2VIQA

Fragment-based discovery of mexiletine derivatives as orally bioavailable inhibitors of urokinase-type plasminogen activator
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
247
structure length
247
Chain Sequence
IIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTISLPSMYNDPQFGTSCEITGFGKENSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHTKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UROKINASE-TYPE PLASMINOGEN ACTIVATOR CHAIN B
publication title Fragment-Based Discovery of Mexiletine Derivatives as Orally Bioavailable Inhibitors of Urokinase-Type Plasminogen Activator.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 58
structure length 247
sequence length 247
ec nomenclature ec 3.4.21.73: U-plasminogen activator.
pdb deposition date 2007-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2viqA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2viqA01
4MDSA 1XVMA 1ZPBA 2C8YB 1MUEB 2OXSA 3ZZ7A 1Y3XA 2BDHA 5F6MA 3SU4A 2FDAA 3ZZ5A 2VNTA 4RKJB 2NU3E 4K3JA 4ASHA 3ZYDA 1UTNA 3U8RH 2CGAA 2ZFPH 1INCA 3VB5A 3Q3KA 1C5YB 4FXGH 4MTBA 3SI4H 1O2PA 1ELDE 5LH8A 4AB9A 2WPJS 4DVAU 1HAOH 4B76A 1JBUH 4D76A 1O3JA 2GT7A 3TNTA 1XUFA 1YCPK 3SU0A 1IQGA 3W95A 1C1WH 1LPZB 1O2MA 4K5ZA 2XCFA 1VCPA 1IQIA 3SUGA 2XRCA 3SV8A 2Q6FA 1MQ6A 3UWIA 1OKXA 2BVRH 1O31A 4ABJA 5DP9A 1ZJDA 1P8VC 1HDTH 4H6SB 1V2KT 2JKHA 4Y6DA 2P94A 2CHAB 3BSQA 4O9VA 4I7YH 1TGSZ 1F0SA 1P2OA 4GLYA 3NWUA 2ZCLP 3Q00A 3TPIZ 1JWTA 6CHAC 4X8UH 1SQTA 5GWZA 1BTPA 2ZGJA 4ABDA 3ITIA 1CT4E 1PQ8A 1UCYH 1YPHC 2D8WA 3PB1E 1CHGA 2H5CA 4WMDA 2JETC 3ZVAA 2R3YA 4BAHB 4AOQA 1C2MA 2BVXH 2FYQA 4X1PU 4D9QA 4AB8A 1O2RA 1O2YA 4U01A 3UQOA 1V2TT 3RXMA 1XM1A 1TPSA 3DFLA 3M5OA 1FY5A 1P2JA 3MNBA 4NFEA 1O3KA 1O2SA 1AKSA 1A46H 3KQCA 1NFWA 1ZMNA 5DJ7A 3UY9A 1UCYE 4X2VA 3URDA 3LIWA 5EPYA 1C5OH 4XBBA 1ELBA 4JK6A 1C4V2 2HRVA 4E06H 1DICA 8KME2 3RXTA 3FAOA 5I25A 2F9NA 4ABFA 5GXPA 1EJNA 1J16A 4X8SH 1O3OA 3EDXB 2ALPA 4Y8YA 4FUFA 1DFPA 1LHGH 2JH5D 4JZ1A 1ZPZA 1GHVH 1TMBH 4OS2A 3SU5A 2A1DB 2G81E 3RXBA 3S7HB 2BOKA 4LZ1H 1GMHF 1CA0C 2BD8A 1N6XA 3KL6A 2ZC9H 2AH4X 1UVUH 3M3TA 3E90B 8LPRA 2ULLA 1C1NA 3BTGE 1S81A 3E0NB 4O3UA 2QN5T 3SV7A 1KXDA 3BTEE 1GCTB 1IHTH 3GDUA 4AG1A 5C1YA 3LDXH 2GD4B 1YLCA 1FJSA 2VIPA 3PTNA 1PPZA 1O2NA 1TLDA 4K2YA 1RFNA 4U32A 3GOVB 5GDSH 2A32A 1QGFA 2O8MA 3PMJA 1TPPA 4TPYA 2GCHG 3TNSA 1SL3A 5DGJA 2SNVA 3ODFA 2TBSA 1UVTH 1Z8IB 2ZHDA 2BD5A 3EYDA 3RXEA 1L4DA 2WUCA 2SGQE 3TJOA 3IITA 4NIXA 1H9HE 1GMCG 4F49A 4FUHA 4X8TH 1P0SH 4ABIA 2P8OC 1O2WA 3MO6A 3GY8A 3A81A 1ELCA 1TGCA 1P2MA 1NTPA 1LVOA 3LJJA 4ISOA 2BDCA 1TGTA 2F9UA 1O32A 2GX4A 1D3TB 1SOTA 2VWOA 3KQEA 2D2DA 1GBBA 1H9IE 2VGCC 1A2CH 1TMTH 4O97A 3DT0H 5ETXA 1W14U 2TIOA 1EZXC 1IQJA 1NU7B 3WY8A 3MOCA 3M7TA 1WV7H 2C4FH 5C5NA 2TGPZ 1TNGA 1CO7E 1YPMH 1ORFA 4X6NA 3RXCA 4LXBH 1O3LA 1OP2A 2ANMH 1IQHA 1FXYA 1UO6A 1FV9A 1TNHA 1GI8B 1PPFE 1AHTH 1TOMH 1DWCH 3ESTA 1ARCA 1NFXA 1G2MA 3QK1A 3QTVH 4ISLA 3SN8A 3GY4A 3SNDA 3Q3YA 1VITG 3RXLA 3UPEA 1GBFA 1O2QA 2XYAA 1CT2E 1AVWA 1YPEH 3KN2A 1ELFA 2P59A 1GJ8B 1HJ8A 3BTQE 1P11E 4NIYA 3UNSA 3DHKH 2PKAB 3V3MA 1GBMA 3T28A 1O3EA 1PYTD 5JBBS 1UTPA 1DANH 5EGMA 1BT7A 1GWAA 1C5UA 1ETSH 4OGXA 3ZZDA 1P09A 4WVPE 1CA8B 2Y7XA 1GI1A 1S0RA 2Z9IA 5ESBA 3QX5H 5F8XA 3A87A 2XWAA 4UONA 3UOUA 5JBTA 3PTBA 2ZCHP 4YT7H 3P70B 2J95A 4OS4A 1QHRB 4RKOB 3UFAA 8GCHG 1V2JT 1FPHH 1YPKH 1GDNA 3QTOH 3ZZCA 2SGPE 4E7RG 4UFGH 5C5OA 2WYJA 2HWLB 4A1VA 3MHWU 2ZQ1A 1LHFH 3STIA 3VB6A 1QB9A 3JZ1B 3F9EA 1SHYA 1BA8B 2WPHS 1ZRKA 2HNTF 1FAXA 2NU2E 2VB0A 2QC2A 1YF4A 1T8MA 2SGFE 1O5DH 2ZHEH 1K1PA 1Y5UT 1YBWA 1QQ4A 3KNXA 2XC4A 3S69A 1FPCH 1LVMA 3RM2H 1KXBA 3UR6A 1ZHMA 2A4RA 2BY8X 1ZMJA 1GL1A 2GDEH 3LC5A 2W7SA 2C90B 3RLWH 1LPGB 2HALA 1TA2A 1QR3E 1DE7H 2Z7FE 5J4SA 4SGBE 2BOHB 4DJZB 1TA6A 4K1EA 2BQ6B 4K69A 1W0ZU 1MD7A 1KXFA 3QLPH 1FUJA 1OWIA 1A5HA 2A4QA 3ATIA 2EI7A 1C5TA 1V2OT 1C5SA 1G9IE 1HIAB 1MQ5A 3RUOA 1ZGVA 3PWCA 1RGQA 3SQHE 1BJUA 1HUTH 3VEQB 4KTCA 2ZU4A 4CH2B 1NRPH 1WOFA 2QXIA 2H2ZA 2VWLA 1EQ9A 3B9FH 1ZGIA 3NUMA 1TMUH 1TQ7B 3UOPA 1Y3UA 1RIWC 3VGCC 3A7YA 2ZWLH 1V3XA 5JPMH 4LK4A 3VXEH 2EI6A 4WXIA 1S6FA 1G2LA 4X2WA 1LKAA 1DT2A 2FP7B 5C3NA 4FVDA 3TJUA 1AFQC 4DURA 5E8EH 3T5FH 3F9FA 3IG6B 4U30A 1TGNA 4NSYA 3M7QA 4BOHA 2FI4E 1TX6A 2A2QH 3TGIE 1E35B 4IS5A 1IQKA 4I31A 1SGEE 2SGDE 4Y10E 4ABAA 5JDUB 5FAHA 1K1NA 1GVKB 4B2AA 1QA0A 1GCDA 2ZO3H 3ZVFA 4BAQB 1DLKB 2O8LA 2ZHFH 2H5DA 2BVSH 3QWCH 1UVOA 5EXNA 1NFUA 3NPSA 4Y7BA 3Q3XA 2V3OH 2BTCE 1O39A 2XC5A 1D4PB 3T25A 2V0BA 1AB9C 4B74A 3RMNH 2HLCA 4CH8B 1V2RT 3A7VA 1GBJA 2OUAA 2VVVA 9ESTA 4H42U 1RS0A 1C1VH 1VJ9U 4ZKSU 4CR9A 1GI3A 5DP7A 1BCUH 3P92A 2WV5A 3K6ZA 1J9CH 5PTPA 1CE5A 1G3CA 1KDQB 1VCQA 4GCHG 2JH0D 4YOJA 4TPIZ 2R0LA 2GV6A 4J1YA 4ZROA 1DM4B 4ABEA 3C1KA 1FY4A 1RRKA 1LVBA 1VCWA 2PSYA 1GJ7B 2J34A 2QXJA 1L1JA 1P2NA 2VJ1A 2ZFRH 5FX5A 3SU1A 5I46H 1AMHA 1NT1A 1QFKH 2B8OH 2Y81A 3GICB 2FODA 1Q2WA 2GDDA 1UTKA 2OC7A 1W3CA 3SI3H 1UTOA 3UR9A 3SHCH 1V2QT 1HLTH 1HAGE 5IYTA 5JYIA 1O2VA 4IMZA 5TCAA 5C1XA 2GZ8A 5FBEA 1DUEA 3LPRA 3LGYA 1DS2E 2RDLA 4B2CA 2NWNA 1AVGH 1BTXA 1H1BA 1P2QA 2XW9A 2P8OB 2QYIA 5L6NH 1GBDA 3EA7A 2ODPA 1XVOA 1A7SA 1G36A 5ESTE 1K28D 2SNWA 1C2LA 5JBAS 2FX6A 3Q77A 1ZYOA 4AG2A 3QGNB 1EB1H 1XUHA 1FLEE 1HAXB 1NROH 1ELAA 1W8BH 4A92A 3BTFE 2RA3A 1BTHH 2J92A 4JCNA 1YPJH 1XKBC 3SJ8A 1EKBB 1O3NA 3S7KB 1KLIH 1W10U 1E36B 2VH6A 4AFQA 3PWBA 1SLXB 2QXHA 1SGYE 1QB1A 1XUKA 4Y0YE 1F7ZA 2UWOA 2QGRA 1HXEH 4GAWA 1AU8A 1P12E 1O2LA 2GCTC 1BRUP 3FZDA 4H4FA 3QZRA 3MTYA 5SGAE 2ZFSA 1VGCC 5FPYA 3BTDE 5AF9H 1EAWA 1ZLRA 1L2EA 2ZU3A 4FUIA 2OQ5A 4QT8C 3MFJA 4JZFH 3RM0H 4OS6A 4FU9A 3P8FA 3TH3H 2J94A 2AGIX 1GMDG 1ANCA 1KIGH 3SNCA 1SVPA 1MTSA 4Q7ZA 1EAXA 3EA9A 1UCYK 1KYNA 3U8TH 2IPHA 5E2OA 4UFFH 1AWHB 4OS7A 1LQEA 1TPAE 2FOAA 2B0FA 4K8YA 2FESH 1UTQA 2QF0A 4CRFA 2Y7ZA 2IN2A 5E0HA 4AZ2B 1WTHD 1K9OE 2GP9B 1O37A 2PSXA 2I6SA 1MTNB 3GYMA 1Z71A 1CBWB 5JB9S 4BANB 4VGCC 1CHOG 1O3DA 1Q31A 3M7UA 1W12U 3BV9B 3DFJA 1HIAA 7KMEH 2BD9A 4YTAA 3M3SA 4MNWA 1S5SA 3SJKA 1THSH 3QZQA 4DOQA 2WV4A 2GCHF 1GGDC 3BG4C 2ZU1A 1C1OA 1QNJA 5DP6A 2FOFA 3DA9B 2CV3A 2H6MA 1OSSA 1QIXB 3V13A 3NXPA 2V6NA 1Z8GA 4CRBA 1C1RA 1GMCF 5LPRA 2UUKB 2PTCE 2XWBI 1O5CB 3UNRA 3OY5U 2FOMB 1C5RA 4MG3A 1TNLA 2BQWB 2FOCA 1LMWB 2FPZA 3TH2H 3U1JB 3RMLH 1WCZA 5EQSA 1JMOH 3T29A 3AASA 3PYHA 2OTVA 1SGQE 1YM0A 4AYYB 4WWYA 2B9LA 3MH7A 2BLQA 1EZSC 3PO1C 1V2VT 2XBWA 4DT7B 1QRWA 2AEIH 2ZGBH 1WYKA 2TGTA 3U1IB 3ZZ6A 1TPOA 4I8KA 1GDUA 1HAZB 1GVZA 1T32A 1ETTH 1GHAG 1YKTA 1ESBA 1VITH 5K7RA 1QQUA 1NPMA 3RU4T 2ODYB 3K65B 4E7NA 5IDKA 3OY6U 1HJAB 1LCYA 4ABGA 1WAYB 4JYVH 1WBGB 1D6WA 3KIDU 1N8OC 5T3HA 1NESE 4A7IB 1TE0A 2EI8A 1VITF 2BHGA 1HNEE 1C2GA 1PQ7A 1RIWB 3VGCB 3SJ9A 3AW0A 4Z0KA 1K21H 5A0CA 4Y79A 2ZDAH 2PKSC 1NRQH 1QJ1B 1P3EA 1GHBG 1AIXH 1KDQA 3ODDA 1BOQA 1IOEA 4WMEA 2J38A 2PV9B 1DWEH 1PQ5A 2SGAA 3LH3A 4AX9H 3RXUA 3LOXA 1BTYA 1DVAH 3O8DA 5T6GA 1KXCA 1W7GH 2WUBA 2FOBA 2PR3A 1OWDA 2P95A 4UDWH 3L6PA 4A1TA 1G3DA 1NU9A 1BRCE 1GDQA 3M37A 1FNIA 3SV9A 2AMDA 1OWKA 1O2ZA 1HYLA 1KLTA 1ESTA 4CHAC 4D7GA 3KQDA 3ATLA 8GCHF 4YZUA 5E0JA 3UREA 1CGJE 3EAJA 4ISNA 4ABBA 1YC0A 3URCA 1QL9A 2ANWA 3QO6A 3HKJB 4X2XA 1NRRH 4CRCA 1T8LA 1G32B 1RTLA 1DWDH 2OCVB 5A09A 1YP9A 3RXGA 1AQ7A 3P95A 7GCHF 4NSVA 2J4IA 3SU6A 5A8YA 2ILNA 4TY7A 3RXFA 1BMNH 3B8JA 1H4WA 4GVUA 1SLVB 1NC6A 4Z6AH 2GMTB 1SR5C 2ZIQH 3FFGA 1GI7B 3BTKE 1RTKA 2RCEA 2W3IA 1RJXB 1MU6B 1KLJH 4Q7YA 3SHAH 4FUBA 2JH6D 2Z3EA 1O30A 1DY9A 1NZQH 2LPRA 3ZVGA 3H5CB 1AY6H 1EPTB 1GBEA 1SI5H 1TGBA 1FY3A 1Z6EA 4X1QU 1HAIH 3GCTG 1TX8A 1AZ8A 2AERH 5GJ4B 1K1OA 1EOJA 3P8GA 1AZZA 4FUCA 4I8HA 3QN7A 1N1LA 3TGKE 3KF2A 5EW2H 1FDPA 1J17T 1KTSB 1H8DH 3BG8A 1Z6JH 4CREA 1SQAA 3GCHB 2FMJA 4B2BA 3ZZ3A 1DUAA 3N7OA 2QCYA 2V3HH 1O2JA 3MO3A 1Z8RA 1RTFB 1NN6A 3S0NA 4MVNA 2Y5FA 3MI4A 2Q6GA 2R2MB 3MU5A 1MKWK 3A89A 5CHAB 2ZG0H 3D49H 1C5ZB 1IQMA 1ELEE 2BD4A 2G52A 1BITA 1YPGH 3TK6A 5K0HA 4JZIA 1TBZH 1E37B 1OOKB 2A5KA 2AMPA 4MNXA 4F4OC 2F9BH 1TNIA 8ESTE 1DPOA 3ZZ8A 3OTJE 2GCTB 2Z3CA 4Y71A 3RDZA 3RC4A 2AYWA 3SNAA 1ZHRA 3BN9A 3LGTA 4Q2KA 1JOUB 3MH4A 2G51A 1MAXA 2J9NA 1GJBB 2R9PA 4D8NA 5HXFA 1GI4A 1MU8B 1P05A 1EOLA 3FP7E 4UFDH 3VFEA 2CMYA 1ZZZA 3LONA 1O3AA 1BJVA 1SFQB 1EASA 1K1LA 2W5EA 2BY7X 5ABWA 1PJPA 4AGJA 1OXGA 1ZTKA 2FTLE 4SGAE 3SJOA 2Z9JA 3F9HA 2PTNA 5L2YH 1GJ6A 4BXSA 2BDBA 3SGQE 1DITH 2BD7A 1F5KU 1OP8A 3FANA 4X6OA 2W7UA 1LHCH 4NCYA 3R3GB 5G4BA 5JBCS 2YNBA 5C1UA 1AGJA 1GHWH 1A5IA 2EEKA 2R2WU 4CBNA 1OWEA 4GCHF 5EQQA 3SV6A 4YLUA 1NFYA 2VIWA 3RC5A 1GBLA 1AFEH 1QRXA 1O36A 2G4TA 2FI3E 2PW8H 2QIQA 1A0LA 1BHXF 1D3PB 5A8XA 2OINA 2XNIA 4DY7B 1C2EA 3LGVA 1GMHG 1P2IA 3ZZAA 1BIOA 2PFEA 2OBQA 1P02A 1TBRH 3A82A 3NCLA 4O03A 4GHTA 1SGFG 1YPLH 2VIVA 2STAE 2HNTE 3D65E 1H8IH 1MKWH 1AE8H 1LO6A 4U2WA 5DP5A 5BPEA 2BZAA 3KGPA 1C2DA 1CU1A 5EODA 3SUEA 5FCRA 1KY9A 1OWJA 4NG9H 1MCVA 4XBCA 3ATWA 4KTUA 1JIMA 2VVUA 3LH1A 4XE4A 4E05H 1TIOA 1YGCH 4X1RU 1RD3B 2ZZUH 2AGEX 4HTCH 2OP9A 4JYUH 2FS8A 2Y5GA 1UK3A 1SGNE 4IMQA 1O3CA 1C4U2 2CHAC 2ZGCA 6CHAB 2O8WA 1SGRE 1A0HB 4Y76A 4NA9H 4B1TA 2BB4A 1GBTA 1GJ5H 2ZDVH 2JETB 4NWLA 4Y8XA 1C5NH 1EUFA 1IHSH 2H9TH 2OD3B 2DE9A 2ZCKP 1F2SE 1C4Y2 3SOSA 4ZH8A 4JYTA 3IWMA 1G3BA 3TGJE 3ATMA 1K1IA 3LT3A 2ZNKH 4MNVA 5EXLA 1UMAH 2P3TB 1BTWA 2VIOA 1GMDF 2Z6BD 5A0BA 6LPRA 1EZQA 3M61U 3V12A 1O3HA 3MU0A 4IBLH 1GI2A 1C5QA 1O5GH 1OX1A 4INHA 1GBKA 5TJXA 2BZ6H 1P01A 3BTHE 2BY5X 1SBWA 2Z94A 1IQFA 4ZHMU 4R8TB 1V6DA 4ZKNU 2FOHA 2VWMA 4X6PA 1Y8TA 1EJAA 1EPTA 4IN2A 2ZECA 4OS5A 2EC9H 3ZVDA 1L1GA 3EE0B 1JXPA 1GJ9B 3RMMH 1GG6C 1UTLM 4CBOA 1CHOF 3PMBB 1KXAA 1TNKA 4YM9A 1CA0B 1FZZA 1Y3WA 5DK1A 4CRGA 1NY22 2THFB 1WQSA 3NK8A 3BIVH 4JMYA 4BTTB 1SLWB 2W26A 4YOGA 3MWIU 3VPKA 3SJIA 3QGJA 4DIHH 2P16A 1S82A 1NRNH 4DGJA 3U8OH 2ZU5A 4TY6A 1C2JA 3ZZBA 1QJ6B 3OYPA 1FY8E 1PFXC 1ESAA 4A6LA 1TYNA 4Y7AA 3ATKA 1FAKH 1GCTC 2BLOA 3GDSA 3ZV8A 1C1TA 1EAUA 4ISHH 2OC1A 2PLXA 1BMLA 1O3FA 1SGPE 3LU9B 3TH4H 1O2TA 4YLQH 3A83A 3GY6A 5FHTA 1VR1H 2FI5E 2ZPQA 3A7TA 4HFPB 3STJA 3OU0A 1K1MA 3PM3A 1FONA 4CRDA 4ZHLU 4Y0ZE 1FIZA 1BRAA 1C5XB 2BLVA 1CGHA 4FUJA 5A8ZA 3A84A 2GT8A 1TALA 1ELGA 3L3TA 3SGAE 4LZ4B 1AN1E 3D62A 1S6HA 1TRYA 1Y3YA 2TRMA 4ISIH 2OBOA 2ZQ2A 1MD8A 3TLOA 3O8BA 1AE5A 4ZXXH 1SB1H 5DG6A 6GCHG 1P57B 5BRRE 1V2ST 3RU4E 4ZXYH 4A1XA 1DX5M 2Q6DA 1Q3XA 2UUYA 2PUQH 3BIUH 1QBOA 1GBAA 1QBVH 4XBDA 1GHAF 1EZUC 1XUGA 3U98H 2A7CA 1KSNA 2VGCB 1ACBE 1LDTT 3PMHB 3GY5A 3PLPA 3ZVBA 2VH0A 1C1SA 1TRMA 2A2XH 2ZKSA 1TX7A 1YLDA 1NRSH 1O5EH 1OYQA 3HPTB 1QL8A 4BAKB 1P2KA 5E0GA 2FS9A 1TWXB 1FIWA 1E0FD 1QJ7B 3E91A 3LC3A 2BDYA 4ZKRU 3RU4D 5E2PA 2SFAA 3DD2H 1G30B 2XTTB 1PPEE 2B7DH 3RMOH 3BEUA 1HAPH 1A5GH 3SGBE 4BTUB 1P3CA 1WU1A 1FN8A 4X0WU 1GHBF 5C20A 1BMAA 1FMGA 5GIBA 2NU1E 4DIIH 4MLFB 3HGNA 4I8GA 1C2FA 1G37A 1ZTJA 1BBRH 2ZTXA 4AFSA 3LKWA 3A86A 4YOIA 4K8BA 1ABIH 2F9OA 3UIRA 1O2KA 3RXOA 4ZAEA 2GZ7A 2VINA 3P17H 1XX9A 3A7XA 3MH6A 2B5TB 1A3EH 1MBQA 5LPFA 3TITA 1PYTC 4GHQA 1D3DB 2F91A 2C3SA 3LGWA 1O5BB 1BBRE 3ZZ4A 4DG4A 5EU8A 3RXDA 1IQEA 1EJMA 2ZPRA 3A80A 2IOTA 5GPIB 3TJVA 1GHZA 3RXKA 1ZTLA 1SG8B 3TK5A 4AFUA 4BAOB 2ASUB 2P93A 4IGDA 2UUJB 3E8LA 2BDIA 5T6FA 1OYTH 4MPXA 1C2IA 1CQQA 2ZA5A 1EB2A 4FVBA 1U6QA 3BTTE 1T4UH 1UK2A 1VJAU 1C2KA 4XOJA 1Z1JA 4FU8A 2TPIZ 3BEIB 4PROA 5DP4A 1H9LB 1SPJA 4B75A 4K1SA 2FWWA 3MNSA 4INKA 4IN1A 4WJG2 4K1TA 1ZSLA 3A8AA 2Z3DA 5GCHG 1QBNA 1ZSJA 3MU8A 1AUJA 3L33A 1LHEH 3VB4A 5EQRA 4NFFA 5FPSA 3RXIA 1MCTA 1WSSH 1A0JA 1PPBH 3SU2A 1ZR0A 1A1RA 4AGKA 4ESTE 3GCTF 5FBIA 1TFXA 1LTOA 1T31A 1HAVB 2FIRH 2AMQA 2WPKS 3DUXH 1C1MA 3RXHA 4CRAA 3F68H 1TONA 1F92A 1GJDB 2KAIB 4BNRA 3AAUA 1AI8H 1SC8U 3A85A 4K60A 3KQBA 1NS3A 1O5FH 3O8CA 3TJNA 5FX6A 1PPGE 3SU3A 1QB6A 4ZKOU 2YNAA 3E0PB 1C5LH 1QTFA 2ZFTA 1GPZA 1XXFA 3EA8A 2HNTC 4AN7A 1UK4A 2CF8H 1XUJA 2BMGB 4INLA 1V2UT 2ODQA 5CE1A 3LJOA 3H7OA 1SLUB 2STBE 2LNCA 2BXTH 2OQUA 1UHBA 3BTME 1D6RA 1MKXK 1F5RA 1P9UA 2M5TA 1GI0A 2ZHWH 2TGAA 1EAIA 4YESB 2YOLA 4NWKA 3ZV9A 2Y5HA 2R3UA 9LPRA 1JRTA 5F8TA 3R0FA 2G5NA 1LQDB 4LOYH 1MZAA 2QF3A 1AFQB 2Y6TA 4H6TA 3W94A 1XMNB 2WYGA 2PWXA 2FXRA 4Q80A 2AGGX 1MH0A 1XXDA 2Q1JA 3PLKA 4UD9H 4BAMB 2GZ9A 1EP5A 1AO5A 1C5WB 1THPB 2R0KA 4Y11E 1DSUA 2F3CE 3CP7A 3EGKH 1O3MA 2DUCA 3SUDA 2Z9LA 1XKAC 2UWLA 1LPKB 2XXLA 1BTZA 3RC6A 4BXWA 3KEEA 2IJOB 4AYVB 1FQ3A 1TQ0B 1SSXA 1W7XH 1EP6A 4FUDA 2D26C 3ZYEA 1GG6B 3B23B 1AB9B 2HPQH 3HKIB 3HK6B 3RXJA 1G3EA 3S9AA 2GV7A 2F9PA 1Y3VA 3P8OA 1ZMLA 2BX4A 1YCPH 3RXPA 1HAHH 3EQ0H 1JRSA 1V2WT 1B7XB 1C1QA 1AVXA 2UUFB 2A4GA 3AW1A 3JZ2B 1EX3A 1YYY1 4WMFA 3K9XB 4O3TA 1JIRA 1O5AB 1WTGH 3HK3B 1PQAA 2A4OA 3H7TA 1GJ4H 1ABJH 2QA9E 2C8WB 1LVYA 3ENSB 1OP0A 4R0IA 3U9AH 1VZQH 6ESTA 2OLGA 4TWWA 7LPRA 3AAVA 1O2GH 3F6UH 1L4ZA 1MKXH 4HI3A 4OGYA 2ZDKA 1MTWA 1O3BA 1SMFE 3A8BA 1O33A 1O2XA 3P6ZB 4GSOA 1HCGA 4X1SU 3SQEE 1RXPA 4Q7XA 1UVPA 3SW2B 4HZHA 1O0DH 2BYAX 3RXAA 1CGIE 4KGAA 1UJ1A 4X6MA 2DE8A 1GBIA 1BB0B 2QY0B 2GGVB 3M3VA 4TWYA 1K1JA 4JK5A 3A8DA 3KCGH 1C9TA 1FY1A 1ZHPA 5DKMA 3TVJB 2BDAA 5DPAA 5J4QA 1W0YH 3I77A 3QUMP 1ZPCA 3K6YA 2CJIA 5DP3A 2BXUH 1IAUA 3G01A 3UQVA 2VIQA 1DXPA 1W11U 2BLWA 4JZEH 1BZXE 2K1QA 1P10A 5LPEA 1L0ZA 1GI6A 1CVWH 2RG3A 4D7FA 3V7TA 3SZNA 1VGCB 3GCOA 3E1XB 4KKDA 1C5VA 2QAAA 4TYDA 4Y8ZA 4ABHA 2FZZA 5FPTA 2XCNA 1WUNH 2P3FH 1TOCB 2BX3A 2PGBB 3CENA 1C2HA 4IC6A 1V2LT 1ARBA 1F0UA 1TBQH 1SFIA 1MZDA 3MNXA 2ZHQH 1O3GA 2ZDMA 1HAVA 2AIQA 1SHHB 5B6OA 2ZTYA 4M7GA 1S0QA 1O3PB 3SNBA 4NZLA 3PV4A 3T2NA 1XUIA 2KAIA 3ZVEA 1YCPM 1LHDH 1J15A 2ANKH 2GTBA 3GDVA 2C93B 1FN6A 3MO9A 1PPCE 4YO9A 3SNEA 3BTWE 2A45B 1UTJA 4VGCB 1MTNC 1N6YA 3AVZA 4I32A 4MNYA 1QL7A 5FCKA 3MMGA 1CBWC 2XBYA 1DDJA 1GI5A 4WH8A 4XDEA 4IC5A 5EW1H 3P8NA 1X7AC 3C27B 2BD3A 1LKBA 4MPUA 2BD2A 1HBTH 5TCCA 1P04A 1Y5AT 1F0RA 3LGIA 1T4VH 1ELTA 4KELA 2FTMA 2C8ZB 1GJCB 1TAWA 1ELVA 3ZZ9A 1B0FA 2FX4A 2RA0A 1DY8A 1K22H 1TABE 1GGDB 3BG4B 2ZU2A 1IQLA 3GY3A 1BDAA 4I8JA 4MPWA 1AWFH 1MMJN 1L1NA 3KHVA 1KXEA 1QY6A 4AFZA 3OX7U 1O3IA 1ID5H 7GCHG 2BM2A 3QDZB 1ANBA 3T27A 2CXVA 2H9HA 2WPIS 1HFDA 3RLYH 1J14A 4JZDH 3TIUA 1HRTH 1BHXB 1V2NT 2F9VA 4ZHAA 1YPHE 6GCHF 1GBHA 3GYLB 4BTIB 3BEFB 1HJ9A 5A2MH 2BDGA 4NIVA 4ZUHA 4YT6H 1K2I1 1GVLA 2D1JA 3PO1B 1BTUA 2ZDLA 2PUXB 3FP6E 3GISB 1HAYB 1P03A 5EXMA 1DXWA 2QV1A 1AD8H 5EOKA 2ZGXH 5AHGH 1SOZA 1C9PA 2I6QA 2Z9GA 2ZFQH 1GJAB 2VVCA 3E3TA 4I8LA 1QCPA 1C1UH 3UNQA 1MAYA 2ZF0H 1GBCA 1DWBH 1T8OA 1N8OB 3GCNA 2XC0A 3LGUA 1O38A 1P9SA 1UTMA 3HGPA 1E38B 3U69H 1Z1IA 1HJAC 3S9BA 4ZMAH 4KTSA 5T6DA 2GKVE 1C1PA 1KTTB 2Y82A 2PKSB 3RP2A 3VB7A 1MTVA 2XBXA 2ZEBA 1GI9B 2W3KA 3S9CA 1S84A 3HATH 4CR5A 2H9EH 2FM2A 4WY3A 2G00A 3PLBA 1ZJKA 1S83A 3TK9A 2A5IA 1QA7A 1NO9H 3ELAH 3PROA 1WQVH 5L30H 2BY9X 2BQ7B 4WXVA 1O2UA 3I78A 5AFZH 4MQAA 4AORA 2V35A 2AIPA 4GPGA 1P06A 3FZZA 2A7HA 3A7ZA 2VWNA 3FP8E 2HGTH 3F9GA 1O2IA 2VIDA 4FUEA 5L2ZH 1ZSKA 2ZTZA 3TU7H 4IW4E 3GY7A 1O2HA 4CHAB 2BY6X 1OWHA 1UHBB 2NU4E 4UEHH 2G5VA 4X8VH 2WPMS 1BMMH 3CS0A 1ANDA 1BBRK 3SUFA 1E34B 1MBMA 2PHBA 2FEQH 1W2KH 1F0TA 2OC8A 3RXVA 4B73A 3A88A 1SGFA 1ZOMA 4D9RA 4HGCA 1GL0E 3RXRA 2FLRH 3SV2H 2FOGA 2CF9H 1BQYA 5LGOA 1THRH 4XFQA 5GCHF 4WH6A 3ZVCA 3M5NA 4X2YA 1FI8A 1TRNA 3MH5A 5C67A 3E16B 3D23A 2A7JA 2FOEA 1AKSB 1CSOE 2ZI2H 1HXFH 4UFEH 5FXLA 1MTUA 1O34A 1Y5BT 2AFQB 4NGAH 5HMAA 4FU7A 1W13U 1F5LA 1A61H 5DP8A 2HOBA 1GHXH 2A31A 2PGQB 2ZGHA 1SGCA 5F8ZA 3V0XA 1HB0B 1HPGA 2ANYA 1SGTA 1S85A 3VXFH 4B71A 1C5PA 1O2OA 3OSYA 4MPVA 1Z7KA 5H4IB 2GMTC 3Q76A 1B5GH 1EATA 1C5MD 3MU1A 2VU8E 4I33A 4OS1A 2H1UA 4NZQA 1SQOA 2G4UA 4WF8A 5HGGA 4THNH 3UWJH 1DLEA 2FLBH 2EA3A 2Y80A 4NIWA 2TGDA 3CS7A 3SO3A 1EPTC 2Z9KA 3MYWA 1Y59T 2FO9A 1T8NA 5JB8S 2ALVA 1OS8A 3GY2A 1QRZA 1SGDE 3BF6H 2A5AA 4XSKU 2NU0E 1AUTC 2UWPA 3UUZA 1BUIA 3F1SB 2AS9A 3NZIA 2PKAA 4DCDA 1HGTH 2QXGA 5EPNA 2HPPH 2XBVA 1OPHB 2C8XB 5HM9A 1EXFA 3A8CA 3GCHC 2ZPSA 1GHYH 5EG4A 1A3BH 3UTUH 1NM6A 2F83A 2O9QA 1TB6H 5F03A 2O8TA 5A0AE 4GUXA 3SBKA 2ESTE 7ESTE 4FUGA 1V2PT 2WPLS 1B0EA 1IQNA 2P3UB 5DO4H 3M5MA 1CT0E 4NA8A 4J2YB 5CHAC 1ANEA 3PMAB 1V2MT 4RSPA 5HYOA 1TNJA 2WINI 4NA7A 5C2ZA 3NKKA 2G55A 1ZRBA 1J8AA 3T62A 1O35A 3SORA 3M35A 4KP0A 2ZDNA 1M9UA 5HM2A 2GVFA 2CN0H 5AFYH 2SGEE 2OC0A 4RN6A 1HV7A 3K2UA 2HVXA 3MU4A 1ETRH 2ZP0H 1D9IA 1PPHE 3FVFB 2G8TA 5CMXH 3RXSA 3E6PH 1T7CA 1BRBE 3M5LA 1Z8JB 3VB3A 4UE7H 3MNCA 4X1NU 1SGIB 5AVDA 4DW2U 1A4WH 1DOJA 2A0QB 3I29A 4A5TS 3M36A 1UVSH 3A7WA 1QURH 1DSTA 2ZFFH 2J2UA 2O8UA 3RXQA 3O8RA 1D3QB 3T26A 2FYRA
chains in the Genus database with same CATH superfamily
4MDSA 1XVMA 1ZPBA 2C8YB 1MUEB 2OXSA 3ZZ7A 1Y3XA 2BDHA 5F6MA 3SU4A 2FDAA 3ZZ5A 2VNTA 4RKJB 2NU3E 4K3JA 2CK3D 2QE7D 4ASHA 3ZYDA 1UTNA 3U8RH 3F2FA 2CGAA 2ZFPH 1INCA 3VB5A 3Q3KA 1C5YB 4FXGH 4MTBA 4XD7D 3SI4H 1O2PA 1ELDE 5LH8A 4AB9A 2WPJS 2JIZD 4DVAU 1HAOH 4B76A 1W0KD 1JBUH 4D76A 1O3JA 2GT7A 3TNTA 1XUFA 1YCPK 3SU0A 1IQGA 3W95A 1C1WH 1LPZB 1O2MA 4K5ZA 2XCFA 1VCPA 1IQIA 3SUGA 2XRCA 3SV8A 2Q6FA 1MQ6A 3UWIA 1OKXA 2BVRH 1O31A 4ABJA 5DP9A 1ZJDA 1P8VC 1HDTH 2L6OA 4H6SB 1V2KT 2JKHA 4Y6DA 2P94A 2CHAB 3BSQA 4O9VA 4I7YH 1TGSZ 1F0SA 1P2OA 3N7EA 4GLYA 3NWUA 2ZCLP 3Q00A 3TPIZ 1JWTA 6CHAC 4X8UH 1SQTA 5GWZA 1BTPA 2ZGJA 4ABDA 3ITIA 1CT4E 1PQ8A 1UCYH 1YPHC 2D8WA 3PB1E 1CHGA 2H5CA 4FETA 4WMDA 2JETC 3ZVAA 2R3YA 4BAHB 4AOQA 1C2MA 2BVXH 2FYQA 4X1PU 4D9QA 4AB8A 1O2RA 1O2YA 4U01A 3UQOA 1V2TT 3RXMA 1XM1A 1TPSA 3DFLA 3M5OA 1FY5A 1P2JA 3MNBA 4NFEA 1O3KA 1O2SA 1AKSA 1A46H 3KQCA 1NFWA 1ZMNA 5DJ7A 3UY9A 1UCYE 4X2VA 3URDA 3LIWA 5EPYA 1C5OH 4XBBA 1ELBA 4JK6A 1C4V2 2HRVA 4E06H 1DICA 8KME2 3RXTA 3FAOA 5I25A 2F9NA 4ABFA 5GXPA 1EJNA 1J16A 4X8SH 1O3OA 3EDXB 2ALPA 4Y8YA 4FUFA 1DFPA 1LHGH 2JH5D 4JZ1A 1ZPZA 1GHVH 1TMBH 4OS2A 3SU5A 2A1DB 2G81E 3RXBA 3S7HB 2JJ2D 2BOKA 4LZ1H 1GMHF 1NBME 1CA0C 2BD8A 1N6XA 3KL6A 2ZC9H 2AH4X 1UVUH 3M3TA 3E90B 1OHHD 2J5UA 8LPRA 2ULLA 1C1NA 3BTGE 1S81A 3E0NB 4O3UA 2QN5T 3SV7A 1KXDA 3BTEE 1GCTB 1IHTH 3GDUA 4AG1A 5C1YA 1NBMD 3LDXH 2GD4B 1YLCA 1FJSA 2VIPA 3PTNA 1PPZA 1O2NA 1TLDA 4K2YA 1RFNA 4U32A 3GOVB 5GDSH 2A32A 1QGFA 2O8MA 3PMJA 1TPPA 4TPYA 2GCHG 3TNSA 1SL3A 5DGJA 2SNVA 3ODFA 2TBSA 1UVTH 1Z8IB 2ZHDA 2BD5A 3EYDA 3RXEA 1L4DA 2WUCA 2SGQE 3TJOA 3IITA 4NIXA 1H9HE 1GMCG 4F49A 4FUHA 4X8TH 1P0SH 2JDID 4ABIA 2P8OC 1O2WA 3MO6A 3KYFA 3GY8A 3A81A 1ELCA 1TGCA 1P2MA 1NTPA 1LVOA 3LJJA 4ISOA 2BDCA 1TGTA 2F9UA 1O32A 2GX4A 3W1EA 1D3TB 1SOTA 2VWOA 3KQEA 2D2DA 1GBBA 1H9IE 2VGCC 1A2CH 1TMTH 1UW7A 4O97A 3DT0H 5ETXA 1W14U 2TIOA 1EZXC 1IQJA 1NU7B 5HKKD 3WY8A 3MOCA 3M7TA 1WV7H 2C4FH 5C5NA 2TGPZ 1TNGA 1CO7E 1YPMH 1ORFA 4X6NA 3RXCA 4LXBH 1O3LA 1OP2A 2ANMH 1IQHA 3PV5A 1FXYA 1UO6A 1FV9A 1TNHA 2V3MA 1GI8B 4ZCNA 1PPFE 1AHTH 1TOMH 1DWCH 3ESTA 1ARCA 1NFXA 1G2MA 3QK1A 3QTVH 4ISLA 3SN8A 3GY4A 3SNDA 3Q3YA 1VITG 3RXLA 3UPEA 1GBFA 1O2QA 2XYAA 1CT2E 1AVWA 1YPEH 3KN2A 4Z1MD 1ELFA 2P59A 1GJ8B 1HJ8A 3BTQE 1P11E 4NIYA 3UNSA 3DHKH 2PKAB 3V3MA 1GBMA 3T28A 1O3EA 1PYTD 5JBBS 1UTPA 1DANH 5EGMA 1BT7A 1GWAA 1C5UA 1ETSH 4OGXA 3ZZDA 1P09A 4WVPE 3H09A 1CA8B 4Q4LA 1S6LA 2Y7XA 1GI1A 1S0RA 2Z9IA 5ESBA 3QX5H 5F8XA 3A87A 2XWAA 4TT3D 4UONA 2W6JD 3UOUA 5JBTA 1WDIA 3PTBA 2ZCHP 4YT7H 3P70B 2J95A 2W6ID 4OS4A 1QHRB 4RKOB 3UFAA 8GCHG 1V2JT 1FPHH 1YPKH 5KECA 1GDNA 3QTOH 3ZZCA 2SGPE 4E7RG 4UFGH 5C5OA 2WYJA 2HWLB 4A1VA 3GS9A 3MHWU 2ZQ1A 1LHFH 3STIA 3VB6A 1QB9A 3UB0A 3JZ1B 3F9EA 1SHYA 1BA8B 2WPHS 1ZRKA 2HNTF 1FAXA 2NU2E 2VB0A 2QC2A 1YF4A 1T8MA 2SGFE 1O5DH 2ZHEH 1K1PA 1Y5UT 1YBWA 1QQ4A 3KNXA 2XC4A 3S69A 1FPCH 1LVMA 3RM2H 1KXBA 3UR6A 1ZHMA 2A4RA 2BY8X 1ZMJA 1GL1A 2GDEH 3LC5A 2W7SA 2C90B 3RLWH 1LPGB 2HALA 1TA2A 4Q63A 1QR3E 1DE7H 2Z7FE 5J4SA 4SGBE 2BOHB 4DJZB 1TA6A 4K1EA 2BQ6B 4K69A 1W0ZU 1MD7A 1KXFA 3QLPH 1FUJA 1OWIA 1A5HA 2A4QA 3ATIA 2EI7A 1C5TA 1V2OT 1C5SA 1G9IE 1HIAB 1MQ5A 3RUOA 1ZGVA 3PWCA 1RGQA 3SQHE 1BJUA 1HUTH 3VEQB 4KTCA 2ZU4A 4CH2B 1NRPH 1WOFA 2QXIA 2H2ZA 2VWLA 1EQ9A 3B9FH 1ZGIA 3NUMA 1TMUH 1TQ7B 3UOPA 1Y3UA 1RIWC 3VGCC 3A7YA 2ZWLH 1V3XA 5JPMH 4LK4A 3VXEH 2EI6A 4WXIA 1S6FA 1G2LA 4X2WA 1LKAA 5B6LA 1DT2A 2FP7B 5C3NA 4FVDA 3TJUA 1AFQC 4DURA 5E8EH 3T5FH 3F9FA 3IG6B 4U30A 1TGNA 4NSYA 3M7QA 4BOHA 2FI4E 1TX6A 2A2QH 3TGIE 1E35B 4IS5A 1IQKA 4I31A 4AC9A 1SGEE 2SGDE 4Y10E 4ABAA 5JDUB 5FAHA 1K1NA 1GVKB 4B2AA 1QA0A 1GCDA 2ZO3H 3ZVFA 4BAQB 1DLKB 2O8LA 2ZHFH 2H5DA 2BVSH 3QWCH 1UVOA 5EXNA 1NFUA 3NPSA 4Y7BA 3Q3XA 2V3OH 2BTCE 2V7QD 1O39A 2XC5A 1D4PB 3T25A 2V0BA 1AB9C 4B74A 3RMNH 2HLCA 4CH8B 1V2RT 3A7VA 1GBJA 2OUAA 1WXRA 2VVVA 9ESTA 4H42U 1RS0A 1C1VH 1VJ9U 4ZKSU 4CR9A 1GI3A 5DP7A 1BCUH 3P92A 2WV5A 3K6ZA 1J9CH 5PTPA 1CE5A 1G3CA 1KDQB 1VCQA 4GCHG 2JH0D 4YOJA 4TPIZ 2R0LA 2GV6A 4J1YA 4ZROA 1DM4B 4ABEA 3C1KA 1FY4A 1RRKA 1LVBA 1VCWA 2PSYA 1GJ7B 2J34A 2QXJA 1L1JA 1P2NA 2KCYA 2VJ1A 2ZFRH 5FX5A 3SU1A 5I46H 4DT4A 1AMHA 1NT1A 1QFKH 2B8OH 2Y81A 3GICB 2FODA 1Q2WA 2GDDA 1UTKA 2OC7A 1W3CA 3SI3H 1UTOA 3UR9A 3SHCH 1V2QT 1HLTH 1HAGE 5IYTA 2XNDD 5CHBA 1O2VA 4IMZA 5TCAA 5JYIA 5C1XA 2GZ8A 5FBEA 1DUEA 3LPRA 3LGYA 1DS2E 2RDLA 4B2CA 2NWNA 1AVGH 1BTXA 1H1BA 1P2QA 2XW9A 2QF4A 2P8OB 2QYIA 5L6NH 1GBDA 3EA7A 2ODPA 1XVOA 1A7SA 1G36A 5ESTE 1K28D 2SNWA 1C2LA 5JBAS 2FX6A 3Q77A 1ZYOA 4AG2A 3QGNB 1EB1H 1XUHA 1FLEE 1HAXB 1NROH 1ELAA 1W8BH 4F48B 2EY4C 3BTFE 4A92A 2RA3A 1BTHH 2J92A 4JCNA 1YPJH 1XKBC 3SJ8A 1EKBB 1O3NA 3S7KB 1KLIH 1W10U 1E36B 2VH6A 4AFQA 3PWBA 1SLXB 2QXHA 1SGYE 1QB1A 1XUKA 4Y0YE 1F7ZA 2UWOA 2QGRA 1HXEH 4GAWA 1AU8A 1P12E 1O2LA 2GCTC 1BRUP 3FZDA 4H4FA 3QZRA 2WHXA 3MTYA 5SGAE 2ZFSA 1VGCC 5FPYA 3BTDE 5AF9H 1EAWA 1ZLRA 1L2EA 2ZU3A 4FUIA 2OQ5A 4QT8C 3MFJA 1SKYE 4JZFH 3RM0H 4OS6A 4FU9A 3P8FA 3TH3H 2J94A 2AGIX 1GMDG 1ANCA 1KIGH 3SNCA 4ACBA 1SVPA 1MTSA 4Q7ZA 2PP6A 1EAXA 3EA9A 1UCYK 1KYNA 3U8TH 2IPHA 5E2OA 4UFFH 1AWHB 4OS7A 1LQEA 1TPAE 2FOAA 2B0FA 4K8YA 2FESH 3PRBA 1UTQA 2QF0A 4CRFA 2Y7ZA 2IN2A 5E0HA 4AZ2B 1WTHD 1K9OE 2GP9B 1O37A 2PSXA 2I6SA 1MTNB 3GYMA 1Z71A 1CBWB 5JB9S 4BANB 4VGCC 1CHOG 1O3DA 1Q31A 3M7UA 1W12U 3BV9B 3DFJA 1HIAA 7KMEH 2BD9A 4YTAA 3M3SA 4MNWA 1S5SA 3SJKA 1THSH 3QZQA 4DOQA 2WV4A 2GCHF 3UAIC 1GGDC 3BG4C 2ZU1A 1C1OA 1QNJA 5DP6A 2FOFA 3DA9B 2CV3A 2H6MA 1OSSA 1QIXB 3V13A 3NXPA 2V6NA 1Z8GA 4CRBA 1C1RA 1GMCF 5LPRA 2UUKB 2PTCE 2XWBI 1O5CB 3UNRA 3OY5U 2FOMB 1C5RA 4MG3A 1TNLA 2BQWB 2FOCA 1LMWB 2FPZA 3TH2H 3U1JB 3RMLH 2L74A 1WCZA 5EQSA 1JMOH 3T29A 3AASA 2IPQX 3PYHA 2OTVA 1SGQE 1YM0A 4AYYB 4WWYA 2B9LA 3MH7A 2BLQA 1EZSC 3PO1C 1V2VT 2XBWA 4DT7B 1QRWA 2AEIH 2ZGBH 1WYKA 2KM0A 2TGTA 3U1IB 3ZZ6A 2YMSC 1TPOA 4I8KA 1GDUA 1HAZB 1GVZA 1T32A 1ETTH 1GHAG 1YKTA 1ESBA 1VITH 5K7RA 1QQUA 1NPMA 3RU4T 2ODYB 3K65B 4E7NA 5IDKA 3OY6U 1HJAB 1LCYA 4ABGA 1WAYB 4JYVH 1WBGB 1D6WA 3KIDU 1N8OC 5T3HA 1NESE 4F55A 4A7IB 1TE0A 2EI8A 1VITF 2BHGA 1HNEE 1C2GA 1PQ7A 1RIWB 3VGCB 3SJ9A 3AW0A 4Z0KA 1K21H 5A0CA 4Y79A 2ZDAH 2PKSC 1NRQH 1QJ1B 1P3EA 3N7DA 1GHBG 3FKSD 1AIXH 1KDQA 3ODDA 1BOQA 1IOEA 4WMEA 2J38A 2PV9B 1DWEH 1PQ5A 2SGAA 3LH3A 4AX9H 3RXUA 2IJD1 3LOXA 1BTYA 1DVAH 3O8DA 5T6GA 1KXCA 1W7GH 2WUBA 2FOBA 2PR3A 1OWDA 2P95A 1W0JD 4UDWH 3L6PA 4A1TA 1G3DA 1NU9A 1BRCE 1GDQA 4I86A 3M37A 1FNIA 3SV9A 2AMDA 1OWKA 1O2ZA 2RDEA 1HYLA 1KLTA 1ESTA 4CHAC 5C0UA 4D7GA 3KQDA 3ATLA 8GCHF 4YZUA 5E0JA 5EIYA 3UREA 1CGJE 3EAJA 4ISNA 4ABBA 1YC0A 3URCA 1QL9A 2ANWA 3QO6A 3HKJB 4X2XA 1NRRH 4CRCA 1T8LA 1G32B 1RTLA 1DWDH 2OCVB 5A09A 1YP9A 3RXGA 1AQ7A 3P95A 7GCHF 4NSVA 2J4IA 3SU6A 5A8YA 3OEHD 2ILNA 4TY7A 3RXFA 1BMNH 3B8JA 1H4WA 4GVUA 1SLVB 1NC6A 2AHME 4Z6AH 2GMTB 1SR5C 2ZIQH 3FFGA 2K0QA 1GI7B 3BTKE 1RTKA 2RCEA 2W3IA 1RJXB 1MU6B 1KLJH 4Q7YA 5GNDA 3SHAH 4FUBA 2JH6D 2Z3EA 1O30A 1DY9A 1NZQH 2LPRA 3ZVGA 3H5CB 1AY6H 3VG8A 1EPTB 1GBEA 1SI5H 1TGBA 1FY3A 1Z6EA 4X1QU 1HAIH 3GCTG 1TX8A 1AZ8A 2AERH 5GJ4B 1K1OA 1EOJA 3P8GA 1AZZA 4FUCA 4I8HA 3QN7A 1N1LA 3TGKE 3KF2A 5EW2H 1FDPA 1J17T 1KTSB 1H8DH 5KEDA 3BG8A 1Z6JH 4CREA 1SQAA 3GCHB 2FMJA 4B2BA 3ZZ3A 1DUAA 3N7OA 2QCYA 2V3HH 1O2JA 3MO3A 1Z8RA 1RTFB 1NN6A 3S0NA 4MVNA 2Y5FA 3MI4A 2Q6GA 2R2MB 3MU5A 1MKWK 3A89A 5CHAB 2ZG0H 3D49H 1C5ZB 1IQMA 1ELEE 2BD4A 2G52A 1BITA 1YPGH 3TK6A 5K0HA 4JZIA 1TBZH 1E37B 1OOKB 2A5KA 2AMPA 4MNXA 4F4OC 2F9BH 2GJGA 1TNIA 8ESTE 1DPOA 3ZZ8A 3OTJE 2GCTB 2Z3CA 4Y71A 3RDZA 3RC4A 2AYWA 3SNAA 1ZHRA 3BN9A 3LGTA 4Q2KA 3WW7A 1JOUB 3MH4A 2G51A 1MAXA 2J9NA 1GJBB 2R9PA 4D8NA 5HXFA 1GI4A 3KYGA 1MU8B 1P05A 1EOLA 3FP7E 4UFDH 3VFEA 2CMYA 1ZZZA 3LONA 1O3AA 1BJVA 1SFQB 1EASA 1K1LA 2W5EA 3F0OA 2BY7X 5ABWA 1PJPA 4AGJA 1OXGA 1ZTKA 2FTLE 4SGAE 3SJOA 2Z9JA 3F9HA 2PTNA 5L2YH 1GJ6A 4BXSA 2BDBA 2M2AA 5EJ1A 3SGQE 1DITH 1YLNA 2BD7A 1F5KU 1OP8A 3FANA 4X6OA 2W7UA 1EFRD 1LHCH 4NCYA 3R3GB 2QF5A 5G4BA 5JBCS 2YNBA 5C1UA 1AGJA 1GHWH 1A5IA 2EEKA 2R2WU 4CBNA 1OWEA 4GCHF 5EQQA 3SV6A 4YLUA 1NFYA 2VIWA 3RC5A 1GBLA 2KCAA 3AK5A 1AFEH 1QRXA 1O36A 2G4TA 2FI3E 2PW8H 2QIQA 1A0LA 1BHXF 1D3PB 5A8XA 2OINA 2WV9A 2XNIA 4DY7B 1C2EA 3LGVA 1GMHG 1P2IA 3ZZAA 1BIOA 2PFEA 2OBQA 1P02A 1TBRH 3A82A 3OE7D 3NCLA 4O03A 4GHTA 4ASUD 3SZEA 1SGFG 1YPLH 2VIVA 2STAE 2HNTE 3D65E 1H8IH 1MKWH 1AE8H 1LO6A 4U2WA 5DP5A 5BPEA 2BZAA 3KGPA 1C2DA 1CU1A 5EODA 3SUEA 5FCRA 1KY9A 2JJ1D 1OWJA 4NG9H 1MCVA 4XBCA 3ATWA 4KTUA 1JIMA 2VVUA 3LH1A 4XE4A 4E05H 1TIOA 1YGCH 4X1RU 1RD3B 2ZZUH 2AGEX 4HTCH 2OP9A 4JYUH 2FS8A 4RT0A 2Y5GA 1UK3A 1SGNE 4IMQA 1O3CA 1C4U2 2CHAC 5IK2D 2KZ4A 4RI0A 2ZGCA 6CHAB 2O8WA 2YMSB 1SGRE 1A0HB 4Y76A 4NA9H 4B1TA 2BB4A 1GBTA 1GJ5H 2ZDVH 2KFWA 2JETB 3PRDA 3CNRA 4NWLA 4Y8XA 1C5NH 1EUFA 1IHSH 2H9TH 2OD3B 3FOAA 2DE9A 2ZCKP 1F2SE 1C4Y2 3SOSA 4ZH8A 5T1VA 4JYTA 3IWMA 1G3BA 2J98B 3TGJE 3ATMA 1K1IA 3LT3A 3F0PA 2ZNKH 4MNVA 5EXLA 1UMAH 2P3TB 1BTWA 2VIOA 1GMDF 2Z6BD 5A0BA 6LPRA 1EZQA 3M61U 3V12A 1O3HA 3MU0A 4IBLH 3F2GA 1GI2A 1C5QA 1O5GH 1OX1A 4INHA 1GBKA 5TJXA 2BZ6H 1P01A 3BTHE 2BY5X 1SBWA 2Z94A 1IQFA 4ZHMU 4R8TB 1V6DA 3OTPA 4ZKNU 2FOHA 2VWMA 4X6PA 1Y8TA 1EJAA 1EPTA 4IN2A 2ZECA 4OS5A 2EC9H 3ZVDA 1L1GA 3EE0B 1JXPA 1GJ9B 3RMMH 1GG6C 1UTLM 4CBOA 1CHOF 3PMBB 1KXAA 1TNKA 4M9FA 4YM9A 1CA0B 1FZZA 1Y3WA 5DK1A 4CRGA 1NY22 2THFB 1WQSA 2KCPA 3DCLA 3NK8A 3BIVH 4JMYA 4BTTB 1SLWB 2W26A 4YOGA 3ZIAD 3MWIU 3VPKA 3SJIA 3QGJA 4DIHH 2P16A 1S82A 1NRNH 4DGJA 3U8OH 2ZU5A 4TY6A 1C2JA 4YXWD 3ZZBA 1QJ6B 3OYPA 1FY8E 1PFXC 1ESAA 4A6LA 1TYNA 4Y7AA 3ATKA 1FAKH 1GCTC 2BLOA 3GDSA 3ZV8A 1C1TA 1EAUA 4ISHH 2OC1A 2PLXA 1BMLA 1O3FA 1SGPE 3LU9B 3TH4H 1O2TA 4YLQH 3A83A 3GY6A 5FHTA 1VR1H 2FI5E 2ZPQA 3A7TA 4HFPB 3STJA 3OU0A 1K1MA 3PM3A 1FONA 4CRDA 4ZHLU 4Y0ZE 1FIZA 1BRAA 1C5XB 2BLVA 1CGHA 4FUJA 5A8ZA 3A84A 2GT8A 5EJZA 1TALA 1ELGA 3L3TA 3SGAE 4LZ4B 1AN1E 3D62A 1S6HA 1TRYA 1Y3YA 2TRMA 4ISIH 3NRLA 3EE7A 2OBOA 2ZQ2A 1MD8A 3TLOA 3O8BA 1AE5A 4TSFD 4ZXXH 1SB1H 5DG6A 6GCHG 1P57B 5BRRE 1V2ST 2XOKD 3RU4E 4ZXYH 4A1XA 1DX5M 2Q6DA 1Q3XA 2UUYA 2PUQH 3BIUH 1QBOA 2HVYB 1GBAA 1QBVH 4XBDA 1GHAF 1EZUC 1XUGA 5HIYA 3U98H 2A7CA 1KSNA 2VGCB 1ACBE 1LDTT 3PMHB 3GY5A 3PLPA 3ZVBA 2VH0A 1C1SA 1TRMA 2VBCA 2A2XH 2ZKSA 1TX7A 1YLDA 1NRSH 1O5EH 1OYQA 3HPTB 1QL8A 4BAKB 1P2KA 4OM9A 2FS9A 1TWXB 1FIWA 5E0GA 1E0FD 1QJ7B 3E91A 3LC3A 2BDYA 4ZKRU 3RU4D 5E2PA 2SFAA 3DD2H 1G30B 2XTTB 1PPEE 2B7DH 3RMOH 3BEUA 1HAPH 1A5GH 3SGBE 4BTUB 1P3CA 1WU1A 1FN8A 2WPDD 4X0WU 1GHBF 5C20A 4P02A 1BMAA 1FMGA 5GIBA 2NU1E 4DIIH 4MLFB 3HGNA 4I8GA 1C2FA 1G37A 1ZTJA 1BBRH 1COWD 2ZTXA 4AFSA 3LKWA 2KCOA 5KGOA 3A86A 4YOIA 4K8BA 3FO8D 1ABIH 2F9OA 3UIRA 1O2KA 3RXOA 4ZAEA 2GZ7A 2VINA 3P17H 1XX9A 3A7XA 3MH6A 2B5TB 1A3EH 1MBQA 5LPFA 3FN8A 5HIZA 3DSPA 3TITA 1PYTC 4GHQA 1D3DB 2F91A 2C3SA 3LGWA 1O5BB 1BBRE 3ZZ4A 4DG4A 5EU8A 3RXDA 2F43B 1IQEA 1EJMA 2ZPRA 3A80A 2IOTA 5GPIB 3TJVA 1GHZA 5C17A 3RXKA 1ZTLA 1SG8B 3TK5A 4AFUA 4BAOB 2ASUB 2P93A 4IGDA 2UUJB 3E8LA 2BDIA 5T6FA 1OYTH 4MPXA 1C2IA 3OEED 1CQQA 2ZA5A 1EB2A 4P00A 4FVBA 1U6QA 3BTTE 1T4UH 1UK2A 1VJAU 1C2KA 4XOJA 1Z1JA 4FU8A 2TPIZ 3BEIB 4PROA 5DP4A 1H9LB 1SPJA 4B75A 2F4LA 4K1SA 2FWWA 3MNSA 4INKA 4ACAA 4IN1A 4WJG2 4K1TA 1ZSLA 3A8AA 2Z3DA 5GCHG 2OK5A 1QBNA 1ZSJA 3MU8A 1AUJA 3L33A 1LHEH 3VB4A 5EQRA 4NFFA 5FPSA 3RXIA 1MCTA 4XRNA 1WSSH 1K0HA 1A0JA 1PPBH 2J98A 3SU2A 1ZR0A 1A1RA 4AGKA 4ESTE 3GCTF 5FBIA 1TFXA 1LTOA 1T31A 1HAVB 2FIRH 2AMQA 2WPKS 3DUXH 1C1MA 3RXHA 4CRAA 5C94A 3F68H 1TONA 1F92A 1GJDB 2KAIB 4BNRA 3AAUA 1AI8H 1SC8U 3A85A 4K60A 3KQBA 1NS3A 1O5FH 3O8CA 3TJNA 5FX6A 1PPGE 3SU3A 1FX0B 1QB6A 4ZKOU 2YNAA 3E0PB 1C5LH 1QTFA 2ZFTA 1GPZA 1XXFA 3EA8A 2J97A 2HNTC 4AN7A 1UK4A 2CF8H 1XUJA 2BMGB 4INLA 1V2UT 2ODQA 5CE1A 3LJOA 3H7OA 1SLUB 2STBE 2LNCA 2BXTH 2OQUA 1UHBA 3BTME 5FL7D 1D6RA 1MKXK 1F5RA 1P9UA 2M5TA 1GI0A 2ZHWH 2TGAA 1EAIA 4YESB 2YOLA 4NWKA 3ZV9A 2Y5HA 2R3UA 2KX4A 3WWFA 9LPRA 1JRTA 5F8TA 3R0FA 2G5NA 1LQDB 4LOYH 1MZAA 2QF3A 1AFQB 2Y6TA 4H6TA 3W94A 1XMNB 2WYGA 2PWXA 2FXRA 4Q80A 2AGGX 1MH0A 1XXDA 2Q1JA 3PLKA 5EJLA 4UD9H 4BAMB 2GZ9A 1EP5A 1AO5A 1C5WB 1THPB 2R0KA 4Y11E 1DSUA 2F3CE 3CP7A 3EGKH 1O3MA 2DUCA 3SUDA 2Z9LA 1XKAC 2UWLA 1LPKB 2XXLA 1BTZA 3RC6A 4BXWA 3KEEA 2IJOB 4AYVB 5DN6D 1FQ3A 1TQ0B 1SSXA 1W7XH 1EP6A 4FUDA 2D26C 3ZYEA 1GG6B 3B23B 1AB9B 2HPQH 3HKIB 3N99A 3HK6B 3RXJA 1G3EA 3S9AA 2GV7A 2F9PA 1Y3VA 3P8OA 4RT1A 1ZMLA 2BX4A 1YCPH 3RXPA 1HAHH 3EQ0H 1JRSA 1V2WT 1B7XB 1C1QA 1AVXA 2UUFB 2A4GA 3AW1A 3JZ2B 1EX3A 1YYY1 4WMFA 3K9XB 4O3TA 1JIRA 1O5AB 1WTGH 3HK3B 1QZ8A 2LP6A 1PQAA 2A4OA 3H7TA 3F2HA 1GJ4H 1ABJH 2QA9E 2C8WB 1LVYA 3ENSB 1OP0A 4R0IA 3U9AH 1VZQH 6ESTA 3DSOA 2OLGA 4TWWA 7LPRA 3AAVA 1O2GH 3F6UH 1L4ZA 1MKXH 4HI3A 4OGYA 2ZDKA 1MTWA 1O3BA 1SMFE 3A8BA 1O33A 1O2XA 3P6ZB 4GSOA 1HCGA 4X1SU 3SQEE 1RXPA 4Q7XA 1UVPA 3SW2B 4HZHA 1O0DH 2BYAX 3RXAA 1CGIE 4KGAA 1UJ1A 5F53A 4X6MA 2DE8A 1GBIA 1BB0B 2QY0B 2GGVB 3M3VA 4TWYA 1K1JA 4JK5A 3A8DA 3KCGH 1C9TA 1FY1A 1ZHPA 5DKMA 3TVJB 2BDAA 5DPAA 5J4QA 1E1QD 1W0YH 3I77A 4FOUC 3QUMP 1ZPCA 1E79D 3K6YA 2CJIA 5DP3A 2BXUH 1IAUA 3G01A 3UQVA 2VIQA 1DXPA 1W11U 2BLWA 1MABB 4JZEH 3OFND 1BZXE 2K1QA 1P10A 5LPEA 1L0ZA 3PV2A 1GI6A 2WZQA 1CVWH 3WWBA 2RG3A 4D7FA 3V7TA 3SZNA 1VGCB 3GCOA 3E1XB 4KKDA 1C5VA 2QAAA 4TYDA 4Y8ZA 4ABHA 2FZZA 5FPTA 2XCNA 1WUNH 3SYJA 2P3FH 1TOCB 2BX3A 2PGBB 3CENA 1C2HA 4IC6A 1V2LT 1ARBA 1F0UA 3F3BA 1TBQH 1SFIA 1MZDA 3MNXA 4B6FA 2ZHQH 1O3GA 2ZDMA 1HAVA 3DSGA 2AIQA 1SHHB 5B6OA 2ZTYA 4M7GA 1S0QA 1O3PB 3SNBA 4NZLA 3PV4A 3T2NA 1XUIA 2KAIA 3ZVEA 1YCPM 1LHDH 1J15A 2ANKH 2GTBA 3GDVA 2C93B 1FN6A 3MO9A 1PPCE 4YO9A 3SNEA 3BTWE 2A45B 2HLDD 1UTJA 4VGCB 1MTNC 1N6YA 3AVZA 4I32A 4MNYA 1QL7A 5FCKA 3MMGA 1CBWC 2XBYA 1DDJA 1GI5A 4WH8A 4XDEA 4IC5A 5EW1H 3P8NA 1X7AC 3C27B 2BD3A 1LKBA 4MPUA 2BD2A 1HBTH 5TCCA 1P04A 1Y5AT 1F0RA 3LGIA 1T4VH 1ELTA 4KELA 2FTMA 2C8ZB 1GJCB 1TAWA 1ELVA 3ZZ9A 1B0FA 2FX4A 2RA0A 1DY8A 1K22H 1TABE 1GGDB 3BG4B 2ZU2A 1IQLA 3GY3A 1VKYA 1BDAA 4I8JA 4MPWA 1AWFH 1MMJN 1L1NA 3KHVA 1KXEA 1QY6A 4AFZA 3OX7U 1O3IA 1ID5H 7GCHG 2BM2A 1H8ED 3QDZB 1ANBA 3T27A 2CXVA 5C0TA 2H9HA 2WPIS 3KQ5A 1HFDA 3RLYH 1J14A 4JZDH 3TIUA 1HRTH 1BHXB 1V2NT 2F9VA 4ZHAA 1YPHE 6GCHF 1GBHA 3GYLB 4BTIB 3BEFB 1HJ9A 5A2MH 2BDGA 4NIVA 4ZUHA 4YT6H 3U28C 1K2I1 1GVLA 2D1JA 3PO1B 1BTUA 2ZDLA 2PUXB 2YMSD 3FP6E 3GISB 2K8IA 1HAYB 1P03A 5EXMA 4HG6A 1DXWA 2QV1A 1AD8H 5EOKA 2ZGXH 5AHGH 1SOZA 1C9PA 2I6QA 2Z9GA 2ZFQH 1GJAB 2VVCA 3E3TA 4I8LA 1QCPA 1C1UH 3UNQA 1MAYA 2ZF0H 1GBCA 1DWBH 1T8OA 1N8OB 3GCNA 2XC0A 3LGUA 1O38A 1P9SA 1UTMA 3HGPA 3MQKC 1E38B 3U69H 1Z1IA 1HJAC 3S9BA 4ZMAH 4KTSA 5T6DA 2GKVE 1C1PA 1KTTB 2Y82A 2PKSB 3RP2A 3VB7A 1MTVA 2XBXA 4B6EA 2ZEBA 1GI9B 2W3KA 3S9CA 1S84A 3HATH 4CR5A 2H9EH 2FM2A 4WY3A 2G00A 3PLBA 1ZJKA 1S83A 3TK9A 2A5IA 1QA7A 1NO9H 3ELAH 3PROA 1WQVH 2WSSD 5L30H 2BY9X 2BQ7B 4WXVA 1O2UA 3I78A 5AFZH 4MQAA 4AORA 2V35A 2AIPA 4GPGA 1P06A 3FZZA 2A7HA 3A7ZA 2VWNA 3FP8E 1YY3A 2HGTH 1O2IA 3F9GA 2VIDA 4FUEA 5L2ZH 1ZSKA 2ZTZA 3TU7H 4IW4E 3GY7A 1O2HA 4CHAB 2BY6X 1OWHA 1UHBB 2NU4E 4UEHH 2G5VA 4X8VH 2WPMS 1BMMH 3CS0A 1ANDA 1BBRK 3SUFA 1E34B 1MBMA 2PHBA 2FEQH 1W2KH 2LELA 1F0TA 2OC8A 3RXVA 4B73A 3A88A 1SGFA 1ZOMA 4D9RA 4HGCA 1GL0E 3RXRA 2FLRH 3SV2H 2FOGA 2CF9H 1BQYA 5LGOA 1THRH 1KMHB 4XFQA 5GCHF 4WH6A 3ZVCA 3M5NA 4X2YA 1FI8A 1TRNA 3MH5A 5C67A 2RFKC 1E1RD 3E16B 3D23A 2A7JA 2FOEA 1AKSB 1CSOE 2ZI2H 1HXFH 4UFEH 5FXLA 1MTUA 1O34A 1Y5BT 2AFQB 4NGAH 5HMAA 4FU7A 1W13U 1F5LA 1A61H 5DP8A 2HOBA 1GHXH 2A31A 2PGQB 2ZGHA 1SGCA 5F8ZA 3V0XA 1HB0B 1HPGA 2ANYA 1YWUA 1SGTA 1S85A 3VXFH 4B71A 1C5PA 1O2OA 3OSYA 4MPVA 1Z7KA 5DSFA 5H4IB 2GMTC 3Q76A 1B5GH 1EATA 1C5MD 3MU1A 2VU8E 4I33A 4OS1A 2H1UA 4NZQA 1SQOA 2G4UA 4WF8A 5HGGA 4THNH 3UWJH 1DLEA 2FLBH 2EA3A 2Y80A 4NIWA 2TGDA 3CS7A 3SO3A 1EPTC 2Z9KA 3MYWA 1Y59T 2FO9A 2KR7A 1T8NA 5JB8S 2ALVA 1OS8A 3GY2A 1QRZA 1SGDE 3BF6H 2A5AA 4XSKU 2NU0E 1AUTC 2UWPA 3UUZA 1BUIA 3F1SB 2AS9A 3NZIA 2PKAA 4DCDA 1HGTH 2QXGA 5EPNA 2HPPH 2XBVA 1OPHB 3OAAD 2C8XB 5HM9A 1EXFA 3A8CA 3GCHC 2ZPSA 1GHYH 5EG4A 1A3BH 3UTUH 1NM6A 2F83A 2O9QA 1TB6H 5F03A 2O8TA 5A0AE 4GUXA 3SBKA 2ESTE 7ESTE 4FUGA 1V2PT 2WPLS 1B0EA 1BMFD 1IQNA 2P3UB 5DO4H 3M5MA 1CT0E 4NA8A 4J2YB 5CHAC 1ANEA 3PMAB 1V2MT 4RSPA 5HYOA 1TNJA 1H8HD 2WINI 4NA7A 5C2ZA 3NKKA 2G55A 1ZRBA 1J8AA 3T62A 1O35A 3SORA 3M35A 4KP0A 2ZDNA 1M9UA 5HM2A 2GVFA 2CN0H 5AFYH 2SGEE 2OC0A 4RN6A 1HV7A 3K2UA 2HVXA 3MU4A 1ETRH 2ZP0H 1D9IA 5CDFE 1PPHE 3FVFB 2G8TA 5CMXH 2EQNA 3RXSA 3E6PH 1T7CA 1BRBE 3M5LA 1Z8JB 3VB3A 4UE7H 3MNCA 4X1NU 1SGIB 5AVDA 4DW2U 1A4WH 1DOJA 2A0QB 3I29A 4A5TS 3M36A 1UVSH 3A7WA 1QURH 1SQRA 1DSTA 2ZFFH 2J2UA 2O8UA 3RXQA 3O8RA 1D3QB 3T26A 2FYRA
chains in the Genus database with same CATH topology
4MDSA 1XVMA 1ZPBA 2C8YB 1MUEB 2OXSA 3ZZ7A 1Y3XA 2BDHA 5F6MA 3SU4A 2FDAA 3ZZ5A 2VNTA 4RKJB 2NU3E 4K3JA 4ASHA 3ZYDA 1UTNA 3U8RH 2CGAA 2ZFPH 1INCA 3VB5A 3Q3KA 1C5YB 4FXGH 4MTBA 3SI4H 1O2PA 1ELDE 5LH8A 4AB9A 2WPJS 4DVAU 1HAOH 4B76A 1JBUH 4D76A 1O3JA 2GT7A 3TNTA 1XUFA 1YCPK 3SU0A 1IQGA 3W95A 1C1WH 1LPZB 1O2MA 4K5ZA 2XCFA 1VCPA 1IQIA 3SUGA 2XRCA 3SV8A 2Q6FA 1MQ6A 3UWIA 1OKXA 2BVRH 1O31A 4ABJA 5DP9A 1ZJDA 1P8VC 1HDTH 4H6SB 1V2KT 2JKHA 4Y6DA 2P94A 2CHAB 3BSQA 4O9VA 4I7YH 1TGSZ 1F0SA 1P2OA 4GLYA 3NWUA 2ZCLP 3Q00A 3TPIZ 1JWTA 6CHAC 4X8UH 1SQTA 5GWZA 1BTPA 2ZGJA 4ABDA 3ITIA 1CT4E 1PQ8A 1UCYH 1YPHC 2D8WA 3PB1E 1CHGA 2H5CA 4WMDA 2JETC 3ZVAA 2R3YA 4BAHB 4AOQA 1C2MA 2BVXH 2FYQA 4X1PU 4D9QA 4AB8A 1O2RA 1O2YA 4U01A 3UQOA 1V2TT 3RXMA 1XM1A 1TPSA 3DFLA 3M5OA 1FY5A 1P2JA 3MNBA 4NFEA 1O3KA 1O2SA 1AKSA 1A46H 3KQCA 1NFWA 1ZMNA 5DJ7A 3UY9A 1UCYE 4X2VA 3URDA 3LIWA 5EPYA 1C5OH 4XBBA 1ELBA 4JK6A 1C4V2 2HRVA 4E06H 1DICA 8KME2 3RXTA 3FAOA 5I25A 2F9NA 4ABFA 5GXPA 1EJNA 1J16A 4X8SH 1O3OA 3EDXB 2ALPA 4Y8YA 4FUFA 1DFPA 1LHGH 2JH5D 4JZ1A 1ZPZA 1GHVH 1TMBH 4OS2A 3SU5A 2A1DB 2G81E 3RXBA 3S7HB 2BOKA 4LZ1H 1GMHF 1CA0C 2BD8A 1N6XA 3KL6A 2ZC9H 2AH4X 1UVUH 3M3TA 3E90B 8LPRA 2ULLA 1C1NA 3BTGE 1S81A 3E0NB 4O3UA 2QN5T 3SV7A 1KXDA 3BTEE 1GCTB 1IHTH 3GDUA 4AG1A 5C1YA 3LDXH 2GD4B 1YLCA 1FJSA 2VIPA 3PTNA 1PPZA 1O2NA 1TLDA 4K2YA 1RFNA 4U32A 3GOVB 5GDSH 2A32A 1QGFA 2O8MA 3PMJA 1TPPA 4TPYA 2GCHG 3TNSA 1SL3A 5DGJA 2SNVA 3ODFA 2TBSA 1UVTH 1Z8IB 2ZHDA 2BD5A 3EYDA 3RXEA 1L4DA 2WUCA 2SGQE 3TJOA 3IITA 4NIXA 1H9HE 1GMCG 4F49A 4FUHA 4X8TH 1P0SH 4ABIA 2P8OC 1O2WA 3MO6A 3GY8A 3A81A 1ELCA 1TGCA 1P2MA 1NTPA 1LVOA 3LJJA 4ISOA 2BDCA 1TGTA 2F9UA 1O32A 2GX4A 1D3TB 1SOTA 2VWOA 3KQEA 2D2DA 1GBBA 1H9IE 2VGCC 1A2CH 1TMTH 4O97A 3DT0H 5ETXA 1W14U 2TIOA 1EZXC 1IQJA 1NU7B 3WY8A 3MOCA 3M7TA 1WV7H 2C4FH 5C5NA 2TGPZ 1TNGA 1CO7E 1YPMH 1ORFA 4X6NA 3RXCA 4LXBH 1O3LA 1OP2A 2ANMH 1IQHA 1FXYA 1UO6A 1FV9A 1TNHA 1GI8B 1PPFE 1AHTH 1TOMH 1DWCH 3ESTA 1ARCA 1NFXA 1G2MA 3QK1A 3QTVH 4ISLA 3SN8A 3GY4A 3SNDA 3Q3YA 1VITG 3RXLA 3UPEA 1GBFA 1O2QA 2XYAA 1CT2E 1AVWA 1YPEH 3KN2A 1ELFA 2P59A 1GJ8B 1HJ8A 3BTQE 1P11E 4NIYA 3UNSA 3DHKH 2PKAB 3V3MA 1GBMA 3T28A 1O3EA 1PYTD 5JBBS 1UTPA 1DANH 5EGMA 1BT7A 1GWAA 1C5UA 1ETSH 4OGXA 3ZZDA 1P09A 4WVPE 1CA8B 2Y7XA 1GI1A 1S0RA 2Z9IA 5ESBA 3QX5H 5F8XA 3A87A 2XWAA 4UONA 3UOUA 5JBTA 3PTBA 2ZCHP 4YT7H 3P70B 2J95A 4OS4A 1QHRB 4RKOB 3UFAA 8GCHG 1V2JT 1FPHH 1YPKH 1GDNA 3QTOH 3ZZCA 2SGPE 4E7RG 4UFGH 5C5OA 2WYJA 2HWLB 4A1VA 3MHWU 2ZQ1A 1LHFH 3STIA 3VB6A 1QB9A 3JZ1B 3F9EA 1SHYA 1BA8B 2WPHS 1ZRKA 2HNTF 1FAXA 2NU2E 2VB0A 2QC2A 1YF4A 1T8MA 2SGFE 1O5DH 2ZHEH 1K1PA 1Y5UT 1YBWA 1QQ4A 3KNXA 2XC4A 3S69A 1FPCH 1LVMA 3RM2H 1KXBA 3UR6A 1ZHMA 2A4RA 2BY8X 1ZMJA 1GL1A 2GDEH 3LC5A 2W7SA 2C90B 3RLWH 1LPGB 2HALA 1TA2A 1QR3E 1DE7H 2Z7FE 5J4SA 4SGBE 2BOHB 4DJZB 1TA6A 4K1EA 2BQ6B 4K69A 1W0ZU 1MD7A 1KXFA 3QLPH 1FUJA 1OWIA 1A5HA 2A4QA 3ATIA 2EI7A 1C5TA 1V2OT 1C5SA 1G9IE 1HIAB 1MQ5A 3RUOA 1ZGVA 3PWCA 1RGQA 3SQHE 1BJUA 1HUTH 3VEQB 4KTCA 2ZU4A 4CH2B 1NRPH 1WOFA 2QXIA 2H2ZA 2VWLA 1EQ9A 3B9FH 1ZGIA 3NUMA 1TMUH 1TQ7B 3UOPA 1Y3UA 1RIWC 3VGCC 3A7YA 2ZWLH 1V3XA 5JPMH 4LK4A 3VXEH 2EI6A 4WXIA 1S6FA 1G2LA 4X2WA 1LKAA 1DT2A 2FP7B 5C3NA 4FVDA 3TJUA 1AFQC 4DURA 5E8EH 3T5FH 3F9FA 3IG6B 4U30A 1TGNA 4NSYA 3M7QA 4BOHA 2FI4E 1TX6A 2A2QH 3TGIE 1E35B 4IS5A 1IQKA 4I31A 1SGEE 2SGDE 4Y10E 4ABAA 5JDUB 5FAHA 1K1NA 1GVKB 4B2AA 1QA0A 1GCDA 2ZO3H 3ZVFA 4BAQB 1DLKB 2O8LA 2ZHFH 2H5DA 2BVSH 3QWCH 1UVOA 5EXNA 1NFUA 3NPSA 4Y7BA 3Q3XA 2V3OH 2BTCE 1O39A 2XC5A 1D4PB 3T25A 2V0BA 1AB9C 4B74A 3RMNH 2HLCA 4CH8B 1V2RT 3A7VA 1GBJA 2OUAA 2VVVA 9ESTA 4H42U 1RS0A 1C1VH 1VJ9U 4ZKSU 4CR9A 1GI3A 5DP7A 1BCUH 3P92A 2WV5A 3K6ZA 1J9CH 5PTPA 1CE5A 1G3CA 1KDQB 1VCQA 4GCHG 2JH0D 4YOJA 4TPIZ 2R0LA 2GV6A 4J1YA 4ZROA 1DM4B 4ABEA 3C1KA 1FY4A 1RRKA 1LVBA 1VCWA 2PSYA 1GJ7B 2J34A 2QXJA 1L1JA 1P2NA 2VJ1A 2ZFRH 5FX5A 3SU1A 5I46H 1AMHA 1NT1A 1QFKH 2B8OH 2Y81A 3GICB 2FODA 1Q2WA 2GDDA 1UTKA 2OC7A 1W3CA 3SI3H 1UTOA 3UR9A 3SHCH 1V2QT 1HLTH 1HAGE 5IYTA 5JYIA 1O2VA 4IMZA 5TCAA 5C1XA 2GZ8A 5FBEA 1DUEA 3LPRA 3LGYA 1DS2E 2RDLA 4B2CA 2NWNA 1AVGH 1BTXA 1H1BA 1P2QA 2XW9A 2P8OB 2QYIA 5L6NH 1GBDA 3EA7A 2ODPA 1XVOA 1A7SA 1G36A 5ESTE 1K28D 2SNWA 1C2LA 5JBAS 2FX6A 3Q77A 1ZYOA 4AG2A 3QGNB 1EB1H 1XUHA 1FLEE 1HAXB 1NROH 1ELAA 1W8BH 4A92A 3BTFE 2RA3A 1BTHH 2J92A 4JCNA 1YPJH 1XKBC 3SJ8A 1EKBB 1O3NA 3S7KB 1KLIH 1W10U 1E36B 2VH6A 4AFQA 3PWBA 1SLXB 2QXHA 1SGYE 1QB1A 1XUKA 4Y0YE 1F7ZA 2UWOA 2QGRA 1HXEH 4GAWA 1AU8A 1P12E 1O2LA 2GCTC 1BRUP 3FZDA 4H4FA 3QZRA 3MTYA 5SGAE 2ZFSA 1VGCC 5FPYA 3BTDE 5AF9H 1EAWA 1ZLRA 1L2EA 2ZU3A 4FUIA 2OQ5A 4QT8C 3MFJA 4JZFH 3RM0H 4OS6A 4FU9A 3P8FA 3TH3H 2J94A 2AGIX 1GMDG 1ANCA 1KIGH 3SNCA 1SVPA 1MTSA 4Q7ZA 1EAXA 3EA9A 1UCYK 1KYNA 3U8TH 2IPHA 5E2OA 4UFFH 1AWHB 4OS7A 1LQEA 1TPAE 2FOAA 2B0FA 4K8YA 2FESH 1UTQA 2QF0A 4CRFA 2Y7ZA 2IN2A 5E0HA 4AZ2B 1WTHD 1K9OE 2GP9B 1O37A 2PSXA 2I6SA 1MTNB 3GYMA 1Z71A 1CBWB 5JB9S 4BANB 4VGCC 1CHOG 1O3DA 1Q31A 3M7UA 1W12U 3BV9B 3DFJA 1HIAA 7KMEH 2BD9A 4YTAA 3M3SA 4MNWA 1S5SA 3SJKA 1THSH 3QZQA 4DOQA 2WV4A 2GCHF 1GGDC 3BG4C 2ZU1A 1C1OA 1QNJA 5DP6A 2FOFA 3DA9B 2CV3A 2H6MA 1OSSA 1QIXB 3V13A 3NXPA 2V6NA 1Z8GA 4CRBA 1C1RA 1GMCF 5LPRA 2UUKB 2PTCE 2XWBI 1O5CB 3UNRA 3OY5U 2FOMB 1C5RA 4MG3A 1TNLA 2BQWB 2FOCA 1LMWB 2FPZA 3TH2H 3U1JB 3RMLH 1WCZA 5EQSA 1JMOH 3T29A 3AASA 3PYHA 2OTVA 1SGQE 1YM0A 4AYYB 4WWYA 2B9LA 3MH7A 2BLQA 1EZSC 3PO1C 1V2VT 2XBWA 4DT7B 1QRWA 2AEIH 2ZGBH 1WYKA 2TGTA 3U1IB 3ZZ6A 1TPOA 4I8KA 1GDUA 1HAZB 1GVZA 1T32A 1ETTH 1GHAG 1YKTA 1ESBA 1VITH 5K7RA 1QQUA 1NPMA 3RU4T 2ODYB 3K65B 4E7NA 5IDKA 3OY6U 1HJAB 1LCYA 4ABGA 1WAYB 4JYVH 1WBGB 1D6WA 3KIDU 1N8OC 5T3HA 1NESE 4A7IB 1TE0A 2EI8A 1VITF 2BHGA 1HNEE 1C2GA 1PQ7A 1RIWB 3VGCB 3SJ9A 3AW0A 4Z0KA 1K21H 5A0CA 4Y79A 2ZDAH 2PKSC 1NRQH 1QJ1B 1P3EA 1GHBG 1AIXH 1KDQA 3ODDA 1BOQA 1IOEA 4WMEA 2J38A 2PV9B 1DWEH 1PQ5A 2SGAA 3LH3A 4AX9H 3RXUA 3LOXA 1BTYA 1DVAH 3O8DA 5T6GA 1KXCA 1W7GH 2WUBA 2FOBA 2PR3A 1OWDA 2P95A 4UDWH 3L6PA 4A1TA 1G3DA 1NU9A 1BRCE 1GDQA 3M37A 1FNIA 3SV9A 2AMDA 1OWKA 1O2ZA 1HYLA 1KLTA 1ESTA 4CHAC 4D7GA 3KQDA 3ATLA 8GCHF 4YZUA 5E0JA 3UREA 1CGJE 3EAJA 4ISNA 4ABBA 1YC0A 3URCA 1QL9A 2ANWA 3QO6A 3HKJB 4X2XA 1NRRH 4CRCA 1T8LA 1G32B 1RTLA 1DWDH 2OCVB 5A09A 1YP9A 3RXGA 1AQ7A 3P95A 7GCHF 4NSVA 2J4IA 3SU6A 5A8YA 2ILNA 4TY7A 3RXFA 1BMNH 3B8JA 1H4WA 4GVUA 1SLVB 1NC6A 4Z6AH 2GMTB 1SR5C 2ZIQH 3FFGA 1GI7B 3BTKE 1RTKA 2RCEA 2W3IA 1RJXB 1MU6B 1KLJH 4Q7YA 3SHAH 4FUBA 2JH6D 2Z3EA 1O30A 1DY9A 1NZQH 2LPRA 3ZVGA 3H5CB 1AY6H 1EPTB 1GBEA 1SI5H 1TGBA 1FY3A 1Z6EA 4X1QU 1HAIH 3GCTG 1TX8A 1AZ8A 2AERH 5GJ4B 1K1OA 1EOJA 3P8GA 1AZZA 4FUCA 4I8HA 3QN7A 1N1LA 3TGKE 3KF2A 5EW2H 1FDPA 1J17T 1KTSB 1H8DH 3BG8A 1Z6JH 4CREA 1SQAA 3GCHB 2FMJA 4B2BA 3ZZ3A 1DUAA 3N7OA 2QCYA 2V3HH 1O2JA 3MO3A 1Z8RA 1RTFB 1NN6A 3S0NA 4MVNA 2Y5FA 3MI4A 2Q6GA 2R2MB 3MU5A 1MKWK 3A89A 5CHAB 2ZG0H 3D49H 1C5ZB 1IQMA 1ELEE 2BD4A 2G52A 1BITA 1YPGH 3TK6A 5K0HA 4JZIA 1TBZH 1E37B 1OOKB 2A5KA 2AMPA 4MNXA 4F4OC 2F9BH 1TNIA 8ESTE 1DPOA 3ZZ8A 3OTJE 2GCTB 2Z3CA 4Y71A 3RDZA 3RC4A 2AYWA 3SNAA 1ZHRA 3BN9A 3LGTA 4Q2KA 1JOUB 3MH4A 2G51A 1MAXA 2J9NA 1GJBB 2R9PA 4D8NA 5HXFA 1GI4A 1MU8B 1P05A 1EOLA 3FP7E 4UFDH 3VFEA 2CMYA 1ZZZA 3LONA 1O3AA 1BJVA 1SFQB 1EASA 1K1LA 2W5EA 2BY7X 5ABWA 1PJPA 4AGJA 1OXGA 1ZTKA 2FTLE 4SGAE 3SJOA 2Z9JA 3F9HA 2PTNA 5L2YH 1GJ6A 4BXSA 2BDBA 3SGQE 1DITH 2BD7A 1F5KU 1OP8A 3FANA 4X6OA 2W7UA 1LHCH 4NCYA 3R3GB 5G4BA 5JBCS 2YNBA 5C1UA 1AGJA 1GHWH 1A5IA 2EEKA 2R2WU 4CBNA 1OWEA 4GCHF 5EQQA 3SV6A 4YLUA 1NFYA 2VIWA 3RC5A 1GBLA 1AFEH 1QRXA 1O36A 2G4TA 2FI3E 2PW8H 2QIQA 1A0LA 1BHXF 1D3PB 5A8XA 2OINA 2XNIA 4DY7B 1C2EA 3LGVA 1GMHG 1P2IA 3ZZAA 1BIOA 2PFEA 2OBQA 1P02A 1TBRH 3A82A 3NCLA 4O03A 4GHTA 1SGFG 1YPLH 2VIVA 2STAE 2HNTE 3D65E 1H8IH 1MKWH 1AE8H 1LO6A 4U2WA 5DP5A 5BPEA 2BZAA 3KGPA 1C2DA 1CU1A 5EODA 3SUEA