3RXLA

Crystal structure of trypsin complexed with (2,5-dimethyl-3-furyl)methanamine
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Cationic trypsin
publication title In-crystal affinity ranking of fragment hit compounds reveals a relationship with their inhibitory activities
doi rcsb
total genus 56
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2011-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3rxlA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3rxlA02
2VWLA 1KLIH 1H4WA 4I8LA 1Z8IB 1TNJA 2ZEBA 5HM9A 1SLXB 4FUBA 2G5NA 1CA0C 1ESTA 1O3LA 1CT4E 2Y80A 1Y8TA 3UY9A 1GBIA 3UUZA 2ZP0H 4ZHMU 1OWIA 1FPHH 1ESAA 4TY6A 4DJZB 2VVUA 5SGAE 5K7RA 2V3OH 2FOAA 2CJIA 2FLBH 1HV7A 1TRNA 1BTUA 5JBBS 3SGQE 1NESE 5C5OA 4A7IB 1A46H 2ZHQH 3BF6H 4MPWA 2ZCHP 1WV7H 4WXVA 8LPRA 1AFEH 1BTHH 1RTKA 3M35A 5E0GA 1TAWA 1S0RA 1C5UA 4BAHB 2HALA 4KKDA 1INCA 3TK5A 1ZTLA 5DP4A 3VGCB 2SGQE 3MI4A 4X8SH 1EX3A 2ZHDA 1HXEH 3F6UH 3HK6B 5F6MA 5EG4A 1F5KU 1ZTJA 3GDVA 1TA6A 1Y3YA 1GMDF 2CHAC 1N6XA 3RXFA 2F9OA 1QB9A 3EAJA 1O5EH 1RGQA 3JZ1B 1VITH 3TH2H 1UCYK 1O2MA 1LPGB 1TBZH 3MNCA 4JYVH 2ZI2H 1G3BA 1AKSB 3SU3A 5JPMH 1FAKH 1K9OE 1GI4A 1CT2E 4K8YA 4NWKA 1HB0B 1W14U 3LJOA 3RXGA 5A09A 1ETTH 4DG4A 3K6ZA 3SV2H 2ZPRA 5HM2A 2BDIA 2EEKA 2ZA5A 2D26C 3ZZ3A 1C5XB 1SHHB 2VIDA 2ZPSA 3LONA 3ESTA 3TLOA 2FX4A 2GDDA 1O3MA 4NZLA 5C1UA 3WY8A 2FODA 1HLTH 1P04A 4U2WA 1NFUA 4ZXXH 3BG4C 2STBE 5A8ZA 1H9HE 2QA9E 5FXLA 4XE4A 1UJ1A 1HBTH 1LO6A 1ZTKA 3VXEH 1TA2A 2HNTE 2PLXA 1MAYA 1MUEB 1JRSA 2NU4E 3STJA 2UWOA 1LMWB 1W0YH 2Z7FE 3KHVA 4GHQA 2IOTA 3SJ8A 3PLBA 1PPEE 1TGCA 3BTQE 2P8OC 2XC4A 1CBWB 1BTXA 1NU9A 3SBKA 1C5TA 1PPBH 4X0WU 5DKMA 1A0HB 1IAUA 1C5OH 1PPHE 1SQOA 2PSYA 4X6MA 3RMOH 5EW1H 1NU7B 1FNIA 3KL6A 3T25A 1FDPA 1MZAA 3SGBE 3DFLA 2R3UA 2F9UA 3VPKA 5BRRE 2AMPA 4ISIH 3UOUA 2JH6D 2A5AA 2Y82A 1J17T 2Z3CA 1DWEH 4X2YA 4LZ1H 3M7UA 3P8GA 1O2UA 1GHZA 1V2UT 2J2UA 3OYPA 1SFQB 4FU8A 4AB8A 1C9TA 1NY22 1TABE 1LHFH 2GD4B 2PSXA 2P16A 2Z9LA 3K9XB 2ZFTA 1DOJA 4R8TB 2PUXB 5EOKA 1OSSA 2BYAX 5DP7A 1VJAU 4K3JA 4MPXA 3KQCA 2BLQA 1C1SA 1EJAA 4BAKB 3BTKE 1G3EA 5FHTA 4KELA 1V2ST 3ZZDA 1SG8B 3A88A 2WUCA 6ESTA 3UOPA 4ABEA 3E16B 1NT1A 3QO6A 4Y79A 2BOKA 1CVWH 3A82A 5ETXA 1GI0A 3LOXA 1FN8A 5E2PA 4XBDA 5DPAA 1GL1A 1ELTA 5LGOA 2VB0A 2HWLB 1O3EA 1ANEA 3VB3A 1O3NA 1A5GH 4MNWA 4Y76A 2KAIB 3V3MA 1DITH 2WPJS 1YC0A 1F7ZA 2ILNA 2BY8X 3GDUA 5LH8A 4A1VA 2FI3E 1L4ZA 3L3TA 4OS4A 3TJNA 1YPMH 1MQ6A 3SUDA 1MH0A 2RA0A 2RA3A 1W2KH 2Z9GA 3M36A 1TX7A 4CBOA 2XTTB 3RXPA 4AYYB 1D6WA 1ZSLA 4ABJA 3Q3YA 4GHTA 2ALVA 1HAZB 4FU7A 1UTPA 4TPYA 4K1EA 3O8DA 1ESBA 1RTLA 3LH3A 1BZXE 1NZQH 3T27A 1O5GH 3FANA 1BMNH 2VJ1A 1QBVH 3MNXA 1T8NA 2PGQB 1CGJE 3A7XA 2XBVA 2K1QA 1U6QA 3ZZ7A 1AB9B 3GCHC 2GGVB 1BCUH 2NU3E 1QRZA 3ZV9A 1SPJA 1WTGH 3ZYDA 3PTNA 2G4TA 4KGAA 1AFQC 3P8NA 5GDSH 1HXFH 1OYQA 1DXPA 1NS3A 2TGTA 2FTMA 1HIAA 3O8RA 1KXFA 4WWYA 3E91A 1YLDA 3UNSA 3TU7H 1LHDH 1RIWC 1XKBC 4TWYA 4E05H 3NWUA 4CR9A 1JIRA 2OC8A 1AVGH 4CRAA 5C1XA 2C8ZB 3RXTA 1YGCH 2WYGA 5FBEA 5B6OA 1CQQA 2R0KA 1F0RA 4BAQB 1H9LB 2J95A 1B5GH 5ESBA 6GCHG 4I8GA 1IQEA 3A7TA 4GCHG 1O31A 2HLCA 2ZPQA 4XBCA 2B0FA 4UDWH 2FLRH 3PO1C 3A86A 3TJUA 3R3GB 4BAMB 4JMYA 1AUTC 1FONA 4FUFA 1NPMA 5DJ7A 2UUKB 2R3YA 4ABGA 3SORA 3UREA 1VGCC 3FFGA 1N1LA 1AN1E 4MNYA 2WPMS 4IS5A 2FYQA 2GMTB 3B8JA 2XWAA 3LPRA 1FY5A 5C67A 2BDBA 2ZU5A 1O3OA 2ANYA 2BLWA 1GG6C 5GIBA 2JKHA 3SHAH 8ESTE 1B0FA 3RXCA 1ZPZA 1ZHPA 4YT6H 2AIPA 1GJCB 3MFJA 4DY7B 1ZGVA 4Y0ZE 5DP9A 4AOQA 5ESTE 1QRXA 5GCHG 2PKSC 1KTSB 1ANDA 1PQAA 4BTTB 2QXJA 4D7FA 4E7NA 1PPZA 2CHAB 5JBTA 2VVVA 4O3TA 1BITA 2M5TA 3SJIA 3HKIB 1HDTH 4B1TA 4ABDA 3DT0H 3Q76A 3SNEA 5L30H 3F9GA 1AUJA 4FXGH 1XUGA 1W12U 2O8UA 1CE5A 2A4RA 1SI5H 1SLVB 5T6FA 3A81A 2GTBA 5EXNA 4OS1A 4B75A 2A4QA 3F1SB 1HCGA 2LNCA 2FOGA 1XXDA 2VU8E 4JYUH 3S9CA 7ESTE 2J34A 1T4UH 1XUJA 2GZ8A 5LPEA 1LPKB 1D6RA 1HAGE 1WYKA 1A2CH 3BG4B 1SMFE 1TRYA 2HNTF 2GCHF 4FVBA 1SGFG 3F9EA 5F03A 1G37A 3ATKA 2BOHB 1QL9A 1GMCF 3S7KB 2CF9H 2PKAB 1FXYA 1BDAA 4XSKU 4HZHA 1ZRKA 1HAVA 1O2TA 1HPGA 1MBMA 1HIAB 1XM1A 1L1GA 1O2YA 2P8OB 4KTSA 1P9SA 1THSH 4AFUA 1W0ZU 3SV6A 1GI7B 4VGCB 1KIGH 1TNLA 1QFKH 2PHBA 1YKTA 3PLPA 1DSUA 1EZSC 1C1MA 1LDTT 1VCQA 2I6SA 3UR6A 1A4WH 1A3EH 3MU5A 1VJ9U 1TQ7B 4NWLA 2DE8A 3PWBA 2W7SA 3SU0A 3PROA 1Y5BT 4ISHH 4DW2U 1TMBH 4GLYA 2OQ5A 3UWIA 2H9HA 4H6TA 1GJ7B 1MZDA 3SJOA 2AEIH 5J4QA 1O2OA 1TONA 1YPEH 2BD4A 3IITA 1SHYA 4ZAEA 3V13A 1FPCH 1ABJH 3LT3A 2ZQ2A 4THNH 5DK1A 3VB7A 3RXLA 1QJ6B 2ODPA 2A4GA 2ZU2A 1NFYA 1XUIA 4CRBA 5DP5A 4CRDA 8GCHG 4K1SA 2FESH 2ZGBH 3NPSA 4O3UA 2PUQH 1WBGB 1T32A 1VCWA 2XWBI 2ZTXA 2VWNA 4YO9A 1CHOG 3RXIA 1OWHA 5DP3A 2TBSA 1ELEE 3ATIA 3PB1E 3BTDE 1BJUA 1YF4A 1ZHRA 1UTOA 5I25A 1PQ8A 2VVCA 1ZRBA 4Z6AH 1TGTA 1IQNA 5C20A 4D8NA 1TWXB 7LPRA 1YYY1 1SGPE 1T4VH 1AVXA 1GI9B 1Z6EA 5JB8S 1C1TA 2ZU1A 2YNAA 3TGKE 4CBNA 1GBLA 1IOEA 3VB4A 1OXGA 4UFGH 2A45B 2C3SA 2PGBB 5H4IB 3URCA 1YBWA 5E0JA 3TGJE 1KXBA 2QC2A 3TPIZ 3BIVH 1GJ5H 1L1NA 3U1IB 2WV4A 1C2EA 1S0QA 4BAOB 2IJOB 1K1LA 4UFDH 3RXBA 1GHVH 4F49A 1O3IA 3M5NA 3FAOA 1GI2A 2FOBA 5BPEA 1LVMA 5T6DA 5AFYH 4CR5A 2ZC9H 1NRRH 1QIXB 3EYDA 4MQAA 3RDZA 1TNKA 3BTEE 1S6HA 4AORA 4YM9A 4NA8A 4BXWA 1OX1A 2JETC 3RM2H 5HXFA 2AIQA 1LQEA 2PTNA 2Z9JA 2NWNA 1EZUC 4BOHA 3TJVA 1QR3E 1J8AA 4JZ1A 1FIWA 3QLPH 1EAXA 5EQQA 1C4V2 1UHBB 3RXRA 3LGIA 3I29A 1GI3A 1F0TA 3CENA 1GGDB 1K22H 1TMUH 4NIVA 1EQ9A 3SI4H 1YM0A 2FOFA 1BA8B 1D3PB 1JWTA 2XCFA 2UUFB 2D2DA 2SGEE 4UONA 2A5IA 3TK9A 3BTWE 2QXHA 3RU4E 1V2LT 2G4UA 2IN2A 3MTYA 1RS0A 1C1WH 4HFPB 2Z3EA 1DWBH 2BM2A 1RTFB 2C93B 1CSOE 2O9QA 1P05A 1TQ0B 3P92A 3E90B 4Y11E 5DP8A 3RXJA 1O3JA 1V2QT 4SGBE 1J15A 2UUYA 1HJAC 1XVMA 1PYTD 3UWJH 3I77A 1SOTA 4YLUA 1AO5A 3SNBA 1BTYA 5T3HA 3LC3A 1T31A 1O36A 1ZHMA 1TGBA 1YPHE 1GDNA 1YCPM 1WOFA 3L33A 3EA7A 1VGCB 4O9VA 1GJ8B 1NN6A 1OOKB 1O39A 2AGIX 2QN5T 2W26A 2SGAA 1FMGA 1Z71A 4ABBA 1CGIE 3GICB 2XC5A 2A0QB 1MMJN 1J14A 1F92A 1K1IA 1TNHA 3GYLB 1ZPCA 1ELVA 1V6DA 2D8WA 1MTVA 1NM6A 5JBCS 4AG1A 1KDQA 3BSQA 4ZKOU 3QUMP 3LDXH 1ELAA 1FJSA 3A89A 3GY2A 6CHAC 3D23A 1ARCA 3SNCA 5E0HA 1LTOA 1BB0B 1LHCH 3D62A 1AZZA 2QXGA 3T5FH 3BIUH 1Z8RA 4NGAH 1E37B 1MQ5A 1AMHA 3P95A 4JCNA 5ABWA 2Q1JA 2FOMB 1QL7A 3M3TA 1DANH 4DOQA 3BTHE 1WQVH 4DGJA 1UK2A 2R2WU 1HUTH 1O35A 4HGCA 3RXVA 1DUAA 5CHAC 3MH5A 4M7GA 1GMDG 3O8CA 3JZ2B 2ZNKH 3ATMA 1GJDB 2OD3B 4LZ4B 3ODFA 4UE7H 1IQHA 3HPTB 1E36B 3RXSA 1DPOA 1TX6A 3H5CB 2BVRH 2GVFA 7GCHF 2Z94A 1TE0A 1NRSH 2H6MA 3BTTE 1BRUP 1DY8A 4FU9A 3G01A 3MU8A 4IMZA 3SHCH 5TCAA 3O8BA 2OC1A 4YESB 5FPTA 1GPZA 3HGPA 5EODA 2BLOA 3M61U 2A7JA 5HGGA 2BXUH 2CN0H 2VWOA 4A5TS 4TYDA 2HGTH 1O37A 1YPGH 2JH5D 3U8OH 1TBRH 3AASA 2Q6DA 1GBBA 1TGSZ 1IQLA 1GVKB 4RN6A 1RXPA 1K1NA 2VINA 2ZHWH 1LQDB 3RC6A 1SLWB 1ANCA 4OS6A 4CHAC 3RM0H 2WPIS 1G32B 4D76A 1KLJH 5GJ4B 2AERH 5EQSA 4NFFA 4MPUA 3SV9A 1GHBF 1OPHB 3RMNH 1V2NT 1K1PA 1DXWA 4IW4E 1T8OA 1FZZA 2GT8A 1UTLM 1SGCA 4ABAA 4Q7XA 2XBXA 1C2HA 2BD8A 2BD3A 4TWWA 5A0AE 1OP2A 1EJMA 2BZAA 2PWXA 2H1UA 3FP7E 3MH4A 1SC8U 1C4Y2 4LXBH 1QURH 1IQGA 1GVLA 1QQ4A 2A7CA 3LC5A 4MPVA 3GY8A 1P09A 2C4FH 2P3FH 4X6PA 1UTKA 3OSYA 1GJBB 2BTCE 5C3NA 4X1QU 2F91A 1MCVA 1LHGH 2FI4E 1A3BH 4BANB 1YCPH 4F4OC 1IHTH 3U8TH 1ZJDA 2CXVA 1ABIH 2O8LA 1GHYH 3ATLA 3T62A 1IQFA 2OC0A 4INHA 1EJNA 2XRCA 2OTVA 5C2ZA 1OYTH 4X6OA 1O5DH 1PFXC 1PQ7A 1S5SA 4AGJA 2RG3A 2BVSH 3ZVEA 3P8FA 1WTHD 1BHXB 2VIWA 3MH6A 1DICA 3GCNA 1C5YB 1ETRH 1P2NA 1OWDA 4AGKA 4JZDH 4DIIH 5F8ZA 1LVBA 5AF9H 3KQEA 1DM4B 1BMLA 3F9HA 1GHAF 1W7GH 4Z0KA 1W10U 1W3CA 2FM2A 2OCVB 1RJXB 3ENSB 3ZVDA 1P01A 1QBNA 1QGFA 1QJ7B 1A0LA 3RMLH 2GP9B 1QBOA 1LVYA 3QK1A 4TPIZ 2BQ7B 4ZROA 4K5ZA 1TPAE 4D7GA 3PV4A 2ANKH 1MKWH 2BDHA 1OWJA 1G30B 2C8WB 3SU5A 2PTCE 2OBQA 1DUEA 3GDSA 1C2IA 1FAXA 1ID5H 3KIDU 3RU4T 4J2YB 2GCTC 1C1RA 1SSXA 3QGNB 2P94A 1IQJA 1OKXA 1YPLH 1UTQA 5FX6A 3ZZ5A 2B5TB 3SNAA 1O5AB 1NFXA 3MYWA 2F9VA 3LGVA 4UD9H 2BDCA 1ZZZA 2J94A 3DFJA 1THPB 3GYMA 3RC5A 2ASUB 3MU1A 4FUEA 1FY3A 2J9NA 5CE1A 2H2ZA 1VITF 2RCEA 3ZZ4A 4NG9H 1CA0B 1HJAB 1GVZA 1LKBA 4AN7A 2V3HH 3Q77A 1KXDA 3K2UA 4MNVA 2VIPA 2ZWLH 3EA9A 1SGEE 2SFAA 1EPTC 1WUNH 3DD2H 3CP7A 1ELDE 5EXMA 1P2JA 3UR9A 2BD2A 4A1TA 1XUHA 1DVAH 1RRKA 2PFEA 3I78A 2QY0B 2P59A 1GCDA 3MHWU 3EGKH 4U30A 1V2VT 2CF8H 5LPFA 2ZHFH 3S9BA 2QCYA 2Z9KA 3EQ0H 1TOMH 5C1YA 2OBOA 4CH8B 5FCRA 3GCTF 3ZVCA 4YOIA 1YCPK 4ESTE 6LPRA 2P95A 3SV8A 2HVXA 1O2KA 2BZ6H 1LCYA 3BTFE 1NC6A 3FZDA 4X1PU 1E38B 1THRH 3ZZCA 2IPHA 1DX5M 3GY7A 1IQMA 2Y81A 5FCKA 3TIUA 1B7XB 2B9LA 1N6YA 3N7OA 1O2VA 4OS2A 5F8TA 4I33A 1CHGA 1HRTH 4YZUA 4U32A 5GPIB 1O3FA 1OWEA 1MBQA 3TGIE 3QWCH 1F5RA 4GAWA 1EUFA 2HNTC 1P03A 1DLEA 1P11E 3SJKA 3STIA 3DHKH 4B2CA 1QB1A 5CHAB 2FEQH 3RXQA 1Q31A 3PLKA 3OY5U 2LPRA 1O3PB 1P2OA 3U1JB 1P02A 1HYLA 1O3DA 5FPSA 1O2IA 1BTPA 1Y5AT 1EXFA 1UVTH 1Y3WA 2QF0A 2ZDKA 1O3CA 3BV9B 2V35A 5JB9S 1C4U2 1C5VA 3PTBA 1BJVA 5EU8A 3ITIA 4YTAA 2ZZUH 5G4BA 1D9IA 1PPFE 1UVSH 2C8YB 3T28A 2XBYA 2ZECA 1A5HA 3U98H 1GDQA 4NSVA 3P6ZB 3MH7A 1GBHA 1G9IE 1GBEA 1QNJA 1GHXH 1P2MA 1C1VH 1C2JA 1DLKB 3TNSA 2Y5HA 1ELGA 2A1DB 3M5MA 5CMXH 4CRGA 2C90B 2TGDA 2HRVA 3LGTA 5A2MH 1O0DH 1V2KT 1RFNA 2QAAA 4NA9H 1AE5A 1GMCG 4OGXA 3RXMA 3E8LA 4BTIB 4NIYA 1EAIA 1C5WB 3SU4A 4CHAB 4FUCA 3HKJB 1ZSKA 1WQSA 1CBWC 1GBDA 4ZKRU 4B74A 4DCDA 1AWFH 3KEEA 4I8JA 3VEQB 2Q6GA 4D9RA 3UFAA 3ODDA 1PPGE 3SO3A 1AQ7A 3A85A 1TBQH 7KMEH 1UMAH 1Z7KA 4CRFA 5K0HA 1P2KA 1EPTA 1S83A 1BT7A 4K2YA 1TLDA 1TMTH 4X1NU 4K8BA 1GWAA 5JDUB 2A32A 4FUJA 5E8EH 1SGYE 4X2WA 2ODYB 1HNEE 2TGPZ 2OLGA 2W5EA 4PROA 2W7UA 2AYWA 2ZO3H 1QCPA 4FUIA 3ZVGA 4E7RG 2G81E 3FP6E 1GI5A 1TIOA 2BLVA 5JYIA 1BBRE 2ZFFH 3MU0A 4BXSA 4Y8ZA 1GDUA 4AYVB 3P8OA 4XOJA 4IC5A 1E34B 1A0JA 4ISOA 1Y59T 4X2VA 4INKA 2A31A 4AB9A 1FI8A 3AW0A 2YNBA 1P9UA 1S82A 2BVXH 1O5FH 3LKWA 3ZZ9A 3RMMH 1EB2A 4A1XA 4ZMAH 2O8MA 3IG6B 1P06A 1GCTC 3ZV8A 5A8XA 3NUMA 4KTCA 4ZHAA 2WUBA 1V2TT 2F83A 2BQWB 9ESTA 3VB6A 1TALA 1N8OC 1MAXA 1O2NA 3IWMA 1MU8B 3ZZBA 1TFXA 2HPQH 1ORFA 1KTTB 2CV3A 1PYTC 2FXRA 1F2SE 4ZHLU 5GXPA 2PW8H 1P8VC 1MCTA 4Y0YE 1FY8E 1A7SA 4OS7A 3RXEA 4B73A 2EI8A 1AKSA 3PYHA 2SGDE 4ZKSU 2FWWA 1GL0E 3RC4A 1MTUA 5A0BA 2P93A 1LHEH 3GCHB 1BBRH 3UTUH 1LVOA 4ASHA 2Y7ZA 4RKOB 1DSTA 1F0SA 4Q80A 1QQUA 4J1YA 1AFQB 4X6NA 1HAVB 5FPYA 1BHXF 2ZCKP 1KXEA 3ZZAA 1NROH 2GCTB 3D49H 3HATH 1RIWB 1C5SA 1UO6A 1LKAA 3KF2A 1AB9C 4B71A 3GISB 3E3TA 3KGPA 3A8AA 3A7VA 4YT7H 1DS2E 1UVPA 2FS9A 2ZCLP 3U9AH 2AGEX 2ZU3A 4YOJA 5DG6A 1IHSH 2ANWA 1GMHF 2R2MB 3SUGA 3PWCA 2Y5FA 3BEIB 3QZRA 1VCPA 1SGDE 1TRMA 5T6GA 3LH1A 2PV9B 1QA0A 2NU0E 1HAPH 3RXUA 3PO1B 1UVOA 2TRMA 4Y7BA 3V0XA 4FUGA 2DUCA 3A87A 2XNIA 1KXAA 1GJ9B 1OWKA 2R9PA 1EAWA 1GJAB 1QA7A 1QJ1B 1EPTB 1F0UA 3FP8E 2QIQA 1A1RA 1KSNA 3KNXA 3E0NB 2WPHS 4YLQH 3HGNA 3KCGH 3RLWH 2FPZA 2OP9A 3AW1A 3MO9A 5A0CA 3LGWA 1GHWH 5FBIA 1EZXC 1VR1H 4FUHA 1NRNH 1ZLRA 2G00A 2O8WA 4JK5A 4I31A 4MVNA 3E6PH 3P17H 3RLYH 4BTUB 1GG6B 4I8HA 4YOGA 3UQVA 4JZIA 1EKBB 4MG3A 2VNTA 3VXFH 2BD7A 4WXIA 2VGCC 2GV6A 1EZQA 1K21H 2WPLS 3RUOA 5C5NA 1O3GA 1QB6A 2G55A 1O3KA 2GDEH 5AFZH 2Y6TA 1ZMLA 1NO9H 2OC7A 3VFEA 4DVAU 2GMTC 5DGJA 2PKSB 3A83A 1G3CA 2GV7A 1XMNB 1CT0E 4DURA 1A5IA 2UWLA 3TVJB 2BY7X 1X7AC 3BEUA 4CRCA 1SB1H 1O2XA 2ZU4A 4UEHH 3Q3XA 5DP6A 3E1XB 4HI3A 1C2LA 2G51A 1QY6A 4JZFH 2VH0A 4H6SB 1JRTA 1NRPH 3ZZ8A 1S6FA 3MO3A 1K1OA 4D9QA 1C9PA 1ZMJA 2KAIA 4ABIA 4Y10E 1V2WT 1XX9A 3H7TA 2BX4A 2H5CA 1K1MA 1JMOH 4K69A 4DIHH 1P12E 1SFIA 1O5BB 2ZHEH 5HMAA 1L4DA 1TYNA 4AZ2B 5EQRA 2DE9A 3QTOH 4IN1A 1F5LA 1VZQH 3MO6A 1ZGIA 1BBRK 3UPEA 1G36A 1BTZA 1V3XA 4GPGA 3QN7A 3L6PA 3MNSA 4K1TA 4A6LA 1HFDA 2TPIZ 3B23B 3W95A 4H42U 2AGGX 2OQUA 7GCHG 1JOUB 1XUKA 1ZJKA 3F68H 1Y3VA 2RDLA 2ZDLA 3M7QA 1W7XH 1EOLA 1Q2WA 1P57B 2O8TA 2Y5GA 2ZQ1A 1XVOA 4MTBA 3GY6A 3LGYA 3MOCA 2AH4X 1O2PA 1O38A 4Q2KA 2BY5X 4DT7B 1V2RT 1FIZA 3OY6U 2XBWA 3GY5A 4JYTA 5IDKA 2D1JA 1GBMA 4WMEA 1ACBE 5HYOA 3BN9A 2G52A 1AWHB 2FZZA 1Y5UT 2QYIA 1FQ3A 1GBKA 1ZOMA 2A5KA 4WJG2 5FAHA 1SQAA 4VGCC 1MTNC 2FX6A 1MTSA 2ODQA 1UTMA 4MDSA 3LGUA 2BHGA 2W3KA 3NCLA 1JBUH 1O2LA 3PMAB 3QDZB 1M9UA 4X8VH 1H8IH 1K2I1 1Y3XA 1TGNA 4XDEA 2B7DH 1AI8H 5TCCA 3SUFA 4E06H 1GHBG 5JBAS 2B8OH 1C2KA 3A7ZA 1O2WA 1J9CH 3TK6A 1AZ8A 4IC6A 1SVPA 2FP7B 3T2NA 3SV7A 1NRQH 1BTWA 3LIWA 4ZXYH 3QX5H 2FI5E 2WYJA 4I8KA 2H9TH 3M3VA 1KDQB 2WPKS 4Y7AA 1O2RA 2F9PA 1O2ZA 1SOZA 3MU4A 3H7OA 2BD9A 2ULLA 1CO7E 3VB5A 1HJ9A 2G8TA 1QHRB 3LU9B 4INLA 1P3EA 1SGQE 1GCTB 2VIVA 2ZF0H 4O03A 2GZ9A 1SGIB 1HAOH 2NU2E 5TJXA 1TPOA 3NK8A 4Y6DA 2BMGB 5IYTA 1N8OB 1O33A 1Q3XA 2ZDMA 3UIRA 3CS0A 1PJPA 1TOCB 3A8DA 3GCOA 3ZVBA 3R0FA 1LPZB 4ZH8A 3HK3B 1EATA 4B2BA 1BRCE 3SU6A 1UTNA 9LPRA 4MNXA 2YOLA 2XXLA 3GY4A 4K60A 1D3TB 3F9FA 1G3DA 1V2MT 5L6NH 2ZKSA 1EP6A 1P0SH 1SGTA 2GT7A 2Z6BD 1J16A 1YP9A 1O2SA 2CMYA 3NXPA 1BMMH 1O30A 4O97A 1NFWA 2JETB 3PMHB 1AD8H 1HGTH 2GZ7A 4CH2B 1GHAG 2STAE 1O3HA 4WH8A 1EB1H 1L1JA 2TIOA 3SUEA 4WF8A 1GBFA 1MD8A 2V6NA 1C1UH 1S84A 2FOHA 2ZGHA 3E0PB 4NSYA 4XBBA 3C1KA 1FLEE 1KY9A 5F8XA 2AMQA 1OP8A 2ZGJA 2EA3A 1E35B 1QL8A 1S85A 1Z8GA 1SR5C 3U8RH 4Q7ZA 3M3SA 1YPHC 2H9EH 1FY1A 1Y3UA 2W3IA 1T8MA 1T8LA 2PKAA 4FUDA 3OTJE 2ZTZA 1HJ8A 1YPJH 4Y8XA 1WCZA 1K1JA 2JH0D 6GCHF 2FYRA 4GCHF 2VWMA 2CGAA 1EOJA 1GGDC 2FO9A 4WMFA 1O5CB 2ZDAH 1HAHH 2FDAA 2J4IA 3A7WA 4NCYA 2UWPA 3S9AA 3A8BA 1ZPBA 3ZYEA 1PPCE 2WV5A 1Z1IA 4XFQA 1ZSJA 4JK6A 1EAUA 4WH6A 5EPYA 3FZZA 3SI3H 1WU1A 4X2XA 3EDXB 2ESTE 3ZVAA 2XC0A 2C8XB 1IQIA 1VITG 3SQEE 3EA8A 4ABHA 1S81A 2Y7XA 2BDYA 2ZDVH 3RU4D 3DUXH 3RXKA 1FY4A 3BG8A 1TX8A 2R0LA 2ZIQH 5PTPA 2AMDA 2FOCA 2A2XH 1GBJA 1YPKH 2V0BA 4X8TH 1SGNE 4R0IA 1JIMA 1G2MA 4WMDA 1TPPA 2QF3A 1TNIA 3DA9B 3BTME 2FTLE 4RKJB 2SNVA 2VGCB 3SN8A 2ZFSA 3ZZ6A 4B76A 6CHAB 2P3TB 3BTGE 2FIRH 1ARBA 1C2GA 1C1QA 3AVZA 2A2QH 1WAYB 1QTFA 2BDGA 2J92A 1O34A 5GCHF 4GVUA 3KQBA 2J38A 5EW2H 1KXCA 3GCTG 3SW2B 1TPSA 2VIQA 4BNRA 2ALPA 5EGMA 1TB6H 2A7HA 1AU8A 1KYNA 1QRWA 3VGCC 2GKVE 2ZDNA 4FVDA 3URDA 2FS8A 4ZUHA 3MWIU 3NZIA 5FX5A 1UK3A 1H9IE 1ZR0A 1G2LA 1MKXH 3SGAE 4Y71A 1ZMNA 1RD3B 2VIOA 2FOEA 1OP0A 3K6YA 3TITA 4UFEH 1FUJA 2P3UB 2BDAA 1O2JA 1W13U 1AY6H 3AAUA 1OS8A 3RXHA 4GSOA 1ZYOA 2EC9H 3U69H 2ZTYA 4IBLH 3V7TA 1O2HA 1CGHA 1DT2A 1ELFA 1MKWK 3RXOA 4ABFA 4AFSA 3KQDA 1CA8B 3B9FH 1IQKA 1DWCH 4AFQA 1C5ZB 1A61H 2QGRA 3SNDA 4Y8YA 1P2IA 3RP2A 1D3DB 3C27B 1EP5A 4NA7A 1C5PA 4AFZA 3UNRA 1DE7H 2GCHG 3SJ9A 1XUFA 3RXAA 3AAVA 2ZFRH 4IN2A 1C5RA 3A80A 4X1RU 1P2QA 3GOVB 4LOYH 2F9NA 3PMBB 4LK4A 1C5QA 4HTCH 1AGJA 3SU1A 2Z9IA 4OGYA 4JZEH 1UHBA 1C1PA 4AX9H 1V2PT 4A92A 2ZFPH 1TNGA 2EI6A 4NFEA 2I6QA 2BXTH 3SQHE 1MTNB 1AHTH 3OX7U 1W11U 1GBTA 3UNQA 3MMGA 1L0ZA 2ZGCA 4NZQA 1BQYA 4I7YH 3PM3A 2HPPH 1GI6A 3RXDA 1HAYB 2BX3A 1W8BH 4I32A 1SQTA 5I46H 1C2MA 3TH4H 3M5LA 2AFQB 8GCHF 1GBCA 1UCYE 1GBAA 5J4SA 4OS5A 2UUJB 4ISLA 3OU0A 4X8UH 1WSSH 3TNTA 1ETSH 4Q7YA 4WY3A 1P3CA 1BRAA 5EPNA 1GI8B 1GJ6A 3QGJA 3SU2A 2OINA 4SGAE 5L2YH 1CHOF 1DY9A 2BY6X 1XXFA 4U01A 5AHGH 3Q3KA 3D65E 2F3CE 3ZVFA 2BD5A 4NIWA 3QTVH 2PR3A 3P70B 2Q6FA 1SGRE 2QV1A 5L2ZH 2H5DA 5A8YA 3EE0B 4NIXA 3A7YA 1Z1JA 2BY9X 1BUIA 1C5MD 1ELBA 1C2DA 1D3QB 1DWDH 1SL3A 1O3AA 1Z8JB 1UK4A 4AG2A 3W94A 4MLFB 8KME2 1MTWA 1SLUB 4GUXA 1AIXH 1AE8H 1MD7A 3NKKA 1SGFA 1MU6B 1H8DH 3LJJA 1FN6A 2SNWA 1EASA 3ELAH 3S0NA 2ANMH 2VH6A 5GWZA 1C5LH 3TH3H 4H4FA 2AS9A 1PQ5A 1MKXK 2ZFQH 3T26A 2XW9A 1UCYH 4TY7A 2SGPE 1ELCA 4IMQA 1O3BA 1NTPA 1P10A 2BB4A 1UVUH 3A84A 1H1BA 1XKAC 2ZGXH 2G5VA 3M5OA 2BQ6B 3BEFB 4ISNA 1V2JT 4IGDA 1KLTA 1BIOA 1Z6JH 1K28D 1O2GH 3V12A 2Z3DA 1C2FA 1O2QA 2THFB 1BOQA 3M7TA 1GI1A 1V2OT 1C1OA 3CS7A 1HAIH 2A4OA 3SZNA 2TGAA 1HAXB 4CREA 4QT8C 1CU1A 2WINI 1GJ4H 3KN2A 3GY3A 1O32A 1C1NA 1DFPA 2HOBA 2XYAA 3FVFB 3ATWA 1UTJA 1BMAA 2SGFE 2OXSA 5AVDA 2EI7A 3QZQA 3M37A 4KP0A 5EXLA 1ANBA 3Q00A 4UFFH 1JXPA 3TJOA 2GX4A 1D4PB 3S69A 3MNBA 3A8CA 4ZKNU 2XCNA 2OUAA 1DDJA 1YLCA 2QXIA 3PMJA 1B0EA 4WVPE 3T29A 5DO4H 5LPRA 3K65B 3S7HB 4KTUA 3UQOA 1SBWA 5E2OA 1AVWA 1T7CA 2ZG0H 2NU1E 1C5NH 1L2EA 4RSPA 1E0FD 3SOSA 2F9BH 4B2AA 2FMJA 1GMHG 1BRBE 1FV9A 4X1SU
chains in the Genus database with same CATH superfamily
2VWLA 1KLIH 1H4WA 2J97A 4I8LA 1Z8IB 1TNJA 2ZEBA 5HM9A 1SLXB 4FUBA 2G5NA 1CA0C 1ESTA 1O3LA 1CT4E 2Y80A 1Y8TA 3UY9A 1GBIA 3UUZA 2ZP0H 4ZHMU 1OWIA 1FPHH 1ESAA 5KEDA 4TY6A 4DJZB 2VVUA 5SGAE 5K7RA 2V3OH 2FOAA 2CJIA 2OK5A 2FLBH 3AK5A 1HV7A 1TRNA 1BTUA 5JBBS 3SGQE 1NESE 5C5OA 5KECA 4A7IB 1A46H 2ZHQH 3BF6H 3WW7A 4MPWA 2ZCHP 1WV7H 4WXVA 8LPRA 1AFEH 1BTHH 1RTKA 3M35A 5E0GA 1TAWA 1S0RA 2RDEA 1C5UA 4BAHB 2HALA 4KKDA 1INCA 3TK5A 1ZTLA 5DP4A 2K8IA 3VGCB 2SGQE 2KCOA 3MI4A 4X8SH 1EX3A 2ZHDA 1HXEH 3F6UH 3HK6B 5F6MA 5EG4A 1F5KU 1ZTJA 3GDVA 1TA6A 3F3BA 1Y3YA 1GMDF 2CHAC 1N6XA 3RXFA 2F9OA 2JJ1D 1QB9A 3EAJA 1O5EH 1RGQA 3JZ1B 1VITH 3TH2H 1UCYK 1O2MA 1LPGB 1TBZH 3MNCA 4JYVH 2ZI2H 1G3BA 1AKSB 3SU3A 4ACAA 5JPMH 1FAKH 1K9OE 1GI4A 3FKSD 1CT2E 4K8YA 4NWKA 1HB0B 1W14U 3LJOA 3RXGA 5F53A 1ETTH 5A09A 4DG4A 3K6ZA 3SV2H 2ZPRA 5HM2A 2BDIA 2EEKA 2ZA5A 2D26C 3ZZ3A 1C5XB 1SHHB 2VIDA 2ZPSA 3LONA 3ESTA 3TLOA 2FX4A 2GDDA 1O3MA 4NZLA 5C1UA 3WY8A 2FODA 1HLTH 1P04A 4U2WA 1NFUA 4ZXXH 3BG4C 2STBE 5A8ZA 1H9HE 2QA9E 5FXLA 4XE4A 1UJ1A 1HBTH 1LO6A 1ZTKA 3VXEH 1TA2A 2HNTE 2PLXA 1MAYA 1MUEB 1JRSA 2NU4E 3STJA 2UWOA 1LMWB 1W0YH 2Z7FE 3KHVA 4GHQA 5B6LA 2IOTA 3SJ8A 3PLBA 1PPEE 1TGCA 4RT0A 3BTQE 2P8OC 2XC4A 1CBWB 1BTXA 1NU9A 3SBKA 1C5TA 1PPBH 4X0WU 5DKMA 1A0HB 1IAUA 1C5OH 1PPHE 1SQOA 2PSYA 4X6MA 3RMOH 5EW1H 1NU7B 1FNIA 3KL6A 3T25A 1FDPA 1MZAA 3SGBE 3DFLA 2R3UA 2F9UA 3VPKA 5BRRE 2AMPA 4ISIH 3UOUA 2JH6D 2A5AA 2Y82A 1J17T 2Z3CA 1DWEH 4X2YA 3KQ5A 4LZ1H 3M7UA 3P8GA 1O2UA 1GHZA 1V2UT 2J2UA 3OYPA 1SFQB 4FU8A 4AB8A 1C9TA 1NY22 1TABE 1LHFH 2GD4B 2PSXA 2P16A 2Z9LA 3K9XB 2ZFTA 1DOJA 4R8TB 2PUXB 5EOKA 1OSSA 2BYAX 5DP7A 1VJAU 4K3JA 4MPXA 3KQCA 2BLQA 1C1SA 1EJAA 4BAKB 3BTKE 1G3EA 5FHTA 4KELA 1V2ST 3ZZDA 1SG8B 4F48B 4FETA 3A88A 2WUCA 6ESTA 3UOPA 4ABEA 1WXRA 3E16B 1NT1A 3QO6A 4Y79A 2BOKA 1CVWH 3A82A 5ETXA 1GI0A 3LOXA 1FN8A 5E2PA 4XBDA 5DPAA 1GL1A 1ELTA 5LGOA 2VB0A 2HWLB 1O3EA 1ANEA 3VB3A 1O3NA 1A5GH 4MNWA 4Y76A 2KAIB 3V3MA 5FL7D 1DITH 2WPJS 1YC0A 1F7ZA 2ILNA 2BY8X 3GDUA 5LH8A 4A1VA 2FI3E 1L4ZA 3L3TA 4OS4A 3TJNA 1YPMH 1MQ6A 3SUDA 1MH0A 2RA0A 2RA3A 1W2KH 2Z9GA 3M36A 1TX7A 4CBOA 2XTTB 3RXPA 4AYYB 1D6WA 1ZSLA 4ABJA 3Q3YA 4GHTA 2ALVA 1HAZB 4FU7A 1UTPA 4TPYA 4K1EA 3O8DA 3H09A 1ESBA 1RTLA 3LH3A 1BZXE 1NZQH 1QZ8A 3T27A 1O5GH 3FANA 1BMNH 2VJ1A 1QBVH 3MNXA 1T8NA 4I86A 2PGQB 1CGJE 3A7XA 2XBVA 2K1QA 1U6QA 4XD7D 3ZZ7A 1AB9B 3GCHC 2GGVB 1BCUH 2NU3E 1QRZA 2XOKD 3ZV9A 1SPJA 1WTGH 3ZYDA 3N7EA 2JIZD 3PTNA 2G4TA 4KGAA 1AFQC 3P8NA 5GDSH 1HXFH 1OYQA 1DXPA 1NS3A 2TGTA 2FTMA 1HIAA 3O8RA 1KXFA 4WWYA 3E91A 1YLDA 3UNSA 3TU7H 1LHDH 1RIWC 1XKBC 4TWYA 4E05H 3NWUA 4CR9A 1JIRA 2OC8A 1AVGH 4CRAA 5HIYA 2C8ZB 3RXTA 5C1XA 1YGCH 2WYGA 5FBEA 5B6OA 5GNDA 1CQQA 2R0KA 1F0RA 4BAQB 1H9LB 4RT1A 2J95A 1B5GH 5ESBA 6GCHG 4I8GA 1IQEA 3A7TA 4GCHG 1O31A 2HLCA 2ZPQA 4XBCA 2B0FA 4UDWH 2FLRH 3F0OA 3PO1C 3A86A 3TJUA 1YY3A 3R3GB 4BAMB 4JMYA 2QF4A 1AUTC 1FONA 2YMSC 4FUFA 1NPMA 5DJ7A 2UUKB 2R3YA 3F0PA 4ABGA 3SORA 3UREA 1VGCC 3FFGA 5EJLA 1N1LA 1AN1E 4MNYA 2WPMS 4IS5A 2FYQA 2GMTB 3B8JA 2XWAA 3LPRA 1FY5A 5C67A 2BDBA 2ZU5A 1O3OA 2ANYA 2BLWA 1GG6C 5GIBA 2JKHA 3SHAH 8ESTE 1B0FA 3RXCA 1ZPZA 1ZHPA 4YT6H 2AIPA 1GJCB 3MFJA 4DY7B 1ZGVA 4Y0ZE 5DP9A 4Z1MD 4AOQA 5ESTE 3GS9A 1QRXA 5GCHG 2PKSC 1KTSB 1ANDA 1PQAA 4BTTB 2QXJA 4D7FA 4E7NA 1PPZA 3MQKC 2CHAB 5JBTA 2VVVA 4O3TA 1BITA 2M5TA 3SJIA 3HKIB 1HDTH 4B1TA 3OEHD 4ABDA 3DT0H 3Q76A 3SNEA 2KFWA 5L30H 3F9GA 1AUJA 4FXGH 1XUGA 1W12U 2O8UA 1CE5A 2A4RA 1SI5H 1SLVB 5T6FA 3A81A 2GTBA 5EXNA 4OS1A 4B75A 2A4QA 3F1SB 1HCGA 2LNCA 2FOGA 1XXDA 1YLNA 2VU8E 4JYUH 3S9CA 7ESTE 2J34A 1T4UH 1XUJA 2GZ8A 5LPEA 1LPKB 1D6RA 1HAGE 1WYKA 1A2CH 3BG4B 1SMFE 2CK3D 1TRYA 2HNTF 2GCHF 4FVBA 1SGFG 3F9EA 5F03A 1G37A 3ATKA 2BOHB 4ASUD 1QL9A 1GMCF 3S7KB 4DT4A 2CF9H 2PKAB 1FXYA 1BDAA 4XSKU 4HZHA 1ZRKA 1HAVA 1O2TA 1HPGA 1MBMA 1HIAB 1XM1A 1L1GA 1O2YA 2P8OB 4KTSA 1P9SA 1THSH 4AFUA 1W0ZU 3SV6A 1GI7B 4VGCB 1KIGH 1TNLA 1QFKH 2PHBA 1YKTA 3PLPA 1DSUA 1EZSC 1C1MA 1LDTT 1VCQA 2I6SA 3UR6A 1A4WH 1A3EH 3OE7D 3MU5A 1VJ9U 3WWFA 1TQ7B 4NWLA 2DE8A 3PWBA 2W7SA 3SU0A 2J5UA 3PROA 1Y5BT 4ISHH 4DW2U 1TMBH 4GLYA 2OQ5A 3UWIA 2H9HA 4H6TA 1GJ7B 1MZDA 3SJOA 2AEIH 2W6ID 5J4QA 1NBME 1O2OA 1TONA 1YPEH 2BD4A 3IITA 1SHYA 4ZAEA 3V13A 1FPCH 1ABJH 3LT3A 2ZQ2A 4Q63A 4THNH 5DK1A 3VB7A 3RXLA 3FN8A 1QJ6B 2ODPA 2A4GA 2ZU2A 1NFYA 1XUIA 4ZCNA 4CRBA 5DP5A 4CRDA 8GCHG 4K1SA 2FESH 2ZGBH 3NPSA 4O3UA 2PUQH 1WBGB 3F2GA 3OAAD 1T32A 1VCWA 2XWBI 2ZTXA 2VWNA 4YO9A 1CHOG 3RXIA 1OWHA 5DP3A 1MABB 2TBSA 1ELEE 3ATIA 3PB1E 3BTDE 1BJUA 1YF4A 1ZHRA 1UTOA 2QF5A 1PQ8A 2VVCA 1ZRBA 4Z6AH 5I25A 1TGTA 1IQNA 5C20A 4D8NA 1TWXB 7LPRA 1YYY1 1SGPE 1T4VH 1AVXA 1GI9B 1Z6EA 5JB8S 1C1TA 2ZU1A 3FO8D 3SYJA 2YNAA 3TGKE 4CBNA 1GBLA 1IOEA 3VB4A 1OXGA 4UFGH 3KYFA 3OFND 2A45B 2C3SA 2PGBB 4OM9A 5H4IB 3URCA 1YBWA 5E0JA 3TGJE 1KXBA 2QC2A 3TPIZ 1COWD 3BIVH 1GJ5H 1L1NA 3U1IB 2WV4A 1C2EA 1S0QA 4BAOB 2IJOB 1K1LA 4UFDH 3RXBA 1GHVH 4F49A 1O3IA 3M5NA 3FAOA 1GI2A 2FOBA 5BPEA 1LVMA 5T6DA 5AFYH 4CR5A 2ZC9H 1NRRH 1QIXB 3EYDA 4MQAA 3RDZA 1TNKA 3BTEE 1S6HA 4AORA 4YM9A 4NA8A 4BXWA 1OX1A 2JETC 3RM2H 5HXFA 2AIQA 1LQEA 2PTNA 2HLDD 2Z9JA 2NWNA 1EZUC 4BOHA 3TJVA 1QR3E 1J8AA 4JZ1A 1FIWA 3QLPH 1EAXA 5EQQA 2EQNA 1C4V2 1UHBB 3RXRA 3LGIA 3I29A 1GI3A 2WHXA 1F0TA 3CENA 1GGDB 1K22H 1TMUH 4NIVA 1EQ9A 3SI4H 1YM0A 2FOFA 1BA8B 1D3PB 1JWTA 2XCFA 2UUFB 2D2DA 2SGEE 4UONA 2A5IA 2QE7D 3TK9A 3BTWE 2QXHA 3RU4E 1V2LT 2G4UA 2IN2A 3MTYA 1RS0A 1C1WH 4HFPB 2Z3EA 1DWBH 2BM2A 1RTFB 2C93B 1CSOE 2O9QA 1P05A 1TQ0B 3P92A 3FOAA 3E90B 4Y11E 5DP8A 3RXJA 1O3JA 1V2QT 4SGBE 1J15A 2UUYA 1HJAC 2KM0A 1XVMA 1PYTD 3UWJH 3I77A 1SOTA 1OHHD 1AO5A 4YLUA 3SNBA 1BTYA 5T3HA 3LC3A 1T31A 1O36A 1ZHMA 1TGBA 1YPHE 1GDNA 1YCPM 1WOFA 3L33A 3EA7A 1VGCB 4O9VA 1GJ8B 1NN6A 1OOKB 1O39A 2AGIX 2QN5T 2W26A 2SGAA 1FMGA 1Z71A 4ABBA 1CGIE 3GICB 2XC5A 2A0QB 1MMJN 1J14A 1F92A 1K1IA 1TNHA 3GYLB 1ZPCA 1ELVA 3PRDA 1V6DA 2D8WA 1MTVA 1NM6A 5JBCS 4AG1A 1KDQA 3BSQA 4ZKOU 3QUMP 3LDXH 1ELAA 1FJSA 3A89A 3GY2A 6CHAC 3D23A 1ARCA 3SNCA 5E0HA 1LTOA 1BB0B 1LHCH 3D62A 1AZZA 2QXGA 5EIYA 3T5FH 3BIUH 1Z8RA 4NGAH 1E37B 1MQ5A 1AMHA 3P95A 4JCNA 5ABWA 2Q1JA 2FOMB 1QL7A 3M3TA 1DANH 1E1QD 4DOQA 3BTHE 1WQVH 4DGJA 1UK2A 2R2WU 1HUTH 1O35A 4HGCA 3RXVA 1DUAA 5CHAC 1W0KD 3MH5A 4M7GA 1GMDG 3O8CA 3JZ2B 2ZNKH 3ATMA 1GJDB 2OD3B 4LZ4B 3ODFA 4UE7H 1IQHA 3HPTB 1E36B 3RXSA 1DPOA 1TX6A 3H5CB 2BVRH 2GVFA 7GCHF 2Z94A 1TE0A 1NRSH 2H6MA 3BTTE 1BRUP 1DY8A 4FU9A 3G01A 2VBCA 3MU8A 4IMZA 4P00A 3SHCH 5TCAA 3O8BA 2OC1A 4YESB 5FPTA 1GPZA 3HGPA 5EODA 2BLOA 3M61U 2A7JA 5HGGA 2BXUH 2CN0H 2VWOA 4A5TS 4TYDA 5KGOA 2HGTH 1O37A 1YPGH 2JH5D 3U8OH 1TBRH 2KR7A 3AASA 2Q6DA 1GBBA 1TGSZ 1IQLA 1GVKB 4RN6A 1RXPA 1K1NA 2VINA 2ZHWH 1LQDB 3RC6A 1SLWB 1ANCA 4OS6A 4CHAC 3RM0H 2WPIS 1G32B 4D76A 1KLJH 5GJ4B 2AERH 5EQSA 4NFFA 4MPUA 3SV9A 1GHBF 1OPHB 3RMNH 1V2NT 1K1PA 1DXWA 4IW4E 1T8OA 1FZZA 2GT8A 1UTLM 1SGCA 4ABAA 4Q7XA 2XBXA 1C2HA 2BD8A 2BD3A 4TWWA 5A0AE 1OP2A 1EJMA 2BZAA 2PWXA 2H1UA 3FP7E 3MH4A 1SC8U 1C4Y2 4LXBH 5CHBA 1QURH 1IQGA 1GVLA 1QQ4A 2A7CA 3LC5A 4MPVA 3UB0A 3GY8A 1P09A 2C4FH 2P3FH 4X6PA 5DN6D 1UTKA 3OSYA 1GJBB 2BTCE 5C3NA 3OEED 4X1QU 2F91A 1MCVA 1LHGH 2FI4E 1A3BH 2WPDD 4BANB 1YCPH 4F4OC 1IHTH 3U8TH 1ZJDA 2CXVA 1ABIH 2O8LA 1GHYH 3ATLA 3T62A 1IQFA 2OC0A 4INHA 1EJNA 2XRCA 2OTVA 5C2ZA 1OYTH 4X6OA 1O5DH 1PFXC 1PQ7A 3PV2A 1S5SA 4AGJA 2RG3A 2BVSH 3ZVEA 3P8FA 1WTHD 1BHXB 2VIWA 3MH6A 1DICA 3GCNA 1C5YB 1ETRH 1P2NA 1OWDA 3PV5A 4AGKA 4JZDH 4DIIH 5F8ZA 1LVBA 5AF9H 3KQEA 1DM4B 1BMLA 3F9HA 1GHAF 1W7GH 4Z0KA 1W10U 1W3CA 2FM2A 2OCVB 1RJXB 3ENSB 3ZVDA 1P01A 1QBNA 2K0QA 1QGFA 1QJ7B 2LP6A 1A0LA 4M9FA 3RMLH 2GP9B 1QBOA 1LVYA 3QK1A 4XRNA 4TPIZ 2BQ7B 4ZROA 4K5ZA 1TPAE 4D7GA 3PV4A 2ANKH 1MKWH 2BDHA 1OWJA 2W6JD 1G30B 2C8WB 3SU5A 2PTCE 2OBQA 1DUEA 3GDSA 1C2IA 1FAXA 1ID5H 3KIDU 3RU4T 4J2YB 2GCTC 1C1RA 1SSXA 3QGNB 3KYGA 2P94A 1IQJA 1OKXA 1YPLH 1UTQA 5FX6A 3ZZ5A 2B5TB 5DSFA 3SNAA 1O5AB 1NFXA 3MYWA 2F9VA 3LGVA 4UD9H 2BDCA 1ZZZA 2J94A 3DFJA 1THPB 3GYMA 3RC5A 2ASUB 3MU1A 4FUEA 1FY3A 2J9NA 5CE1A 2H2ZA 1VITF 2PP6A 2RCEA 3ZZ4A 4NG9H 1CA0B 1HJAB 1GVZA 1LKBA 4AN7A 2V3HH 3Q77A 1KXDA 3K2UA 4MNVA 2VIPA 2ZWLH 3CNRA 1SGEE 3EA9A 2SFAA 1EPTC 1WUNH 3DD2H 3CP7A 1ELDE 5EXMA 1P2JA 2RFKC 3UR9A 2BD2A 4A1TA 1XUHA 1DVAH 1RRKA 1E1RD 2PFEA 3I78A 2QY0B 2P59A 1GCDA 3MHWU 3EGKH 4U30A 1V2VT 2CF8H 5LPFA 2ZHFH 3S9BA 2QCYA 2Z9KA 3EQ0H 1TOMH 5C1YA 2OBOA 4CH8B 5FCRA 3GCTF 3ZVCA 4YOIA 1YCPK 4ESTE 6LPRA 2P95A 3SV8A 2HVXA 1O2KA 2BZ6H 1LCYA 3BTFE 1NC6A 3FZDA 1KMHB 4X1PU 1E38B 1H8ED 1THRH 3ZZCA 2IPHA 1DX5M 3GY7A 1IQMA 2Y81A 5FCKA 4ACBA 3TIUA 1B7XB 2B9LA 1N6YA 3N7OA 1O2VA 4Q4LA 4OS2A 5F8TA 4I33A 1CHGA 1HRTH 4YZUA 4U32A 5GPIB 1O3FA 3WWBA 1OWEA 1MBQA 3TGIE 3QWCH 1F5RA 3F2FA 4GAWA 1EUFA 2HNTC 1P03A 1DLEA 5T1VA 1P11E 3SJKA 3STIA 3DHKH 4B2CA 1QB1A 5CHAB 2FEQH 3RXQA 1Q31A 3PLKA 3OY5U 2F43B 2LPRA 1O3PB 1P2OA 3U1JB 1P02A 1HYLA 1O3DA 5FPSA 1O2IA 1BTPA 1Y5AT 1EXFA 1UVTH 1Y3WA 2QF0A 2ZDKA 1O3CA 3BV9B 2V35A 5JB9S 1C4U2 1C5VA 3PTBA 1BJVA 5EU8A 3ITIA 4YTAA 2ZZUH 5G4BA 1D9IA 1PPFE 1UVSH 2C8YB 3T28A 2XBYA 2ZECA 1A5HA 3U98H 1GDQA 4NSVA 3P6ZB 3MH7A 1GBHA 1G9IE 1GBEA 1QNJA 2F4LA 1GHXH 1P2MA 1C1VH 1C2JA 1DLKB 3TNSA 2Y5HA 3ZIAD 1ELGA 2A1DB 3M5MA 5CMXH 4CRGA 2C90B 2TGDA 2HRVA 3LGTA 5A2MH 1O0DH 1V2KT 1RFNA 4P02A 2QAAA 4NA9H 1AE5A 1GMCG 4OGXA 3RXMA 3E8LA 4BTIB 3EE7A 4NIYA 1EAIA 1C5WB 3SU4A 4CHAB 4FUCA 3HKJB 1ZSKA 1WQSA 1CBWC 1GBDA 4ZKRU 4B74A 4DCDA 1AWFH 3KEEA 4I8JA 3VEQB 2Q6GA 4D9RA 3UFAA 3ODDA 1PPGE 3SO3A 1AQ7A 3A85A 1TBQH 7KMEH 1UMAH 1Z7KA 4CRFA 5K0HA 1P2KA 1EPTA 1S83A 1BT7A 4K2YA 1H8HD 1TLDA 1TMTH 4F55A 4X1NU 4K8BA 1GWAA 5JDUB 2A32A 4FUJA 5E8EH 1SGYE 4X2WA 2ODYB 1HNEE 2TGPZ 2OLGA 2W5EA 4PROA 2W7UA 2AYWA 2ZO3H 1QCPA 4FUIA 3ZVGA 4E7RG 2G81E 3FP6E 3DSOA 1GI5A 1TIOA 2BLVA 5JYIA 1BBRE 2ZFFH 2WSSD 3MU0A 1E79D 4BXSA 4Y8ZA 1GDUA 4AYVB 3P8OA 4XOJA 3DSPA 4IC5A 1E34B 1A0JA 4ISOA 1Y59T 4X2VA 4INKA 2A31A 4AB9A 1FI8A 3AW0A 2YNBA 1P9UA 1S82A 2BVXH 1O5FH 3LKWA 3ZZ9A 3RMMH 1EB2A 4A1XA 4ZMAH 2O8MA 3IG6B 1P06A 1GCTC 3ZV8A 5A8XA 5CDFE 3NUMA 4KTCA 4ZHAA 1S6LA 2WUBA 1V2TT 2F83A 2BQWB 9ESTA 3VB6A 1TALA 1N8OC 1MAXA 1O2NA 3IWMA 1MU8B 3ZZBA 1TFXA 2HPQH 1ORFA 5C0UA 1KTTB 2CV3A 1PYTC 1W0JD 2FXRA 1F2SE 4ZHLU 5GXPA 2PW8H 1P8VC 1MCTA 4Y0YE 1FY8E 1A7SA 4OS7A 3RXEA 4B73A 2EI8A 1AKSA 3PYHA 2SGDE 2AHME 4ZKSU 2FWWA 1GL0E 3RC4A 1MTUA 5A0BA 2P93A 1LHEH 3GCHB 1BBRH 3UTUH 1LVOA 4ASHA 2Y7ZA 4RKOB 1DSTA 1F0SA 4Q80A 1QQUA 4J1YA 1AFQB 4X6NA 1HAVB 5FPYA 1BHXF 2ZCKP 1KXEA 3ZZAA 1NROH 2GCTB 3D49H 3HATH 1RIWB 1C5SA 1UO6A 1LKAA 3KF2A 1AB9C 4B71A 3GISB 3E3TA 3KGPA 3A8AA 3A7VA 4YT7H 1DS2E 1UVPA 2FS9A 2ZCLP 3U9AH 2AGEX 2ZU3A 4YOJA 5DG6A 1IHSH 2ANWA 1GMHF 2R2MB 3SUGA 3PWCA 2Y5FA 3BEIB 3QZRA 1VCPA 1SGDE 1TRMA 5T6GA 3LH1A 2PV9B 1QA0A 2NU0E 1HAPH 3RXUA 3PO1B 1UVOA 2TRMA 4Y7BA 3V0XA 4FUGA 2DUCA 3A87A 2XNIA 2YMSB 1KXAA 1GJ9B 1OWKA 2R9PA 1EAWA 1GJAB 4RI0A 2WZQA 1QA7A 1QJ1B 1EPTB 1F0UA 2EY4C 2QIQA 3FP8E 1A1RA 1WDIA 1KSNA 3KNXA 3E0NB 2WPHS 4YLQH 3HGNA 3KCGH 3RLWH 2FPZA 2OP9A 3AW1A 2KCAA 3MO9A 5A0CA 3LGWA 1GHWH 5FBIA 1EZXC 1VR1H 4FUHA 1NRNH 1ZLRA 2G00A 2O8WA 4JK5A 4I31A 2IPQX 4MVNA 3E6PH 3P17H 3RLYH 4BTUB 1GG6B 4I8HA 4YOGA 3UQVA 4JZIA 1EKBB 4MG3A 2VNTA 1VKYA 3VXFH 2BD7A 4WXIA 2VGCC 2GV6A 1EZQA 1K21H 2WPLS 3RUOA 5C5NA 1O3GA 1QB6A 2G55A 2M2AA 1O3KA 2GDEH 5AFZH 2Y6TA 1ZMLA 1NO9H 2OC7A 3VFEA 4DVAU 2XNDD 2GMTC 5DGJA 2PKSB 3A83A 1G3CA 2GV7A 1K0HA 1XMNB 3UAIC 1CT0E 4DURA 1A5IA 2UWLA 3TVJB 2BY7X 1X7AC 3BEUA 4CRCA 1SB1H 1O2XA 2ZU4A 4UEHH 3Q3XA 5DP6A 3E1XB 4HI3A 1C2LA 2G51A 1QY6A 4JZFH 2VH0A 4H6SB 1JRTA 1NRPH 3ZZ8A 1S6FA 3MO3A 1K1OA 4D9QA 4HG6A 1C9PA 1ZMJA 2KAIA 4ABIA 4Y10E 1V2WT 1XX9A 3H7TA 2BX4A 2H5CA 1K1MA 1JMOH 4K69A 4DIHH 1P12E 1SFIA 1O5BB 3NRLA 2ZHEH 2KCPA 5HMAA 1L4DA 1TYNA 4AZ2B 5EQRA 2DE9A 3QTOH 4IN1A 1F5LA 1VZQH 3MO6A 1ZGIA 1BBRK 3UPEA 1G36A 1BTZA 1V3XA 4GPGA 3QN7A 3L6PA 3MNSA 4K1TA 4A6LA 1HFDA 2TPIZ 3B23B 3W95A 4H42U 3VG8A 2AGGX 2OQUA 7GCHG 1JOUB 1XUKA 1ZJKA 3F68H 1Y3VA 2RDLA 2ZDLA 3M7QA 1W7XH 1EOLA 1Q2WA 1P57B 2O8TA 2Y5GA 2ZQ1A 1XVOA 4MTBA 5C0TA 3GY6A 3LGYA 3SZEA 3MOCA 2AH4X 1O2PA 1O38A 4Q2KA 2BY5X 4DT7B 1V2RT 1FIZA 3OY6U 2XBWA 3GY5A 4JYTA 5IDKA 2D1JA 1GBMA 4WMEA 1ACBE 5HYOA 3BN9A 2G52A 4B6EA 1AWHB 2FZZA 1Y5UT 2QYIA 1FQ3A 1GBKA 1ZOMA 2A5KA 4WJG2 5FAHA 1SQAA 4VGCC 1MTNC 2FX6A 1MTSA 2ODQA 1UTMA 4MDSA 3LGUA 2BHGA 4FOUC 2W3KA 3NCLA 1JBUH 1O2LA 3PMAB 3QDZB 1M9UA 4X8VH 1H8IH 1K2I1 1Y3XA 1TGNA 4XDEA 2B7DH 1AI8H 5TCCA 3SUFA 4E06H 1GHBG 5JBAS 2B8OH 1C2KA 3A7ZA 5C17A 1O2WA 1J9CH 3TK6A 1AZ8A 3DCLA 4IC6A 1SVPA 2FP7B 3T2NA 2J98A 3SV7A 1NRQH 1BTWA 3LIWA 4ZXYH 3QX5H 2FI5E 2WYJA 4I8KA 2H9TH 3M3VA 1KDQB 2WPKS 4Y7AA 1O2RA 2F9PA 1O2ZA 1NBMD 1SOZA 3MU4A 3H7OA 2BD9A 2ULLA 1BMFD 1CO7E 3VB5A 1HJ9A 2G8TA 1QHRB 3LU9B 4INLA 1P3EA 1SGQE 1GCTB 2VIVA 2ZF0H 4O03A 2GZ9A 1SGIB 1HAOH 5C94A 2NU2E 5TJXA 1TPOA 3NK8A 4Y6DA 2BMGB 2V7QD 5IYTA 1N8OB 1O33A 1Q3XA 2ZDMA 3UIRA 3CS0A 1PJPA 1TOCB 3A8DA 3GCOA 3ZVBA 3R0FA 1LPZB 4ZH8A 3HK3B 1EATA 4B2BA 1BRCE 3SU6A 1UTNA 9LPRA 4MNXA 2YOLA 2XXLA 3GY4A 4K60A 1D3TB 3F9FA 1G3DA 1V2MT 5L6NH 2ZKSA 1EP6A 1P0SH 1SGTA 2GT7A 2Z6BD 4YXWD 1J16A 1YP9A 1O2SA 2CMYA 3NXPA 1BMMH 1O30A 4O97A 1NFWA 2JETB 3PMHB 1AD8H 1HGTH 2GZ7A 4CH2B 1GHAG 2STAE 1O3HA 4WH8A 1EB1H 1L1JA 2TIOA 3SUEA 4B6FA 4WF8A 3DSGA 1GBFA 1MD8A 2V6NA 1C1UH 1S84A 2FOHA 2ZGHA 3E0PB 4NSYA 4XBBA 3C1KA 3U28C 1FLEE 1KY9A 5F8XA 2AMQA 1OP8A 3N99A 2ZGJA 2EA3A 1E35B 1QL8A 1S85A 1Z8GA 1SR5C 3U8RH 4Q7ZA 3M3SA 1YPHC 2H9EH 1FY1A 1Y3UA 2W3IA 1T8MA 1T8LA 2PKAA 4FUDA 3OTJE 2GJGA 2ZTZA 1HJ8A 1YPJH 4Y8XA 1WCZA 1K1JA 2JH0D 6GCHF 2FYRA 4GCHF 1EFRD 2VWMA 2CGAA 1EOJA 1GGDC 2FO9A 4WMFA 1O5CB 2ZDAH 1HAHH 2FDAA 2J4IA 3A7WA 4NCYA 2UWPA 3S9AA 3A8BA 1ZPBA 3ZYEA 1PPCE 2WV5A 1Z1IA 4XFQA 1ZSJA 4JK6A 1EAUA 4WH6A 5EPYA 3FZZA 3SI3H 1WU1A 4X2XA 3EDXB 2ESTE 3ZVAA 2XC0A 2C8XB 1IQIA 1VITG 2V3MA 3SQEE 3EA8A 4ABHA 1S81A 2Y7XA 2BDYA 2ZDVH 3RU4D 3DUXH 3RXKA 1FY4A 3BG8A 1TX8A 2R0LA 2ZIQH 5PTPA 2AMDA 2FOCA 2A2XH 1GBJA 1YPKH 2V0BA 3N7DA 4X8TH 1SGNE 4R0IA 1JIMA 1G2MA 4AC9A 4WMDA 2J98B 1TPPA 2QF3A 1TNIA 3DA9B 3BTME 3OTPA 2FTLE 4RKJB 2SNVA 2VGCB 3SN8A 2ZFSA 3ZZ6A 2KZ4A 4B76A 6CHAB 2P3TB 3BTGE 2FIRH 1ARBA 1C2GA 1C1QA 3AVZA 2A2QH 1WAYB 1QTFA 2BDGA 2J92A 1O34A 5GCHF 4GVUA 3KQBA 2J38A 5EW2H 1KXCA 3GCTG 3SW2B 1TPSA 2VIQA 4BNRA 2ALPA 5EGMA 1TB6H 2A7HA 1AU8A 1KYNA 1QRWA 3VGCC 2GKVE 2ZDNA 4FVDA 3URDA 5EJ1A 2FS8A 4ZUHA 3MWIU 3NZIA 5FX5A 1UK3A 1H9IE 1ZR0A 1YWUA 1G2LA 1MKXH 3SGAE 4Y71A 1ZMNA 1RD3B 2VIOA 5IK2D 2FOEA 3F2HA 1OP0A 3K6YA 3TITA 4UFEH 1FUJA 2P3UB 2BDAA 1O2JA 1W13U 1AY6H 3AAUA 1OS8A 2L74A 3RXHA 4GSOA 1ZYOA 2EC9H 3U69H 2ZTYA 4IBLH 2YMSD 3V7TA 1O2HA 2JDID 1CGHA 1DT2A 3PRBA 1ELFA 1MKWK 3RXOA 4ABFA 4AFSA 3KQDA 1CA8B 3B9FH 1IQKA 1DWCH 4AFQA 1C5ZB 1A61H 2QGRA 3SNDA 4Y8YA 1P2IA 3RP2A 1D3DB 2IJD1 3C27B 1EP5A 4NA7A 1C5PA 4AFZA 3UNRA 1DE7H 2GCHG 3SJ9A 1XUFA 3RXAA 3AAVA 2ZFRH 4IN2A 1C5RA 3A80A 4X1RU 1P2QA 3GOVB 4LOYH 4TSFD 2F9NA 3PMBB 4LK4A 1C5QA 4HTCH 1AGJA 3SU1A 2Z9IA 2WV9A 4OGYA 4JZEH 1UHBA 1C1PA 4AX9H 1V2PT 4A92A 2ZFPH 1TNGA 2EI6A 4NFEA 2I6QA 2BXTH 3SQHE 2HVYB 1MTNB 1AHTH 3OX7U 1W11U 1GBTA 3UNQA 3MMGA 1L0ZA 2ZGCA 4NZQA 1BQYA 4I7YH 3PM3A 2HPPH 1GI6A 3RXDA 1HAYB 2BX3A 1W8BH 4I32A 1SQTA 5I46H 1C2MA 3TH4H 3M5LA 2AFQB 8GCHF 1GBCA 1UCYE 2L6OA 1GBAA 5J4SA 4OS5A 2UUJB 4ISLA 3OU0A 4X8UH 1WSSH 3TNTA 1ETSH 4Q7YA 4WY3A 1P3CA 1BRAA 5EPNA 1GI8B 1GJ6A 3QGJA 3SU2A 1UW7A 2OINA 4SGAE 5L2YH 1CHOF 1DY9A 2BY6X 1XXFA 4U01A 5AHGH 3Q3KA 3D65E 2F3CE 3ZVFA 2BD5A 4NIWA 3QTVH 2PR3A 3P70B 2Q6FA 1SGRE 2QV1A 5L2ZH 5HIZA 2H5DA 5A8YA 3EE0B 4NIXA 3A7YA 1Z1JA 2BY9X 1BUIA 1C5MD 1ELBA 1C2DA 1D3QB 1DWDH 1SL3A 1O3AA 1Z8JB 1UK4A 4AG2A 3W94A 4MLFB 8KME2 1MTWA 1SLUB 4GUXA 1AIXH 1AE8H 1MD7A 3NKKA 1SGFA 1MU6B 1H8DH 3LJJA 4TT3D 1FN6A 2SNWA 1EASA 3ELAH 3S0NA 2ANMH 2VH6A 5GWZA 1C5LH 3TH3H 4H4FA 2AS9A 1PQ5A 1MKXK 2ZFQH 3T26A 2XW9A 1UCYH 4TY7A 2SGPE 1ELCA 4IMQA 1O3BA 1NTPA 1P10A 2BB4A 1UVUH 3A84A 1H1BA 1XKAC 2ZGXH 2G5VA 3M5OA 2BQ6B 3BEFB 4ISNA 1V2JT 4IGDA 1KLTA 1BIOA 1Z6JH 1K28D 1O2GH 3V12A 2Z3DA 1C2FA 1O2QA 2THFB 1BOQA 3M7TA 1GI1A 1V2OT 1C1OA 3CS7A 1HAIH 2A4OA 3SZNA 2TGAA 1HAXB 4CREA 4QT8C 1CU1A 2WINI 1GJ4H 3KN2A 2JJ2D 1O32A 1C1NA 3GY3A 1DFPA 5EJZA 2HOBA 2XYAA 3FVFB 3ATWA 1UTJA 1BMAA 2SGFE 2OXSA 5AVDA 2EI7A 5HKKD 2KCYA 3QZQA 3M37A 4KP0A 5EXLA 1ANBA 2LELA 3Q00A 4UFFH 1JXPA 1SQRA 1SKYE 3TJOA 1FX0B 2GX4A 3W1EA 1D4PB 3S69A 3MNBA 3A8CA 4ZKNU 2XCNA 2OUAA 1DDJA 1YLCA 2QXIA 3PMJA 1B0EA 4WVPE 3T29A 5DO4H 5LPRA 3K65B 3S7HB 4KTUA 3UQOA 1SBWA 2KX4A 5E2OA 1AVWA 1T7CA 2ZG0H 2NU1E 1C5NH 1L2EA 4RSPA 1E0FD 3SOSA 2F9BH 4B2AA 2FMJA 1GMHG 1BRBE 1FV9A 4X1SU
chains in the Genus database with same CATH topology
2VWLA 1KLIH 1H4WA 4I8LA 1Z8IB 1TNJA 2ZEBA 5HM9A 1SLXB 4FUBA 2G5NA 1CA0C 1ESTA 1O3LA 1CT4E 2Y80A 1Y8TA 3UY9A 1GBIA 3UUZA 2ZP0H 4ZHMU 1OWIA 1FPHH 1ESAA 4TY6A 4DJZB 2VVUA 5SGAE 5K7RA 2V3OH 2FOAA 2CJIA 2FLBH 1HV7A 1TRNA 1BTUA 5JBBS 3SGQE 1NESE 5C5OA 4A7IB 1A46H 2ZHQH 3BF6H 4MPWA 2ZCHP 1WV7H 4WXVA 8LPRA 1AFEH 1BTHH 1RTKA 3M35A 5E0GA 1TAWA 1S0RA 1C5UA 4BAHB 2HALA 4KKDA 1INCA 3TK5A 1ZTLA 5DP4A 3VGCB 2SGQE 3MI4A 4X8SH 1EX3A 2ZHDA 1HXEH 3F6UH 3HK6B 5F6MA 5EG4A 1F5KU 1ZTJA 3GDVA 1TA6A 1Y3YA 1GMDF 2CHAC 1N6XA 3RXFA 2F9OA 1QB9A 3EAJA 1O5EH 1RGQA 3JZ1B 1VITH 3TH2H 1UCYK 1O2MA 1LPGB 1TBZH 3MNCA 4JYVH 2ZI2H 1G3BA 1AKSB 3SU3A 5JPMH 1FAKH 1K9OE 1GI4A 1CT2E 4K8YA 4NWKA 1HB0B 1W14U 3LJOA 3RXGA 5A09A 1ETTH 4DG4A 3K6ZA 3SV2H 2ZPRA 5HM2A 2BDIA 2EEKA 2ZA5A 2D26C 3ZZ3A 1C5XB 1SHHB 2VIDA 2ZPSA 3LONA 3ESTA 3TLOA 2FX4A 2GDDA 1O3MA 4NZLA 5C1UA 3WY8A 2FODA 1HLTH 1P04A 4U2WA 1NFUA 4ZXXH 3BG4C 2STBE 5A8ZA 1H9HE 2QA9E 5FXLA 4XE4A 1UJ1A 1HBTH 1LO6A 1ZTKA 3VXEH 1TA2A 2HNTE 2PLXA 1MAYA 1MUEB 1JRSA 2NU4E 3STJA 2UWOA 1LMWB 1W0YH 2Z7FE 3KHVA 4GHQA 2IOTA 3SJ8A 3PLBA 1PPEE 1TGCA 3BTQE 2P8OC 2XC4A 1CBWB 1BTXA 1NU9A 3SBKA 1C5TA 1PPBH 4X0WU 5DKMA 1A0HB 1IAUA 1C5OH 1PPHE 1SQOA 2PSYA 4X6MA 3RMOH 5EW1H 1NU7B 1FNIA 3KL6A 3T25A 1FDPA 1MZAA 3SGBE 3DFLA 2R3UA 2F9UA 3VPKA 5BRRE 2AMPA 4ISIH 3UOUA 2JH6D 2A5AA 2Y82A 1J17T 2Z3CA 1DWEH 4X2YA 4LZ1H 3M7UA 3P8GA 1O2UA 1GHZA 1V2UT 2J2UA 3OYPA 1SFQB 4FU8A 4AB8A 1C9TA 1NY22 1TABE 1LHFH 2GD4B 2PSXA 2P16A 2Z9LA 3K9XB 2ZFTA 1DOJA 4R8TB 2PUXB 5EOKA 1OSSA 2BYAX 5DP7A 1VJAU 4K3JA 4MPXA 3KQCA 2BLQA 1C1SA 1EJAA 4BAKB 3BTKE 1G3EA 5FHTA 4KELA 1V2ST 3ZZDA 1SG8B 3A88A 2WUCA 6ESTA 3UOPA 4ABEA 3E16B 1NT1A 3QO6A 4Y79A 2BOKA 1CVWH 3A82A 5ETXA 1GI0A 3LOXA 1FN8A 5E2PA 4XBDA 5DPAA 1GL1A 1ELTA 5LGOA 2VB0A 2HWLB 1O3EA 1ANEA 3VB3A 1O3NA 1A5GH 4MNWA 4Y76A 2KAIB 3V3MA 1DITH 2WPJS 1YC0A 1F7ZA 2ILNA 2BY8X 3GDUA 5LH8A 4A1VA 2FI3E 1L4ZA 3L3TA 4OS4A 3TJNA 1YPMH 1MQ6A 3SUDA 1MH0A 2RA0A 2RA3A 1W2KH 2Z9GA 3M36A 1TX7A 4CBOA 2XTTB 3RXPA 4AYYB 1D6WA 1ZSLA 4ABJA 3Q3YA 4GHTA 2ALVA 1HAZB 4FU7A 1UTPA 4TPYA 4K1EA 3O8DA 1ESBA 1RTLA 3LH3A 1BZXE 1NZQH 3T27A 1O5GH 3FANA 1BMNH 2VJ1A 1QBVH 3MNXA 1T8NA 2PGQB 1CGJE 3A7XA 2XBVA 2K1QA 1U6QA 3ZZ7A 1AB9B 3GCHC 2GGVB 1BCUH 2NU3E 1QRZA 3ZV9A 1SPJA 1WTGH 3ZYDA 3PTNA 2G4TA 4KGAA 1AFQC 3P8NA 5GDSH 1HXFH 1OYQA 1DXPA 1NS3A 2TGTA 2FTMA 1HIAA 3O8RA 1KXFA 4WWYA 3E91A 1YLDA 3UNSA 3TU7H 1LHDH 1RIWC 1XKBC 4TWYA 4E05H 3NWUA 4CR9A 1JIRA 2OC8A 1AVGH 4CRAA 5C1XA 2C8ZB 3RXTA 1YGCH 2WYGA 5FBEA 5B6OA 1CQQA 2R0KA 1F0RA 4BAQB 1H9LB 2J95A 1B5GH 5ESBA 6GCHG 4I8GA 1IQEA 3A7TA 4GCHG 1O31A 2HLCA 2ZPQA 4XBCA 2B0FA 4UDWH 2FLRH 3PO1C 3A86A 3TJUA 3R3GB 4BAMB 4JMYA 1AUTC 1FONA 4FUFA 1NPMA 5DJ7A 2UUKB 2R3YA 4ABGA 3SORA 3UREA 1VGCC 3FFGA 1N1LA 1AN1E 4MNYA 2WPMS 4IS5A 2FYQA 2GMTB 3B8JA 2XWAA 3LPRA 1FY5A 5C67A 2BDBA 2ZU5A 1O3OA 2ANYA 2BLWA 1GG6C 5GIBA 2JKHA 3SHAH 8ESTE 1B0FA 3RXCA 1ZPZA 1ZHPA 4YT6H 2AIPA 1GJCB 3MFJA 4DY7B 1ZGVA 4Y0ZE 5DP9A 4AOQA 5ESTE 1QRXA 5GCHG 2PKSC 1KTSB 1ANDA 1PQAA 4BTTB 2QXJA 4D7FA 4E7NA 1PPZA 2CHAB 5JBTA 2VVVA 4O3TA 1BITA 2M5TA 3SJIA 3HKIB 1HDTH 4B1TA 4ABDA 3DT0H 3Q76A 3SNEA 5L30H 3F9GA 1AUJA 4FXGH 1XUGA 1W12U 2O8UA 1CE5A 2A4RA 1SI5H 1SLVB 5T6FA 3A81A 2GTBA 5EXNA 4OS1A 4B75A 2A4QA 3F1SB 1HCGA 2LNCA 2FOGA 1XXDA 2VU8E 4JYUH 3S9CA 7ESTE 2J34A 1T4UH 1XUJA 2GZ8A 5LPEA 1LPKB 1D6RA 1HAGE 1WYKA 1A2CH 3BG4B 1SMFE 1TRYA 2HNTF 2GCHF 4FVBA 1SGFG 3F9EA 5F03A 1G37A 3ATKA 2BOHB 1QL9A 1GMCF 3S7KB 2CF9H 2PKAB 1FXYA 1BDAA 4XSKU 4HZHA 1ZRKA 1HAVA 1O2TA 1HPGA 1MBMA 1HIAB 1XM1A 1L1GA 1O2YA 2P8OB 4KTSA 1P9SA 1THSH 4AFUA 1W0ZU 3SV6A 1GI7B 4VGCB 1KIGH 1TNLA 1QFKH 2PHBA 1YKTA 3PLPA 1DSUA 1EZSC 1C1MA 1LDTT 1VCQA 2I6SA 3UR6A 1A4WH 1A3EH 3MU5A 1VJ9U 1TQ7B 4NWLA 2DE8A 3PWBA 2W7SA 3SU0A 3PROA 1Y5BT 4ISHH 4DW2U 1TMBH 4GLYA 2OQ5A 3UWIA 2H9HA 4H6TA 1GJ7B 1MZDA 3SJOA 2AEIH 5J4QA 1O2OA 1TONA 1YPEH 2BD4A 3IITA 1SHYA 4ZAEA 3V13A 1FPCH 1ABJH 3LT3A 2ZQ2A 4THNH 5DK1A 3VB7A 3RXLA 1QJ6B 2ODPA 2A4GA 2ZU2A 1NFYA 1XUIA 4CRBA 5DP5A 4CRDA 8GCHG 4K1SA 2FESH 2ZGBH 3NPSA 4O3UA 2PUQH 1WBGB 1T32A 1VCWA 2XWBI 2ZTXA 2VWNA 4YO9A 1CHOG 3RXIA 1OWHA 5DP3A 2TBSA 1ELEE 3ATIA 3PB1E 3BTDE 1BJUA 1YF4A 1ZHRA 1UTOA 5I25A 1PQ8A 2VVCA 1ZRBA 4Z6AH 1TGTA 1IQNA 5C20A 4D8NA 1TWXB 7LPRA 1YYY1 1SGPE 1T4VH 1AVXA 1GI9B 1Z6EA 5JB8S 1C1TA 2ZU1A 2YNAA 3TGKE 4CBNA 1GBLA 1IOEA 3VB4A 1OXGA 4UFGH 2A45B 2C3SA 2PGBB 5H4IB 3URCA 1YBWA 5E0JA 3TGJE 1KXBA 2QC2A 3TPIZ 3BIVH 1GJ5H 1L1NA 3U1IB 2WV4A 1C2EA 1S0QA 4BAOB 2IJOB 1K1LA 4UFDH 3RXBA 1GHVH 4F49A 1O3IA 3M5NA 3FAOA 1GI2A 2FOBA 5BPEA 1LVMA 5T6DA 5AFYH 4CR5A 2ZC9H 1NRRH 1QIXB 3EYDA 4MQAA 3RDZA 1TNKA 3BTEE 1S6HA 4AORA 4YM9A 4NA8A 4BXWA 1OX1A 2JETC 3RM2H 5HXFA 2AIQA 1LQEA 2PTNA 2Z9JA 2NWNA 1EZUC 4BOHA 3TJVA 1QR3E 1J8AA 4JZ1A 1FIWA 3QLPH 1EAXA 5EQQA 1C4V2 1UHBB 3RXRA 3LGIA 3I29A 1GI3A 1F0TA 3CENA 1GGDB 1K22H 1TMUH 4NIVA 1EQ9A 3SI4H 1YM0A 2FOFA 1BA8B 1D3PB 1JWTA 2XCFA 2UUFB 2D2DA 2SGEE 4UONA 2A5IA 3TK9A 3BTWE 2QXHA 3RU4E 1V2LT 2G4UA 2IN2A 3MTYA 1RS0A 1C1WH 4HFPB 2Z3EA 1DWBH 2BM2A 1RTFB 2C93B 1CSOE 2O9QA 1P05A 1TQ0B 3P92A 3E90B 4Y11E 5DP8A 3RXJA 1O3JA 1V2QT 4SGBE 1J15A 2UUYA 1HJAC 1XVMA 1PYTD 3UWJH 3I77A 1SOTA 4YLUA 1AO5A 3SNBA 1BTYA 5T3HA 3LC3A 1T31A 1O36A 1ZHMA 1TGBA 1YPHE 1GDNA 1YCPM 1WOFA 3L33A 3EA7A 1VGCB 4O9VA 1GJ8B 1NN6A 1OOKB 1O39A 2AGIX 2QN5T 2W26A 2SGAA 1FMGA 1Z71A 4ABBA 1CGIE 3GICB 2XC5A 2A0QB 1MMJN 1J14A 1F92A 1K1IA 1TNHA 3GYLB 1ZPCA 1ELVA 1V6DA 2D8WA 1MTVA 1NM6A 5JBCS 4AG1A 1KDQA 3BSQA 4ZKOU 3QUMP 3LDXH 1ELAA 1FJSA 3A89A 3GY2A 6CHAC 3D23A 1ARCA 3SNCA 5E0HA 1LTOA 1BB0B 1LHCH 3D62A 1AZZA 2QXGA 3T5FH 3BIUH 1Z8RA 4NGAH 1E37B 1MQ5A 1AMHA 3P95A 4JCNA 5ABWA 2Q1JA 2FOMB 1QL7A 3M3TA 1DANH 4DOQA 3BTHE 1WQVH 4DGJA 1UK2A 2R2WU 1HUTH 1O35A 4HGCA 3RXVA 1DUAA 5CHAC 3MH5A 4M7GA 1GMDG 3O8CA 3JZ2B 2ZNKH 3ATMA 1GJDB 2OD3B 4LZ4B 3ODFA 4UE7H 1IQHA 3HPTB 1E36B 3RXSA 1DPOA 1TX6A 3H5CB 2BVRH 2GVFA 7GCHF 2Z94A 1TE0A 1NRSH 2H6MA 3BTTE 1BRUP 1DY8A 4FU9A 3G01A 3MU8A 4IMZA 3SHCH 5TCAA 3O8BA 2OC1A 4YESB 5FPTA 1GPZA 3HGPA 5EODA 2BLOA 3M61U 2A7JA 5HGGA 2BXUH 2CN0H 2VWOA 4A5TS 4TYDA 2HGTH 1O37A 1YPGH 2JH5D 3U8OH 1TBRH 3AASA 2Q6DA 1GBBA 1TGSZ 1IQLA 1GVKB 4RN6A 1RXPA 1K1NA 2VINA 2ZHWH 1LQDB 3RC6A 1SLWB 1ANCA 4OS6A 4CHAC 3RM0H 2WPIS 1G32B 4D76A 1KLJH 5GJ4B 2AERH 5EQSA 4NFFA 4MPUA 3SV9A 1GHBF 1OPHB 3RMNH 1V2NT 1K1PA 1DXWA 4IW4E 1T8OA 1FZZA 2GT8A 1UTLM 1SGCA 4ABAA 4Q7XA 2XBXA 1C2HA 2BD8A 2BD3A 4TWWA 5A0AE 1OP2A 1EJMA 2BZAA 2PWXA 2H1UA 3FP7E 3MH4A 1SC8U 1C4Y2 4LXBH 1QURH 1IQGA 1GVLA 1QQ4A 2A7CA 3LC5A 4MPVA 3GY8A 1P09A 2C4FH 2P3FH 4X6PA 1UTKA 3OSYA 1GJBB 2BTCE 5C3NA 4X1QU 2F91A 1MCVA 1LHGH 2FI4E 1A3BH 4BANB 1YCPH 4F4OC 1IHTH 3U8TH 1ZJDA 2CXVA 1ABIH 2O8LA 1GHYH 3ATLA 3T62A 1IQFA 2OC0A 4INHA 1EJNA 2XRCA 2OTVA 5C2ZA 1OYTH 4X6OA 1O5DH 1PFXC 1PQ7A 1S5SA 4AGJA 2RG3A 2BVSH 3ZVEA 3P8FA 1WTHD 1BHXB 2VIWA 3MH6A 1DICA 3GCNA 1C5YB 1ETRH 1P2NA 1OWDA 4AGKA 4JZDH 4DIIH 5F8ZA 1LVBA 5AF9H 3KQEA 1DM4B 1BMLA 3F9HA 1GHAF 1W7GH 4Z0KA 1W10U 1W3CA 2FM2A 2OCVB 1RJXB 3ENSB 3ZVDA 1P01A 1QBNA 1QGFA 1QJ7B 1A0LA 3RMLH 2GP9B 1QBOA 1LVYA 3QK1A 4TPIZ 2BQ7B 4ZROA 4K5ZA 1TPAE 4D7GA 3PV4A 2ANKH 1MKWH 2BDHA 1OWJA 1G30B 2C8WB 3SU5A 2PTCE 2OBQA 1DUEA 3GDSA 1C2IA 1FAXA 1ID5H 3KIDU 3RU4T 4J2YB 2GCTC 1C1RA 1SSXA 3QGNB 2P94A 1IQJA 1OKXA 1YPLH 1UTQA 5FX6A 3ZZ5A 2B5TB 3SNAA 1O5AB 1NFXA 3MYWA 2F9VA 3LGVA 4UD9H 2BDCA 1ZZZA 2J94A 3DFJA 1THPB 3GYMA 3RC5A 2ASUB 3MU1A 4FUEA 1FY3A 2J9NA 5CE1A 2H2ZA 1VITF 2RCEA 3ZZ4A 4NG9H 1CA0B 1HJAB 1GVZA 1LKBA 4AN7A 2V3HH 3Q77A 1KXDA 3K2UA 4MNVA 2VIPA 2ZWLH 3EA9A 1SGEE 2SFAA 1EPTC 1WUNH 3DD2H 3CP7A 1ELDE 5EXMA 1P2JA 3UR9A 2BD2A 4A1TA 1XUHA 1DVAH 1RRKA 2PFEA 3I78A 2QY0B 2P59A 1GCDA 3MHWU 3EGKH 4U30A 1V2VT 2CF8H 5LPFA 2ZHFH 3S9BA 2QCYA 2Z9KA 3EQ0H 1TOMH 5C1YA 2OBOA 4CH8B 5FCRA 3GCTF 3ZVCA 4YOIA 1YCPK 4ESTE 6LPRA 2P95A 3SV8A 2HVXA 1O2KA 2BZ6H 1LCYA 3BTFE 1NC6A 3FZDA 4X1PU 1E38B