3RXLA

Crystal structure of trypsin complexed with (2,5-dimethyl-3-furyl)methanamine
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cationic trypsin
publication title In-crystal affinity ranking of fragment hit compounds reveals a relationship with their inhibitory activities
doi rcsb
molecule tags Hydrolase/hydrolase inhibitor
total genus 56
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2011-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3rxlA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3rxlA02
2ZDLA 5JB8S 1XM1A 2ZU1A 1BOQA 1BRCE 1MTNB 2BYAX 1GHYH 1ZRKA 1EP5A 1SFIA 1Y3XA 3U8TH 1NPMA 1LQDB 1EZQA 2ZP0H 1QHRB 1HRTH 1AIXH 4WXIA 2F9VA 2HALA 1SGFA 1O32A 2JKHA 1MKXK 1L4DA 2FMJA 4OS2A 1C4U2 2ZGXH 4WY3A 1J8AA 1O2MA 3UR6A 4WH6A 3PMAB 3SZNA 4FUIA 3A88A 1O5DH 3MTYA 3TJNA 1SGCA 1NU7B 3UNQA 1G3CA 2OBOA 1HJAB 1LVBA 3L3TA 1GMHG 1P11E 1P04A 2BD4A 4ABEA 1F5RA 4MNYA 2ZF0H 3RUOA 4CRAA 1O2SA 1ELGA 2JETB 2PSYA 1G3DA 2BZAA 2RDLA 3ODFA 2JETC 5GIBA 1O5GH 1K1MA 1PPGE 1LPZB 4GUXA 1PQAA 4K69A 1GJDB 1XVOA 3MH5A 4AB8A 2OXSA 1Y5BT 4XOJA 5ABWA 1QBVH 3PO1C 4FUHA 2AIQA 1BT7A 3W94A 3VB7A 3QX5H 3ZZ8A 1VCQA 3UTUH 1V6DA 1D3PB 5AVDA 4LZ1H 2C90B 1TE0A 1TYNA 2F9OA 3QUMP 3AASA 3T27A 4ABFA 1GI7B 5CE1A 2AIPA 1DM4B 1OP0A 1TX8A 1HYLA 1GG6B 3VGCB 3BN9A 5EQRA 3QGNB 3FZZA 5A8ZA 1OOKB 2W7UA 5FCRA 2Q6GA 1THSH 2FI3E 4FUFA 1TNLA 4Q7ZA 4ZH8A 1FQ3A 4K2YA 3ATKA 1AE5A 2FOFA 1YLDA 1HIAB 2FI5E 3BTKE 2A5KA 3STIA 1T8OA 1TNKA 3UNRA 1BQYA 4GVUA 4NGAH 4AFSA 1O5CB 3UOUA 1A1RA 1HIAA 4AYVB 2H1UA 2ZU3A 3TH2H 1LTOA 3SU1A 2W26A 1QB6A 1NT1A 3UQVA 3DHKH 1TMUH 5C2ZA 4JZ1A 3RP2A 1A5IA 2J92A 3UREA 4ABIA 4DURA 1TNHA 2PKSB 1THPB 3RXMA 1EKBB 4X8TH 4Y7BA 1KDQB 5F8TA 4DIHH 1BRBE 2RCEA 1C5UA 1MQ5A 1O3LA 1BIOA 2IJOB 2G55A 1DE7H 1QJ1B 3A80A 3VB3A 2O8WA 1H9HE 1Z1IA 1FPHH 1N8OC 5L30H 1KXBA 1QB9A 3UIRA 1HAOH 3EDXB 4YO9A 3SJ9A 1DSTA 2Y80A 1UTOA 1O3GA 1ZSJA 1SQAA 1W3CA 3S9AA 1XUFA 2M5TA 1YPEH 4NZLA 1K28D 2G52A 2SGPE 3EA9A 1OKXA 2V3HH 2JH0D 2F83A 1T4UH 2ZECA 4CBOA 2B9LA 1KXFA 2AGIX 1BTXA 3EE0B 1AFQC 3QZQA 3OSYA 5FPYA 5T6GA 5DP3A 1FY1A 1QGFA 1TABE 5FAHA 3NK8A 1P12E 4O97A 1HB0B 1RJXB 1SR5C 1VITH 2HOBA 4Q7XA 4YTAA 2AERH 2FLRH 1VR1H 1K2I1 3KQBA 4K5ZA 5AFZH 3RXDA 2VGCB 1O3BA 1EXFA 2SFAA 1Y8TA 1HAZB 1V3XA 3AAUA 5AFYH 2BHGA 1C1SA 2PHBA 1A2CH 1GJCB 3KQDA 1FZZA 1ANCA 1ZYOA 1RTKA 1ELFA 1TA2A 1CT2E 2G81E 3MU4A 2NWNA 3GDUA 4D76A 3A83A 1CBWB 3S0NA 2DE9A 3A7XA 2OD3B 4X6OA 3KHVA 1SL3A 3A87A 1RIWB 1HJ8A 1F5LA 1QA0A 6ESTA 1C2EA 2ULLA 5E0GA 2VIVA 5LPRA 1O5AB 1XKAC 3F6UH 1DXPA 3SU6A 1HGTH 2SGQE 3RXGA 5IYTA 3T26A 4LZ4B 1GJ5H 3M5NA 2VWMA 3RXBA 4A92A 1O3CA 5L2YH 2Y6TA 4A6LA 2C8ZB 2VH0A 3OTJE 3T62A 1A0LA 2QF0A 1W7GH 4BAOB 1GVKB 3RU4E 4KTSA 1C1TA 3Q3YA 1IHSH 4UE7H 3E6PH 3ZZBA 3SNDA 3LGVA 2VH6A 4GCHG 2GV6A 4B71A 3BTQE 1SOZA 3RM0H 1O3EA 4FUBA 1LQEA 1TMTH 2ZIQH 1F0RA 1QBNA 4UFFH 1GI6A 4K3JA 2GGVB 3M7UA 1YP9A 3UFAA 2HWLB 3BTGE 2PTNA 1T8MA 1ZTLA 1SVPA 3SV2H 1ETSH 4X2XA 3RXQA 4AX9H 1MU8B 2NU4E 1S85A 1NTPA 2OC7A 3T28A 1RTFB 1JIMA 5F8XA 1O36A 3GY3A 2H2ZA 5C3NA 2EI8A 1K1IA 1GHZA 1ZGVA 1GBEA 3M36A 3T29A 2GDDA 1YPHE 4I8HA 5EGMA 5T6FA 3TNTA 7GCHF 1TPOA 1NRSH 1T4VH 2QXJA 2CV3A 4E7RG 4BAMB 2ZFSA 1O30A 1NESE 2BLQA 1GBCA 3UQOA 1G36A 1DUEA 1K21H 2CF8H 4MPWA 3UOPA 1TFXA 1AB9B 2R2WU 2YNBA 4B2BA 1V2WT 1V2TT 4UD9H 4E05H 3GISB 3GICB 1QJ7B 4Y8ZA 1C2GA 4K1EA 3M61U 1GPZA 2XBVA 3ZZCA 2KAIB 1RD3B 1W14U 3RMLH 1DANH 2UUFB 1JOUB 1QB1A 1S6HA 2ZFRH 4ASHA 1WBGB 1YPJH 3Q77A 2VB0A 1D6RA 3AAVA 5A0AE 2HPQH 1B0FA 2CJIA 2KAIA 1RGQA 2ZHEH 2GKVE 3A7WA 3NUMA 1N6XA 1P2QA 5L6NH 1BDAA 3OU0A 1C4Y2 4PROA 4MNWA 4UFGH 2OLGA 3PYHA 2A7JA 4RKJB 3TK9A 1KXCA 3GCHC 3OX7U 3P8GA 2HVXA 4FUDA 1KTSB 4IC6A 2QIQA 2HRVA 3MI4A 4XBDA 3ZVAA 4WH8A 2ZDNA 2HNTF 3GY8A 1FDPA 1ZGIA 1K1JA 2XNIA 1OPHB 5JDUB 3ITIA 4WMEA 1RRKA 1SBWA 1SI5H 1TPAE 3ESTA 3SU4A 1CU1A 1O3AA 1OX1A 3BSQA 6GCHG 2UWLA 1CT4E 3GY7A 2UWOA 3EA8A 3SUFA 1RTLA 3IWMA 3IITA 1W10U 2ODPA 2WPHS 1BRUP 5AHGH 4JZDH 1DX5M 2O8UA 4D8NA 3Q76A 1O2GH 5HGGA 1IQGA 2R3UA 7KMEH 4CR5A 1MTSA 2BLOA 2PUXB 3BTDE 3FFGA 1CHGA 1HNEE 3Q3KA 4ZKSU 1C5QA 1LCYA 3B23B 1KSNA 3MH4A 3P92A 2BY5X 2VIQA 1SOTA 3EAJA 2BD8A 1O39A 4IGDA 5DPAA 3V13A 2DUCA 2QXHA 3PLPA 1CO7E 3F9GA 3RU4T 2CN0H 1KXDA 1V2QT 1DWBH 2QA9E 1C5MD 3SU3A 4NCYA 4CHAB 1GGDC 1ELVA 2P3UB 1IQMA 1S0QA 3JZ2B 4MTBA 4KGAA 2WUBA 5FBEA 1GBIA 2BD7A 5FPSA 3A8DA 2ZHQH 2AGGX 1SGTA 3AW1A 2J34A 1HAXB 4Y8XA 4LXBH 1O0DH 1ESAA 1GI3A 3MNXA 1JWTA 1O34A 4BXWA 1O3MA 2H5DA 1P2IA 1C2MA 2EA3A 4ZHLU 1TNGA 1TPPA 1O3JA 2BXTH 4NFEA 4DOQA 1CA8B 3A7VA 1BMMH 1T31A 3GDSA 3SN8A 1HXFH 3SI4H 4A7IB 5LPEA 2Z9LA 3NWUA 3LC5A 3PTNA 3SV8A 3M5LA 3E8LA 3TLOA 1D3TB 2FZZA 3PLKA 1C2HA 4X1PU 3B9FH 1C1VH 1K22H 4XFQA 1D3QB 2F9PA 3P70B 4IW4E 2C8XB 2TGTA 1EPTC 3PWBA 1Y3WA 1NFUA 3M3VA 2UWPA 2Z94A 4B75A 1O3PB 3MNCA 1UVTH 1DSUA 1O2KA 1CA0C 2P16A 3BEFB 1TGBA 1G2LA 4IMZA 1S0RA 4JZEH 1GMDF 1N1LA 1XKBC 4X8SH 1GJ4H 7GCHG 1G32B 4DW2U 1OYTH 3ZZ4A 2BLVA 2G8TA 3N7OA 2BMGB 2QF3A 1YPHC 2GV7A 3PWCA 2FIRH 3TH4H 1V2UT 3T25A 2GZ8A 3LJJA 3ZV8A 1C5YB 4DT7B 5EXMA 4OS6A 4J2YB 3GY6A 2G51A 1BA8B 5FPTA 5E0JA 3TGIE 1ARCA 1EZSC 4I33A 5FXLA 2ZPRA 1O37A 3GCNA 1DFPA 1H8IH 1AWFH 1Q2WA 1ZRBA 3SV9A 1W0YH 3RXJA 3LGTA 1BJVA 1HAGE 1FN8A 1MH0A 1TBQH 1C5ZB 3M7QA 1HJ9A 1RFNA 2ZU5A 2P93A 3VB5A 1DY9A 5F6MA 1D3DB 2PGQB 1WYKA 4KKDA 5GCHG 2BD3A 2ZGBH 4OS4A 1KXEA 1MMJN 4E06H 5JBTA 1AFEH 2ZCLP 1BUIA 1SLWB 1F7ZA 1YCPH 3LH3A 5K0HA 4FU8A 4AFZA 3TNSA 3ELAH 3LDXH 1TNIA 1VGCC 2ESTE 2XC0A 1GBJA 3SNBA 1HBTH 1AGJA 3VB4A 1DLKB 1YGCH 1AVWA 1D4PB 1LDTT 4GHTA 3AW0A 3MO9A 4CR9A 1BTPA 1AN1E 4NZQA 2VWOA 4O9VA 2GD4B 2VWNA 1IQKA 2OC1A 2YNAA 3BEUA 1O33A 3A7YA 2WYJA 1EOLA 2XWAA 3MU5A 4NFFA 5T6DA 2SNVA 2C8WB 1BMLA 1A0JA 1HAVB 2TRMA 1BTHH 1UJ1A 2GT8A 3QTOH 3ZV9A 1C2IA 1GDNA 4OGYA 1FLEE 1P3CA 3PMHB 1HAVA 4CRCA 4ABJA 2Z9IA 2GDEH 1SFQB 3L33A 4GPGA 3UPEA 1AE8H 2BOHB 1C1OA 3E0PB 3WY8A 1TGNA 3U9AH 1TX6A 1INCA 1GMCF 6CHAB 1IHTH 4I8JA 6CHAC 2GCTB 1AWHB 4Z6AH 4MPUA 3ZVEA 2FESH 3U1JB 4IN2A 1NRPH 1E34B 1MTNC 2P94A 3V7TA 1DLEA 1ELBA 2A4QA 4ESTE 4K8BA 1QR3E 4FUCA 2IN2A 1FPCH 4ZKNU 2ZA5A 1V2PT 4BTUB 3MYWA 2QAAA 1FMGA 1GBMA 3RM2H 2PWXA 5EXLA 4DJZB 1PPEE 1O3NA 3FAOA 4J1YA 4JZFH 5G4BA 1L1NA 3DD2H 2THFB 1TGSZ 2BXUH 1JXPA 2XBYA 1O2RA 9ESTA 3TK6A 1F0UA 1VCWA 4OS5A 1NY22 4UFDH 3RDZA 1NFYA 1GI2A 1HJAC 1A7SA 4BTTB 4X8VH 1DITH 4Y11E 4UDWH 2C8YB 1ELAA 2FTLE 1HAHH 1Y3UA 2Y7XA 3U69H 1YF4A 2ZEBA 3ODDA 2BTCE 1BTUA 3LU9B 3SHAH 2FS8A 3S7HB 1GJ8B 1C1UH 4ZKRU 1GMDG 4NIWA 2BDBA 3HK6B 2HLCA 5C1UA 4GAWA 1AVXA 1AKSA 4X6MA 2WPKS 2OQUA 8LPRA 1MAXA 2SGEE 5HM9A 4X6NA 2BDHA 4GCHF 3ZVCA 1UTJA 2BDIA 1GBLA 3GYLB 2P95A 4I32A 2J95A 1EAUA 4NIYA 1P09A 1GG6C 2AFQB 1T32A 4R0IA 3VGCC 1C1QA 3SU2A 4U32A 5EU8A 1H8DH 1BJUA 2PLXA 3CS7A 4X0WU 1XUKA 1O2LA 1BBRK 1WQSA 3UNSA 1E37B 1P10A 3H7OA 5F8ZA 3LH1A 4H6SB 1AO5A 3PTBA 1NFWA 5TCAA 4FUEA 3RXLA 1MBQA 3V12A 5C5NA 1MUEB 2Z3DA 1GWAA 4MNXA 1GBTA 2QGRA 1C2LA 1W0ZU 2F3CE 1FIWA 3LONA 1MBMA 3ZZDA 3ATMA 1O31A 1QY6A 5TJXA 1GL0E 4X1SU 1O3HA 2D1JA 4THNH 2STBE 2PKSC 1MD7A 2Q1JA 4DVAU 1DPOA 1P9UA 1S5SA 1YPKH 2LPRA 1H9IE 1ZHRA 2A32A 4HZHA 1O2WA 4ISOA 2IOTA 3SJ8A 2ZTZA 3A81A 3H7TA 1EAIA 4AG2A 3RXEA 1ABIH 1W13U 3ATWA 4GHQA 3A8AA 3QTVH 4ZXXH 1LHGH 1HAIH 1P3EA 3MFJA 1O2JA 2TGAA 1GI1A 2VVVA 4F49A 3KN2A 5I25A 2XCNA 5A0BA 5C1YA 1SGPE 1YPLH 1UTNA 2BVRH 1A0HB 1X7AC 1GMCG 1WAYB 2P3TB 1DS2E 1Z8RA 2BQ6B 3BTWE 1TIOA 1V2LT 2SGFE 3A85A 1O3DA 6GCHF 3F1SB 1EZXC 2A2QH 1ACBE 4JMYA 2O8MA 3OYPA 3VPKA 4X2WA 2PSXA 1SGRE 4CRDA 1ZPCA 1UHBB 1BHXF 2I6SA 1F0TA 2VU8E 1GI8B 5F03A 4ABHA 2VGCC 5DP7A 3TIUA 1EQ9A 1FONA 5EW2H 4O3UA 5HMAA 3SU5A 1P06A 1EX3A 4YLUA 1MCTA 2C3SA 1PPBH 1UHBA 3QK1A 3U1IB 4B2AA 5GDSH 4WXVA 1SB1H 1XUJA 2ZFQH 1LKAA 5LH8A 4ZROA 5EOKA 1PPFE 3ATLA 2QXIA 1CBWC 4MPVA 1K1PA 1HLTH 1RS0A 2GZ9A 1MKWK 1RIWC 2J94A 2W3KA 2BZ6H 2XC5A 3IG6B 2I6QA 2CMYA 4BANB 4QT8C 3M37A 3RC6A 4INLA 1GJAB 4AB9A 2VINA 3CS0A 1FNIA 3RXIA 3VB6A 4D9QA 2FXRA 1F5KU 4AOQA 3GOVB 1SSXA 3GCOA 1PQ8A 1ZHPA 4ISHH 1UCYK 2BD2A 1OSSA 5E2OA 3URCA 2J4IA 3TITA 4Z0KA 3U98H 3FP7E 3STJA 3SV6A 1C5TA 1SPJA 2YOLA 2BDAA 1S82A 3LIWA 4ZMAH 3QGJA 1DWDH 3O8BA 5DP8A 4BAKB 1T8LA 1IQFA 1ZSLA 3TGKE 2ZDKA 1H9LB 4F4OC 4H4FA 4MQAA 1WU1A 1TGTA 2R2MB 1TB6H 2UUYA 2A0QB 5J4QA 1DY8A 2OC8A 4TWYA 2V3OH 2BX3A 1Z8JB 6LPRA 1A3EH 1GJBB 1NRNH 4I8LA 1L0ZA 3VXEH 4H42U 4ZKOU 4CRFA 1MTVA 1H4WA 1CGHA 4X8UH 2XRCA 3UR9A 2QY0B 4VGCB 4IBLH 2FO9A 4HTCH 3UY9A 1VITG 4INKA 1HAPH 1AB9C 3SGBE 1EP6A 2R9PA 4TPYA 1IOEA 2TBSA 1EZUC 4MNVA 1AMHA 1IQJA 2ZU2A 1C2FA 1S81A 3E1XB 2EC9H 4IN1A 4CREA 2BY8X 3VXFH 4E7NA 4I7YH 3R3GB 1J15A 3HKJB 5GXPA 1C9PA 1QL8A 4NA7A 1FAXA 1GHAG 4B1TA 1BTWA 3LOXA 3RXCA 8KME2 3SV7A 3W95A 1DDJA 1P03A 2EI6A 1BTYA 1L2EA 3MMGA 2C4FH 5BPEA 5GCHF 5H4IB 2F9NA 2ZNKH 4Y8YA 1FIZA 2BX4A 1L1GA 1LMWB 1V2NT 2GP9B 2QYIA 1SGQE 1ZJDA 2FOCA 2ANWA 1B7XB 1ZPZA 1V2JT 4AORA 2A5AA 4Y79A 3MU1A 3TJVA 3DFLA 1TOCB 1M9UA 3U8OH 1AZZA 1L1JA 3LJOA 3RXFA 1GDUA 1C1NA 1O2IA 1TMBH 4X1QU 1QBOA 2ODYB 3UWIA 2A31A 2ZFPH 4HFPB 4NA8A 1TOMH 1YLCA 3TJUA 1TQ0B 3RXAA 2O8LA 2R0LA 2ZU4A 2AS9A 1WUNH 1IQIA 1ZOMA 2D26C 3BG4B 1P0SH 2GT7A 3F9HA 2AMPA 2PV9B 3SU0A 4XDEA 3F68H 2VIWA 4K60A 3GY5A 4X2VA 2Y81A 3RXKA 1G37A 1PPZA 2FYRA 3P95A 2NU0E 2SGDE 3SJKA 2ZPSA 3S69A 4ZAEA 1SGEE 3FP8E 5CMXH 1QCPA 1Y3VA 4FU9A 2A5IA 2BDCA 8GCHF 4XE4A 3SNAA 1UTMA 4WMFA 2VNTA 2AEIH 1YCPK 5JB9S 4CHAC 3A89A 1ETTH 4WWYA 3K6ZA 1C5VA 1ELDE 3E91A 5I46H 3DA9B 5A09A 2RG3A 4O3TA 2OUAA 3SUDA 5C20A 5C1XA 2XBXA 2A4OA 1Q3XA 1W11U 3ZVBA 1O2OA 2W3IA 4Y0YE 1DT2A 1NC6A 4YLQH 1A4WH 4TY6A 2ZCKP 5HXFA 1GCTB 4NWKA 3E3TA 1P9SA 2Z9KA 2PUQH 3SBKA 3H5CB 2ZHWH 4DGJA 1NRQH 1ID5H 1C1MA 2QN5T 3ZVGA 2JH5D 1A46H 2ZGHA 1JMOH 1QRXA 5AF9H 1SGIB 3RXTA 2FPZA 4TY7A 2HPPH 1DICA 1V2MT 1VJAU 5LPFA 2AGEX 2G00A 2ZFFH 3MH6A 2IPHA 2Z3CA 2P8OB 2WINI 3KCGH 1ANEA 4CRBA 1O2YA 2R0KA 1BITA 4JK6A 1NU9A 1S6FA 2TGPZ 1BZXE 2GZ7A 5TCCA 2B7DH 3FVFB 1RXPA 3D62A 1DUAA 2G4TA 4GLYA 1ZR0A 3MU0A 1GHWH 2A7HA 2OCVB 3SGAE 3I77A 1FY5A 1YYY1 2FODA 1KY9A 1ZLRA 3NPSA 4NIXA 1ESBA 1ELCA 1A5HA 2ALPA 3GDVA 1AVGH 1C1PA 1K1LA 4X1RU 4BNRA 2Y5GA 2UUJB 1FAKH 1FY4A 1XUGA 1EAXA 1C5NH 4Y6DA 4Q7YA 1EUFA 1CVWH 1XX9A 1NM6A 1C2JA 2BOKA 1LPKB 5DO4H 2ILNA 2A7CA 2VJ1A 2OTVA 5E8EH 3U8RH 4AFUA 1O35A 2A2XH 3SUEA 3TU7H 4D7FA 1ORFA 4FUJA 1PFXC 1HDTH 2A4GA 2V35A 1PJPA 4ABDA 5CHAB 3QO6A 1EB1H 3E16B 5T3HA 3ZYDA 5BRRE 5GWZA 1Y59T 4CH2B 1KTTB 2ZWLH 3DUXH 4DG4A 1ZTKA 1EJNA 1VCPA 4X2YA 3SI3H 1CHOG 1J16A 1OP2A 1TBRH 3ZZ6A 9LPRA 1AHTH 4YZUA 4MLFB 3PB1E 2FS9A 1Z6EA 2CGAA 1GBHA 2SGAA 1EJAA 3A86A 3RLYH 2WV5A 4XSKU 4ZHMU 2FOMB 1DVAH 1UTPA 1O3OA 2ZFTA 4RN6A 2V6NA 3EYDA 1DXWA 1WQVH 1NN6A 2ANYA 4A1XA 4YOGA 5FX6A 1O2VA 2V0BA 2J9NA 4I8KA 4K8YA 4WF8A 1C5WB 2OP9A 1ETRH 3KQCA 4FVBA 2D8WA 4MPXA 3RXRA 4IMQA 3ZZ7A 3RC4A 2P3FH 2BB4A 2ZHDA 1GBFA 1YC0A 1A61H 1KLTA 1Z1JA 5SGAE 1IQLA 8GCHG 4U30A 2GCTC 1SG8B 1LPGB 2HNTE 4ZUHA 2ZKSA 1XXFA 1U6QA 2B8OH 4JYTA 1GI0A 1UK4A 1V2ST 1MTUA 2FTMA 4JK5A 4IS5A 2Q6FA 5DP4A 2GMTB 5LGOA 4TPIZ 5J4SA 3UUZA 4KTCA 5JPMH 2GMTC 1F2SE 1ZSKA 1FXYA 2SNWA 3M3SA 3RXUA 4B73A 1GBDA 3TGJE 1EB2A 3KGPA 2PW8H 2VWLA 1V2KT 2ZG0H 1BHXB 1NZQH 1P57B 1ZJKA 3BV9B 3PLBA 4U2WA 1C5PA 1P05A 3ZYEA 1PPCE 1CT0E 3ZZ9A 1QURH 1IQEA 1W7XH 2UUKB 3P8NA 1PQ5A 4HI3A 3SNCA 4Y0ZE 4BOHA 2FI4E 4TWWA 1AKSB 2ZGCA 3I29A 3LT3A 2NU2E 1V2RT 2ANMH 2CF9H 3MNBA 2FOGA 2TGDA 1XXDA 1C4V2 4OGXA 2BD9A 2QCYA 4M7GA 1QA7A 1TX7A 1P2MA 4YM9A 3MWIU 2H6MA 1V2VT 3TH3H 1AY6H 1NO9H 2G4UA 3QLPH 2FYQA 3SNEA 1XMNB 2ALVA 2Z6BD 2ASUB 1CSOE 3PO1B 3MH7A 3A82A 1C5XB 2G5NA 1E35B 1CGJE 3KNXA 1LVYA 5FCKA 2G5VA 2FOBA 2WYGA 1BB0B 1A3BH 3M5OA 3S9BA 2H9TH 4ISNA 3PMBB 1D6WA 4SGAE 1PQ7A 3KQEA 1JBUH 1GHBG 1GL1A 1W12U 3NCLA 2DE8A 1SHHB 5DGJA 3O8DA 4ABGA 5A8XA 1SLVB 2F91A 3PM3A 1EAWA 2O8TA 2QXGA 3KF2A 1P01A 3AVZA 2FEQH 1VITF 1TRNA 1DWCH 3EA7A 3Q3XA 3BTEE 1UVPA 3S7KB 1C2KA 5A8YA 4CRGA 2FOHA 3ZZAA 3QWCH 3RU4D 3BTME 1O2TA 2PFEA 1DWEH 2Y82A 3ENSB 2FX4A 5EG4A 1AUJA 1JIRA 1C5LH 1KLJH 3SHCH 1A5GH 2ZTYA 4IC5A 1WCZA 4A1VA 3E90B 1HXEH 2Y5FA 1FUJA 2GX4A 1SQTA 1ZMLA 3PV4A 1GHAF 1W8BH 4U01A 1VZQH 1B0EA 2RA3A 1OYQA 2XTTB 1HFDA 4WJG2 1MKXH 2A45B 1BCUH 3JZ1B 1ZTJA 2H9HA 2C93B 1MZDA 2GCHF 1BMAA 1CGIE 1ESTA 1Y5UT 1SHYA 1B5GH 3G01A 3KL6A 1LHDH 4AYYB 4O03A 1OWKA 3ZZ3A 1AZ8A 1N8OB 1O3FA 1O2PA 1ARBA 3FP6E 4ISLA 1XVMA 1KDQA 1N6YA 4X6PA 3R0FA 1BRAA 1O3IA 3CENA 2QC2A 3HKIB 1OXGA 3M5MA 3M7TA 2BY6X 2VVUA 5L2ZH 2BQ7B 1PPHE 4I8GA 2QV1A 3LKWA 1HUTH 1L4ZA 3C1KA 3BEIB 1AD8H 4YT7H 3MOCA 2HNTC 1AFQB 1QIXB 2Z9JA 2GVFA 4TYDA 1P2OA 4Q2KA 2FWWA 1QQ4A 3QN7A 3BTFE 3LPRA 1GBKA 5DP6A 4AG1A 2FDAA 1FV9A 1IQHA 1P8VC 1UK3A 4XBCA 3GCTF 2LNCA 3P8FA 3FANA 3TVJB 3DFJA 1YPGH 2VIPA 8ESTE 2BDGA 2BLWA 3S9CA 3O8CA 3Q00A 3K2UA 1FY3A 5E2PA 3I78A 1MU6B 2TPIZ 1TONA 3M35A 2EI7A 1ABJH 1TQ7B 1OS8A 1O2HA 2H9EH 1NFXA 4RSPA 3V0XA 4I31A 5C67A 1BBRH 4JYVH 1Z8GA 3RMMH 2FLBH 1SQOA 4RKOB 2ZDAH 1LVOA 1ZPBA 1PYTC 4JCNA 5DK1A 3BG8A 2AMQA 1KYNA 2R3YA 3A7ZA 1MZAA 3SORA 2O9QA 2NU3E 1Y5AT 5DP5A 3T2NA 1TRYA 1TGCA 2AYWA 1MQ6A 4OS1A 1QFKH 1T7CA 4ABBA 1HPGA 1XUHA 3K9XB 3NZIA 4BAHB 5ESTE 1IQNA 1GDQA 1BTZA 2XBWA 1O2ZA 3ATIA 1UTLM 1FN6A 1UK2A 2PGBB 1CQQA 5EXNA 1JRTA 1THRH 2B5TB 1TALA 2JH6D 1G2MA 2ZC9H 3GYMA 2ZO3H 4OS7A 1EOJA 3V3MA 2ZTXA 2WPIS 4NSYA 5FBIA 3T5FH 1GI4A 3UWJH 4Y76A 1G3BA 3SOSA 3SGQE 1QRZA 3RXSA 1ZMNA 2XWBI 4NIVA 4BAQB 1NRRH 1GI5A 3L6PA 3SQEE 4VGCC 4UFEH 2J2UA 3A8BA 4Q80A 1G3EA 4YESB 4UONA 1H1BA 1QNJA 2EEKA 3MO6A 5IDKA 3RMOH 4FVDA 1ZZZA 2J38A 4KP0A 1IAUA 2XYAA 3SW2B 1LHCH 4K1TA 1SGNE 3TPIZ 2FM2A 1NROH 4DCDA 2ZPQA 3D65E 1LO6A 4ZHAA 3LC3A 2NU1E 2P59A 2RA0A 1W2KH 1O2QA 4MDSA 2FOEA 1SLUB 5B6OA 3P17H 1YKTA 2OINA 1KLIH 1MD8A 5FHTA 1ANBA 3P6ZB 3ZVFA 2B0FA 2GCHG 3OY6U 5E0HA 4B76A 3GY4A 1YBWA 1KIGH 4DY7B 3PROA 1UTKA 5EPYA 2F9BH 1UMAH 2WUCA 1C5SA 4MG3A 1S84A 3ZZ5A 2BY9X 3ZVDA 4JZIA 1ANDA 1TPSA 1Q31A 1CE5A 4LK4A 4D9RA 1EASA 1MKWH 1TAWA 1CHOF 3OY5U 5ETXA 3GCHB 5K7RA 3BIUH 1HV7A 2BQWB 2ZDVH 5FX5A 2ZDMA 3QDZB 5JBAS 2Y5HA 4FUGA 1ELTA 1GHXH 5ESBA 1TLDA 4DIIH 2PR3A 1G9IE 1GI9B 1SGFG 2OQ5A 2WPMS 3NKKA 3VEQB 1O5FH 1Z7KA 1TNJA 3DT0H 1S83A 1MCVA 3P8OA 1WSSH 3HPTB 2D2DA 4NA9H 4KELA 2WPJS 1O2NA 1UCYH 2PTCE 3BG4C 3GCTG 1LHFH 1SMFE 4Y71A 1WOFA 2XXLA 1E38B 5PTPA 4YOJA 1BBRE 3KIDU 4YT6H 1EATA 3BIVH 4Y10E 3RXPA 5JBBS 3EGKH 1ZHMA 1TA6A 2XCFA 1GJ9B 1TRMA 5EODA 3SJOA 1OWEA 1F92A 1YPMH 1GCDA 4JYUH 3FZDA 3RXOA 5JBCS 4HGCA 4NWLA 1Z6JH 5DP9A 1T8NA 1O2XA 1DOJA 2FP7B 3RXHA 3NXPA 2BVXH 3PMJA 2W5EA 1O5EH 1GGDB 1XUIA 1YCPM 1FY8E 3MNSA 3SQHE 3VFEA 4X1NU 3CP7A 5GPIB 3HGPA 3RLWH 1TBZH 1OWJA 2STAE 1GCTC 1WTHD 2ZZUH 2GTBA 4CH8B 2A1DB 2BDYA 4ISIH 5DKMA 3M3TA 4INHA 2FX6A 4Y7AA 1BMNH 1J9CH 2ZGJA 4B74A 3QZRA 1C9TA 1F0SA 1ELEE 3MU8A 2ODQA 1ZMJA 2P8OC 5HM2A 1FJSA 2BD5A 4K1SA 1KXAA 2VIDA 1WTGH 1K1OA 3D49H 1GMHF 2Z9GA 4WVPE 2VVCA 5JYIA 1EPTB 4AN7A 5EPNA 1OP8A 4AGJA 2XW9A 1UVOA 3LGWA 2Y7ZA 3K6YA 2K1QA 1CA0B 1K9OE 1YM0A 3D23A 3MO3A 1O3KA 2BM2A 2VIOA 1SLXB 1EPTA 1VJ9U 1E0FD 4GSOA 4WMDA 1AU8A 1MAYA 1V2OT 4SGBE 1GJ7B 3BF6H 7LPRA 3A7TA 1K1NA 5HYOA 5EW1H 4ZXYH 1LKBA 4A1TA 4BXSA 3MHWU 3SO3A 5C5OA 2W7SA 1D9IA 1P02A 4KTUA 1UO6A 2F9UA 2OBQA 1Z8IB 5DG6A 1C5RA 1GVLA 1UTQA 4AZ2B 4FXGH 1G30B 1GHVH 2PKAB 1SC8U 1P2KA 3BTTE 3SUGA 4CBNA 1OWIA 1GHBF 3F9FA 3HGNA 1C1WH 1LVMA 2HGTH 2Q6DA 5A2MH 1HCGA 4A5TS 2PKAA 4AFQA 2CXVA 1TWXB 1OWDA 3URDA 4B2CA 4XBBA 5CHAC 4LOYH 1PYTD 1C1RA 3K65B 4AGKA 3LGUA 4UEHH 1GJ6A 2Z7FE 4ABAA 5DJ7A 3F9EA 2AH4X 3TK5A 2WV4A 4FU7A 1C2DA 1EJMA 1E36B 1LHEH 3HK3B 3HATH 1UCYE 4NG9H 1QQUA 1P2NA 1AI8H 1FI8A 5EQSA 1Z71A 2XC4A 4D7GA 3C27B 5EQQA 3LGIA 1VGCB 1SGDE 2TIOA 2FOAA 1GBBA 3E0NB 7ESTE 4MVNA 3TJOA 3B8JA 3O8RA 2Z3EA 2A4RA 1QL9A 4YOIA 2AMDA 3A84A 3GY2A 1QJ6B 1Y3YA 4H6TA 1O2UA 2BY7X 3SJIA 2ZHFH 3KEEA 2ANKH 2CHAB 2WPLS 1J14A 5GJ4B 1NS3A 1OWHA 2CHAC 1QRWA 2OC0A 1WV7H 4BTIB 1HAYB 1AUTC 1O38A 1O5BB 2H5CA 1MTWA 1GBAA 3BTHE 1C5OH 4R8TB 3RC5A 3RXVA 1GVZA 1QL7A 3EQ0H 5A0CA 2ZCHP 2BVSH 1J17T 2ZI2H 1QTFA 1UVSH 2ZQ2A 4NSVA 3RMNH 3A8CA 1SGYE 1AQ7A 3LGYA 2ZQ1A 1UVUH 1P2JA 1JRSA
chains in the Genus database with same CATH superfamily
2ZDLA 5JB8S 1XM1A 2ZU1A 1BOQA 1BRCE 1MTNB 3KYFA 2BYAX 1GHYH 1ZRKA 1EP5A 1SFIA 1Y3XA 1YWUA 3U8TH 1NPMA 2J5UA 1LQDB 1EZQA 2ZP0H 1QHRB 1HRTH 1AIXH 4WXIA 2F9VA 2HALA 1SGFA 1O32A 2JKHA 1MKXK 1L4DA 2FMJA 4OS2A 1C4U2 2ZGXH 3WWBA 4WY3A 1J8AA 1O2MA 3UR6A 4WH6A 3F2FA 3PMAB 3SZNA 4FUIA 3A88A 1O5DH 3MTYA 3TJNA 1SGCA 1NU7B 3UNQA 1G3CA 2OBOA 1HJAB 1LVBA 3L3TA 1GMHG 1P11E 1P04A 2BD4A 4ABEA 1F5RA 3DSOA 4MNYA 2ZF0H 3RUOA 4CRAA 1O2SA 1ELGA 2JETB 2PSYA 1G3DA 2BZAA 2RDLA 3ODFA 2JETC 5GIBA 1O5GH 1K1MA 1PPGE 1LPZB 4GUXA 1PQAA 4K69A 1GJDB 1XVOA 3MH5A 4AB8A 2OXSA 1Y5BT 4XOJA 5ABWA 1QBVH 3PO1C 4FUHA 2AIQA 1BT7A 3W94A 3VB7A 3QX5H 3ZZ8A 1VCQA 3UTUH 1V6DA 1D3PB 5AVDA 4LZ1H 2C90B 4ACAA 1TE0A 1TYNA 2F9OA 3QUMP 3AASA 3T27A 4ABFA 1GI7B 5CE1A 2AIPA 1DM4B 1OP0A 4F55A 2K0QA 1TX8A 1HYLA 1GG6B 3VGCB 3BN9A 5EQRA 3QGNB 3FZZA 5A8ZA 1OOKB 2W7UA 5FCRA 2Q6GA 1THSH 2FI3E 4FUFA 1TNLA 4Q7ZA 4ZH8A 1FQ3A 4K2YA 3ATKA 1AE5A 2FOFA 1YLDA 1HIAB 2FI5E 3BTKE 2A5KA 3STIA 1T8OA 4M9FA 1TNKA 3UNRA 1BQYA 4GVUA 4NGAH 4AFSA 1O5CB 3UOUA 1A1RA 1HIAA 4AYVB 2H1UA 2ZU3A 3TH2H 1LTOA 3SU1A 2W26A 2WSSD 1QB6A 1NT1A 4RI0A 2J97A 3DHKH 3UQVA 1TMUH 5C2ZA 4JZ1A 3RP2A 1A5IA 2J92A 3UREA 4ABIA 4DURA 1TNHA 2PKSB 1THPB 3RXMA 1EKBB 4X8TH 3AK5A 4Y7BA 1KDQB 5F8TA 3F2GA 4DIHH 1BRBE 2RCEA 1C5UA 1MQ5A 1O3LA 1BIOA 2IJOB 2G55A 1DE7H 1QJ1B 2KZ4A 2J98B 3A80A 3VB3A 2O8WA 1H9HE 1Z1IA 1FPHH 1N8OC 5L30H 1KXBA 1QB9A 3UIRA 1HAOH 3EDXB 4YO9A 3SJ9A 1DSTA 2Y80A 1UTOA 1O3GA 1ZSJA 1SQAA 1W3CA 3S9AA 1XUFA 2M5TA 1YPEH 4NZLA 1K28D 2G52A 2SGPE 3EA9A 1OKXA 2V3HH 2JH0D 2F83A 1T4UH 2ZECA 4CBOA 2B9LA 1KXFA 2AGIX 1BTXA 3EE0B 1AFQC 3QZQA 3OSYA 5FPYA 5T6GA 5DP3A 1FY1A 1QGFA 1TABE 5FAHA 3NK8A 3ZIAD 5EIYA 1P12E 4I86A 4O97A 1HB0B 1RJXB 1SR5C 1VITH 2HOBA 4Q7XA 4YTAA 2AERH 2FLRH 1VR1H 1FX0B 1K2I1 3KQBA 4K5ZA 5AFZH 3RXDA 2VGCB 2LP6A 1O3BA 1EXFA 2SFAA 1Y8TA 1HAZB 1V3XA 3AAUA 5AFYH 2BHGA 1W0JD 1C1SA 2PHBA 1A2CH 1GJCB 3KQDA 4TT3D 1FZZA 1YLNA 1ANCA 1ZYOA 1RTKA 1ELFA 1TA2A 1CT2E 2G81E 3MU4A 2NWNA 3GDUA 4D76A 3A83A 1CBWB 3S0NA 2DE9A 3A7XA 2OD3B 2F43B 2KCPA 4X6OA 3KHVA 1SL3A 3A87A 1RIWB 1HJ8A 1F5LA 1QA0A 6ESTA 1NBME 1C2EA 2ULLA 5E0GA 2VIVA 5C17A 5LPRA 1O5AB 3SZEA 1H8ED 2XNDD 1XKAC 3F6UH 1DXPA 3SU6A 1HGTH 2SGQE 3RXGA 5IYTA 3T26A 4LZ4B 1GJ5H 3M5NA 2VWMA 3RXBA 4A92A 1O3CA 5L2YH 2Y6TA 4A6LA 2C8ZB 2VH0A 3OTJE 3T62A 1A0LA 2QF0A 4AC9A 1W7GH 4BAOB 2AHME 1GVKB 3RU4E 4KTSA 1C1TA 3Q3YA 1IHSH 4UE7H 3E6PH 3ZZBA 2JJ2D 3SNDA 3W1EA 3LGVA 2VH6A 4GCHG 2GV6A 4B71A 3BTQE 1SOZA 3RM0H 1O3EA 4FUBA 1LQEA 1TMTH 2ZIQH 1F0RA 1QBNA 4UFFH 1GI6A 4K3JA 2GGVB 3M7UA 1YP9A 3UFAA 2HWLB 3BTGE 2PTNA 1T8MA 1ZTLA 1SVPA 3SV2H 1ETSH 4X2XA 3RXQA 4AX9H 1MU8B 2NU4E 5C0TA 1S85A 1NTPA 2OC7A 3T28A 1RTFB 1JIMA 5F8XA 1O36A 3GY3A 2H2ZA 5C3NA 2EI8A 1K1IA 1GHZA 1ZGVA 1GBEA 3M36A 3T29A 2GDDA 1YPHE 4I8HA 5EGMA 5T6FA 3TNTA 7GCHF 1TPOA 1NRSH 1T4VH 2QXJA 2CV3A 4E7RG 4BAMB 2ZFSA 1O30A 1NESE 2BLQA 1GBCA 3UQOA 1G36A 1DUEA 2WV9A 1K21H 2CF8H 4MPWA 3UOPA 1TFXA 1AB9B 2R2WU 2YNBA 4B2BA 1K0HA 1V2WT 1V2TT 4UD9H 4E05H 3GISB 3GICB 1QJ7B 4Y8ZA 1C2GA 4K1EA 3M61U 1GPZA 2CK3D 2XBVA 3ZZCA 2KAIB 1RD3B 1W14U 3RMLH 1DANH 2UUFB 1JOUB 1QB1A 1S6HA 2ZFRH 4RT1A 4ASHA 1WBGB 1YPJH 3Q77A 2VB0A 1D6RA 3AAVA 5A0AE 2HPQH 2HLDD 1B0FA 2CJIA 2KAIA 1RGQA 2ZHEH 2GKVE 3A7WA 3NUMA 1N6XA 1P2QA 5L6NH 1BDAA 3OU0A 1C4Y2 4PROA 4MNWA 4UFGH 1WDIA 2OLGA 3PYHA 2A7JA 4RKJB 3TK9A 1KXCA 3GCHC 3OTPA 3OX7U 2HVXA 3P8GA 4FUDA 1KTSB 4IC6A 3OFND 2QIQA 2HRVA 3MI4A 4XBDA 3ZVAA 4WH8A 2ZDNA 2HNTF 4P00A 3GY8A 1FDPA 1ZGIA 1K1JA 2XNIA 1OPHB 5JDUB 3ITIA 4WMEA 1RRKA 1SBWA 1SI5H 1TPAE 3ESTA 3SU4A 1CU1A 1O3AA 1OX1A 3BSQA 6GCHG 2UWLA 1CT4E 5DN6D 3GY7A 2UWOA 3EA8A 3SUFA 1RTLA 3IWMA 3IITA 1W10U 2ODPA 2WPHS 1BRUP 5AHGH 4JZDH 1DX5M 2O8UA 4Q63A 3Q76A 4D8NA 1O2GH 5HGGA 1IQGA 2R3UA 4YXWD 7KMEH 4CR5A 1MTSA 2BLOA 2PUXB 3BTDE 3FFGA 1CHGA 1HNEE 3Q3KA 4ZKSU 1C5QA 1LCYA 3B23B 1KSNA 3MH4A 3P92A 2BY5X 2VIQA 1SOTA 3EAJA 2BD8A 1O39A 4IGDA 5DPAA 3V13A 2DUCA 2QXHA 3PLPA 1CO7E 3F9GA 3RU4T 2CN0H 1KXDA 1V2QT 1DWBH 2QA9E 1C5MD 3SU3A 4NCYA 4CHAB 1GGDC 1ELVA 3F2HA 2P3UB 1IQMA 1BMFD 1S0QA 3JZ2B 4MTBA 4KGAA 2WUBA 5FBEA 1GBIA 2BD7A 5FPSA 3A8DA 2ZHQH 2AGGX 1SGTA 3AW1A 2J34A 1HAXB 4Y8XA 4LXBH 1O0DH 1ESAA 1GI3A 3MNXA 1JWTA 1O34A 4BXWA 1O3MA 2H5DA 1P2IA 1C2MA 2EA3A 4ZHLU 1TNGA 1TPPA 1O3JA 2BXTH 4NFEA 4DOQA 1CA8B 3A7VA 1BMMH 1T31A 3PRBA 3GDSA 3SN8A 1HXFH 3SI4H 4A7IB 5LPEA 2Z9LA 3NWUA 3LC5A 3PTNA 3SV8A 3M5LA 3E8LA 3TLOA 1D3TB 2FZZA 2EY4C 3PLKA 1C2HA 4X1PU 3B9FH 1C1VH 1K22H 4XFQA 1D3QB 2F9PA 3P70B 4IW4E 2C8XB 2TGTA 1EPTC 3PWBA 1Y3WA 1NFUA 3M3VA 2UWPA 2Z94A 4B75A 1O3PB 3MNCA 1UVTH 1DSUA 1O2KA 1CA0C 2P16A 3BEFB 1TGBA 1G2LA 4IMZA 1S0RA 4JZEH 1GMDF 1N1LA 1XKBC 3F0PA 4X8SH 1GJ4H 7GCHG 1G32B 4DW2U 1OYTH 3ZZ4A 2BLVA 2G8TA 3N7OA 2BMGB 2QF3A 1YPHC 2GV7A 3PWCA 2FIRH 3TH4H 1V2UT 3T25A 2GZ8A 3LJJA 3ZV8A 1C5YB 4DT7B 5EXMA 4OS6A 4J2YB 3GY6A 2G51A 1BA8B 2KCOA 5FPTA 5E0JA 3TGIE 1ARCA 1EZSC 4I33A 5FXLA 2ZPRA 1O37A 3GCNA 1DFPA 1H8IH 1AWFH 1Q2WA 1ZRBA 3SV9A 1W0YH 3RXJA 3LGTA 2OK5A 1BJVA 1HAGE 1FN8A 1MH0A 1TBQH 1C5ZB 3M7QA 1HJ9A 1RFNA 2ZU5A 2P93A 3VB5A 1DY9A 5F6MA 1D3DB 2PGQB 1WYKA 4KKDA 5GCHG 2BD3A 2ZGBH 4OS4A 1KXEA 1MMJN 4E06H 5JBTA 1AFEH 2ZCLP 1BUIA 1SLWB 1F7ZA 1YCPH 3LH3A 5K0HA 4FU8A 4AFZA 3TNSA 3ELAH 3LDXH 1TNIA 1VGCC 2ESTE 2XC0A 1GBJA 3SNBA 2EQNA 1HBTH 1AGJA 3VB4A 4HG6A 1DLKB 1YGCH 1AVWA 4DT4A 1D4PB 1LDTT 4GHTA 3AW0A 3MO9A 4CR9A 1BTPA 1AN1E 4NZQA 2VWOA 4O9VA 2GD4B 4Z1MD 2VWNA 1IQKA 2OC1A 2YNAA 3BEUA 1O33A 3A7YA 2WYJA 1EOLA 2KR7A 2XWAA 3MU5A 4NFFA 5T6DA 2SNVA 2C8WB 1BMLA 1A0JA 1HAVB 2TRMA 1BTHH 1UJ1A 2GT8A 3QTOH 3ZV9A 1C2IA 1GDNA 4OGYA 1FLEE 1P3CA 3PMHB 1HAVA 4CRCA 4ABJA 2Z9IA 2GDEH 1SFQB 3L33A 4GPGA 5EJ1A 3UPEA 1AE8H 2BOHB 1C1OA 3E0PB 3WY8A 1TGNA 3U9AH 1TX6A 1INCA 1GMCF 6CHAB 1IHTH 4I8JA 6CHAC 2GCTB 1AWHB 4Z6AH 4MPUA 3ZVEA 2FESH 3U1JB 4IN2A 1NRPH 1E34B 1MTNC 2P94A 3V7TA 1DLEA 1ELBA 2A4QA 4ESTE 4K8BA 1QR3E 4FUCA 2IN2A 1FPCH 4ZKNU 2ZA5A 1V2PT 4BTUB 3MYWA 2QAAA 1FMGA 1GBMA 3RM2H 2PWXA 5EXLA 4DJZB 1PPEE 1O3NA 3FAOA 4J1YA 4JZFH 5G4BA 1L1NA 3DD2H 2THFB 1TGSZ 2BXUH 1JXPA 2XBYA 1O2RA 9ESTA 3TK6A 1F0UA 1VCWA 4OS5A 1NY22 4UFDH 3RDZA 2KM0A 1NFYA 1GI2A 2LELA 1HJAC 1A7SA 4BTTB 4X8VH 1DITH 4Y11E 4UDWH 2C8YB 1ELAA 2FTLE 1HAHH 1Y3UA 2Y7XA 3U69H 1YF4A 2ZEBA 3ODDA 2BTCE 1BTUA 3LU9B 3SHAH 2FS8A 3S7HB 1GJ8B 1C1UH 4ZKRU 1GMDG 4NIWA 2BDBA 3HK6B 2HLCA 5C1UA 4GAWA 1AVXA 1AKSA 4X6MA 2WPKS 2OQUA 8LPRA 1MAXA 2SGEE 5HM9A 4X6NA 2BDHA 4GCHF 3ZVCA 1UTJA 2BDIA 2KX4A 1GBLA 2IPQX 3GYLB 2P95A 4I32A 2J95A 1EAUA 4NIYA 1P09A 1GG6C 2AFQB 1T32A 4R0IA 3VGCC 5HIYA 1C1QA 3SU2A 4U32A 5EU8A 1H8DH 1BJUA 2PLXA 3CS7A 4X0WU 1XUKA 1O2LA 1BBRK 1WQSA 3UNSA 1E37B 1P10A 3H7OA 5F8ZA 3WWFA 3LH1A 4H6SB 1AO5A 3PTBA 1NFWA 5TCAA 4FUEA 3RXLA 1MBQA 3CNRA 3V12A 5C5NA 1MUEB 2Z3DA 1GWAA 4MNXA 1GBTA 2QGRA 1C2LA 1W0ZU 2F3CE 1FIWA 2WHXA 3LONA 1MBMA 3ZZDA 3ATMA 1O31A 1QY6A 5TJXA 1GL0E 4X1SU 2YMSB 1O3HA 2D1JA 3KYGA 4THNH 2STBE 2PKSC 1MD7A 2Q1JA 4DVAU 1DPOA 1P9UA 1S5SA 1YPKH 2LPRA 1H9IE 1ZHRA 2A32A 4HZHA 1O2WA 4ISOA 2IOTA 3SJ8A 2ZTZA 3A81A 3H7TA 1EAIA 4AG2A 3RXEA 1ABIH 1W13U 3ATWA 4GHQA 3A8AA 3QTVH 4ZXXH 1LHGH 1HAIH 1P3EA 3MFJA 1O2JA 2TGAA 1GI1A 2VVVA 4F49A 3KN2A 5I25A 2XCNA 5A0BA 5C1YA 1SGPE 1YPLH 1UTNA 2BVRH 1A0HB 1X7AC 1GMCG 1WAYB 2P3TB 1DS2E 1Z8RA 2BQ6B 3BTWE 1TIOA 1V2LT 2SGFE 3A85A 1O3DA 6GCHF 3F1SB 1EZXC 2A2QH 1ACBE 4JMYA 2O8MA 3OYPA 3VPKA 4X2WA 2PSXA 1SGRE 2QE7D 4CRDA 1ZPCA 1UHBB 1BHXF 2I6SA 1F0TA 2VU8E 1GI8B 5F03A 4ABHA 2VGCC 5DP7A 3TIUA 1EQ9A 1FONA 5EW2H 4O3UA 5HMAA 3SU5A 1P06A 4B6EA 1EX3A 4YLUA 1MCTA 2C3SA 4XRNA 1PPBH 1UHBA 3QK1A 3U1IB 4B2AA 5GDSH 4WXVA 1SB1H 1XUJA 2ZFQH 1LKAA 5LH8A 4ZROA 5EOKA 1PPFE 3ATLA 2QXIA 1CBWC 4MPVA 1K1PA 1HLTH 1RS0A 2GZ9A 1MKWK 1RIWC 2J94A 2W3KA 2BZ6H 2XC5A 3IG6B 2I6QA 2CMYA 4BANB 4QT8C 3M37A 3RC6A 4INLA 1GJAB 4AB9A 2VINA 3CS0A 1FNIA 3RXIA 3VB6A 4D9QA 2HVYB 2FXRA 1F5KU 4AOQA 3GOVB 1SSXA 3GCOA 1PQ8A 1ZHPA 4ISHH 1UCYK 2BD2A 1OSSA 5E2OA 3URCA 2J4IA 3TITA 4Z0KA 3U98H 3FP7E 3STJA 2IJD1 3SV6A 1C5TA 1SPJA 2YOLA 3KQ5A 2BDAA 1S82A 3LIWA 4ZMAH 3QGJA 1DWDH 3O8BA 5DP8A 4BAKB 1T8LA 1IQFA 1ZSLA 3TGKE 2ZDKA 1H9LB 4Q4LA 4F4OC 4H4FA 4MQAA 5KEDA 1WU1A 1TGTA 2KCYA 2R2MB 1TB6H 1W0KD 2UUYA 2A0QB 5J4QA 1DY8A 2OC8A 4TWYA 2V3OH 3NRLA 2BX3A 1Z8JB 6LPRA 1A3EH 1GJBB 1NRNH 4I8LA 1L0ZA 3VXEH 4H42U 4ZKOU 4CRFA 2XOKD 1MTVA 1H4WA 1CGHA 4X8UH 2XRCA 3UR9A 2QY0B 4VGCB 3OE7D 2FO9A 4HTCH 4IBLH 3UY9A 1VITG 4INKA 1HAPH 1AB9C 3SGBE 1EP6A 2R9PA 4TPYA 2W6ID 1IOEA 2TBSA 1EZUC 4MNVA 1AMHA 1IQJA 2ZU2A 1C2FA 1S81A 3E1XB 2EC9H 4IN1A 4CREA 2BY8X 3VXFH 4E7NA 4I7YH 3R3GB 1J15A 3HKJB 5GXPA 1C9PA 1QL8A 4NA7A 1FAXA 1GHAG 2RFKC 4B1TA 1BTWA 3LOXA 3RXCA 8KME2 3SV7A 3H09A 3W95A 3FO8D 1DDJA 1P03A 2EI6A 1BTYA 1L2EA 3MMGA 2C4FH 5BPEA 5GCHF 5H4IB 4P02A 2F9NA 2ZNKH 4Y8YA 1FIZA 2BX4A 1L1GA 1LMWB 1V2NT 2GP9B 2QYIA 1SGQE 1ZJDA 2FOCA 2ANWA 1B7XB 1ZPZA 1V2JT 4AORA 2A5AA 4Y79A 3MU1A 3TJVA 3DFLA 1TOCB 1M9UA 3U8OH 1AZZA 1L1JA 3LJOA 3RXFA 1GDUA 1C1NA 1O2IA 1TMBH 4X1QU 1QBOA 2ODYB 3UWIA 2A31A 2ZFPH 4HFPB 4ASUD 4NA8A 1TOMH 3N7DA 1YLCA 3TJUA 1TQ0B 3RXAA 2O8LA 2R0LA 2ZU4A 2AS9A 1WUNH 1IQIA 1ZOMA 2D26C 3BG4B 1P0SH 2GT7A 3F9HA 2AMPA 2PV9B 3SU0A 4XDEA 3F68H 2WPDD 2VIWA 4K60A 3GY5A 4X2VA 2Y81A 3RXKA 1G37A 1PPZA 2FYRA 3P95A 2NU0E 2RDEA 2SGDE 3SJKA 2ZPSA 3S69A 4ZAEA 1SGEE 3FP8E 5CMXH 1QCPA 1Y3VA 4FU9A 2A5IA 2BDCA 8GCHF 4XE4A 3SNAA 1UTMA 4WMFA 2VNTA 2AEIH 1YCPK 5JB9S 4CHAC 3A89A 1ETTH 4WWYA 3K6ZA 1C5VA 1ELDE 3E91A 5I46H 3DA9B 5A09A 1SKYE 2RG3A 4O3TA 2OUAA 3SUDA 5C20A 5C1XA 2XBXA 2A4OA 2YMSD 1Q3XA 1W11U 2W6JD 3ZVBA 1O2OA 2W3IA 4Y0YE 1DT2A 1NC6A 4YLQH 1A4WH 4TY6A 2ZCKP 5HXFA 1GCTB 4NWKA 3E3TA 1P9SA 2Z9KA 2PUQH 3SBKA 3H5CB 2ZHWH 4DGJA 1NRQH 1ID5H 1C1MA 2QN5T 3ZVGA 2JH5D 1A46H 2ZGHA 1JMOH 1QRXA 5AF9H 1SGIB 3RXTA 2FPZA 4TY7A 2HPPH 1DICA 1V2MT 1VJAU 5LPFA 2AGEX 2G00A 2ZFFH 3MH6A 2IPHA 2Z3CA 2P8OB 2WINI 3KCGH 1ANEA 4CRBA 1O2YA 2R0KA 1BITA 4JK6A 1NU9A 1S6FA 2TGPZ 1BZXE 2GZ7A 5TCCA 2B7DH 3FVFB 1RXPA 3D62A 1DUAA 2G4TA 4GLYA 1ZR0A 3MU0A 1GHWH 2A7HA 2OCVB 3SGAE 3I77A 1FY5A 1YYY1 2FODA 1KY9A 1ZLRA 3NPSA 4NIXA 1ESBA 1ELCA 1A5HA 2ALPA 3GDVA 1AVGH 1C1PA 1K1LA 4X1RU 4BNRA 2Y5GA 2UUJB 1FAKH 1FY4A 1XUGA 1EAXA 1C5NH 4Y6DA 4Q7YA 1EUFA 1CVWH 1XX9A 1NM6A 3SYJA 1C2JA 2BOKA 1LPKB 1H8HD 5DO4H 2ILNA 2A7CA 2VJ1A 2OTVA 5E8EH 3U8RH 4AFUA 1O35A 2A2XH 3SUEA 3TU7H 4D7FA 1ORFA 4FUJA 1PFXC 1HDTH 2A4GA 2V35A 1PJPA 4ABDA 5CHAB 3QO6A 1EB1H 3E16B 5T3HA 3ZYDA 5BRRE 5GWZA 1Y59T 4CH2B 1KTTB 2ZWLH 3DUXH 4DG4A 1ZTKA 1EJNA 1VCPA 4X2YA 3SI3H 1CHOG 1J16A 1OP2A 1TBRH 3ZZ6A 9LPRA 3FN8A 1AHTH 4YZUA 4MLFB 5F53A 3PB1E 2FS9A 1Z6EA 2CGAA 1GBHA 2SGAA 1EJAA 3A86A 5KGOA 3RLYH 2WV5A 4XSKU 4ZHMU 1QZ8A 5HIZA 2FOMB 1DVAH 1UTPA 1O3OA 2ZFTA 4RN6A 2V6NA 3EYDA 1DXWA 1WQVH 1NN6A 2ANYA 3PV2A 4A1XA 4YOGA 5FX6A 1O2VA 2V0BA 2J9NA 4I8KA 4K8YA 4WF8A 1C5WB 2OP9A 1ETRH 3KQCA 4FVBA 2D8WA 4MPXA 3RXRA 4IMQA 3ZZ7A 3RC4A 2P3FH 2V3MA 2BB4A 2ZHDA 1GBFA 1YC0A 1A61H 1KLTA 1Z1JA 5SGAE 1IQLA 8GCHG 4U30A 2GCTC 1SG8B 1LPGB 2HNTE 4ZUHA 2ZKSA 1XXFA 1U6QA 2B8OH 4JYTA 1GI0A 2PP6A 1UK4A 1V2ST 1MTUA 2FTMA 4JK5A 4IS5A 2Q6FA 5DP4A 2GMTB 5LGOA 4TPIZ 5J4SA 3UUZA 4KTCA 5JPMH 2GMTC 1F2SE 1ZSKA 1FXYA 2SNWA 3M3SA 3RXUA 4B73A 1GBDA 3TGJE 1EB2A 3KGPA 3UAIC 2PW8H 2VWLA 1V2KT 2ZG0H 1BHXB 1NZQH 1P57B 1ZJKA 3BV9B 2M2AA 3PLBA 4U2WA 3DCLA 1C5PA 1P05A 3ZYEA 1PPCE 3U28C 1CT0E 3ZZ9A 1QURH 1IQEA 1W7XH 2UUKB 3P8NA 1PQ5A 4HI3A 3SNCA 4Y0ZE 4BOHA 2FI4E 4TWWA 1AKSB 2ZGCA 3I29A 3LT3A 2NU2E 1V2RT 2ANMH 2CF9H 3MNBA 2FOGA 2TGDA 4TSFD 1XXDA 3N7EA 1C4V2 4OGXA 2BD9A 2QCYA 4M7GA 1WXRA 1QA7A 1TX7A 1P2MA 4YM9A 3MWIU 2H6MA 1V2VT 3TH3H 1AY6H 1NO9H 2G4UA 3QLPH 2FYQA 3SNEA 1XMNB 2ALVA 2Z6BD 2ASUB 1CSOE 3PO1B 3MH7A 3A82A 1C5XB 2G5NA 5HKKD 1E35B 1CGJE 3KNXA 1LVYA 5FCKA 2G5VA 2FOBA 2WYGA 4ACBA 1BB0B 1A3BH 3M5OA 3S9BA 2H9TH 4ISNA 3PMBB 1D6WA 4SGAE 2KCAA 4FETA 1PQ7A 3KQEA 1JBUH 1GHBG 3WW7A 1GL1A 1W12U 1NBMD 3NCLA 2DE8A 1SHHB 5DGJA 3O8DA 4ABGA 5A8XA 1SLVB 2F91A 3PM3A 1EAWA 2O8TA 2QXGA 3KF2A 1P01A 3AVZA 2FEQH 1VITF 1TRNA 1DWCH 3EA7A 3Q3XA 3BTEE 1UVPA 3S7KB 1C2KA 5A8YA 4CRGA 2FOHA 3ZZAA 3QWCH 3RU4D 3BTME 5IK2D 1O2TA 2PFEA 3FOAA 1DWEH 2Y82A 3ENSB 2FX4A 5EG4A 1AUJA 1JIRA 1C5LH 1KLJH 2YMSC 1A5GH 3SHCH 2ZTYA 4IC5A 1WCZA 2VBCA 1VKYA 3E90B 1HXEH 2Y5FA 1FUJA 4A1VA 1SQRA 2GX4A 1ZMLA 1SQTA 3PV4A 1GHAF 1W8BH 4U01A 1VZQH 1B0EA 2RA3A 2QF4A 1OYQA 1E1QD 2XTTB 1HFDA 4WJG2 1MKXH 2A45B 1BCUH 3JZ1B 1ZTJA 2H9HA 2C93B 2L74A 1MZDA 2GCHF 1BMAA 1CGIE 1ESTA 1Y5UT 1SHYA 1B5GH 3G01A 3KL6A 1LHDH 5C94A 4AYYB 4O03A 1KMHB 1OWKA 3ZZ3A 1AZ8A 1N8OB 1O3FA 1O2PA 1ARBA 3FP6E 4ISLA 1XVMA 2WZQA 1KDQA 1N6YA 4X6PA 3R0FA 1BRAA 1O3IA 3CENA 2QC2A 3HKIB 1OXGA 2JIZD 3M5MA 2J98A 2BY6X 3M7TA 2VVUA 5L2ZH 2BQ7B 1PPHE 4I8GA 2QV1A 3LKWA 5C0UA 1HUTH 1L4ZA 3C1KA 3BEIB 1AD8H 4YT7H 3MOCA 2HNTC 1AFQB 1QIXB 2Z9JA 2GVFA 3OEHD 4TYDA 1P2OA 4Q2KA 2FWWA 1QQ4A 3QN7A 3BTFE 3LPRA 1GBKA 5DP6A 4AG1A 2FDAA 1FV9A 1IQHA 1P8VC 1UK3A 4XBCA 3GCTF 2LNCA 3P8FA 3FANA 3TVJB 3DFJA 1YPGH 2VIPA 8ESTE 2BDGA 2BLWA 2F4LA 3UB0A 3S9CA 3O8CA 3Q00A 3K2UA 1FY3A 5E2PA 3I78A 1MU6B 2TPIZ 1TONA 3M35A 2EI7A 1ABJH 1TQ7B 1OS8A 1O2HA 3DSGA 2H9EH 1NFXA 4RSPA 3V0XA 4I31A 5C67A 1BBRH 4JYVH 1Z8GA 3RMMH 2FLBH 1SQOA 4RKOB 2ZDAH 1LVOA 1ZPBA 1PYTC 4JCNA 3FKSD 3PV5A 2QF5A 5DK1A 3BG8A 2AMQA 1KYNA 2R3YA 3A7ZA 1MZAA 3SORA 2O9QA 2NU3E 1Y5AT 5DP5A 3T2NA 1TRYA 1TGCA 2AYWA 1MQ6A 4OS1A 1QFKH 1T7CA 5CHBA 4ABBA 1HPGA 1XUHA 3K9XB 3NZIA 4BAHB 5ESTE 1IQNA 1GDQA 1BTZA 2XBWA 1O2ZA 3ATIA 1UTLM 1FN6A 1UK2A 2PGBB 1EFRD 1CQQA 5EXNA 1JRTA 2KFWA 1THRH 2B5TB 1TALA 2JH6D 1G2MA 2ZC9H 3GYMA 2ZO3H 3PRDA 4OS7A 1EOJA 3V3MA 2ZTXA 2WPIS 4NSYA 4FOUC 5FBIA 3T5FH 1GI4A 3UWJH 4B6FA 4Y76A 1G3BA 3SOSA 3SGQE 1QRZA 3RXSA 1ZMNA 2XWBI 4NIVA 4BAQB 1NRRH 1GI5A 3L6PA 3SQEE 3N99A 4VGCC 4UFEH 3DSPA 2J2UA 3A8BA 4Q80A 1G3EA 4YESB 4UONA 1H1BA 1QNJA 2EEKA 3MO6A 5IDKA 3RMOH 4FVDA 1ZZZA 2J38A 4KP0A 1IAUA 2XYAA 3SW2B 1LHCH 4K1TA 1SGNE 3TPIZ 2FM2A 1NROH 4DCDA 2ZPQA 3D65E 1LO6A 4ZHAA 1YY3A 3LC3A 2NU1E 2P59A 2RA0A 1W2KH 1O2QA 4MDSA 2FOEA 1SLUB 5B6OA 3P17H 1YKTA 2OINA 1KLIH 1MD8A 5FHTA 1ANBA 3P6ZB 3ZVFA 2B0FA 2V7QD 2GCHG 3OY6U 5E0HA 4B76A 3GY4A 1YBWA 1KIGH 4DY7B 3PROA 1UTKA 5EPYA 2F9BH 1UMAH 2WUCA 1C5SA 4MG3A 1S84A 3ZZ5A 2BY9X 3ZVDA 4JZIA 1ANDA 1TPSA 1Q31A 1CE5A 4LK4A 4D9RA 5KECA 1EASA 1MKWH 1TAWA 1CHOF 3OY5U 5ETXA 3GCHB 5K7RA 3BIUH 1HV7A 2BQWB 2ZDVH 5FX5A 2ZDMA 3QDZB 5JBAS 2Y5HA 4FUGA 1ELTA 1GHXH 5ESBA 1TLDA 4DIIH 2PR3A 1G9IE 1GI9B 1SGFG 2JDID 2OQ5A 2WPMS 3NKKA 1O5FH 3VEQB 1Z7KA 1TNJA 3DT0H 1S83A 1E1RD 1MCVA 3P8OA 1WSSH 3HPTB 2D2DA 3EE7A 4NA9H 4KELA 2WPJS 1O2NA 1UCYH 2PTCE 5CDFE 3BG4C 3GCTG 1LHFH 1SMFE 4Y71A 1WOFA 2XXLA 1E38B 5PTPA 4YOJA 4RT0A 1BBRE 3KIDU 4YT6H 1EATA 3BIVH 5T1VA 4Y10E 3RXPA 5DSFA 5JBBS 3EGKH 1ZHMA 1TA6A 2XCFA 1S6LA 1GJ9B 1OHHD 1TRMA 5EODA 3SJOA 1OWEA 1F92A 1YPMH 1GCDA 4JYUH 3FZDA 3RXOA 5JBCS 1UW7A 4HGCA 4NWLA 1Z6JH 5DP9A 1T8NA 1O2XA 1DOJA 2FP7B 3RXHA 3NXPA 2BVXH 3PMJA 2W5EA 1O5EH 5EJZA 1GGDB 1XUIA 1YCPM 1FY8E 3MNSA 3SQHE 3VFEA 4X1NU 3CP7A 5GPIB 3HGPA 3RLWH 4F48B 1TBZH 1OWJA 2STAE 1GCTC 1WTHD 2ZZUH 2GTBA 4CH8B 2A1DB 2BDYA 4ISIH 5DKMA 3M3TA 4INHA 2FX6A 4Y7AA 1BMNH 1J9CH 2ZGJA 4B74A 3QZRA 1MABB 3F3BA 1C9TA 3F0OA 1F0SA 1ELEE 3MU8A 2ODQA 1ZMJA 2P8OC 5HM2A 1FJSA 2K8IA 2BD5A 4K1SA 1KXAA 2VIDA 1WTGH 4ZCNA 1K1OA 3D49H 1GMHF 2Z9GA 4WVPE 2VVCA 5JYIA 1EPTB 4AN7A 5EPNA 5GNDA 3VG8A 1OP8A 3GS9A 4AGJA 2XW9A 1UVOA 3LGWA 2Y7ZA 3K6YA 2K1QA 1CA0B 1K9OE 1YM0A 3D23A 3MO3A 1O3KA 2BM2A 2VIOA 2L6OA 1SLXB 1EPTA 1VJ9U 1E0FD 4GSOA 4WMDA 4XD7D 1AU8A 1MAYA 1V2OT 4SGBE 1GJ7B 3BF6H 7LPRA 3A7TA 1K1NA 5HYOA 5EW1H 4ZXYH 1LKBA 4A1TA 4BXSA 3MHWU 3SO3A 5C5OA 2W7SA 1D9IA 1P02A 4KTUA 1UO6A 2F9UA 2OBQA 1Z8IB 5DG6A 1C5RA 1GVLA 1UTQA 4AZ2B 4FXGH 1G30B 1GHVH 2PKAB 1SC8U 1P2KA 3BTTE 3SUGA 4CBNA 1OWIA 1GHBF 3F9FA 3HGNA 1C1WH 1LVMA 3OEED 2HGTH 2Q6DA 5A2MH 1HCGA 4A5TS 2PKAA 4AFQA 2CXVA 1TWXB 1OWDA 3URDA 4B2CA 4XBBA 5CHAC 4LOYH 1PYTD 1C1RA 3K65B 4AGKA 3LGUA 4UEHH 1GJ6A 2Z7FE 4ABAA 5DJ7A 3F9EA 3MQKC 2AH4X 3TK5A 2WV4A 4FU7A 1C2DA 1EJMA 1E36B 1LHEH 2JJ1D 3HK3B 3HATH 1UCYE 4NG9H 1QQUA 1P2NA 1AI8H 1FI8A 5EQSA 1Z71A 2XC4A 4D7GA 3C27B 1COWD 5EQQA 3LGIA 1VGCB 1SGDE 2TIOA 2FOAA 1GBBA 3E0NB 7ESTE 4MVNA 3TJOA 3B8JA 3O8RA 2Z3EA 2A4RA 1QL9A 4YOIA 2AMDA 3A84A 3GY2A 1QJ6B 1Y3YA 5B6LA 4H6TA 1O2UA 5FL7D 2BY7X 3SJIA 2ZHFH 3KEEA 2ANKH 2CHAB 2WPLS 5EJLA 1J14A 5GJ4B 1NS3A 1OWHA 2CHAC 1E79D 1QRWA 1WV7H 2OC0A 4BTIB 1HAYB 1AUTC 1O38A 1O5BB 2H5CA 1MTWA 1GBAA 3BTHE 1C5OH 4R8TB 3RC5A 3RXVA 1GVZA 4OM9A 1QL7A 3EQ0H 5A0CA 2ZCHP 2BVSH 1J17T 3OAAD 2ZI2H 1QTFA 1UVSH 2ZQ2A 4NSVA 3RMNH 3A8CA 1SGYE 2GJGA 1AQ7A 3LGYA 2ZQ1A 1UVUH 1P2JA 1JRSA
chains in the Genus database with same CATH topology
2ZDLA 5JB8S 1XM1A 2ZU1A 1BOQA 1BRCE 1MTNB 2BYAX 1GHYH 1ZRKA 1EP5A 1SFIA 1Y3XA 3U8TH 1NPMA 1LQDB 1EZQA 2ZP0H 1QHRB 1HRTH 1AIXH 4WXIA 2F9VA 2HALA 1SGFA 1O32A 2JKHA 1MKXK 1L4DA 2FMJA 4OS2A 1C4U2 2ZGXH 4WY3A 1J8AA 1O2MA 3UR6A 4WH6A 3PMAB 3SZNA 4FUIA 3A88A 1O5DH 3MTYA 3TJNA 1SGCA 1NU7B 3UNQA 1G3CA 2OBOA 1HJAB 1LVBA 3L3TA 1GMHG 1P11E 1P04A 2BD4A 4ABEA 1F5RA 4MNYA 2ZF0H 3RUOA 4CRAA 1O2SA 1ELGA 2JETB 2PSYA 1G3DA 2BZAA 2RDLA 3ODFA 2JETC 5GIBA 1O5GH 1K1MA 1PPGE 1LPZB 4GUXA 1PQAA 4K69A 1GJDB 1XVOA 3MH5A 4AB8A 2OXSA 1Y5BT 4XOJA 5ABWA 1QBVH 3PO1C 4FUHA 2AIQA 1BT7A 3W94A 3VB7A 3QX5H 3ZZ8A 1VCQA 3UTUH 1V6DA 1D3PB 5AVDA 4LZ1H 2C90B 1TE0A 1TYNA 2F9OA 3QUMP 3AASA 3T27A 4ABFA 1GI7B 5CE1A 2AIPA 1DM4B 1OP0A 1TX8A 1HYLA 1GG6B 3VGCB 3BN9A 5EQRA 3QGNB 3FZZA 5A8ZA 1OOKB 2W7UA 5FCRA 2Q6GA 1THSH 2FI3E 4FUFA 1TNLA 4Q7ZA 4ZH8A 1FQ3A 4K2YA 3ATKA 1AE5A 2FOFA 1YLDA 1HIAB 2FI5E 3BTKE 2A5KA 3STIA 1T8OA 1TNKA 3UNRA 1BQYA 4GVUA 4NGAH 4AFSA 1O5CB 3UOUA 1A1RA 1HIAA 4AYVB 2H1UA 2ZU3A 3TH2H 1LTOA 3SU1A 2W26A 1QB6A 1NT1A 3UQVA 3DHKH 1TMUH 5C2ZA 4JZ1A 3RP2A 1A5IA 2J92A 3UREA 4ABIA 4DURA 1TNHA 2PKSB 1THPB 3RXMA 1EKBB 4X8TH 4Y7BA 1KDQB 5F8TA 4DIHH 1BRBE 2RCEA 1C5UA 1MQ5A 1O3LA 1BIOA 2IJOB 2G55A 1DE7H 1QJ1B 3A80A 3VB3A 2O8WA 1H9HE 1Z1IA 1FPHH 1N8OC 5L30H 1KXBA 1QB9A 3UIRA 1HAOH 3EDXB 4YO9A 3SJ9A 1DSTA 2Y80A 1UTOA 1O3GA 1ZSJA 1SQAA 1W3CA 3S9AA 1XUFA 2M5TA 1YPEH 4NZLA 1K28D 2G52A 2SGPE 3EA9A 1OKXA 2V3HH 2JH0D 2F83A 1T4UH 2ZECA 4CBOA 2B9LA 1KXFA 2AGIX 1BTXA 3EE0B 1AFQC 3QZQA 3OSYA 5FPYA 5T6GA 5DP3A 1FY1A 1QGFA 1TABE 5FAHA 3NK8A 1P12E 4O97A 1HB0B 1RJXB 1SR5C 1VITH 2HOBA 4Q7XA 4YTAA 2AERH 2FLRH 1VR1H 1K2I1 3KQBA 4K5ZA 5AFZH 3RXDA 2VGCB 1O3BA 1EXFA 2SFAA 1Y8TA 1HAZB 1V3XA 3AAUA 5AFYH 2BHGA 1C1SA 2PHBA 1A2CH 1GJCB 3KQDA 1FZZA 1ANCA 1ZYOA 1RTKA 1ELFA 1TA2A 1CT2E 2G81E 3MU4A 2NWNA 3GDUA 4D76A 3A83A 1CBWB 3S0NA 2DE9A 3A7XA 2OD3B 4X6OA 3KHVA 1SL3A 3A87A 1RIWB 1HJ8A 1F5LA 1QA0A 6ESTA 1C2EA 2ULLA 5E0GA 2VIVA 5LPRA 1O5AB 1XKAC 3F6UH 1DXPA 3SU6A 1HGTH 2SGQE 3RXGA 5IYTA 3T26A 4LZ4B 1GJ5H 3M5NA 2VWMA 3RXBA 4A92A 1O3CA 5L2YH 2Y6TA 4A6LA 2C8ZB 2VH0A 3OTJE 3T62A 1A0LA 2QF0A 1W7GH 4BAOB 1GVKB 3RU4E 4KTSA 1C1TA 3Q3YA 1IHSH 4UE7H 3E6PH 3ZZBA 3SNDA 3LGVA 2VH6A 4GCHG 2GV6A 4B71A 3BTQE 1SOZA 3RM0H 1O3EA 4FUBA 1LQEA 1TMTH 2ZIQH 1F0RA 1QBNA 4UFFH 1GI6A 4K3JA 2GGVB 3M7UA 1YP9A 3UFAA 2HWLB 3BTGE 2PTNA 1T8MA 1ZTLA 1SVPA 3SV2H 1ETSH 4X2XA 3RXQA 4AX9H 1MU8B 2NU4E 1S85A 1NTPA 2OC7A 3T28A 1RTFB 1JIMA 5F8XA 1O36A 3GY3A 2H2ZA 5C3NA 2EI8A 1K1IA 1GHZA 1ZGVA 1GBEA 3M36A 3T29A 2GDDA 1YPHE 4I8HA 5EGMA 5T6FA 3TNTA 7GCHF 1TPOA 1NRSH 1T4VH 2QXJA 2CV3A 4E7RG 4BAMB 2ZFSA 1O30A 1NESE 2BLQA 1GBCA 3UQOA 1G36A 1DUEA 1K21H 2CF8H 4MPWA 3UOPA 1TFXA 1AB9B 2R2WU 2YNBA 4B2BA 1V2WT 1V2TT 4UD9H 4E05H 3GISB 3GICB 1QJ7B 4Y8ZA 1C2GA 4K1EA 3M61U 1GPZA 2XBVA 3ZZCA 2KAIB 1RD3B 1W14U 3RMLH 1DANH 2UUFB 1JOUB 1QB1A 1S6HA 2ZFRH 4ASHA 1WBGB 1YPJH 3Q77A 2VB0A 1D6RA 3AAVA 5A0AE 2HPQH 1B0FA 2CJIA 2KAIA 1RGQA 2ZHEH 2GKVE 3A7WA 3NUMA 1N6XA 1P2QA 5L6NH 1BDAA 3OU0A 1C4Y2 4PROA 4MNWA 4UFGH 2OLGA 3PYHA 2A7JA 4RKJB 3TK9A 1KXCA 3GCHC 3OX7U 3P8GA 2HVXA 4FUDA 1KTSB 4IC6A 2QIQA 2HRVA 3MI4A 4XBDA 3ZVAA 4WH8A 2ZDNA 2HNTF 3GY8A 1FDPA 1ZGIA 1K1JA 2XNIA 1OPHB 5JDUB 3ITIA 4WMEA 1RRKA 1SBWA 1SI5H 1TPAE 3ESTA 3SU4A 1CU1A 1O3AA 1OX1A 3BSQA 6GCHG 2UWLA 1CT4E 3GY7A 2UWOA 3EA8A 3SUFA 1RTLA 3IWMA 3IITA 1W10U 2ODPA 2WPHS 1BRUP 5AHGH 4JZDH 1DX5M 2O8UA 4D8NA 3Q76A 1O2GH 5HGGA 1IQGA 2R3UA 7KMEH 4CR5A 1MTSA 2BLOA 2PUXB 3BTDE 3FFGA 1CHGA 1HNEE 3Q3KA 4ZKSU 1C5QA 1LCYA 3B23B 1KSNA 3MH4A 3P92A 2BY5X 2VIQA 1SOTA 3EAJA 2BD8A 1O39A 4IGDA 5DPAA 3V13A 2DUCA 2QXHA 3PLPA 1CO7E 3F9GA 3RU4T 2CN0H 1KXDA 1V2QT 1DWBH 2QA9E 1C5MD 3SU3A 4NCYA 4CHAB 1GGDC 1ELVA 2P3UB 1IQMA 1S0QA 3JZ2B 4MTBA 4KGAA 2WUBA 5FBEA 1GBIA 2BD7A 5FPSA 3A8DA 2ZHQH 2AGGX 1SGTA 3AW1A 2J34A 1HAXB 4Y8XA 4LXBH 1O0DH 1ESAA 1GI3A 3MNXA 1JWTA 1O34A 4BXWA 1O3MA 2H5DA 1P2IA 1C2MA 2EA3A 4ZHLU 1TNGA 1TPPA 1O3JA 2BXTH 4NFEA 4DOQA 1CA8B 3A7VA 1BMMH 1T31A 3GDSA 3SN8A 1HXFH 3SI4H 4A7IB 5LPEA 2Z9LA 3NWUA 3LC5A 3PTNA 3SV8A 3M5LA 3E8LA 3TLOA 1D3TB 2FZZA 3PLKA 1C2HA 4X1PU 3B9FH 1C1VH 1K22H 4XFQA 1D3QB 2F9PA 3P70B 4IW4E 2C8XB 2TGTA 1EPTC 3PWBA 1Y3WA 1NFUA 3M3VA 2UWPA 2Z94A 4B75A 1O3PB 3MNCA 1UVTH 1DSUA 1O2KA 1CA0C 2P16A 3BEFB 1TGBA 1G2LA 4IMZA 1S0RA 4JZEH 1GMDF 1N1LA 1XKBC 4X8SH 1GJ4H 7GCHG 1G32B 4DW2U 1OYTH 3ZZ4A 2BLVA 2G8TA 3N7OA 2BMGB 2QF3A 1YPHC 2GV7A 3PWCA 2FIRH 3TH4H 1V2UT 3T25A 2GZ8A 3LJJA 3ZV8A 1C5YB 4DT7B 5EXMA 4OS6A 4J2YB 3GY6A 2G51A 1BA8B 5FPTA 5E0JA 3TGIE 1ARCA 1EZSC 4I33A 5FXLA 2ZPRA 1O37A 3GCNA 1DFPA 1H8IH 1AWFH 1Q2WA 1ZRBA 3SV9A 1W0YH 3RXJA 3LGTA 1BJVA 1HAGE 1FN8A 1MH0A 1TBQH 1C5ZB 3M7QA 1HJ9A 1RFNA 2ZU5A 2P93A 3VB5A 1DY9A 5F6MA 1D3DB 2PGQB 1WYKA 4KKDA 5GCHG 2BD3A 2ZGBH 4OS4A 1KXEA 1MMJN 4E06H 5JBTA 1AFEH 2ZCLP 1BUIA 1SLWB 1F7ZA 1YCPH 3LH3A 5K0HA 4FU8A 4AFZA 3TNSA 3ELAH 3LDXH 1TNIA 1VGCC 2ESTE 2XC0A 1GBJA 3SNBA 1HBTH 1AGJA 3VB4A 1DLKB 1YGCH 1AVWA 1D4PB 1LDTT 4GHTA 3AW0A 3MO9A 4CR9A 1BTPA 1AN1E 4NZQA 2VWOA 4O9VA 2GD4B 2VWNA 1IQKA 2OC1A 2YNAA 3BEUA 1O33A 3A7YA 2WYJA 1EOLA 2XWAA 3MU5A 4NFFA 5T6DA 2SNVA 2C8WB 1BMLA 1A0JA 1HAVB 2TRMA 1BTHH 1UJ1A 2GT8A 3QTOH 3ZV9A 1C2IA 1GDNA 4OGYA 1FLEE 1P3CA 3PMHB 1HAVA 4CRCA 4ABJA 2Z9IA 2GDEH 1SFQB 3L33A 4GPGA 3UPEA 1AE8H 2BOHB 1C1OA 3E0PB 3WY8A 1TGNA 3U9AH 1TX6A 1INCA 1GMCF 6CHAB 1IHTH 4I8JA 6CHAC 2GCTB 1AWHB 4Z6AH 4MPUA 3ZVEA 2FESH 3U1JB 4IN2A 1NRPH 1E34B 1MTNC 2P94A 3V7TA 1DLEA 1ELBA 2A4QA 4ESTE 4K8BA 1QR3E 4FUCA 2IN2A 1FPCH 4ZKNU 2ZA5A 1V2PT 4BTUB 3MYWA 2QAAA 1FMGA 1GBMA 3RM2H 2PWXA 5EXLA 4DJZB 1PPEE 1O3NA 3FAOA 4J1YA 4JZFH 5G4BA 1L1NA 3DD2H 2THFB 1TGSZ 2BXUH 1JXPA 2XBYA 1O2RA 9ESTA 3TK6A 1F0UA 1VCWA 4OS5A 1NY22 4UFDH 3RDZA 1NFYA 1GI2A 1HJAC 1A7SA 4BTTB 4X8VH 1DITH 4Y11E 4UDWH 2C8YB 1ELAA 2FTLE 1HAHH 1Y3UA 2Y7XA 3U69H 1YF4A 2ZEBA 3ODDA 2BTCE 1BTUA 3LU9B 3SHAH 2FS8A 3S7HB 1GJ8B 1C1UH 4ZKRU 1GMDG 4NIWA 2BDBA 3HK6B 2HLCA 5C1UA 4GAWA 1AVXA 1AKSA 4X6MA 2WPKS 2OQUA 8LPRA 1MAXA 2SGEE 5HM9A 4X6NA 2BDHA 4GCHF 3ZVCA 1UTJA 2BDIA 1GBLA 3GYLB 2P95A 4I32A 2J95A 1EAUA 4NIYA 1P09A 1GG6C 2AFQB 1T32A 4R0IA 3VGCC 1C1QA 3SU2A 4U32A 5EU8A 1H8DH 1BJUA 2PLXA 3CS7A 4X0WU 1XUKA 1O2LA 1BBRK 1WQSA 3UNSA 1E37B 1P10A 3H7OA 5F8ZA 3LH1A 4H6SB 1AO5A 3PTBA 1NFWA 5TCAA 4FUEA 3RXLA 1MBQA 3V12A 5C5NA 1MUEB 2Z3DA 1GWAA 4MNXA 1GBTA 2QGRA 1C2LA 1W0ZU 2F3CE 1FIWA 3LONA 1MBMA 3ZZDA 3ATMA 1O31A 1QY6A 5TJXA 1GL0E 4X1SU 1O3HA 2D1JA 4THNH 2STBE 2PKSC 1MD7A 2Q1JA 4DVAU 1DPOA 1P9UA 1S5SA 1YPKH 2LPRA 1H9IE 1ZHRA 2A32A 4HZHA 1O2WA 4ISOA 2IOTA 3SJ8A 2ZTZA 3A81A 3H7TA 1EAIA 4AG2A 3RXEA 1ABIH 1W13U 3ATWA 4GHQA 3A8AA 3QTVH 4ZXXH 1LHGH 1HAIH 1P3EA 3MFJA 1O2JA 2TGAA 1GI1A 2VVVA 4F49A 3KN2A 5I25A 2XCNA 5A0BA 5C1YA 1SGPE 1YPLH 1UTNA 2BVRH 1A0HB 1X7AC 1GMCG 1WAYB 2P3TB 1DS2E 1Z8RA 2BQ6B 3BTWE 1TIOA 1V2LT 2SGFE 3A85A 1O3DA 6GCHF 3F1SB 1EZXC 2A2QH 1ACBE 4JMYA 2O8MA 3OYPA 3VPKA 4X2WA 2PSXA 1SGRE 4CRDA 1ZPCA 1UHBB 1BHXF 2I6SA 1F0TA 2VU8E 1GI8B 5F03A 4ABHA 2VGCC 5DP7A 3TIUA 1EQ9A 1FONA 5EW2H 4O3UA 5HMAA 3SU5A 1P06A 1EX3A 4YLUA 1MCTA 2C3SA 1PPBH 1UHBA 3QK1A 3U1IB 4B2AA 5GDSH 4WXVA 1SB1H 1XUJA 2ZFQH 1LKAA 5LH8A 4ZROA 5EOKA 1PPFE 3ATLA 2QXIA 1CBWC 4MPVA 1K1PA 1HLTH 1RS0A 2GZ9A 1MKWK 1RIWC 2J94A 2W3KA 2BZ6H 2XC5A 3IG6B 2I6QA 2CMYA 4BANB 4QT8C 3M37A 3RC6A 4INLA 1GJAB 4AB9A 2VINA 3CS0A 1FNIA 3RXIA 3VB6A 4D9QA 2FXRA 1F5KU 4AOQA 3GOVB 1SSXA 3GCOA 1PQ8A 1ZHPA 4ISHH 1UCYK 2BD2A 1OSSA 5E2OA 3URCA 2J4IA 3TITA 4Z0KA 3U98H 3FP7E 3STJA 3SV6A 1C5TA 1SPJA 2YOLA 2BDAA 1S82A 3LIWA 4ZMAH 3QGJA 1DWDH 3O8BA 5DP8A 4BAKB 1T8LA 1IQFA 1ZSLA 3TGKE 2ZDKA 1H9LB 4F4OC 4H4FA 4MQAA 1WU1A 1TGTA 2R2MB 1TB6H 2UUYA 2A0QB 5J4QA 1DY8A 2OC8A 4TWYA 2V3OH 2BX3A 1Z8JB 6LPRA 1A3EH 1GJBB 1NRNH 4I8LA 1L0ZA 3VXEH 4H42U 4ZKOU 4CRFA 1MTVA 1H4WA 1CGHA 4X8UH 2XRCA 3UR9A 2QY0B 4VGCB 4IBLH 2FO9A 4HTCH 3UY9A 1VITG 4INKA 1HAPH 1AB9C 3SGBE 1EP6A