3UQVA

Bovine trypsin variant x(triplephe227) in complex with small molecule inhibitor
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSETYNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSASSFIITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGFYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Correlating structure and ligand affinity in drug discovery: a cautionary tale involving second shell residues.
pubmed doi rcsb
source organism Bos taurus
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Cationic trypsin
total genus 53
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2011-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3uqvA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3uqvA02
1ZMNA 4I8GA 1ID5H 3GY8A 2QXGA 3SV7A 1C2DA 1TMBH 4UFGH 1BJUA 5F8TA 3RU4E 1NESE 1ORFA 1ELGA 3C27B 2BD3A 4Q80A 3TIUA 4NFFA 1OWKA 1MTNB 1MKWH 1SI5H 5C67A 3BTME 8GCHG 2IN2A 1HUTH 4WMDA 5EXLA 4H42U 1P02A 3D23A 2EI7A 3OX7U 1AVWA 4X8TH 1TPSA 4U32A 2XWAA 1GHYH 1GJCB 2BQ7B 2BX4A 4MPUA 2F9UA 1HXEH 1BRUP 2SNWA 1AI8H 1MKXH 1AU8A 3OYPA 3SU5A 1GL1A 1NU9A 1VZQH 1YPLH 3MH4A 1K22H 1PQAA 3TVJB 4RSPA 2G5VA 4O3UA 5F6MA 4AB9A 3Q3XA 1HIAA 3L6PA 1T32A 1FPHH 2O8UA 2Z3DA 1ZLRA 1J8AA 5EXNA 4H4FA 3PTBA 1Y5AT 3IWMA 4CH8B 1EPTB 3NZIA 4AYVB 1GI1A 1RRKA 4LOYH 2VGCB 1VGCB 2B0FA 3H7TA 1DDJA 4X1PU 3E16B 1C1TA 3P8GA 4BOHA 1B0EA 5ESBA 2V0BA 3ZYDA 3QGJA 1NC6A 4CRAA 3H5CB 3BTWE 2BTCE 1QIXB 1EP5A 8GCHF 1GDQA 4A7IB 4BTUB 4A1TA 1L0ZA 4WJG2 1AHTH 2VIVA 5A8ZA 1SGEE 2P94A 3Q3KA 4X2XA 1H9LB 1JRSA 2XW9A 2A7CA 1EAXA 3LGVA 1HCGA 2BD4A 5F8ZA 4BTIB 2FOMB 1D9IA 1TPPA 3LONA 3TU7H 1NRRH 4AFQA 1OSSA 1QQUA 3F9EA 3BF6H 1P2JA 1B0FA 4DIHH 1NPMA 5T6DA 5BRRE 5EQSA 3SGBE 2WPHS 3S69A 1HAYB 3LIWA 1P57B 2XC0A 2R0LA 5L30H 5DKMA 2A4QA 4JK5A 4YLQH 4B71A 3GICB 2VWOA 2ZFTA 1O2ZA 2FDAA 3BTTE 1YM0A 3OU0A 3ODDA 2FX6A 4NIYA 3MNXA 4JYTA 2FWWA 4WXVA 2B7DH 1YF4A 4RKJB 1GBMA 1QHRB 1ABIH 1UVOA 3BTKE 4K8YA 5GCHG 5L2ZH 4AORA 3UWIA 1Z71A 4X0WU 3SW2B 2GMTB 1N8OB 4A6LA 1S82A 1QTFA 2V3OH 1GL0E 1AFEH 1GI9B 1E37B 1XM1A 3TPIZ 4AG1A 2O8MA 2J4IA 3V7TA 4D9RA 4B76A 2ZGXH 2GCHG 4NA9H 3FZDA 1Z8IB 1CU1A 3SU2A 4B2BA 3TGIE 1FI8A 1YPMH 1V2MT 5C20A 2ZFPH 3ZZ6A 1J14A 1HJ8A 1BHXB 3VFEA 1UVSH 3GY4A 3LU9B 5DP8A 5TJXA 2Z9JA 1P2KA 1O2SA 2P8OB 3BTGE 1AWHB 1L1JA 1T8MA 1GHZA 3QO6A 4CRBA 4UD9H 3NPSA 4WH8A 2A7JA 4BAOB 1O2TA 3SJOA 2FI3E 3UR9A 1BTYA 4D7FA 2GV7A 1ZMJA 1S0RA 3GYLB 3ZVCA 5E2OA 3ZZ3A 1PQ5A 2AIPA 3MOCA 1O37A 1YGCH 1G2MA 1UTNA 3B9FH 3NXPA 2Y7XA 3A82A 1MCTA 5G4BA 2FXRA 6CHAC 4FUJA 1GHVH 1DM4B 3RXRA 3ZZDA 1KDQB 1OWEA 1RS0A 3CS7A 2D26C 4Q7ZA 1F0TA 2CHAB 4AX9H 1UVTH 6GCHF 1ZGVA 2G81E 1DXPA 1GMHF 5DK1A 3GY7A 3RXFA 1JBUH 5A09A 2FZZA 1K1IA 3NWUA 3ZVAA 1SGTA 2A2XH 3A81A 3L33A 2VNTA 4WMEA 3I77A 4XBCA 1TBZH 3R0FA 3A8CA 1DICA 4YOJA 1T8LA 1SGRE 2GTBA 3U69H 3U8TH 4CR9A 1SHYA 3UFAA 2A31A 4A5TS 1O2OA 2XTTB 4I32A 2R3YA 2WPMS 1LVYA 4MLFB 2GZ9A 1A5HA 1C2EA 1NM6A 1BHXF 3VB4A 4GSOA 1HAXB 1C2JA 1UK4A 3KNXA 3KGPA 3BSQA 1ELTA 1WOFA 2VWNA 1VITG 3OTJE 2QA9E 2AERH 3MO3A 3MWIU 2ZECA 2Y80A 4IN1A 1BMAA 1ZPZA 2ZPRA 3M7TA 1GCDA 1C4U2 1MZDA 3GCHC 2ZHWH 3BTEE 2PHBA 1DWEH 2FYRA 2BY8X 1VITH 1ZHPA 1XUHA 4XBBA 1EATA 1T4UH 1O5EH 1DUAA 1GBLA 1IQGA 2FM2A 2CN0H 3MNCA 5EQQA 3K6YA 2KAIA 1Q2WA 1O2IA 1PYTD 1PPGE 3KN2A 2W3IA 5F03A 1MKXK 1A46H 3MH6A 2XWBI 3RMNH 2Y7ZA 1O2QA 2JH0D 4Y8ZA 6ESTA 1U6QA 2FODA 2FLRH 3HPTB 1VITF 1KXAA 4A1VA 1E35B 1EZQA 5FX5A 4OS4A 3B8JA 4THNH 2AMPA 3W95A 2Y5FA 5IDKA 1G9IE 2UWOA 2GX4A 3U98H 4Y76A 1BMLA 3EA9A 1YPHE 2FPZA 2GZ8A 1G37A 2ZDAH 1LPKB 1O3OA 3URCA 2ALPA 1GJ4H 1GHXH 1XXDA 1TA2A 3CS0A 1W7GH 2QIQA 4ASHA 2BLOA 4JCNA 1BOQA 4Z0KA 4O03A 1RIWB 1AWFH 1V2QT 3I29A 3RXJA 2ANKH 1WQSA 2BLWA 1HLTH 4Y11E 4R0IA 2EI8A 4Y7BA 3HGPA 1O3LA 4X6OA 4TY7A 1ZRKA 1LDTT 3UR6A 3RDZA 1W14U 4ZXXH 1O34A 2Z9LA 1BT7A 3F6UH 1EPTC 1W13U 4X2VA 3T28A 4INHA 3P8FA 1TYNA 1Z1IA 2PTNA 4AGKA 1D4PB 5ESTE 4X6NA 1A3EH 2PKAB 2YNBA 1AE8H 1TWXB 3S7HB 3MO9A 1HV7A 2AFQB 4KP0A 3DUXH 1WUNH 2VWMA 3PROA 4AFUA 4SGAE 4XFQA 5GWZA 1GI5A 4YO9A 1AB9C 1G2LA 1THSH 1AVGH 1MQ5A 1HGTH 1O3BA 1S6FA 2ASUB 2QY0B 2EC9H 3SU6A 1DLEA 4HI3A 1IQMA 5EGMA 2GVFA 3A8AA 1TNIA 1ZTLA 2SGDE 2Z3CA 2F9BH 1KIGH 5JBAS 2OTVA 1KLIH 1TABE 1YPKH 2Y5HA 4OGYA 1GMCF 4MVNA 2ZGCA 1HAZB 1A5IA 1ELVA 3UUZA 3PLKA 2G51A 3SO3A 5EPYA 1TAWA 1FNIA 4X1QU 1F7ZA 3VB3A 1OX1A 1D6RA 5E0JA 2BD5A 4I8HA 1BBRE 2TGDA 2ZCKP 4MNWA 5GDSH 2C90B 1O3EA 1LQEA 1FY8E 2VWLA 2SGAA 4AZ2B 4O97A 1H8DH 4YM9A 2GKVE 1UVUH 5TCCA 1OYTH 1A1RA 4UFEH 5EW1H 3O8CA 1V2UT 1C2KA 1AY6H 3ZZ7A 3SNBA 1SLUB 2RCEA 1M9UA 1MCVA 2P95A 2Z9KA 5GPIB 1TGCA 1JWTA 2Z9GA 1GBCA 3MI4A 5E0GA 2PLXA 4XE4A 1QB9A 1UTMA 4CRCA 2AGEX 2W5EA 2GD4B 2QN5T 4X2WA 1GI8B 1UMAH 1SGCA 4B75A 1UK2A 3ZVDA 2ZPQA 3ODFA 3RXMA 2ANMH 2GMTC 2OC8A 5A0AE 4UE7H 1IQJA 2M5TA 1C2IA 1TALA 2HOBA 1ZPBA 3PV4A 1Z6EA 3VB5A 4ISIH 3UREA 3DFLA 3UOUA 4NA7A 1TGSZ 4B73A 1IQLA 1NN6A 7GCHG 1Y3UA 4Q2KA 1YPEH 1SFQB 4VGCC 1A5GH 1P12E 3SU3A 1O5BB 1GDNA 1PPHE 2QF3A 1GBHA 2TGAA 1MBMA 1O2RA 3V0XA 2VVUA 1C5SA 1LQDB 1BRCE 2J94A 5DP5A 1SG8B 4U30A 5T6FA 3A84A 5DO4H 1IQEA 2G4TA 5JYIA 3RXHA 1A0JA 1GJAB 4U01A 4NWKA 1SL3A 4ZKRU 3TJVA 1XUFA 1OWIA 3MH7A 2ZU2A 1GJ6A 1LVMA 1ZMLA 7GCHF 3AASA 1IHTH 2J92A 1MTUA 5E2PA 2BXUH 1QRZA 5K7RA 1CE5A 1LKBA 3LPRA 5DPAA 4CR5A 1RIWC 3HKIB 2A5AA 1QB6A 3ATLA 2BDAA 2DUCA 4CRGA 1JOUB 2H9EH 3M3SA 1ZJDA 3SI4H 1FZZA 5BPEA 2Z6BD 6GCHG 4I7YH 3LKWA 1C2MA 1HXFH 1TGTA 3RUOA 3G01A 1LHGH 1SOTA 3TJNA 2VIQA 1MAYA 3SJ8A 3QUMP 1SGFG 3F9GA 1ANDA 2UUKB 2AEIH 3SV9A 1DSUA 3PYHA 3JZ1B 3A7YA 3RXEA 1SLVB 1YPHC 5C1UA 2FIRH 1P3EA 2TBSA 3TJUA 3Q77A 2ZO3H 5AVDA 5FX6A 5DJ7A 3V12A 2VVCA 1SQTA 3QGNB 3RXSA 1K1LA 1GI7B 2JKHA 1IQKA 4IGDA 4ABFA 3GCOA 1LCYA 4IC6A 1K1OA 1W0ZU 1S5SA 3LGTA 1LHFH 5L2YH 4LZ4B 3KEEA 4WMFA 6LPRA 2Y82A 1TBQH 3FANA 2P93A 1FV9A 2F9VA 3S9CA 2A4OA 1JMOH 2C8WB 4FVBA 4YESB 1O2KA 2F9PA 1O3CA 1RD3B 4KTUA 2NU4E 1G30B 1FIZA 1UCYK 2WPJS 4J2YB 4IS5A 4LXBH 5F8XA 1FONA 1TE0A 4GVUA 3SU0A 1Q31A 1ELDE 1XUIA 1O3PB 1QRXA 3BEUA 2PUQH 5JBCS 2P3TB 2YOLA 3VPKA 1E0FD 4ZKOU 1G3BA 2J95A 1AZZA 1QB1A 2GCTC 3A7TA 1B7XB 1PYTC 1FY4A 1TNJA 3K65B 1BIOA 2C8YB 5CE1A 3GY6A 1Z7KA 3QDZB 3BG4C 2BY6X 2ZC9H 1QJ6B 4TWWA 1P06A 2ZFFH 1CO7E 3MU0A 1O2NA 1BBRK 1TX8A 2HALA 1AN1E 3A86A 3OY6U 3M5MA 2STAE 4DGJA 3RXQA 2BXTH 4ZROA 1Y3VA 2ZHFH 2B9LA 2VIWA 2PGQB 1OWJA 1GHBG 1UTOA 2QC2A 3ZVGA 2AMDA 4ESTE 1SGFA 2GZ7A 1MZAA 3AAVA 1O5AB 3SN8A 2A0QB 3PTNA 2BVRH 4CHAB 2HRVA 3C1KA 2CV3A 1WV7H 2HNTE 2WINI 4JZEH 2V3HH 4B2AA 1IQNA 1EZUC 1CA0C 4E7RG 1J9CH 5LGOA 3E0PB 3FP8E 1GG6B 1O38A 5FPTA 1L1NA 1ARBA 4I8KA 2ZZUH 4FU8A 2ZFQH 3QTVH 2VGCC 1O3AA 3D62A 3SUGA 3TLOA 2ODQA 1C5TA 1BBRH 2O8LA 4JZDH 1W11U 2GGVB 1YLDA 1IOEA 1MQ6A 1Q3XA 1EB1H 3MFJA 1C5ZB 2PKSC 3IITA 2H9TH 4MNYA 1O2LA 4K1SA 4GLYA 1E34B 4XOJA 1UTLM 2EA3A 4INKA 4Y71A 1CSOE 3OY5U 1S6HA 1Y5BT 1GBIA 2B8OH 3S9BA 4TPIZ 1O2GH 1SGPE 1GVLA 1EOLA 4ABIA 3E90B 5AF9H 5A0CA 2FI5E 1S83A 1Z8GA 4HTCH 1WBGB 3ZV8A 2BM2A 2FOGA 4X2YA 1BJVA 4GCHF 3ZZ8A 1EAWA 5SGAE 1AB9B 4DW2U 3GCTG 4KGAA 1GI4A 1SHHB 1QQ4A 2UUJB 2BVSH 2FOFA 5FAHA 1F0RA 4YZUA 1FQ3A 3M7UA 3A83A 5HMAA 8KME2 3K6ZA 3ZZBA 2TPIZ 1JIMA 2ILNA 2FOEA 1A4WH 1GDUA 1O3GA 2ZPSA 2BOKA 2WUBA 1SQOA 1V2TT 2PKAA 3A87A 1O2MA 1JXPA 1TNKA 3U9AH 3VGCB 1A61H 3QZQA 3SUEA 2XXLA 3RXUA 3A80A 5LPFA 1BUIA 1MTNC 3GCTF 1Y3YA 2CF8H 2GDEH 4I33A 1BCUH 3RC6A 1AD8H 5C2ZA 1QCPA 3BIUH 3RM0H 1P10A 1PQ8A 1DSTA 8LPRA 4DIIH 1D6WA 4WXIA 1N8OC 4X1SU 4YLUA 1EB2A 3TH2H 4WY3A 2PFEA 2RG3A 5HGGA 1S84A 2IOTA 5C5NA 1O3MA 5PTPA 4D7GA 1H8IH 4K8BA 3BTHE 2JETB 3NCLA 2TIOA 2ZDKA 1QR3E 3BIVH 4AFSA 2HNTF 1EJNA 4ZKNU 4D8NA 1VCPA 5C5OA 1QJ7B 3M5NA 1ARCA 1W10U 1V2NT 5EU8A 4JZFH 1ANEA 1CHOG 1Y5UT 1EQ9A 1WTHD 1KLJH 4R8TB 1IQFA 3OSYA 3ZVFA 3TNSA 1K9OE 1L4DA 3M3TA 3AW1A 2G4UA 1KTTB 2ZKSA 1HAGE 1TBRH 2ZU4A 5L6NH 1XKBC 2FTMA 4DG4A 1MH0A 1UHBB 2ALVA 5A0BA 2AGIX 2J38A 3QLPH 2QGRA 2ODPA 1FAXA 4ISOA 2P8OC 1PJPA 1YC0A 1P8VC 4NA8A 1UTQA 3PMBB 2ZCLP 5JB8S 3SOSA 1NT1A 1O2WA 1BTUA 3U1JB 3RMLH 3T26A 1QBOA 2HNTC 3CENA 2O8TA 1VCWA 1C2LA 2AMQA 2ZHDA 3SZNA 3AW0A 2I6SA 1AKSB 1ZTJA 1GI3A 3FP7E 3UTUH 3LJOA 2BY7X 3E8LA 3LGYA 4UFDH 1LPGB 1N6XA 1V2WT 2BD7A 1P2MA 2G00A 2J2UA 4JZIA 3ENSB 2WV5A 1HIAB 1FN8A 3PM3A 3RXVA 3F9HA 3PMAB 1Z1JA 3P17H 1HAHH 4IC5A 1DITH 3RP2A 1TNGA 5EW2H 1TOCB 3A8DA 1K21H 1WCZA 2HPPH 1SLXB 7ESTE 4Y8XA 4TYDA 1MUEB 1T31A 1HBTH 4BAMB 3TK5A 2F83A 4MNVA 2P16A 4HFPB 1CHOF 2ZTYA 3Q00A 1OKXA 2H6MA 1S81A 2NU2E 4AOQA 3NUMA 1TX7A 2SFAA 2BLVA 2D8WA 1K2I1 2ZU3A 2FS9A 2DE8A 5JB9S 1EP6A 1GI0A 3VB7A 1RTKA 2Y5GA 1JRTA 1TMTH 5A2MH 1HYLA 2XRCA 5B6OA 1EJAA 1V2PT 2Q6DA 4YT6H 4NSVA 1OWHA 1UO6A 2BMGB 3AVZA 1O3IA 1HDTH 1C5UA 2WYGA 1YCPH 4ABGA 3FAOA 4ZHLU 3ATMA 2Z7FE 2BB4A 1C1UH 2D2DA 1K1PA 2FEQH 4WF8A 1DWDH 1IQIA 3FVFB 3RXLA 1ZSKA 2BY5X 1EPTA 3SV2H 1FY1A 1C1WH 1SFIA 1CGJE 3SNCA 1PPZA 2OLGA 2BQ6B 3SQHE 1KXDA 4Q7YA 3P70B 4E05H 3SGAE 1CA8B 3SNDA 1RTLA 4DY7B 2ZCHP 4X1RU 4HGCA 3RMMH 2SGFE 1QFKH 2FOAA 1DOJA 1TMUH 2WUCA 3UPEA 3SJ9A 1BTXA 1T7CA 4QT8C 5DP9A 1W12U 1WQVH 5DP6A 3T27A 4BTTB 2A1DB 3PB1E 4GPGA 3EA8A 4Y0ZE 1THRH 4DURA 3A88A 1PPFE 3S0NA 1LVBA 3PO1B 3I78A 3UNRA 1HAPH 2O8WA 1XKAC 2ZNKH 3FFGA 4BAKB 3A7VA 3ZVEA 5AFYH 1Z8RA 1V2VT 1HAVB 5E0HA 1RTFB 1BA8B 3GYMA 3F68H 1BITA 2ESTE 1KXCA 1YPJH 3SU1A 4IBLH 1YBWA 2TGTA 2H9HA 3A8BA 1K1JA 1V2LT 3FZZA 4K1EA 5T3HA 1FY5A 4B74A 1UK3A 5FPSA 3U1IB 5A8XA 3SNEA 1OYQA 5CMXH 2BDHA 4BANB 3SU4A 1TONA 2XBVA 2PWXA 4FU9A 1MU6B 1CBWC 2ZEBA 4ISHH 3SQEE 1MU8B 1C5NH 1O33A 2ZA5A 4ZAEA 4BAHB 3PLPA 3BG8A 1ELEE 5LPEA 1C5MD 1EAIA 1GCTB 1GMDF 4NCYA 2A2QH 4ABAA 1EASA 2R9PA 4X1NU 1RXPA 2W7SA 1TGBA 1O3KA 3HGNA 3NKKA 3E1XB 3SGQE 2NWNA 4BNRA 3SUFA 1V2ST 1GBJA 3AAUA 1CVWH 1QGFA 1QURH 3KCGH 3A7XA 2FS8A 3PWCA 1E36B 2FOCA 1DY8A 3P6ZB 1GBEA 1QA0A 1ZHRA 1O2VA 1HPGA 1P01A 4AYYB 4MPWA 1P2IA 1O39A 1ZGIA 1L2EA 1MKWK 3RLYH 2IPHA 3KQBA 1UCYH 3SJKA 2ZFSA 1IQHA 1F0SA 3LC5A 1LKAA 2W7UA 1HJAB 3MU4A 2ZF0H 3BV9B 1CGHA 1DPOA 1CT4E 3V13A 2PW8H 1C1NA 1VGCC 1LTOA 1NRPH 4GCHG 4MPXA 5FBEA 1ACBE 1H9HE 2Q6GA 4KTSA 4FUFA 1GGDC 2NU3E 2FYQA 4ZUHA 1ZPCA 1BMMH 1DXWA 2SNVA 4YTAA 1P09A 3LH1A 1O2JA 5DGJA 5K0HA 5GIBA 1XUKA 3PMJA 3RXCA 3ZZ4A 5IYTA 1NFYA 2ZTZA 5T6GA 3MU5A 4ZH8A 3UNSA 9LPRA 5HXFA 2CF9H 1CQQA 2F9NA 5AFZH 4ISLA 5ABWA 2XBWA 1NROH 1KXEA 2A45B 4J1YA 1ESAA 1BTPA 5A8YA 3MHWU 4FUDA 2ZI2H 3S7KB 2BQWB 4NGAH 1LO6A 2TRMA 1C5RA 4KKDA 3SNAA 3URDA 1XUGA 1C9PA 3P8OA 3NK8A 1V2OT 1TGNA 1ZZZA 2BZAA 3VXFH 4AB8A 1BTHH 2A5KA 1V2KT 2C4FH 2H5CA 1EXFA 1CBWB 1SGIB 2GT7A 2P3UB 4GHQA 4FU7A 1C1PA 2I6QA 1O32A 2VH0A 1AUJA 3DHKH 4FXGH 1DVAH 1B5GH 1FN6A 1C5OH 1EAUA 1RJXB 4AGJA 2VJ1A 1SMFE 4ABBA 4O3TA 4ABDA 2ZHEH 2GV6A 3A89A 1P03A 1VJ9U 2WV4A 4MNXA 2V6NA 4FUGA 2G55A 1CHGA 1XX9A 3E3TA 3RXOA 4UONA 1UJ1A 3ZV9A 3T29A 2P3FH 1T4VH 1YPGH 2BD8A 4K3JA 4Q7XA 1C1QA 3LGUA 1OOKB 2BD9A 1H4WA 3LT3A 5DP7A 3RMOH 2NU0E 1DX5M 5LPRA 2FP7B 1F92A 3D65E 1O5GH 1P11E 2CGAA 1W3CA 4O9VA 3M5OA 1ETRH 1MD8A 3UNQA 4I31A 2NU1E 1TQ0B 1N1LA 4Y6DA 1VJAU 2KAIB 1GGDB 4MG3A 1ABJH 3M35A 1W0YH 4OS5A 2ZFRH 2GCHF 1BDAA 3U8RH 1HFDA 1GBTA 2CMYA 4K69A 1C5VA 5GXPA 2FO9A 4YT7H 5FPYA 3EGKH 3T25A 2BVXH 1DUEA 1C2FA 1PFXC 1GMCG 1ANCA 1EKBB 3DD2H 3H7OA 1HRTH 3KIDU 1QNJA 1K28D 1S85A 3TNTA 2PSYA 1GJDB 2H2ZA 1SLWB 3HKJB 1AQ7A 2PUXB 3VXEH 3PO1C 1GCTC 2PSXA 1O5FH 4TY6A 2VINA 4H6TA 1SGDE 2ZDNA 3BTDE 2XBXA 1MD7A 2LNCA 2RA0A 1C1OA 1WSSH 1AMHA 3RC5A 3TH4H 1TA6A 3LGWA 2BZ6H 4OGXA 1GBDA 1AE5A 1GVKB 1P2NA 2G5NA 1OPHB 5HYOA 2FX4A 1O2PA 2AIQA 2DE9A 2BX3A 1ZRBA 3V3MA 1TQ7B 2HGTH 1AIXH 9ESTA 4RN6A 2R2MB 3PMHB 1SC8U 4GHTA 3RXPA 3K2UA 4UEHH 3SHCH 1HAIH 5DP3A 1NFWA 3BN9A 3UWJH 2UWLA 4UFFH 3EYDA 3A7WA 3RXAA 1PPCE 3RU4D 4FUCA 1G32B 2VVVA 1J15A 3WY8A 4RKOB 2BDCA 1OXGA 3TGKE 2ODYB 5C1YA 4KTCA 1GBAA 1O5CB 1THPB 1O2HA 1KDQA 5E8EH 3RU4T 1FAKH 1DLKB 2FOBA 4Y79A 1C1RA 1HB0B 1P9UA 2HWLB 5JBTA 1WAYB 3ZZAA 4ZHAA 1MTWA 4X8SH 1SGQE 1K1NA 3RXGA 2WYJA 4CH2B 2XNIA 4DOQA 3O8RA 1A7SA 1FJSA 3GY5A 1BB0B 4IMQA 3B23B 2VU8E 3RLWH 1KSNA 1WTGH 1SB1H 1O0DH 4X6MA 2R3UA 2SGQE 2JH6D 1NY22 3BEIB 1W7XH 4CBNA 2XC5A 3SHAH 1DFPA 2GT8A 2G52A 5C1XA 2VB0A 2Z9IA 2AH4X 3BTFE 3MH5A 4X6PA 2F9OA 4ZKSU 3UQVA 3M7QA 4MQAA 2J34A 2OUAA 3EE0B 1H9IE 1C9TA 4FUEA 4NZLA 1C5XB 3T5FH 3QX5H 2XC4A 3P95A 1GVZA 4LK4A 1TNLA 1GBBA 2CXVA 2F91A 1CT2E 2F3CE 1AGJA 1O3FA 4A1XA 1W8BH 1LVOA 1XVOA 4JZ1A 1LHDH 3MMGA 1MBQA 2AS9A 1GPZA 4WWYA 1D3QB 2AGGX 2OC0A 1Y59T 2ANYA 1Y3XA 2PGBB 1GHAG 3TK6A 1V6DA 3ZZ9A 1Y3WA 2CJIA 1IAUA 3EA7A 4NZQA 1NFUA 2H5DA 1IHSH 1FDPA 1TRYA 4WH6A 5HM9A 2BDYA 3E0NB 4JYUH 1C1VH 1L1GA 3HATH 1HNEE 4CREA 2ZQ1A 3SV6A 3VEQB 3KF2A 4YOIA 3ZZ5A 4K2YA 1AO5A 1C5YB 4ABJA 5EPNA 4CBOA 1A3BH 4OS6A 3GOVB 1SGNE 1ZSJA 3GCNA 2SGPE 1EUFA 1UTJA 2C8XB 2WPKS 2ZGJA 5HM2A 4JK6A 1J17T 5J4QA 4A92A 3CP7A 4CHAC 6CHAB 2HVXA 4Y0YE 2QXIA 1ETSH 1P9SA 3A7ZA 1CA0B 1GMDG 1KLTA 3MU8A 4NSYA 1QRWA 3STJA 1C2GA 1F0UA 4SGBE 3ATWA 1HJAC 3MNSA 1EJMA 1QJ1B 1WYKA 3KQEA 3F1SB 1W2KH 1GHBF 4MPVA 1G3CA 3JZ2B 2A5IA 1AFQC 2ZTXA 1O35A 4OS1A 3EAJA 2XBYA 1OWDA 1VR1H 2BOHB 2PKSB 3DFJA 1Y8TA 2FTLE 1QBVH 2Z3EA 1GHWH 2A32A 3PLBA 1BQYA 1P3CA 4LZ1H 2Y6TA 3GDSA 4WVPE 1KYNA 2GCTB 1FUJA 1ESBA 2C3SA 3GDVA 1SQAA 4F4OC 3KQDA 1C4V2 1ELCA 2ZU1A 1UTKA 2ZWLH 2PV9B 2FESH 2VIPA 1V2RT 3GY3A 1TRMA 2C93B 1NU7B 2OBQA 2STBE 4DVAU 4Y8YA 4NIWA 1PPBH 3MO6A 4NG9H 2ULLA 1TOMH 3ATKA 3T62A 4GUXA 4DJZB 1SBWA 2SGEE 5ETXA 1GI2A 5TCAA 3EDXB 1P2QA 1V3XA 3Q3YA 2AYWA 3QWCH 3RXTA 5FBIA 1QL8A 3M36A 3ATIA 4K60A 2ZIQH 4MDSA 4Y10E 1ESTA 1OS8A 2H1UA 3IG6B 1ZOMA 3UIRA 3VGCC 1EX3A 2PR3A 5DP4A 4DCDA 2R2WU 3M61U 1VCQA 1X7AC 1AVXA 1GG6C 2OXSA 1D3DB 1P0SH 1ZTKA 1FXYA 2OQUA 5FCKA 1J16A 1C1MA 1P04A 2A4RA 2K1QA 5FCRA 3P8NA 2RA3A 3RXDA 2UUFB 1HAOH 2BHGA 1SVPA 3SORA 3MYWA 5EODA 3SBKA 1NRNH 3GISB 1O2UA 1RFNA 3BEFB 1YCPK 1D3PB 3ZVBA 1A2CH 2UUYA 1BRBE 4NIXA 4H6SB 2BYAX 2OP9A 1MTVA 1INCA 1EOJA 4FVDA 3SI3H 3ZZCA 1G3DA 1O2YA 2JETC 1ZYOA 4M7GA 3TH3H 3KL6A 2V35A 3GDUA 3M5LA 1QBNA 5FXLA 1OP2A 2VIOA 3STIA 3E91A 1D3TB 1PQ7A 2OCVB 5EQRA 1F2SE 1YLCA 1NFXA 1NZQH 2BDGA 3LC3A 2HPQH 1A0LA 3UOPA 2R0KA 2RDLA 3TJOA 1HAVA 1PPEE 1GI6A 3SUDA 4JMYA 2ZDVH 5EOKA 1DT2A 1UHBA 1SSXA 1ELAA 2BLQA 2VIDA 1AUTC 1F5KU 1YCPM 1LHCH 1FLEE 4ZHMU 1EZSC 1FIWA 4K5ZA 1O3NA 1ETTH 1O3DA 3L3TA 2FLBH 1BZXE 3LGIA 4ISNA 3RXIA 4IN2A 1O2XA 2ANWA 5CHAB 1EZXC 4TPYA 1GJ9B 1ELBA 1GJBB 1OP8A 3Q76A 1QA7A 1BTWA 2OINA 3TK9A 3SJIA 1Z6JH 5LH8A 1F5LA 2BY9X 2Z94A 3HK6B 2YNAA 4I8JA 1CT0E 2XCNA 2ZU5A 2W26A 1O31A 2FOHA 1P2OA 5H4IB 1H1BA 1C5PA 1T8OA 1AKSA 1O5DH 3S9AA 3TGJE 5FHTA 2QYIA 5I25A 4CRDA 2A4GA 1V2JT 5JBBS 1C5WB 3SV8A 1KXFA 1SOZA 1C2HA 4Z6AH 1ZSLA 4X8VH 5JDUB 2OC7A 1O30A 3K9XB 1JIRA 2PTCE 2JH5D 4CRFA 4F49A 5AHGH 3RXBA 1TB6H 1F5RA 1O36A 3RXKA 2C8ZB 4D9QA 1ZHMA 3KQCA 4FUHA 1UTPA 2ZDLA 3HK3B 1O3JA 4VGCB 7KMEH 1OP0A 2ZGHA 3R3GB 2EEKA 2BD2A 2BDBA 4BAQB 3KHVA 4HZHA 1MMJN 5GCHF 2ZDMA 4BXSA 1A0HB 1KXBA 3RM2H 2QF0A 2THFB 1TPOA 3W94A 1K1MA 3VB6A 3LJJA 1QL9A 2ZGBH 4KELA 3LDXH 1MTSA 4Y7AA 3M37A 1XVMA 2QCYA 3ESTA 1YYY1 4ZMAH 1O3HA 1QY6A 1LMWB 1FY3A 3MNBA 1ZJKA 8ESTE 2WPIS 2XYAA 1KY9A 4AG2A 2QAAA 3A85A 1GBFA 2OQ5A 1GWAA 1BMNH 1HJ9A 2XCFA 3MU1A 4IMZA 2QXHA 2HLCA 4ABHA 1XMNB 2B5TB 1NRQH 4ABEA 3BG4B 1AFQB 1NTPA 3O8DA 5EG4A 4ZXYH 2QXJA 4AFZA 3LOXA 1TX6A 5J4SA 4IW4E 2UWPA 2ZQ2A 3F9FA 5GJ4B 7LPRA 2D1JA 3MTYA 4NFEA 3QK1A 4OS2A 4GAWA 3PWBA 3RC4A 1N6YA 1MAXA 1DANH 1GMHG 1BRAA 3TITA 2A7HA 1DY9A 2Y81A 4XBDA 3ELAH 2OBOA 3U8OH 4XSKU 1ZR0A 4BXWA 1KTSB 3BTQE 1SGYE 2IJOB 2J9NA 3EQ0H 1RGQA 1TNHA 1NS3A 1XUJA 2ZP0H 1C5LH 3QTOH 2VH6A 1YP9A 1DWBH 4PROA 1LHEH 1SR5C 4B2CA 4B1TA 4INLA 3UY9A 1Z8JB 3DA9B 1S0QA 2CHAC 1UVPA 1L4ZA 1GJ5H 4D76A 1C1SA 1DS2E 1GJ7B 2FI4E 1LPZB 1NRSH 3GY2A 2QV1A 2O9QA 4FUBA 2GP9B 1FMGA 1GJ8B 1TFXA 4DT7B 1GHAF 2G8TA 3ITIA 4AN7A 4YOGA 2TGPZ 3E6PH 1TLDA 1ANBA 5DG6A 1AZ8A 3N7OA 3T2NA 1XXFA 3QN7A 1DE7H 1C4Y2 1TIOA 2P59A 1GBKA 2BDIA 3UQOA 2EI6A 1ELFA 2FMJA 4NWLA 3P92A 1TRNA 2W3KA 5C3NA 1YKTA 5JPMH 1G3EA 1UCYE 3D49H 5EXMA 1CGIE 1DWCH 3O8BA 3QZRA 4I8LA 1G36A 2Q6FA 1E38B 3FP6E 5CHAC 3ZYEA 1WU1A 2LPRA 1NO9H 2ZHQH 4K1TA 4MTBA 1TPAE 2GDDA 4JYVH 4U2WA 3DT0H 4XDEA 4UDWH 1SPJA 4E06H 1FPCH 3M3VA 2OD3B 4E7NA 2ZG0H 4TWYA 1C5QA 2OC1A 3LH3A 1QL7A 4X8UH 2Q1JA 1T8NA 3GCHB 2WPLS 1BTZA 5I46H 4NIVA 1P05A 4OS7A 4FUIA
chains in the Genus database with same CATH superfamily
4RT1A 1ZMNA 4I8GA 1ID5H 1QZ8A 3GY8A 2QXGA 3SV7A 1C2DA 1TMBH 4UFGH 1E1RD 1BJUA 5F8TA 3RU4E 1NESE 1ORFA 1ELGA 2WPDD 3SZEA 3C27B 2BD3A 4Q80A 3TIUA 4NFFA 1OWKA 1MTNB 1MKWH 1SI5H 5C67A 3BTME 8GCHG 2IN2A 1HUTH 4WMDA 5EXLA 4H42U 1P02A 3D23A 2EI7A 2KR7A 3OX7U 1AVWA 4X8TH 1TPSA 4U32A 2XWAA 1E1QD 1GHYH 1GJCB 2BQ7B 2BX4A 4MPUA 2F9UA 2J97A 1HXEH 1BRUP 5CHBA 2SNWA 1AI8H 1MKXH 1AU8A 3OYPA 3SU5A 1GL1A 1NU9A 1VZQH 1YPLH 3MH4A 1K22H 1PQAA 3TVJB 4RSPA 2G5VA 4O3UA 5F6MA 4AB9A 3Q3XA 1HIAA 3L6PA 1T32A 1FPHH 2O8UA 2Z3DA 2KX4A 1ZLRA 1J8AA 5EXNA 4H4FA 3PTBA 1Y5AT 3IWMA 4CH8B 1EPTB 3NZIA 4AYVB 1GI1A 1RRKA 4LOYH 2VGCB 1VGCB 2B0FA 3H7TA 1DDJA 4X1PU 3E16B 1C1TA 3P8GA 4BOHA 1B0EA 5ESBA 5IK2D 2V0BA 3ZYDA 1NBMD 3QGJA 3DSPA 1NC6A 4CRAA 3H5CB 3BTWE 2BTCE 1QIXB 1EP5A 8GCHF 1GDQA 4A7IB 4BTUB 4A1TA 1L0ZA 4WJG2 3VG8A 1AHTH 2VIVA 5A8ZA 1SGEE 2P94A 3Q3KA 5KEDA 4X2XA 1H9LB 1JRSA 2XW9A 2A7CA 4Q63A 1EAXA 3LGVA 1HCGA 2BD4A 5F8ZA 4BTIB 2FOMB 1D9IA 1TPPA 3LONA 3TU7H 1NRRH 4AFQA 1OSSA 1QQUA 3F9EA 3BF6H 1P2JA 1B0FA 4DIHH 1NPMA 5T6DA 5BRRE 5EQSA 3SGBE 2WPHS 3S69A 1HAYB 3LIWA 1P57B 2XC0A 2R0LA 5L30H 5DKMA 2A4QA 4JK5A 4YLQH 4B71A 3GICB 2CK3D 2VWOA 2KFWA 2ZFTA 1O2ZA 3UB0A 2FDAA 3BTTE 1YM0A 3OU0A 3ODDA 2FX6A 4NIYA 3MNXA 4JYTA 2FWWA 4WXVA 2B7DH 1YF4A 4RKJB 1GBMA 1QHRB 1ABIH 1UVOA 3BTKE 4K8YA 5GCHG 5L2ZH 4AORA 3UWIA 3OEHD 2WHXA 1Z71A 5HIZA 3W1EA 4X0WU 3SW2B 2GMTB 1N8OB 4A6LA 1S82A 1QTFA 1YY3A 2V3OH 1GL0E 1AFEH 1GI9B 1E37B 1XM1A 3TPIZ 4AG1A 2O8MA 2J4IA 3V7TA 4D9RA 4B76A 2ZGXH 2GCHG 4NA9H 1K0HA 3FZDA 1Z8IB 1CU1A 3H09A 3SU2A 4B2BA 4HG6A 3TGIE 1FI8A 1YPMH 1V2MT 5C20A 2ZFPH 3ZZ6A 1J14A 1HJ8A 3PV5A 1BHXB 1FX0B 3VFEA 4ZCNA 1UVSH 3GY4A 3LU9B 5DP8A 5TJXA 2Z9JA 1P2KA 1O2SA 1VKYA 2P8OB 3BTGE 1AWHB 1L1JA 1T8MA 1GHZA 3QO6A 4CRBA 4UD9H 3NPSA 4WH8A 2A7JA 3F3BA 4BAOB 1O2TA 3SJOA 2FI3E 4I86A 3UR9A 1BTYA 4D7FA 2GV7A 1ZMJA 1S0RA 3GYLB 3ZVCA 5E2OA 3ZZ3A 1PQ5A 2AIPA 3MOCA 1O37A 1YGCH 2EY4C 1G2MA 1UTNA 3B9FH 3NXPA 2Y7XA 3A82A 1MCTA 5G4BA 2FXRA 6CHAC 4FUJA 1GHVH 1DM4B 3RXRA 3ZZDA 1KDQB 1OWEA 1RS0A 3CS7A 2D26C 4Q7ZA 1F0TA 2CHAB 4AX9H 1UVTH 6GCHF 3GS9A 1ZGVA 2G81E 1DXPA 1GMHF 5DK1A 3DSOA 3GY7A 3RXFA 1JBUH 5A09A 2FZZA 1K1IA 3NWUA 3ZVAA 1SGTA 2A2XH 3A81A 3L33A 2VNTA 4WMEA 3I77A 4XBCA 1TBZH 3R0FA 3A8CA 1DICA 4YOJA 1T8LA 1SGRE 2GTBA 3U69H 3U8TH 4CR9A 1SHYA 3UFAA 2A31A 4A5TS 1O2OA 2XTTB 4I32A 2R3YA 2WPMS 1LVYA 4MLFB 2GZ9A 1A5HA 1C2EA 1NM6A 1BHXF 3VB4A 4GSOA 1HAXB 1C2JA 1UK4A 5C0UA 3KNXA 3KGPA 3BSQA 1ELTA 2LELA 2HVYB 1WOFA 2VWNA 1VITG 3OTJE 2QA9E 2AERH 3MO3A 3MWIU 2ZECA 2Y80A 4IN1A 1BMAA 1ZPZA 4TSFD 2ZPRA 3M7TA 1GCDA 1C4U2 1MZDA 3GCHC 2ZHWH 3BTEE 2PHBA 5EIYA 1DWEH 2L6OA 2FYRA 2BY8X 1VITH 1ZHPA 1XUHA 4XBBA 1EATA 1T4UH 1O5EH 1DUAA 1GBLA 1IQGA 2FM2A 1SKYE 2CN0H 3MNCA 5EQQA 3K6YA 5CDFE 2KAIA 1Q2WA 1O2IA 1PYTD 1PPGE 3KN2A 2W3IA 5F03A 1MKXK 1A46H 3MH6A 2XWBI 3RMNH 2Y7ZA 1O2QA 2JH0D 4Y8ZA 6ESTA 1U6QA 2FODA 2FLRH 3HPTB 1VITF 1KXAA 4A1VA 1E35B 1EZQA 5FX5A 4OS4A 3B8JA 4THNH 2AMPA 3W95A 2Y5FA 5IDKA 1G9IE 2UWOA 2GX4A 3U98H 4Y76A 1BMLA 3EA9A 1YPHE 2FPZA 1OHHD 2GZ8A 1G37A 2ZDAH 1LPKB 1O3OA 3URCA 2ALPA 1GJ4H 1GHXH 1XXDA 1TA2A 3CS0A 1W7GH 3WWFA 2QIQA 2YMSB 4ASHA 2BLOA 3AK5A 2HLDD 4JCNA 1BOQA 4Z0KA 4O03A 1RIWB 1AWFH 1V2QT 3I29A 3RXJA 2ANKH 1WQSA 2BLWA 3KYGA 1HLTH 4Y11E 4R0IA 2EI8A 4Y7BA 3HGPA 1KMHB 1O3LA 4X6OA 4TY7A 1ZRKA 1LDTT 3UR6A 3RDZA 1W14U 4ZXXH 1O34A 2Z9LA 1BT7A 4Q4LA 3F6UH 1EPTC 1W13U 4X2VA 3T28A 4INHA 3P8FA 1TYNA 1Z1IA 2PTNA 4AGKA 1D4PB 5ESTE 4X6NA 1A3EH 2PKAB 2YNBA 1AE8H 1TWXB 3S7HB 3MO9A 1HV7A 2AFQB 4KP0A 3DUXH 1WUNH 2VWMA 3PROA 4AFUA 4SGAE 4XFQA 5GWZA 1GI5A 4YO9A 1AB9C 1G2LA 1THSH 1AVGH 1MQ5A 1HGTH 1O3BA 1S6FA 2ASUB 2QY0B 2EC9H 3SU6A 1DLEA 4HI3A 1IQMA 5EGMA 2GVFA 3A8AA 1TNIA 1ZTLA 2SGDE 2Z3CA 2F9BH 1KIGH 2W6JD 5JBAS 2OTVA 1KLIH 1TABE 1YPKH 2Y5HA 4OGYA 1GMCF 2AHME 4MVNA 2ZGCA 1HAZB 3FO8D 1A5IA 1ELVA 3UUZA 3PLKA 2G51A 3SO3A 1YWUA 5EPYA 1TAWA 1FNIA 4X1QU 1F7ZA 3VB3A 1OX1A 1D6RA 1H8HD 5E0JA 2BD5A 4I8HA 1BBRE 2TGDA 3N7DA 2ZCKP 3FOAA 4MNWA 5GDSH 2C90B 1O3EA 1LQEA 1FY8E 2VWLA 2SGAA 4AZ2B 4O97A 2QF5A 1H8DH 4YM9A 2GKVE 1UVUH 5TCCA 1OYTH 1A1RA 4UFEH 5EW1H 3O8CA 1V2UT 1C2KA 1AY6H 3ZZ7A 3SNBA 1SLUB 2RCEA 1M9UA 1MCVA 2P95A 2Z9KA 5GPIB 1TGCA 1JWTA 2Z9GA 1GBCA 3MI4A 5E0GA 2PP6A 4B6EA 2PLXA 4XE4A 1QB9A 4F55A 1UTMA 4CRCA 2AGEX 2W5EA 2GD4B 2QN5T 4X2WA 1GI8B 1UMAH 1SGCA 5F53A 4B75A 1UK2A 3ZVDA 2ZPQA 3ODFA 3RXMA 2ANMH 3F2GA 2GMTC 2OC8A 5A0AE 4UE7H 1IQJA 2M5TA 1C2IA 1TALA 2HOBA 1ZPBA 3PV4A 5HIYA 1Z6EA 3VB5A 4ISIH 3UREA 3DFLA 3UOUA 4NA7A 1TGSZ 4B73A 1IQLA 1NN6A 7GCHG 1Y3UA 4Q2KA 1YPEH 1SFQB 4VGCC 1A5GH 1P12E 1EFRD 3SU3A 1O5BB 1GDNA 1PPHE 2QF3A 1GBHA 2TGAA 1MBMA 1O2RA 3V0XA 2VVUA 1C5SA 1LQDB 1BRCE 2J94A 5DP5A 1SG8B 4U30A 2JJ1D 5T6FA 3A84A 5DO4H 1IQEA 2G4TA 5JYIA 3RXHA 1A0JA 1GJAB 4U01A 4NWKA 1SL3A 4ZKRU 3TJVA 1XUFA 1OWIA 3MH7A 2ZU2A 4FOUC 1GJ6A 1LVMA 1ZMLA 7GCHF 3AASA 1IHTH 2J92A 1MTUA 5E2PA 2BXUH 1QRZA 5K7RA 1CE5A 1LKBA 5C17A 3LPRA 5DPAA 4CR5A 1RIWC 3HKIB 2A5AA 1QB6A 3ATLA 2BDAA 2DUCA 4CRGA 1JOUB 2H9EH 3M3SA 1ZJDA 3SI4H 1FZZA 5BPEA 2Z6BD 6GCHG 4I7YH 3LKWA 1C2MA 1HXFH 4F48B 1TGTA 3RUOA 3G01A 1LHGH 1E79D 1SOTA 3TJNA 2VIQA 1MAYA 3SJ8A 3QUMP 3NRLA 4RI0A 1SGFG 3F9GA 1ANDA 2UUKB 2AEIH 3SV9A 1DSUA 3PYHA 3JZ1B 3A7YA 3RXEA 1SLVB 1YPHC 5C1UA 2FIRH 1P3EA 2K0QA 2TBSA 3TJUA 3Q77A 2ZO3H 5AVDA 5FX6A 5DJ7A 3V12A 2VVCA 1SQTA 3DSGA 3QGNB 3RXSA 1K1LA 1GI7B 2JKHA 1IQKA 4IGDA 4ABFA 3GCOA 1LCYA 4IC6A 1K1OA 1W0ZU 1S5SA 3LGTA 1LHFH 5L2YH 4LZ4B 3KEEA 4WMFA 6LPRA 2Y82A 1TBQH 3N99A 3FANA 2P93A 1FV9A 2F9VA 3S9CA 2A4OA 1JMOH 2C8WB 4FVBA 4YESB 1O2KA 2F9PA 1O3CA 2M2AA 3OTPA 1RD3B 4KTUA 2NU4E 1G30B 1FIZA 1UCYK 2WPJS 4J2YB 4IS5A 4LXBH 5F8XA 1FONA 1TE0A 4GVUA 3SU0A 1Q31A 1ELDE 1XUIA 1O3PB 1QRXA 3BEUA 2PUQH 5JBCS 2P3TB 2YOLA 3VPKA 1E0FD 4ZKOU 1G3BA 2J95A 1AZZA 1QB1A 2GCTC 3A7TA 1B7XB 1PYTC 1FY4A 1TNJA 1COWD 3K65B 1BIOA 2C8YB 5CE1A 3GY6A 1Z7KA 3QDZB 3BG4C 2BY6X 2ZC9H 1QJ6B 4TWWA 1P06A 2ZFFH 1CO7E 3MU0A 1O2NA 1BBRK 4ASUD 1TX8A 2HALA 1AN1E 3A86A 3OY6U 3M5MA 2STAE 3FKSD 4DGJA 3RXQA 2BXTH 4ZROA 1Y3VA 2ZHFH 2B9LA 3OE7D 1SQRA 2VIWA 2PGQB 1OWJA 1GHBG 1UTOA 2QC2A 3ZVGA 2AMDA 4ESTE 1SGFA 2GZ7A 1MZAA 2EQNA 3AAVA 1O5AB 3SN8A 2A0QB 3PTNA 2BVRH 4CHAB 2HRVA 3C1KA 2CV3A 1WV7H 2HNTE 2WINI 4JZEH 2V3HH 4B2AA 1IQNA 1EZUC 4Z1MD 1CA0C 4E7RG 1J9CH 5LGOA 3E0PB 3FP8E 1GG6B 1O38A 5FPTA 1L1NA 1ARBA 4I8KA 2ZZUH 4FU8A 2ZFQH 3QTVH 1W0KD 2VGCC 1O3AA 3D62A 3SUGA 3TLOA 2ODQA 1C5TA 1BBRH 2O8LA 4JZDH 1W11U 2KCYA 2GGVB 1YLDA 1IOEA 1MQ6A 1Q3XA 1EB1H 3MFJA 1C5ZB 2PKSC 4ACBA 3IITA 2H9TH 4MNYA 1O2LA 4K1SA 4GLYA 1E34B 4XOJA 1UTLM 2EA3A 4INKA 4Y71A 1CSOE 3OY5U 1S6HA 1Y5BT 1GBIA 2B8OH 3S9BA 4TPIZ 1O2GH 2JIZD 1SGPE 1GVLA 1EOLA 4ABIA 3E90B 5AF9H 5A0CA 2FI5E 1S83A 1Z8GA 3OAAD 4HTCH 1WBGB 3ZV8A 2BM2A 2FOGA 4X2YA 1BJVA 4GCHF 3ZZ8A 1EAWA 5SGAE 1AB9B 4DW2U 3GCTG 4KGAA 1GI4A 1SHHB 1QQ4A 2UUJB 2BVSH 2FOFA 5FAHA 1F0RA 4YZUA 1FQ3A 3M7UA 3A83A 5HMAA 8KME2 3K6ZA 3ZZBA 2TPIZ 1JIMA 2ILNA 2FOEA 1A4WH 1GDUA 1O3GA 2ZPSA 4FETA 2BOKA 2WUBA 1SQOA 1V2TT 3F0OA 2PKAA 3A87A 1O2MA 1JXPA 1TNKA 3U9AH 3VGCB 1A61H 4YXWD 2VBCA 3QZQA 3SUEA 2XXLA 3RXUA 3A80A 5LPFA 1BUIA 1MTNC 3GCTF 1Y3YA 2CF8H 2GDEH 4I33A 1BCUH 3RC6A 1AD8H 5C2ZA 1QCPA 3BIUH 3RM0H 1P10A 1PQ8A 1DSTA 8LPRA 4DIIH 1D6WA 4XRNA 4WXIA 1N8OC 4X1SU 4YLUA 1EB2A 3TH2H 4WY3A 2PFEA 2RG3A 5HGGA 1S84A 2IOTA 5C5NA 1O3MA 5PTPA 2WSSD 4D7GA 1H8IH 4K8BA 3BTHE 2JETB 3NCLA 2TIOA 2ZDKA 1QR3E 3BIVH 4AFSA 2HNTF 1EJNA 2RDEA 4ZKNU 4D8NA 1VCPA 5C5OA 1QJ7B 3M5NA 1ARCA 3CNRA 4ACAA 1W10U 1V2NT 5EU8A 4JZFH 1ANEA 1CHOG 1Y5UT 1EQ9A 1WTHD 1KLJH 4R8TB 1IQFA 3OSYA 3ZVFA 3TNSA 1K9OE 1L4DA 3M3TA 3AW1A 2G4UA 1KTTB 2ZKSA 1HAGE 1TBRH 2ZU4A 5L6NH 1XKBC 2FTMA 4DG4A 1MH0A 1UHBB 2ALVA 5A0BA 2GJGA 2AGIX 2J38A 3QLPH 2QGRA 2ODPA 1FAXA 4ISOA 2P8OC 2QE7D 1PJPA 1YC0A 1P8VC 4NA8A 3OEED 1UTQA 3PMBB 2ZCLP 5JB8S 3SOSA 1NT1A 1O2WA 1BTUA 3U1JB 3RMLH 3T26A 1QBOA 2HNTC 3CENA 2O8TA 1VCWA 1C2LA 2AMQA 2ZHDA 3SZNA 3AW0A 2I6SA 1AKSB 1ZTJA 1GI3A 3FP7E 3UTUH 3LJOA 2BY7X 3E8LA 3LGYA 4UFDH 1LPGB 1N6XA 1V2WT 2BD7A 1P2MA 2G00A 2J2UA 4JZIA 3ENSB 2WV5A 1HIAB 1FN8A 3PM3A 3RXVA 3ZIAD 3F9HA 3PMAB 1Z1JA 3P17H 1HAHH 4IC5A 1DITH 3RP2A 1TNGA 5EW2H 1TOCB 3A8DA 1K21H 1WCZA 2HPPH 1SLXB 7ESTE 4Y8XA 4TYDA 1MUEB 1T31A 1HBTH 4BAMB 3TK5A 2F83A 4MNVA 2P16A 4HFPB 2JDID 1CHOF 2ZTYA 3Q00A 1OKXA 2H6MA 1S81A 2NU2E 4AOQA 3NUMA 1TX7A 2SFAA 2BLVA 2D8WA 1K2I1 2ZU3A 2FS9A 2DE8A 5JB9S 1EP6A 1GI0A 3VB7A 1RTKA 2Y5GA 1JRTA 1TMTH 5A2MH 1HYLA 2XRCA 5B6OA 1EJAA 1V2PT 2Q6DA 4M9FA 4YT6H 4NSVA 1OWHA 1UO6A 2BMGB 3AVZA 1O3IA 1HDTH 1C5UA 2WYGA 1YCPH 4ABGA 3FAOA 4ZHLU 3ATMA 2Z7FE 2BB4A 1C1UH 2D2DA 1K1PA 2FEQH 4WF8A 1DWDH 1IQIA 3FVFB 3RXLA 1ZSKA 2BY5X 1EPTA 3SV2H 1FY1A 1C1WH 1SFIA 1CGJE 3SNCA 1PPZA 2OLGA 2BQ6B 3SQHE 1KXDA 4Q7YA 3P70B 3PRDA 4E05H 3SGAE 1CA8B 3SNDA 1RTLA 4DY7B 2ZCHP 4X1RU 4HGCA 3RMMH 2SGFE 5EJZA 1QFKH 2FOAA 1DOJA 1TMUH 1H8ED 2WUCA 3N7EA 3UPEA 3SJ9A 1BTXA 1T7CA 2LP6A 4QT8C 5DP9A 1W12U 1WQVH 5DP6A 3T27A 5T1VA 4BTTB 2A1DB 3F0PA 3PB1E 4GPGA 3EA8A 4Y0ZE 1THRH 4DURA 3A88A 1PPFE 3S0NA 1LVBA 3PO1B 3I78A 3UNRA 1HAPH 2O8WA 1XKAC 2ZNKH 3FFGA 4BAKB 3A7VA 3ZVEA 5AFYH 1Z8RA 1V2VT 1HAVB 5E0HA 1RTFB 1BA8B 3GYMA 3F68H 1BITA 3KQ5A 2ESTE 1KXCA 1YPJH 3SU1A 4IBLH 1YBWA 2TGTA 2H9HA 3A8BA 1K1JA 1V2LT 3FZZA 4K1EA 5T3HA 1FY5A 4B74A 1UK3A 5FPSA 3U1IB 5A8XA 3SNEA 1OYQA 5CMXH 2BDHA 2YMSC 4BANB 3SU4A 5C0TA 1TONA 2XBVA 2PWXA 4FU9A 4RT0A 1MU6B 1CBWC 2ZEBA 4ISHH 3SQEE 1MU8B 4B6FA 1C5NH 1O33A 2ZA5A 4ZAEA 4BAHB 3PLPA 3BG8A 1ELEE 5LPEA 1C5MD 1EAIA 1GCTB 1GMDF 4NCYA 2A2QH 4ABAA 1EASA 2R9PA 4X1NU 1RXPA 5KGOA 2W7SA 1TGBA 1O3KA 3HGNA 3NKKA 3E1XB 3SGQE 2NWNA 4BNRA 3SUFA 1V2ST 1GBJA 3AAUA 1CVWH 1QGFA 1QURH 3KCGH 3A7XA 2FS8A 3PWCA 1E36B 1MABB 2FOCA 1DY8A 2J98A 3P6ZB 1GBEA 1QA0A 1ZHRA 1O2VA 1HPGA 1P01A 4AYYB 4MPWA 1P2IA 1O39A 1ZGIA 1L2EA 1MKWK 3RLYH 2IPHA 3KQBA 1UCYH 3SJKA 2ZFSA 1IQHA 1F0SA 3LC5A 1LKAA 2W7UA 1HJAB 3MU4A 2ZF0H 3BV9B 1CGHA 1DPOA 1CT4E 3V13A 2PW8H 1C1NA 1VGCC 1LTOA 1NRPH 4GCHG 4MPXA 5FBEA 3SYJA 2KCAA 1ACBE 1H9HE 2Q6GA 4KTSA 4FUFA 1GGDC 2NU3E 2FYQA 2YMSD 4ZUHA 1ZPCA 1BMMH 1DXWA 2SNVA 4YTAA 1P09A 3LH1A 1O2JA 5DGJA 5K0HA 5GIBA 1XUKA 3PMJA 3RXCA 3ZZ4A 5IYTA 1NFYA 2ZTZA 5T6GA 3MU5A 4ZH8A 3UNSA 9LPRA 5HXFA 2CF9H 1CQQA 2F9NA 5AFZH 4ISLA 5ABWA 2XBWA 1NROH 1KXEA 2A45B 4J1YA 1ESAA 1BTPA 5A8YA 3MHWU 4FUDA 2ZI2H 3S7KB 2BQWB 4NGAH 1LO6A 2TRMA 1C5RA 5FL7D 4KKDA 3SNAA 3URDA 1XUGA 1C9PA 3P8OA 3NK8A 1V2OT 1TGNA 1ZZZA 2BZAA 3VXFH 4AB8A 1BTHH 2A5KA 1V2KT 2C4FH 2H5CA 1EXFA 1CBWB 1SGIB 2GT7A 2P3UB 4GHQA 4DT4A 4FU7A 1C1PA 5B6LA 2I6QA 2XOKD 1O32A 2VH0A 1AUJA 3DHKH 4FXGH 1DVAH 1B5GH 1FN6A 1C5OH 1EAUA 1RJXB 4AGJA 2VJ1A 1SMFE 4ABBA 4O3TA 4ABDA 2ZHEH 2GV6A 3A89A 1P03A 1VJ9U 2WV4A 4MNXA 2V6NA 4FUGA 2G55A 1CHGA 1XX9A 3E3TA 3RXOA 4UONA 1UJ1A 3ZV9A 3T29A 2P3FH 1T4VH 1YPGH 2BD8A 4K3JA 4Q7XA 1C1QA 3LGUA 1OOKB 2BD9A 1H4WA 3LT3A 5DP7A 3RMOH 2NU0E 1DX5M 5LPRA 2FP7B 1F92A 3D65E 1O5GH 1P11E 2CGAA 1W3CA 4O9VA 3M5OA 1ETRH 1MD8A 1NBME 3UNQA 4I31A 2NU1E 2XNDD 5DN6D 1TQ0B 1N1LA 4Y6DA 1UW7A 1VJAU 2KAIB 1GGDB 4MG3A 1ABJH 3M35A 1W0YH 4OS5A 2ZFRH 2GCHF 1BDAA 3U8RH 1HFDA 1GBTA 2CMYA 4K69A 1C5VA 5GXPA 2FO9A 4YT7H 5FPYA 3EGKH 3T25A 2BVXH 1DUEA 1C2FA 1PFXC 1GMCG 1ANCA 1EKBB 3DD2H 3H7OA 1HRTH 3KIDU 1QNJA 1K28D 1S85A 3TNTA 2PSYA 1GJDB 2H2ZA 1SLWB 3HKJB 1AQ7A 5DSFA 2PUXB 3VXEH 3PO1C 1GCTC 2PSXA 1O5FH 4TY6A 2VINA 4H6TA 1SGDE 2ZDNA 3BTDE 2XBXA 3EE7A 1MD7A 2LNCA 2RA0A 2WZQA 1C1OA 1WSSH 1AMHA 3RC5A 3TH4H 1TA6A 3LGWA 2BZ6H 4OGXA 1GBDA 1AE5A 1GVKB 1P2NA 2G5NA 1OPHB 5HYOA 2FX4A 1O2PA 2AIQA 2DE9A 2BX3A 3PV2A 2K8IA 1ZRBA 4TT3D 3V3MA 1TQ7B 2HGTH 1AIXH 9ESTA 4RN6A 2R2MB 3PMHB 1SC8U 4GHTA 3RXPA 3K2UA 4UEHH 3SHCH 1HAIH 5DP3A 1NFWA 3BN9A 3UWJH 2UWLA 4UFFH 3EYDA 3A7WA 3RXAA 1PPCE 3RU4D 4FUCA 1G32B 2VVVA 1J15A 3WY8A 2IJD1 4RKOB 2BDCA 1OXGA 3TGKE 2ODYB 2KCPA 5C1YA 4KTCA 1GBAA 1O5CB 1THPB 1O2HA 1KDQA 5E8EH 3RU4T 1FAKH 1DLKB 2FOBA 4Y79A 1C1RA 1HB0B 1P9UA 2HWLB 5JBTA 1WAYB 3ZZAA 4ZHAA 1MTWA 4X8SH 1SGQE 1K1NA 3RXGA 2WYJA 4CH2B 2XNIA 4DOQA 3O8RA 1A7SA 1FJSA 3GY5A 1BB0B 4IMQA 2J98B 3B23B 2VU8E 3RLWH 1KSNA 1WTGH 1SB1H 1O0DH 4X6MA 2R3UA 2SGQE 2JH6D 1NY22 3BEIB 1W7XH 4CBNA 2XC5A 3SHAH 1DFPA 2W6ID 2GT8A 2G52A 5C1XA 2VB0A 2Z9IA 2AH4X 3BTFE 3MH5A 4X6PA 2F9OA 4ZKSU 3UQVA 3M7QA 4MQAA 2J34A 2OUAA 3EE0B 1H9IE 1C9TA 4FUEA 4NZLA 1C5XB 3T5FH 3QX5H 2XC4A 3P95A 1GVZA 4LK4A 1TNLA 1GBBA 2CXVA 2F91A 1CT2E 2F3CE 1AGJA 1O3FA 4A1XA 1W8BH 1LVOA 1XVOA 5EJ1A 4JZ1A 1LHDH 3MMGA 1MBQA 2RFKC 2AS9A 1GPZA 4WWYA 1D3QB 2AGGX 5HKKD 2OC0A 1Y59T 2ANYA 1Y3XA 2PGBB 1GHAG 2JJ2D 3TK6A 1V6DA 3ZZ9A 1Y3WA 2CJIA 1IAUA 3EA7A 4NZQA 1NFUA 2H5DA 1IHSH 1FDPA 1TRYA 4WH6A 5HM9A 4P00A 2BDYA 3E0NB 4JYUH 1C1VH 1L1GA 3HATH 1HNEE 4CREA 2ZQ1A 3UAIC 3VEQB 3KF2A 3SV6A 4YOIA 3ZZ5A 4K2YA 1AO5A 1C5YB 4ABJA 5EPNA 4CBOA 1A3BH 4OS6A 3GOVB 1SGNE 1ZSJA 3GCNA 2SGPE 1EUFA 1UTJA 2C8XB 2J5UA 2WPKS 2ZGJA 4JK6A 5HM2A 1J17T 5J4QA 4A92A 3CP7A 4CHAC 6CHAB 2HVXA 4Y0YE 2QXIA 1ETSH 1P9SA 3A7ZA 2WV9A 1CA0B 1GMDG 1KLTA 3MU8A 4NSYA 1QRWA 3STJA 1C2GA 1F0UA 2F43B 4SGBE 3ATWA 1HJAC 3MNSA 1EJMA 1QJ1B 1YLNA 1WYKA 3KQEA 3F1SB 1W2KH 1GHBF 4MPVA 1G3CA 3JZ2B 2A5IA 1AFQC 2ZTXA 1O35A 4OS1A 3EAJA 2XBYA 1OWDA 1VR1H 2BOHB 2PKSB 3DFJA 1Y8TA 2FTLE 1QBVH 2Z3EA 1GHWH 2A32A 3PLBA 1BQYA 1P3CA 4LZ1H 2Y6TA 3GDSA 4WVPE 3DCLA 1KYNA 2GCTB 1FUJA 1ESBA 2C3SA 3GDVA 1SQAA 4F4OC 3KQDA 1C4V2 1ELCA 2ZU1A 1UTKA 2ZWLH 2PV9B 2FESH 2VIPA 1V2RT 3GY3A 1TRMA 2C93B 1NU7B 4AC9A 2OBQA 2STBE 4DVAU 4Y8YA 4NIWA 1PPBH 3MO6A 4NG9H 2ULLA 1TOMH 3ATKA 2V7QD 3T62A 3FN8A 4GUXA 4DJZB 1SBWA 3U28C 2SGEE 5ETXA 1GI2A 5TCAA 3EDXB 1P2QA 1V3XA 3Q3YA 2AYWA 3QWCH 3RXTA 5FBIA 1QL8A 3M36A 3ATIA 4K60A 2ZIQH 3PRBA 4MDSA 2KM0A 4Y10E 1ESTA 1OS8A 2OK5A 2H1UA 3IG6B 1ZOMA 3UIRA 3VGCC 1EX3A 2PR3A 5DP4A 4DCDA 2R2WU 3M61U 1VCQA 1X7AC 1AVXA 1GG6C 2OXSA 1D3DB 1P0SH 1ZTKA 1FXYA 2OQUA 5FCKA 1J16A 1C1MA 1P04A 2A4RA 2K1QA 5FCRA 3P8NA 2RA3A 3RXDA 2UUFB 1HAOH 2BHGA 1SVPA 3SORA 5C94A 3MYWA 5EODA 3SBKA 1NRNH 3GISB 1O2UA 1RFNA 3BEFB 1YCPK 1D3PB 3ZVBA 1A2CH 2UUYA 1BRBE 4NIXA 4H6SB 2BYAX 2OP9A 1MTVA 1INCA 1EOJA 4FVDA 4P02A 3SI3H 3ZZCA 1G3DA 1O2YA 2JETC 1ZYOA 4M7GA 3TH3H 3KL6A 2V35A 3GDUA 3M5LA 1QBNA 5FXLA 1OP2A 2VIOA 3STIA 3E91A 1D3TB 1PQ7A 2OCVB 5EQRA 1F2SE 1YLCA 1NFXA 1NZQH 2BDGA 3LC3A 2HPQH 1A0LA 3UOPA 2R0KA 2RDLA 5EJLA 3TJOA 1HAVA 1PPEE 1GI6A 3SUDA 4JMYA 2ZDVH 5EOKA 1DT2A 1UHBA 1SSXA 1ELAA 2BLQA 2VIDA 1AUTC 1F5KU 1YCPM 1LHCH 1FLEE 4ZHMU 1EZSC 1FIWA 4K5ZA 1O3NA 1ETTH 1O3DA 3WWBA 3L3TA 2FLBH 1BZXE 3LGIA 4ISNA 3RXIA 4IN2A 1O2XA 2ANWA 5CHAB 1EZXC 5GNDA 4TPYA 1GJ9B 1ELBA 1GJBB 1OP8A 3Q76A 1QA7A 1BTWA 2OINA 3TK9A 3SJIA 1Z6JH 5LH8A 1F5LA 2BY9X 2Z94A 2KZ4A 3HK6B 2YNAA 4I8JA 1CT0E 2XCNA 2ZU5A 2W26A 1O31A 2FOHA 1P2OA 5H4IB 1H1BA 1C5PA 1T8OA 1AKSA 1O5DH 3S9AA 3TGJE 2QF4A 2QYIA 5FHTA 5I25A 2KCOA 4CRDA 2A4GA 1V2JT 5JBBS 1C5WB 3SV8A 1KXFA 1SOZA 1C2HA 4Z6AH 1ZSLA 4X8VH 5JDUB 2OC7A 1O30A 3K9XB 1JIRA 2PTCE 2JH5D 4CRFA 4F49A 5AHGH 3RXBA 1TB6H 1F5RA 1O36A 3RXKA 2C8ZB 4D9QA 1ZHMA 3KQCA 4FUHA 1UTPA 2ZDLA 3HK3B 1O3JA 4VGCB 4XD7D 7KMEH 1OP0A 2ZGHA 5KECA 3R3GB 2EEKA 2BD2A 2BDBA 4BAQB 3KHVA 4HZHA 1MMJN 5GCHF 2ZDMA 4BXSA 4OM9A 1A0HB 1KXBA 3RM2H 2QF0A 2THFB 1TPOA 3W94A 1K1MA 3VB6A 3LJJA 1QL9A 2ZGBH 1S6LA 4KELA 3LDXH 1MTSA 4Y7AA 3M37A 1XVMA 2QCYA 3ESTA 1YYY1 4ZMAH 1O3HA 1QY6A 1LMWB 1FY3A 3MNBA 1ZJKA 8ESTE 3WW7A 2WPIS 2XYAA 1KY9A 3F2FA 2V3MA 2QAAA 3A85A 4AG2A 1GBFA 2OQ5A 1GWAA 1BMNH 1HJ9A 2XCFA 3MU1A 4IMZA 2QXHA 2HLCA 4ABHA 1XMNB 2B5TB 1NRQH 4ABEA 3BG4B 1AFQB 1NTPA 3O8DA 5EG4A 4ZXYH 2QXJA 4AFZA 3LOXA 1TX6A 5J4SA 4IW4E 2UWPA 2ZQ2A 3F9FA 5GJ4B 7LPRA 2D1JA 3MTYA 4NFEA 3QK1A 4OS2A 4GAWA 3PWBA 3RC4A 1N6YA 1MAXA 1DANH 1GMHG 1BRAA 3TITA 2A7HA 1DY9A 2Y81A 4XBDA 3ELAH 2OBOA 3U8OH 4XSKU 1ZR0A 4BXWA 1KTSB 3BTQE 1SGYE 2IJOB 2J9NA 3EQ0H 1RGQA 1TNHA 1NS3A 1XUJA 2ZP0H 1C5LH 2IPQX 3QTOH 1W0JD 2VH6A 1YP9A 1DWBH 3KYFA 4PROA 1LHEH 1SR5C 4B2CA 4B1TA 4INLA 3UY9A 1Z8JB 3DA9B 1S0QA 2CHAC 1UVPA 1L4ZA 1GJ5H 4D76A 1C1SA 1DS2E 1GJ7B 2FI4E 1LPZB 1NRSH 2F4LA 3GY2A 3OFND 2QV1A 2O9QA 4FUBA 2GP9B 1FMGA 1GJ8B 1TFXA 4DT7B 1GHAF 2G8TA 3ITIA 4AN7A 4YOGA 2TGPZ 3E6PH 1TLDA 1WXRA 1ANBA 5DG6A 1AZ8A 3N7OA 3T2NA 1XXFA 3QN7A 1DE7H 1C4Y2 1TIOA 2P59A 1GBKA 2BDIA 2L74A 3UQOA 2EI6A 1ELFA 2FMJA 4NWLA 3P92A 1TRNA 2W3KA 5C3NA 1YKTA 5JPMH 1G3EA 1UCYE 3D49H 1BMFD 5EXMA 1CGIE 1DWCH 3O8BA 3QZRA 4I8LA 1G36A 2Q6FA 1WDIA 1E38B 3FP6E 5CHAC 3F2HA 3ZYEA 1WU1A 2LPRA 1NO9H 2ZHQH 4K1TA 3MQKC 4MTBA 1TPAE 2GDDA 4JYVH 4U2WA 3DT0H 4XDEA 4UDWH 1SPJA 4E06H 1FPCH 3M3VA 2OD3B 4E7NA 2ZG0H 4TWYA 1C5QA 2OC1A 3LH3A 1QL7A 4X8UH 2Q1JA 1T8NA 3GCHB 2WPLS 1BTZA 5I46H 4NIVA 1P05A 4OS7A 4FUIA
chains in the Genus database with same CATH topology
1ZMNA 4I8GA 1ID5H 3GY8A 2QXGA 3SV7A 1C2DA 1TMBH 4UFGH 1BJUA 5F8TA 3RU4E 1NESE 1ORFA 1ELGA 3C27B 2BD3A 4Q80A 3TIUA 4NFFA 1OWKA 1MTNB 1MKWH 1SI5H 5C67A 3BTME 8GCHG 2IN2A 1HUTH 4WMDA 5EXLA 4H42U 1P02A 3D23A 2EI7A 3OX7U 1AVWA 4X8TH 1TPSA 4U32A 2XWAA 1GHYH 1GJCB 2BQ7B 2BX4A 4MPUA 2F9UA 1HXEH 1BRUP 2SNWA 1AI8H 1MKXH 1AU8A 3OYPA 3SU5A 1GL1A 1NU9A 1VZQH 1YPLH 3MH4A 1K22H 1PQAA 3TVJB 4RSPA 2G5VA 4O3UA 5F6MA 4AB9A 3Q3XA 1HIAA 3L6PA 1T32A 1FPHH 2O8UA 2Z3DA 1ZLRA 1J8AA 5EXNA 4H4FA 3PTBA 1Y5AT 3IWMA 4CH8B 1EPTB 3NZIA 4AYVB 1GI1A 1RRKA 4LOYH 2VGCB 1VGCB 2B0FA 3H7TA 1DDJA 4X1PU 3E16B 1C1TA 3P8GA 4BOHA 1B0EA 5ESBA 2V0BA 3ZYDA 3QGJA 1NC6A 4CRAA 3H5CB 3BTWE 2BTCE 1QIXB 1EP5A 8GCHF 1GDQA 4A7IB 4BTUB 4A1TA 1L0ZA 4WJG2 1AHTH 2VIVA 5A8ZA 1SGEE 2P94A 3Q3KA 4X2XA 1H9LB 1JRSA 2XW9A 2A7CA 1EAXA 3LGVA 1HCGA 2BD4A 5F8ZA 4BTIB 2FOMB 1D9IA 1TPPA 3LONA 3TU7H 1NRRH 4AFQA 1OSSA 1QQUA 3F9EA 3BF6H 1P2JA 1B0FA 4DIHH 1NPMA 5T6DA 5BRRE 5EQSA 3SGBE 2WPHS 3S69A 1HAYB 3LIWA 1P57B 2XC0A 2R0LA 5L30H 5DKMA 2A4QA 4JK5A 4YLQH 4B71A 3GICB 2VWOA 2ZFTA 1O2ZA 2FDAA 3BTTE 1YM0A 3OU0A 3ODDA 2FX6A 4NIYA 3MNXA 4JYTA 2FWWA 4WXVA 2B7DH 1YF4A 4RKJB 1GBMA 1QHRB 1ABIH 1UVOA 3BTKE 4K8YA 5GCHG 5L2ZH 4AORA 3UWIA 1Z71A 4X0WU 3SW2B 2GMTB 1N8OB 4A6LA 1S82A 1QTFA 2V3OH 1GL0E 1AFEH 1GI9B 1E37B 1XM1A 3TPIZ 4AG1A 2O8MA 2J4IA 3V7TA 4D9RA 4B76A 2ZGXH 2GCHG 4NA9H 3FZDA 1Z8IB 1CU1A 3SU2A 4B2BA 3TGIE 1FI8A 1YPMH 1V2MT 5C20A 2ZFPH 3ZZ6A 1J14A 1HJ8A 1BHXB 3VFEA 1UVSH 3GY4A 3LU9B 5DP8A 5TJXA 2Z9JA 1P2KA 1O2SA 2P8OB 3BTGE 1AWHB 1L1JA 1T8MA 1GHZA 3QO6A 4CRBA 4UD9H 3NPSA 4WH8A 2A7JA 4BAOB 1O2TA 3SJOA 2FI3E 3UR9A 1BTYA 4D7FA 2GV7A 1ZMJA 1S0RA 3GYLB 3ZVCA 5E2OA 3ZZ3A 1PQ5A 2AIPA 3MOCA 1O37A 1YGCH 1G2MA 1UTNA 3B9FH 3NXPA 2Y7XA 3A82A 1MCTA 5G4BA 2FXRA 6CHAC 4FUJA 1GHVH 1DM4B 3RXRA 3ZZDA 1KDQB 1OWEA 1RS0A 3CS7A 2D26C 4Q7ZA 1F0TA 2CHAB 4AX9H 1UVTH 6GCHF 1ZGVA 2G81E 1DXPA 1GMHF 5DK1A 3GY7A 3RXFA 1JBUH 5A09A 2FZZA 1K1IA 3NWUA 3ZVAA 1SGTA 2A2XH 3A81A 3L33A 2VNTA 4WMEA 3I77A 4XBCA 1TBZH 3R0FA 3A8CA 1DICA 4YOJA 1T8LA 1SGRE 2GTBA 3U69H 3U8TH 4CR9A 1SHYA 3UFAA 2A31A 4A5TS 1O2OA 2XTTB 4I32A 2R3YA 2WPMS 1LVYA 4MLFB 2GZ9A 1A5HA 1C2EA 1NM6A 1BHXF 3VB4A 4GSOA 1HAXB 1C2JA 1UK4A 3KNXA 3KGPA 3BSQA 1ELTA 1WOFA 2VWNA 1VITG 3OTJE 2QA9E 2AERH 3MO3A 3MWIU 2ZECA 2Y80A 4IN1A 1BMAA 1ZPZA 2ZPRA 3M7TA 1GCDA 1C4U2 1MZDA 3GCHC 2ZHWH 3BTEE 2PHBA 1DWEH 2FYRA 2BY8X 1VITH 1ZHPA 1XUHA 4XBBA 1EATA 1T4UH 1O5EH 1DUAA 1GBLA 1IQGA 2FM2A 2CN0H 3MNCA 5EQQA 3K6YA 2KAIA 1Q2WA 1O2IA 1PYTD 1PPGE 3KN2A 2W3IA 5F03A 1MKXK 1A46H 3MH6A 2XWBI 3RMNH 2Y7ZA 1O2QA 2JH0D 4Y8ZA 6ESTA 1U6QA 2FODA 2FLRH 3HPTB 1VITF 1KXAA 4A1VA 1E35B 1EZQA 5FX5A 4OS4A 3B8JA 4THNH 2AMPA 3W95A 2Y5FA 5IDKA 1G9IE 2UWOA 2GX4A 3U98H 4Y76A 1BMLA 3EA9A 1YPHE 2FPZA 2GZ8A 1G37A 2ZDAH 1LPKB 1O3OA 3URCA 2ALPA 1GJ4H 1GHXH 1XXDA 1TA2A 3CS0A 1W7GH 2QIQA 4ASHA 2BLOA 4JCNA 1BOQA 4Z0KA 4O03A 1RIWB 1AWFH 1V2QT 3I29A 3RXJA 2ANKH 1WQSA 2BLWA 1HLTH 4Y11E 4R0IA 2EI8A 4Y7BA 3HGPA 1O3LA 4X6OA 4TY7A 1ZRKA 1LDTT 3UR6A 3RDZA 1W14U 4ZXXH 1O34A 2Z9LA 1BT7A 3F6UH 1EPTC 1W13U 4X2VA 3T28A 4INHA 3P8FA 1TYNA 1Z1IA 2PTNA 4AGKA 1D4PB 5ESTE 4X6NA 1A3EH 2PKAB 2YNBA 1AE8H 1TWXB 3S7HB 3MO9A 1HV7A 2AFQB 4KP0A 3DUXH 1WUNH 2VWMA 3PROA 4AFUA 4SGAE 4XFQA 5GWZA 1GI5A 4YO9A 1AB9C 1G2LA 1THSH 1AVGH 1MQ5A 1HGTH 1O3BA 1S6FA 2ASUB 2QY0B 2EC9H 3SU6A 1DLEA 4HI3A 1IQMA 5EGMA 2GVFA 3A8AA 1TNIA 1ZTLA 2SGDE 2Z3CA 2F9BH 1KIGH 5JBAS 2OTVA 1KLIH 1TABE 1YPKH 2Y5HA 4OGYA 1GMCF 4MVNA 2ZGCA 1HAZB 1A5IA 1ELVA 3UUZA 3PLKA 2G51A 3SO3A 5EPYA 1TAWA 1FNIA 4X1QU 1F7ZA 3VB3A 1OX1A 1D6RA 5E0JA 2BD5A 4I8HA 1BBRE 2TGDA 2ZCKP 4MNWA 5GDSH 2C90B 1O3EA 1LQEA 1FY8E 2VWLA 2SGAA 4AZ2B 4O97A 1H8DH 4YM9A 2GKVE 1UVUH 5TCCA 1OYTH 1A1RA 4UFEH 5EW1H 3O8CA 1V2UT 1C2KA 1AY6H 3ZZ7A 3SNBA 1SLUB 2RCEA 1M9UA 1MCVA 2P95A 2Z9KA 5GPIB 1TGCA 1JWTA 2Z9GA 1GBCA 3MI4A 5E0GA 2PLXA 4XE4A 1QB9A 1UTMA 4CRCA 2AGEX 2W5EA 2GD4B 2QN5T 4X2WA 1GI8B 1UMAH 1SGCA 4B75A 1UK2A 3ZVDA 2ZPQA 3ODFA 3RXMA 2ANMH 2GMTC 2OC8A 5A0AE 4UE7H 1IQJA 2M5TA 1C2IA 1TALA 2HOBA 1ZPBA 3PV4A 1Z6EA 3VB5A 4ISIH 3UREA 3DFLA 3UOUA 4NA7A 1TGSZ 4B73A 1IQLA 1NN6A 7GCHG 1Y3UA 4Q2KA 1YPEH 1SFQB 4VGCC 1A5GH 1P12E 3SU3A 1O5BB 1GDNA 1PPHE 2QF3A 1GBHA 2TGAA 1MBMA 1O2RA 3V0XA 2VVUA 1C5SA 1LQDB 1BRCE 2J94A 5DP5A 1SG8B 4U30A 5T6FA 3A84A 5DO4H 1IQEA 2G4TA 5JYIA 3RXHA 1A0JA 1GJAB 4U01A 4NWKA 1SL3A 4ZKRU 3TJVA 1XUFA 1OWIA 3MH7A 2ZU2A 1GJ6A 1LVMA 1ZMLA 7GCHF 3AASA 1IHTH 2J92A 1MTUA 5E2PA 2BXUH 1QRZA 5K7RA 1CE5A 1LKBA 3LPRA 5DPAA 4CR5A 1RIWC 3HKIB 2A5AA 1QB6A 3ATLA 2BDAA 2DUCA 4CRGA 1JOUB 2H9EH 3M3SA 1ZJDA 3SI4H 1FZZA 5BPEA 2Z6BD 6GCHG 4I7YH 3LKWA 1C2MA 1HXFH 1TGTA 3RUOA 3G01A 1LHGH 1SOTA 3TJNA 2VIQA 1MAYA 3SJ8A 3QUMP 1SGFG 3F9GA 1ANDA 2UUKB 2AEIH 3SV9A 1DSUA 3PYHA 3JZ1B 3A7YA 3RXEA 1SLVB 1YPHC 5C1UA 2FIRH 1P3EA 2TBSA 3TJUA 3Q77A 2ZO3H 5AVDA 5FX6A 5DJ7A 3V12A 2VVCA 1SQTA 3QGNB 3RXSA 1K1LA 1GI7B 2JKHA 1IQKA 4IGDA 4ABFA 3GCOA 1LCYA 4IC6A 1K1OA 1W0ZU 1S5SA 3LGTA 1LHFH 5L2YH 4LZ4B 3KEEA 4WMFA 6LPRA 2Y82A 1TBQH 3FANA 2P93A 1FV9A 2F9VA 3S9CA 2A4OA 1JMOH 2C8WB 4FVBA 4YESB 1O2KA 2F9PA 1O3CA 1RD3B 4KTUA 2NU4E 1G30B 1FIZA 1UCYK 2WPJS 4J2YB 4IS5A 4LXBH 5F8XA 1FONA 1TE0A 4GVUA 3SU0A 1Q31A 1ELDE 1XUIA 1O3PB 1QRXA 3BEUA 2PUQH 5JBCS 2P3TB 2YOLA 3VPKA 1E0FD 4ZKOU 1G3BA 2J95A 1AZZA 1QB1A 2GCTC 3A7TA 1B7XB 1PYTC 1FY4A 1TNJA 3K65B 1BIOA 2C8YB 5CE1A 3GY6A 1Z7KA 3QDZB 3BG4C 2BY6X 2ZC9H 1QJ6B 4TWWA 1P06A 2ZFFH 1CO7E 3MU0A 1O2NA 1BBRK 1TX8A 2HALA 1AN1E 3A86A 3OY6U 3M5MA 2STAE 4DGJA 3RXQA 2BXTH 4ZROA 1Y3VA 2ZHFH 2B9LA 2VIWA 2PGQB 1OWJA 1GHBG 1UTOA 2QC2A 3ZVGA 2AMDA 4ESTE 1SGFA 2GZ7A 1MZAA 3AAVA 1O5AB 3SN8A 2A0QB 3PTNA 2BVRH 4CHAB 2HRVA 3C1KA 2CV3A 1WV7H 2HNTE 2WINI 4JZEH 2V3HH 4B2AA 1IQNA 1EZUC 1CA0C 4E7RG 1J9CH 5LGOA 3E0PB 3FP8E 1GG6B 1O38A 5FPTA 1L1NA 1ARBA 4I8KA 2ZZUH 4FU8A 2ZFQH 3QTVH 2VGCC 1O3AA 3D62A 3SUGA 3TLOA 2ODQA 1C5TA 1BBRH 2O8LA 4JZDH 1W11U 2GGVB 1YLDA 1IOEA 1MQ6A 1Q3XA 1EB1H 3MFJA 1C5ZB 2PKSC 3IITA 2H9TH 4MNYA 1O2LA 4K1SA 4GLYA 1E34B 4XOJA 1UTLM 2EA3A 4INKA 4Y71A 1CSOE 3OY5U 1S6HA 1Y5BT 1GBIA 2B8OH 3S9BA 4TPIZ 1O2GH 1SGPE 1GVLA 1EOLA 4ABIA 3E90B 5AF9H 5A0CA 2FI5E 1S83A 1Z8GA 4HTCH 1WBGB 3ZV8A 2BM2A 2FOGA 4X2YA 1BJVA 4GCHF 3ZZ8A 1EAWA 5SGAE 1AB9B 4DW2U 3GCTG 4KGAA 1GI4A 1SHHB 1QQ4A 2UUJB 2BVSH 2FOFA 5FAHA 1F0RA 4YZUA 1FQ3A 3M7UA 3A83A 5HMAA 8KME2 3K6ZA 3ZZBA 2TPIZ 1JIMA 2ILNA 2FOEA 1A4WH 1GDUA 1O3GA 2ZPSA 2BOKA 2WUBA 1SQOA 1V2TT 2PKAA 3A87A 1O2MA 1JXPA 1TNKA 3U9AH 3VGCB 1A61H 3QZQA 3SUEA 2XXLA 3RXUA 3A80A 5LPFA 1BUIA 1MTNC 3GCTF 1Y3YA 2CF8H 2GDEH 4I33A 1BCUH 3RC6A 1AD8H 5C2ZA 1QCPA 3BIUH 3RM0H 1P10A 1PQ8A 1DSTA 8LPRA 4DIIH 1D6WA 4WXIA 1N8OC 4X1SU 4YLUA 1EB2A 3TH2H 4WY3A 2PFEA 2RG3A 5HGGA 1S84A 2IOTA 5C5NA 1O3MA 5PTPA 4D7GA 1H8IH 4K8BA 3BTHE 2JETB 3NCLA 2TIOA 2ZDKA 1QR3E 3BIVH 4AFSA 2HNTF 1EJNA 4ZKNU 4D8NA 1VCPA 5C5OA 1QJ7B 3M5NA 1ARCA 1W10U 1V2NT 5EU8A 4JZFH 1ANEA 1CHOG 1Y5UT 1EQ9A 1WTHD 1KLJH 4R8TB 1IQFA 3OSYA 3ZVFA 3TNSA 1K9OE 1L4DA 3M3TA 3AW1A 2G4UA 1KTTB 2ZKSA 1HAGE 1TBRH 2ZU4A 5L6NH 1XKBC 2FTMA 4DG4A 1MH0A 1UHBB 2ALVA 5A0BA 2AGIX 2J38A 3QLPH 2QGRA 2ODPA 1FAXA 4ISOA 2P8OC 1PJPA 1YC0A 1P8VC 4NA8A 1UTQA 3PMBB 2ZCLP 5JB8S 3SOSA 1NT1A 1O2WA 1BTUA 3U1JB 3RMLH 3T26A 1QBOA 2HNTC 3CENA 2O8TA 1VCWA 1C2LA 2AMQA 2ZHDA 3SZNA 3AW0A 2I6SA 1AKSB 1ZTJA 1GI3A 3FP7E 3UTUH 3LJOA 2BY7X 3E8LA 3LGYA 4UFDH 1LPGB 1N6XA 1V2WT 2BD7A 1P2MA 2G00A 2J2UA 4JZIA 3ENSB 2WV5A 1HIAB 1FN8A 3PM3A 3RXVA 3F9HA 3PMAB 1Z1JA 3P17H 1HAHH 4IC5A 1DITH 3RP2A 1TNGA 5EW2H 1TOCB 3A8DA 1K21H 1WCZA 2HPPH 1SLXB 7ESTE 4Y8XA 4TYDA 1MUEB 1T31A 1HBTH 4BAMB 3TK5A 2F83A 4MNVA 2P16A 4HFPB 1CHOF 2ZTYA 3Q00A 1OKXA 2H6MA 1S81A 2NU2E 4AOQA 3NUMA 1TX7A 2SFAA 2BLVA 2D8WA 1K2I1 2ZU3A 2FS9A 2DE8A 5JB9S 1EP6A 1GI0A 3VB7A 1RTKA 2Y5GA 1JRTA 1TMTH 5A2MH 1HYLA 2XRCA 5B6OA 1EJAA 1V2PT 2Q6DA 4YT6H 4NSVA 1OWHA 1UO6A 2BMGB 3AVZA 1O3IA 1HDTH 1C5U