5F6MA

Isotropic trypsin model for comparison of diffuse scattering
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cationic trypsin
publication title Measuring and modeling diffuse scattering in protein X-ray crystallography.
pubmed doi rcsb
molecule tags Hydrolase
total genus 62
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2015-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 5f6mA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 5f6mA02
1ABIH 2OLGA 1ZPBA 1EX3A 1RIWB 3RM0H 2HPQH 1QNJA 2A5IA 1P2OA 1O39A 4AN7A 1S0RA 1EAXA 1SFQB 3LC5A 2DE8A 2ZFTA 1FQ3A 4JZDH 3RMLH 1ORFA 2AH4X 3M35A 1BZXE 2UUFB 2RA3A 1O3JA 1P2MA 2QV1A 1OWJA 2WV5A 2ZNKH 2SGFE 1LTOA 2ALVA 2G5NA 2BY6X 2OC1A 4WWYA 1BTWA 2XC5A 3AASA 3GYLB 1QQUA 1VGCB 3HATH 1Z7KA 1KIGH 1FY5A 5JDUB 1P11E 3R3GB 1QL9A 3SJOA 1ZPZA 1C5UA 1EKBB 1LHDH 1C5XB 1TRNA 1BIOA 2FX4A 1ZHPA 1T8NA 4A92A 1TGCA 1C5VA 1BMLA 1GJ6A 1BMNH 5JPMH 4NSVA 1Y3UA 4AB9A 4Q7XA 1KDQB 1N1LA 2TRMA 1ZTJA 3SBKA 3S9CA 5EPYA 1BRUP 5BRRE 1QL7A 3M3SA 5FXLA 1THPB 1RTKA 2BTCE 4INHA 1O3BA 1P2JA 1FIWA 5EOKA 1G30B 4ZH8A 2ZHQH 2ZHWH 2AMQA 2GT8A 1J9CH 2AFQB 1TPPA 3AW0A 1O2JA 1W14U 4DGJA 1D4PB 1IQNA 2OTVA 4CREA 4AFZA 2A7JA 2CHAC 2J92A 1GJAB 1ELEE 3ODFA 3T5FH 1W12U 4IW4E 3VB6A 3E8LA 1T8LA 4TPIZ 1O3EA 2ZGBH 4YO9A 4ZKNU 1CQQA 5E2OA 4O3UA 3ZV8A 1NFWA 2WPIS 3B8JA 2A2QH 2F9BH 1AVWA 2G52A 2VGCB 5EODA 2K1QA 1Q3XA 2ZHDA 1MKWH 3D23A 1GMDF 2R2MB 2NU0E 1C5OH 2R9PA 2AYWA 2TIOA 3P17H 4HZHA 1QA0A 1XM1A 2Z9JA 1TA6A 2ZC9H 3LH1A 1FPHH 3Q76A 5DGJA 2W3IA 2HALA 1IQJA 3UTUH 1EB2A 4MTBA 4GUXA 1C1SA 4NIVA 3H7TA 3GY7A 1MUEB 1MZAA 1GHBG 2ZTZA 1GJ8B 4XOJA 4CRGA 2QY0B 3P8GA 4X6NA 1K1LA 1A2CH 4THNH 2G55A 1XX9A 2XC4A 3GDUA 1KXAA 1P2IA 7KMEH 1D3PB 2OINA 3UWIA 2BX3A 1O3PB 3AVZA 5CE1A 1GCTB 1RRKA 4LK4A 1O2PA 3SJ8A 5FX5A 3U69H 1C1RA 1OP0A 1GI7B 4Y0YE 1NU7B 4CRCA 5EQSA 3DUXH 1GBEA 1ESAA 1SLWB 3MU8A 1MH0A 1HAGE 1IQIA 4YLUA 1D6RA 3JZ1B 1O2ZA 1AFEH 4DVAU 1B0EA 3F6UH 2CV3A 1SOZA 2FM2A 2BVSH 1BCUH 1TPSA 4J1YA 3TGKE 2XBWA 3P92A 2GCTB 1TAWA 3VB3A 2VJ1A 1HAYB 1KLTA 2QXJA 4DW2U 1ZJKA 2ZU1A 1GI5A 1C5SA 1ID5H 4X8VH 3A8AA 5EXLA 1HJ8A 1S81A 5DP9A 3PMJA 3A82A 3E91A 4PROA 2QF3A 1GMHF 2Y7ZA 3ESTA 1MKXK 1QQ4A 5E2PA 1L1GA 3S69A 3U9AH 3P6ZB 1FPCH 5FPYA 3V3MA 3LGUA 2Y7XA 2ZDAH 2PV9B 1G3EA 1QY6A 3RC6A 2G81E 1P12E 1W11U 3QGNB 3UIRA 4DJZB 3LU9B 2WPMS 1GBKA 2G51A 1SHYA 3ELAH 3K65B 3T62A 1DSUA 2OQ5A 1C1NA 1O3FA 4A1XA 3GY5A 4B74A 8KME2 1ETTH 4A5TS 1UTOA 4MPVA 3MHWU 1KXEA 3LJJA 1UCYH 2THFB 4AG1A 1EXFA 3SUDA 4U01A 1QBVH 3SU2A 3NZIA 1WYKA 2BM2A 1AUTC 1GCDA 5PTPA 1P09A 3O8BA 1ZTLA 1B0FA 1V2JT 4IMZA 2SFAA 3F9FA 4O03A 2BB4A 4NWLA 4FUEA 2I6QA 1L2EA 3SQEE 1K1MA 5EQQA 1O5BB 1UTMA 3ZZ4A 2FYRA 1YLDA 1FY3A 1W0YH 2GP9B 1C2FA 4WH6A 1ELCA 2V3OH 2YOLA 3UR9A 1BBRH 2ANKH 2PUXB 4Y7BA 3MH5A 5J4SA 3U1JB 4BAOB 3VXFH 3OU0A 4Y79A 2TGPZ 3BN9A 2KAIA 1O38A 4YLQH 3PYHA 1TMUH 1HRTH 1RGQA 2AMDA 4FUHA 4Y0ZE 1PFXC 5DP6A 3TIUA 1ANBA 5ESTE 4AX9H 3P70B 1HXFH 1GBLA 2WUCA 3V7TA 1P03A 1O2QA 2FOMB 4ZKSU 1ABJH 2BD9A 2PLXA 3AAVA 5LPRA 1ZSLA 4X2WA 1BBRE 2A4QA 1AFQC 2AMPA 3BTDE 5L2ZH 5FPTA 1F7ZA 2C8ZB 1YPLH 3FP8E 2GD4B 4XBBA 3SI4H 4H4FA 2PKAA 3SGAE 5A09A 2PSXA 1TQ7B 3RXFA 1T8MA 1G36A 5GDSH 3PO1B 4WF8A 1ZGIA 1VCQA 3C27B 2ZPRA 4YZUA 1V2LT 3OYPA 2OC7A 4ISLA 1DWCH 4E06H 4GVUA 5A8ZA 1H8IH 1EATA 1PJPA 3QDZB 2CF8H 4X1SU 1V2RT 3M7TA 1K2I1 2ZCLP 4Y11E 1INCA 4E7NA 5A0BA 5EG4A 2ZU3A 3VB4A 3M3TA 4Y71A 3GYMA 3E1XB 1O37A 1O2TA 4MPXA 1HAXB 1ZRBA 1NC6A 1SR5C 2BZAA 2FPZA 1P8VC 2AGIX 1L4ZA 2GGVB 3UWJH 3CS0A 2I6SA 2CJIA 4FU9A 1P9UA 3QLPH 1RFNA 1GGDB 1GI2A 1YPHC 3QO6A 1K1NA 3RXJA 3GICB 1V2NT 1DUAA 5AF9H 5HM2A 4ZHAA 1GHAG 1NM6A 1C2GA 3UQVA 4KGAA 4M7GA 1ARBA 3T26A 3NCLA 3SNBA 1GJBB 3ZZDA 1TRYA 1HAVB 1AU8A 3PROA 1EUFA 4A6LA 1GWAA 2IOTA 1FV9A 3VXEH 4BTIB 4U32A 1A46H 1G3BA 4Q2KA 1KLJH 1OP2A 1N8OC 2EC9H 1G9IE 1GBCA 2W26A 1V6DA 4I8JA 4AOQA 1WSSH 3U8RH 1O36A 1OS8A 2LNCA 1EOJA 5C5OA 1SLUB 3SW2B 2FOFA 5AHGH 4X6PA 1XUGA 1O3LA 3RXRA 6CHAC 1C9TA 4BANB 1SGCA 3E3TA 1UVPA 1HIAB 5C5NA 2FS8A 1S85A 1S6FA 1DWDH 1GBJA 5C2ZA 1BOQA 1SG8B 1KSNA 2WYGA 2B5TB 2OC8A 1SGNE 2ANWA 1BITA 3FZDA 2B7DH 2BQ7B 1O35A 1HCGA 3KQBA 3ZVGA 1PPZA 1TE0A 1WV7H 4YT6H 1EZUC 1FXYA 4ZXXH 3RLWH 1O3KA 4DIIH 3RXKA 2FESH 2Q1JA 3OY5U 4ABGA 1HAIH 1BTXA 4ZXYH 3LOXA 4CRFA 2G4UA 3I77A 1HB0B 4D7FA 4RKJB 2C93B 3GCTF 2BD8A 1N6YA 2WV4A 1A0HB 2BD3A 2BLWA 4WVPE 3T2NA 1GJDB 1DITH 1SB1H 1F5RA 1ANDA 3QZQA 1EAIA 1C9PA 1Y3YA 4B76A 3M5NA 2W3KA 4IGDA 3SUEA 1GJCB 2Z6BD 2R3YA 3P95A 2ZDLA 3BIVH 3D65E 2F9OA 3EDXB 1AUJA 3OX7U 2P3TB 1GJ5H 1QRZA 5C20A 1HV7A 2WPLS 3BTTE 1NRQH 4H42U 1TOCB 1S0QA 3DFJA 4D9QA 1P01A 1DICA 1ZLRA 2BOKA 1CHOF 2GV6A 2STAE 2ANYA 1AZZA 3MFJA 3OY6U 4ISNA 1RTLA 1BB0B 4MPUA 1CHGA 1AN1E 3GDVA 3ATMA 2XXLA 1DXPA 1V2UT 2H6MA 1RXPA 1DFPA 1YPKH 1DWEH 4X2VA 2Z9LA 2BDIA 2SGDE 4R0IA 1ZZZA 4AZ2B 4VGCC 5EXNA 3FAOA 2GT7A 4Y10E 3ATWA 2CHAB 3BG8A 4MNYA 3RXDA 1MMJN 3UNRA 1AKSA 3RXPA 2HVXA 1NRRH 1KLIH 1D3DB 3SV9A 4I8KA 2OCVB 1CT4E 2ZQ2A 4I33A 1V2TT 4BOHA 2XBYA 2IJOB 3RXIA 1WQVH 4YOGA 1GI1A 1ARCA 2BXTH 5HMAA 1MU6B 3EE0B 5BPEA 1BBRK 1MD8A 1F0SA 1ELBA 5EGMA 1EZSC 3ZVEA 1QB1A 1K21H 5CHAC 1SGDE 1V2OT 2P3FH 1NN6A 2ZFSA 4AFUA 2FO9A 3GISB 1VCWA 4ISOA 2Z9GA 4FUFA 2BY7X 4FVBA 1GMDG 2VWOA 1TONA 2B8OH 3TLOA 1NROH 5LPFA 2AIQA 3SU3A 1C5PA 1OOKB 5L30H 5F8TA 1IOEA 1DSTA 1BHXF 4RKOB 1CGIE 1AWHB 2JH5D 2ZDMA 4J2YB 1AGJA 1O2WA 4MNXA 4TPYA 1WTGH 1JRSA 1WTHD 1Z1IA 1UHBA 3V13A 2A32A 2R0KA 3I29A 2SGEE 4I31A 1AQ7A 2VVCA 2UUKB 2AIPA 4K60A 2XC0A 1SOTA 1O2XA 4OS2A 1BRCE 3O8CA 2H9HA 1TNLA 3RU4E 1W2KH 2ZFFH 4JMYA 1YCPK 1ELGA 1BRBE 1YGCH 4JCNA 1O30A 1JIRA 1C1VH 1K28D 1E37B 2B0FA 3LGTA 1F92A 1UVSH 3M3VA 1WU1A 2D26C 3EA8A 4TYDA 5B6OA 3MO3A 3PB1E 2BVXH 5FCKA 1TGBA 1CA0C 2JKHA 4CRAA 3ZVAA 3RMMH 3KGPA 1A7SA 2HLCA 2A7CA 1FAKH 2JH6D 4H6TA 3ODDA 5AFYH 1AIXH 3FFGA 2ALPA 1Z8RA 3TK6A 5SGAE 3ZVBA 4XFQA 2CN0H 3A8BA 4D76A 5JBCS 4HI3A 1Z1JA 2ODYB 1UTPA 3BTME 4FUDA 3HGNA 1QB6A 4B1TA 3UPEA 4LOYH 2ZHFH 3RXMA 4ZMAH 1F0UA 1O5GH 2BD7A 4BXSA 2ZTYA 4JZIA 3MO9A 1SQTA 3EA9A 1JOUB 1K9OE 2ZPSA 2CGAA 3QUMP 3UFAA 5JBTA 1GMHG 4X6MA 4CH8B 1TNGA 4TWWA 1A1RA 5E0GA 3GY6A 1P06A 2PSYA 4ABAA 3UOUA 4Y6DA 4B71A 3KN2A 1ZJDA 4B73A 4WMEA 3ZVDA 4U30A 4AYVB 1TX8A 2PW8H 3CS7A 2GKVE 2ULLA 4JK5A 3DHKH 2Z9KA 3SOSA 4A1VA 1O2OA 4NG9H 5HYOA 1C2HA 1IQEA 1FDPA 3BF6H 1HDTH 3ZZ8A 5K0HA 2VINA 1EOLA 1XUKA 1EZQA 3M7UA 1J15A 1XXDA 1Y5AT 1TA2A 2ZFPH 1G3DA 1A3EH 1IQLA 1O2VA 1O3DA 2Q6DA 1V2KT 4X8UH 3M5LA 2BY9X 3RXSA 1HAHH 4UEHH 4CBOA 1UTNA 4NWKA 1HAZB 2O8MA 3RM2H 1CU1A 4GCHF 1C1QA 1GI3A 1TB6H 1GBDA 2A4RA 2BLVA 2P93A 1HJAB 3P8FA 4I32A 1JMOH 1G32B 3ZV9A 1AFQB 4I8GA 1O2HA 2Y5GA 4YTAA 4X0WU 1Z71A 5T6DA 1WOFA 2FTLE 1LPZB 3A7XA 3RC4A 3BTKE 1Z8JB 2NU4E 1C2LA 1UK3A 3TPIZ 2BLOA 1W8BH 3FZZA 1YC0A 1ELTA 1O3IA 2GTBA 2UWOA 3K2UA 3M37A 5E8EH 1ZHRA 3TJOA 1HUTH 2H2ZA 3SUGA 2RCEA 2SGQE 3HK3B 4K2YA 1SMFE 4O9VA 3SZNA 3RC5A 2ZIQH 4ISHH 2ZFRH 3TH2H 1P2QA 1VR1H 3T25A 1FONA 2H5DA 1KXFA 1YYY1 3NPSA 5ESBA 4ABFA 5L2YH 3BTGE 3ZZ3A 2R2WU 1DS2E 1LPGB 1MTWA 4FUIA 4ZAEA 3E0NB 3TITA 3HKIB 3TU7H 4AYYB 1GDNA 1YKTA 1FLEE 2BDGA 2TGDA 2NU2E 4WXIA 2G00A 3FP6E 1TMTH 2FLBH 3GY4A 1P9SA 4JZEH 4DG4A 3LIWA 4FUGA 2BLQA 3PLBA 4YT7H 4WXVA 1H4WA 4K8YA 1O2RA 1NO9H 3RMOH 2PTNA 7GCHF 3U98H 1SGRE 2HNTE 1ZTKA 1TGSZ 2JETC 1TNIA 3IG6B 4KELA 3LH3A 4GLYA 1LCYA 2A0QB 2VWLA 5GCHG 3F1SB 1Q31A 1K1IA 1LHCH 4CR5A 1EJNA 3ZYDA 3AW1A 5EW1H 1UTKA 1ELVA 4O97A 5GJ4B 1LO6A 2VWMA 4NSYA 1TBZH 2OUAA 1LKAA 1P57B 5FBEA 1B7XB 1TNKA 3UR6A 1IQFA 1GPZA 3R0FA 4ABJA 1K22H 1LQEA 5JBAS 6CHAB 4GAWA 2D8WA 1S5SA 3QTVH 4X1RU 1O32A 1C5WB 1FI8A 4FXGH 3SV2H 1H1BA 4JYVH 3SJIA 1HPGA 2YNAA 2CF9H 2R3UA 2R0LA 5EW2H 1ZHMA 2PWXA 1AVXA 1UVTH 1UJ1A 7LPRA 4IC5A 1TGTA 2ZDVH 4MPWA 2GDEH 4ABIA 3SI3H 1T8OA 2ZTXA 3VB5A 1GBFA 1X7AC 3RXQA 4LZ4B 3URDA 1AY6H 1NTPA 2ZG0H 1UO6A 5I25A 1UCYE 3LGWA 2FYQA 3D49H 1AB9B 5ABWA 1HXEH 2KAIB 3SU6A 1G3CA 1S83A 2BVRH 3ZZ7A 4ABHA 1MTNB 1BTZA 1MU8B 1QHRB 2VIWA 2DUCA 2J34A 1CVWH 1PPCE 6GCHF 1P04A 4DURA 2AEIH 1VZQH 2Y82A 3ATKA 4HTCH 1KTSB 1YP9A 3MNCA 1P05A 1OWDA 2VB0A 1T7CA 3GCTG 3W95A 2VGCC 2PKSB 1E36B 2QA9E 5DP5A 2QCYA 1HBTH 1D6WA 3K6YA 3A7VA 4INLA 1JWTA 4WMDA 2P59A 3KF2A 4CR9A 1V2WT 4KTCA 1TYNA 1M9UA 1QIXB 1JIMA 2PKAB 5JYIA 3TH3H 1C1PA 2BYAX 1GBTA 3PLPA 3TNSA 2G8TA 4KTSA 3KQCA 3RU4T 1TWXB 3VPKA 3BTFE 1PPFE 2C8XB 3SQHE 4ABBA 1LPKB 4FUBA 3STJA 4MVNA 1NRNH 2Y80A 4VGCB 5EXMA 3Q00A 2ZPQA 2ZFQH 4B2CA 4BAKB 1DUEA 2OC0A 1CHOG 3BTWE 2VIDA 1DX5M 3BV9B 1SQOA 2C3SA 2V35A 4Y8YA 1L1JA 2VIVA 2PR3A 2ILNA 1XVOA 1BTYA 4AB8A 1GCTC 3FP7E 4AGJA 1AWFH 1FN6A 3KL6A 4MLFB 5JBBS 1U6QA 3RP2A 3PTBA 3GCNA 1WUNH 3RXVA 4I8LA 1GI9B 1YPEH 1O2SA 5FPSA 1MKWK 1O2MA 1SPJA 3S0NA 3GY3A 5CHAB 1FNIA 4K1EA 2VNTA 3NUMA 5DPAA 4Z0KA 1MAYA 4BXWA 1ZR0A 1LVBA 1C1WH 2NU3E 1O3NA 2J94A 1C5MD 1FY1A 1HYLA 3GCHC 4ABDA 1GMCF 1QRXA 5AVDA 3RUOA 3A89A 3HPTB 1ZRKA 3MH7A 2GMTC 2C8YB 5DJ7A 1V2MT 1DOJA 3E16B 1UK2A 3H7OA 3KCGH 4Y8XA 2FI3E 1RJXB 1BJUA 1BDAA 1DT2A 2O8WA 5G4BA 2SGPE 3DFLA 5EQRA 2TBSA 1PPEE 1LVYA 8GCHF 1P0SH 3VFEA 2VIOA 2XRCA 4IN2A 1CGJE 1OWEA 1DY9A 4D8NA 3NKKA 2BD4A 1OWHA 3Q3KA 4ZROA 1FY8E 1LVOA 1BTPA 1Y59T 1SVPA 4H6SB 5HXFA 1CBWC 1EP6A 1Y3WA 4K1SA 1MZDA 2ZGCA 1UMAH 2XW9A 2XWAA 1FIZA 3ZZAA 2J9NA 2ODQA 1CA0B 1WAYB 2FODA 1XVMA 2QGRA 3PV4A 3A8DA 1HAOH 5A8YA 1O3CA 2G5VA 3W94A 1C5RA 4UFFH 3BG4C 3UY9A 1PPHE 2ZECA 1ELAA 1AI8H 4ASHA 3ZZBA 2XTTB 4IN1A 4MNWA 1TPOA 5K7RA 2GDDA 1C5ZB 1CA8B 1GHWH 2ZGHA 2AGGX 4XBDA 3UQOA 5FCRA 1GHYH 3MNXA 1BTUA 3VB7A 1MQ5A 1TX6A 1DLEA 2OQUA 4UFEH 3ZZ9A 1N6XA 2EI8A 2HGTH 3V0XA 1C2DA 1O34A 1O5AB 3KNXA 1NFXA 1UVOA 4OS5A 3ENSB 5T3HA 1YLCA 4FUCA 3T29A 2FP7B 3TGIE 3SNDA 1JRTA 4IMQA 1AMHA 1QJ7B 3A88A 2J95A 3BEFB 1NZQH 4INKA 2Z3EA 2OXSA 2VVUA 5C3NA 1IQKA 3KIDU 1CT2E 4IC6A 2STBE 2DE9A 1GJ9B 1GJ7B 1Y3VA 3A7WA 2Z9IA 1G2LA 1C5TA 3HGPA 3F68H 1TPAE 1EB1H 4JZFH 1DWBH 2A5KA 1UCYK 3MO6A 2UWPA 3LPRA 1HGTH 3CP7A 4DOQA 4X2XA 1PPGE 4DCDA 3GY2A 1BUIA 1YBWA 3RXLA 4NZLA 1SC8U 1GG6C 1MQ6A 4RSPA 2EI6A 1W10U 5AFZH 2H1UA 1FMGA 1FN8A 1DE7H 1SGFG 2SNVA 4Q7ZA 1QA7A 3SU0A 3LGYA 1LHFH 2UWLA 3LKWA 1MTVA 5A0AE 1OP8A 4BNRA 2BDAA 4ZKOU 4E7RG 1OKXA 2F9VA 3MI4A 3NK8A 1MAXA 2FOGA 3A85A 3U1IB 3RXGA 1NS3A 3RMNH 3SHCH 4NFFA 1GHAF 3V12A 3E0PB 1L1NA 1C2EA 2ZGXH 3H5CB 1QFKH 2EEKA 1GBBA 1YPJH 3S9BA 2A4GA 1RD3B 2QN5T 1LDTT 2ZZUH 3MTYA 1EPTA 1EJAA 3S7KB 4ISIH 1FUJA 3PMBB 2BY5X 3A80A 5GPIB 1CO7E 2XNIA 1PYTC 2OP9A 7ESTE 4GCHG 3GCOA 1UHBB 2BDBA 1C2KA 4GHQA 2QAAA 5L6NH 1GL0E 1MKXH 3C1KA 3SV7A 1Y5BT 2ZCKP 2BHGA 1O2NA 3ZZ6A 1SL3A 2AGEX 2CXVA 4BAHB 1QCPA 3VEQB 4TWYA 1V2PT 3F9GA 1C5LH 1OYQA 1IQGA 2OBQA 1CGHA 4B75A 1O5FH 4OS6A 3D62A 1HFDA 4CHAC 4A1TA 1BT7A 3TK5A 2BDCA 1UTQA 2EA3A 2PUQH 4UE7H 1ZYOA 4TY7A 1ZSKA 3SO3A 1DY8A 1BMMH 1VITF 1J17T 2F3CE 4YOJA 1BTHH 4SGBE 3RXTA 4JK6A 1AZ8A 2BD5A 2BXUH 1PQ5A 2C90B 1GL1A 2EI7A 1CSOE 1H9IE 4X1NU 3PTNA 1KY9A 3SNCA 1H9LB 1O5EH 1K1JA 2PGBB 6LPRA 3B9FH 2TPIZ 1XMNB 4MQAA 1TNHA 2JETB 4RN6A 2GZ7A 2PGQB 3MNSA 3LDXH 3BTHE 3RXCA 2O8TA 3M36A 1YPGH 1MCVA 2TGTA 1P3EA 4OS7A 3P8NA 3SU5A 3S7HB 2UUJB 3DD2H 3KHVA 1OX1A 1C1OA 1Z8GA 1NFYA 2VIQA 4F4OC 1SGFA 4ZHMU 1DANH 1DM4B 1ANCA 1O2YA 4D9RA 2ZGJA 7GCHG 3NWUA 1P2NA 1V2QT 2Y5FA 3PWBA 2BOHB 3GY8A 1E0FD 1SGTA 1PYTD 2P8OC 3HKJB 1GVLA 1UTLM 3QWCH 1E34B 2FOHA 3LONA 3VGCC 4X6OA 4X1QU 3O8DA 1O2UA 1O3MA 3Q3YA 4ZUHA 4WJG2 1TLDA 1C1MA 1G2MA 1YPHE 3FANA 3G01A 3RXEA 1SLXB 1AD8H 2AS9A 3MH4A 4NA8A 1Y8TA 2FI4E 4K1TA 4Q7YA 3BEIB 2YNBA 3RXUA 1FZZA 3A8CA 4O3TA 1GBHA 3BIUH 1Q2WA 3L3TA 2W7SA 1FY4A 4NZQA 1KDQA 1EASA 4YM9A 1E35B 4BTUB 1QB9A 4UFGH 3QK1A 4WH8A 5A8XA 1EJMA 3Q77A 4YESB 1TFXA 2FTMA 1T4VH 2GCHF 2XWBI 2ZU2A 5FHTA 3ITIA 3LGIA 1T31A 3K6ZA 3RLYH 8ESTE 2PTCE 2BZ6H 4Q80A 4TY6A 1GDUA 1GVKB 2FS9A 1CT0E 1VCPA 1Y3XA 2D2DA 3LJOA 4FVDA 3JZ2B 2H5CA 3M61U 1F5KU 1YF4A 5FX6A 1AO5A 3KQDA 2Y81A 1TMBH 5DP4A 1GHVH 4OGXA 5FBIA 1SGYE 2A5AA 1SI5H 1A0JA 5DP8A 1O2LA 2P16A 4KKDA 2F9UA 5C1UA 2FLRH 4K8BA 5F6MA 5LGOA 1EQ9A 2FOAA 1EPTC 1KXBA 2QXIA 4SGAE 1C5QA 1V3XA 1LQDB 2M5TA 3LC3A 4X1PU 2J2UA 6GCHG 2HPPH 2F9NA 4Z6AH 4MNVA 9ESTA 3SJKA 2RG3A 4Y7AA 2WUBA 4CRDA 1ELDE 3QTOH 1O3HA 3RXHA 1NPMA 3BSQA 5GXPA 1KXDA 1QURH 4KP0A 1HJ9A 1TABE 2RDLA 3TJUA 1D3TB 1C2MA 2Y6TA 1AE5A 1T4UH 2VH6A 1V2ST 5I46H 1WCZA 4AORA 1NRPH 1GHXH 1O0DH 3BTEE 1XUHA 1C1UH 5F8XA 2W7UA 3MU1A 3PWCA 1C4V2 4FU8A 4AG2A 1RIWC 1PPBH 1GI4A 4I7YH 4K5ZA 3QX5H 1OWKA 2XYAA 1BRAA 2H9TH 2FOEA 3OSYA 3ZVCA 1F5LA 2ZEBA 2A4OA 3SNAA 1SGPE 2P95A 1PQAA 1NRSH 4FUJA 3OTJE 2FX6A 1TX7A 2VWNA 3QGJA 2XBXA 1FAXA 3TVJB 1LVMA 1QBNA 1S6HA 2HWLB 2ZU5A 2HOBA 4ZHLU 1C4U2 1GDQA 1LMWB 1QJ1B 2Z3DA 3IITA 2P94A 3GCHB 5JB8S 1C2IA 2V6NA 1RTFB 1W7XH 1D3QB 2FWWA 2Z7FE 4X8SH 3A7YA 4BAQB 5C1XA 1N8OB 2GMTB 4B2AA 1XUFA 2VU8E 1QRWA 4X8TH 1VGCC 2WYJA 4GPGA 2ZF0H 3E90B 1ETSH 1S84A 1Z6JH 5GWZA 1GBAA 4CH2B 1TNJA 4IS5A 1XKBC 2FXRA 1CE5A 1GMCG 1P02A 1EZXC 3MU0A 2GVFA 3U8TH 3L33A 2BX4A 4IBLH 2BDYA 3E6PH 3A81A 3MNBA 2QIQA 2BDHA 1MBQA 5IYTA 1XUJA 2BY8X 3MOCA 2P3UB 1W7GH 1WQSA 3ATIA 1DVAH 3EA7A 3RXAA 3S9AA 3SUFA 3SV8A 1O3OA 1CBWB 4JZ1A 1DDJA 4LXBH 2NU1E 1OXGA 4XSKU 3WY8A 3A87A 4YOIA 5T6GA 2UUYA 5A0CA 1MBMA 8GCHG 3M5MA 2FOCA 3KEEA 1XXFA 5HGGA 3B23B 2O8LA 2C4FH 3RXBA 1A5HA 4UFDH 3TJNA 4DT7B 1VJ9U 3BG4B 3P8OA 2ODPA 4ESTE 3M7QA 1Y5UT 1ETRH 3ZVFA 2B9LA 2F9PA 1GHZA 1W0ZU 1ZMNA 3NXPA 1DLKB 3PMHB 2ZA5A 5ETXA 2SGAA 3MU4A 1A5GH 6ESTA 3SGBE 1SLVB 1A3BH 4XBCA 2A31A 1OYTH 5E0JA 3UOPA 4K3JA 1EP5A 1A0LA 2FEQH 4X2YA 1OWIA 4OS1A 2Q6GA 3T28A 2LPRA 3TH4H 5C67A 1SQAA 2WINI 2ZDKA 3UREA 2Z3CA 5DP7A 2PHBA 1C1TA 2ASUB 2Q6FA 1NFUA 1SGIB 3SN8A 1GVZA 2OD3B 1TIOA 5TCAA 1GHBF 1O2GH 3EYDA 2QF0A 1MTUA 3EAJA 5JB9S 1O33A 1K1PA 1DPOA 1XKAC 2AERH 1PQ7A 3MYWA 5F8ZA 5C1YA 4NIXA 3TGJE 4AFQA 1LKBA 1F0RA 1HJAC 2GZ8A 1EAWA 2IN2A 3U8OH 1MD7A 1NESE 4NIYA 2WPJS 1HNEE 1VJAU 5EPNA 1H8DH 4ABEA 5H4IB 5DKMA 1OPHB 1F2SE 1ZOMA 3A84A 1C4Y2 1GG6B 4UD9H 1IAUA 4CBNA 3FVFB 1IQHA 3N7OA 3BTQE 4NCYA 1JXPA 1YM0A 2A45B 3SORA 3QN7A 3F9EA 1TGNA 1TBRH 1SGEE 5T6FA 4NFEA 4JYUH 1QTFA 1KYNA 1DXWA 1IHTH 4HFPB 3SHAH 1MCTA 3SGQE 1O5DH 1WBGB 1LHGH 1YCPH 3IWMA 1ELFA 4E05H 2FIRH 3A86A 3RDZA 2F83A 3ZZCA 2FZZA 1JBUH 2PFEA 3Q3XA 3UUZA 2WPHS 5E0HA 2HNTF 2H9EH 1AE8H 2O9QA 4FU7A 1FJSA 1L0ZA 2Z94A 4XDEA 2GCTC 5GCHF 2WPKS 5DO4H 2V3HH 5TCCA 4NIWA 2ESTE 3ZZ5A 1KTTB 1W3CA 4WMFA 1NY22 2ZU4A 2BMGB 2FOBA 2XCFA 1AHTH 1C5NH 1T32A 2O8UA 2ZO3H 2RA0A 3RU4D 1A4WH 2CMYA 1G37A 3EGKH 4QT8C 1A61H 3KQEA 1J14A 1HAVA 4OS4A 2QC2A 2XBVA 1GBIA 3AAUA 5F03A 3DT0H 1C5YB 1J8AA 4CHAB 5TJXA 1NT1A 1P2KA 1GI0A 1VITH 2GV7A 4GHTA 1O5CB 1Z6EA 2ZHEH 2Y5HA 1TBQH 1P3CA 2D1JA 1QR3E 1ZMJA 2QXGA 9LPRA 4WY3A 3MU5A 3HK6B 1O31A 1SHHB 5IDKA 1ACBE 1SSXA 2XCNA 3A83A 1HIAA 1L4DA 2VH0A 3GDSA 1AVGH 5DG6A 3SV6A 1GBMA 3SJ9A 1ZMLA 3URCA 1QJ6B 1VITG 4HGCA 1TQ0B 2GX4A 3CENA 4CRBA 5A2MH 2ZP0H 2HRVA 2J38A 5DK1A 1J16A 1UVUH 1QBOA 3A7ZA 5CMXH 1GI6A 1Z8IB 3ATLA 3LGVA 3LT3A 1SGQE 3UNSA 3L6PA 1AB9C 3DA9B 1BJVA 4DIHH 1ANEA 1SFIA 1THSH 2VIPA 3SU1A 3UNQA 1MTNC 2P8OB 1HAPH 5DP3A 1O3GA 2FMJA 1THRH 8LPRA 3VGCB 1ESTA 2W5EA 2G4TA 2SNWA 2VVVA 4AGKA 1O2IA 1ZPCA 4NA7A 2ZQ1A 3I78A 1ZSJA 3SNEA 2PKSC 1XUIA 3O8RA 1O3AA 2ZDNA 2QYIA 1H9HE 1AKSB 3K9XB 2A1DB 3EQ0H 4NA9H 1GJ4H 4Y76A 4K69A 3RXOA 1HLTH 1A5IA 4MDSA 1TALA 1YCPM 4NGAH 2F91A 5EU8A 4I8HA 1IQMA 1C2JA 1RS0A 3PLKA 4JYTA 2OBOA 3PO1C 2BD2A 2HNTC 1V2VT 2ZWLH 5LH8A 5GIBA 2IPHA 4BTTB 1BHXB 4KTUA 2FI5E 2V0BA 3PMAB 1BMAA 2ZKSA 3MH6A 1E38B 1IHSH 3STIA 4A7IB 1BQYA 4Y8ZA 4BAMB 1TOMH 1B5GH 2GCHG 1D9IA 1O2KA 2NWNA 2C8WB 3GOVB 4D7GA 4F49A 1EPTB 2ANMH 3F9HA 1BA8B 4MG3A 4AFSA 1SBWA 1QGFA 3QZRA 5J4QA 4ZKRU 3M5OA 1YPMH 2BQWB 1GGDC 1F0TA 1UK4A 2A7HA 2QXHA 1LHEH 4XE4A 4OGYA 2J4IA 4UONA 1TRMA 1EAUA 1MTSA 4DY7B 2A2XH 1S82A 4U2WA 5HM9A 1ESBA 1PQ8A 3SU4A 1K1OA 3BEUA 3A7TA 4B2BA 3TJVA 1W13U 4UDWH 3TNTA 2JH0D 4R8TB 1ZGVA 1OSSA 1NU9A 2TGAA 5LPEA 3T27A 4GSOA 2FDAA 1UTJA 3TK9A 1KXCA 1QL8A 2GZ9A 5FAHA 4LZ1H 3PM3A 2ZCHP 2BQ6B 3MMGA 1GI8B 3MWIU 2ZI2H 3ZYEA 1P10A
chains in the Genus database with same CATH superfamily
1ABIH 2OLGA 1ZPBA 1EX3A 1RIWB 3RM0H 2HPQH 1QNJA 2A5IA 1P2OA 1O39A 4AN7A 1S0RA 1EAXA 1SFQB 2L6OA 3LC5A 2DE8A 2ZFTA 1FQ3A 4JZDH 3RMLH 1ORFA 2AH4X 3M35A 1BZXE 2UUFB 2RA3A 1O3JA 1P2MA 2QV1A 1OWJA 2WV5A 2ZNKH 2SGFE 2RDEA 1LTOA 2ALVA 2G5NA 2BY6X 2OC1A 4WWYA 1BTWA 2XC5A 2CK3D 3AASA 3GYLB 1QQUA 1VGCB 3HATH 1Z7KA 1KIGH 1FY5A 5JDUB 1P11E 3R3GB 1QL9A 3SJOA 1ZPZA 1C5UA 1EKBB 1LHDH 1C5XB 1TRNA 1BIOA 2FX4A 1ZHPA 1T8NA 4A92A 2KR7A 4ASUD 3VG8A 1TGCA 1C5VA 1BMLA 1GJ6A 1BMNH 5JPMH 4NSVA 1Y3UA 4AB9A 4Q7XA 1KDQB 1N1LA 2TRMA 1ZTJA 3SBKA 3S9CA 5EPYA 1BRUP 5BRRE 1QL7A 3FOAA 3M3SA 1THPB 5FXLA 1RTKA 2BTCE 4INHA 1O3BA 1P2JA 1FIWA 5EOKA 1G30B 4ZH8A 2ZHQH 2ZHWH 2AMQA 2GT8A 1J9CH 2AFQB 1TPPA 3AW0A 1O2JA 1W14U 4DGJA 1D4PB 1IQNA 2OTVA 5FL7D 4CREA 4AFZA 2A7JA 3WWBA 2CHAC 2J92A 1GJAB 1ELEE 3ODFA 3T5FH 1W12U 4IW4E 3VB6A 3E8LA 1T8LA 4TPIZ 1O3EA 2ZGBH 4YO9A 4ZKNU 1CQQA 5E2OA 4O3UA 3ZV8A 1NFWA 2WPIS 3B8JA 2A2QH 2F9BH 1AVWA 2G52A 2VGCB 2K0QA 5EODA 2K1QA 1Q3XA 2ZHDA 3N99A 1MKWH 3D23A 1GMDF 2R2MB 2NU0E 1C5OH 2R9PA 2AYWA 2TIOA 3P17H 4HZHA 2PP6A 1QA0A 1XM1A 2Z9JA 1TA6A 2ZC9H 3LH1A 1FPHH 3Q76A 4M9FA 5DGJA 2W3IA 2HALA 1IQJA 3UTUH 1EB2A 4MTBA 4GUXA 1C1SA 4NIVA 3H7TA 3GY7A 1MUEB 1MZAA 1GHBG 2ZTZA 1GJ8B 4XOJA 4CRGA 2QY0B 3P8GA 4X6NA 1K1LA 1A2CH 4THNH 2G55A 1XX9A 2XC4A 3GDUA 1KXAA 1P2IA 7KMEH 1D3PB 2OINA 3UWIA 2BX3A 1O3PB 3AVZA 5CE1A 1GCTB 1RRKA 3UAIC 3F0OA 4LK4A 1O2PA 3SJ8A 5FX5A 3U69H 1C1RA 4TT3D 1OP0A 1GI7B 4Y0YE 1NU7B 4AC9A 4CRCA 5EQSA 3DUXH 1GBEA 5HIYA 1ESAA 5HKKD 1SLWB 3MU8A 1MH0A 1YWUA 1HAGE 1IQIA 4YLUA 1D6RA 3JZ1B 1O2ZA 1AFEH 4DVAU 1B0EA 3F6UH 2CV3A 1SOZA 2FM2A 2BVSH 1BCUH 1TPSA 4J1YA 3TGKE 2XBWA 3P92A 2GCTB 1TAWA 3VB3A 2VJ1A 1HAYB 1KLTA 2QXJA 4DW2U 1ZJKA 2ZU1A 1GI5A 1C5SA 1ID5H 4X8VH 3A8AA 5EXLA 1HJ8A 1S81A 5DP9A 3PMJA 3A82A 3E91A 4PROA 2QF3A 1GMHF 2Y7ZA 3ESTA 1MKXK 1QQ4A 5E2PA 1L1GA 3S69A 3U9AH 3P6ZB 1FPCH 5FPYA 3V3MA 3LGUA 2Y7XA 2ZDAH 2PV9B 1G3EA 1QY6A 3RC6A 2G81E 1P12E 1W11U 3QGNB 3UIRA 4DJZB 3LU9B 2WPMS 1GBKA 2G51A 1SHYA 3ELAH 3K65B 3T62A 1DSUA 2OQ5A 1C1NA 1O3FA 4A1XA 3GY5A 4B74A 8KME2 1ETTH 4A5TS 2HVYB 1UTOA 4MPVA 3MHWU 1KXEA 3LJJA 1UCYH 2THFB 4AG1A 1EXFA 3SUDA 4U01A 1QBVH 3SU2A 3NZIA 1WYKA 2BM2A 1AUTC 1GCDA 5PTPA 1P09A 3O8BA 1ZTLA 1B0FA 1V2JT 4IMZA 2SFAA 3F9FA 4O03A 2BB4A 4NWLA 4XRNA 4FUEA 2I6QA 1L2EA 3SQEE 1K1MA 5EQQA 5GNDA 1O5BB 1UTMA 3ZZ4A 2FYRA 1YLDA 1FY3A 1W0YH 2GP9B 1C2FA 4WH6A 3OEHD 1ELCA 2V3OH 2YOLA 3UR9A 1BBRH 2ANKH 1WDIA 2PUXB 4Y7BA 3MH5A 5J4SA 3U1JB 2JJ1D 4BAOB 3VXFH 3OU0A 4Y79A 2TGPZ 3BN9A 2KAIA 1O38A 4YLQH 3PYHA 1TMUH 1HRTH 1RGQA 2AMDA 4FUHA 2KX4A 4Y0ZE 1PFXC 5DP6A 3TIUA 1ANBA 5ESTE 4AX9H 3P70B 1HXFH 1GBLA 2WUCA 3V7TA 1P03A 1O2QA 2FOMB 4ZKSU 1ABJH 2BD9A 2PLXA 3AAVA 5LPRA 1ZSLA 4X2WA 1BBRE 2A4QA 1AFQC 2AMPA 3BTDE 5L2ZH 5FPTA 1F7ZA 2C8ZB 1YPLH 3FP8E 2GD4B 4XBBA 3SI4H 4H4FA 2PKAA 3SGAE 5A09A 2PSXA 1TQ7B 2F4LA 2WZQA 3RXFA 1T8MA 1G36A 5GDSH 3PO1B 2EQNA 4WF8A 1ZGIA 1VCQA 4OM9A 3C27B 2ZPRA 4YZUA 1V2LT 3OYPA 2OC7A 4ISLA 1DWCH 4E06H 4GVUA 5A8ZA 1H8IH 1EATA 1PJPA 3QDZB 2CF8H 4X1SU 4B6FA 1V2RT 3M7TA 4FOUC 1K2I1 2ZCLP 4Y11E 1INCA 4E7NA 5A0BA 5EG4A 2ZU3A 3VB4A 3M3TA 4Y71A 3GYMA 3E1XB 1O37A 1O2TA 4MPXA 1HAXB 1ZRBA 1NC6A 1SR5C 2BZAA 2FPZA 1P8VC 2AGIX 1L4ZA 2GGVB 3UWJH 3CS0A 2I6SA 2CJIA 4FU9A 1P9UA 3QLPH 1RFNA 1GGDB 1GI2A 1YPHC 3QO6A 1K1NA 3RXJA 3GICB 1V2NT 1DUAA 5AF9H 5HM2A 4ZHAA 1GHAG 1NM6A 1C2GA 3UQVA 4KGAA 4M7GA 1ARBA 3T26A 3NCLA 3SNBA 1GJBB 3ZZDA 1TRYA 1HAVB 1AU8A 2KCAA 3PROA 1EUFA 4A6LA 1GWAA 2IOTA 1FV9A 3VXEH 4BTIB 4U32A 4F55A 1A46H 1G3BA 4Q2KA 1KLJH 1OP2A 1N8OC 2EC9H 1G9IE 1GBCA 2W26A 1V6DA 4I8JA 4AOQA 1WSSH 3WWFA 3U8RH 5F53A 2JJ2D 1O36A 1OS8A 2LNCA 1EOJA 5C5OA 1SLUB 3SW2B 2FOFA 5AHGH 3FKSD 4X6PA 1XUGA 1O3LA 3RXRA 6CHAC 1C9TA 4BANB 1SGCA 3E3TA 1UVPA 1HIAB 5C5NA 2FS8A 1S85A 1S6FA 1DWDH 1GBJA 5C2ZA 1BOQA 1SG8B 1KSNA 2WYGA 2B5TB 2OC8A 1SGNE 2ANWA 1BITA 3FZDA 2B7DH 1BMFD 2BQ7B 1O35A 1HCGA 3KQBA 3ZVGA 1PPZA 5B6LA 1TE0A 1WV7H 4YT6H 1EZUC 1FXYA 2WSSD 4ZXXH 3RLWH 1O3KA 4DIIH 3RXKA 2FESH 2Q1JA 3OY5U 4ABGA 1HAIH 1BTXA 4ZXYH 3LOXA 4CRFA 2G4UA 3I77A 1HB0B 4D7FA 4RKJB 2C93B 3GCTF 2BD8A 1N6YA 2WV4A 1A0HB 2BD3A 2BLWA 4WVPE 3T2NA 1GJDB 1DITH 1SB1H 1F5RA 1ANDA 3QZQA 1EAIA 1C9PA 1Y3YA 4B76A 3M5NA 2W3KA 4IGDA 3SUEA 1GJCB 2Z6BD 2R3YA 3P95A 2ZDLA 3BIVH 3D65E 2F9OA 3EDXB 1AUJA 3OX7U 2P3TB 1GJ5H 1QRZA 5C20A 1HV7A 2WPLS 3BTTE 1NRQH 4H42U 1TOCB 1S0QA 3DFJA 4D9QA 1P01A 1DICA 4XD7D 1ZLRA 2BOKA 1CHOF 2GV6A 2STAE 2ANYA 1AZZA 3MFJA 3OY6U 4ISNA 1RTLA 1BB0B 4MPUA 1CHGA 3CNRA 1AN1E 3GDVA 3ATMA 2XXLA 1DXPA 1V2UT 2H6MA 1RXPA 1DFPA 1YPKH 1DWEH 4X2VA 2Z9LA 2BDIA 2SGDE 4R0IA 1ZZZA 4AZ2B 4VGCC 5EXNA 3FAOA 2GT7A 4Y10E 3ATWA 2CHAB 3BG8A 4MNYA 3RXDA 1MMJN 3UNRA 1AKSA 2QF4A 3RXPA 2HVXA 1NRRH 1KLIH 1D3DB 3H09A 3SV9A 4I8KA 2OCVB 1CT4E 2ZQ2A 4I33A 1V2TT 4BOHA 2XBYA 2IJOB 3RXIA 1WQVH 4YOGA 1GI1A 1ARCA 2BXTH 5HMAA 1MU6B 3EE0B 5BPEA 1BBRK 1MD8A 1YY3A 1F0SA 1ELBA 5EGMA 1EZSC 3ZVEA 1QB1A 1K21H 5CHAC 1SGDE 1V2OT 2P3FH 1NN6A 2ZFSA 4AFUA 2FO9A 3GISB 1VCWA 4ISOA 2Z9GA 4FUFA 2BY7X 4FVBA 1GMDG 2VWOA 1TONA 2B8OH 3TLOA 1NROH 5LPFA 2AIQA 3SU3A 1C5PA 1OOKB 5L30H 5F8TA 1IOEA 1DSTA 1BHXF 4RKOB 1CGIE 1AWHB 2JH5D 2ZDMA 4J2YB 1AGJA 1O2WA 4MNXA 4TPYA 1WTGH 1JRSA 1WTHD 2W6JD 1Z1IA 1UHBA 3V13A 2A32A 2R0KA 3I29A 3SZEA 2SGEE 4I31A 1AQ7A 2VVCA 2UUKB 2AIPA 4K60A 2XC0A 5C94A 1SOTA 1O2XA 4OS2A 1BRCE 3O8CA 2H9HA 1TNLA 3RU4E 1W2KH 2ZFFH 4JMYA 1YCPK 3KYGA 1ELGA 1BRBE 1YGCH 4JCNA 1O30A 1JIRA 1C1VH 1K28D 1E37B 2B0FA 3LGTA 1F92A 4F48B 1UVSH 3M3VA 3OE7D 1WU1A 2D26C 3EA8A 4TYDA 5B6OA 3MO3A 3PB1E 2BVXH 5FCKA 1TGBA 1CA0C 2JKHA 4CRAA 3ZVAA 3RMMH 3KGPA 1A7SA 2HLCA 2A7CA 1FAKH 2JH6D 4H6TA 3ODDA 5AFYH 1AIXH 3FFGA 2ALPA 1Z8RA 3TK6A 5SGAE 3ZVBA 4XFQA 2CN0H 3A8BA 4D76A 5JBCS 4HI3A 1Z1JA 2ODYB 1UTPA 3BTME 4FUDA 3HGNA 1QB6A 4B1TA 3UPEA 4LOYH 2ZHFH 3RXMA 4ZMAH 1F0UA 1O5GH 2BD7A 3OAAD 4BXSA 2ZTYA 4JZIA 4Q63A 3MO9A 1SQTA 3EA9A 1JOUB 1K9OE 2ZPSA 2CGAA 3QUMP 3UFAA 5JBTA 1E1QD 1GMHG 4X6MA 4CH8B 1TNGA 4TWWA 1A1RA 5E0GA 3GY6A 1P06A 2PSYA 4ABAA 3UOUA 4Y6DA 4B71A 3KN2A 1ZJDA 4B73A 4WMEA 3ZVDA 4U30A 4AYVB 4ACBA 1TX8A 2PW8H 3CS7A 2GKVE 2ULLA 4JK5A 3DHKH 2Z9KA 3SOSA 4A1VA 1O2OA 4NG9H 5HYOA 1C2HA 1IQEA 2XOKD 1FDPA 3BF6H 1HDTH 3ZZ8A 5K0HA 2VINA 1EOLA 1XUKA 1EZQA 3M7UA 1J15A 1XXDA 2XNDD 1Y5AT 1TA2A 2ZFPH 1G3DA 1A3EH 2YMSC 5HIZA 3F2FA 1IQLA 1O2VA 1O3DA 2Q6DA 3MQKC 1V2KT 4X8UH 3M5LA 2BY9X 3RXSA 1HAHH 4UEHH 4CBOA 1UTNA 4RT1A 1VKYA 4NWKA 1HAZB 2O8MA 2VBCA 3FO8D 3RM2H 1CU1A 4GCHF 1C1QA 1GI3A 1TB6H 1GBDA 2A4RA 2BLVA 2P93A 1HJAB 3P8FA 4I32A 1JMOH 1G32B 3ZV9A 1AFQB 4I8GA 1O2HA 2Y5GA 4YTAA 4X0WU 1Z71A 5T6DA 1WOFA 2FTLE 1LPZB 3A7XA 3RC4A 3BTKE 1Z8JB 2NU4E 1C2LA 1UK3A 3TPIZ 2BLOA 1W8BH 3FZZA 1YC0A 1ELTA 1O3IA 2GTBA 2UWOA 1NBMD 3K2UA 3M37A 5E8EH 1ZHRA 3TJOA 1HUTH 2H2ZA 3SUGA 2RCEA 2SGQE 1SQRA 3HK3B 4K2YA 1SMFE 4O9VA 3SZNA 3RC5A 2ZIQH 4DT4A 5EIYA 4ISHH 2ZFRH 3TH2H 2LELA 1P2QA 3DSPA 1VR1H 3T25A 1FONA 2H5DA 1KXFA 1YYY1 3NPSA 5ESBA 4ABFA 5L2YH 3BTGE 3ZZ3A 2R2WU 1DS2E 1LPGB 1MTWA 4FUIA 4ZAEA 3E0NB 3TITA 3HKIB 3TU7H 4AYYB 1GDNA 1YKTA 1FLEE 2BDGA 2TGDA 2NU2E 4WXIA 2G00A 3FP6E 1TMTH 2FLBH 3GY4A 1P9SA 4JZEH 2YMSD 4DG4A 3LIWA 4FUGA 2BLQA 3PLBA 4YT7H 4WXVA 1H4WA 4K8YA 1O2RA 1NO9H 3RMOH 2PTNA 7GCHF 3U98H 1FX0B 1SGRE 2HNTE 2QE7D 1ZTKA 1TGSZ 2JETC 1TNIA 3IG6B 4KELA 3LH3A 4GLYA 1LCYA 2A0QB 2VWLA 5GCHG 3F1SB 1Q31A 1K1IA 1LHCH 4CR5A 1EJNA 3ZYDA 3AW1A 5EW1H 1UTKA 1ELVA 4O97A 5GJ4B 1LO6A 2VWMA 4NSYA 1TBZH 2OUAA 1LKAA 1P57B 5FBEA 1B7XB 1TNKA 3UR6A 1IQFA 1GPZA 3R0FA 4ABJA 1K22H 1LQEA 5JBAS 6CHAB 1E1RD 4GAWA 2D8WA 1S5SA 3QTVH 4X1RU 1O32A 1C5WB 1FI8A 4FXGH 3N7EA 3SV2H 3OTPA 1H1BA 3GS9A 4JYVH 3SJIA 1E79D 1HPGA 2YNAA 2CF9H 2R3UA 2R0LA 5EW2H 1ZHMA 2PWXA 1AVXA 1UVTH 1UJ1A 7LPRA 4IC5A 3PRBA 2M2AA 1TGTA 2ZDVH 4MPWA 2GDEH 4ABIA 3SI3H 1T8OA 2ZTXA 3VB5A 1GBFA 1X7AC 3RXQA 4LZ4B 3URDA 1AY6H 1NTPA 2ZG0H 1UO6A 3DSGA 5I25A 1UCYE 3LGWA 2FYQA 3D49H 1AB9B 5ABWA 1HXEH 1UW7A 2KAIB 3SU6A 1G3CA 1S83A 2BVRH 3ZZ7A 4ABHA 1MTNB 1BTZA 1MU8B 1QHRB 2VIWA 2DUCA 2J34A 1CVWH 1PPCE 6GCHF 1P04A 4DURA 2AEIH 1VZQH 2Y82A 3ATKA 4HTCH 1KTSB 1YP9A 3MNCA 1P05A 1OWDA 2VB0A 4P00A 1T7CA 3GCTG 3W95A 2VGCC 2PKSB 1E36B 2QA9E 5DP5A 2QCYA 1HBTH 1D6WA 3K6YA 3A7VA 4INLA 1JWTA 4WMDA 2P59A 3KF2A 4CR9A 1V2WT 4KTCA 1TYNA 1M9UA 1QIXB 1JIMA 2PKAB 5JYIA 3TH3H 1C1PA 2BYAX 1GBTA 3PLPA 3TNSA 2G8TA 4KTSA 3KQCA 3RU4T 1TWXB 3VPKA 3BTFE 1PPFE 2C8XB 3SQHE 4ABBA 1LPKB 4FUBA 3STJA 1K0HA 4MVNA 2JDID 1NRNH 2Y80A 4VGCB 5EXMA 3Q00A 2ZPQA 2WPDD 2ZFQH 4B2CA 4BAKB 1DUEA 2OC0A 1CHOG 3BTWE 2VIDA 1DX5M 3BV9B 1SQOA 2C3SA 2V35A 4Y8YA 1L1JA 2VIVA 2PR3A 2ILNA 1XVOA 1BTYA 4AB8A 1GCTC 2J98A 3FP7E 4AGJA 1AWFH 1FN6A 3KL6A 4MLFB 5JBBS 1U6QA 3RP2A 3PTBA 3GCNA 1WUNH 3RXVA 4I8LA 1GI9B 1YPEH 1O2SA 1NBME 5FPSA 1MKWK 1O2MA 1SPJA 3S0NA 3GY3A 5CHAB 1FNIA 4K1EA 2VNTA 3NUMA 5DPAA 4Z0KA 1MAYA 4BXWA 1ZR0A 1LVBA 1C1WH 2NU3E 1O3NA 2J94A 1C5MD 1FY1A 2L74A 1HYLA 3GCHC 4ABDA 1GMCF 1QRXA 5AVDA 3RUOA 3A89A 3HPTB 1ZRKA 3MH7A 2GMTC 2C8YB 5DJ7A 1V2MT 1DOJA 3E16B 1UK2A 3H7OA 3KCGH 4Y8XA 2FI3E 1RJXB 1BJUA 1BDAA 1DT2A 2O8WA 5G4BA 2SGPE 3PRDA 3DFLA 5EQRA 2TBSA 1PPEE 1LVYA 8GCHF 1P0SH 3VFEA 2VIOA 2XRCA 4IN2A 1CGJE 1OWEA 1DY9A 4D8NA 3NKKA 2BD4A 1OWHA 3Q3KA 4ZROA 3ZIAD 1FY8E 1LVOA 1BTPA 1Y59T 1SVPA 4H6SB 5HXFA 1CBWC 1EP6A 1Y3WA 2EY4C 4K1SA 1MZDA 2ZGCA 1UMAH 2XW9A 2XWAA 1FIZA 3ZZAA 2J9NA 2ODQA 1CA0B 1WAYB 2FODA 2IPQX 1XVMA 2QGRA 3PV4A 3A8DA 1HAOH 5A8YA 1O3CA 2G5VA 4TSFD 3W94A 1C5RA 4UFFH 3BG4C 3UY9A 1PPHE 2ZECA 1ELAA 1AI8H 4ASHA 3ZZBA 2XTTB 4IN1A 4MNWA 2V7QD 1TPOA 5K7RA 2GDDA 3EE7A 1C5ZB 1CA8B 1GHWH 2ZGHA 2AGGX 4XBDA 3UQOA 2KCPA 5FCRA 1GHYH 3MNXA 1BTUA 3VB7A 1MQ5A 1TX6A 5IK2D 1DLEA 2OQUA 4UFEH 3ZZ9A 1N6XA 2EI8A 2HGTH 3V0XA 1C2DA 4B6EA 1O34A 1O5AB 3KNXA 1NFXA 1UVOA 4OS5A 3ENSB 5T3HA 1YLCA 1S6LA 4FUCA 3T29A 2FP7B 3TGIE 3SNDA 1JRTA 4IMQA 1AMHA 1QJ7B 3A88A 2J95A 3BEFB 3PV2A 1NZQH 4INKA 2Z3EA 2OXSA 2VVUA 5C3NA 1IQKA 3KIDU 1CT2E 1H8ED 4IC6A 2STBE 2DE9A 1GJ9B 1GJ7B 1Y3VA 3A7WA 2Z9IA 1G2LA 1C5TA 3HGPA 3SYJA 1OHHD 3F68H 1TPAE 4FETA 1EB1H 4JZFH 1DWBH 2A5KA 1UCYK 3MO6A 2UWPA 3LPRA 1HGTH 3CP7A 4DOQA 4X2XA 1PPGE 4DCDA 3GY2A 1BUIA 1YBWA 3RXLA 4NZLA 1SC8U 1GG6C 1MQ6A 4RSPA 2EI6A 1W10U 5AFZH 2H1UA 1FMGA 1FN8A 4RT0A 1DE7H 1SGFG 2SNVA 4Q7ZA 2YMSB 1QA7A 3SU0A 3LGYA 1LHFH 2UWLA 3LKWA 1MTVA 5A0AE 1OP8A 4BNRA 2BDAA 4ZKOU 4E7RG 1OKXA 3OFND 2F9VA 3MI4A 3NK8A 1MAXA 2FOGA 3DCLA 3A85A 3U1IB 2KCOA 3RXGA 1NS3A 3RMNH 3SHCH 4NFFA 1GHAF 3V12A 1MABB 3E0PB 1L1NA 1C2EA 2ZGXH 3H5CB 1QFKH 2EEKA 1GBBA 1YPJH 3S9BA 2A4GA 1RD3B 2QN5T 1LDTT 2ZZUH 3MTYA 1EPTA 3KQ5A 1EJAA 3F2HA 4ISIH 3S7KB 1FUJA 3PMBB 2BY5X 3A80A 5GPIB 2OK5A 1CO7E 2XNIA 2AHME 1PYTC 4YXWD 2OP9A 7ESTE 4GCHG 3GCOA 1UHBB 2BDBA 1C2KA 4GHQA 2QAAA 5L6NH 1GL0E 1MKXH 3C1KA 3SV7A 1Y5BT 2ZCKP 2BHGA 1O2NA 3ZZ6A 1SL3A 2AGEX 2CXVA 4BAHB 5KEDA 1QCPA 3VEQB 4TWYA 5C0UA 1V2PT 3F9GA 1C5LH 1OYQA 1IQGA 2OBQA 1CGHA 4B75A 1O5FH 5EJLA 4OS6A 3D62A 1HFDA 3DSOA 4A1TA 4CHAC 5EJ1A 3TK5A 1BT7A 2BDCA 1UTQA 2EA3A 2PUQH 4UE7H 4I86A 1ZYOA 4TY7A 1ZSKA 3SO3A 1DY8A 1BMMH 1VITF 1J17T 2F3CE 4YOJA 1BTHH 4SGBE 3RXTA 4JK6A 1W0JD 1AZ8A 2BD5A 2BXUH 1PQ5A 2C90B 1GL1A 2EI7A 1CSOE 1H9IE 4X1NU 3PTNA 1KY9A 3SNCA 1H9LB 1O5EH 1K1JA 2PGBB 1WXRA 6LPRA 3B9FH 2TPIZ 1XMNB 4MQAA 1TNHA 2JETB 3F0PA 4RN6A 2GZ7A 2PGQB 3MNSA 3LDXH 3BTHE 3RXCA 2O8TA 3M36A 1YPGH 1MCVA 2TGTA 3NRLA 1P3EA 4OS7A 3P8NA 3SU5A 3S7HB 2UUJB 3DD2H 3KHVA 1OX1A 1C1OA 1Z8GA 1NFYA 2VIQA 4F4OC 1SGFA 4ZHMU 1DANH 1DM4B 1ANCA 1O2YA 3OEED 4D9RA 2J97A 2ZGJA 7GCHG 2KM0A 3NWUA 1P2NA 1V2QT 2Y5FA 3PWBA 5T1VA 2BOHB 3GY8A 1E0FD 1SGTA 1PYTD 2P8OC 3HKJB 1GVLA 1UTLM 3QWCH 1E34B 2FOHA 3LONA 3VGCC 4X6OA 4X1QU 3O8DA 1O2UA 1O3MA 3Q3YA 4ZUHA 4WJG2 1TLDA 1C1MA 1G2MA 1YPHE 3FANA 3G01A 3RXEA 1SLXB 1AD8H 2AS9A 3MH4A 4NA8A 1Y8TA 2FI4E 4K1TA 4Q7YA 3BEIB 2YNBA 3RXUA 1FZZA 3A8CA 4O3TA 1GBHA 3BIUH 1Q2WA 3L3TA 2W7SA 1FY4A 4NZQA 1KDQA 2KZ4A 1EASA 4YM9A 1E35B 4BTUB 1QB9A 3AK5A 4UFGH 3QK1A 4WH8A 5A8XA 1EJMA 3Q77A 4YESB 1TFXA 2FTMA 1T4VH 4ACAA 2GCHF 2XWBI 2ZU2A 5FHTA 3ITIA 3LGIA 1T31A 3K6ZA 3RLYH 8ESTE 2PTCE 2BZ6H 4Q80A 4TY6A 1GDUA 1GVKB 2FS9A 1CT0E 1VCPA 1Y3XA 2D2DA 3LJOA 4FVDA 3JZ2B 2H5CA 5DN6D 3M61U 1F5KU 1YF4A 5FX6A 1AO5A 3KQDA 2Y81A 1TMBH 5DP4A 1GHVH 4OGXA 5FBIA 1EFRD 1SGYE 2A5AA 2W6ID 1SI5H 1A0JA 5DP8A 1O2LA 2KCYA 2P16A 2F9UA 4KKDA 5C1UA 2FLRH 4K8BA 5F6MA 5LGOA 1EQ9A 2FOAA 1EPTC 1KXBA 2QXIA 4SGAE 1C5QA 1V3XA 1LQDB 2M5TA 3LC3A 4X1PU 2J2UA 6GCHG 2HPPH 2J5UA 2F9NA 4Z6AH 4MNVA 9ESTA 3SJKA 3F3BA 2RG3A 4Y7AA 2WUBA 4CRDA 1ELDE 3QTOH 1O3HA 3RXHA 1NPMA 3BSQA 5GXPA 1KXDA 1QURH 4KP0A 1HJ9A 1TABE 2RDLA 3TJUA 1D3TB 1C2MA 2Y6TA 4RI0A 1AE5A 1T4UH 2VH6A 1V2ST 5I46H 1WCZA 4AORA 1NRPH 1GHXH 1O0DH 5KGOA 3BTEE 1XUHA 1C1UH 5F8XA 2W7UA 1KMHB 3MU1A 3PWCA 1C4V2 4FU8A 4AG2A 3FN8A 1RIWC 1PPBH 1GI4A 4I7YH 4K5ZA 3QX5H 1OWKA 2XYAA 1BRAA 5CDFE 2H9TH 2FOEA 3OSYA 3ZVCA 1F5LA 2ZEBA 2A4OA 3SNAA 1SGPE 2P95A 1PQAA 1NRSH 4FUJA 3OTJE 2FX6A 1TX7A 2VWNA 3QGJA 2XBXA 1FAXA 3TVJB 1LVMA 1QBNA 1S6HA 2HWLB 2ZU5A 2QF5A 2HOBA 4ZHLU 1C4U2 1GDQA 5C17A 1LMWB 1QJ1B 2Z3DA 3IITA 2P94A 3GCHB 5JB8S 1C2IA 2V6NA 1RTFB 1W7XH 1D3QB 2FWWA 2Z7FE 4X8SH 3A7YA 4BAQB 5C1XA 1N8OB 2GMTB 4B2AA 1XUFA 2VU8E 1COWD 2K8IA 1QRWA 4X8TH 1VGCC 2WYJA 4GPGA 2ZF0H 3E90B 1ETSH 1S84A 1Z6JH 5GWZA 1GBAA 4CH2B 1TNJA 4IS5A 1XKBC 2FXRA 1CE5A 1GMCG 1P02A 1EZXC 3MU0A 2GVFA 3U8TH 3L33A 2BX4A 4IBLH 2BDYA 3E6PH 3A81A 3MNBA 2QIQA 2BDHA 1MBQA 5IYTA 3PV5A 1XUJA 2BY8X 3MOCA 2P3UB 1W7GH 1WQSA 3ATIA 1DVAH 3EA7A 3RXAA 3S9AA 3SUFA 3SV8A 1O3OA 1CBWB 4JZ1A 1DDJA 4LXBH 2NU1E 1OXGA 4XSKU 3WY8A 3A87A 4YOIA 5T6GA 2UUYA 5A0CA 1MBMA 8GCHG 3M5MA 2FOCA 3KEEA 1XXFA 2RFKC 5HGGA 3B23B 2O8LA 2C4FH 3RXBA 1A5HA 4UFDH 3TJNA 4DT7B 1VJ9U 3BG4B 3P8OA 2ODPA 4ESTE 3M7QA 1Y5UT 1ETRH 3ZVFA 2B9LA 2F9PA 1GHZA 1W0ZU 1ZMNA 3NXPA 1DLKB 3PMHB 2ZA5A 5ETXA 2SGAA 3MU4A 1A5GH 6ESTA 3SGBE 1SLVB 1A3BH 4XBCA 2A31A 1OYTH 5E0JA 3UOPA 4K3JA 1EP5A 1A0LA 2FEQH 4X2YA 1OWIA 4OS1A 2Q6GA 3T28A 2LPRA 3TH4H 5C67A 1SQAA 2WINI 2ZDKA 3UREA 2Z3CA 5DP7A 2PHBA 5EJZA 1C1TA 2ASUB 2Q6FA 1NFUA 1SGIB 3SN8A 1GVZA 2OD3B 1TIOA 5TCAA 1GHBF 1O2GH 3EYDA 2QF0A 1MTUA 3EAJA 3KYFA 5JB9S 1O33A 1K1PA 1DPOA 1XKAC 2AERH 3W1EA 1PQ7A 3MYWA 5F8ZA 5C1YA 4NIXA 3TGJE 4AFQA 1LKBA 1F0RA 1HJAC 2GZ8A 1EAWA 2IN2A 3U8OH 1MD7A 1NESE 4NIYA 2WPJS 1HNEE 1VJAU 5EPNA 1H8DH 4ABEA 5H4IB 5DKMA 2IJD1 1OPHB 1F2SE 1ZOMA 3A84A 1C4Y2 1GG6B 2J98B 4UD9H 1IAUA 4CBNA 3FVFB 3U28C 1IQHA 3N7OA 3BTQE 4NCYA 1JXPA 1YM0A 2A45B 3SORA 3QN7A 3F9EA 1TGNA 1TBRH 1SGEE 5T6FA 3F2GA 4NFEA 4JYUH 1QTFA 1KYNA 1DXWA 1IHTH 4HFPB 3SHAH 1MCTA 3SGQE 1O5DH 1WBGB 1LHGH 2JIZD 1YCPH 1YLNA 3IWMA 1ELFA 4E05H 2FIRH 3A86A 3RDZA 2F83A 4Z1MD 3ZZCA 3WW7A 2FZZA 1JBUH 2PFEA 3Q3XA 3UUZA 2WPHS 5E0HA 2HNTF 2H9EH 1AE8H 2O9QA 4FU7A 1FJSA 1L0ZA 2Z94A 1SKYE 4XDEA 2GCTC 5GCHF 2WPKS 5DO4H 2V3HH 5TCCA 4NIWA 2ESTE 3ZZ5A 4Q4LA 1KTTB 1W3CA 4WMFA 2V3MA 1NY22 2ZU4A 2BMGB 2FOBA 2XCFA 3UB0A 1AHTH 1C5NH 1T32A 2O8UA 2ZO3H 2RA0A 3RU4D 1A4WH 2CMYA 1G37A 3EGKH 4QT8C 1A61H 3KQEA 1J14A 1HAVA 4OS4A 2QC2A 2XBVA 1GBIA 3AAUA 1H8HD 5F03A 3DT0H 1C5YB 1J8AA 4CHAB 5TJXA 1NT1A 1P2KA 1GI0A 1VITH 2GV7A 4GHTA 1O5CB 1Z6EA 2ZHEH 2Y5HA 1TBQH 1P3CA 2D1JA 1QR3E 1ZMJA 2QXGA 9LPRA 4WY3A 4ZCNA 3MU5A 3HK6B 1O31A 1SHHB 5IDKA 1ACBE 1SSXA 2XCNA 3A83A 1HIAA 1L4DA 2VH0A 3GDSA 1AVGH 5DG6A 3SV6A 1GBMA 2KFWA 1QZ8A 3SJ9A 1ZMLA 3URCA 1QJ6B 1VITG 4HGCA 1TQ0B 2GX4A 3CENA 4CRBA 5A2MH 2ZP0H 2HRVA 2J38A 5DK1A 1J16A 3N7DA 1UVUH 2HLDD 1QBOA 3A7ZA 5CMXH 1GI6A 1Z8IB 3ATLA 3LGVA 3LT3A 1SGQE 3UNSA 3L6PA 1AB9C 3DA9B 1BJVA 4DIHH 1ANEA 1SFIA 1THSH 2VIPA 3SU1A 3UNQA 1MTNC 2P8OB 1HAPH 5DP3A 1O3GA 2FMJA 1THRH 8LPRA 3VGCB 1ESTA 2W5EA 2G4TA 2SNWA 2VVVA 4AGKA 1O2IA 1ZPCA 4NA7A 2ZQ1A 3I78A 1ZSJA 3SNEA 2PKSC 1XUIA 3O8RA 1O3AA 2ZDNA 2QYIA 1H9HE 1AKSB 3K9XB 2A1DB 3EQ0H 4NA9H 1GJ4H 2LP6A 4Y76A 4K69A 3RXOA 1HLTH 1A5IA 4MDSA 1TALA 1YCPM 4NGAH 2F91A 5EU8A 4I8HA 1IQMA 1C2JA 1RS0A 3PLKA 4JYTA 2OBOA 3PO1C 2BD2A 2HNTC 1V2VT 2ZWLH 5LH8A 5GIBA 2IPHA 4BTTB 1BHXB 4KTUA 2FI5E 2V0BA 3PMAB 5KECA 1BMAA 2ZKSA 3MH6A 1E38B 1IHSH 3STIA 4A7IB 1BQYA 4Y8ZA 2WV9A 5C0TA 4BAMB 1TOMH 1B5GH 2GCHG 1D9IA 1W0KD 2WHXA 1O2KA 2NWNA 2C8WB 3GOVB 4D7GA 4F49A 1EPTB 2ANMH 5DSFA 3F9HA 2GJGA 1BA8B 4MG3A 4AFSA 1SBWA 1QGFA 3QZRA 5J4QA 4ZKRU 3M5OA 1YPMH 2BQWB 1GGDC 1F0TA 1UK4A 2A7HA 2QXHA 1LHEH 4XE4A 4OGYA 2J4IA 4UONA 1TRMA 1EAUA 1MTSA 4P02A 4DY7B 2A2XH 1S82A 2F43B 4U2WA 1ESBA 1PQ8A 5HM9A 3SU4A 1K1OA 3BEUA 3A7TA 4B2BA 3TJVA 1W13U 4UDWH 3TNTA 2JH0D 4R8TB 1ZGVA 1OSSA 1NU9A 2TGAA 5LPEA 3T27A 4GSOA 5CHBA 2FDAA 1UTJA 3TK9A 1KXCA 1QL8A 2GZ9A 5FAHA 4LZ1H 3PM3A 4HG6A 2ZCHP 2BQ6B 3MMGA 1GI8B 3MWIU 2ZI2H 3ZYEA 1P10A
chains in the Genus database with same CATH topology
1ABIH 2OLGA 1ZPBA 1EX3A 1RIWB 3RM0H 2HPQH 1QNJA 2A5IA 1P2OA 1O39A 4AN7A 1S0RA 1EAXA 1SFQB 3LC5A 2DE8A 2ZFTA 1FQ3A 4JZDH 3RMLH 1ORFA 2AH4X 3M35A 1BZXE 2UUFB 2RA3A 1O3JA 1P2MA 2QV1A 1OWJA 2WV5A 2ZNKH 2SGFE 1LTOA 2ALVA 2G5NA 2BY6X 2OC1A 4WWYA 1BTWA 2XC5A 3AASA 3GYLB 1QQUA 1VGCB 3HATH 1Z7KA 1KIGH 1FY5A 5JDUB 1P11E 3R3GB 1QL9A 3SJOA 1ZPZA 1C5UA 1EKBB 1LHDH 1C5XB 1TRNA 1BIOA 2FX4A 1ZHPA 1T8NA 4A92A 1TGCA 1C5VA 1BMLA 1GJ6A 1BMNH 5JPMH 4NSVA 1Y3UA 4AB9A 4Q7XA 1KDQB 1N1LA 2TRMA 1ZTJA 3SBKA 3S9CA 5EPYA 1BRUP 5BRRE 1QL7A 3M3SA 5FXLA 1THPB 1RTKA 2BTCE 4INHA 1O3BA 1P2JA 1FIWA 5EOKA 1G30B 4ZH8A 2ZHQH 2ZHWH 2AMQA 2GT8A 1J9CH 2AFQB 1TPPA 3AW0A 1O2JA 1W14U 4DGJA 1D4PB 1IQNA 2OTVA 4CREA 4AFZA 2A7JA 2CHAC 2J92A 1GJAB 1ELEE 3ODFA 3T5FH 1W12U 4IW4E 3VB6A 3E8LA 1T8LA 4TPIZ 1O3EA 2ZGBH 4YO9A 4ZKNU 1CQQA 5E2OA 4O3UA 3ZV8A 1NFWA 2WPIS 3B8JA 2A2QH 2F9BH 1AVWA 2G52A 2VGCB 5EODA 2K1QA 1Q3XA 2ZHDA 1MKWH 3D23A 1GMDF 2R2MB 2NU0E 1C5OH 2R9PA 2AYWA 2TIOA 3P17H 4HZHA 1QA0A 1XM1A 2Z9JA 1TA6A 2ZC9H 3LH1A 1FPHH 3Q76A 5DGJA 2W3IA 2HALA 1IQJA 3UTUH 1EB2A 4MTBA 4GUXA 1C1SA 4NIVA 3H7TA 3GY7A 1MUEB 1MZAA 1GHBG 2ZTZA 1GJ8B 4XOJA 4CRGA 2QY0B 3P8GA 4X6NA 1K1LA 1A2CH 4THNH 2G55A 1XX9A 2XC4A 3GDUA 1KXAA 1P2IA 7KMEH 1D3PB 2OINA 3UWIA 2BX3A 1O3PB 3AVZA 5CE1A 1GCTB 1RRKA 4LK4A 1O2PA 3SJ8A 5FX5A 3U69H 1C1RA 1OP0A 1GI7B 4Y0YE 1NU7B 4CRCA 5EQSA 3DUXH 1GBEA 1ESAA 1SLWB 3MU8A 1MH0A 1HAGE 1IQIA 4YLUA 1D6RA 3JZ1B 1O2ZA 1AFEH 4DVAU 1B0EA 3F6UH 2CV3A 1SOZA 2FM2A 2BVSH 1BCUH 1TPSA 4J1YA 3TGKE 2XBWA 3P92A 2GCTB 1TAWA 3VB3A 2VJ1A 1HAYB 1KLTA 2QXJA 4DW2U 1ZJKA 2ZU1A 1GI5A 1C5SA 1ID5H 4X8VH 3A8AA 5EXLA 1HJ8A 1S81A 5DP9A 3PMJA 3A82A 3E91A 4PROA 2QF3A 1GMHF 2Y7ZA 3ESTA 1MKXK 1QQ4A 5E2PA 1L1GA 3S69A 3U9AH 3P6ZB 1FPCH 5FPYA 3V3MA 3LGUA 2Y7XA 2ZDAH 2PV9B 1G3EA 1QY6A 3RC6A 2G81E 1P12E 1W11U 3QGNB 3UIRA 4DJZB 3LU9B 2WPMS 1GBKA 2G51A 1SHYA 3ELAH 3K65B 3T62A 1DSUA 2OQ5A 1C1NA 1O3FA 4A1XA 3GY5A 4B74A 8KME2 1ETTH 4A5TS 1UTOA 4MPVA 3MHWU 1KXEA 3LJJA 1UCYH 2THFB 4AG1A 1EXFA 3SUDA 4U01A 1QBVH 3SU2A 3NZIA 1WYKA 2BM2A 1AUTC 1GCDA 5PTPA 1P09A 3O8BA 1ZTLA 1B0FA 1V2JT 4IMZA 2SFAA 3F9FA 4O03A 2BB4A 4NWLA 4FUEA 2I6QA 1L2EA 3SQEE 1K1MA 5EQQA 1O5BB 1UTMA 3ZZ4A 2FYRA 1YLDA 1FY3A 1W0YH 2GP9B 1C2FA 4WH6A 1ELCA 2V3OH 2YOLA 3UR9A 1BBRH 2ANKH 2PUXB 4Y7BA 3MH5A 5J4SA 3U1JB 4BAOB 3VXFH 3OU0A 4Y79A 2TGPZ 3BN9A 2KAIA 1O38A 4YLQH 3PYHA 1TMUH 1HRTH 1RGQA 2AMDA 4FUHA 4Y0ZE 1PFXC 5DP6A 3TIUA 1ANBA 5ESTE 4AX9H 3P70B 1HXFH 1GBLA 2WUCA 3V7TA 1P03A 1O2QA 2FOMB 4ZKSU 1ABJH 2BD9A 2PLXA 3AAVA 5LPRA 1ZSLA 4X2WA 1BBRE 2A4QA 1AFQC 2AMPA 3BTDE 5L2ZH 5FPTA 1F7ZA 2C8ZB 1YPLH 3FP8E 2GD4B 4XBBA 3SI4H 4H4FA 2PKAA 3SGAE 5A09A 2PSXA 1TQ7B 3RXFA 1T8MA 1G36A 5GDSH 3PO1B 4WF8A 1ZGIA 1VCQA 3C27B 2ZPRA 4YZUA 1V2LT 3OYPA 2OC7A 4ISLA 1DWCH 4E06H 4GVUA 5A8ZA 1H8IH 1EATA 1PJPA 3QDZB 2CF8H 4X1SU 1V2RT 3M7TA 1K2I1 2ZCLP 4Y11E 1INCA 4E7NA 5A0BA 5EG4A 2ZU3A 3VB4A 3M3TA 4Y71A 3GYMA 3E1XB 1O37A 1O2TA 4MPXA 1HAXB 1ZRBA 1NC6A 1SR5C 2BZAA 2FPZA 1P8VC 2AGIX 1L4ZA 2GGVB 3UWJH 3CS0A 2I6SA 2CJIA 4FU9A 1P9UA 3QLPH 1RFNA 1GGDB 1GI2A 1YPHC 3QO6A 1K1NA 3RXJA 3GICB 1V2NT 1DUAA 5AF9H 5HM2A 4ZHAA 1GHAG 1NM6A 1C2GA 3UQVA 4KGAA 4M7GA 1ARBA 3T26A 3NCLA 3SNBA 1GJBB 3ZZDA 1TRYA 1HAVB 1AU8A 3PROA 1EUFA 4A6LA 1GWAA 2IOTA 1FV9A 3VXEH 4BTIB 4U32A 1A46H 1G3BA 4Q2KA 1KLJH 1OP2A 1N8OC 2EC9H 1G9IE 1GBCA 2W26A 1V6DA 4I8JA 4AOQA 1WSSH 3U8RH 1O36A 1OS8A 2LNCA 1EOJA 5C5OA 1SLUB 3SW2B 2FOFA 5AHGH 4X6PA 1XUGA 1O3LA 3RXRA 6CHAC 1C9TA 4BANB 1SGCA 3E3TA 1UVPA 1HIAB 5C5NA 2FS8A 1S85A 1S6FA 1DWDH 1GBJA 5C2ZA 1BOQA 1SG8B 1KSNA 2WYGA 2B5TB 2OC8A 1SGNE 2ANWA 1BITA 3FZDA 2B7DH 2BQ7B 1O35A 1HCGA 3KQBA 3ZVGA 1PPZA 1TE0A 1WV7H 4YT6H 1EZUC 1FXYA 4ZXXH 3RLWH 1O3KA 4DIIH 3RXKA 2FESH 2Q1JA 3OY5U 4ABGA 1HAIH 1BTXA 4ZXYH 3LOXA 4CRFA 2G4UA 3I77A 1HB0B 4D7FA 4RKJB 2C93B 3GCTF 2BD8A 1N6YA 2WV4A 1A0HB 2BD3A 2BLWA 4WVPE 3T2NA 1GJDB 1DITH 1SB1H 1F5RA 1ANDA 3QZQA 1EAIA 1C9PA 1Y3YA 4B76A 3M5NA 2W3KA 4IGDA 3SUEA 1GJCB 2Z6BD 2R3YA 3P95A 2ZDLA 3BIVH 3D65E 2F9OA 3EDXB 1AUJA 3OX7U 2P3TB 1GJ5H 1QRZA 5C20A 1HV7A 2WPLS 3BTTE 1NRQH 4H42U 1TOCB 1S0QA 3DFJA 4D9QA 1P01A 1DICA 1ZLRA 2BOKA 1CHOF 2GV6A 2STAE 2ANYA 1AZZA 3MFJA 3OY6U 4ISNA 1RTLA 1BB0B 4MPUA 1CHGA 1AN1E 3GDVA 3ATMA 2XXLA 1DXPA 1V2UT 2H6MA 1RXPA 1DFPA 1YPKH 1DWEH 4X2VA 2Z9LA 2BDIA 2SGDE 4R0IA 1ZZZA 4AZ2B 4VGCC 5EXNA 3FAOA 2GT7A 4Y10E 3ATWA 2CHAB 3BG8A 4MNYA 3RXDA 1MMJN 3UNRA 1AKSA 3RXPA 2HVXA 1NRRH 1KLIH 1D3DB 3SV9A 4I8KA 2OCVB 1CT4E 2ZQ2A 4I33A 1V2TT 4BOHA 2XBYA 2IJOB 3RXIA 1WQVH 4YOGA 1GI1A 1ARCA 2BXTH 5HMAA 1MU6B 3EE0B 5BPEA 1BBRK 1MD8A 1F0SA 1ELBA 5EGMA 1EZSC 3ZVEA 1QB1A 1K21H 5CHAC 1SGDE 1V2OT 2P3FH 1NN6A 2ZFSA 4AFUA 2FO9A 3GISB 1VCWA 4ISOA 2Z9GA 4FUFA 2BY7X 4FVBA 1GMDG 2VWOA 1TONA 2B8OH 3TLOA 1NROH 5LPFA 2AIQA 3SU3A 1C5PA 1OOKB 5L30H 5F8TA 1IOEA 1DSTA 1BHXF 4RKOB 1CGIE 1AWHB 2JH5D 2ZDMA 4J2YB 1AGJA 1O2WA 4MNXA 4TPYA 1WTGH 1JRSA 1WTHD 1Z1IA 1UHBA 3V13A 2A32A 2R0KA 3I29A 2SGEE 4I31A 1AQ7A 2VVCA 2UUKB 2AIPA 4K60A 2XC0A 1SOTA 1O2XA 4OS2A 1BRCE 3O8CA 2H9HA 1TNLA 3RU4E 1W2KH 2ZFFH 4JMYA 1YCPK 1ELGA 1BRBE 1YGCH 4JCNA 1O30A 1JIRA 1C1VH 1K28D 1E37B 2B0FA 3LGTA 1F92A 1UVSH 3M3VA 1WU1A 2D26C 3EA8A 4TYDA 5B6OA 3MO3A 3PB1E 2BVXH 5FCKA 1TGBA 1CA0C 2JKHA 4CRAA 3ZVAA 3RMMH 3KGPA 1A7SA 2HLCA 2A7CA 1FAKH 2JH6D 4H6TA 3ODDA 5AFYH 1AIXH 3FFGA 2ALPA 1Z8RA 3TK6A 5SGAE 3ZVBA 4XFQA 2CN0H 3A8BA 4D76A 5JBCS 4HI3A 1Z1JA 2ODYB 1UTPA 3BTME 4FUDA 3HGNA 1QB6A 4B1TA 3UPEA 4LOYH 2ZHFH 3RXMA 4ZMAH 1F0UA 1O5GH 2BD7A 4BXSA 2ZTYA 4JZIA 3MO9A 1SQTA 3EA9A 1JOUB 1K9OE 2ZPSA 2CGAA 3QUMP 3UFAA 5JBTA 1GMHG 4X6MA 4CH8B 1TNGA 4TWWA 1A1RA 5E0GA 3GY6A 1P06A 2PSYA 4ABAA 3UOUA 4Y6DA 4B71A 3KN2A 1ZJDA 4B73A 4WMEA 3ZVDA 4U30A 4AYVB 1TX8A 2PW8H 3CS7A 2GKVE 2ULLA 4JK5A 3DHKH 2Z9KA 3SOSA 4A1VA 1O2OA 4NG9H 5HYOA 1C2HA 1IQEA 1FDPA 3BF6H 1HDTH 3ZZ8A 5K0HA 2VINA 1EOLA 1XUKA 1EZQA 3M7UA 1J15A 1XXDA 1Y5AT 1TA2A 2ZFPH 1G3DA 1A3EH 1IQLA 1O2VA 1O3DA 2Q6DA 1V2KT 4X8UH 3M5LA 2BY9X 3RXSA 1HAHH 4UEHH 4CBOA 1UTNA 4NWKA 1HAZB 2O8MA 3RM2H 1CU1A 4GCHF 1C1QA 1GI3A 1TB6H 1GBDA 2A4RA 2BLVA 2P93A 1HJAB 3P8FA 4I32A 1JMOH 1G32B 3ZV9A 1AFQB 4I8GA 1O2HA 2Y5GA 4YTAA 4X0WU 1Z71A 5T6DA 1WOFA 2FTLE 1LPZB 3A7XA 3RC4A 3BTKE 1Z8JB 2NU4E 1C2LA 1UK3A 3TPIZ 2BLOA 1W8BH 3FZZA 1YC0A 1ELTA 1O3IA 2GTBA 2UWOA 3K2UA 3M37A 5E8EH 1ZHRA 3TJOA 1HUTH 2H2ZA 3SUGA 2RCEA 2SGQE 3HK3B 4K2YA 1SMFE 4O9VA 3SZNA 3RC5A 2ZIQH 4ISHH 2ZFRH 3TH2H 1P2QA 1VR1H 3T25A 1FONA 2H5DA 1KXFA 1YYY1 3NPSA 5ESBA 4ABFA 5L2YH 3BTGE 3ZZ3A 2R2WU 1DS2E 1LPGB 1MTWA 4FUIA 4ZAEA 3E0NB 3TITA 3HKIB 3TU7H 4AYYB 1GDNA 1YKTA 1FLEE 2BDGA 2TGDA 2NU2E 4WXIA 2G00A 3FP6E 1TMTH 2FLBH 3GY4A 1P9SA 4JZEH 4DG4A 3LIWA 4FUGA 2BLQA 3PLBA 4YT7H 4WXVA 1H4WA 4K8YA 1O2RA 1NO9H 3RMOH 2PTNA 7GCHF 3U98H 1SGRE 2HNTE 1ZTKA 1TGSZ 2JETC 1TNIA 3IG6B 4KELA 3LH3A 4GLYA 1LCYA 2A0QB 2VWLA 5GCHG 3F1SB 1Q31A 1K1IA 1LHCH 4CR5A 1EJNA 3ZYDA 3AW1A 5EW1H 1UTKA 1ELVA 4O97A 5GJ4B 1LO6A 2VWMA 4NSYA 1TBZH 2OUAA 1LKAA 1P57B 5FBEA 1B7XB 1TNKA 3UR6A 1IQFA 1GPZA 3R0FA 4ABJA 1K22H 1LQEA 5JBAS 6CHAB 4GAWA 2D8WA 1S5SA 3QTVH 4X1RU 1O32A 1C5WB 1FI8A 4FXGH 3SV2H 1H1BA 4JYVH 3SJIA 1HPGA 2YNAA 2CF9H 2R3UA 2R0LA 5EW2H 1ZHMA 2PWXA 1AVXA 1UVTH 1UJ1A 7LPRA 4IC5A 1TGTA 2ZDVH 4MPWA 2GDEH 4ABIA 3SI3H 1T8OA 2ZTXA 3VB5A 1GBFA 1X7AC 3RXQA 4LZ4B 3URDA 1AY6H 1NTPA 2ZG0H 1UO6A 5I25A 1UCYE 3LGWA 2FYQA 3D49H 1AB9B 5ABWA 1HXEH 2KAIB 3SU6A 1G3CA 1S83A 2BVRH 3ZZ7A 4ABHA 1MTNB 1BTZA 1MU8B 1QHRB 2VIWA 2DUCA 2J34A 1CVWH 1PPCE 6GCHF 1P04A 4DURA 2AEIH 1VZQH 2Y82A 3ATKA 4HTCH 1KTSB 1YP9A 3MNCA 1P05A 1OWDA 2VB0A 1T7CA 3GCTG 3W95A 2VGCC 2PKSB 1E36B 2QA9E 5DP5A 2QCYA 1HBTH 1D6WA 3K6YA 3A7VA 4INLA 1JWTA 4WMDA 2P59A 3KF2A 4CR9A 1V2WT 4KTCA 1TYNA 1M9UA 1QIXB 1JIMA 2PKAB 5JYIA 3TH3H 1C1PA 2BYAX 1GBTA 3PLPA 3TNSA 2G8TA 4KTSA 3KQCA 3RU4T 1TWXB 3VPKA 3BTFE 1PPFE 2C8XB 3SQHE 4ABBA 1LPKB 4FUBA 3STJA 4MVNA 1NRNH 2Y80A 4VGCB