2VIQA

Fragment-based discovery of mexiletine derivatives as orally bioavailable inhibitors of urokinase-type plasminogen activator
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
247
structure length
247
Chain Sequence
IIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTISLPSMYNDPQFGTSCEITGFGKENSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHTKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UROKINASE-TYPE PLASMINOGEN ACTIVATOR CHAIN B
publication title Fragment-Based Discovery of Mexiletine Derivatives as Orally Bioavailable Inhibitors of Urokinase-Type Plasminogen Activator.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 58
structure length 247
sequence length 247
ec nomenclature ec 3.4.21.73: U-plasminogen activator.
pdb deposition date 2007-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2viqA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2viqA01
1V2QT 1TGNA 1Z71A 1GBTA 4ISHH 5HXFA 1F7ZA 2ZA5A 2QXGA 1J17T 1D3DB 1GHXH 1C1OA 3C1KA 1FY3A 3VPKA 4ABFA 1AB9C 3FP6E 1ZJDA 1O5GH 1GDQA 1S83A 1UHBB 2STBE 1PQ8A 3SUGA 1VITF 1EASA 3V7TA 4X2WA 2KAIA 5CHAB 1FXYA 1BRAA 3RMLH 1SG8B 1JOUB 2UUJB 1OYQA 2BVRH 1YLDA 1SGIB 3VXFH 2ANWA 1P09A 1Z8GA 4H4FA 4Y76A 2XBXA 1KXBA 2WUCA 3LGIA 1CO7E 1HYLA 3P8GA 3UNRA 3KGPA 2M5TA 2VGCB 3RXCA 2QXHA 1S5SA 3DHKH 1AFQB 2FESH 1HAOH 1PQAA 4FU8A 1FONA 1GI5A 3UQVA 1YPJH 1O2UA 3M7UA 3SU0A 4SGBE 1RTKA 1SGRE 4CRGA 3SU6A 3UR6A 2GCHF 1AFEH 2AIQA 2SGDE 1ABIH 5C1XA 2JH0D 3UPEA 4THNH 2GCTB 4LZ1H 5PTPA 3A80A 1CQQA 2XBYA 2ULLA 2XNIA 1RGQA 1GGDC 2FX4A 1GBAA 2FTMA 1L4ZA 2BDGA 2NWNA 1WU1A 2NU1E 1N8OB 1BDAA 3U8RH 4I7YH 4NIWA 4WH8A 1QQ4A 4NIXA 1LVBA 1H8IH 2G00A 1V2JT 3RU4E 2FEQH 3A7VA 4KTCA 4MPVA 5K0HA 3SBKA 1P02A 1O34A 2WPMS 3FANA 1TOMH 4HI3A 3KQDA 3U9AH 2BVXH 2FOCA 4YOJA 1ZSKA 1MKXH 1UK2A 2C4FH 2PLXA 3FFGA 3RXJA 1PPFE 3SGAE 1SGPE 1Y5UT 4B76A 1K1MA 1BT7A 1Y8TA 3TH3H 2A4RA 3C27B 1V2NT 2ALVA 5GCHF 3SUEA 1TNJA 3KIDU 2OC1A 4AFZA 1O31A 3RXGA 1DY9A 2BOHB 2Z9IA 1P2JA 2QCYA 1TGBA 2G51A 4IN2A 2ANMH 2CHAB 4Y7BA 2G5VA 3ZVAA 1K1JA 1HPGA 1HV7A 3VGCB 5SGAE 1A5HA 1FMGA 4Q7YA 4AGJA 1SC8U 3P8NA 4D8NA 1GL0E 4CBNA 1NN6A 2C93B 1C5OH 4Y7AA 3ZZ7A 1QGFA 1TYNA 2ZU4A 4M7GA 3TJOA 2F3CE 1N6XA 3BTEE 1A0JA 2J94A 3JZ1B 1P9SA 3OYPA 1L2EA 7GCHG 1UTNA 4FU9A 3KN2A 2STAE 4OS7A 3ZYDA 5EXMA 1SLXB 1SBWA 2JETB 2GV7A 4X2XA 3RXAA 1CGHA 8GCHF 3SJIA 3BSQA 1QRZA 2SGFE 3E1XB 6CHAC 4KP0A 1K1IA 4NIVA 3T2NA 1ZYOA 1C5QA 3E3TA 2TBSA 3GCOA 1ELCA 2VVUA 3LGWA 2UWPA 1TGTA 3V12A 5A8XA 2HVXA 1MU6B 2ZWLH 3GY5A 1TNLA 1RIWC 1VITG 3UFAA 4R8TB 2QC2A 3K6YA 1ELTA 2G81E 2YNAA 4XE4A 2A2XH 1GJCB 1K1PA 4LK4A 2BY8X 4ABAA 4J1YA 2D8WA 1C2JA 2RDLA 3RDZA 1NFWA 5K7RA 1J16A 3IWMA 3ATWA 1F0UA 1QJ7B 1XUIA 3LGTA 2RA3A 4DJZB 4DY7B 4TPIZ 1JWTA 1N6YA 1MU8B 1E0FD 3CP7A 3LONA 5CHAC 2BD2A 2ILNA 3GCNA 2ZU5A 1ZMLA 3MU4A 2GCHG 1TIOA 5BPEA 5TJXA 4WH6A 1C5TA 1QJ6B 3K65B 1SSXA 2F9BH 3E16B 3VFEA 1KXFA 2VIVA 1QL7A 1GJAB 1O30A 2ZP0H 4NGAH 4Y0ZE 1AU8A 2SGEE 1EX3A 1KDQB 3P8OA 1FQ3A 1YBWA 1DITH 3P17H 4AFUA 2B9LA 1SOTA 1HB0B 3EQ0H 1HAGE 1LTOA 3PROA 3I29A 2TGPZ 1TPAE 1J9CH 3A88A 3SJOA 3HKJB 5E0GA 3SU4A 4IMZA 1LKBA 1BCUH 3PMBB 2GZ8A 2Q1JA 1MTNC 1YF4A 1DY8A 2BX3A 3ZZDA 5JBTA 1MBQA 4BAKB 1P9UA 4O9VA 2UUYA 1K1NA 1BHXF 1BRBE 2Q6GA 3GDVA 3A7WA 4WVPE 2PFEA 5GPIB 1C5SA 3KCGH 5IDKA 2XXLA 1MD7A 1BTWA 4I8JA 4LZ4B 2XBWA 5DJ7A 2B0FA 1B0EA 2H9HA 1A2CH 2W7UA 3SW2B 1G3BA 5J4QA 1ABJH 1S85A 1INCA 3M5OA 3Q3XA 1MUEB 4Y0YE 1FZZA 1C5YB 1O2QA 2C90B 2VU8E 1ZHRA 4AB8A 1TNIA 3PWBA 1TQ7B 3QO6A 4CRCA 1C5NH 2ZFRH 1OWDA 2ODQA 2ASUB 1TLDA 3BTME 3RC4A 1FI8A 3RM0H 2QXIA 2CHAC 4X2YA 1QIXB 3W95A 1EP6A 4JZ1A 3QTVH 4E7RG 1GBHA 2HNTF 3A86A 1OWEA 8GCHG 1BMNH 1T8OA 1K2I1 2XYAA 1GJ9B 2V3HH 1MKXK 2HNTC 3BEUA 1V2PT 4AX9H 4FXGH 2G4UA 3MNSA 4X1NU 3FAOA 2ZCHP 2ZPSA 4B73A 1O2YA 1O3FA 3BEIB 1CHOG 1TMUH 5DPAA 1IQNA 1ORFA 1SLVB 2BY7X 3LC5A 3ZZ5A 2YOLA 3U98H 1QBOA 1Q3XA 1XXDA 1Q31A 1FY4A 2WYJA 2XWBI 2AMDA 1GBCA 3T28A 5JDUB 2AGGX 4XOJA 1O5EH 1AZZA 4GCHF 1XVOA 4H6SB 4YESB 2OQ5A 2WUBA 1GMDF 1T8NA 3F9GA 3RC5A 5L6NH 5ESBA 1GI1A 1IQMA 1CA0C 3AW1A 4I32A 3HGNA 1WAYB 1O38A 4D9QA 3M7TA 4XBCA 3OY6U 1C4V2 3BTDE 1HRTH 4K2YA 2P8OC 1WV7H 1D4PB 1ANEA 3L3TA 1H8DH 1NC6A 2G55A 3ELAH 5DP7A 3M36A 3QTOH 4DIHH 1MCTA 2D2DA 1NESE 3Q3YA 4FUDA 5EGMA 1YYY1 1CBWB 1V2UT 3U69H 1S6HA 1AI8H 1YGCH 3PMHB 4R0IA 4YLUA 1PQ7A 5EW2H 1F92A 4CHAC 1RD3B 1Z7KA 1MTUA 2F9PA 2P3FH 3SNDA 4UFGH 1RS0A 4KKDA 5HM9A 4Q7XA 2ZO3H 1ETTH 1HLTH 3NKKA 1EP5A 1KXCA 2BX4A 1ZTLA 4MPWA 2A7HA 3EA9A 1YPHC 2BDYA 2QYIA 1AWHB 3MYWA 4AN7A 4K3JA 3MU1A 3UTUH 2AGIX 3N7OA 1KLJH 3TK6A 1AVGH 1JRTA 1DFPA 1QQUA 3FP7E 5EG4A 1AKSA 3LGYA 3TLOA 1ZMNA 2XCFA 5C5OA 1EAUA 1HJ8A 1G3CA 4NZQA 3SU2A 5I46H 1CA8B 4ZKRU 1NFUA 2FDAA 4ZXXH 1W3CA 1FV9A 1GJ7B 1D9IA 2FWWA 1LVYA 4GLYA 3S7HB 1B5GH 2P3UB 1CE5A 1EPTC 3MNCA 1AZ8A 1WSSH 1LHCH 1THSH 2ZIQH 1FAKH 5T3HA 4OS5A 4ZMAH 2P95A 4IC5A 1QA0A 7LPRA 2OXSA 1HCGA 1O3NA 2BY9X 1VR1H 3PTBA 4ZROA 3ZV8A 2FI3E 2J34A 3QGJA 5EPYA 2WPLS 4YLQH 2A4OA 4Y8ZA 4MG3A 4B75A 2ZFFH 1C5ZB 1YP9A 4A5TS 5ESTE 1W2KH 3ATMA 3BN9A 3W94A 5FBIA 4JZEH 3NUMA 1P05A 1KXEA 1CT0E 3SQHE 2PKSB 1AVWA 4Z0KA 4ZKOU 3I78A 3SU5A 8ESTE 1MMJN 5T6DA 2BTCE 4JYTA 1G32B 1MKWH 2FLBH 2PKAA 4DG4A 5A8YA 1DM4B 1K21H 1IQEA 4GCHG 4INKA 1S84A 1JIMA 4CRBA 3RU4D 1HAHH 1F2SE 1GMDG 5F8XA 3SNEA 9ESTA 3RXKA 2CF8H 1O3IA 1O2OA 1XM1A 4D9RA 2A7JA 1SGEE 1AUJA 4OS1A 1UTOA 4Y79A 3RUOA 3TH4H 4UEHH 3H7TA 3KQBA 3URCA 5LPEA 2UWOA 4U01A 3RXFA 5CMXH 3QWCH 1W14U 2F91A 3ZV9A 4JCNA 3GCHB 1IAUA 4D76A 4DGJA 2BZAA 1FIWA 2PTNA 3GY3A 3HPTB 1V2RT 2O8LA 1C5RA 2VIOA 1V2VT 1TGCA 3ZZ3A 3S0NA 2H6MA 3TU7H 2DE9A 1EAIA 2ZC9H 4MNVA 1O3PB 2P59A 3SO3A 1C1WH 3K2UA 2FP7B 2WPHS 1XUFA 2Y6TA 1ZRBA 3URDA 3G01A 3KEEA 3TNSA 7KMEH 3NPSA 1WUNH 5DP3A 1P04A 3RMMH 2FODA 2A2QH 4Y6DA 1A0LA 2XWAA 1JMOH 4RKOB 5HYOA 2Z3DA 2A5IA 1TNHA 2Z3EA 4FUFA 2ZGCA 3BV9B 1YCPH 1LHGH 3A87A 3RXQA 1MAXA 5E2OA 1ZMJA 4FVBA 2PV9B 4ISLA 4UONA 3PLBA 2NU4E 2ANYA 2CF9H 4B74A 2FOMB 4DIIH 4NWKA 2TIOA 1QHRB 2FOFA 1P01A 1IQKA 5F8ZA 3CS7A 3SV6A 2BOKA 1GJDB 1UTKA 1V2WT 1V6DA 2Z9GA 4NA8A 2RA0A 1TWXB 1A4WH 1UMAH 1EPTA 2FZZA 2VH0A 4CRAA 1O3GA 1D3QB 3RXDA 1FLEE 3BG8A 4AZ2B 1P8VC 4UFDH 3UY9A 1O3HA 2GT8A 4H42U 1H9HE 1UTPA 5JB8S 1K28D 2WPIS 4E06H 2WYGA 1C1QA 3IITA 1FNIA 1GBBA 1BTZA 1C5LH 2ZDLA 3K6ZA 3EDXB 2AS9A 4DW2U 1GDNA 1GHVH 1ELVA 5DP8A 1BJVA 4RSPA 3ZVFA 1C4Y2 1BTYA 1DSUA 4JZDH 4ISNA 1C2HA 4BTIB 1TX7A 1J8AA 1VGCB 2BVSH 2QF0A 1CGJE 1LPGB 2HWLB 2XW9A 4Z6AH 2FOAA 1TOCB 4NIYA 3KQEA 2BD9A 4Y10E 3TNTA 4ABEA 1DXPA 1Z8RA 1ZTKA 4ZUHA 1OP0A 1GCTC 3FZZA 2AFQB 4CRFA 4VGCC 1BBRH 3ZVCA 5GWZA 2ZQ1A 3LC3A 1OYTH 2QIQA 4XBDA 3F68H 2J38A 3KNXA 2H2ZA 3OY5U 2WPJS 2F9UA 2PGBB 1HJAC 1GBLA 4JMYA 1BTXA 1YPGH 4UFEH 3P92A 4YT7H 1FIZA 4X8TH 1UTJA 1C1PA 4I8LA 2UUFB 2OBQA 1AGJA 4U30A 1P3CA 4B71A 7ESTE 4INHA 1EB1H 4CREA 8LPRA 2QAAA 2PR3A 1QY6A 3MNXA 1BZXE 2W5EA 2J9NA 1MKWK 5FPTA 2FI4E 1GBEA 1BHXB 1SGTA 1TNKA 2NU0E 3GY8A 3T29A 2SGAA 5JBAS 1C5XB 3ODDA 4GUXA 3NXPA 5LPFA 1ZOMA 3KF2A 4AYYB 4OS6A 1E34B 5DP9A 1WYKA 3OSYA 2XC0A 5DP5A 3AASA 1TABE 2C8XB 1O2KA 1TRYA 3SJ9A 2F9OA 2ZHWH 5DGJA 5L2YH 3UR9A 1UCYE 2JH6D 1ACBE 1FY1A 5EXLA 2VIDA 3TIUA 4DURA 1C2MA 1PYTD 1W8BH 1YM0A 3PLPA 2ZQ2A 3AAVA 2WV5A 3SNAA 5A8ZA 2GT7A 2ZHFH 1YLCA 5HMAA 1PPZA 1D3TB 5DP6A 4NWLA 2A32A 4IGDA 1A61H 1DSTA 5ABWA 2V6NA 2FO9A 2IOTA 1HNEE 1O2HA 1TGSZ 2BY6X 4A1XA 1V2TT 2C3SA 3M5NA 6ESTA 2BB4A 4FVDA 4A1TA 2TRMA 3E8LA 1ZSLA 3RXMA 1O2JA 4WMEA 1THRH 1SLUB 2A0QB 1O5AB 2GZ7A 4I8HA 2F9NA 1CHOF 1LO6A 1O2XA 1ETSH 1XKBC 3MO3A 4K60A 2JH5D 3VEQB 1DX5M 1GG6B 3ENSB 3TJNA 1ZHPA 1F0RA 3FP8E 3WY8A 1S82A 1QRXA 2BZ6H 4DOQA 1GHAF 1O3EA 1G2MA 1X7AC 1YCPK 2VH6A 2ZFPH 3T27A 5C2ZA 3AW0A 3EYDA 1LVOA 1UVPA 3MHWU 2UWLA 1L0ZA 1P2MA 1HUTH 1EZUC 2XCNA 1M9UA 3PO1B 4FUHA 3BTFE 4AGKA 4FUCA 5E0HA 1VJ9U 2GMTB 2FS9A 3SHCH 1O2TA 2QF3A 3RC6A 1BQYA 1ZZZA 2PSYA 2ZGXH 2BLVA 1PPBH 4O03A 3RXLA 1AY6H 2VWLA 3A7YA 4PROA 4ZHAA 2OQUA 4Y8YA 5TCCA 3STIA 1VITH 4TPYA 3SUFA 3PMAB 2EI8A 4INLA 1TA6A 5DKMA 2PSXA 2SFAA 2OC7A 1W7XH 4IS5A 2QGRA 4JYUH 1VGCC 2VGCC 5FPSA 1W0ZU 1AFQC 3A85A 1B0FA 2BD4A 3A7XA 2ZPQA 4MPUA 5LGOA 2XTTB 4OS2A 1KY9A 1BA8B 2ZPRA 4JYVH 1P03A 4AORA 2GKVE 1O3LA 1C9TA 1FN6A 3GY7A 2Z3CA 1C9PA 1GMHG 1AIXH 1BUIA 1ZLRA 1SHYA 2GCTC 1C5MD 3BTHE 1ARBA 1GI0A 3MNBA 1SI5H 2EI6A 2FM2A 1GMCF 2SGPE 1QA7A 2BD5A 3NK8A 2CGAA 4A1VA 1N8OC 4ZKNU 1HAYB 2H1UA 2R3YA 1EAWA 2VIPA 3QZQA 1E38B 1HFDA 5JYIA 2OC8A 4BNRA 3RU4T 2ODPA 1WTGH 1WTHD 1V2LT 2ZEBA 2VB0A 1P2QA 3ZVGA 4H6TA 1C2EA 3MH5A 3QDZB 1A5IA 1PJPA 2V35A 3JZ2B 2ZFSA 1O3DA 2Z9KA 2FXRA 1Z1JA 1ELDE 1BBRK 2BYAX 2C8YB 2Z6BD 1GBKA 2HNTE 1CSOE 1XUHA 4WMDA 3SV7A 1MQ5A 3RLWH 3SU1A 1UJ1A 2BQWB 2BLQA 1RTLA 2FLRH 3UIRA 1GJ8B 2ZGBH 1TE0A 4GPGA 1SQOA 2PWXA 1C2GA 1NRQH 3VGCC 1LMWB 4ABGA 4X6NA 1C2KA 3SN8A 1GCDA 2KAIB 1NFXA 2ZDAH 4X1PU 1NS3A 1AHTH 4O3TA 1ELFA 1JBUH 2THFB 1UTMA 3A7ZA 3MU8A 1EB2A 1O37A 3ZZAA 4CR9A 1TB6H 4X6MA 1MZAA 5FHTA 1O32A 1HIAA 4K69A 4B1TA 1LCYA 1YPEH 2ZFTA 2BDIA 3HGPA 3U1JB 1O2VA 3GCTG 3U1IB 3SNCA 1J15A 1G3EA 4JZIA 1UVUH 1TX8A 1DICA 1DPOA 4X8VH 2JETC 1W13U 2J95A 2ESTE 4TYDA 3SNBA 4OGYA 2TGDA 1IHSH 1AE8H 2XBVA 3NCLA 1TNGA 3Q3KA 1P2KA 1GHAG 2O8UA 1P3EA 2CN0H 2IJOB 1ZHMA 2Z94A 3GY4A 1NROH 1SQAA 1O5CB 1XXFA 1UHBA 1Y3YA 1DUEA 4YT6H 4ISIH 1AO5A 2FIRH 1TPOA 3OTJE 3HK3B 3TGIE 3LJOA 3QUMP 3ZZ9A 1V3XA 4X8SH 2Y7ZA 3R3GB 1NO9H 3LU9B 2W26A 3BEFB 3FVFB 1SGYE 3PWCA 1GBDA 3B8JA 3BTKE 2BXUH 1W11U 4YZUA 2A1DB 1C5UA 4MPXA 1GHBF 2BDCA 3KL6A 2P3TB 3GY6A 1IQLA 2GGVB 1O0DH 2H5DA 1YPHE 4X6PA 3MTYA 1TALA 2FS8A 1SQTA 3SV9A 1T31A 2A31A 3SZNA 1J14A 3T5FH 4HFPB 2Y82A 4ABJA 4UFFH 5F03A 4MTBA 4ABDA 1OS8A 5TCAA 2PTCE 4KELA 1GMCG 2Y5HA 4WXVA 3ZVDA 3A84A 4BAHB 1C5VA 3QLPH 1QBNA 3KQCA 1HDTH 1MH0A 4X1QU 2NU3E 4BTUB 1Z8JB 4BOHA 4MLFB 1SGNE 1TQ0B 3EE0B 2Q6DA 3ATLA 2ZHEH 1HAZB 4NG9H 2Y5GA 3HATH 3P8FA 4WMFA 3D65E 2C8WB 1LQEA 3MOCA 3HK6B 1SGDE 3BG4B 3LPRA 1P57B 3ZVBA 1O3BA 1Y3VA 1T7CA 1C2DA 2VINA 2VJ1A 3MO6A 1LHEH 3GDSA 5G4BA 3QN7A 2HPQH 1NZQH 1O3JA 3RXSA 2ZTYA 5DK1A 4ESTE 1KXAA 1EKBB 1IHTH 3E90B 3RXVA 4K1TA 1O2LA 1OP8A 4ABHA 4MVNA 2H5CA 3VB3A 3L33A 1AB9B 3CENA 2SNWA 1TONA 1C1NA 1OWHA 1DOJA 3DA9B 1IQFA 1FDPA 3U8TH 5FCKA 3M7QA 5AF9H 2G4TA 2FPZA 2AEIH 4HTCH 1SL3A 5A0AE 2Q6FA 5AFYH 1AQ7A 1D6RA 1FPHH 3EA8A 1TRMA 1RXPA 3F9HA 3MFJA 1ETRH 3MO9A 2CV3A 4A7IB 2OBOA 2ZI2H 3TGJE 2UUKB 3QK1A 2GTBA 2H9TH 1DANH 3A8DA 2BM2A 4KTUA 1P0SH 1IQHA 4WJG2 1DLEA 3ATIA 5GJ4B 3GDUA 1UVSH 1DWEH 3VB4A 3D62A 1Y3UA 1SR5C 3QX5H 3GICB 2F9VA 4NFEA 1KLIH 5T6FA 3RXHA 1PPEE 2BDHA 1GGDB 2ZGHA 1FY5A 3S7KB 3A83A 1NPMA 5IYTA 2B8OH 3LT3A 2CMYA 3P6ZB 1UK4A 2VWOA 1D3PB 4NA9H 9LPRA 3BTQE 1C5PA 5AVDA 4B2AA 4BTTB 5FX5A 5FBEA 3PV4A 1GI8B 3S69A 1GHBG 1QL8A 3ZVEA 4J2YB 2BY5X 1CT4E 1WBGB 3SJ8A 1EJMA 5A0CA 1DWBH 2Z7FE 3RXTA 2Z9JA 2D26C 1W10U 2VWMA 1ZPCA 1PPGE 1ZGVA 1Y59T 2WPKS 5FCRA 2ZG0H 1BTPA 1SMFE 3A8AA 1TBQH 4IBLH 4NFFA 3GYLB 1SGFA 3VB7A 1NY22 3AVZA 1KDQA 1TBRH 1P11E 3GOVB 1CBWC 1ESTA 1A1RA 1YPKH 3MI4A 5DG6A 1VCWA 1VZQH 1E36B 3V13A 1C1RA 2GDEH 3BTTE 4CRDA 4LOYH 4YTAA 1V2KT 1O2RA 2ZZUH 1Z6EA 1A46H 3TVJB 3OU0A 5B6OA 1AN1E 1GVLA 1ZTJA 3T25A 4AB9A 4UE7H 1QB9A 4HZHA 2XC5A 2GD4B 1QCPA 4I8KA 2ZU1A 3M5MA 3MU5A 2HRVA 2QY0B 3F9EA 4XSKU 2W3IA 2A4QA 1MCVA 4GSOA 2OTVA 6CHAB 2I6QA 2TGAA 4O97A 1C5WB 1GVZA 2FTLE 2ALPA 1C1MA 1O3CA 5E8EH 4RN6A 4X0WU 5H4IB 3ZZCA 1O2SA 5EU8A 3SHAH 1U6QA 2VNTA 5LH8A 1P2IA 3UOPA 4LXBH 1ZR0A 3STJA 1T8LA 2V0BA 4A6LA 1BTUA 1SFQB 1GPZA 1SOZA 3K9XB 4NCYA 3UWJH 3RLYH 1WQSA 3MU0A 2R0LA 4XBBA 2AH4X 3S9AA 3QGNB 1SPJA 5LPRA 1A5GH 2A45B 1S81A 1DWDH 2OD3B 2ZCKP 3GYMA 2CXVA 1GDUA 1P2NA 5AFZH 3O8CA 1K1OA 3A8CA 3UREA 1RRKA 5L2ZH 2BDBA 4AG2A 1TMBH 4Q2KA 4E05H 3T62A 4MDSA 3E91A 1MZDA 1NRNH 4IC6A 8KME2 1GBJA 1SVPA 3P95A 1DDJA 1TPSA 4CH8B 1GI3A 1PPCE 5C20A 1EUFA 1QFKH 2HGTH 6GCHF 1A7SA 2G5NA 1SGCA 1TBZH 1Y3XA 3MMGA 1XX9A 2HOBA 1NRSH 2PHBA 4FUEA 1DXWA 4X1RU 1EQ9A 2BDAA 2LPRA 2PKSC 2GVFA 1W0YH 3DD2H 1FY8E 5I25A 1ANCA 3NZIA 5J4SA 4Q80A 4FUBA 1NU9A 1L1JA 4ISOA 2QXJA 3ZZ8A 3Q76A 2A5AA 2AYWA 5GDSH 2AMPA 2SNVA 3PM3A 3O8RA 2BQ7B 1WCZA 1GMHF 1DE7H 1AD8H 2XC4A 3ODFA 1A3BH 1UK3A 1SGQE 1BMMH 3SGBE 1ELEE 2G52A 1MTNB 1O5FH 1ZSJA 1B7XB 4RKJB 5FXLA 1EOLA 1GL1A 1ARCA 1KIGH 2K1QA 3TITA 3D49H 4D7FA 2QV1A 1PFXC 2B7DH 2EA3A 1DT2A 5FAHA 2R9PA 1T4VH 3GCHC 1AKSB 4HGCA 1HGTH 3SQEE 1DUAA 3M3TA 1QNJA 1HXFH 2Z9LA 4OS4A 1XVMA 1Y5AT 2ZDNA 1VCQA 1E35B 1FN8A 1FPCH 3TK5A 3L6PA 3LH1A 3BF6H 2FOHA 1EATA 5E0JA 4NA7A 3ZZ6A 2G8TA 4Q7ZA 1QBVH 1ELGA 4E7NA 1ANBA 2AIPA 1OXGA 5EQQA 3AAUA 3Q00A 4Y71A 2ZDMA 4GHTA 1YKTA 2JKHA 3TJUA 1XKAC 2F83A 5EPNA 1NFYA 2OLGA 1Z6JH 2VVVA 3A81A 2PUXB 5FX6A 3TK9A 1OX1A 4YOIA 4QT8C 1YPLH 1VJAU 2I6SA 3ESTA 1O2WA 2OP9A 1TFXA 3RXOA 3UWIA 1YC0A 1ZGIA 2BHGA 3TH2H 1G3DA 2Y81A 3D23A 3GCTF 4OGXA 1Y3WA 4YO9A 5JBCS 1NRPH 2RCEA 4X6OA 2PUQH 4CBOA 3ZZ4A 1OOKB 1NTPA 4SGAE 2PKAB 3LH3A 3SUDA 1O35A 1EOJA 1GHZA 2P93A 4I31A 3LOXA 1YCPM 2VWNA 1BMLA 2BD8A 1SB1H 2ZECA 2AMQA 1Q2WA 1RFNA 1T4UH 1ELAA 4YOGA 1CA0B 1O39A 1G30B 3RXIA 3M37A 1DS2E 1JIRA 5JB9S 3RMOH 1CT2E 2ZDVH 6GCHG 4O3UA 2P8OB 2VIWA 3S9CA 5EOKA 3RXPA 1P06A 1Z1IA 1HBTH 1H9LB 1C2LA 1GVKB 4B2BA 1BTHH 1NM6A 1OPHB 2GV6A 4JZFH 3SU3A 1C1TA 4BXSA 1O5DH 3R0FA 1BRCE 5DO4H 1CVWH 4YM9A 3CS0A 2ZU3A 1BIOA 2FYQA 2R3UA 4WXIA 2R2MB 1QJ1B 2TGTA 2O8WA 4KTSA 1GBFA 1AE5A 1WOFA 4K8YA 1HJ9A 1NRRH 2Y7XA 4I8GA 4NSYA 1C1SA 1ZPZA 4NZLA 4CHAB 1MTVA 3PB1E 4TY6A 1G2LA 1H9IE 3LIWA 4MQAA 1GJ4H 1WQVH 1TA2A 2HALA 1O3MA 1KXDA 1L4DA 5C5NA 1LPKB 1TPPA 3H5CB 1P2OA 1H4WA 2J4IA 4U32A 1V2MT 3RXEA 2BLOA 2FMJA 5HM2A 2ZHDA 1QB1A 5AHGH 1KTTB 1O2IA 2GDDA 1LDTT 3B9FH 1L1NA 5JPMH 1F5KU 1LHFH 1IOEA 4WY3A 2ZCLP 1GHYH 1A0HB 4X2VA 4IMQA 4CR5A 3E0NB 1HAVB 2P16A 1UO6A 3EAJA 4ABBA 5A09A 1HAXB 1FUJA 5L30H 4AYVB 2HPPH 2ZDKA 5GCHG 1KTSB 5EW1H 1EPTB 4MNXA 1QTFA 2ANKH 1UVTH 1H1BA 4K8BA 2OC0A 2OUAA 2ZHQH 3A89A 3HKIB 3ITIA 1C2IA 1LVMA 4ZKSU 3SI4H 1CGIE 1F5RA 5EQRA 3TPIZ 1N1LA 4XFQA 1GBIA 3PMJA 5FPYA 2AGEX 2O9QA 1MQ6A 5C3NA 3BTWE 3GISB 5GIBA 3RXRA 2B5TB 2AERH 3NWUA 3ZZBA 1VCPA 5C67A 5CE1A 3RM2H 4BAOB 3SOSA 3LKWA 3ATKA 1GJ6A 1Y5BT 3F6UH 2GP9B 1MBMA 1BMAA 1S6FA 1GI6A 3UOUA 1O2MA 1K9OE 1O3AA 1K1LA 1EXFA 2W3KA 1XMNB 2ZTZA 4IN1A 2D1JA 2DE8A 1ID5H 3E6PH 1XUGA 1GJBB 1HXEH 3SV2H 5HGGA 4JK6A 4ABIA 4JK5A 3M3SA 2BLWA 3A8BA 1UCYH 1TRNA 1AMHA 4X1SU 1ZRKA 1AVXA 2BMGB 1QRWA 2WINI 1S0RA 4AG1A 5GXPA 4GAWA 4X8UH 3DT0H 1MAYA 1SHHB 1V2OT 3SI3H 4NSVA 1O3OA 4FU7A 1GG6C 1FJSA 2EEKA 2ZU2A 2EI7A 3SJKA 1EZSC 3TGKE 4ZHMU 1O5BB 5JBBS 1PYTC 4BAMB 2ZKSA 1TMTH 1L1GA 1QB6A 2BD7A 2YNBA 1TAWA 1ELBA 4ZXYH 3PO1C 3PTNA 1XUJA 4ZH8A 1G36A 2SGQE 1T32A 2GMTC 3M5LA 2R0KA 4MNWA 1MTSA 3VB6A 4K1EA 1EJNA 1MTWA 2QA9E 1XUKA 3BIUH 3MH7A 3Q77A 3DFJA 1PQ5A 2A5KA 1IQJA 2J2UA 2OINA 1LQDB 1O33A 1GI4A 1RTFB 1OKXA 2W7SA 3SV8A 1GI7B 3PYHA 5DP4A 4AFSA 2IPHA 2BQ6B 2BD3A 3DUXH 2ZTXA 3LDXH 4DT7B 4UD9H 1LHDH 3M61U 3TJVA 4BANB 2ZF0H 1QL9A 1HAIH 2RG3A 4U2WA 1QURH 4TWWA 1CHGA 1O2ZA 2XRCA 5EQSA 1UTLM 1MD8A 2ZFQH 3O8BA 2PW8H 2A7CA 5A0BA 3MWIU 2ZNKH 4GHQA 1EZXC 1BRUP 1CU1A 1BITA 3GY2A 2VIQA 1KLTA 1THPB 3O8DA 1O2PA 6LPRA 1GBMA 4BXWA 3BIVH 1D6WA 1AWFH 3V0XA 1C1UH 3S9BA 1W12U 2HLCA 2QN5T 1OP2A 3DFLA 1C1VH 2V3OH 1DWCH 3E0PB 1QR3E 3IG6B 4AFQA 1A3EH 1BBRE 5F8TA 4FUGA 4WWYA 2CJIA 3LGVA 3P70B 1YPMH 3BTGE 3M35A 2FOGA 1G9IE 3A7TA 2ZGJA 3EA7A 2H9EH 1OSSA 3QZRA 1F5LA 1RJXB 1ESBA 1DLKB 2NU2E 2DUCA 1UVOA 3VXEH 2VVCA 1EZQA 3UUZA 3LJJA 4F49A 1F0TA 3KHVA 3LGUA 1IQGA 1PPHE 4B2CA 1W7GH 3H7OA 3I77A 2J92A 1EAXA 1GCTB 4FUIA 1F0SA 3F9FA 4VGCB 3UNQA 4XDEA 4CH2B 4MNYA 2A4GA 2O8MA 4K5ZA 4UDWH 4DCDA 1NU7B 1O2GH 1C4U2 2FYRA 2EC9H 1Z8IB 1G37A 1HJAB 3RXUA 1BB0B 3EGKH 1O36A 5C1UA 3RP2A 3VB5A 3M3VA 2ODYB 2PGQB 1SFIA 3PLKA 1JXPA 1ZJKA 3FZDA 1ESAA 1IQIA 2O8TA 2C8ZB 3MH6A 1KSNA 5A2MH 1GHWH 2FI5E 1KYNA 4WF8A 4TY7A 1S0QA 1BOQA 3UNSA 3ZYEA 2Y5FA 4ASHA 3RXBA 3V3MA 2R2WU 4IW4E 3MH4A 1TX6A 5ETXA 1SGFG 4ZHLU 2P94A 2FOEA 3SORA 1O3KA 1V2ST 1ANDA 1C2FA 3SGQE 1EJAA 4A92A 5EODA 1UCYK 4TWYA 1ZPBA 4GVUA 1FAXA 5T6GA 3OX7U 1AUTC 1DVAH 1E37B 5C1YA 1OWJA 1GI9B 2GX4A 1OWKA 5E2PA 4DVAU 4I33A 3T26A 2OCVB 2FX6A 2GZ9A 1K22H 1OWIA 5F6MA 1LKAA 2BXTH 1UTQA 2FOBA 1HAPH 4BAQB 1T8MA 4KGAA 1NT1A 5BRRE 2TPIZ 5EXNA 3F1SB 3A82A 1LPZB 4AOQA 1JRSA 1O2NA 3UQOA 1GJ5H 3RMNH 1GI2A 1P10A 4K1SA 3B23B 2LNCA 4FUJA 1BJUA 1GWAA 4Y8XA 3BG4C 1SLWB 4Y11E 1HIAB 3U8OH 1RIWB 1HAVA 4F4OC 7GCHF 4D7GA 2Y80A 4ZAEA 2IN2A 2WV4A 1P12E
chains in the Genus database with same CATH superfamily
1V2QT 1TGNA 1Z71A 1GBTA 4ISHH 5HXFA 2LELA 1F7ZA 2ZA5A 3FKSD 2QXGA 1J17T 1D3DB 1GHXH 1C1OA 3C1KA 1FY3A 3VPKA 4ABFA 1AB9C 3FP6E 1ZJDA 1O5GH 1GDQA 1S83A 1UHBB 2STBE 1PQ8A 3SUGA 1VITF 2J5UA 1EASA 3V7TA 4X2WA 3N7EA 2KAIA 5CHAB 1FXYA 1BRAA 3RMLH 1SG8B 1JOUB 2UUJB 1OYQA 2BVRH 1YLDA 1SGIB 3VXFH 2ANWA 1P09A 1Z8GA 4H4FA 4Y76A 2XBXA 1KXBA 2WUCA 3LGIA 1CO7E 1HYLA 3P8GA 3UNRA 3KGPA 2M5TA 2VGCB 3RXCA 2QXHA 1S5SA 3DHKH 1AFQB 2FESH 1HAOH 1PQAA 4FU8A 1FONA 1GI5A 2WHXA 1YPJH 3UQVA 1O2UA 3M7UA 3SU0A 4SGBE 2J98B 1RTKA 1SGRE 4CRGA 3SU6A 3UR6A 2GCHF 1AFEH 2AIQA 2SGDE 1ABIH 5C1XA 2JH0D 3UPEA 4THNH 2GCTB 4LZ1H 5PTPA 3PRBA 3A80A 1CQQA 2XBYA 2ULLA 2XNIA 1RGQA 1GGDC 2FX4A 1GBAA 2FTMA 1L4ZA 2BDGA 2NWNA 1WU1A 2NU1E 1N8OB 1BDAA 3U8RH 4I7YH 4NIWA 4WH8A 1QQ4A 4NIXA 1LVBA 1H8IH 2G00A 1V2JT 3RU4E 2FEQH 3A7VA 4KTCA 4MPVA 1OHHD 5K0HA 3SBKA 1P02A 1O34A 2WPMS 3FANA 1TOMH 4HI3A 3KQDA 3U9AH 2BVXH 2FOCA 5EIYA 4YOJA 1ZSKA 1MKXH 1UK2A 2C4FH 2PLXA 3FFGA 2WPDD 3RXJA 1PPFE 3SGAE 1SGPE 1Y5UT 4B76A 1K1MA 1BT7A 1Y8TA 3TH3H 2A4RA 3C27B 1V2NT 2ALVA 5GCHF 3SUEA 1TNJA 3KIDU 2OC1A 4AFZA 1O31A 3RXGA 1DY9A 2BOHB 2Z9IA 1P2JA 2QCYA 1TGBA 2G51A 4IN2A 2ANMH 2CHAB 4Y7BA 2G5VA 3ZVAA 1K1JA 1HPGA 1HV7A 3VGCB 1WXRA 5SGAE 1A5HA 1FMGA 4Q7YA 4AGJA 1SC8U 3P8NA 4D8NA 1GL0E 4CBNA 1NN6A 4ACBA 2C93B 1C5OH 4Y7AA 3ZZ7A 1QGFA 1TYNA 2ZU4A 4M7GA 3TJOA 2F3CE 1N6XA 3BTEE 2KCYA 1A0JA 2J94A 3JZ1B 1P9SA 3OYPA 1L2EA 7GCHG 1UTNA 1W0JD 4FU9A 3KN2A 2STAE 4OS7A 3ZYDA 5EXMA 1SLXB 1SBWA 2JETB 2GV7A 4X2XA 3RXAA 1CGHA 8GCHF 3SJIA 3BSQA 1QRZA 2SGFE 3E1XB 6CHAC 4KP0A 1K1IA 4NIVA 3T2NA 1ZYOA 1C5QA 4Q4LA 3E3TA 2TBSA 3GCOA 1ELCA 2VVUA 3LGWA 4OM9A 2UWPA 1TGTA 3V12A 5A8XA 2HVXA 1MU6B 2ZWLH 3GY5A 1TNLA 1RIWC 1VITG 3UFAA 4R8TB 5C0UA 2QC2A 3K6YA 1ELTA 2G81E 2YNAA 4XE4A 2A2XH 1GJCB 1K1PA 5HKKD 4LK4A 2K8IA 2BY8X 4ABAA 5B6LA 2V3MA 4J1YA 2D8WA 1C2JA 2RDLA 3RDZA 1NFWA 5K7RA 1J16A 3IWMA 3ATWA 1F0UA 1QJ7B 1XUIA 3LGTA 2RA3A 4DJZB 4DY7B 4TPIZ 1JWTA 5CHBA 1N6YA 1MU8B 1E0FD 3CP7A 3LONA 5CHAC 2BD2A 2ILNA 3GCNA 2ZU5A 1ZMLA 3MU4A 2GCHG 1TIOA 5BPEA 5TJXA 4WH6A 1C5TA 1QJ6B 3K65B 1W0KD 1SSXA 2F9BH 3E16B 3VFEA 1KXFA 2VIVA 1QL7A 1GJAB 1O30A 2ZP0H 4NGAH 4Y0ZE 1AU8A 2SGEE 5F53A 1EX3A 1KDQB 3P8OA 1FQ3A 1YBWA 1DITH 4TT3D 3P17H 4AFUA 2B9LA 1SOTA 4Q63A 1HB0B 3EQ0H 1HAGE 1LTOA 3PROA 3I29A 2TGPZ 1TPAE 5CDFE 1J9CH 3A88A 3SJOA 3HKJB 5E0GA 3SU4A 4IMZA 1LKBA 2KCOA 1BCUH 3PMBB 2GZ8A 2V7QD 2Q1JA 1MTNC 1YF4A 1DY8A 2BX3A 3ZZDA 5JBTA 1MBQA 4BAKB 1P9UA 4O9VA 2UUYA 1K1NA 1BHXF 1BRBE 2Q6GA 3GDVA 3A7WA 4WVPE 2PFEA 5GPIB 1C5SA 3KCGH 5IDKA 2XXLA 1MD7A 1BTWA 4I8JA 4LZ4B 2XBWA 5DJ7A 2B0FA 1B0EA 3SZEA 3WWFA 2H9HA 1A2CH 4RI0A 2W7UA 3SW2B 3OEED 1G3BA 5J4QA 1ABJH 1S85A 1INCA 3M5OA 3Q3XA 1YWUA 1MUEB 4Y0YE 1FZZA 1C5YB 1O2QA 2C90B 2VU8E 1ZHRA 4AB8A 1TNIA 3PWBA 1TQ7B 3QO6A 4CRCA 1C5NH 1MABB 2ZFRH 1OWDA 2ODQA 2ASUB 1TLDA 3BTME 3UAIC 3RC4A 1FI8A 3RM0H 2QXIA 2CHAC 4X2YA 1QIXB 3W95A 1EP6A 4JZ1A 3QTVH 4E7RG 1GBHA 2HNTF 3A86A 3OTPA 1OWEA 8GCHG 1BMNH 1T8OA 1K2I1 2XYAA 3FOAA 1GJ9B 2V3HH 1MKXK 2HNTC 4M9FA 3BEUA 1V2PT 4AX9H 4FXGH 2G4UA 3MNSA 4X1NU 3FAOA 2ZCHP 2ZPSA 4B73A 1O2YA 1O3FA 3BEIB 2OK5A 1CHOG 1TMUH 5DPAA 1IQNA 1ORFA 1SLVB 2BY7X 3LC5A 3ZZ5A 2YOLA 3U98H 1QBOA 1Q3XA 1XXDA 1Q31A 1FY4A 2WYJA 2XWBI 2AMDA 1GBCA 3T28A 5JDUB 2AGGX 4XOJA 1O5EH 1AZZA 4GCHF 1XVOA 3W1EA 4H6SB 4YESB 2OQ5A 2WUBA 1GMDF 1T8NA 3F9GA 3RC5A 5L6NH 5ESBA 1GI1A 1IQMA 1CA0C 3AW1A 4I32A 3HGNA 1WAYB 1O38A 4D9QA 3M7TA 4XBCA 3OY6U 1C4V2 3BTDE 1HRTH 4K2YA 2P8OC 1WV7H 1D4PB 1ANEA 2F4LA 3L3TA 1H8DH 1NC6A 2G55A 3ELAH 5DP7A 3M36A 3QTOH 4DIHH 1MCTA 2D2DA 1NESE 3Q3YA 4FUDA 5EGMA 1YYY1 1CBWB 1V2UT 3U69H 2QE7D 1S6HA 1AI8H 1YGCH 3PMHB 4R0IA 4YLUA 1PQ7A 5EW2H 1F92A 4CHAC 1RD3B 1Z7KA 4XRNA 1MTUA 2F9PA 2P3FH 3SNDA 4UFGH 1RS0A 3DSGA 4KKDA 5HM9A 4Q7XA 2ZO3H 1ETTH 1HLTH 3NKKA 1EP5A 1KXCA 4F55A 2BX4A 1ZTLA 4MPWA 2A7HA 3EA9A 1YPHC 2BDYA 2QYIA 1AWHB 2JJ1D 3MYWA 4AN7A 4K3JA 3MU1A 3UTUH 2AGIX 3N7OA 1KLJH 3TK6A 1AVGH 1JRTA 1DFPA 1QQUA 3FP7E 5EG4A 1AKSA 3LGYA 3TLOA 1ZMNA 2XCFA 5C5OA 1EAUA 1HJ8A 1G3CA 4NZQA 3SU2A 5I46H 1CA8B 4ZKRU 1NFUA 2FDAA 4ZXXH 1W3CA 1FV9A 1GJ7B 1D9IA 2FWWA 1LVYA 4GLYA 3S7HB 1B5GH 2P3UB 1CE5A 1EPTC 3MNCA 1AZ8A 1WSSH 1LHCH 1THSH 2ZIQH 1FAKH 1SKYE 5T3HA 4OS5A 4ZMAH 2P95A 4IC5A 1QA0A 7LPRA 2OXSA 1HCGA 1O3NA 2BY9X 1VR1H 3PTBA 4ZROA 3ZV8A 2FI3E 2J34A 3NRLA 3QGJA 5EPYA 2WPLS 4YLQH 2A4OA 4Y8ZA 4MG3A 4B75A 2ZFFH 1C5ZB 1YP9A 4A5TS 5ESTE 1W2KH 3ATMA 3KYGA 3BN9A 3W94A 5FBIA 4JZEH 3NUMA 1P05A 3DSPA 3OAAD 1KXEA 4FOUC 1CT0E 3SQHE 2PKSB 1AVWA 4Z0KA 4ZKOU 3I78A 3SU5A 8ESTE 1MMJN 5T6DA 2BTCE 4JYTA 1G32B 1MKWH 2FLBH 2PKAA 4DG4A 5A8YA 1DM4B 1K21H 1IQEA 4GCHG 4INKA 1S84A 1JIMA 4CRBA 3RU4D 1HAHH 1F2SE 1GMDG 5F8XA 3SNEA 9ESTA 3RXKA 2CF8H 1O3IA 1O2OA 1XM1A 2JIZD 4D9RA 2A7JA 1SGEE 1AUJA 4OS1A 1UTOA 2K0QA 4Y79A 3RUOA 3TH4H 4UEHH 3H7TA 3KQBA 3URCA 5LPEA 2UWOA 4U01A 3RXFA 5CMXH 3QWCH 1W14U 2F91A 3ZV9A 4JCNA 3GCHB 1IAUA 4D76A 4DGJA 2BZAA 1FIWA 2PTNA 3GY3A 3HPTB 1V2RT 2O8LA 1C5RA 2VIOA 1V2VT 1TGCA 3ZZ3A 3S0NA 2H6MA 3TU7H 2DE9A 1EAIA 2ZC9H 4MNVA 1O3PB 2P59A 3SO3A 1C1WH 3K2UA 2FP7B 2WPHS 1XUFA 2Y6TA 1ZRBA 3URDA 3G01A 3KEEA 3TNSA 7KMEH 3NPSA 1WUNH 5DP3A 1P04A 3RMMH 2FODA 2A2QH 4Y6DA 1A0LA 2XWAA 1JMOH 4RKOB 5HYOA 2Z3DA 2A5IA 1TNHA 2Z3EA 4FUFA 2ZGCA 3BV9B 1YCPH 1LHGH 3A87A 3RXQA 1MAXA 5E2OA 1ZMJA 4FVBA 2PV9B 4ISLA 4UONA 3PLBA 2NU4E 2ANYA 2CF9H 2L6OA 2FOMB 4B74A 4DIIH 4NWKA 2TIOA 1QHRB 2FOFA 1P01A 1IQKA 5F8ZA 2KFWA 3CS7A 1KMHB 3SV6A 2XNDD 2BOKA 1GJDB 1UTKA 1V2WT 1V6DA 2Z9GA 4NA8A 2RA0A 1TWXB 1A4WH 1UMAH 1EPTA 2FZZA 2VH0A 3KQ5A 3OFND 4ACAA 4CRAA 1O3GA 1D3QB 3RXDA 1FLEE 3BG8A 5GNDA 4AZ2B 1P8VC 4UFDH 3UY9A 1O3HA 2GT8A 4H42U 1H9HE 1UTPA 5JB8S 5FL7D 1K28D 2WPIS 4E06H 2WYGA 1C1QA 3IITA 1FNIA 1GBBA 1BTZA 1C5LH 2ZDLA 3K6ZA 3EDXB 2AS9A 4DW2U 2W6JD 1GDNA 1GHVH 3OEHD 1ELVA 5DP8A 1BJVA 4RSPA 3ZVFA 1C4Y2 1BTYA 1DSUA 4JZDH 4ISNA 2XOKD 1C2HA 4BTIB 1TX7A 1J8AA 1VGCB 2BVSH 2QF0A 1CGJE 1LPGB 2HWLB 2XW9A 4Z6AH 2FOAA 1TOCB 2YMSD 4NIYA 3KQEA 2BD9A 4Y10E 3TNTA 4ABEA 1DXPA 1Z8RA 1ZTKA 4ZUHA 1OP0A 1GCTC 3FZZA 2AFQB 4CRFA 4VGCC 1BBRH 2J97A 3ZVCA 5GWZA 2ZQ1A 3LC3A 1OYTH 2QIQA 4XBDA 3F68H 2J38A 3KNXA 2H2ZA 3OY5U 2WPJS 2F9UA 2PGBB 1HJAC 1GBLA 4JMYA 1BTXA 1YPGH 4UFEH 3P92A 4YT7H 1FIZA 4X8TH 1UTJA 1C1PA 4I8LA 2UUFB 2OBQA 1AGJA 4U30A 1P3CA 4B71A 4YXWD 7ESTE 4INHA 1EB1H 4CREA 8LPRA 2QAAA 3CNRA 2PR3A 1QY6A 3MNXA 1BZXE 2W5EA 2J9NA 1MKWK 5FPTA 2FI4E 1GBEA 1BHXB 5HIYA 1SGTA 1TNKA 2NU0E 3GY8A 3T29A 2SGAA 5JBAS 1C5XB 3ODDA 4GUXA 3NXPA 5LPFA 1ZOMA 3KF2A 4AYYB 4OS6A 1E34B 5DP9A 1WYKA 3OSYA 2XC0A 5DP5A 3AASA 1TABE 2C8XB 1O2KA 1TRYA 3SJ9A 2F9OA 2ZHWH 5DGJA 5L2YH 3UR9A 1UCYE 2JH6D 2QF4A 1ACBE 1FY1A 5EXLA 2VIDA 3TIUA 4DURA 1C2MA 1PYTD 1W8BH 1YM0A 3PLPA 2ZQ2A 3AAVA 2WV5A 3SNAA 5A8ZA 2GT7A 2ZHFH 1YLCA 5HMAA 1PPZA 1D3TB 5DP6A 4NWLA 1SQRA 2A32A 4IGDA 5EJ1A 1A61H 1DSTA 5ABWA 2V6NA 2FO9A 2IOTA 3UB0A 1HNEE 1O2HA 1TGSZ 2BY6X 4A1XA 1V2TT 2C3SA 3M5NA 6ESTA 2BB4A 4FVDA 4A1TA 2TRMA 3E8LA 1ZSLA 3RXMA 1O2JA 4WMEA 1THRH 1SLUB 2A0QB 1O5AB 2GZ7A 4I8HA 2F9NA 1CHOF 1LO6A 1O2XA 1ETSH 1XKBC 3MO3A 4K60A 2JH5D 3VEQB 1DX5M 1GG6B 3ENSB 3TJNA 1ZHPA 1F0RA 3FP8E 3WY8A 1S82A 1QRXA 2BZ6H 4DOQA 1GHAF 1O3EA 1G2MA 1X7AC 1YCPK 2VH6A 2ZFPH 3T27A 5C2ZA 3AW0A 3EYDA 1LVOA 1UVPA 3MHWU 2UWLA 1L0ZA 1P2MA 1HUTH 1EZUC 2XCNA 1M9UA 3PO1B 4FUHA 3BTFE 4AGKA 4FUCA 5E0HA 1VJ9U 2GMTB 2FS9A 3SHCH 1O2TA 2QF3A 3RC6A 1BQYA 1ZZZA 2PSYA 2ZGXH 2BLVA 1PPBH 4O03A 3RXLA 1AY6H 2VWLA 3A7YA 3OE7D 4PROA 2OQUA 4ZHAA 4Y8YA 5TCCA 3STIA 1VITH 4TPYA 3SUFA 3PMAB 2EI8A 4INLA 1TA6A 5DKMA 2PSXA 2SFAA 2OC7A 1W7XH 4IS5A 2QGRA 4JYUH 1VGCC 2VGCC 5FPSA 1W0ZU 1AFQC 3A85A 1B0FA 2BD4A 3A7XA 2ZPQA 4MPUA 5LGOA 2XTTB 4OS2A 1KY9A 1BA8B 2ZPRA 4JYVH 1P03A 4AORA 2GKVE 1O3LA 1C9TA 1FN6A 3GY7A 2Z3CA 1C9PA 1GMHG 1AIXH 1BUIA 1ZLRA 1SHYA 2GCTC 1C5MD 1COWD 3BTHE 1ARBA 1GI0A 3MNBA 1SI5H 2EI6A 2FM2A 1GMCF 2SGPE 1QA7A 2BD5A 3NK8A 2CGAA 4A1VA 1N8OC 4ZKNU 1HAYB 2H1UA 2R3YA 1EAWA 2VIPA 3QZQA 1E38B 1HFDA 5JYIA 2OC8A 4BNRA 3RU4T 1NBME 2ODPA 1WTGH 1WTHD 1V2LT 2ZEBA 2VB0A 1P2QA 3ZVGA 4H6TA 1C2EA 3MH5A 3QDZB 1A5IA 1PJPA 2V35A 3JZ2B 2ZFSA 1O3DA 2Z9KA 2FXRA 1Z1JA 1ELDE 1BBRK 2BYAX 2C8YB 2Z6BD 1GBKA 2HNTE 1CSOE 1XUHA 4P02A 4WMDA 2KM0A 3SV7A 1MQ5A 3RLWH 2F43B 3SU1A 1UJ1A 2BQWB 2BLQA 1RTLA 2FLRH 3UIRA 1GJ8B 2ZGBH 1TE0A 4GPGA 1SQOA 2PWXA 1C2GA 1NRQH 3VGCC 1LMWB 4ABGA 4X6NA 1C2KA 3SN8A 1GCDA 2KAIB 1NFXA 2ZDAH 4X1PU 1NS3A 1AHTH 4O3TA 1ELFA 1JBUH 2THFB 1UTMA 3A7ZA 3MU8A 1EB2A 1O37A 2WSSD 3ZZAA 4CR9A 1TB6H 5C17A 4X6MA 1MZAA 5FHTA 5T1VA 1O32A 1HIAA 4K69A 4B1TA 1LCYA 3H09A 1YPEH 2ZFTA 2BDIA 3HGPA 3U1JB 1O2VA 3GCTG 3U1IB 3SNCA 1J15A 1G3EA 4JZIA 1UVUH 1TX8A 1DICA 1DPOA 4X8VH 2JETC 2M2AA 1W13U 2J95A 2ESTE 4TYDA 3SNBA 4OGYA 2TGDA 1IHSH 1AE8H 2XBVA 3NCLA 1TNGA 3Q3KA 4AC9A 1P2KA 1GHAG 2O8UA 1P3EA 2CN0H 2IJOB 2LP6A 1ZHMA 2Z94A 3GY4A 1NROH 1SQAA 1O5CB 1XXFA 5C0TA 1UHBA 1Y3YA 1DUEA 4YT6H 4ISIH 1AO5A 2FIRH 1TPOA 3OTJE 3HK3B 3TGIE 3LJOA 3QUMP 3ZZ9A 1E79D 1V3XA 4X8SH 2Y7ZA 3R3GB 1NO9H 3LU9B 2W26A 3BEFB 1K0HA 3FVFB 1SGYE 3PWCA 1GBDA 3B8JA 3BTKE 3KYFA 2BXUH 1W11U 4YZUA 2A1DB 1C5UA 4MPXA 1GHBF 2BDCA 3KL6A 2P3TB 3GY6A 1IQLA 2GGVB 1O0DH 2H5DA 1YPHE 4X6PA 2J98A 3MTYA 1TALA 2FS8A 1SQTA 3SV9A 1E1QD 1T31A 2A31A 3SZNA 1J14A 3T5FH 4HFPB 2Y82A 4ABJA 4UFFH 5F03A 4MTBA 4ABDA 1OS8A 5TCAA 2PTCE 4KELA 5C94A 1GMCG 2Y5HA 4WXVA 3ZVDA 3A84A 2WV9A 3PRDA 4BAHB 1C5VA 4RT0A 3QLPH 1QBNA 3KQCA 1HDTH 1MH0A 4X1QU 2NU3E 4BTUB 1Z8JB 4BOHA 4MLFB 1SGNE 1TQ0B 3EE0B 2Q6DA 3ATLA 2ZHEH 1HAZB 4NG9H 2KCAA 2Y5GA 2KCPA 2EY4C 3HATH 3P8FA 4WMFA 3D65E 2C8WB 1LQEA 2IJD1 3HK6B 3MOCA 1SGDE 3BG4B 3LPRA 1P57B 3ZVBA 1O3BA 1Y3VA 1T7CA 1C2DA 2VINA 2VJ1A 3MO6A 1LHEH 3GDSA 5G4BA 3QN7A 2HPQH 1NZQH 1O3JA 3RXSA 2ZTYA 3F2FA 5DK1A 4ESTE 1KXAA 4I86A 1EKBB 1IHTH 3E90B 3RXVA 4K1TA 1O2LA 1OP8A 4ABHA 4MVNA 2H5CA 3VB3A 3L33A 1AB9B 3CENA 2SNWA 1TONA 1C1NA 1OWHA 1DOJA 3DA9B 1IQFA 1FDPA 3U8TH 5FCKA 3M7QA 5AF9H 2G4TA 2FPZA 2AEIH 4HTCH 1SL3A 5A0AE 2Q6FA 5AFYH 1AQ7A 1D6RA 1FPHH 3EA8A 1QZ8A 1TRMA 1RXPA 3F9HA 3MFJA 1ETRH 3MO9A 2CV3A 4A7IB 2OBOA 2ZI2H 3TGJE 2UUKB 1WDIA 3QK1A 2GTBA 2H9TH 1DANH 3A8DA 2BM2A 4KTUA 1P0SH 1IQHA 4WJG2 1DLEA 3ATIA 5GJ4B 3GDUA 1UVSH 1FX0B 1DWEH 3VB4A 3D62A 1Y3UA 1SR5C 3QX5H 3GICB 2GJGA 2F9VA 1E1RD 4NFEA 1KLIH 5T6FA 3RXHA 1PPEE 2BDHA 1GGDB 2ZGHA 1FY5A 4XD7D 3S7KB 3A83A 1NPMA 5IYTA 2B8OH 3LT3A 2CMYA 3P6ZB 1UK4A 2VWOA 1D3PB 4NA9H 9LPRA 3BTQE 1C5PA 5AVDA 4B2AA 4BTTB 4P00A 5FX5A 5FBEA 3PV4A 1GI8B 3S69A 1GHBG 1QL8A 3ZVEA 4J2YB 3EE7A 2BY5X 1CT4E 1WBGB 3N7DA 3SJ8A 1EJMA 5A0CA 2VBCA 1DWBH 2Z7FE 3RXTA 2Z9JA 2D26C 1W10U 2VWMA 1ZPCA 1PPGE 1ZGVA 1Y59T 2WPKS 5FCRA 2ZG0H 1BTPA 1SMFE 3A8AA 1TBQH 4IBLH 4NFFA 3GYLB 1SGFA 3VB7A 1NY22 3AVZA 1KDQA 1TBRH 1P11E 3GOVB 1CBWC 1ESTA 1A1RA 1YPKH 3MI4A 5DG6A 1VCWA 1VZQH 1E36B 3V13A 1C1RA 2GDEH 3BTTE 4CRDA 4LOYH 4YTAA 1V2KT 1O2RA 2ZZUH 1Z6EA 1A46H 3TVJB 3OU0A 5B6OA 1AN1E 1GVLA 1ZTJA 3T25A 4AB9A 4UE7H 3MQKC 1QB9A 4HZHA 2XC5A 2GD4B 1QCPA 4I8KA 2ZU1A 3M5MA 3MU5A 1EFRD 2HRVA 2QY0B 3F9EA 4XSKU 2W3IA 2A4QA 1MCVA 4GSOA 2OTVA 6CHAB 2I6QA 2TGAA 4O97A 1C5WB 1GVZA 2FTLE 2ALPA 1C1MA 1O3CA 5E8EH 4RN6A 4X0WU 5H4IB 3ZZCA 1O2SA 5EU8A 3SHAH 1U6QA 2VNTA 5LH8A 1P2IA 3UOPA 4LXBH 1ZR0A 3STJA 1T8LA 2V0BA 4A6LA 1BTUA 1SFQB 1GPZA 1SOZA 3K9XB 4NCYA 3UWJH 3RLYH 1WQSA 3MU0A 2R0LA 4XBBA 2AH4X 3S9AA 3QGNB 1SPJA 5LPRA 1A5GH 2A45B 1S81A 4B6FA 1DWDH 2OD3B 2ZCKP 3F3BA 3GYMA 2CXVA 1GDUA 1P2NA 5AFZH 3O8CA 1K1OA 3A8CA 5EJLA 3UREA 1RRKA 5L2ZH 2BDBA 4AG2A 1TMBH 1YLNA 4Q2KA 3T62A 4E05H 4F48B 4MDSA 3E91A 1MZDA 1NRNH 4IC6A 8KME2 1GBJA 4DT4A 1SVPA 3P95A 1DDJA 1TPSA 4CH8B 1GI3A 1PPCE 5C20A 2JJ2D 1EUFA 1QFKH 2HGTH 6GCHF 2CK3D 1A7SA 2G5NA 1SGCA 1TBZH 1Y3XA 3MMGA 1XX9A 2HOBA 1NRSH 2PHBA 4FUEA 1DXWA 4X1RU 1EQ9A 2BDAA 2LPRA 2PKSC 2HVYB 2GVFA 1W0YH 3DD2H 1FY8E 5I25A 3SYJA 1ANCA 3NZIA 2KR7A 5J4SA 4Q80A 4FUBA 1NU9A 1NBMD 1L1JA 5IK2D 4ISOA 2QXJA 3ZZ8A 3Q76A 2A5AA 2AYWA 5GDSH 2AMPA 2SNVA 3PM3A 3O8RA 2BQ7B 1WCZA 1GMHF 1DE7H 1AD8H 2XC4A 3ODFA 1A3BH 1UK3A 1SGQE 1BMMH 3SGBE 1ELEE 2G52A 1MTNB 1O5FH 1ZSJA 1B7XB 4RKJB 5FXLA 1EOLA 1GL1A 1ARCA 1KIGH 2K1QA 3TITA 3D49H 4D7FA 2QV1A 2YMSB 1PFXC 2B7DH 2EA3A 1DT2A 5FAHA 2R9PA 1BMFD 1T4VH 3GCHC 1AKSB 4HGCA 1HGTH 3SQEE 1DUAA 3M3TA 4ZCNA 1QNJA 1HXFH 2Z9LA 4OS4A 1XVMA 1Y5AT 2ZDNA 1VCQA 1E35B 3WWBA 1FN8A 1FPCH 3TK5A 3L6PA 3LH1A 5HIZA 3BF6H 2FOHA 1EATA 5E0JA 4NA7A 3ZZ6A 2G8TA 4Q7ZA 1QBVH 1ELGA 4E7NA 1ANBA 2AIPA 1OXGA 5EQQA 3AAUA 3Q00A 4Y71A 2ZDMA 4GHTA 3ZIAD 1YKTA 2JKHA 3TJUA 1XKAC 5KEDA 2F83A 5EPNA 1NFYA 2OLGA 1Z6JH 2VVVA 3A81A 2PUXB 5FX6A 2L74A 3TK9A 1OX1A 4YOIA 4QT8C 1YPLH 1VJAU 2I6SA 3ESTA 1O2WA 2OP9A 1TFXA 2JDID 3RXOA 3UWIA 1YC0A 1ZGIA 2BHGA 3TH2H 1G3DA 2Y81A 3D23A 3GCTF 4OGXA 1Y3WA 4YO9A 5JBCS 1NRPH 2RCEA 4X6OA 2PUQH 4CBOA 3ZZ4A 1OOKB 1NTPA 4SGAE 2PKAB 3LH3A 3SUDA 1O35A 1EOJA 1GHZA 1S6LA 2P93A 4I31A 3LOXA 1YCPM 2VWNA 1BMLA 2BD8A 1SB1H 2ZECA 2AMQA 1Q2WA 1RFNA 1T4UH 1ELAA 4YOGA 1CA0B 1O39A 1G30B 3RXIA 3M37A 3AK5A 1DS2E 1JIRA 5JB9S 3RMOH 1CT2E 2ZDVH 6GCHG 4O3UA 2P8OB 2VIWA 3S9CA 5EOKA 3RXPA 1P06A 1Z1IA 1HBTH 1H9LB 1C2LA 1GVKB 4B2BA 1BTHH 1NM6A 1OPHB 2GV6A 4JZFH 3SU3A 1C1TA 4BXSA 1O5DH 3R0FA 1BRCE 5DO4H 1CVWH 4YM9A 5KGOA 3CS0A 2ZU3A 2WZQA 1BIOA 2FYQA 2R3UA 4WXIA 2R2MB 1QJ1B 2TGTA 2O8WA 4KTSA 1GBFA 3DSOA 1AE5A 1WOFA 4K8YA 1HJ9A 1NRRH 2Y7XA 4I8GA 4NSYA 1C1SA 1ZPZA 4NZLA 4CHAB 1MTVA 3PB1E 4TY6A 1G2LA 1H9IE 2AHME 3LIWA 4MQAA 5KECA 1GJ4H 1WQVH 1TA2A 2HALA 1O3MA 1KXDA 1L4DA 5C5NA 1LPKB 1TPPA 3H5CB 1P2OA 1H4WA 2J4IA 4TSFD 4U32A 2RFKC 1V2MT 3RXEA 2BLOA 2FMJA 5HM2A 2ZHDA 1QB1A 5AHGH 1KTTB 1O2IA 5DN6D 2GDDA 1LDTT 3B9FH 1L1NA 5JPMH 1F5KU 2PP6A 1LHFH 1IOEA 4WY3A 2ZCLP 1GHYH 1A0HB 4X2VA 4IMQA 4CR5A 3E0NB 1HAVB 3PV5A 2P16A 1UO6A 3EAJA 4ABBA 5A09A 1HAXB 1FUJA 5L30H 4AYVB 2HPPH 2ZDKA 5GCHG 1KTSB 5EW1H 1EPTB 4MNXA 1QTFA 2W6ID 2ANKH 1UVTH 1H1BA 4K8BA 2OC0A 2YMSC 2OUAA 2ZHQH 3A89A 3HKIB 3ITIA 1C2IA 1LVMA 4ZKSU 3SI4H 1CGIE 1H8HD 1F5RA 3F0OA 5EQRA 3TPIZ 1N1LA 4XFQA 1GBIA 3PMJA 5FPYA 2AGEX 2KZ4A 1MQ6A 2O9QA 3BTWE 3GISB 5GIBA 3RXRA 2B5TB 5C3NA 2AERH 3NWUA 3ZZBA 1VCPA 5C67A 5CE1A 3RM2H 4BAOB 3SOSA 3LKWA 3ATKA 1GJ6A 1Y5BT 3F6UH 2GP9B 1MBMA 1BMAA 1S6FA 1GI6A 3UOUA 1O2MA 1K9OE 1O3AA 1K1LA 3FO8D 1EXFA 2W3KA 1XMNB 2ZTZA 2KX4A 4IN1A 2D1JA 1VKYA 2DE8A 1ID5H 3E6PH 1XUGA 1GJBB 1UW7A 3FN8A 3F2HA 1HXEH 3SV2H 5HGGA 4JK6A 4ABIA 4JK5A 3M3SA 2BLWA 3A8BA 1UCYH 1TRNA 1AMHA 4X1SU 1ZRKA 2HLDD 1AVXA 2BMGB 1QRWA 2WINI 1S0RA 4AG1A 5GXPA 4GAWA 4X8UH 3DT0H 2QF5A 1MAYA 1SHHB 1V2OT 3SI3H 4NSVA 1O3OA 4FU7A 1GG6C 1FJSA 2EEKA 2ZU2A 2EI7A 3SJKA 1EZSC 3TGKE 4ZHMU 1O5BB 5JBBS 1PYTC 4BAMB 2ZKSA 1TMTH 3F0PA 1L1GA 1QB6A 5EJZA 2BD7A 2YNBA 1TAWA 1ELBA 4ZXYH 3PO1C 3PTNA 1XUJA 4ZH8A 1G36A 2SGQE 1T32A 2GMTC 3M5LA 2R0KA 4MNWA 1MTSA 3VB6A 4K1EA 1EJNA 1MTWA 3U28C 2QA9E 1XUKA 3BIUH 3MH7A 3Q77A 3DFJA 1PQ5A 2A5KA 1IQJA 2J2UA 2OINA 1LQDB 1O33A 1GI4A 1RTFB 1OKXA 2W7SA 3SV8A 4HG6A 1GI7B 3PYHA 5DP4A 4AFSA 2IPHA 2BQ6B 2BD3A 3DUXH 2ZTXA 3LDXH 4DT7B 4UD9H 1LHDH 3M61U 3TJVA 4BANB 2ZF0H 1QL9A 1HAIH 2RG3A 4U2WA 1QURH 4TWWA 1CHGA 1O2ZA 2XRCA 5EQSA 1UTLM 1MD8A 2IPQX 2ZFQH 3O8BA 2PW8H 3F2GA 3WW7A 2A7CA 5A0BA 3MWIU 2ZNKH 4GHQA 1EZXC 1BRUP 4B6EA 1CU1A 1BITA 4Z1MD 3GY2A 2VIQA 1KLTA 1THPB 3O8DA 1O2PA 6LPRA 1GBMA 4BXWA 3BIVH 1D6WA 1AWFH 3V0XA 1C1UH 3S9BA 1W12U 2HLCA 2QN5T 1OP2A 3DFLA 1C1VH 2V3OH 1DWCH 3E0PB 3N99A 3GS9A 1QR3E 3IG6B 4AFQA 1A3EH 1BBRE 5F8TA 4FUGA 4WWYA 2CJIA 3LGVA 3P70B 1YPMH 5DSFA 3BTGE 3M35A 2FOGA 1G9IE 3A7TA 2ZGJA 3EA7A 2H9EH 1H8ED 1OSSA 1F5LA 3QZRA 1RJXB 1ESBA 1DLKB 2NU2E 2DUCA 1UVOA 3VXEH 2VVCA 1EZQA 3UUZA 3LJJA 4F49A 1F0TA 3KHVA 3LGUA 1IQGA 1PPHE 4B2CA 3VG8A 1W7GH 3H7OA 3I77A 2J92A 1EAXA 1GCTB 4FUIA 1F0SA 3F9FA 4VGCB 3UNQA 4XDEA 4CH2B 4MNYA 2A4GA 2O8MA 4K5ZA 4UDWH 4DCDA 1NU7B 1O2GH 1C4U2 2FYRA 2EC9H 1Z8IB 1G37A 1HJAB 3RXUA 1BB0B 3EGKH 1O36A 5C1UA 3RP2A 3VB5A 3M3VA 2ODYB 2PGQB 1SFIA 3PLKA 4RT1A 1JXPA 1ZJKA 2EQNA 1ESAA 1IQIA 2O8TA 2RDEA 3FZDA 2C8ZB 3MH6A 1KSNA 5A2MH 1GHWH 2FI5E 1KYNA 4WF8A 4TY7A 1S0QA 3DCLA 1BOQA 3UNSA 3ZYEA 2Y5FA 4ASHA 3RXBA 3V3MA 2R2WU 4IW4E 3MH4A 1TX6A 5ETXA 1SGFG 4ZHLU 2P94A 2FOEA 3SORA 1O3KA 1V2ST 1ANDA 1C2FA 3PV2A 3SGQE 1EJAA 4A92A 5EODA 1UCYK 4TWYA 1ZPBA 4GVUA 1FAXA 5T6GA 3OX7U 1AUTC 1DVAH 1E37B 5C1YA 1OWJA 1GI9B 2GX4A 1OWKA 5E2PA 4DVAU 4I33A 3T26A 2OCVB 2FX6A 2GZ9A 1K22H 1OWIA 5F6MA 1LKAA 2BXTH 1UTQA 2FOBA 1HAPH 4BAQB 1T8MA 4KGAA 1NT1A 5BRRE 2TPIZ 5EXNA 3F1SB 3A82A 1LPZB 4AOQA 1JRSA 1O2NA 3UQOA 1GJ5H 3RMNH 1GI2A 1P10A 4K1SA 3B23B 2LNCA 4FUJA 1BJUA 1GWAA 4Y8XA 3BG4C 4FETA 1SLWB 1YY3A 4Y11E 1HIAB 3U8OH 1RIWB 1HAVA 4F4OC 7GCHF 4D7GA 2Y80A 4ZAEA 2IN2A 2WV4A 4ASUD 1P12E
chains in the Genus database with same CATH topology
1V2QT 1TGNA 1Z71A 1GBTA 4ISHH 5HXFA 1F7ZA 2ZA5A 2QXGA 1J17T 1D3DB 1GHXH 1C1OA 3C1KA 1FY3A 3VPKA 4ABFA 1AB9C 3FP6E 1ZJDA 1O5GH 1GDQA 1S83A 1UHBB 2STBE 1PQ8A 3SUGA 1VITF 1EASA 3V7TA 4X2WA 2KAIA 5CHAB 1FXYA 1BRAA 3RMLH 1SG8B 1JOUB 2UUJB 1OYQA 2BVRH 1YLDA 1SGIB 3VXFH 2ANWA 1P09A 1Z8GA 4H4FA 4Y76A 2XBXA 1KXBA 2WUCA 3LGIA 1CO7E 1HYLA 3P8GA 3UNRA 3KGPA 2M5TA 2VGCB 3RXCA 2QXHA 1S5SA 3DHKH 1AFQB 2FESH 1HAOH 1PQAA 4FU8A 1FONA 1GI5A 3UQVA 1YPJH 1O2UA 3M7UA 3SU0A 4SGBE 1RTKA 1SGRE 4CRGA 3SU6A 3UR6A 2GCHF 1AFEH 2AIQA 2SGDE 1ABIH 5C1XA 2JH0D 3UPEA 4THNH 2GCTB 4LZ1H 5PTPA 3A80A 1CQQA 2XBYA 2ULLA 2XNIA 1RGQA 1GGDC 2FX4A 1GBAA 2FTMA 1L4ZA 2BDGA 2NWNA 1WU1A 2NU1E 1N8OB 1BDAA 3U8RH 4I7YH 4NIWA 4WH8A 1QQ4A 4NIXA 1LVBA 1H8IH 2G00A 1V2JT 3RU4E 2FEQH 3A7VA 4KTCA 4MPVA 5K0HA 3SBKA 1P02A 1O34A 2WPMS 3FANA 1TOMH 4HI3A 3KQDA 3U9AH 2BVXH 2FOCA 4YOJA 1ZSKA 1MKXH 1UK2A 2C4FH 2PLXA 3FFGA 3RXJA 1PPFE 3SGAE 1SGPE 1Y5UT 4B76A 1K1MA 1BT7A 1Y8TA 3TH3H 2A4RA 3C27B 1V2NT 2ALVA 5GCHF 3SUEA 1TNJA 3KIDU 2OC1A 4AFZA 1O31A 3RXGA 1DY9A 2BOHB 2Z9IA 1P2JA 2QCYA 1TGBA 2G51A 4IN2A 2ANMH 2CHAB 4Y7BA 2G5VA 3ZVAA 1K1JA 1HPGA 1HV7A 3VGCB 5SGAE 1A5HA 1FMGA 4Q7YA 4AGJA 1SC8U 3P8NA 4D8NA 1GL0E 4CBNA 1NN6A 2C93B 1C5OH 4Y7AA 3ZZ7A 1QGFA 1TYNA 2ZU4A 4M7GA 3TJOA 2F3CE 1N6XA 3BTEE 1A0JA 2J94A 3JZ1B 1P9SA 3OYPA 1L2EA 7GCHG 1UTNA 4FU9A 3KN2A 2STAE 4OS7A 3ZYDA 5EXMA 1SLXB 1SBWA 2JETB 2GV7A 4X2XA 3RXAA 1CGHA 8GCHF 3SJIA 3BSQA 1QRZA 2SGFE 3E1XB 6CHAC 4KP0A 1K1IA 4NIVA 3T2NA 1ZYOA 1C5QA 3E3TA 2TBSA 3GCOA 1ELCA 2VVUA 3LGWA 2UWPA 1TGTA 3V12A 5A8XA 2HVXA 1MU6B 2ZWLH 3GY5A 1TNLA 1RIWC 1VITG 3UFAA 4R8TB 2QC2A 3K6YA 1ELTA 2G81E 2YNAA 4XE4A 2A2XH 1GJCB 1K1PA 4LK4A 2BY8X 4ABAA 4J1YA 2D8WA 1C2JA 2RDLA 3RDZA 1NFWA 5K7RA 1J16A 3IWMA 3ATWA 1F0UA 1QJ7B 1XUIA 3LGTA 2RA3A 4DJZB 4DY7B 4TPIZ 1JWTA 1N6YA 1MU8B 1E0FD 3CP7A 3LONA 5CHAC 2BD2A 2ILNA 3GCNA 2ZU5A 1ZMLA 3MU4A 2GCHG 1TIOA 5BPEA 5TJXA 4WH6A 1C5TA 1QJ6B 3K65B 1SSXA 2F9BH 3E16B 3VFEA 1KXFA 2VIVA 1QL7A 1GJAB 1O30A 2ZP0H 4NGAH 4Y0ZE 1AU8A 2SGEE 1EX3A 1KDQB 3P8OA 1FQ3A 1YBWA 1DITH 3P17H 4AFUA 2B9LA 1SOTA 1HB0B 3EQ0H 1HAGE 1LTOA 3PROA 3I29A 2TGPZ 1TPAE 1J9CH 3A88A 3SJOA 3HKJB 5E0GA 3SU4A 4IMZA 1LKBA 1BCUH 3PMBB 2GZ8A 2Q1JA 1MTNC 1YF4A 1DY8A 2BX3A 3ZZDA 5JBTA 1MBQA 4BAKB 1P9UA 4O9VA 2UUYA 1K1NA 1BHXF 1BRBE 2Q6GA 3GDVA 3A7WA 4WVPE 2PFEA 5GPIB 1C5SA 3KCGH 5IDKA 2XXLA 1MD7A 1BTWA 4I8JA 4LZ4B 2XBWA 5DJ7A 2B0FA 1B0EA 2H9HA 1A2CH 2W7UA 3SW2B 1G3BA 5J4QA 1ABJH 1S85A 1INCA 3M5OA 3Q3XA 1MUEB 4Y0YE 1FZZA 1C5YB 1O2QA 2C90B 2VU8E 1ZHRA 4AB8A 1TNIA 3PWBA 1TQ7B 3QO6A 4CRCA 1C5NH 2ZFRH 1OWDA 2ODQA 2ASUB 1TLDA 3BTME 3RC4A 1FI8A 3RM0H 2QXIA 2CHAC 4X2YA 1QIXB 3W95A 1EP6A 4JZ1A 3QTVH 4E7RG 1GBHA 2HNTF 3A86A 1OWEA 8GCHG 1BMNH 1T8OA 1K2I1 2XYAA 1GJ9B 2V3HH 1MKXK 2HNTC 3BEUA 1V2PT 4AX9H 4FXGH 2G4UA 3MNSA 4X1NU 3FAOA 2ZCHP 2ZPSA 4B73A 1O2YA 1O3FA 3BEIB 1CHOG 1TMUH 5DPAA 1IQNA 1ORFA 1SLVB 2BY7X 3LC5A 3ZZ5A 2YOLA 3U98H 1QBOA 1Q3XA 1XXDA 1Q31A 1FY4A 2WYJA 2XWBI 2AMDA 1GBCA 3T28A 5JDUB 2AGGX 4XOJA 1O5EH 1AZZA 4GCHF 1XVOA 4H6SB 4YESB 2OQ5A 2WUBA 1GMDF 1T8NA 3F9GA 3RC5A 5L6NH 5ESBA 1GI1A 1IQMA 1CA0C 3AW1A 4I32A 3HGNA 1WAYB 1O38A 4D9QA 3M7TA 4XBCA 3OY6U 1C4V2 3BTDE 1HRTH 4K2YA 2P8OC 1WV7H 1D4PB 1ANEA 3L3TA 1H8DH 1NC6A 2G55A 3ELAH 5DP7A 3M36A 3QTOH 4DIHH 1MCTA 2D2DA 1NESE 3Q3YA 4FUDA 5EGMA 1YYY1 1CBWB 1V2UT 3U69H 1S6HA 1AI8H 1YGCH 3PMHB 4R0IA 4YLUA 1PQ7A 5EW2H 1F92A 4CHAC 1RD3B 1Z7KA 1MTUA 2F9PA 2P3FH 3SNDA 4UFGH 1RS0A 4KKDA 5HM9A 4Q7XA 2ZO3H 1ETTH 1HLTH 3NKKA 1EP5A 1KXCA 2BX4A 1ZTLA 4MPWA 2A7HA 3EA9A 1YPHC 2BDYA 2QYIA 1AWHB 3MYWA 4AN7A 4K3JA 3MU1A 3UTUH 2AGIX 3N7OA 1KLJH 3TK6A 1AVGH 1JRTA 1DFPA 1QQUA 3FP7E 5EG4A 1AKSA 3LGYA 3TLOA 1ZMNA 2XCFA 5C5OA 1EAUA 1HJ8A 1G3CA 4NZQA 3SU2A 5I46H 1CA8B 4ZKRU 1NFUA 2FDAA 4ZXXH 1W3CA 1FV9A 1GJ7B 1D9IA 2FWWA 1LVYA 4GLYA 3S7HB 1B5GH 2P3UB 1CE5A 1EPTC 3MNCA 1AZ8A 1WSSH 1LHCH 1THSH 2ZIQH 1FAKH 5T3HA 4OS5A 4ZMAH 2P95A 4IC5A 1QA0A 7LPRA 2OXSA 1HCGA 1O3NA 2BY9X 1VR1H 3PTBA 4ZROA 3ZV8A 2FI3E 2J34A 3QGJA 5EPYA 2WPLS 4YLQH 2A4OA 4Y8ZA 4MG3A 4B75A 2ZFFH 1C5ZB 1YP9A 4A5TS 5ESTE 1W2KH 3ATMA 3BN9A 3W94A 5FBIA 4JZEH 3NUMA 1P05A 1KXEA 1CT0E 3SQHE 2PKSB 1AVWA 4Z0KA 4ZKOU 3I78A 3SU5A 8ESTE 1MMJN 5T6DA 2BTCE 4JYTA 1G32B 1MKWH 2FLBH 2PKAA 4DG4A 5A8YA 1DM4B 1K21H 1IQEA 4GCHG 4INKA 1S84A 1JIMA 4CRBA 3RU4D 1HAHH 1F2SE 1GMDG 5F8XA 3SNEA 9ESTA 3RXKA 2CF8H 1O3IA 1O2OA 1XM1A 4D9RA 2A7JA 1SGEE 1AUJA 4OS1A 1UTOA 4Y79A 3RUOA 3TH4H 4UEHH 3H7TA 3KQBA 3URCA 5LPEA 2UWOA 4U01A 3RXFA 5CMXH 3QWCH 1W14U 2F91A 3ZV9A 4JCNA 3GCHB 1IAUA 4D76A 4DGJA 2BZAA 1FIWA 2PTNA 3GY3A 3HPTB 1V2RT 2O8LA 1C5RA 2VIOA 1V2VT 1TGCA 3ZZ3A 3S0NA 2H6MA 3TU7H 2DE9A 1EAIA 2ZC9H 4MNVA 1O3PB 2P59A 3SO3A 1C1WH 3K2UA 2FP7B 2WPHS 1XUFA 2Y6TA 1ZRBA 3URDA 3G01A 3KEEA 3TNSA 7KMEH 3NPSA 1WUNH 5DP3A 1P04A 3RMMH 2FODA 2A2QH 4Y6DA 1A0LA 2XWAA 1JMOH 4RKOB 5HYOA 2Z3DA 2A5IA 1TNHA 2Z3EA 4FUFA 2ZGCA 3BV9B 1YCPH 1LHGH 3A87A 3RXQA 1MAXA 5E2OA 1ZMJA 4FVBA 2PV9B 4ISLA 4UONA 3PLBA 2NU4E 2ANYA 2CF9H 4B74A 2FOMB 4DIIH 4NWKA 2TIOA 1QHRB 2FOFA 1P01A 1IQKA 5F8ZA 3CS7A 3SV6A 2BOKA 1GJDB 1UTKA 1V2WT 1V6DA 2Z9GA 4NA8A 2RA0A 1TWXB 1A4WH 1UMAH 1EPTA 2FZZA 2VH0A 4CRAA 1O3GA 1D3QB 3RXDA 1FLEE 3BG8A 4AZ2B 1P8VC 4UFDH 3UY9A 1O3HA 2GT8A 4H42U 1H9HE 1UTPA 5JB8S 1K28D 2WPIS 4E06H 2WYGA 1C1QA 3IITA 1FNIA 1GBBA 1BTZA 1C5LH 2ZDLA 3K6ZA 3EDXB 2AS9A 4DW2U 1GDNA 1GHVH 1ELVA 5DP8A 1BJVA 4RSPA 3ZVFA 1C4Y2 1BTYA 1DSUA 4JZDH 4ISNA 1C2HA 4BTIB 1TX7A 1J8AA 1VGCB 2BVSH 2QF0A 1CGJE 1LPGB 2HWLB 2XW9A 4Z6AH 2FOAA 1TOCB 4NIYA 3KQEA 2BD9A 4Y10E 3TNTA 4ABEA 1DXPA 1Z8RA 1ZTKA 4ZUHA 1OP0A 1GCTC 3FZZA 2AFQB 4CRFA 4VGCC 1BBRH 3ZVCA 5GWZA 2ZQ1A 3LC3A 1OYTH 2QIQA 4XBDA 3F68H 2J38A 3KNXA 2H2ZA 3OY5U 2WPJS 2F9UA 2PGBB 1HJAC 1GBLA 4JMYA 1BTXA 1YPGH 4UFEH 3P92A 4YT7H 1FIZA 4X8TH 1UTJA 1C1PA 4I8LA 2UUFB 2OBQA 1AGJA 4U30A 1P3CA 4B71A 7ESTE 4INHA 1EB1H 4CREA 8LPRA 2QAAA 2PR3A 1QY6A 3MNXA 1BZXE 2W5EA 2J9NA 1MKWK 5FPTA 2FI4E 1GBEA 1BHXB 1SGTA 1TNKA 2NU0E 3GY8A 3T29A 2SGAA 5JBAS 1C5XB 3ODDA 4GUXA 3NXPA 5LPFA 1ZOMA 3KF2A 4AYYB 4OS6A 1E34B 5DP9A 1WYKA 3OSYA 2XC0A 5DP5A 3AASA 1TABE 2C8XB 1O2KA 1TRYA 3SJ9A 2F9OA 2ZHWH 5DGJA 5L2YH 3UR9A 1UCYE 2JH6D 1ACBE 1FY1A 5EXLA 2VIDA 3TIUA 4DURA 1C2MA 1PYTD 1W8BH 1YM0A 3PLPA 2ZQ2A 3AAVA 2WV5A 3SNAA 5A8ZA 2GT7A 2ZHFH 1YLCA 5HMAA 1PPZA 1D3TB 5DP6A 4NWLA 2A32A 4IGDA 1A61H 1DSTA 5ABWA 2V6NA 2FO9A 2IOTA 1HNEE 1O2HA 1TGSZ 2BY6X 4A1XA 1V2TT 2C3SA 3M5NA 6ESTA 2BB4A 4FVDA 4A1TA 2TRMA 3E8LA 1ZSLA 3RXMA 1O2JA 4WMEA 1THRH 1SLUB 2A0QB 1O5AB 2GZ7A 4I8HA 2F9NA 1CHOF 1LO6A 1O2XA 1ETSH 1XKBC 3MO3A 4K60A 2JH5D 3VEQB 1DX5M 1GG6B 3ENSB 3TJNA 1ZHPA 1F0RA 3FP8E 3WY8A 1S82A 1QRXA 2BZ6H 4DOQA 1GHAF 1O3EA 1G2MA 1X7AC 1YCPK 2VH6A 2ZFPH 3T27A 5C2ZA 3AW0A 3EYDA 1LVOA 1UVPA 3MHWU 2UWLA 1L0ZA 1P2MA 1HUTH 1EZUC 2XCNA 1M9UA 3PO1B 4FUHA 3BTFE 4AGKA 4FUCA 5E0HA 1VJ9U 2GMTB 2FS9A 3SHCH 1O2TA 2QF3A 3RC6A 1BQYA 1ZZZA 2PSYA 2ZGXH 2BLVA 1PPBH 4O03A 3RXLA 1AY6H 2VWLA 3A7YA 4PROA 4ZHAA 2OQUA 4Y8YA 5TCCA 3STIA 1VITH 4TPYA 3SUFA 3PMAB 2EI8A 4INLA 1TA6A 5DKMA 2PSXA 2SFAA 2OC7A 1W7XH 4IS5A 2QGRA 4JYUH 1VGCC 2VGCC 5FPSA 1W0ZU 1AFQC 3A85A 1B0FA 2BD4A 3A7XA 2ZPQA 4MPUA 5LGOA 2XTTB 4OS2A 1KY9A 1BA8B 2ZPRA 4JYVH 1P03A 4AORA 2GKVE 1O3LA 1C9TA 1FN6A 3GY7A 2Z3CA 1C9PA 1GMHG 1AIXH 1BUIA 1ZLRA 1SHYA 2GCTC 1C5MD 3BTHE 1ARBA 1GI0A 3MNBA 1SI5H 2EI6A 2FM2A 1GMCF 2SGPE 1QA7A 2BD5A 3NK8A 2CGAA 4A1VA 1N8OC 4ZKNU 1HAYB 2H1UA 2R3YA 1EAWA 2VIPA 3QZQA 1E38B 1HFDA 5JYIA 2OC8A 4BNRA 3RU4T 2ODPA 1WTGH 1WTHD 1V2LT 2ZEBA 2VB0A 1P2QA 3ZVGA 4H6TA 1C2EA 3MH5A 3QDZB 1A5IA 1PJPA 2V35A 3JZ2B 2ZFSA 1O3DA 2Z9KA 2FXRA 1Z1JA 1ELDE 1BBRK 2BYAX 2C8YB 2Z6BD 1GBKA 2HNTE 1CSOE 1XUHA 4WMDA 3SV7A 1MQ5A 3RLWH 3SU1A 1UJ1A 2BQWB 2BLQA 1RTLA 2FLRH 3UIRA 1GJ8B 2ZGBH 1TE0A 4GPGA 1SQOA 2PWXA 1C2GA 1NRQH 3VGCC 1LMWB 4ABGA 4X6NA 1C2KA 3SN8A 1GCDA 2KAIB 1NFXA 2ZDAH 4X1PU