2AGGX 1DLKB 4FUCA 2R2MB 5A2MH 4NA7A 1ELTA 5A0AE 1O3PB 2Z9IA 4IW4E 1DWEH 2SGPE 1FPCH 3UNRA 1C4Y2 4FUGA 3S7KB 1DOJA 2QXJA 5AVDA 1O2LA 5E8EH 2A45B 2XNDD 4AGJA 1HAIH 3RXCA 1MU6B 3LC3A 1SGDE 2EY4C 2CN0H 2ZECA 3AW0A 4BAKB 4FUFA 2GCTC 2ZC9H 2WPKS 1XUJA 3BV9B 4XD7D 1O3FA 1VCQA 1DX5M 2GP9B 4UE7H 1V2OT 3QTVH 1HXFH 1DFPA 4ABHA 1LO6A 1ZTKA 1T4UH 1QRXA 3MH6A 1TPPA 3VB5A 4Y10E 5HXFA 5C17A 1ELAA 3DUXH 1O2VA 2BXUH 1O3GA 2CMYA 2A31A 1Z6JH 3V12A 2PFEA 3ZZBA 4UFGH 1SGFG 2P3UB 1CHOF 3GYLB 1UTMA 4FU9A 3GDVA 1ELCA 4YM9A 1GMCG 1HJ8A 1D9IA 3TNSA 4LXBH 1OP8A 3KGPA 1UTLM 1YY3A 1K9OE 2XRCA 4YO9A 1K1JA 1O2SA 1TRYA 1VITF 2IJOB 1ELDE 2BY7X 2WPIS 2C8WB 1C1RA 1Q2WA 2SGDE 5AF9H 1H8ED 1W8BH 5E0JA 2LELA 3T62A 3DT0H 3SJIA 3BEIB 4H6TA 1O2KA 1HCGA 1W11U 4Y79A 4JYTA 1BA8B 1GVZA 4BAMB 4RN6A 1T8MA 5HIYA 1C2KA 2UUFB 1GJ6A 3F3BA 5HM9A 2V3HH 1YC0A 3RLYH 1YGCH 2KR7A 2QXIA 3Q3KA 2FOHA 1HAVB 3Q3XA 6ESTA 4I8KA 1F0RA 4ABBA 3P8NA 3STIA 3LH3A 1GI2A 3TJUA 1PFXC 1LHEH 1DITH 1S81A 1AGJA 2A5AA 4JZFH 1T7CA 3RXKA 2C90B 2BLQA 1GBMA 4MDSA 4NIXA 1TFXA 4E7RG 3ZZ9A 2Y82A 1GJAB 3KIDU 4MG3A 1CGJE 1V2LT 2FTLE 3C1KA 3OY5U 1QURH 1C9PA 1BIOA 2ZTYA 2R3UA 1UTNA 5DKMA 3LGYA 3V0XA 1QL7A 2JIZD 3HATH 1AKSA 2A2QH 2PTCE 1EPTB 1IQNA 2FODA 1MMJN 1C1NA 3V7TA 3EA7A 5AFYH 2J95A 3VXEH 1JXPA 3WW7A 2FYQA 3PO1C 2P93A 2PSYA 1AWHB 1YPGH 1LPKB 1MCTA 3TLOA 2WYGA 2VVVA 4ABDA 2FZZA 1FY8E 1FONA 3SNAA 2A4GA 1BBRK 2STBE 2TGTA 1GG6B 1MTSA 1L1JA 2RDEA 5KEDA 4ISHH 4A1TA 1BMFD 2G00A 1L1NA 3PMAB 4TPYA 1UVOA 1VCPA 1QQ4A 1YYY1 2FYRA 2ZFSA 3SU3A 3TK6A 1SC8U 2JH5D 3BIVH 2P16A 4FUBA 1AMHA 1QJ1B 2XNIA 1WBGB 2GKVE 2ZFFH 1Q31A 1XUIA 1BHXB
chains in the Genus database with same CATH topology
1W2KH 1GI8B 1GBAA 3HPTB 1GI6A 1KSNA 1KY9A 3I78A 3SUFA 1YM0A 2FWWA 1TQ0B 1C2DA 4FU7A 3ATWA 7GCHF 2AFQB 4XBBA 4A5TS 5LPEA 2BY9X 4Q7YA 1SGNE 4TWWA 3PV4A 3K65B 1BHXF 2ZU5A 1YCPK 3QK1A 1O2XA 3SU4A 3SI4H 5JB9S 3A83A 1W0YH 1KLIH 2GZ9A 2XBVA 3MO3A 3P92A 1KIGH 1FY5A 3SU1A 4IS5A 2ZEBA 1Z8RA 2F9PA 1GMDF 2ZGBH 1J14A 3HK6B 1O2WA 1OXGA 2GDDA 1TGNA 1E36B 1BJVA 3GCOA 3LGTA 1MTWA 5T6DA 4A1XA 1S0QA 1ZRKA 1CE5A 4D8NA 1PQ7A 1PPHE 3A8AA 1XUFA 1P9UA 1HJAC 4X1SU 1A4WH 5ESTE 1N1LA 2JH0D 5TCAA 1V2VT 2P94A 4OS2A 5CE1A 1RS0A 1O3BA 1SL3A 2FS8A 3IITA 5T6FA 2R0LA 3UUZA 1LHCH 2VIWA 4BTUB 5TJXA 5JBCS 4F4OC 1KTTB 1D3QB 2RA0A 2FMJA 3LKWA 1C1UH 5LPFA 3RXBA 3PWBA 5GDSH 1C2MA 1P04A 2C8XB 5EGMA 1G2MA 3S9BA 3LONA 3MHWU 2FM2A 1SPJA 2O8MA 4VGCC 2PSXA 5EQQA 2CXVA 1BCUH 1WOFA 3SU2A 1AFEH 2PV9B 2WUCA 3F9EA 3P6ZB 4X0WU 1O30A 1UTKA 1SBWA 1GBEA 3T5FH 2HVXA 4KELA 4X1RU 1ELEE 1C5QA 4CRGA 2V0BA 3TVJB 1O3NA 1UK3A 1V2UT 3UFAA 3KCGH 1O2OA 1UTJA 1BDAA 2UWLA 1C2EA 5E2PA 3KEEA 1E35B 4NSYA 3DD2H 2WPHS 5GCHF 1A46H 1G36A 1RIWC 5FXLA 4ZHLU 4JYUH 1YLDA 1C1SA 1PQAA 3LGUA 1C1WH 3MU0A 1RGQA 2ANKH 2ZP0H 3K9XB 1TWXB 1AFQB 1P2JA 1SGIB 1ZMLA 3GCHC 1SQTA 1ESAA 3PMBB 2A7HA 1IQMA 4ISLA 1O36A 1TONA 3RC5A 2J38A 3E3TA 2JKHA 3A7TA 1ZSLA 2VU8E 2ODQA 1HAXB 4ISIH 1EP5A 1O5DH 3UWJH 1AE8H 4X6NA 3DHKH 1TAWA 2YNAA 1ZTLA 3Q00A 2Y81A 2OBOA 1G3BA 1DWDH 4NGAH 1KXAA 4INLA 4WJG2 3ATIA 3F9HA 4I33A 3EYDA 1BMMH 1SQAA 4LZ1H 1GI3A 1NFYA 1W0ZU 3UPEA 4J2YB 1D3DB 1MTNC 3QX5H 1ZLRA 4JZ1A 1MKWK 1OWJA 4WH8A 2FOEA 1IQJA 3ZZ3A 1LKAA 2BOKA 1GL0E 5ABWA 4HI3A 2O8UA 5SGAE 3NKKA 3U8TH 2BY6X 2Y7XA 2BHGA 1O31A 3RXEA 1NRQH 1OX1A 3MU4A 3EA9A 1B0FA 2ZFQH 4AX9H 2BZ6H 4NFEA 1GCTC 3ZVCA 1NO9H 3AVZA 1K21H 1MKXK 1C1OA 1CA0B 2F9UA 3TNTA 3RXPA 4ABAA 2Y7ZA 4RKJB 1P06A 3A8CA 3P17H 1C5NH 2OC0A 3PWCA 3RMNH 3BIUH 4A1VA 1FDPA 2AMQA 3ZZ7A 4GSOA 1LQDB 2NU3E 3SJ9A 2W26A 3OX7U 3GCTG 1TPSA 1Z1IA 1Z7KA 1ESTA 2BQ6B 1LVBA 1VGCC 1C5SA 1GHAF 5JPMH 4CHAC 3V13A 3ZZDA 5GXPA 3S9CA 3QZRA 1XVOA 3B23B 1BB0B 1TNKA 1X7AC 1O2TA 4Y76A 5FBEA 1OYTH 2C8YB 4TY7A 2FOMB 3U1IB 1ELGA 3GOVB 2AGEX 2JETB 1NESE 4THNH 2CJIA 1FQ3A 4B71A 1GMHF 3A89A 5A8ZA 2A4RA 1C1QA 5EG4A 5HYOA 4WXIA 1QRZA 3ATKA 1C5RA 1GBKA 1QL9A 1IHTH 4TY6A 3RXSA 2SFAA 3SOSA 4AFSA 8KME2 1YP9A 5FBIA 3M3TA 3MU8A 6LPRA 2ZCKP 4ZKNU 3U1JB 3S7HB 1C2JA 5C1UA 1C5TA 2HALA 3E0NB 1UHBA 2Z6BD 1A5GH 4ZKRU 3FANA 4FUDA 1GDQA 1ZPCA 3RMLH 1GBBA 4MPXA 5EOKA 1Z1JA 3Q77A 2VWNA 2O8WA 5C1XA 2LPRA 1EJAA 3RM0H 2G51A 2BZAA 1AVXA 4WWYA 1QL8A 1ABIH 3RXTA 2TGDA 2OUAA 1SGFA 1OWDA 4ZMAH 1O3EA 5DP5A 1AKSB 3E90B 2ZDMA 4ZHAA 2WINI 1C5WB 2OXSA 4BXSA 2P8OC 3GY2A 1CQQA 1LQEA 1TRMA 3M5LA 4JZDH 1BRAA 2EEKA 3QTOH 1RD3B 3MNCA 2BD4A 4KKDA 1EJNA 4JK6A 4GAWA 4BXWA 3BTWE 5EXLA 1N6XA 2Z9JA 2P59A 1HPGA 4B75A 1LVYA 2ZCLP 3RXRA 3MFJA 3ZZ4A 1O0DH 3SV6A 1EASA 1FMGA 1QQUA 3M61U 1SGPE 3TH4H 4CR5A 1IQIA 4D9RA 4GCHF 1RJXB 3B9FH 3MH5A 2QXHA 2QYIA 3BTEE 1TBZH 1C1TA 1AB9C 4UD9H 2PGBB 3S9AA 3NPSA 1BTZA 2FI4E 4A92A 1QBOA 2BVXH 1BMAA 3TGJE 2BX3A 5DJ7A 2ZPQA 2ZU1A 1DY9A 5HMAA 2Z9LA 1MD7A 1QJ6B 4HZHA 3QGJA 3RXIA 3U9AH 1UVSH 4XBDA 5E2OA 2OD3B 3TK9A 1DUEA 1ARBA 3ATLA 1EZQA 2BQWB 1WTGH 3D23A 1YCPH 1MZDA 4RKOB 1SLVB 4AZ2B 2FS9A 5DP6A 3LGWA 3MTYA 2FLBH 2GV6A 4CRAA 3MO6A 1DS2E 1PPGE 7GCHG 2BYAX 4DIIH 1V2PT 1SQOA 1YCPM 3UQVA 2QAAA 4HFPB 1D3PB 1J16A 5IDKA 1SSXA 1VZQH 3QN7A 5DP7A 1CA8B 1HDTH 1SGRE 4ZXXH 2H1UA 1OP0A 3RLWH 3PTBA 4O3TA 4X1NU 3ZZ6A 8LPRA 1J15A 1BMNH 8GCHG 1UVUH 2Q6DA 4UEHH 1MCVA 5CMXH 1P11E 1GMDG 4GHTA 2FTMA 1FPHH 4XFQA 5E0HA 1ARCA 5DK1A 1MD8A 2ESTE 1SOZA 3M36A 4XDEA 3ZVGA 4BTIB 1QA7A 2ZFRH 1WUNH 1N8OB 4DURA 1GBTA 1C2HA 1F0TA 1O38A 1MH0A 2Y5HA 3A84A 3HKIB 4NA9H 2ZU2A 3VXFH 3TU7H 3VB6A 3M7QA 1BRBE 1Z8IB 4HTCH 4NA8A 2IOTA 2C8ZB 1T4VH 2QA9E 1IQKA 2UWOA 1EX3A 1H1BA 1XUKA 3URCA 2TBSA 1XXDA 4KTUA 4Y11E 4D76A 1UVPA 1QB6A 2XYAA 2GCHG 1P01A 4BAHB 1SGTA 1C2FA 1EP6A 1NROH 3KQEA 1LMWB 1G2LA 1GWAA 1KXCA 3BTTE 1DVAH 1HLTH 1TNGA 2J4IA 4GLYA 1DLEA 2O8LA 4TPIZ 3SU6A 1ETRH 1T8NA 1O3CA 2G5VA 3M35A 1A0JA 1OWIA 5JBBS 2ZG0H 3KQDA 3MU5A 3RMMH 3S69A 3TGIE 2XWAA 1ZPBA 3SV7A 2XW9A 5GIBA 4YT7H 2B8OH 2D26C 2ZHEH 4MNYA 1E34B 1PPZA 2WUBA 1BRUP 1GHBF 1H8DH 2BD7A 2TRMA 5L6NH 2GGVB 1O5EH 1QR3E 2OQUA 3G01A 2G8TA 1MAXA 1BTPA 3MMGA 2ZKSA 4YZUA 1V3XA 4KGAA 3A87A 2BDHA 1O35A 4IC6A 5FX5A 1QB1A 4DW2U 1ZGIA 3RXGA 4NZLA 5EW1H 1P2OA 4O9VA 1NS3A 1PYTD 1NFXA 1HIAA 4CREA 1QY6A 2R0KA 1EPTC 2ZPSA 5L30H 1BQYA 1K1OA 1TNHA 2B5TB 3QO6A 1C5PA 3GISB 1MKWH 2FXRA 3ZVFA 1MBQA 1GDUA 2B0FA 1QBVH 3H7TA 1SOTA 5LPRA 5CHAB 1FY1A 1HAHH 1Y5AT 1L0ZA 2R3YA 1YPHC 4WMFA 2XTTB 4Y7AA 4NIVA 5A0CA 1GVKB 2ZZUH 3E1XB 1KXEA 1GBLA 4K1SA 1GG6C 1GI5A 4ABIA 1AD8H 1CT4E 2BD2A 3ITIA 2A7JA 3U69H 4ISOA 1ZPZA 2G4UA 3SNEA 1FZZA 2CHAC 1OOKB 2PKAB 3SBKA 1NM6A 1IQFA 2PUQH 1C5XB 1SFIA 1MKXH 1Z71A 1G32B 1TBRH 2FESH 3RU4D 2QV1A 4MNWA 5LGOA 2ZQ2A 4IMZA 4LOYH 4O97A 3ATMA 1TOMH 6CHAC 2J34A 4WVPE 2AEIH 1ANEA 1K1MA 1GCDA 1AVGH 1P10A 1WQSA 5AHGH 1CU1A 2UUJB 4O3UA 4AORA 1FN8A 2G4TA 1F92A 1O5GH 3A88A 4Q7XA 3RU4E 3BEFB 2ZHDA 1FAKH 3VB7A 4OS7A 1ZZZA 4Q80A 4BTTB 3NK8A 1C5ZB 1HYLA 1W3CA 4I32A 1Y3UA 2PR3A 1BTWA 1KYNA 2UUYA 1LDTT 2Z9KA 3BTME 4CRCA 5F8XA 3RXJA 1C1VH 5EXNA 1EUFA 2VIPA 4OS4A 3BG4C 4K5ZA 1TRNA 3SNBA 1C5MD 1GL1A 5G4BA 3UR6A 2Q6FA 1E37B 1O2IA 5H4IB 1GJ7B 1AIXH 3NXPA 1CO7E 4ZUHA 2O9QA 1OYQA 1GJ8B 2BMGB 1QJ7B 1B7XB 1TA6A 1NN6A 1EXFA 1Y8TA 4OS1A 1OPHB 2RDLA 4B2BA 1NC6A 3RC6A 3OY6U 5JB8S 3KQCA 4IGDA 4Y8XA 3UY9A 1HAPH 4IC5A 5FCRA 1GMHG 3RM2H 1UHBB 5C20A 3ZZAA 1HRTH 3H7OA 2AERH 3M7TA 2VGCC 2D1JA 3CENA 1A61H 1OWKA 3QZQA 2VH6A 1YPLH 2QN5T 3CS0A 5J4SA 3SGBE 3MNBA 2TIOA 1GJ4H 1GJBB 4XOJA 3PMJA 4M7GA 1CT0E 3MH7A 2H9HA 4D7FA 2EI7A 4JZEH 3F1SB 3RUOA 3GDUA 1S5SA 2ZDAH 3IWMA 5C5OA 3PLPA 1UCYE 3M3SA 1NRPH 2NU2E 1BITA 4IMQA 1AFQC 1FI8A 1XXFA 1WAYB 1ZYOA 4YTAA 1INCA 1DY8A 1THPB 3I77A 1G37A 3AASA 4B76A 2H9TH 2R2WU 2W5EA 3E8LA 1K22H 5PTPA 3UQOA 2WPMS 2HNTF 3F9FA 4I31A 4AOQA 5K7RA 2OTVA 3RXFA 1L1GA 1BTUA 5ESBA 1RFNA 3QDZB 3ZV8A 1GMCF 1PPEE 1C2LA 2A32A 2J2UA 1ELFA 1P8VC 1S6HA 2VH0A 2NU4E 4U01A 4WXVA 5C3NA 1J9CH 4JMYA 2F9VA 1FIWA 4Y0ZE 4Z0KA 3SNDA 1PPCE 1UJ1A 3TJVA 4DG4A 4IN2A 4DIHH 4CBNA 1O2GH 1U6QA 2ALVA 1LHDH 1GHVH 2NU0E 1TNJA 2XC0A 4YOGA 6GCHG 1CBWC 1DWBH 1O2NA 1BUIA 3UNQA 1OKXA 5T6GA 2Z9GA 2PKSB 2P95A 1MAYA 2XC5A 1HBTH 3T29A 1SHYA 2XWBI 2ZIQH 4XBCA 3A85A 3B8JA 4INHA 1K1IA 2FIRH 3EA8A 1YPHE 3T28A 1V2NT 2THFB 2GZ7A 2XCFA 2STAE 4X2XA 1H9IE 1PJPA 1TNIA 5DP9A 1O2UA 1RIWB 1NRNH 5L2ZH 2XC4A 5GWZA 3BTQE 1DXWA 1Q3XA 2BVRH 1S85A 3LGIA 3GY5A 3GY4A 3W94A 1O2YA 1TGSZ 3T26A 1IHSH 2WV4A 1C2GA 3L33A 1UTPA 2PUXB 3I29A 3RMOH 4DVAU 2R9PA 1JOUB 3NCLA 1P12E 4Y8YA 2HWLB 4MTBA 5FPSA 1IQLA 1S84A 3FZZA 4GPGA 1VJ9U 1EB2A 3BTDE 4I7YH 1QNJA 1ANBA 3RXMA 1YKTA 1UO6A 1EPTA 1GI9B 2ILNA 3H5CB 3MO9A 4Y7BA 3U8RH 3V3MA 2VJ1A 1GI7B 4YT6H 1O39A 1M9UA 1W10U 3ZYEA 2VB0A 1DWCH 1PPFE 2OBQA 1O3AA 1IOEA 3UREA 5EXMA 3FP6E 9ESTA 1XM1A 2AGIX 1O2HA 3UTUH 4KTCA 3MI4A 2M5TA 3P95A 4FXGH 2ZDLA 3RDZA 2XCNA 3LOXA 3AAVA 1T31A 2Z7FE 1IQHA 1MTUA 2H5CA 1V2RT 3LJJA 1IAUA 1TBQH 5C2ZA 2BDIA 5EU8A 2C3SA 3A7YA 4I8LA 1MQ5A 3SJ8A 1BOQA 1ZJKA 3QUMP 4IBLH 1QGFA 1XUGA 1FJSA 3PB1E 4I8GA 4JK5A 1P2IA 4AYVB 1KLTA 1GCTB 3CP7A 2J92A 1GGDC 1Y3YA 1FIZA 2WPJS 4BNRA 1TB6H 1ZSKA 4TYDA 3FAOA 1RTKA 1D6RA 1BRCE 1EOLA 3SV9A 5DP4A 3P8OA 5K0HA 1C1PA 1O2MA 1QRWA 2JH6D 3ZZ8A 4X8UH 3PLBA 5F8ZA 5GJ4B 1SGYE 1CHOG 1HV7A 2A7CA 1ELBA 1H9HE 1W12U 1WV7H 2H6MA 3A82A 2HPQH 2A4QA 3HGPA 2BDCA 1EAIA 4NZQA 3VGCB 5I46H 1DDJA 1DM4B 3BG8A 1QCPA 4B73A 1ZRBA 4DCDA 1JIMA 4FUJA 2PW8H 2ANWA 2VWOA 2ZA5A 1VITG 4I8JA 1VGCB 2IPHA 4CHAB 2VIVA 3TH2H 3RXUA 2FLRH 3ZZCA 5BPEA 1G3EA 2FOGA 2PGQB 4DY7B 2ZWLH 2VVUA 3RXHA 1GJCB 1HIAB 3LT3A 3LC5A 4OGXA 2ZU3A 4LZ4B 1C4V2 2J9NA 2OLGA 5FX6A 1OSSA 1MUEB 2BLOA 2KAIA 1Z6EA 1JRTA 1THSH 2C4FH 2UWPA 3SHCH 3A7XA 3DA9B 3Q3YA 2WYJA 1F2SE 3SI3H 1K1PA 2QCYA 4ASHA 4MPUA 1SG8B 1UCYK 3PM3A