3UQVA

Bovine trypsin variant x(triplephe227) in complex with small molecule inhibitor
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSETYNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSASSFIITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGFYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cationic trypsin
publication title Correlating structure and ligand affinity in drug discovery: a cautionary tale involving second shell residues.
pubmed doi rcsb
source organism Bos taurus
molecule tags Hydrolase/hydrolase inhibitor
total genus 53
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2011-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3uqvA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3uqvA02
4R8TB 1D6RA 1EXFA 2GCHG 1F5LA 1NO9H 1ETSH 1NFXA 4FUFA 4HTCH 3ATWA 1Y3YA 1UVPA 3SU0A 1HYLA 3P6ZB 4YOIA 3SBKA 4LXBH 3NPSA 1EB1H 3PWCA 4JZIA 4UFDH 3SOSA 3VB6A 4NIWA 4GLYA 2BD2A 1YPEH 2ZDMA 3UFAA 3RUOA 4LOYH 4JZ1A 1GBHA 2CHAB 5GPIB 1A2CH 1XUIA 1IQMA 2FI5E 2BDCA 3QX5H 1DM4B 3UY9A 1WYKA 2SNWA 2P16A 2UUKB 1NT1A 1Z6EA 2ZZUH 3LOXA 1O2YA 2WINI 4AYYB 4RKOB 1K2I1 1SFQB 3RXOA 1K1JA 4YOJA 4NWLA 5DKMA 1P2QA 1TPSA 2TIOA 5GDSH 3U1IB 5C20A 5C5NA 4X2YA 2W7SA 1DY9A 3T27A 5AHGH 1A5HA 1OWKA 1RD3B 1C5TA 2G8TA 4AFUA 4BTTB 1D3PB 1K1IA 2ZGHA 2HLCA 3SJIA 4YZUA 1W2KH 1DDJA 1NPMA 2LNCA 3RXJA 3QTVH 1TA2A 2GZ8A 1YPHE 2BZ6H 1H9LB 2A4GA 1CT2E 1EASA 1RTFB 5B6OA 1C2HA 3B9FH 1RIWB 1Z7KA 1BTXA 1N1LA 3UR9A 1J9CH 1O36A 3MYWA 3ODDA 3Q3YA 2WPHS 1PQ8A 1SLVB 3A88A 5FCRA 3STJA 2PKAB 5DP9A 2VWNA 3UOUA 1GMDG 1QA0A 3H7OA 1C2GA 1GL0E 3OY5U 2JH5D 1GMCF 1UK4A 2CGAA 9LPRA 1DSTA 1OWHA 2I6SA 2WPJS 1M9UA 1GJ8B 2RA0A 3OU0A 1LVOA 2BQ6B 3RU4D 1SGDE 1QGFA 2BD9A 5H4IB 5EW2H 1ZTKA 4AFQA 2FLRH 1LHCH 3Q3XA 3D62A 3EA7A 5C1XA 1NZQH 1LMWB 4HZHA 1KXDA 1QJ7B 1O3OA 3D23A 4IMZA 1V2RT 1TB6H 1E0FD 5K0HA 2CMYA 1P09A 5TCCA 4X1SU 1NM6A 1BJVA 1W8BH 4MNYA 1O2MA 4Y10E 1FQ3A 1ZOMA 3ZV9A 3I78A 3RM2H 1TWXB 2PUXB 1EUFA 3SNDA 1C5ZB 1A5IA 1ELTA 3A8DA 1C5WB 3A7WA 5TJXA 1O3MA 3PMJA 2FOAA 5GCHG 3RXPA 1IQIA 1ZHPA 1DWBH 5AF9H 3BG8A 3ZYDA 1TRNA 4GCHG 1ID5H 1AVWA 1HJAC 2ALVA 2ZCLP 4WY3A 4YT7H 1ETRH 1ELGA 1A0JA 1FY5A 2FS8A 1PFXC 2ZQ1A 2C8WB 5EPNA 2Y6TA 4UDWH 2FI3E 1B0EA 2ZIQH 3QZRA 3TH3H 1P2OA 1QY6A 3HPTB 1GWAA 3I29A 3IITA 4AFZA 3ZZ7A 5CMXH 2C3SA 1ARBA 2ZI2H 1MBMA 1ZRKA 1C5OH 2ZCHP 5HMAA 1D3DB 2PKSC 3KIDU 2VGCB 1O3CA 1QURH 1SQOA 3KCGH 5K7RA 2WV5A 2QY0B 1ZGVA 8LPRA 1YGCH 2A7HA 2UWOA 4HI3A 3M61U 1OPHB 3KHVA 2BD7A 1ZPZA 5LPRA 2NWNA 4ISNA 2XRCA 4FUJA 3GCTG 2H5DA 2HNTF 3MU4A 3RXTA 2R2WU 4D9QA 2WPIS 3P8OA 1ZZZA 1P2JA 4Y7BA 3E0PB 3SI4H 1GJ6A 2VVCA 1O3PB 4GHQA 3R0FA 1F0TA 1EATA 5JBTA 1YBWA 1JIRA 1DSUA 4IW4E 4FUCA 3QTOH 1O2QA 2C4FH 3M7UA 3ZZBA 4BAOB 3PTBA 5EXMA 3ZZ5A 1C1NA 4BTIB 3ATKA 4CBNA 4JZFH 2PW8H 4NGAH 1TABE 1S84A 4CRAA 2Z9LA 1O35A 1SQTA 1CA0C 3IWMA 1O2UA 2TGAA 1F0RA 3BG4B 1NN6A 4NIXA 1LVMA 2Z3CA 2A4OA 2HGTH 2ZTYA 1Z71A 2F9VA 2G81E 4B73A 1UJ1A 7LPRA 2JETC 4D7FA 3GY7A 4Y79A 3LPRA 2GCTC 1MD7A 1HIAB 4KELA 3TJVA 3PLPA 2A5IA 2ZGXH 1GGDC 3GCHB 1Y5AT 4YLQH 1KTSB 1OP2A 4MDSA 3SORA 2BXTH 2CN0H 2GV7A 4NSVA 2G52A 3SN8A 1LVBA 3NCLA 3SHAH 1FUJA 1TE0A 4B75A 3P17H 1XVMA 3RC5A 3BTHE 1ANEA 2Y80A 1P2NA 1NRPH 2I6QA 3A86A 3BF6H 1WSSH 3U8TH 2FOMB 1G3CA 2A4RA 1GMCG 1ZPBA 2HNTE 2P59A 2O8UA 5LPFA 4ZAEA 1UTNA 1TRMA 4VGCB 1GI9B 3TJUA 1TBRH 1BTZA 5IDKA 2A2XH 2EEKA 2P94A 1P3CA 4Q2KA 5EXLA 3RXKA 1AKSB 1C2FA 2BLOA 3LT3A 4IC6A 5C2ZA 2BY8X 1KLIH 2VWOA 1SGRE 2VJ1A 3BEUA 4GSOA 3T28A 2ULLA 3TU7H 1OYQA 1TNJA 3GY6A 1AQ7A 1C9TA 1P3EA 3SNBA 4DJZB 4BAHB 3SV7A 1FN6A 2GV6A 2ZHDA 3RLWH 3VEQB 2ZFRH 1IQKA 2EI7A 3V12A 1F7ZA 1AWHB 4KKDA 3LGTA 2FOBA 2ZDVH 1BBRE 4ZHMU 4AORA 4UFFH 1TBQH 2QA9E 1RS0A 3RU4T 2WPLS 1SMFE 7ESTE 2RCEA 2V3OH 1KXCA 1CHOF 3L33A 3SU6A 4B71A 1EP5A 3N7OA 1TMTH 2AIQA 2P93A 3RXMA 1NY22 8GCHG 2YNBA 2M5TA 1GVZA 1V2TT 3RXQA 1W13U 2XNIA 1UCYK 2G00A 1ZSKA 2P8OC 1ZMJA 1HAPH 2KAIA 5BRRE 3EGKH 2OQUA 3F9FA 2FS9A 3SU3A 3TJNA 1ABIH 1TGBA 2AYWA 1DWDH 4GAWA 3EAJA 4AZ2B 1GDQA 3TLOA 2ZU5A 1LQEA 3FZDA 4FVDA 2PSYA 4D9RA 5JYIA 4CH2B 1Z6JH 1QL8A 1BTUA 4ISLA 3SNEA 1GJ9B 5E0JA 5CHAC 4A5TS 1GI6A 1AVGH 1KXAA 3FFGA 2C8XB 1WTGH 4WVPE 1FY1A 1TMBH 5LPEA 1GCTC 1O3HA 1BRBE 3TPIZ 1O2VA 4U01A 3LC5A 4A6LA 3T2NA 2QGRA 4FUHA 1O3BA 3U69H 1OP8A 5DP6A 2OUAA 4ABAA 2QCYA 1KXBA 2BX4A 1DWEH 3ODFA 1ABJH 2BDGA 2QAAA 3L6PA 1O3DA 4ZKOU 1GMHG 1MKWH 1SLWB 2ILNA 3GY8A 5IYTA 2B8OH 4INHA 1BTHH 3SW2B 2FLBH 4ABDA 4JK5A 1BIOA 1C5XB 1ZSLA 2R0LA 2G4UA 4DY7B 2VWLA 4YTAA 1A3BH 1W3CA 1UHBA 1TOCB 1ZJKA 4FUGA 4ABGA 2ZDLA 1FY8E 1BA8B 3QUMP 1NU7B 4TWYA 4JCNA 4Y76A 1KTTB 4AG1A 4AB8A 1P10A 2OLGA 2QXHA 3E1XB 1O5GH 4O3UA 1C1RA 1LKAA 4WXIA 2ZU1A 1GBLA 1O5BB 4K69A 1K28D 1FPCH 1Y59T 3PLBA 1NRRH 2J95A 3AAVA 1NTPA 1GBBA 1G2MA 1T31A 2ZNKH 2ZHQH 1F5RA 5F8TA 3AAUA 5GWZA 2Y7XA 3A80A 3SU2A 1TNLA 4ZKSU 3TH4H 3ZV8A 1YLCA 3FP6E 4YOGA 4CRFA 3KQEA 1SGEE 1FNIA 3E90B 3LGYA 1P01A 4DT7B 7GCHF 1CBWB 4GUXA 2FM2A 1THRH 4K1EA 3ZVBA 1LHFH 1BHXB 4I8KA 1SG8B 4I8JA 1HXFH 3O8CA 4AFSA 2XCFA 3URCA 1RTLA 1ZLRA 3UIRA 1EZXC 2TGTA 4OS5A 1HAVA 2SGEE 1XMNB 2BY7X 1QBVH 3MU5A 3KQBA 1DLEA 1WBGB 2F9BH 1Q2WA 4NIVA 4XBCA 1PQ5A 4K1TA 1O2GH 1CGIE 4TYDA 1UTLM 4U30A 2ZU3A 1Y3XA 4FUDA 1XM1A 4WF8A 4X0WU 1TPAE 2H2ZA 4D76A 5A8XA 6CHAB 1P11E 1C5PA 2VB0A 2BQ7B 3GOVB 5DP4A 3M3TA 1PJPA 3W94A 3NXPA 3UNQA 1LQDB 4WMFA 5TCAA 3CS0A 1TGNA 2BXUH 3BIVH 4WMEA 4WH8A 1TALA 1BTWA 2GMTC 1EP6A 2QV1A 3U9AH 5C1UA 1UTOA 1C5SA 2F9PA 2QXJA 2VVUA 2ASUB 3QGJA 2BTCE 2O8TA 2ZF0H 4ZKNU 2OD3B 1HJ9A 3SGAE 3A7TA 2FO9A 2TGPZ 3HATH 1V2LT 4FU7A 2IJOB 4Q7YA 3F1SB 5DP3A 3KEEA 2EA3A 1DUEA 1AFQC 1G3EA 3FVFB 1O32A 2Z3DA 2BOKA 4TPIZ 2A4QA 1GJBB 1C1TA 1GG6B 2CF9H 3SJ9A 2F91A 1ZMNA 1FJSA 8ESTE 4I7YH 2Z3EA 1YPGH 2ZPSA 1O39A 4B76A 1DICA 1VGCB 1W7XH 4X2XA 3P95A 2ZHWH 1L0ZA 4Y8XA 1UTPA 1GHAF 5F8XA 4GPGA 4DIHH 4E7RG 1UTKA 1GDUA 1V2NT 5DO4H 1IQHA 1Y8TA 4MVNA 4AGKA 3U8OH 1HAYB 1KXEA 4ZXXH 2Y5FA 4MQAA 1YPJH 1G32B 3LONA 1AE8H 1MCTA 2IN2A 3D65E 1H9IE 1SLUB 3G01A 3OY6U 4CRCA 1DS2E 4CH8B 2H9HA 3DA9B 2BDBA 5G4BA 1O2RA 1IQNA 3SV8A 1O31A 2OBQA 1QHRB 3ZZAA 1AE5A 1BBRK 1HXEH 3S9CA 4YT6H 2BD3A 2DUCA 1TLDA 3VXEH 1BRUP 1BITA 1E34B 2HALA 4K3JA 1Z8JB 3A8CA 1PYTC 1GVKB 4WXVA 1TQ0B 3ENSB 1KDQA 1MTUA 4INKA 1GI2A 3TK5A 3A82A 5EQQA 1FPHH 4BXWA 1CO7E 1V2JT 3RMMH 2GD4B 3RM0H 3S7HB 3SNAA 3M5MA 3U98H 2NU3E 1TYNA 3LJOA 5DK1A 1CT0E 1MH0A 3IG6B 3M3VA 3CP7A 2G5VA 3M7TA 2ZTXA 4X2VA 1T4VH 2FODA 1UCYE 4IN2A 3T26A 2Z94A 4FUBA 2ZHFH 1HFDA 1SBWA 3BTWE 1IQJA 2JH6D 3RXDA 1AMHA 3UNSA 3F9GA 4K1SA 4BNRA 1LTOA 1W0YH 3VB7A 1TBZH 4A92A 3E8LA 2XBYA 1YPMH 2B9LA 1VZQH 1G9IE 3BTGE 1N8OB 2OC7A 7GCHG 1O2SA 1P57B 2BVXH 1OWJA 1BQYA 4XDEA 3QWCH 3GDUA 3H5CB 1MKXH 1V2UT 1NU9A 1LPKB 1O3IA 4B2AA 2D26C 1VCQA 1GHBF 1KY9A 1KXFA 1VCWA 4FU8A 2FESH 4X6PA 1C5LH 4NA8A 4D7GA 2SGPE 1QA7A 2GT7A 2ODYB 3QLPH 4BAMB 5C67A 1TA6A 2STAE 3M3SA 1A61H 1ESBA 1PYTD 2HOBA 5JBAS 2XW9A 4HFPB 1GJDB 1T8MA 1ZMLA 2ZDAH 3RU4E 3M37A 3RXHA 3A85A 1XKAC 1K9OE 4CHAB 1LKBA 1EAWA 3TIUA 1GPZA 4CRGA 4OGXA 1C2KA 2R3YA 1Z8RA 1BHXF 2ZU2A 4Z6AH 4B2BA 2BX3A 1W12U 3H7TA 1BMNH 3K2UA 1XX9A 1K1LA 1V2OT 3MMGA 4UEHH 4ABEA 2BDAA 1V2MT 3MNSA 3PB1E 5EQRA 1WTHD 4E06H 3BSQA 1C5QA 3SJOA 1EKBB 1XKBC 1EPTC 3EA8A 3HKJB 2ZFFH 4H6SB 1O2LA 2P3TB 1P02A 4MNWA 3LKWA 2W7UA 1NRQH 2ZWLH 5CHAB 2OC0A 1G3BA 1K1NA 2JKHA 1ZHRA 2NU4E 2O8MA 1C5UA 5ESBA 3LJJA 1L1JA 1GJ4H 4X1QU 2ZEBA 2VINA 2AERH 1D4PB 4WWYA 2P95A 3E6PH 3OSYA 3BEFB 1ZHMA 1D9IA 2YNAA 1P04A 5FPSA 5FXLA 2FMJA 1ANCA 1A0HB 2BY5X 4ZKRU 1C5VA 3W95A 6ESTA 1GHAG 1DFPA 1HAZB 3D49H 1ACBE 2SGQE 1RXPA 2GTBA 2RDLA 3SHCH 4DURA 1JOUB 1NFUA 1H4WA 1P9SA 2R2MB 2F9UA 1KLTA 3I77A 1C1VH 1O3LA 2ZFSA 3FZZA 3V7TA 1JXPA 1C4U2 4E7NA 5I25A 1O5AB 5PTPA 3MH5A 1QRWA 1CVWH 2BOHB 4WH6A 5EODA 3GISB 1ZGIA 2G51A 3RC4A 1K21H 1MZAA 1TX7A 3GYMA 1E36B 1GI1A 3F9EA 2XC4A 1BRAA 3VGCC 2J4IA 1EOJA 1TRYA 3KQCA 1LHGH 3GICB 2ZDNA 1HDTH 4CRBA 2ZU4A 4K5ZA 5EGMA 3UPEA 2JH0D 4NCYA 4NSYA 1HNEE 5JPMH 3ATIA 1EQ9A 5DP8A 1O37A 1GI0A 2D2DA 3JZ2B 1HB0B 2C93B 2UUFB 4X8VH 5FBEA 1VJ9U 4KGAA 1P03A 1A3EH 1GBEA 2BD8A 1OXGA 1AZZA 3DFJA 2ODQA 1MAXA 1SL3A 4K8BA 2CHAC 3ESTA 2ZECA 1BCUH 1A5GH 4NFEA 1VITF 4NFFA 1MTSA 2ZFPH 5HYOA 4DCDA 2ANWA 4AGJA 4WJG2 5FPTA 4OS7A 4B1TA 1YC0A 1DOJA 1Y5UT 1P06A 1O2WA 1TX6A 2HWLB 3UNRA 1GBIA 1TNGA 2GX4A 4CR5A 2O8WA 2A45B 3RXUA 3SGQE 2A2QH 1QL9A 3C27B 3RC6A 1BDAA 3RMNH 1O38A 1XUGA 4PROA 1GBTA 3HGPA 2WPMS 3NK8A 1BOQA 1Q3XA 3QGNB 1OKXA 2AMPA 4H4FA 3GDVA 1HGTH 1D3TB 2STBE 1JIMA 5AVDA 1D6WA 2Z9KA 2Z9IA 1SLXB 2GGVB 3SUDA 1S83A 1EJMA 1T7CA 1PPHE 1TMUH 4ZMAH 1C2MA 1RIWC 4MNVA 1F0UA 2FPZA 1GCDA 1Z1IA 4UE7H 5A0AE 1A0LA 1MTNB 2W5EA 2BLWA 2OBOA 4SGAE 1SQAA 1P8VC 4X2WA 1SPJA 1SFIA 1O2PA 1C9PA 1S81A 1DE7H 1YCPK 4GHTA 4AG2A 3K9XB 1O3EA 2KAIB 3NUMA 3QO6A 4H6TA 1FMGA 1IAUA 5E0GA 3CS7A 1W11U 1AFQB 1K22H 1ELFA 1GJAB 5FX6A 1VR1H 1PQAA 3R3GB 2UUYA 2BVSH 1GBMA 2Q6GA 3SQHE 1ORFA 4CBOA 4JYTA 3V3MA 5A2MH 2SFAA 1UK2A 4O03A 5SGAE 1EOLA 1QQUA 3SU4A 1UVSH 3RXEA 4ISOA 3ZVAA 2THFB 1WU1A 3ZVFA 2GDEH 3KNXA 1J16A 2Y5HA 4AYVB 2OQ5A 5DP5A 1FLEE 4MPUA 1BUIA 1HV7A 1Y3WA 3O8BA 2FXRA 1S0QA 4IBLH 1GI5A 2OC8A 3LGUA 1TPPA 1G2LA 2HVXA 4Y71A 2PSXA 1ZRBA 4OS2A 1AY6H 5E0HA 5EU8A 1QJ1B 3EQ0H 3MH4A 4NWKA 2ODPA 2WUCA 4ESTE 1K1MA 5EPYA 2DE8A 3RXVA 3U1JB 1SGYE 1SGCA 1LPGB 1C2IA 1U6QA 1H8IH 1TNKA 5DP7A 1SHHB 1ESTA 1SGTA 1ANDA 4Q7XA 3M5OA 1HRTH 5F6MA 1UHBB 1DWCH 1CGHA 2ZCKP 1B5GH 1UK3A 4Q80A 3A84A 1O5CB 1GBCA 1AFEH 3AW1A 3FANA 2O8LA 2ZA5A 3ZZCA 4Y0ZE 2ZC9H 4Y0YE 5E2OA 1UMAH 2BM2A 4TPYA 2VGCC 1MZDA 3M5LA 2QF3A 3PM3A 3RMLH 4JMYA 3MO9A 2A7JA 2ZPRA 1SHYA 1T8LA 4DVAU 3OX7U 1UTQA 5ABWA 3RXIA 1K1OA 3TGJE 1HAOH 3PLKA 2GZ9A 3S9AA 1ELCA 3S9BA 1BTYA 3SGBE 4Y8ZA 1O2ZA 3BTDE 2A7CA 3VB4A 2AGGX 1AVXA 2H9TH 1EAIA 2TRMA 5GJ4B 4NG9H 1VITG 3BTQE 4J1YA 4LZ1H 1QNJA 1A1RA 3GY5A 1MMJN 3KGPA 2HRVA 1GL1A 1N6XA 3WY8A 5LGOA 4BTUB 3UREA 1EJAA 1H9HE 4UFEH 3BEIB 1OX1A 2XC5A 1HAVB 2XWAA 1GHYH 2XWBI 3BIUH 2QC2A 1S6FA 1O5EH 3LH1A 1CSOE 2F83A 4E05H 3E3TA 2BDIA 2H6MA 3BG4C 1SI5H 4INLA 1MUEB 3MNBA 3S69A 1T32A 3QN7A 3V13A 3CENA 2LPRA 3HK6B 1AUJA 1JRTA 5FAHA 3SUGA 1YCPM 1O2XA 1FAKH 2OXSA 2VIDA 3SQEE 4O3TA 1YP9A 4O9VA 3UWJH 1OYTH 2TBSA 1L1GA 1G3DA 1AN1E 1RRKA 1SGFG 2FYQA 2VIOA 1UCYH 4CREA 4ZHAA 1SGPE 3LH3A 4M7GA 1QIXB 3UWIA 2AGIX 1DT2A 1YM0A 4AOQA 1AZ8A 3TITA 2Y5GA 1O33A 1EZQA 3PO1C 3OYPA 1C1UH 1HJAB 4ZHLU 1ZPCA 3KN2A 4LK4A 3MHWU 1O0DH 2FIRH 4I33A 4NA7A 4X6MA 1FI8A 4DW2U 1SGIB 1CHOG 1V2QT 1NRNH 1CQQA 1GBAA 1DX5M 3GCOA 1GHZA 1GHWH 1BB0B 1ELBA 4AX9H 5JB8S 2WPKS 3A8AA 2ZG0H 3T29A 4D8NA 2AEIH 2PKSB 1EPTA 4BAKB 2W26A 1EX3A 2Z9GA 3M35A 4JYVH 2HPQH 1IQFA 2VH6A 4KTUA 2G5NA 4LZ4B 1LO6A 1ZSJA 1O3NA 1PPGE 4KTSA 3RXCA 3UQOA 1EAUA 4GCHF 1XUJA 1ZJDA 1GI8B 1Y3VA 2Y7ZA 1QRXA 3BTFE 4DOQA 2BQWB 5A8YA 2QIQA 1JRSA 2UWPA 1D3QB 5ESTE 6GCHF 1O2KA 5T6FA 3MU0A 2DE9A 1CT4E 3ZZ6A 1WQVH 2J92A 2XTTB 3TGKE 3VGCB 2BLVA 4XBDA 1G36A 4X8SH 2W3KA 1W14U 5L2YH 1NESE 2AGEX 2PWXA 1HJ8A 1OWEA 4Y7AA 1C1WH 2G4TA 4BOHA 1GJCB 3MNCA 3SO3A 1MQ5A 1TFXA 5DGJA 5L30H 1ARCA 1KDQB 1O2IA 1CA0B 2V3HH 5A09A 2OC1A 1GI4A 1IQLA 5AFZH 1AB9C 1UVOA 4MPXA 2PUQH 2ZFTA 2RA3A 3GCTF 1AD8H 4B74A 4DIIH 3A87A 2B0FA 1ZR0A 3ZZ8A 2QYIA 1QB9A 2F3CE 5F03A 2JETB 3QK1A 3ZVGA 2GCTB 1S5SA 1A7SA 2ANYA 3SV9A 1LDTT 1LCYA 3F68H 1V6DA 1B7XB 2H9EH 1VJAU 1GGDB 1YF4A 1BZXE 5GIBA 1UTMA 1MQ6A 2WYJA 1P9UA 4Z0KA 2OCVB 1GBDA 1AI8H 3A81A 2TGDA 1FIWA 3F9HA 2FP7B 4THNH 1OOKB 4X1PU 3P92A 2PTNA 1TGCA 1HPGA 3P70B 4YESB 3MU8A 2A1DB 1C1SA 2H1UA 1WCZA 2ZKSA 3NWUA 2ALPA 1MBQA 3RLYH 1FY4A 1C1OA 1A46H 2GP9B 4I8HA 4BXSA 3SUEA 1LVYA 1YPLH 1C1MA 2FTLE 1XXFA 2F9OA 1NFYA 1FDPA 2A5AA 2PV9B 2VU8E 1P2IA 1UVTH 3GCNA 4O97A 4Y11E 4B2CA 2IPHA 3M5NA 1GVLA 4JK6A 5FX5A 2BD5A 1LPZB 1O3FA 3Q77A 1DY8A 3LDXH 5HXFA 1V2PT 1HAIH 4MG3A 2AH4X 2V35A 4Y6DA 3Q00A 3M7QA 4UD9H 3ZVCA 1GDNA 4X8UH 1CU1A 2V0BA 2BHGA 3BTEE 1CA8B 3RP2A 1E35B 3EYDA 1JMOH 1MU6B 3LGIA 3LU9B 4MLFB 3RDZA 4IC5A 1DITH 1TPOA 1V2VT 3STIA 1O34A 3K6ZA 1WUNH 1T8NA 4DGJA 2FYRA 1SGFA 1GBKA 1TNIA 1KLJH 1QBNA 1DVAH 1PPZA 1YYY1 2PKAA 3T62A 4ABFA 1CBWC 3RXGA 3RXRA 1EAXA 1C4Y2 4CR9A 2P8OB 3LIWA 1BRCE 4ZUHA 2BD4A 3PYHA 3SU1A 1ESAA 3UOPA 1W7GH 3PROA 1C5RA 4MNXA 1L2EA 1DXPA 3HKIB 4U2WA 1O3KA 2P3UB 1FXYA 1THPB 1FIZA 3K6YA 1LHDH 4UFGH 2AIPA 4NIYA 2Z6BD 1NRSH 4YLUA 5EOKA 2PLXA 4MPWA 5T3HA 1EZSC 4XOJA 2HPPH 2FTMA 5CE1A 1LHEH 1S82A 1QCPA 4I8GA 6CHAC 4ZH8A 1QQ4A 1C5YB 3PV4A 4FUIA 5J4QA 1GCTB 5FPYA 1HAXB 4OS6A 1SGNE 1C4V2 1C2EA 1WAYB 8GCHF 1BBRH 2BY6X 3ZZ3A 3VFEA 1Z8IB 6GCHG 2QF0A 4ZXYH 3RMOH 1Q31A 2A31A 5I46H 2XBWA 5A0CA 3A7XA 3Q76A 2C90B 4F49A 3BTME 1YLDA 2R3UA 1AWFH 2GZ7A 3KQDA 1SVPA 3M36A 4DG4A 1O30A 1O2NA 4MPVA 4NZLA 2AMDA 2WUBA 3BTKE 3Q3KA 3O8RA 1JBUH 1S6HA 2HNTC 1UVUH 2J38A 1VITH 2PTCE 2YOLA 1J14A 5A0BA 1J15A 1XVOA 4X6OA 4CRDA 5A8ZA 2ZTZA 1GHXH 2GVFA 4KP0A 4ABHA 3UQVA 3GY2A 1X7AC 1GBFA 4ZROA 1FONA 1TNHA 4ABJA 2XBVA 4R0IA 1GG6C 1MAYA 1PPBH 1THSH 4ASHA 2VIQA 3V0XA 4BAQB 2VH0A 3SUFA 2A32A 3TJOA 2ZO3H 1V2ST 4JZEH 4XE4A 1C2JA 1VCPA 1NS3A 1QB6A 2Z7FE 4A7IB 1VGCC 2TPIZ 1OWIA 1WOFA 1EZUC 2BDHA 4X8TH 3RXBA 2OINA 2RG3A 4IN1A 1OP0A 3UTUH 1P12E 1IQEA 1O3JA 2PR3A 1A4WH 1GMHF 3A83A 1RJXB 2EC9H 5LH8A 3FP8E 2C8YB 2C8ZB 3GYLB 4UONA 1PPFE 5C3NA 2FX6A 2FWWA 1MTVA 1NROH 1S85A 3EE0B 1KIGH 3SJKA 4NA9H 1CGJE 4YO9A 1HCGA 1QR3E 3O8DA 8KME2 1FV9A 4IGDA 2W3IA 1W10U 1C5MD 3MFJA 1T8OA 1SGQE 5ETXA 3GY3A 1INCA 2SGDE 1IHTH 2VIWA 4Q7ZA 1BMLA 4OGYA 1NFWA 1J17T 2FOCA 2ZDKA 4GVUA 2UUJB 1TGSZ 3F6UH 1ELEE 4OS4A 1MKWK 3A7YA 2ZQ2A 5EXNA 1DANH 1TGTA 1ZTLA 2B5TB 3BV9B 1H1BA 2J9NA 1E38B 2XXLA 2AFQB 1JWTA 5EG4A 1GHBG 1J8AA 1UO6A 4ISHH 2PFEA 1EB2A 1NC6A 1PPCE 3PO1B 3RXAA 1C1PA 2XCNA 2OTVA 2J94A 3SV6A 1F5KU 3MU1A 1SR5C 2J2UA 4IMQA 1HIAA 5FCKA 1F2SE 1O5DH 3A7VA 2BVRH 4BANB 1BTPA 4K2YA 1B0FA 2XYAA 3SJ8A 2O9QA 1MU8B 3PMHB 2GMTB 3SU5A 4ABBA 2SGAA 3VXFH 1P2MA 1N8OC 5JBCS 3QDZB 1IHSH 2FOEA 1G37A 2PHBA 2WV4A 1W0ZU 2D8WA 4I32A 2EI6A 4K60A 4K8YA 4A1TA 3FP7E 2NU0E 2Y82A 2ZPQA 2ANMH 1ANBA 4KTCA 4AB9A 1YPKH 3L3TA 1QBOA 3ZZ9A 1AKSA 1DPOA 1XUFA 3ELAH 4H42U 3MO6A 1SSXA 1YKTA 2Q6DA 2Y81A 3ATMA 3E0NB 2B7DH 5L2ZH 1CHGA 1TOMH 3RXSA 3SI3H 5DG6A 1QJ6B 1SB1H 3LGWA 2ZGCA 5HM9A 3ATLA 4FU9A 1RFNA 4U32A 1K1PA 3P8GA 2VWMA 1RTKA 1O5FH 3S7KB 3PTNA 5EW1H 2BB4A 1AUTC 5E8EH 4CHAC 2BY9X 3TVJB 3GDSA 3EA9A 5BPEA 1GJ7B 2FOFA 3TNTA 4RN6A 1DXWA 3RXFA 2Q1JA 3MH7A 3DUXH 2PGQB 1TIOA 1AIXH 3BTTE 1PPEE 2BDYA 4FXGH 1E37B 2A0QB 1AB9B 2FEQH 2J34A 3SZNA 4OS1A 1FAXA 3GY4A 2VNTA 4XFQA 1Y5BT 4YM9A 1GHVH 2FOGA 4WMDA 2WYGA 1G30B 3HK3B 5GXPA 1OWDA 3U8RH 1L4DA 5JDUB 2GCHF 1V2WT 4JYUH 2FI4E 3T5FH 9ESTA 1S0RA 4Y8YA 1SOZA 1XUHA 4IS5A 3URDA 3KF2A 1EJNA 3LC3A 1TONA 3PMAB 4ISIH 1WQSA 2GT8A 3T25A 2BLQA 2XC0A 1Z8GA 4RSPA 1L4ZA 4TY6A 5FHTA 2V6NA 3VB3A 1QTFA 1SOTA 1FY3A 2SGFE 1H8DH 1MTWA 1O2JA 4FUEA 1GJ5H 3P8NA 1AU8A 2ANKH 3AASA 3SV2H 3TK9A 2A5KA 2GDDA 2GKVE 1PQ7A 5C1YA 1BJUA 5FBIA 1QB1A 1C2DA 3ZYEA 1XUKA 1Y3UA 1ELAA 2Z9JA 2ZHEH 4J2YB 1QRZA 3MI4A 3TNSA 1QL7A 1FZZA 1Z1JA 2Q6FA 2ZGJA 3ITIA 1O3AA 2H5CA 2ZFQH 5DPAA 2VVVA 1F92A 3E91A 3B8JA 5E2PA 4NZQA 6LPRA 5DJ7A 1O3GA 1T4UH 4AN7A 4MTBA 1RGQA 3EDXB 1ZYOA 2NU2E 3AW0A 2G55A 3RXLA 4FVBA 3VPKA 2BMGB 5EQSA 3TK6A 1ZTJA 1GI7B 2IOTA 4X1RU 1P2KA 1YCPH 1C5NH 3MH6A 1OS8A 1AHTH 3UR6A 2PGBB 1O2TA 3DT0H 2VIVA 3UUZA 2CXVA 2NU1E 3NZIA 2CJIA 1IQGA 3MWIU 4SGBE 3E16B 2ZGBH 1BMAA 2VIPA 3B23B 3GCHC 3ZVEA 3C1KA 1DUAA 1MCVA 1N6YA 2QXIA 1GMDF 3AVZA 4RKJB 2FZZA 3P8FA 4I8LA 3A89A 1HBTH 1BT7A 1F0SA 3OTJE 2K1QA 1ELVA 5JBBS 1SC8U 1HAHH 2FOHA 3QZQA 1AGJA 2OP9A 1EPTB 3ZZ4A 4I31A 2UWLA 4F4OC 2D1JA 1AO5A 1C2LA 4VGCC 1ETTH 3KL6A 1GBJA 1HLTH 3LGVA 1GI3A 1TQ7B 3A8BA 1CE5A 3MO3A 1UTJA 3K65B 2QXGA 2BYAX 5JB9S 3DD2H 3NKKA 1TX8A 4XSKU 1MD8A 5F8ZA 1OSSA 2ZP0H 1FN8A 3ZZDA 1BMMH 3A7ZA 5T6DA 1L1NA 7KMEH 2CV3A 1IOEA 4XBBA 4QT8C 1DLKB 1P05A 3ZVDA 5L6NH 2F9NA 3S0NA 1QFKH 1MKXK 1HUTH 1V2KT 3MNXA 1KSNA 3TH2H 3FAOA 1V3XA 1KYNA 1MTNC 5HM2A 2QN5T 5T6GA 2AS9A 4ABIA 2AMQA 1HAGE 1O2OA 3DFLA 5GCHF 4A1VA 2ESTE 4A1XA 1ELDE 3HGNA 1YPHC 3BN9A 3MOCA 4X6NA 3SNCA 5AFYH 5HGGA 3VB5A 2CF8H 1WV7H 2P3FH 2R9PA 3JZ1B 3TGIE 4HGCA 1P0SH 3PWBA 2BZAA 4JZDH 5J4SA 2R0KA 1O2HA 1XXDA 2FX4A 3PMBB 2FDAA 2SNVA 4X1NU 3DHKH 4TWWA 2XBXA 2EI8A 3MTYA 5C5OA 1TAWA 4TY7A 1C1QA
chains in the Genus database with same CATH superfamily
4R8TB 1D6RA 1EXFA 2GCHG 3OFND 1F5LA 1NO9H 1ETSH 1NFXA 4FUFA 4HTCH 3ATWA 1Y3YA 1UVPA 3SU0A 1HYLA 3P6ZB 4FOUC 4YOIA 3SBKA 4LXBH 3NPSA 1EB1H 3PWCA 4JZIA 4UFDH 3SOSA 3VB6A 4NIWA 4GLYA 2BD2A 1YPEH 2ZDMA 3UFAA 3RUOA 4LOYH 4JZ1A 1GBHA 2CHAB 5GPIB 1A2CH 1XUIA 1IQMA 2WZQA 2FI5E 2BDCA 3QX5H 1DM4B 3UY9A 1WYKA 2SNWA 2P16A 2UUKB 1NT1A 1Z6EA 2ZZUH 3LOXA 1O2YA 2WINI 4AYYB 4RKOB 1K2I1 1SFQB 3RXOA 1K1JA 4YOJA 4NWLA 5DKMA 1P2QA 1TPSA 2TIOA 5GDSH 3U1IB 5C20A 5C5NA 4X2YA 2W7SA 1DY9A 3T27A 5AHGH 1A5HA 1OWKA 1RD3B 1C5TA 2G8TA 4AFUA 4BTTB 1D3PB 1K1IA 2ZGHA 2QF4A 2HLCA 3SJIA 4YZUA 1W2KH 1DDJA 3N7DA 3F0PA 1NPMA 2LNCA 3RXJA 3QTVH 1TA2A 2GZ8A 1YPHE 2BZ6H 1H9LB 1COWD 2A4GA 1CT2E 1EASA 1RTFB 5B6OA 2F43B 1C2HA 3B9FH 1RIWB 1Z7KA 2V3MA 1BTXA 1N1LA 3UR9A 1J9CH 1O36A 3MYWA 3ODDA 3Q3YA 2WPHS 1PQ8A 1SLVB 3A88A 5FCRA 3STJA 2PKAB 5DP9A 2VWNA 2KCPA 3UOUA 1GMDG 1QA0A 3H7OA 1C2GA 1GL0E 3OY5U 2JH5D 1GMCF 1UK4A 2CGAA 9LPRA 1DSTA 1OWHA 2I6SA 2WPJS 2XNDD 1M9UA 1GJ8B 2RA0A 3OU0A 1LVOA 2BQ6B 3RU4D 1SGDE 1QGFA 2BD9A 5H4IB 5EW2H 1ZTKA 1EFRD 2FLRH 1LHCH 4AFQA 3Q3XA 3D62A 3EA7A 5C1XA 1NZQH 1LMWB 5IK2D 4HG6A 4HZHA 1KXDA 1QJ7B 1O3OA 3D23A 4IMZA 4M9FA 1V2RT 1TB6H 1E0FD 5K0HA 2CMYA 1P09A 5TCCA 4X1SU 1NM6A 1BJVA 1W8BH 4MNYA 1O2MA 2LP6A 4Y10E 1FQ3A 1ZOMA 3ZV9A 4I86A 3I78A 3RM2H 1TWXB 2PUXB 1EUFA 3SNDA 1C5ZB 1A5IA 2YMSC 1ELTA 3A8DA 1C5WB 3A7WA 5TJXA 1O3MA 3PMJA 2FOAA 5GCHG 3RXPA 1IQIA 1ZHPA 1DWBH 5AF9H 3BG8A 3ZYDA 1TRNA 4GCHG 1ID5H 1AVWA 1HJAC 2ALVA 2ZCLP 4WY3A 4YT7H 1ETRH 3SYJA 1ELGA 5F53A 1A0JA 1FY5A 2FS8A 1PFXC 2ZQ1A 2C8WB 5EPNA 2Y6TA 4UDWH 2FI3E 1B0EA 2ZIQH 3QZRA 3TH3H 1P2OA 1NBMD 1QY6A 3HPTB 1GWAA 3I29A 3IITA 4AFZA 3ZZ7A 2HLDD 5CMXH 2C3SA 1ARBA 2ZI2H 1MBMA 1ZRKA 1C5OH 2ZCHP 5HMAA 1D3DB 2PKSC 3KIDU 2VGCB 1O3CA 1QURH 1SQOA 3KCGH 5K7RA 2WV5A 2QY0B 1ZGVA 8LPRA 1YGCH 2A7HA 2UWOA 4HI3A 3M61U 1OPHB 3KHVA 2BD7A 1ZPZA 5LPRA 2NWNA 4ISNA 2XRCA 4FUJA 3GCTG 2H5DA 2HNTF 3MU4A 3RXTA 5DSFA 4Q63A 2R2WU 4D9QA 2WPIS 3P8OA 1ZZZA 1P2JA 4Y7BA 3E0PB 3SI4H 1GJ6A 2VVCA 1O3PB 4GHQA 3R0FA 2GJGA 1F0TA 1EATA 5JBTA 1YBWA 1JIRA 1DSUA 4IW4E 4FUCA 3QTOH 2YMSD 1O2QA 2C4FH 3M7UA 3ZZBA 4BAOB 3PTBA 5EXMA 3ZZ5A 1C1NA 4BTIB 3ATKA 4CBNA 4JZFH 2PW8H 4NGAH 1QZ8A 1TABE 1S84A 4CRAA 2Z9LA 1O35A 3FO8D 1SQTA 1CA0C 3IWMA 1O2UA 2TGAA 1F0RA 3BG4B 1NN6A 4NIXA 1LVMA 2Z3CA 2A4OA 2HGTH 2ZTYA 1Z71A 2F9VA 2G81E 2W6JD 4B73A 1UJ1A 7LPRA 2JETC 4D7FA 3GY7A 4Y79A 3LPRA 2GCTC 3DSOA 1MD7A 1HIAB 4KELA 3TJVA 3PLPA 2A5IA 2ZGXH 1GGDC 3GCHB 1Y5AT 4YLQH 1KTSB 1OP2A 4MDSA 3SORA 2BXTH 2CN0H 2GV7A 4NSVA 2G52A 3SN8A 1OHHD 1LVBA 3NCLA 3SHAH 1FUJA 1TE0A 4B75A 3P17H 1XVMA 3RC5A 3BTHE 1ANEA 5FL7D 2Y80A 1P2NA 1NRPH 4Q4LA 2I6QA 3A86A 3BF6H 1WSSH 3U8TH 2FOMB 1G3CA 2A4RA 1GMCG 1ZPBA 2HNTE 2P59A 2O8UA 5LPFA 4ZAEA 1UTNA 1TRMA 4VGCB 1GI9B 3TJUA 1TBRH 1BTZA 5IDKA 2A2XH 2EEKA 2P94A 1P3CA 4Q2KA 5EXLA 5EJ1A 3RXKA 1AKSB 1C2FA 2BLOA 3LT3A 4IC6A 5C2ZA 2BY8X 1KLIH 2VWOA 1SGRE 2VJ1A 3BEUA 4GSOA 3T28A 2ULLA 3TU7H 1OYQA 1TNJA 3GY6A 4ASUD 1AQ7A 2J98A 1C9TA 1P3EA 3SNBA 4DJZB 4BAHB 3SV7A 1FN6A 2GV6A 2ZHDA 3RLWH 3VEQB 2ZFRH 1IQKA 2EI7A 3V12A 1F7ZA 1AWHB 4KKDA 3LGTA 2FOBA 2ZDVH 1BBRE 4ZHMU 4AORA 4UFFH 1TBQH 2QA9E 1RS0A 3RU4T 2WPLS 1SMFE 7ESTE 4XRNA 2RCEA 2V3OH 1KXCA 1CHOF 3L33A 3SU6A 4B71A 1EP5A 3N7OA 5EJZA 1TMTH 2AIQA 2P93A 3RXMA 1NY22 8GCHG 2YNBA 2M5TA 1GVZA 1V2TT 3RXQA 1W13U 2XNIA 1UCYK 2JIZD 3PRBA 2G00A 1ZSKA 2P8OC 1ZMJA 1HAPH 2KAIA 5BRRE 3EGKH 2OQUA 3F9FA 2FS9A 3SU3A 3TJNA 1ABIH 1TGBA 2AYWA 1DWDH 4GAWA 3EAJA 4AZ2B 4P00A 1GDQA 3TLOA 2ZU5A 1LQEA 3FZDA 4FVDA 2PSYA 4D9RA 2HVYB 5JYIA 5B6LA 4CH2B 1Z6JH 1QL8A 3NRLA 1BTUA 4ISLA 3SNEA 1GJ9B 5E0JA 5CHAC 4A5TS 1GI6A 1AVGH 2L74A 1KXAA 3FFGA 2C8XB 1WTGH 4WVPE 1FY1A 1TMBH 5LPEA 1GCTC 1O3HA 1BRBE 3TPIZ 1O2VA 4U01A 3LC5A 4A6LA 3T2NA 2QGRA 4FUHA 1O3BA 3U69H 1OP8A 5DP6A 2OUAA 4ABAA 2QCYA 1KXBA 2BX4A 1DWEH 3ODFA 1ABJH 2BDGA 2QAAA 3L6PA 1O3DA 4ZKOU 1GMHG 1MKWH 1SLWB 2ILNA 3GY8A 5IYTA 2B8OH 4INHA 1BTHH 3SW2B 2FLBH 4ABDA 4JK5A 2WPDD 1BIOA 3DCLA 1C5XB 1ZSLA 2R0LA 2G4UA 4DY7B 2VWLA 4Z1MD 4YTAA 1A3BH 1W3CA 5GNDA 1UHBA 1TOCB 1ZJKA 4FUGA 4ABGA 2ZDLA 1FY8E 3WW7A 1BA8B 3QUMP 1NU7B 4TWYA 4JCNA 4Y76A 1KTTB 4AG1A 4AB8A 1P10A 3WWBA 2OLGA 2QXHA 3E1XB 1O5GH 4O3UA 1C1RA 1LKAA 1YWUA 4WXIA 2ZU1A 1GBLA 1O5BB 4K69A 1K28D 1FPCH 1Y59T 3PLBA 1NRRH 2J95A 3AAVA 1NTPA 1GBBA 1G2MA 1T31A 2ZNKH 2ZHQH 1F5RA 5F8TA 3AAUA 1S6LA 5GWZA 2Y7XA 3A80A 3SU2A 1TNLA 4ZKSU 3TH4H 3ZV8A 1YLCA 3FP6E 4YOGA 2CK3D 4CRFA 3KQEA 1SGEE 1FNIA 3E90B 3LGYA 1P01A 4DT7B 7GCHF 2EQNA 1CBWB 4GUXA 2FM2A 1THRH 4K1EA 4RI0A 3ZVBA 1LHFH 1BHXB 4I8KA 1SG8B 4I8JA 4YXWD 1HXFH 3O8CA 4AFSA 2XCFA 3URCA 1RTLA 1ZLRA 3UIRA 1EZXC 2TGTA 4OS5A 1HAVA 2SGEE 1XMNB 2BY7X 1QBVH 3MU5A 3KQBA 4P02A 1DLEA 1WBGB 2F9BH 1Q2WA 4NIVA 4XBCA 1PQ5A 2YMSB 4K1TA 1O2GH 1CGIE 4TYDA 1UTLM 4U30A 2ZU3A 1Y3XA 4FUDA 1XM1A 3N99A 4WF8A 4X0WU 1TPAE 2H2ZA 4D76A 5A8XA 6CHAB 1P11E 1C5PA 2VB0A 2KCAA 2BQ7B 3GOVB 5DP4A 3M3TA 1PJPA 3W94A 4B6EA 3NXPA 3UNQA 1LQDB 4WMFA 5TCAA 3CS0A 1TGNA 3F2GA 2BXUH 3BIVH 4WMEA 4WH8A 1TALA 1BTWA 2GMTC 1EP6A 2QV1A 3U9AH 5C1UA 1UTOA 1C5SA 2F9PA 2QXJA 2VVUA 2ASUB 3QGJA 2BTCE 2O8TA 2ZF0H 4ZKNU 2OD3B 1HJ9A 3SGAE 3A7TA 2FO9A 2TGPZ 3HATH 1V2LT 4FU7A 2IJOB 4Q7YA 3F1SB 5DP3A 3KEEA 2EA3A 1DUEA 2XOKD 1AFQC 1G3EA 3FVFB 1O32A 2Z3DA 2BOKA 4TPIZ 2A4QA 1GJBB 1C1TA 1GG6B 2CF9H 3SJ9A 2F91A 1ZMNA 1FJSA 8ESTE 4I7YH 2Z3EA 1YPGH 2ZPSA 1O39A 4B76A 1DICA 1VGCB 1W7XH 4X2XA 3P95A 2ZHWH 1L0ZA 4Y8XA 3N7EA 1UTPA 1GHAF 5F8XA 1K0HA 4GPGA 4DIHH 4E7RG 1UTKA 1GDUA 1V2NT 5DO4H 1IQHA 1Y8TA 4MVNA 4AGKA 3U8OH 1HAYB 1KXEA 4ZXXH 2Y5FA 4MQAA 1YPJH 1G32B 3LONA 1AE8H 1MCTA 2IN2A 3D65E 1H9IE 1SLUB 3G01A 3OY6U 3CNRA 3W1EA 4CRCA 1DS2E 4CH8B 2H9HA 3DA9B 2BDBA 5G4BA 1O2RA 1IQNA 3SV8A 1O31A 2OBQA 1QHRB 3ZZAA 1AE5A 1BBRK 1HXEH 3S9CA 4YT6H 2BD3A 2DUCA 1TLDA 3VXEH 1BRUP 1BITA 2IPQX 1E34B 2HALA 4K3JA 1Z8JB 3A8CA 1PYTC 1GVKB 4WXVA 1TQ0B 1W0JD 3ENSB 1KDQA 1MTUA 4INKA 1GI2A 2LELA 3PV2A 3TK5A 3A82A 5EQQA 3FOAA 1FPHH 4BXWA 1CO7E 1V2JT 3RMMH 2GD4B 3RM0H 3S7HB 5DN6D 3SNAA 3M5MA 3U98H 2NU3E 1TYNA 3LJOA 5DK1A 1CT0E 1MH0A 3IG6B 3M3VA 3CP7A 2G5VA 3M7TA 2ZTXA 4X2VA 1T4VH 2FODA 1UCYE 2F4LA 4IN2A 3T26A 2Z94A 3OEHD 4FUBA 2ZHFH 1HFDA 1SBWA 3BTWE 1IQJA 2JH6D 3RXDA 1AMHA 3UNSA 3F9GA 4K1SA 4BNRA 1LTOA 1W0YH 3VB7A 1TBZH 4A92A 3E8LA 2XBYA 1YPMH 2B9LA 1VZQH 4ACAA 1G9IE 3BTGE 1N8OB 2OC7A 7GCHG 1O2SA 1P57B 2BVXH 3F2FA 1OWJA 1BQYA 4XDEA 3QWCH 3GDUA 3H5CB 1MKXH 1V2UT 1NU9A 1LPKB 1O3IA 4B2AA 2D26C 1VCQA 1GHBF 1KY9A 2KR7A 1KXFA 1VCWA 4FU8A 2FESH 4X6PA 1C5LH 4NA8A 4D7GA 2SGPE 1QA7A 2GT7A 2ODYB 3QLPH 4BAMB 5C67A 1TA6A 2STAE 3M3SA 1A61H 1ESBA 1PYTD 2HOBA 5JBAS 2XW9A 4HFPB 1GJDB 1T8MA 1ZMLA 2ZDAH 3RU4E 3M37A 2RFKC 3RXHA 3A85A 1XKAC 1K9OE 4CHAB 1LKBA 1EAWA 2JJ1D 3TIUA 1FX0B 1GPZA 4CRGA 4OGXA 1C2KA 2R3YA 1Z8RA 1BHXF 2ZU2A 4Z6AH 4B2BA 2BX3A 1W12U 3H7TA 1BMNH 3K2UA 1XX9A 1K1LA 1V2OT 3MMGA 4UEHH 4ABEA 2BDAA 1V2MT 3MNSA 3PB1E 5EQRA 1WTHD 4E06H 3BSQA 1C5QA 3SJOA 1MABB 1EKBB 1XKBC 1EPTC 3EA8A 3HKJB 2ZFFH 4H6SB 1O2LA 2P3TB 1P02A 4MNWA 3LKWA 2W7UA 1NRQH 5T1VA 2ZWLH 5CHAB 2OC0A 1G3BA 1K1NA 2JKHA 1ZHRA 2NU4E 2O8MA 1C5UA 5ESBA 3LJJA 1L1JA 1GJ4H 4X1QU 2ZEBA 2VINA 2IJD1 2AERH 1D4PB 3OE7D 4WWYA 3WWFA 2P95A 3E6PH 3OSYA 3BEFB 1ZHMA 1D9IA 2YNAA 1P04A 5FPSA 5FXLA 2FMJA 1ANCA 1A0HB 2BY5X 4ZKRU 1C5VA 3W95A 6ESTA 1GHAG 1DFPA 1HAZB 3D49H 1ACBE 2SGQE 1RXPA 3H09A 2GTBA 2RDLA 3SHCH 4DURA 1JOUB 1NFUA 1NBME 1H4WA 1P9SA 2R2MB 2F9UA 1KLTA 3I77A 1C1VH 1O3LA 2ZFSA 3FZZA 3V7TA 1JXPA 1C4U2 4E7NA 5I25A 1O5AB 5PTPA 3MH5A 3ZIAD 1QRWA 1CVWH 2BOHB 4WH6A 5EODA 3GISB 1ZGIA 2G51A 3RC4A 1K21H 1MZAA 1TX7A 3GYMA 1E36B 1GI1A 3F9EA 2XC4A 1BRAA 3VGCC 2J4IA 1EOJA 1TRYA 3KQCA 1LHGH 3GICB 2ZDNA 1HDTH 4CRBA 2ZU4A 5C17A 4K5ZA 2RDEA 5EGMA 3UPEA 2JH0D 2KCOA 4NCYA 4NSYA 1HNEE 5JPMH 3ATIA 1EQ9A 5DP8A 1O37A 1GI0A 2D2DA 3JZ2B 1HB0B 2C93B 4FETA 2UUFB 3F2HA 4X8VH 5FBEA 1VJ9U 4KGAA 1P03A 1A3EH 1GBEA 2BD8A 3KQ5A 1OXGA 1AZZA 3DFJA 2ODQA 1MAXA 1SL3A 1VKYA 4K8BA 2CHAC 3ESTA 3OAAD 2ZECA 1BCUH 1A5GH 4NFEA 1VITF 4NFFA 2JDID 1MTSA 2ZFPH 5HYOA 4DCDA 2ANWA 4AGJA 4WJG2 5FPTA 4OS7A 4B1TA 1YC0A 1DOJA 1Y5UT 1P06A 1O2WA 1TX6A 2HWLB 3UNRA 1GBIA 1TNGA 2GX4A 2J98B 4CR5A 2O8WA 2A45B 3RXUA 1W0KD 3SGQE 2A2QH 1QL9A 4F48B 3C27B 2AHME 3RC6A 1BDAA 3RMNH 1O38A 5C0TA 1XUGA 2KZ4A 4PROA 1GBTA 1E1QD 2KX4A 3HGPA 2WPMS 3NK8A 1BOQA 1Q3XA 3QGNB 1OKXA 2AMPA 4H4FA 3GDVA 1HGTH 1D3TB 2STBE 1JIMA 5AVDA 1D6WA 2Z9KA 2Z9IA 1SLXB 2GGVB 3SUDA 1S83A 1EJMA 1T7CA 1PPHE 1TMUH 4ZMAH 1C2MA 1RIWC 4MNVA 1F0UA 2FPZA 1GCDA 1Z1IA 4UE7H 5A0AE 1A0LA 1MTNB 2W5EA 2BLWA 2OBOA 4SGAE 1SQAA 1P8VC 4X2WA 1SPJA 1SFIA 1O2PA 1C9PA 1S81A 1DE7H 1YCPK 4GHTA 4AG2A 3K9XB 1O3EA 3SZEA 2KAIB 3NUMA 3QO6A 4H6TA 1FMGA 1IAUA 5E0GA 3CS7A 1W11U 1AFQB 1K22H 1ELFA 1GJAB 5FX6A 1VR1H 1PQAA 3R3GB 2UUYA 2BVSH 1GBMA 2Q6GA 3SQHE 1ORFA 4CBOA 4JYTA 3V3MA 5A2MH 2SFAA 1UK2A 2K0QA 4O03A 5SGAE 1EOLA 1QQUA 3SU4A 2VBCA 1UVSH 3RXEA 4ISOA 3ZVAA 2THFB 1WU1A 3ZVFA 2GDEH 3KNXA 1J16A 2Y5HA 4AYVB 2OQ5A 5DP5A 1FLEE 4MPUA 1BUIA 1HV7A 1Y3WA 3O8BA 2FXRA 1S0QA 4IBLH 1GI5A 2OC8A 3LGUA 1TPPA 1G2LA 2HVXA 4Y71A 2PSXA 1ZRBA 4OS2A 1AY6H 5E0HA 5EU8A 1QJ1B 3EQ0H 3MH4A 4NWKA 2ODPA 2WUCA 4ESTE 1K1MA 5EPYA 2DE8A 3RXVA 3U1JB 1SGYE 1SGCA 1LPGB 1C2IA 1U6QA 1H8IH 1TNKA 5DP7A 1SHHB 1ESTA 1SGTA 1ANDA 4Q7XA 3M5OA 1HRTH 5F6MA 1UHBB 1DWCH 1CGHA 2ZCKP 1B5GH 1UK3A 4Q80A 3A84A 1O5CB 2J5UA 1GBCA 1AFEH 3AW1A 3FANA 2O8LA 2ZA5A 3ZZCA 4Y0ZE 2ZC9H 4Y0YE 5E2OA 1UMAH 2BM2A 4TPYA 2VGCC 1MZDA 3M5LA 2QF3A 3PM3A 3RMLH 4JMYA 3MO9A 2A7JA 2ZPRA 1SHYA 1T8LA 4DVAU 3OX7U 1UTQA 5ABWA 3RXIA 1K1OA 3TGJE 1HAOH 3PLKA 2GZ9A 2WHXA 3S9AA 1ELCA 3S9BA 1BTYA 3SGBE 4Y8ZA 1O2ZA 3BTDE 2A7CA 3VB4A 2AGGX 1AVXA 2J97A 2H9TH 1EAIA 2TRMA 5GJ4B 4NG9H 1VITG 3BTQE 4J1YA 4LZ1H 1QNJA 1A1RA 3GY5A 4TT3D 1MMJN 3KGPA 2HRVA 1GL1A 1N6XA 3WY8A 5LGOA 4BTUB 3UREA 1EJAA 1H9HE 2M2AA 4UFEH 3BEIB 1OX1A 2XC5A 1HAVB 2WV9A 2XWAA 1GHYH 2XWBI 3BIUH 2QC2A 1S6FA 1O5EH 3LH1A 1CSOE 2F83A 4E05H 3E3TA 2BDIA 2H6MA 3BG4C 1SI5H 4INLA 1MUEB 3MNBA 3S69A 1T32A 3QN7A 3V13A 3CENA 2LPRA 3HK6B 1AUJA 1JRTA 5FAHA 3SUGA 1YCPM 1O2XA 1FAKH 2OXSA 2VIDA 3SQEE 4O3TA 1YP9A 4O9VA 3UWJH 1OYTH 2TBSA 1L1GA 1G3DA 1AN1E 1RRKA 1SGFG 2FYQA 2VIOA 1UCYH 4CREA 4ZHAA 1SGPE 3LH3A 4M7GA 1QIXB 3UWIA 2AGIX 1DT2A 1YM0A 4AOQA 1AZ8A 3TITA 2Y5GA 1O33A 1EZQA 3PO1C 3OYPA 1C1UH 1HJAB 4ZHLU 1ZPCA 3KN2A 4LK4A 3MHWU 1O0DH 2FIRH 4I33A 4NA7A 4X6MA 1FI8A 4DW2U 1SGIB 1CHOG 1V2QT 1NRNH 1CQQA 1GBAA 1DX5M 3GCOA 1GHZA 1GHWH 1BB0B 1ELBA 4AX9H 5JB8S 2WPKS 3A8AA 2ZG0H 3T29A 4D8NA 2AEIH 2PKSB 1EPTA 4BAKB 2W26A 1EX3A 3VG8A 2Z9GA 4ACBA 3M35A 4JYVH 2HPQH 3AK5A 1IQFA 2VH6A 4KTUA 2G5NA 4LZ4B 1LO6A 1ZSJA 1O3NA 1PPGE 4KTSA 3RXCA 3UQOA 1EAUA 4GCHF 1XUJA 1ZJDA 1GI8B 1Y3VA 2Y7ZA 1QRXA 3BTFE 4DOQA 2BQWB 5A8YA 2QIQA 1JRSA 2UWPA 1D3QB 5ESTE 6GCHF 1O2KA 5T6FA 3MU0A 2DE9A 1CT4E 3ZZ6A 1WQVH 2J92A 2XTTB 3TGKE 3VGCB 2BLVA 4XBDA 1G36A 4X8SH 2W3KA 1W14U 5L2YH 1NESE 2AGEX 2PWXA 1HJ8A 1OWEA 4Y7AA 5HIYA 1C1WH 2G4TA 4BOHA 1GJCB 3MNCA 3SO3A 4DT4A 1MQ5A 1TFXA 5DGJA 5L30H 1ARCA 1KDQB 1O2IA 1CA0B 2V3HH 5A09A 2OC1A 1GI4A 3KYGA 1IQLA 5AFZH 1AB9C 1UVOA 4MPXA 2PUQH 2ZFTA 2RA3A 3GCTF 1AD8H 4B74A 4DIIH 3A87A 2B0FA 1ZR0A 3ZZ8A 2QYIA 1QB9A 2F3CE 5F03A 2JETB 3QK1A 3ZVGA 2GCTB 1S5SA 1A7SA 2ANYA 3SV9A 1LDTT 1LCYA 3F68H 3U28C 1V6DA 1B7XB 2H9EH 1VJAU 1GGDB 1YF4A 1BZXE 5GIBA 1UTMA 1MQ6A 2QE7D 2WYJA 1P9UA 4Z0KA 2OCVB 1GBDA 1AI8H 3A81A 2TGDA 1FIWA 3F9HA 2FP7B 4THNH 1OOKB 1H8HD 4X1PU 3P92A 2PTNA 1TGCA 1HPGA 3P70B 4YESB 3MU8A 2A1DB 1C1SA 2H1UA 1WCZA 2ZKSA 3NWUA 2ALPA 1MBQA 3RLYH 1FY4A 1C1OA 1A46H 2GP9B 4I8HA 4BXSA 3SUEA 1WDIA 1LVYA 1YPLH 2KFWA 1C1MA 1XXFA 2F9OA 1NFYA 1FDPA 2A5AA 2FTLE 2PV9B 1P2IA 1UVTH 2VU8E 3GCNA 4O97A 4Y11E 4B2CA 2IPHA 2W6ID 3M5NA 1GVLA 4JK6A 5FX5A 2BD5A 1LPZB 1O3FA 3Q77A 1DY8A 3LDXH 5HXFA 3GS9A 1V2PT 4F55A 1HAIH 4MG3A 2AH4X 2V35A 4Y6DA 3Q00A 3M7QA 4UD9H 3ZVCA 1GDNA 4X8UH 5CDFE 1CU1A 2V0BA 2BHGA 3BTEE 1CA8B 3RP2A 3PV5A 1E35B 4XD7D 3EYDA 1JMOH 1MU6B 3LGIA 3LU9B 4MLFB 3RDZA 4IC5A 1DITH 1TPOA 1V2VT 3STIA 1O34A 3K6ZA 1WUNH 1T8NA 4DGJA 2FYRA 1SGFA 1GBKA 1TNIA 1KLJH 1QBNA 1DVAH 1PPZA 1YYY1 2PKAA 3T62A 4ABFA 1CBWC 3RXGA 3RXRA 1EAXA 1C4Y2 4CR9A 2P8OB 3LIWA 5KEDA 1BRCE 4ZUHA 2BD4A 3PYHA 3SU1A 1WXRA 1ESAA 3UOPA 1W7GH 3PROA 1C5RA 4MNXA 1L2EA 1DXPA 3HKIB 4U2WA 1O3KA 2P3UB 5HKKD 1FXYA 1THPB 1FIZA 3K6YA 1LHDH 4UFGH 2AIPA 4NIYA 2Z6BD 1NRSH 4YLUA 5EOKA 2PLXA 4MPWA 3MQKC 5T3HA 1EZSC 4XOJA 5KGOA 2HPPH 2FTMA 5CE1A 1LHEH 1S82A 1QCPA 4I8GA 6CHAC 3EE7A 4ZH8A 1QQ4A 1C5YB 3PV4A 4FUIA 5J4QA 1GCTB 5FPYA 1HAXB 4OS6A 1SGNE 2KM0A 1C4V2 1C2EA 1WAYB 3UB0A 8GCHF 1BBRH 2BY6X 3ZZ3A 3VFEA 1Z8IB 6GCHG 2QF0A 4ZXYH 3RMOH 1Q31A 2A31A 5I46H 2XBWA 5A0CA 3A7XA 3Q76A 2C90B 4F49A 3BTME 1YLDA 2R3UA 1AWFH 2GZ7A 3KQDA 1SVPA 3M36A 4DG4A 1O30A 1O2NA 4MPVA 4NZLA 2AMDA 2WUBA 3BTKE 3Q3KA 3O8RA 5EIYA 1JBUH 1S6HA 2HNTC 1UVUH 2J38A 1VITH 2PTCE 2YOLA 1J14A 5A0BA 1J15A 1XVOA 4X6OA 4CRDA 5A8ZA 2ZTZA 1GHXH 2GVFA 4KP0A 4ABHA 3UQVA 3GY2A 1X7AC 1GBFA 4ZROA 1FONA 1TNHA 4ABJA 2XBVA 4R0IA 3DSGA 1GG6C 1MAYA 1PPBH 1THSH 2V7QD 4ASHA 2VIQA 3V0XA 4BAQB 2VH0A 3SUFA 2A32A 3TJOA 2ZO3H 1V2ST 4JZEH 4XE4A 1C2JA 1VCPA 1NS3A 1QB6A 2Z7FE 4A7IB 1VGCC 2TPIZ 1OWIA 1WOFA 1EZUC 2BDHA 4X8TH 3RXBA 2OINA 1BMFD 2RG3A 4IN1A 4AC9A 1OP0A 3UTUH 4ZCNA 1P12E 1IQEA 1O3JA 2PR3A 1A4WH 1GMHF 2PP6A 3A83A 1RJXB 2EC9H 5LH8A 3FP8E 2C8YB 2C8ZB 3GYLB 4UONA 1PPFE 4RT1A 5C3NA 2FX6A 2FWWA 1MTVA 1NROH 1S85A 3EE0B 1KIGH 3SJKA 4NA9H 1CGJE 4YO9A 1HCGA 1QR3E 3O8DA 8KME2 1FV9A 4IGDA 2W3IA 1W10U 1C5MD 3MFJA 1T8OA 1SGQE 5ETXA 3GY3A 1INCA 2SGDE 1IHTH 2VIWA 4Q7ZA 1BMLA 4OGYA 1NFWA 1J17T 2FOCA 2ZDKA 4GVUA 2UUJB 1TGSZ 3F6UH 1ELEE 4OS4A 1MKWK 3A7YA 2ZQ2A 5EXNA 1DANH 1TGTA 1ZTLA 2B5TB 3BV9B 1H1BA 5CHBA 2J9NA 1E38B 2XXLA 2JJ2D 2AFQB 1JWTA 5EG4A 1GHBG 1J8AA 1UO6A 4ISHH 2PFEA 1EB2A 1NC6A 1PPCE 3PO1B 3RXAA 1C1PA 2XCNA 2OTVA 2J94A 3SV6A 1F5KU 3MU1A 1SR5C 2J2UA 4IMQA 1HIAA 5FCKA 1F2SE 1O5DH 3A7VA 2BVRH 4BANB 1BTPA 4K2YA 1B0FA 2XYAA 3SJ8A 2O9QA 1MU8B 3PMHB 2GMTB 3SU5A 4ABBA 2SGAA 3VXFH 1P2MA 4OM9A 1N8OC 5JBCS 3QDZB 1IHSH 2FOEA 1G37A 2PHBA 2WV4A 1W0ZU 2D8WA 4I32A 2EI6A 5EJLA 4K60A 4K8YA 4A1TA 3FP7E 2NU0E 2Y82A 2ZPQA 2ANMH 1ANBA 4KTCA 4AB9A 1YPKH 2L6OA 3L3TA 1QBOA 3ZZ9A 1AKSA 1DPOA 1XUFA 3ELAH 4H42U 3MO6A 2EY4C 1SSXA 1YKTA 2Q6DA 2Y81A 3ATMA 3E0NB 2B7DH 5L2ZH 3FKSD 1CHGA 5HIZA 1TOMH 3RXSA 3SI3H 5DG6A 1QJ6B 1SB1H 3LGWA 2ZGCA 1E1RD 5HM9A 3ATLA 4FU9A 1RFNA 4U32A 1K1PA 3P8GA 2VWMA 1RTKA 1O5FH 3S7KB 3PTNA 5EW1H 4B6FA 2BB4A 1AUTC 5E8EH 4CHAC 2BY9X 3TVJB 3GDSA 3EA9A 5BPEA 1GJ7B 2FOFA 3TNTA 1E79D 4RN6A 3FN8A 1DXWA 3RXFA 2Q1JA 3MH7A 3UAIC 3DUXH 2PGQB 1TIOA 1AIXH 3DSPA 3BTTE 1PPEE 2BDYA 4FXGH 1E37B 2A0QB 1AB9B 2FEQH 2J34A 3SZNA 4OS1A 1FAXA 3GY4A 2VNTA 4XFQA 1Y5BT 4YM9A 1GHVH 2FOGA 4WMDA 2WYGA 1G30B 3HK3B 3OEED 5GXPA 1OWDA 3U8RH 2OK5A 1L4DA 5JDUB 2GCHF 1V2WT 4JYUH 2FI4E 3T5FH 9ESTA 1S0RA 4Y8YA 1SOZA 1XUHA 4IS5A 3URDA 3KF2A 1EJNA 3LC3A 1TONA 3PMAB 4ISIH 1WQSA 2GT8A 3T25A 2BLQA 2XC0A 1Z8GA 4RSPA 1L4ZA 4TY6A 5FHTA 2V6NA 3VB3A 1QTFA 1SOTA 1FY3A 2SGFE 1H8DH 1MTWA 1O2JA 4FUEA 1GJ5H 3P8NA 1AU8A 2ANKH 3AASA 3SV2H 3TK9A 2A5KA 2GDDA 2GKVE 1PQ7A 5C1YA 1BJUA 5FBIA 1QB1A 1C2DA 3ZYEA 1XUKA 1Y3UA 1ELAA 2Z9JA 2ZHEH 4J2YB 1QRZA 3MI4A 3TNSA 1QL7A 1FZZA 1Z1JA 2Q6FA 2ZGJA 3ITIA 1O3AA 2H5CA 2ZFQH 5DPAA 2VVVA 1F92A 3E91A 3B8JA 5E2PA 4NZQA 6LPRA 5DJ7A 2KCYA 1O3GA 1T4UH 4AN7A 4MTBA 1RGQA 3EDXB 1ZYOA 2NU2E 3AW0A 2G55A 3RXLA 4FVBA 3VPKA 3PRDA 2BMGB 5EQSA 4TSFD 3TK6A 1ZTJA 1GI7B 2IOTA 4X1RU 1P2KA 1YCPH 1C5NH 3MH6A 1OS8A 1AHTH 3UR6A 1O2TA 2PGBB 3DT0H 2VIVA 3UUZA 2CXVA 2NU1E 3NZIA 2CJIA 1IQGA 5C94A 3MWIU 4SGBE 5KECA 3E16B 2ZGBH 1BMAA 2VIPA 3B23B 3GCHC 3ZVEA 3F3BA 3C1KA 1DUAA 1MCVA 1N6YA 2QXIA 1GMDF 3AVZA 4RKJB 2FZZA 3P8FA 4I8LA 3A89A 1HBTH 1BT7A 1F0SA 3OTJE 2K1QA 1ELVA 4RT0A 5JBBS 1SC8U 1HAHH 2FOHA 3QZQA 1AGJA 2OP9A 1EPTB 3ZZ4A 4I31A 2UWLA 4F4OC 2D1JA 1AO5A 1C2LA 4VGCC 1ETTH 2K8IA 3KL6A 1GBJA 1HLTH 3LGVA 1GI3A 1TQ7B 3A8BA 1CE5A 3MO3A 1KMHB 1UTJA 3K65B 2QXGA 2BYAX 5JB9S 3DD2H 3NKKA 1TX8A 2QF5A 4XSKU 1MD8A 1SKYE 2WSSD 5F8ZA 1OSSA 2ZP0H 1FN8A 3ZZDA 1BMMH 3A7ZA 5T6DA 1L1NA 7KMEH 2CV3A 3KYFA 1IOEA 4XBBA 4QT8C 1DLKB 1P05A 3ZVDA 5L6NH 2F9NA 3S0NA 1QFKH 1MKXK 1HUTH 1V2KT 1YLNA 3MNXA 1KSNA 3TH2H 3FAOA 1V3XA 1KYNA 1MTNC 5HM2A 2QN5T 5T6GA 2AS9A 4ABIA 2AMQA 1HAGE 1O2OA 3DFLA 5GCHF 4A1VA 2ESTE 5C0UA 4A1XA 1ELDE 3HGNA 1YPHC 3BN9A 3MOCA 4X6NA 3SNCA 3F0OA 5AFYH 5HGGA 3VB5A 3OTPA 2CF8H 1WV7H 2P3FH 2R9PA 3JZ1B 1H8ED 3TGIE 4HGCA 1P0SH 3PWBA 2BZAA 1YY3A 4JZDH 5J4SA 2R0KA 1UW7A 1O2HA 1XXDA 2FX4A 3PMBB 2FDAA 2SNVA 4X1NU 3DHKH 1SQRA 4TWWA 2XBXA 2EI8A 3MTYA 5C5OA 1TAWA 4TY7A 1C1QA
chains in the Genus database with same CATH topology
4R8TB 1D6RA 1EXFA 2GCHG 1F5LA 1NO9H 1ETSH 1NFXA 4FUFA 4HTCH 3ATWA 1Y3YA 1UVPA 3SU0A 1HYLA 3P6ZB 4YOIA 3SBKA 4LXBH 3NPSA 1EB1H 3PWCA 4JZIA 4UFDH 3SOSA 3VB6A 4NIWA 4GLYA 2BD2A 1YPEH 2ZDMA 3UFAA 3RUOA 4LOYH 4JZ1A 1GBHA 2CHAB 5GPIB 1A2CH 1XUIA 1IQMA 2FI5E 2BDCA 3QX5H 1DM4B 3UY9A 1WYKA 2SNWA 2P16A 2UUKB 1NT1A 1Z6EA 2ZZUH 3LOXA 1O2YA 2WINI 4AYYB 4RKOB 1K2I1 1SFQB 3RXOA 1K1JA 4YOJA 4NWLA 5DKMA 1P2QA 1TPSA 2TIOA 5GDSH 3U1IB 5C20A 5C5NA 4X2YA 2W7SA 1DY9A 3T27A 5AHGH 1A5HA 1OWKA 1RD3B 1C5TA 2G8TA 4AFUA 4BTTB 1D3PB 1K1IA 2ZGHA 2HLCA 3SJIA 4YZUA 1W2KH 1DDJA 1NPMA 2LNCA 3RXJA 3QTVH 1TA2A 2GZ8A 1YPHE 2BZ6H 1H9LB 2A4GA 1CT2E 1EASA 1RTFB 5B6OA 1C2HA 3B9FH 1RIWB 1Z7KA 1BTXA 1N1LA 3UR9A 1J9CH 1O36A 3MYWA 3ODDA 3Q3YA 2WPHS 1PQ8A 1SLVB 3A88A 5FCRA 3STJA 2PKAB 5DP9A 2VWNA 3UOUA 1GMDG 1QA0A 3H7OA 1C2GA 1GL0E 3OY5U 2JH5D 1GMCF 1UK4A 2CGAA 9LPRA 1DSTA 1OWHA 2I6SA 2WPJS 1M9UA 1GJ8B 2RA0A 3OU0A 1LVOA 2BQ6B 3RU4D 1SGDE 1QGFA 2BD9A 5H4IB 5EW2H 1ZTKA 4AFQA 2FLRH 1LHCH 3Q3XA 3D62A 3EA7A 5C1XA 1NZQH 1LMWB 4HZHA 1KXDA 1QJ7B 1O3OA 3D23A 4IMZA 1V2RT 1TB6H 1E0FD 5K0HA 2CMYA 1P09A 5TCCA 4X1SU 1NM6A 1BJVA 1W8BH 4MNYA 1O2MA 4Y10E 1FQ3A 1ZOMA 3ZV9A 3I78A 3RM2H 1TWXB 2PUXB 1EUFA 3SNDA 1C5ZB 1A5IA 1ELTA 3A8DA 1C5WB 3A7WA 5TJXA 1O3MA 3PMJA 2FOAA 5GCHG 3RXPA 1IQIA 1ZHPA 1DWBH 5AF9H 3BG8A 3ZYDA 1TRNA 4GCHG 1ID5H 1AVWA 1HJAC 2ALVA 2ZCLP 4WY3A 4YT7H 1ETRH 1ELGA 1A0JA 1FY5A 2FS8A 1PFXC 2ZQ1A 2C8WB 5EPNA 2Y6TA 4UDWH 2FI3E 1B0EA 2ZIQH 3QZRA 3TH3H 1P2OA 1QY6A 3HPTB 1GWAA 3I29A 3IITA 4AFZA 3ZZ7A 5CMXH 2C3SA 1ARBA 2ZI2H 1MBMA 1ZRKA 1C5OH 2ZCHP 5HMAA 1D3DB 2PKSC 3KIDU 2VGCB 1O3CA 1QURH 1SQOA 3KCGH 5K7RA 2WV5A 2QY0B 1ZGVA 8LPRA 1YGCH 2A7HA 2UWOA 4HI3A 3M61U 1OPHB 3KHVA 2BD7A 1ZPZA 5LPRA 2NWNA 4ISNA 2XRCA 4FUJA 3GCTG 2H5DA 2HNTF 3MU4A 3RXTA 2R2WU 4D9QA 2WPIS 3P8OA 1ZZZA 1P2JA 4Y7BA 3E0PB 3SI4H 1GJ6A 2VVCA 1O3PB 4GHQA 3R0FA 1F0TA 1EATA 5JBTA 1YBWA 1JIRA 1DSUA 4IW4E 4FUCA 3QTOH 1O2QA 2C4FH 3M7UA 3ZZBA 4BAOB 3PTBA 5EXMA 3ZZ5A 1C1NA 4BTIB 3ATKA 4CBNA 4JZFH 2PW8H 4NGAH 1TABE 1S84A 4CRAA 2Z9LA 1O35A 1SQTA 1CA0C 3IWMA 1O2UA 2TGAA 1F0RA 3BG4B 1NN6A 4NIXA 1LVMA 2Z3CA 2A4OA 2HGTH 2ZTYA 1Z71A 2F9VA 2G81E 4B73A 1UJ1A 7LPRA 2JETC 4D7FA 3GY7A 4Y79A 3LPRA 2GCTC 1MD7A 1HIAB 4KELA 3TJVA 3PLPA 2A5IA 2ZGXH 1GGDC 3GCHB 1Y5AT 4YLQH 1KTSB 1OP2A 4MDSA 3SORA 2BXTH 2CN0H 2GV7A 4NSVA 2G52A 3SN8A 1LVBA 3NCLA 3SHAH 1FUJA 1TE0A 4B75A 3P17H 1XVMA 3RC5A 3BTHE 1ANEA 2Y80A 1P2NA 1NRPH 2I6QA 3A86A 3BF6H 1WSSH 3U8TH 2FOMB 1G3CA 2A4RA 1GMCG 1ZPBA 2HNTE 2P59A 2O8UA 5LPFA 4ZAEA 1UTNA 1TRMA 4VGCB 1GI9B 3TJUA 1TBRH 1BTZA 5IDKA 2A2XH 2EEKA 2P94A 1P3CA 4Q2KA 5EXLA 3RXKA 1AKSB 1C2FA 2BLOA 3LT3A 4IC6A 5C2ZA 2BY8X 1KLIH 2VWOA 1SGRE 2VJ1A 3BEUA 4GSOA 3T28A 2ULLA 3TU7H 1OYQA 1TNJA 3GY6A 1AQ7A 1C9TA 1P3EA 3SNBA 4DJZB 4BAHB 3SV7A 1FN6A 2GV6A 2ZHDA 3RLWH 3VEQB 2ZFRH 1IQKA 2EI7A 3V12A 1F7ZA 1AWHB 4KKDA 3LGTA 2FOBA 2ZDVH 1BBRE 4ZHMU 4AORA 4UFFH 1TBQH 2QA9E 1RS0A 3RU4T 2WPLS 1SMFE 7ESTE 2RCEA 2V3OH 1KXCA 1CHOF 3L33A 3SU6A 4B71A 1EP5A 3N7OA 1TMTH 2AIQA 2P93A 3RXMA 1NY22 8GCHG 2YNBA 2M5TA 1GVZA 1V2TT 3RXQA 1W13U 2XNIA 1UCYK 2G00A 1ZSKA 2P8OC 1ZMJA 1HAPH 2KAIA 5BRRE 3EGKH 2OQUA 3F9FA 2FS9A 3SU3A 3TJNA 1ABIH 1TGBA 2AYWA 1DWDH 4GAWA 3EAJA 4AZ2B 1GDQA 3TLOA 2ZU5A 1LQEA 3FZDA 4FVDA 2PSYA 4D9RA 5JYIA 4CH2B 1Z6JH 1QL8A 1BTUA 4ISLA 3SNEA 1GJ9B 5E0JA 5CHAC 4A5TS 1GI6A 1AVGH 1KXAA 3FFGA 2C8XB 1WTGH 4WVPE 1FY1A 1TMBH 5LPEA 1GCTC 1O3HA 1BRBE 3TPIZ 1O2VA 4U01A 3LC5A 4A6LA 3T2NA 2QGRA 4FUHA 1O3BA 3U69H 1OP8A 5DP6A 2OUAA 4ABAA 2QCYA 1KXBA 2BX4A 1DWEH 3ODFA 1ABJH 2BDGA 2QAAA 3L6PA 1O3DA 4ZKOU 1GMHG 1MKWH 1SLWB 2ILNA 3GY8A 5IYTA 2B8OH 4INHA 1BTHH 3SW2B 2FLBH 4ABDA 4JK5A 1BIOA 1C5XB 1ZSLA 2R0LA 2G4UA 4DY7B 2VWLA 4YTAA 1A3BH 1W3CA 1UHBA 1TOCB 1ZJKA 4FUGA 4ABGA 2ZDLA 1FY8E 1BA8B 3QUMP 1NU7B 4TWYA 4JCNA 4Y76A 1KTTB 4AG1A 4AB8A 1P10A 2OLGA 2QXHA 3E1XB 1O5GH 4O3UA 1C1RA 1LKAA 4WXIA 2ZU1A 1GBLA 1O5BB 4K69A 1K28D 1FPCH 1Y59T 3PLBA 1NRRH 2J95A 3AAVA 1NTPA 1GBBA 1G2MA 1T31A 2ZNKH 2ZHQH 1F5RA 5F8TA 3AAUA 5GWZA 2Y7XA 3A80A 3SU2A 1TNLA 4ZKSU 3TH4H 3ZV8A 1YLCA 3FP6E 4YOGA 4CRFA 3KQEA 1SGEE 1FNIA 3E90B 3LGYA 1P01A 4DT7B 7GCHF 1CBWB 4GUXA 2FM2A 1THRH 4K1EA 3ZVBA 1LHFH 1BHXB 4I8KA 1SG8B 4I8JA 1HXFH 3O8CA 4AFSA 2XCFA 3URCA 1RTLA 1ZLRA 3UIRA 1EZXC 2TGTA 4OS5A 1HAVA 2SGEE 1XMNB 2BY7X 1QBVH 3MU5A 3KQBA 1DLEA 1WBGB 2F9BH 1Q2WA 4NIVA 4XBCA 1PQ5A 4K1TA 1O2GH 1CGIE 4TYDA 1UTLM 4U30A 2ZU3A 1Y3XA 4FUDA 1XM1A 4WF8A 4X0WU 1TPAE 2H2ZA 4D76A 5A8XA 6CHAB 1P11E 1C5PA 2VB0A 2BQ7B 3GOVB 5DP4A 3M3TA 1PJPA 3W94A 3NXPA 3UNQA 1LQDB 4WMFA 5TCAA 3CS0A 1TGNA 2BXUH 3BIVH 4WMEA 4WH8A 1TALA 1BTWA 2GMTC 1EP6A 2QV1A 3U9AH 5C1UA 1UTOA 1C5SA 2F9PA 2QXJA 2VVUA 2ASUB 3QGJA 2BTCE 2O8TA 2ZF0H 4ZKNU 2OD3B 1HJ9A 3SGAE 3A7TA 2FO9A 2TGPZ 3HATH 1V2LT 4FU7A 2IJOB 4Q7YA 3F1SB 5DP3A 3KEEA 2EA3A 1DUEA 1AFQC 1G3EA 3FVFB 1O32A 2Z3DA 2BOKA 4TPIZ 2A4QA 1GJBB 1C1TA 1GG6B 2CF9H 3SJ9A 2F91A 1ZMNA 1FJSA 8ESTE 4I7YH 2Z3EA 1YPGH 2ZPSA 1O39A 4B76A 1DICA 1VGCB 1W7XH 4X2XA 3P95A 2ZHWH 1L0ZA 4Y8XA 1UTPA 1GHAF 5F8XA 4GPGA 4DIHH 4E7RG 1UTKA 1GDUA 1V2NT 5DO4H 1IQHA 1Y8TA 4MVNA 4AGKA 3U8OH 1HAYB 1KXEA 4ZXXH 2Y5FA 4MQAA 1YPJH 1G32B 3LONA 1AE8H 1MCTA 2IN2A 3D65E 1H9IE 1SLUB 3G01A 3OY6U 4CRCA 1DS2E 4CH8B 2H9HA 3DA9B 2BDBA 5G4BA 1O2RA 1IQNA 3SV8A 1O31A 2OBQA 1QHRB 3ZZAA 1AE5A 1BBRK 1HXEH 3S9CA 4YT6H 2BD3A 2DUCA 1TLDA 3VXEH 1BRUP 1BITA 1E34B 2HALA 4K3JA 1Z8JB 3A8CA 1PYTC 1GVKB 4WXVA 1TQ0B 3ENSB 1KDQA 1MTUA 4INKA 1GI2A 3TK5A 3A82A 5EQQA 1FPHH 4BXWA 1CO7E 1V2JT 3RMMH 2GD4B 3RM0H 3S7HB 3SNAA 3M5MA 3U98H 2NU3E 1TYNA 3LJOA 5DK1A 1CT0E 1MH0A 3IG6B 3M3VA 3CP7A 2G5VA 3M7TA 2ZTXA 4X2VA 1T4VH 2FODA 1UCYE 4IN2A 3T26A 2Z94A 4FUBA 2ZHFH 1HFDA 1SBWA 3BTWE 1IQJA 2JH6D 3RXDA 1AMHA 3UNSA 3F9GA 4K1SA 4BNRA 1LTOA 1W0YH 3VB7A 1TBZH 4A92A 3E8LA 2XBYA 1YPMH 2B9LA 1VZQH 1G9IE 3BTGE 1N8OB 2OC7A 7GCHG 1O2SA 1P57B 2BVXH 1OWJA 1BQYA 4XDEA 3QWCH 3GDUA 3H5CB 1MKXH 1V2UT 1NU9A 1LPKB 1O3IA 4B2AA 2D26C 1VCQA 1GHBF 1KY9A 1KXFA 1VCWA 4FU8A 2FESH 4X6PA 1C5LH 4NA8A 4D7GA 2SGPE 1QA7A 2GT7A 2ODYB 3QLPH 4BAMB 5C67A 1TA6A 2STAE 3M3SA 1A61H 1ESBA 1PYTD 2HOBA 5JBAS 2XW9A 4HFPB 1GJDB 1T8MA 1ZMLA 2ZDAH 3RU4E 3M37A 3RXHA 3A85A 1XKAC 1K9OE 4CHAB 1LKBA 1EAWA 3TIUA 1GPZA 4CRGA 4OGXA 1C2KA 2R3YA 1Z8RA 1BHXF 2ZU2A 4Z6AH 4B2BA 2BX3A 1W12U 3H7TA 1BMNH 3K2UA 1XX9A 1K1LA 1V2OT 3MMGA 4UEHH 4ABEA 2BDAA 1V2MT 3MNSA 3PB1E 5EQRA 1WTHD 4E06H 3BSQA 1C5QA 3SJOA 1EKBB 1XKBC 1EPTC 3EA8A 3HKJB 2ZFFH 4H6SB 1O2LA 2P3TB 1P02A 4MNWA 3LKWA 2W7UA 1NRQH 2ZWLH 5CHAB 2OC0A 1G3BA 1K1NA 2JKHA 1ZHRA 2NU4E 2O8MA 1C5UA 5ESBA 3LJJA 1L1JA 1GJ4H 4X1QU 2ZEBA 2VINA 2AERH 1D4PB 4WWYA 2P95A 3E6PH 3OSYA 3BEFB 1ZHMA 1D9IA 2YNAA 1P04A 5FPSA 5FXLA 2FMJA 1ANCA 1A0HB 2BY5X 4ZKRU 1C5VA 3W95A 6ESTA 1GHAG 1DFPA 1HAZB 3D49H 1ACBE 2SGQE 1RXPA 2GTBA 2RDLA 3SHCH 4DURA 1JOUB 1NFUA 1H4WA 1P9SA 2R2MB 2F9UA 1KLTA 3I77A 1C1VH 1O3LA 2ZFSA 3FZZA 3V7TA 1JXPA 1C4U2 4E7NA 5I25A 1O5AB 5PTPA 3MH5A 1QRWA 1CVWH 2BOHB 4WH6A 5EODA 3GISB 1ZGIA 2G51A 3RC4A 1K21H 1MZAA 1TX7A 3GYMA 1E36B 1GI1A 3F9EA 2XC4A 1BRAA 3VGCC 2J4IA 1EOJA 1TRYA 3KQCA 1LHGH 3GICB 2ZDNA 1HDTH 4CRBA 2ZU4A 4K5ZA 5EGMA 3UPEA 2JH0D 4NCYA 4NSYA 1HNEE 5JPMH 3ATIA 1EQ9A 5DP8A 1O37A 1GI0A 2D2DA 3JZ2B 1HB0B 2C93B 2UUFB 4X8VH 5FBEA 1VJ9U 4KGAA 1P03A 1A3EH 1GBEA 2BD8A 1OXGA 1AZZA 3DFJA 2ODQA 1MAXA 1SL3A 4K8BA 2CHAC 3ESTA 2ZECA 1BCUH 1A5GH 4NFEA 1VITF 4NFFA 1MTSA 2ZFPH 5HYOA 4DCDA 2ANWA 4AGJA 4WJG2 5FPTA 4OS7A 4B1TA 1YC0A 1DOJA 1Y5UT 1P06A 1O2WA 1TX6A 2HWLB 3UNRA 1GBIA 1TNGA 2GX4A 4CR5A 2O8WA 2A45B 3RXUA 3SGQE 2A2QH 1QL9A 3C27B 3RC6A 1BDAA 3RMNH 1O38A 1XUGA 4PROA 1GBTA 3HGPA 2WPMS 3NK8A 1BOQA 1Q3XA 3QGNB 1OKXA 2AMPA 4H4FA 3GDVA 1HGTH 1D3TB 2STBE 1JIMA 5AVDA 1D6WA 2Z9KA 2Z9IA 1SLXB 2GGVB 3SUDA 1S83A 1EJMA 1T7CA 1PPHE 1TMUH 4ZMAH 1C2MA 1RIWC 4MNVA 1F0UA 2FPZA 1GCDA 1Z1IA 4UE7H 5A0AE 1A0LA 1MTNB 2W5EA 2BLWA 2OBOA