5F6MA

Isotropic trypsin model for comparison of diffuse scattering
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Cationic trypsin
publication title Measuring and modeling diffuse scattering in protein X-ray crystallography.
pubmed doi rcsb
total genus 62
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2015-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 5f6mA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 5f6mA02
4B2AA 3QX5H 1L1JA 1LDTT 2BY7X 2FOFA 4ISNA 1AD8H 2V3OH 3SU0A 3S0NA 1D6WA 1QFKH 2W7SA 4E05H 5A09A 1A4WH 3MO3A 2B8OH 3DUXH 1FMGA 4B76A 1XUHA 3LKWA 2VVVA 1O3FA 1NFYA 1F2SE 1AO5A 1NFWA 1ZHPA 7LPRA 2FTMA 1UVPA 4OS6A 4B75A 2UWPA 4UFFH 3SGBE 5J4SA 4BTTB 3MH5A 4WVPE 5H4IB 4OS2A 1O34A 2XC5A 1G37A 1AUJA 2VIVA 1GBMA 4JMYA 1ANDA 5HGGA 3T2NA 2FLRH 4CH2B 6GCHG 2GDDA 2BTCE 1C2DA 3SUEA 1KLJH 1TX6A 5CHAB 1K1IA 5EQSA 3PMJA 3ZVBA 4X8TH 3KCGH 5F03A 1K2I1 2BLVA 2UWOA 1O2KA 3UR9A 1H4WA 1XX9A 3OSYA 3BTWE 3HATH 4Y8XA 5A0BA 4WXVA 2CMYA 2ILNA 4X6NA 1LQEA 4YOIA 3TLOA 4NIXA 2A4RA 4CRBA 1KSNA 1EB2A 4I8HA 4TWWA 1Z8RA 1CVWH 2BY8X 3PTBA 3MO6A 3GY2A 3LH3A 1PYTD 4YLUA 1YPLH 2P94A 1C2IA 2J94A 4JZEH 1L1NA 2YNAA 2ZECA 2ANKH 1C2EA 4K1SA 3SNCA 1V2QT 1O2ZA 2UUYA 3TPIZ 1GVKB 1ZMLA 1UK3A 4XFQA 4ABJA 1QCPA 3URDA 3RXRA 3QTOH 2BLOA 1SVPA 1TGNA 4VGCB 1MH0A 1HV7A 5AF9H 1GDQA 1EP5A 1GBKA 2AYWA 4ABHA 1SHHB 2HVXA 3MU5A 3T25A 3Q3YA 1Y3WA 1A7SA 2UWLA 1O3LA 3RLYH 1DM4B 4I32A 1QBVH 1V2JT 4MPWA 1HXEH 4Y10E 1XUKA 3MTYA 2XWBI 3CP7A 2ZU5A 4BOHA 2GVFA 1IAUA 4MNVA 1C5RA 1K1NA 1EJMA 1AY6H 1TGCA 4GVUA 1E0FD 1GCTB 1G3BA 1NRNH 4XOJA 3BTDE 4ZH8A 1GMDF 1OYQA 2VH6A 2VIWA 3L3TA 1GI9B 1FNIA 3E1XB 6LPRA 1M9UA 2BZAA 1YCPK 1T4UH 2G52A 1Y3YA 1LPZB 1OX1A 5EU8A 2O8TA 1L2EA 4FU7A 4TY7A 2VU8E 1SB1H 4ZHLU 1YGCH 1T32A 2ODQA 2P93A 4BXWA 5C1UA 4GAWA 2V0BA 1UVSH 1JBUH 1O2NA 2BDGA 1YPHE 4J1YA 1A61H 3M5NA 1EAUA 2BLWA 1K1JA 2ALVA 1VZQH 2CGAA 3TGJE 4DY7B 3QZRA 1WCZA 5FBIA 1TYNA 1TA2A 4Q2KA 2FESH 4F49A 3A7YA 1ACBE 1P2OA 1AIXH 1Z7KA 3QUMP 4NGAH 1C2FA 3P95A 3OY6U 3A80A 2J2UA 4Y8YA 1W14U 2FYRA 2PKSB 1TPSA 2ZDMA 3RXFA 1CA0B 2BDBA 4LZ4B 5AFYH 2CV3A 4Q7ZA 3TITA 1FPHH 3M5MA 2WPJS 3SJ9A 2A4GA 1RGQA 3RUOA 2VIDA 1FY1A 3PMBB 1TFXA 1ZJKA 3SZNA 1C1SA 4DCDA 5HM9A 2QYIA 3PO1B 3T29A 2STAE 3TU7H 3KHVA 4ZHMU 1V2TT 3KN2A 1NO9H 1A0HB 2Y7ZA 3I29A 5GXPA 2QC2A 2ZFPH 1VITG 1UTQA 2XC4A 1ZMNA 1IQIA 3M7TA 2VWMA 1GWAA 4OS1A 1W0YH 2SFAA 3JZ2B 1LHFH 1P01A 2RA0A 2XYAA 3KL6A 1CT0E 1O3EA 2AH4X 5DP4A 1Y5AT 1FIZA 3C27B 3A87A 1W10U 1BRBE 4TPYA 2EA3A 2AERH 2ZPRA 1GI5A 3VFEA 2JH0D 1KLTA 2OD3B 1DANH 1KDQB 1MTUA 4X0WU 1OP2A 1O3KA 4JYVH 2ASUB 1GBFA 3K65B 3NK8A 3F9FA 1TPPA 2VIOA 3Q77A 3RMNH 1Z71A 2DE8A 4TYDA 1NFUA 1FY5A 4WWYA 2HPPH 2ZG0H 5DKMA 4B73A 3TGKE 2EI7A 1TWXB 4I8KA 3QGJA 1AE8H 1V2ST 3H7OA 3H7TA 1ZPBA 3RXKA 1MTVA 1AI8H 1UTLM 4BNRA 1V2UT 2TRMA 1NU9A 5EOKA 1UTKA 1EKBB 3ATKA 4YO9A 3PV4A 3TNTA 3PMAB 1D3DB 2ZGJA 1BMMH 4ZKNU 1O2YA 1YBWA 1GBLA 2VH0A 4LK4A 1KXBA 1S0RA 2I6SA 1S5SA 2R0KA 3FP8E 3E16B 1C1WH 5EPNA 3S9BA 2PWXA 3ZVEA 2GZ9A 1O3OA 1QURH 1AB9B 1O3AA 4Y76A 5AFZH 3VGCC 2XBXA 2D8WA 4B71A 2GCHF 2FX4A 1BMLA 1GPZA 1O3PB 4F4OC 5EPYA 3P8OA 1CT4E 1MUEB 1BBRH 2Q1JA 1GI0A 2Q6GA 1LHGH 3F68H 2B7DH 1WV7H 2AIPA 2ESTE 1O2QA 1NFXA 2ZFQH 1TGBA 1C5QA 3RXQA 2SGEE 4QT8C 4ZROA 2ZGHA 2WPHS 5GCHF 2P8OC 1Y59T 4GLYA 3W94A 1H1BA 4UDWH 8KME2 1V2VT 3GCHC 1FI8A 2B9LA 1MKWH 2H1UA 4M7GA 1OWIA 4E7RG 1JWTA 1G32B 3ZZBA 4IN1A 1L0ZA 1DWEH 3EYDA 2XCFA 3UWJH 2ULLA 1GJ6A 3BG4C 2BY9X 4YESB 5A8YA 4X8VH 1C5ZB 3SBKA 3SN8A 5A8ZA 3ZZ7A 1X7AC 1B5GH 1FJSA 4WH8A 1ZYOA 5JPMH 5FCRA 2OCVB 2V6NA 1BDAA 1SGCA 1IQHA 4X2YA 3UFAA 1CA0C 3FZDA 2R2WU 1JRSA 3V3MA 1CGHA 3LGIA 5L2ZH 3TJVA 4I8GA 4R8TB 5EXMA 4DJZB 1W13U 5K7RA 1E34B 2ZHQH 1O2VA 2QF0A 4CRFA 1P03A 2GZ8A 4Z0KA 1GBBA 3PO1C 2OUAA 1TOMH 2M5TA 3RDZA 5FHTA 4YOGA 1OOKB 3A82A 3PLBA 1O3GA 1THPB 1MAYA 1TAWA 1FN8A 7GCHF 2AEIH 1D3PB 2FIRH 3RLWH 1L4DA 3BIVH 4CRDA 1GJ9B 4ZHAA 2CXVA 1O31A 2QV1A 3QDZB 4Y8ZA 2ZDNA 1DY8A 1HJAB 3MMGA 1XVMA 3CS7A 1TMTH 2F83A 2LPRA 1GI3A 1QTFA 1GL0E 1GHBG 1P57B 1G2MA 1AFEH 5EQRA 2GCHG 1A5GH 4D7FA 2ODPA 3TGIE 2A4OA 4UE7H 3UNQA 4IN2A 1LVBA 2O8LA 2ZFTA 2SGDE 3IWMA 1SGEE 1TRNA 1V2LT 2BOHB 1LVYA 1KTTB 3MHWU 3VXEH 1DT2A 1O2PA 1NESE 2Y5HA 1PQ5A 3KF2A 1O2OA 3FP7E 1YKTA 3OYPA 1C5NH 1LPKB 3BSQA 3V12A 4ZAEA 3AW1A 4KGAA 2F9PA 3UUZA 2G5VA 2Q6DA 3LH1A 3HK3B 1HUTH 3UR6A 4YOJA 3RMOH 1RRKA 3SV8A 1EPTC 4DIIH 2Q6FA 3VB6A 4CBNA 1UTPA 2A5IA 3SJ8A 1ELBA 4ISOA 3ZVAA 5FPYA 3SUFA 1BMNH 1DY9A 1BA8B 1CGJE 2WV4A 3U8RH 4IW4E 1GMCF 3HKIB 1GGDC 4X8UH 5C2ZA 1VJAU 1J15A 4AG1A 1ZMJA 5C1YA 5F8XA 4H42U 1HAVA 3ZV8A 3LDXH 1U6QA 1LHDH 1UK4A 1UK2A 2ZFFH 2Y7XA 5AHGH 1O2GH 1O32A 5EXLA 2TGDA 1P04A 3ZVDA 1LVOA 1QR3E 5DP5A 1EJAA 2VWOA 3GY6A 1SR5C 1O2RA 1GI7B 1TB6H 4JZFH 2BDHA 1QQUA 3HKJB 1VITH 3SGAE 4R0IA 3DHKH 1NPMA 1P3EA 1SI5H 5EXNA 2CJIA 4FUHA 4NZLA 2PKAA 1FN6A 4A1VA 4BAHB 2VGCC 5E2OA 2ZTXA 4K69A 2FODA 4OGXA 3OU0A 4YM9A 2P16A 5ABWA 1TBZH 3AAVA 4JZ1A 1TPOA 1UCYE 4MPXA 4K60A 2A5AA 2FP7B 2R3UA 2R3YA 4NFEA 2PGBB 4DG4A 1AE5A 3RXIA 2HALA 1Z1IA 2Z3DA 2Z9IA 2CF9H 3ZVCA 1THRH 1TA6A 5LPFA 1GMHF 1RIWC 5G4BA 2ZGBH 1O5DH 2ZHWH 3T27A 1MZDA 4RSPA 1PQ7A 1CU1A 3GDUA 4U01A 4H6TA 4BAOB 1GI8B 1EPTA 2SGQE 2EC9H 1N6YA 4X1PU 5A0CA 3LC5A 5A2MH 2BX3A 1NRQH 3RXTA 1F0SA 5GPIB 1NM6A 1NROH 1MCTA 4NIYA 4AGKA 4LZ1H 4WMDA 8GCHG 4DT7B 4WMFA 2OBQA 5L6NH 4AG2A 1BITA 1C1NA 1EXFA 4K5ZA 1C4U2 1L1GA 2QA9E 4AYVB 1RTKA 1XKAC 2ZFSA 5BRRE 3D65E 1AKSA 1E37B 1CE5A 3U1JB 3ZZDA 1ANCA 1CBWC 3ZV9A 4A6LA 5EW1H 1HAPH 2ANMH 1C1TA 4MPVA 1NY22 5C5NA 1KXAA 2O8MA 1BBRK 1NTPA 1UHBA 3LPRA 3OY5U 1HJAC 3BG8A 1QBOA 2Z9GA 1O2XA 5ETXA 1QRZA 3UY9A 1TNLA 3G01A 1GJ5H 1YPKH 1BTZA 4GSOA 1YYY1 1MD7A 3BEIB 2F9NA 4WH6A 4BAQB 1XUGA 4Y71A 2XW9A 3U1IB 3RXCA 1NRPH 2H6MA 1W2KH 2Z94A 4XDEA 1CHOF 3SNBA 1PPBH 2CF8H 1O3DA 1C9TA 3D23A 3LONA 4OGYA 2G4TA 2GV7A 1MKWK 3MU4A 1T8OA 1SG8B 2FOBA 1ABJH 4U30A 1GJ4H 1DITH 2AMDA 3BTME 2FS8A 4UFGH 5DP6A 1AUTC 3PMHB 2XBYA 2C8YB 1KIGH 2PTNA 4IC5A 4FUBA 2JH6D 1B7XB 1C5XB 1QRXA 2VNTA 3E91A 1SL3A 5JBCS 1LMWB 2GTBA 3RC6A 2K1QA 3O8BA 3R0FA 4I33A 3SV6A 1EASA 4AORA 1C2MA 3TH3H 1NT1A 1AFQB 2GGVB 2ZC9H 2A31A 2GKVE 4O3UA 7KMEH 2J38A 2BVSH 2IPHA 4FUCA 6CHAC 2FLBH 3S7KB 1J14A 1TRMA 2ANWA 5LPEA 2ZQ1A 5I25A 3AASA 3U69H 3AAUA 3S9AA 8ESTE 2DE9A 1UTJA 3KEEA 2Y5GA 4KTCA 5E0GA 3RC5A 1K1MA 3BIUH 3U98H 1BTUA 4AOQA 1QGFA 3RM2H 1SOTA 4Q7XA 3GOVB 3QTVH 4TPIZ 1MTSA 1DFPA 2BMGB 3ESTA 1GI1A 3M7UA 1K1LA 2UUFB 1V6DA 1RJXB 3QZQA 5DPAA 3MNXA 4AFZA 1MD8A 1RS0A 4X1SU 2B0FA 3NPSA 1TBRH 4NA9H 3GCNA 3T26A 2PTCE 3RXVA 5TCAA 5JYIA 1HJ9A 3FFGA 2CHAC 2RA3A 2G51A 5F8TA 1QB6A 1Z6JH 1GHXH 3Q3XA 2FOMB 2O8UA 4I31A 3BTKE 1YCPM 5E0HA 1FY3A 1ZSKA 3RXSA 1SBWA 1O3MA 2C4FH 2ZPSA 1Y5BT 5T6GA 2ZKSA 2TBSA 1OXGA 1D4PB 2FMJA 1DLKB 2Z9KA 2ZZUH 2O8WA 5I46H 1NRSH 1ZSJA 3BF6H 3EA8A 3TVJB 3VGCB 5L2YH 1OP8A 1ARCA 2BM2A 5C67A 1T31A 2QY0B 1YP9A 1C5SA 1KY9A 4X1RU 1OYTH 1F5RA 3CENA 1OWKA 2BXTH 1J16A 4I8LA 2PSYA 1MU8B 3RXOA 4TY6A 1P11E 3FAOA 3CS0A 4IGDA 1TIOA 4JK6A 1QJ1B 2BB4A 5JBBS 2ZPQA 1MAXA 2H9TH 1CGIE 1K21H 1TMUH 1UVTH 2VINA 3M37A 4PROA 2P8OB 1QL7A 4X2XA 3GCHB 2TIOA 3PROA 4CRAA 2VVCA 1V2NT 1TOCB 1O3IA 1XXFA 4RN6A 4KELA 5DO4H 1ETSH 3SUDA 3FVFB 3V7TA 1S82A 3GDVA 2QCYA 1DX5M 1TNKA 2C8ZB 4OS4A 3BG4B 2QIQA 5FPSA 1W8BH 3QLPH 3RXLA 1S6FA 2WINI 1OKXA 3GY8A 1HAXB 3A8BA 1O38A 1GHWH 3MI4A 3R3GB 4D7GA 4ZMAH 3A8DA 1JOUB 3SU4A 3V13A 2BD3A 4ABGA 4GCHF 3A8CA 3P70B 5DGJA 2STBE 4FUEA 2WPLS 3RXUA 3URCA 1WQSA 3EAJA 3GY7A 1BTWA 1BRCE 3NWUA 2ZTYA 4K8YA 1GHZA 2XBWA 1ETRH 1MQ5A 1HAYB 3E3TA 1IOEA 3I77A 2SGPE 1E35B 3A84A 1ANEA 1ORFA 1RFNA 1WTGH 2G4UA 3E6PH 4AFSA 1MMJN 1H9IE 1T7CA 2F9UA 2WV5A 2ODYB 1O3HA 3RMMH 1HAVB 2O9QA 4BXSA 3RC4A 3E8LA 4UD9H 2OLGA 5DJ7A 4X6MA 1C1MA 1TX7A 3U9AH 4E06H 1GBJA 2BY5X 2FXRA 3RXEA 1SFQB 2OQ5A 1Y8TA 1GVLA 1LKBA 5FX6A 2QAAA 1AFQC 2C90B 2OXSA 3GY5A 2A1DB 3TJNA 3ZYEA 2VVUA 3QO6A 3P6ZB 4TWYA 3UQVA 1GMDG 3MYWA 1DICA 3KQBA 4Y11E 4B74A 2WPIS 5IYTA 2HWLB 1B0FA 1H8IH 3LGYA 1C2GA 2PKAB 2C93B 3DA9B 1V2PT 5DP7A 1LKAA 2JETB 2NU0E 4X8SH 1VGCC 3PLPA 1EP6A 1KYNA 1P2NA 1DUEA 2G00A 2BD8A 2ZDLA 3QGNB 2J92A 3HGPA 1TNGA 3RU4T 1YC0A 1CQQA 4Q7YA 1JRTA 3ZYDA 1XUJA 1SGRE 1QRWA 2GV6A 3NKKA 1KXEA 3VB5A 3AVZA 5LPRA 1O5EH 3B9FH 4NA7A 3TNSA 1SLVB 5GJ4B 1FY8E 1IQKA 2IN2A 1KTSB 2Y81A 2AFQB 3M5LA 4X2WA 1FV9A 3UREA 3MU1A 3LIWA 2FZZA 4U2WA 3TK6A 2XNIA 1EPTB 3KIDU 3FP6E 1GHYH 4JZIA 1HAHH 3GDSA 8LPRA 5EW2H 3A85A 1SGYE 1GHVH 4Y7BA 1SLWB 5JBAS 1AGJA 1Y5UT 1P9UA 3MU8A 1GGDB 1K22H 1Y3UA 1WUNH 1UVUH 1AKSB 1GI6A 1CA8B 3LGWA 2Z7FE 3IITA 3LC3A 2BY6X 2QF3A 5IDKA 5L30H 1DWDH 4FVDA 2BVRH 2P59A 4X2VA 2HLCA 1UHBB 5FCKA 3HGNA 3UNSA 3MU0A 4D8NA 1A2CH 3SO3A 2YOLA 1EZUC 3LJOA 2KAIA 3UOPA 3D62A 1P05A 3P8GA 1GDNA 3A7WA 3EDXB 4MQAA 2CN0H 3MFJA 1HAIH 3K6ZA 3O8RA 1FAXA 4BTUB 2BD9A 1GG6B 7ESTE 4KTSA 4Q80A 3A81A 1YF4A 2VGCB 1TPAE 2ZNKH 1C9PA 1GI4A 1A46H 1V2KT 4FUJA 4YTAA 3T5FH 2PUXB 2QN5T 1ZPZA 5DP8A 1EB1H 1BRAA 1LPGB 4JK5A 2FOGA 2J4IA 3T28A 4D9QA 4INLA 4YZUA 1RIWB 1D6RA 2HNTC 3PTNA 4MNWA 1ELEE 1C5YB 1V2RT 1W12U 3P17H 1O33A 3ZZ5A 1BBRE 4SGAE 1O2UA 4RKOB 1HXFH 5T6FA 2BQWB 1P2JA 3RMLH 3SUGA 4FVBA 2ZU2A 1AZZA 1PFXC 4IBLH 1HFDA 1GBTA 1O3JA 1HJ8A 1EJNA 2P3FH 3SHAH 5HXFA 3C1KA 3E90B 1BHXB 2FEQH 3HK6B 1C5LH 1EZQA 3SI4H 3BV9B 1W7XH 2BX4A 1FQ3A 1SFIA 4FUGA 1CBWB 1ELCA 1Q2WA 4A92A 1AVXA 3S9CA 4ZXYH 2P3TB 2PV9B 3M35A 4INKA 3Q3KA 1TNIA 3LGTA 2EEKA 1C1OA 1HGTH 3ZZ4A 2J95A 1O37A 2NU3E 1F5KU 2Z3CA 2P95A 3N7OA 2ZF0H 4HTCH 4DOQA 1GBIA 1FZZA 1BZXE 1H9HE 1W11U 2F9OA 2HGTH 1NZQH 2JETC 4NA8A 4MTBA 2FPZA 4IMQA 2GCTC 3A7ZA 3BTQE 3M3VA 5A0AE 3BTFE 1RTFB 3SNEA 3F9GA 1ELDE 2PLXA 4Y7AA 3UWIA 5AVDA 1PPZA 3SNDA 1DSTA 5GCHG 5C1XA 3W95A 5JB8S 4GUXA 4MPUA 1P09A 4ZXXH 3SGQE 3ZZ8A 1PQ8A 4AB9A 5GWZA 3VXFH 1WYKA 1GJ8B 1DDJA 2ZCLP 1G9IE 2PGQB 4UFEH 2VJ1A 4O03A 1IQMA 4MG3A 1SGTA 1YLDA 2BDYA 4AN7A 4WF8A 3NZIA 3ZZCA 6CHAB 1S0QA 5FXLA 1GJCB 4AFUA 3GCTF 2V3HH 1ZPCA 2TGAA 1IQGA 4O3TA 2R2MB 3SV2H 2F9BH 4IC6A 2JH5D 3M61U 1SGQE 1T8MA 4NWKA 1QL8A 2BQ6B 1BTHH 1HIAA 3PWBA 1N6XA 2OTVA 1C4V2 4B2BA 2GMTB 4GPGA 1T4VH 4H6SB 1GBEA 2W26A 1EATA 1XXDA 1T8LA 1FLEE 3KGPA 2A7CA 7GCHG 1UCYH 1LTOA 1SC8U 4FUFA 5T6DA 2OC7A 3VEQB 1IQLA 1VR1H 1OS8A 2VWLA 3OTJE 1IHSH 2Z9LA 1C5WB 2ZHDA 3A88A 3ZVFA 1O3CA 3M7QA 2CHAB 3EGKH 3SU5A 2A7JA 1GG6C 3ATIA 4ABEA 1C1PA 1EX3A 1UO6A 1WTHD 1KXCA 2UUKB 2OC1A 1YLCA 3NUMA 3SORA 1NRRH 1ELGA 3MNSA 4A5TS 1C2LA 2DUCA 3TJOA 1FY4A 4CRCA 1AZ8A 2BXUH 1TLDA 1W3CA 3PLKA 3SQHE 1PPGE 4XE4A 1ZZZA 1TX8A 3LGUA 2NU1E 4X6PA 4AYYB 2OBOA 3RXBA 1Z8GA 3ZZ9A 1SOZA 1OWHA 1VCQA 1B0EA 6GCHF 2Y6TA 5FBEA 1HYLA 1QY6A 4NG9H 2SGAA 4B2CA 4Y79A 2WUBA 1ARBA 3GY4A 2HOBA 3A86A 4FU8A 3SV9A 1P2KA 1SSXA 1BOQA 2W3IA 1V3XA 1GHAF 2ZU4A 2BD7A 3ZVGA 1BRUP 2TPIZ 3SV7A 1O2JA 3BEUA 2D26C 2QXJA 2SNVA 2Y5FA 3PWCA 1C1RA 3RP2A 2LNCA 1S81A 3KQCA 1G3DA 1PPCE 1GBDA 1QBNA 1ZJDA 1E38B 3RM0H 5F6MA 3TJUA 1K9OE 4Y6DA 3RXMA 2BD2A 4THNH 1VJ9U 1BIOA 3VB7A 3GCTG 1IQNA 2ZI2H 1THSH 2FI3E 4CR5A 1UTOA 4X6OA 1GMCG 1C1UH 4YT6H 2A5KA 3UIRA 1ZTLA 2WPKS 3STJA 1N8OC 4HZHA 3KNXA 3ODDA 3HPTB 1ZRBA 2XXLA 1EZXC 1MTNB 2WUCA 1C1VH 2B5TB 3S69A 2G81E 1BTPA 3T62A 5JDUB 3EA9A 4ZKRU 1O3BA 3U8OH 1O2SA 2R0LA 2ZDVH 1NU7B 4IS5A 2ZFRH 2ZHEH 1P2IA 2BD4A 1FDPA 3EE0B 1HLTH 2FWWA 3SU6A 3B8JA 2VIQA 3SJKA 1ZLRA 3GY3A 1JMOH 1MBQA 4O9VA 3LT3A 4JZDH 3ZZ3A 4JCNA 2XC0A 4ABFA 4CRGA 1TNJA 2YNBA 4CBOA 1W0ZU 2J9NA 2VIPA 4CREA 4WJG2 2VWNA 1QJ7B 1Q3XA 2KAIB 4D76A 1C2JA 1PJPA 2OC8A 1P12E 4YT7H 3PYHA 2A4QA 1C2KA 1JIMA 2PUQH 4CHAC 1GMHG 1O2MA 2Z3EA 5ESBA 3MO9A 1J8AA 1HB0B 1SHYA 3E0NB 3ATLA 1VGCB 2BVXH 1F0RA 4FUDA 1GHAG 5EG4A 2FOAA 5ESTE 3UPEA 1EOJA 3GCOA 2ZP0H 1TE0A 1J9CH 3UNRA 3L6PA 1IHTH 2RCEA 2PSXA 1TABE 2GMTC 2GT8A 2BHGA 4Y0YE 1S84A 2AIQA 3FZZA 4CH8B 4ZKOU 1Z8JB 1WOFA 1Q31A 1FIWA 3RXDA 4UONA 1V2OT 3RXAA 3TK9A 5DP3A 2W3KA 3RU4E 1INCA 1O35A 1LHCH 1XVOA 3M3SA 5PTPA 1K28D 1H9LB 1TMBH 2TGTA 2ZTZA 3F9EA 4LXBH 1Y3VA 4CR9A 1ELTA 2AMPA 2HPQH 1SGFG 4BAMB 1SQTA 3K9XB 1ZHMA 1C5TA 1CHOG 1MQ6A 3ATWA 1A5IA 1WQVH 1AQ7A 3UQOA 5HYOA 1TNHA 2BDAA 1ZGIA 2ANYA 2GDEH 1EZSC 3RXGA 1ZTJA 3BEFB 3BTTE 1KLIH 1MCVA 5DP9A 1Z6EA 4K1TA 2C8XB 4Y0ZE 1VITF 1HDTH 2A2XH 1DWBH 1BJUA 2FDAA 4X1QU 2ALPA 2IJOB 1BT7A 2EI6A 5FAHA 1GJBB 1BB0B 3DD2H 2XCNA 3ZZAA 1BHXF 2PHBA 2RDLA 1A0LA 2NU2E 1LHEH 2H9HA 5EGMA 5C5OA 1SQOA 1QNJA 1S83A 4BANB 1HNEE 3E0PB 1BCUH 1K1OA 5EQQA 1A3BH 2AS9A 3P8FA 4XBDA 3GISB 3Q00A 5SGAE 1LCYA 2BOKA 2C3SA 1O5BB 1PQAA 4ISLA 4RKJB 5DG6A 2W7UA 3ELAH 1OWDA 2HRVA 1ZHRA 3P92A 1YPHC 3BTEE 1WSSH 2GX4A 4KKDA 2AGEX 1Z8IB 3P8NA 1GDUA 2WPMS 4DVAU 4MNXA 1UCYK 1XKBC 5JBTA 3PB1E 1JXPA 2SNWA 3SQEE 1P2QA 4WMEA 3A7VA 1ETTH 2G55A 1QA0A 3U8TH 1MTNC 1QA7A 4O97A 2BQ7B 2QXHA 3WY8A 2Z6BD 1WAYB 1SPJA 4Z6AH 1O2HA 5CMXH 3PM3A 1TALA 1G36A 3K6YA 1C5OH 1KXFA 1C4Y2 3SU1A 3SU3A 1O30A 2V35A 5LH8A 1Y3XA 1GCDA 1BTXA 1NC6A 1MBMA 2A7HA 3ZZ6A 1ABIH 1DPOA 1RXPA 3SI3H 1DLEA 1F0UA 4FXGH 3RXJA 1VCPA 4INHA 1TQ7B 2UUJB 5FX5A 1WU1A 4NZQA 5E0JA 1HIAB 1KXDA 3A89A 2FTLE 3ODFA 1ZGVA 2QXGA 2H5DA 3L33A 1GJAB 3IG6B 1QIXB 3MNCA 1DVAH 1O0DH 1RD3B 4OS5A 4AZ2B 1HBTH 4KTUA 2GT7A 3SHCH 2FI4E 4HGCA 1O2IA 4E7NA 1DXPA 3A83A 9LPRA 4IMZA 5T3HA 1Z1JA 1L4ZA 1QJ6B 5CHAC 3RXPA 3A8AA 1ESBA 1DWCH 5J4QA 4A1TA 1AMHA 1ELAA 1O2WA 1YPGH 4NIWA 4UEHH 2GCTB 4XBCA 1GI2A 1MTWA 2OINA 6ESTA 1O5FH 2F3CE 3TH2H 1PPEE 1HAZB 3D49H 2A32A 3VB3A 3ITIA 4HI3A 2PW8H 5HMAA 3TIUA 1AVWA 4NSYA 3O8DA 2A2QH 4ZUHA 2AGGX 3LJJA 1IQJA 4NIVA 1C5VA 1MKXH 2PFEA 3ENSB 3FANA 4WXIA 1T8NA 3UOUA 5CE1A 2D1JA 1GBCA 1SGNE 1HAOH 1C1QA 1NN6A 1A1RA 4FUIA 4B1TA 5TJXA 1E36B 4ABBA 1O2TA 1VCWA 1ZRKA 2ZU1A 3JZ1B 1O39A 1A5HA 4VGCC 1G3EA 2XWAA 1ANBA 2NWNA 4GCHG 1S85A 1D3QB 1QB1A 4H4FA 3RU4D 1D9IA 1BTYA 1UJ1A 1F0TA 3O8CA 2Y82A 1ZR0A 2QGRA 2F9VA 2FOEA 1XUIA 2ZQ2A 1D3TB 1SQAA 4JYUH 1O5CB 1PPHE 4K2YA 4NSVA 3RXHA 2ZWLH 2F91A 1GJDB 1P10A 3EQ0H 4XBBA 2H9EH 3DFJA 3OX7U 4K1EA 3ATMA 3DFLA 1OWJA 1GCTC 3MH4A 4A7IB 1SGDE 3SJOA 4ABIA 1GHBF 3M3TA 2SGFE 2THFB 3MWIU 1G2LA 2ZCKP 1AHTH 1FAKH 4ZKSU 1GJ7B 4BAKB 2XBVA 2GP9B 1EAXA 2FX6A 1QQ4A 2BDIA 3SOSA 2FO9A 2ZDKA 4ESTE 2G8TA 1DS2E 2ZGCA 3NCLA 4K3JA 4GHTA 1TONA 1UTMA 1NS3A 2A0QB 3MNBA 1C5UA 1MU6B 1IQEA 5DK1A 5K0HA 3QWCH 2AGIX 1F92A 2ZO3H 5C3NA 1AN1E 2RG3A 4AB8A 9ESTA 1EAWA 2R9PA 4WY3A 4X1NU 4DURA 1QL9A 2HNTE 1XUFA 3TK5A 1LVMA 4GHQA 1ESAA 1OP0A 2FOHA 4I8JA 2FM2A 1LO6A 1P2MA 3K2UA 1C2HA 4MLFB 4OS7A 1P0SH 1YM0A 4HFPB 1WBGB 2PKSC 3LGVA 2WYGA 1BUIA 3QN7A 1OWEA 1CHGA 5F8ZA 1BJVA 1G3CA 2A45B 1YPEH 1ELFA 5C20A 4ISHH 5GIBA 5BPEA 2IOTA 1UTNA 1P06A 1N8OB 2H5CA 1SLUB 1GL1A 4SGBE 2P3UB 1H8DH 2BDCA 3I78A 1O5AB 2I6QA 1BMAA 2JKHA 1IQFA 3BTHE 1ELVA 2Y80A 5HM2A 1FPCH 2ZA5A 3TH4H 1HAGE 1RTLA 2NU4E 3M36A 4MNYA 3V0XA 1YPJH 1W7GH 1C5MD 1OPHB 5GDSH 2OP9A 1ESTA 1LQDB 1O3NA 1P3CA 1BQYA 3B23B 1HPGA 3M5OA 5JB9S 3SW2B 1YPMH 1HRTH 1F7ZA 3KQEA 3F1SB 1UVOA 3GICB 1A0JA 4D9RA 5A8XA 1SLXB 1K1PA 3EA7A 3LU9B 2QXIA 2AMQA 3F6UH 3SU2A 3MH7A 1J17T 3SJIA 4CHAB 1GBHA 4I7YH 1G30B 1DOJA 4U32A 1ID5H 2GZ7A 2ZCHP 4XSKU 1PYTC 8GCHF 1P02A 5EODA 2BZ6H 2PR3A 3GYLB 5FPTA 1YCPH 4AGJA 4KP0A 3BN9A 4FU9A 3S7HB 4K8BA 3QK1A 2OC0A 3BTGE 1N1LA 3STIA 2VB0A 3Q76A 4DIHH 1TQ0B 3LOXA 2Z9JA 1FXYA 4A1XA 1ZOMA 1DXWA 2TGPZ 1OSSA 2GD4B 1AWHB 2ZIQH 2FI5E 2OQUA 2ZHFH 3F9HA 4ISIH 1CO7E 1SGPE 1AB9C 1XM1A 1S6HA 4BTIB 1A3EH 1P9SA 2ZDAH 1TGSZ 1CT2E 4J2YB 5B6OA 1ZSLA 1DUAA 2WYJA 5LGOA 1SGIB 3KQDA 4AX9H 5E8EH 4JYTA 3NXPA 3GYMA 4YLQH 4ASHA 1DSUA 1EQ9A 4MVNA 4MDSA 2HNTF 1DE7H 1AU8A 3VB4A 1AVGH 2J34A 1EAIA 5TCCA 1SGFA 3UTUH 4NFFA 1EOLA 1UMAH 4LOYH 2FYQA 1MKXK 3MH6A 4DGJA 1AWFH 2ZEBA 2FOCA 4NWLA 4AFQA 3DT0H 1KDQA 4NCYA 1TRYA 1QHRB 2ZU3A 2FS9A 3MOCA 1CSOE 4DW2U 2ZGXH 1EUFA 2D2DA 1V2WT 1P8VC 1QB9A 1O5GH 2G5NA 3SNAA 4ABDA 2BLQA 1GVZA 1O36A 1O2LA 3H5CB 2EI8A 1PPFE 1ZTKA 1JIRA 1XMNB 5E2PA 3VPKA 1GBAA 2BD5A 2XRCA 1TBQH 1FONA 1F5LA 2C8WB 1C5PA 1FUJA 1V2MT 3A7XA 2W5EA 1TGTA 1SMFE 3A7TA 2BYAX 4ABAA 3AW0A 1HCGA 2H2ZA 4UFDH 1MZAA 2XTTB
chains in the Genus database with same CATH superfamily
4B2AA 3QX5H 1L1JA 1LDTT 2BY7X 2FOFA 4ISNA 1AD8H 1W0JD 2V3OH 2KCAA 2F4LA 3SU0A 3S0NA 1D6WA 1QFKH 2W7SA 4E05H 5A09A 2JDID 1A4WH 3MO3A 2B8OH 3F0PA 3DUXH 1FMGA 4B76A 1XUHA 3LKWA 2VVVA 1O3FA 1NFYA 1F2SE 1AO5A 1NFWA 1ZHPA 7LPRA 2FTMA 1UVPA 4OS6A 4B75A 2UWPA 3OTPA 4UFFH 3SGBE 5J4SA 4BTTB 3MH5A 4WVPE 5H4IB 4OS2A 1O34A 2XC5A 1G37A 1AUJA 2VIVA 1GBMA 4JMYA 1ANDA 5HGGA 3T2NA 2FLRH 5HIYA 4CH2B 6GCHG 2GDDA 2BTCE 1C2DA 3SUEA 1KLJH 1TX6A 5CHAB 1K1IA 5EQSA 3PMJA 3ZVBA 4X8TH 3KCGH 5F03A 1K2I1 2BLVA 2UWOA 1O2KA 3UR9A 1H4WA 1XX9A 3OSYA 3BTWE 3HATH 4Y8XA 5A0BA 4WXVA 2CMYA 2ILNA 4XD7D 4X6NA 1LQEA 4YOIA 3TLOA 4NIXA 2A4RA 4CRBA 1KSNA 1EB2A 4I8HA 4TWWA 1Z8RA 1CVWH 2BY8X 4M9FA 3PTBA 3MO6A 3GY2A 3LH3A 1PYTD 4YLUA 1YPLH 2P94A 1C2IA 3DCLA 2J94A 4JZEH 1L1NA 2YNAA 2ZECA 2ANKH 1C2EA 4K1SA 3SNCA 1V2QT 1O2ZA 2UUYA 3TPIZ 1GVKB 1ZMLA 1UK3A 4XFQA 4ABJA 1QCPA 3URDA 3RXRA 3QTOH 2BLOA 1SVPA 1TGNA 4VGCB 1MH0A 1HV7A 5AF9H 1GDQA 1EP5A 1GBKA 2AYWA 4ABHA 1SHHB 3KQ5A 2HVXA 3MU5A 3T25A 3Q3YA 1Y3WA 1A7SA 2UWLA 1O3LA 3RLYH 1DM4B 4I32A 1QBVH 1V2JT 4MPWA 1HXEH 4Y10E 1XUKA 3MTYA 2XWBI 3CP7A 2ZU5A 4BOHA 2GVFA 1IAUA 3UB0A 4MNVA 1C5RA 1K1NA 1EJMA 1AY6H 1TGCA 4GVUA 1E0FD 4FOUC 1GCTB 1G3BA 1NRNH 4XOJA 3BTDE 4ZH8A 1GMDF 1OYQA 2VH6A 2VIWA 3L3TA 1GI9B 1FNIA 3E1XB 6LPRA 1M9UA 2BZAA 1YCPK 1T4UH 2G52A 1Y3YA 1LPZB 1OX1A 5EU8A 2O8TA 1L2EA 4FU7A 4TY7A 2VU8E 1SB1H 4ZHLU 1YGCH 1T32A 2ODQA 2P93A 4BXWA 5C1UA 4GAWA 2V0BA 1UVSH 1JBUH 4AC9A 1O2NA 2BDGA 3KYFA 1YPHE 4J1YA 1A61H 3M5NA 1EAUA 2BLWA 1K1JA 2ALVA 1VZQH 2CGAA 3TGJE 2J5UA 4DY7B 3QZRA 1WCZA 5FBIA 1TYNA 1TA2A 4Q2KA 2KFWA 2FESH 4F49A 3A7YA 1ACBE 1P2OA 1AIXH 1Z7KA 3QUMP 4NGAH 1C2FA 3P95A 3OY6U 3A80A 2J2UA 4Y8YA 2IPQX 1W14U 2FYRA 1E1RD 2PKSB 1TPSA 2ZDMA 3RXFA 1CA0B 2BDBA 2RDEA 4LZ4B 5AFYH 2CV3A 4Q7ZA 3TITA 1FPHH 3M5MA 2WPJS 3SJ9A 2A4GA 1RGQA 3RUOA 2VIDA 1FY1A 3PMBB 1TFXA 1ZJKA 3SZNA 1C1SA 4DCDA 5HM9A 2QYIA 3PO1B 3T29A 2STAE 4YXWD 3TU7H 3KHVA 4ZHMU 1V2TT 3KN2A 1NO9H 1A0HB 4RT0A 2Y7ZA 3I29A 5GXPA 2QC2A 2ZFPH 1VITG 1UTQA 2XC4A 1ZMNA 1IQIA 3M7TA 2VWMA 1GWAA 4OS1A 1W0YH 2SFAA 1H8HD 3JZ2B 1LHFH 1P01A 2RA0A 2XYAA 3KL6A 1CT0E 1W0KD 1O3EA 2AH4X 3PRBA 5DP4A 1Y5AT 1FIZA 3C27B 3A87A 1W10U 1BRBE 4TPYA 2EA3A 2AERH 2ZPRA 1GI5A 3VFEA 2JH0D 1KLTA 2OD3B 1DANH 1KDQB 1MTUA 4X0WU 4FETA 1OP2A 1O3KA 2WV9A 2ASUB 4JYVH 1GBFA 3K65B 3NK8A 3F9FA 1TPPA 2VIOA 3Q77A 3RMNH 1Z71A 2PP6A 2DE8A 4TYDA 1NFUA 1FY5A 4WWYA 2HPPH 2ZG0H 5DKMA 4B73A 3TGKE 2EI7A 1TWXB 4I8KA 3QGJA 1AE8H 1V2ST 3H7OA 3H7TA 1ZPBA 3RXKA 2K8IA 1MTVA 1AI8H 1UTLM 4BNRA 1V2UT 2TRMA 1NU9A 5EOKA 1UTKA 1EKBB 3ATKA 4YO9A 3PV4A 3TNTA 3PMAB 1D3DB 2ZGJA 1BMMH 4ZKNU 5KECA 1O2YA 1YBWA 1GBLA 2VH0A 4LK4A 1KXBA 1S0RA 2I6SA 1S5SA 2R0KA 3FP8E 3E16B 1C1WH 5EPNA 3S9BA 4DT4A 2PWXA 3ZVEA 2GZ9A 1O3OA 1QURH 1AB9B 2JJ1D 1O3AA 4Y76A 5AFZH 3VGCC 2XBXA 1BMFD 2D8WA 4B71A 2GCHF 2FX4A 1BMLA 1GPZA 1O3PB 4F4OC 5EPYA 3P8OA 1CT4E 1MUEB 1BBRH 2Q1JA 1GI0A 2Q6GA 1LHGH 3F68H 1UW7A 2B7DH 1WV7H 2AIPA 2ESTE 1O2QA 1NFXA 2ZFQH 1TGBA 1C5QA 3RXQA 2SGEE 4QT8C 4ZROA 2ZGHA 2WPHS 5GCHF 2P8OC 1Y59T 4GLYA 3W94A 1H1BA 4UDWH 8KME2 1V2VT 3GCHC 1FI8A 2B9LA 1MKWH 2H1UA 4M7GA 1OWIA 4E7RG 1JWTA 1G32B 3ZZBA 4IN1A 3CNRA 1L0ZA 1DWEH 3EYDA 2XCFA 3UWJH 2ULLA 1GJ6A 3BG4C 2BY9X 4YESB 5A8YA 4X8VH 1C5ZB 3SBKA 3SN8A 5A8ZA 3ZZ7A 1X7AC 1B5GH 1FJSA 4WH8A 1ZYOA 5JPMH 5FCRA 2OCVB 2V6NA 1BDAA 4ZCNA 1SGCA 1IQHA 4X2YA 5CDFE 3UFAA 1CA0C 3FZDA 2R2WU 1JRSA 3V3MA 1CGHA 3LGIA 5L2ZH 3UAIC 3TJVA 4I8GA 4R8TB 5EXMA 4DJZB 1W13U 5K7RA 1E34B 2ZHQH 1O2VA 2QF0A 4CRFA 1P03A 2GZ8A 4Z0KA 1GBBA 2QF4A 3PO1C 2L74A 2OUAA 1TOMH 2M5TA 3RDZA 5FHTA 3WW7A 4YOGA 1OOKB 3A82A 3PLBA 1O3GA 1THPB 1MAYA 1TAWA 1FN8A 7GCHF 2AEIH 4OM9A 1D3PB 2FIRH 3RLWH 1L4DA 3BIVH 4CRDA 1GJ9B 4ZHAA 2CXVA 1O31A 2QV1A 3QDZB 4Y8ZA 2ZDNA 1DY8A 3PV5A 1HJAB 3MMGA 1XVMA 3CS7A 2QE7D 1TMTH 2F83A 2LPRA 1GI3A 1QTFA 5EJ1A 1GL0E 1GHBG 1P57B 2W6ID 1G2MA 1AFEH 5EQRA 2GCHG 1A5GH 4D7FA 2ODPA 5CHBA 3TGIE 2A4OA 4UE7H 3UNQA 4IN2A 1LVBA 2O8LA 2ZFTA 2SGDE 3IWMA 1SGEE 1TRNA 1V2LT 2BOHB 1LVYA 1KTTB 3MHWU 3VXEH 1DT2A 1O2PA 1NESE 2Y5HA 1PQ5A 3KF2A 1O2OA 3FP7E 1YKTA 3OYPA 1C5NH 2KZ4A 1LPKB 3BSQA 3V12A 4ZAEA 3AW1A 1S6LA 4KGAA 2F9PA 3UUZA 2G5VA 2Q6DA 3LH1A 3HK3B 1HUTH 3UR6A 4YOJA 3RMOH 1RRKA 3SV8A 1EPTC 4DIIH 2Q6FA 3VB6A 4CBNA 1UTPA 2A5IA 3SJ8A 1ELBA 4ISOA 3ZVAA 5FPYA 3SUFA 1BMNH 1DY9A 1BA8B 1CGJE 2WV4A 3U8RH 1H8ED 4IW4E 1GMCF 3HKIB 1GGDC 4X8UH 5C2ZA 1VJAU 1J15A 4AG1A 1ZMJA 5C1YA 5F8XA 4H42U 3H09A 1HAVA 3ZV8A 3LDXH 1U6QA 1LHDH 1UK4A 1UK2A 2ZFFH 2Y7XA 2AHME 1O2GH 1O32A 5AHGH 5EXLA 2TGDA 1P04A 3ZVDA 1LVOA 1QR3E 5DP5A 1EJAA 2VWOA 3GY6A 1SR5C 1O2RA 1GI7B 1TB6H 4JZFH 2BDHA 1QQUA 3HKJB 1VITH 2J97A 3SGAE 4R0IA 3DHKH 1NPMA 1P3EA 1SI5H 5EXNA 2CJIA 4FUHA 4NZLA 2PKAA 1FN6A 4A1VA 4BAHB 2VGCC 5E2OA 2ZTXA 4K69A 2FODA 4OGXA 3OU0A 4YM9A 2P16A 5ABWA 2J98A 1TBZH 3AAVA 4JZ1A 2HLDD 1TPOA 1UCYE 4MPXA 4K60A 2A5AA 2FP7B 2R3UA 2R3YA 4NFEA 4RI0A 2PGBB 4DG4A 1VKYA 1AE5A 3RXIA 2HALA 1Z1IA 2Z3DA 2Z9IA 2CF9H 3ZVCA 1THRH 1TA6A 5LPFA 1GMHF 1RIWC 5G4BA 2ZGBH 1O5DH 2ZHWH 3T27A 1MZDA 4RSPA 1PQ7A 1CU1A 3GDUA 4U01A 4H6TA 4BAOB 1GI8B 1EPTA 2SGQE 2EC9H 1N6YA 2JIZD 4X1PU 3LC5A 5A0CA 2BX3A 5A2MH 1NRQH 3OFND 1F0SA 3RXTA 5GPIB 1NM6A 1NROH 1MCTA 4NIYA 4AGKA 4LZ1H 4WMDA 8GCHG 4DT7B 4Q4LA 4WMFA 2OBQA 5L6NH 4AG2A 1BITA 1C1NA 1EXFA 4K5ZA 1C4U2 1L1GA 2QA9E 4AYVB 1RTKA 1XKAC 2ZFSA 5BRRE 3D65E 1AKSA 1E37B 1CE5A 3WWBA 3U1JB 3ZZDA 1ANCA 1CBWC 3ZV9A 4A6LA 5EW1H 1HAPH 2ANMH 1C1TA 4MPVA 2RFKC 1NY22 5EJZA 5C5NA 1KXAA 2O8MA 1BBRK 1NTPA 1UHBA 3LPRA 3OY5U 1HJAC 3BG8A 1QBOA 2Z9GA 1O2XA 5ETXA 1QRZA 3UY9A 1TNLA 3G01A 1GJ5H 1YPKH 1BTZA 4GSOA 1YYY1 1MD7A 3BEIB 2F9NA 4WH6A 4BAQB 1XUGA 4Y71A 2XW9A 3U1IB 1FX0B 1NRPH 2H6MA 1E79D 1W2KH 3RXCA 2Z94A 4XDEA 1CHOF 3SNBA 1PPBH 2CF8H 1O3DA 1C9TA 3D23A 2KCOA 3LONA 4OGYA 2G4TA 2GV7A 1MKWK 3MU4A 1T8OA 1SG8B 2FOBA 1ABJH 4U30A 1GJ4H 1DITH 2AMDA 3BTME 2FS8A 4UFGH 5DP6A 1AUTC 3PMHB 2XBYA 2C8YB 1KIGH 2PTNA 4IC5A 4FUBA 2JH6D 1B7XB 1C5XB 1QRXA 2VNTA 3E91A 1SL3A 5JBCS 4ACBA 1LMWB 2GTBA 3FO8D 3RC6A 2K1QA 1WDIA 3O8BA 3R0FA 4I33A 3SV6A 1EASA 4ACAA 4AORA 1C2MA 3TH3H 1NT1A 1AFQB 2GGVB 2ZC9H 2A31A 2GKVE 4O3UA 7KMEH 3OEED 2J38A 2BVSH 2IPHA 4FUCA 6CHAC 2FLBH 3S7KB 1J14A 1TRMA 2ANWA 5LPEA 2ZQ1A 5I25A 3AASA 1OHHD 3U69H 3AAUA 3S9AA 8ESTE 2DE9A 1UTJA 3KEEA 2Y5GA 4KTCA 5E0GA 3RC5A 1K1MA 3BIUH 3U98H 1BTUA 4AOQA 1QGFA 3RM2H 1SOTA 1K0HA 4Q7XA 3GOVB 3QTVH 4TPIZ 1MTSA 1DFPA 2BMGB 3ESTA 1GI1A 3M7UA 1K1LA 2UUFB 1V6DA 1RJXB 3QZQA 5DPAA 3MNXA 4AFZA 1MD8A 1RS0A 4X1SU 3GS9A 2B0FA 3NPSA 1TBRH 4NA9H 3GCNA 3T26A 2PTCE 3RXVA 5TCAA 5JYIA 1HJ9A 2OK5A 3FFGA 2CHAC 2RA3A 2G51A 3OAAD 5F8TA 1QB6A 1Z6JH 1GHXH 3Q3XA 2FOMB 2O8UA 4I31A 3BTKE 1YCPM 5E0HA 1FY3A 1ZSKA 3RXSA 1SBWA 1O3MA 2C4FH 2ZPSA 1Y5BT 5T6GA 2ZKSA 2TBSA 1OXGA 1D4PB 2FMJA 1DLKB 2Z9KA 2ZZUH 2O8WA 5I46H 1NRSH 1ZSJA 3BF6H 3EA8A 3TVJB 3VGCB 5L2YH 1OP8A 1ARCA 2BM2A 5C67A 1T31A 2QY0B 1YP9A 1C5SA 1KY9A 4X1RU 1OYTH 1F5RA 3CENA 1OWKA 2BXTH 1J16A 2KX4A 4I8LA 2PSYA 1MU8B 3RXOA 4TY6A 1P11E 3FAOA 3CS0A 4IGDA 1TIOA 4JK6A 1QJ1B 2BB4A 5JBBS 2ZPQA 1MAXA 2H9TH 1CGIE 1K21H 1TMUH 1UVTH 2VINA 3M37A 4PROA 5HKKD 2P8OB 1QL7A 4X2XA 3GCHB 2TIOA 3PROA 4CRAA 2VVCA 1V2NT 1TOCB 1O3IA 1XXFA 4RN6A 4KELA 5DO4H 1ETSH 3SUDA 3FVFB 3V7TA 1S82A 3GDVA 2QCYA 1DX5M 1TNKA 2C8ZB 4OS4A 3BG4B 2QIQA 5FPSA 1W8BH 2EQNA 3QLPH 3RXLA 1S6FA 2WINI 1OKXA 3GY8A 1HAXB 2LP6A 3A8BA 1O38A 1GHWH 3MI4A 3R3GB 4D7GA 4ZMAH 3A8DA 1JOUB 3SU4A 3V13A 2BD3A 4ABGA 4GCHF 3A8CA 3P70B 5DGJA 2STBE 3PV2A 4FUEA 2WPLS 3RXUA 3URCA 1WQSA 3EAJA 3GY7A 1BTWA 1BRCE 5C17A 3NWUA 2ZTYA 4K8YA 1GHZA 2XBWA 1ETRH 1MQ5A 1HAYB 3E3TA 1IOEA 1EFRD 3I77A 2SGPE 1E35B 3A84A 1ANEA 1ORFA 1RFNA 1WTGH 2G4UA 2LELA 3E6PH 4AFSA 1MMJN 1H9IE 1T7CA 2F9UA 2WV5A 2ODYB 1O3HA 2GJGA 3RMMH 1HAVB 2O9QA 4BXSA 3RC4A 3E8LA 4UD9H 2OLGA 5DJ7A 4X6MA 1C1MA 1TX7A 3U9AH 4E06H 1GBJA 2BY5X 2FXRA 3RXEA 1SFQB 2OQ5A 1Y8TA 1GVLA 1LKBA 5FX6A 1YWUA 2QAAA 1AFQC 2C90B 2OXSA 3GY5A 2A1DB 3TJNA 3ZYEA 2VVUA 3QO6A 3P6ZB 4TWYA 3UQVA 1GMDG 3MYWA 3WWFA 1DICA 3KQBA 4Y11E 4B74A 2WPIS 5DN6D 5IYTA 2HWLB 2M2AA 1B0FA 1H8IH 3LGYA 1C2GA 2PKAB 2C93B 3DA9B 1V2PT 5DP7A 1LKAA 2JETB 2NU0E 4X8SH 1VGCC 3PLPA 1EP6A 1KYNA 1P2NA 1DUEA 2G00A 2BD8A 2J98B 2ZDLA 3QGNB 2J92A 3HGPA 1TNGA 3RU4T 1YC0A 1CQQA 4Q7YA 1JRTA 3ZYDA 1XUJA 1SGRE 2GV6A 1QRWA 3NKKA 1KXEA 2CK3D 3AVZA 3VB5A 5LPRA 1O5EH 3B9FH 4NA7A 3TNSA 1SLVB 5GJ4B 1FY8E 1IQKA 2IN2A 1KTSB 2Y81A 2AFQB 3M5LA 4X2WA 1FV9A 3UREA 3MU1A 3LIWA 2FZZA 4U2WA 3TK6A 2XNIA 1EPTB 3KIDU 3FP6E 1GHYH 4JZIA 1HAHH 3GDSA 8LPRA 5EW2H 3A85A 1SGYE 1GHVH 4Y7BA 1SLWB 5JBAS 1AGJA 1Y5UT 1P9UA 3MU8A 1GGDB 1K22H 3DSPA 1Y3UA 1WUNH 1UVUH 1AKSB 1GI6A 1CA8B 3LGWA 2Z7FE 3IITA 3LC3A 2BY6X 2QF3A 5IDKA 5L30H 1DWDH 4FVDA 2BVRH 2P59A 4X2VA 2HLCA 1UHBB 5FCKA 3HGNA 3UNSA 3MU0A 4D8NA 1A2CH 3SO3A 2YOLA 1EZUC 3LJOA 2KAIA 3UOPA 3D62A 1P05A 3P8GA 1GDNA 3A7WA 3EDXB 4MQAA 4F48B 2CN0H 3MFJA 1HAIH 1COWD 3K6ZA 3O8RA 1FAXA 4BTUB 2BD9A 1GG6B 7ESTE 4KTSA 4Q80A 3A81A 1YF4A 2VGCB 1TPAE 2ZNKH 1C9PA 1GI4A 1A46H 1V2KT 4FUJA 4YTAA 3T5FH 2PUXB 2QN5T 1ZPZA 5DP8A 1EB1H 1BRAA 1LPGB 4JK5A 2FOGA 2J4IA 3T28A 4D9QA 4INLA 4YZUA 1RIWB 1D6RA 2HNTC 3PTNA 4Z1MD 4MNWA 1ELEE 1C5YB 1V2RT 1W12U 3P17H 1O33A 3ZZ5A 1BBRE 4SGAE 1O2UA 4RKOB 1HXFH 5T6FA 2BQWB 1P2JA 3RMLH 3F2HA 3SUGA 4FVBA 2ZU2A 1AZZA 1PFXC 4IBLH 1HFDA 1GBTA 1O3JA 1HJ8A 1EJNA 2P3FH 3SHAH 5HXFA 3C1KA 3E90B 1BHXB 2FEQH 3HK6B 1C5LH 1EZQA 3SI4H 3BV9B 3FN8A 1W7XH 3F0OA 2BX4A 1FQ3A 1SFIA 4FUGA 1CBWB 1ELCA 1Q2WA 2KM0A 4A92A 1AVXA 3S9CA 4ZXYH 2P3TB 2PV9B 3M35A 4INKA 3Q3KA 1TNIA 3LGTA 2EEKA 1C1OA 1HGTH 3ZZ4A 2J95A 1O37A 2NU3E 1F5KU 2Z3CA 2P95A 3N7OA 2ZF0H 4HTCH 4DOQA 5KGOA 1GBIA 4XRNA 1FZZA 1BZXE 1H9HE 1W11U 2F9OA 3F2GA 2HGTH 1NZQH 2JETC 4NA8A 4MTBA 2FPZA 4IMQA 2GCTC 3A7ZA 4HG6A 3BTQE 3M3VA 5A0AE 3BTFE 1RTFB 3SNEA 3F9GA 1ELDE 2PLXA 4Y7AA 3UWIA 5AVDA 1PPZA 3SNDA 1DSTA 5GCHG 5C1XA 3W95A 5JB8S 4GUXA 4MPUA 2L6OA 1P09A 5F53A 4ZXXH 3SGQE 3ZZ8A 1PQ8A 4AB9A 5GWZA 3VXFH 1WYKA 1GJ8B 1DDJA 2ZCLP 1G9IE 2PGQB 4UFEH 2VJ1A 4O03A 1IQMA 1YY3A 4MG3A 1SGTA 1YLDA 2BDYA 4AN7A 4WF8A 3NZIA 3ZZCA 6CHAB 1S0QA 5FXLA 1GJCB 4AFUA 3GCTF 2V3HH 1ZPCA 2TGAA 5HIZA 1IQGA 4O3TA 2R2MB 3SV2H 2F9BH 4IC6A 2JH5D 3M61U 1SGQE 1T8MA 4NWKA 1QL8A 2BQ6B 1BTHH 1HIAA 3PWBA 1N6XA 2OTVA 3AK5A 1C4V2 4B2BA 2GMTB 4GPGA 2HVYB 1T4VH 4H6SB 1GBEA 2W26A 1EATA 1XXDA 1T8LA 1FLEE 3KGPA 2A7CA 7GCHG 1UCYH 1LTOA 1SC8U 4FUFA 5T6DA 2OC7A 3VEQB 1IQLA 1VR1H 1OS8A 2VWLA 3OTJE 1IHSH 2Z9LA 1C5WB 2ZHDA 3A88A 3ZVFA 2V7QD 3F2FA 1O3CA 3M7QA 2CHAB 3EGKH 3SU5A 2A7JA 1GG6C 3ATIA 4ABEA 1C1PA 1EX3A 1UO6A 1WTHD 1KXCA 2UUKB 2OC1A 1YLCA 3NUMA 3SORA 1NRRH 1ELGA 3MNSA 4A5TS 1C2LA 2DUCA 3TJOA 1FY4A 4CRCA 1AZ8A 2BXUH 1TLDA 1W3CA 3PLKA 3SQHE 1PPGE 1KMHB 4XE4A 1ZZZA 1TX8A 3LGUA 2NU1E 4X6PA 4AYYB 2OBOA 3RXBA 1Z8GA 3ZZ9A 1SOZA 1OWHA 1VCQA 1B0EA 6GCHF 2Y6TA 5FBEA 2JJ2D 1HYLA 1QY6A 4NG9H 2SGAA 4B2CA 4Y79A 2WUBA 1ARBA 3GY4A 2HOBA 3A86A 4FU8A 3SV9A 1P2KA 1SSXA 1BOQA 2W3IA 1V3XA 1GHAF 2ZU4A 2BD7A 3ZVGA 1BRUP 2TPIZ 2W6JD 3SV7A 1O2JA 3BEUA 2D26C 2QXJA 2SNVA 2Y5FA 3PWCA 1C1RA 1WXRA 3RP2A 2LNCA 1S81A 3KQCA 1G3DA 1PPCE 1GBDA 1QBNA 1ZJDA 1E38B 3RM0H 5F6MA 3TJUA 1K9OE 4Y6DA 3RXMA 2BD2A 4THNH 1VJ9U 1BIOA 4I86A 3VB7A 3GCTG 1IQNA 2ZI2H 1THSH 2FI3E 4CR5A 1UTOA 4X6OA 1GMCG 1C1UH 4YT6H 2A5KA 3UIRA 1ZTLA 2WPKS 3STJA 1N8OC 4HZHA 3KNXA 3ODDA 3HPTB 1ZRBA 2XXLA 1EZXC 1MTNB 2WUCA 1C1VH 2B5TB 3S69A 2G81E 1BTPA 3T62A 5JDUB 3EA9A 4ZKRU 1O3BA 3U8OH 1O2SA 2R0LA 2ZDVH 1NU7B 2WPDD 4IS5A 2ZFRH 2ZHEH 1P2IA 3EE7A 2BD4A 1FDPA 3EE0B 1HLTH 2FWWA 3SU6A 3B8JA 2VIQA 3SJKA 1ZLRA 3GY3A 1JMOH 1MBQA 4O9VA 3LT3A 4JZDH 3ZZ3A 4JCNA 2XC0A 4ABFA 4CRGA 1TNJA 2YNBA 4CBOA 1W0ZU 2J9NA 2VIPA 4CREA 4WJG2 2VWNA 1QJ7B 4TT3D 4TSFD 3SYJA 1Q3XA 2KAIB 1SKYE 4D76A 1C2JA 1PJPA 2OC8A 1P12E 4YT7H 3PYHA 2A4QA 1C2KA 1JIMA 2PUQH 4CHAC 1GMHG 1O2MA 2KR7A 2Z3EA 5ESBA 3MO9A 1J8AA 1HB0B 2KCYA 1SHYA 3E0NB 3ATLA 1VGCB 2BVXH 1F0RA 4FUDA 1GHAG 5EG4A 2FOAA 5ESTE 3UPEA 1EOJA 3GCOA 2ZP0H 1TE0A 1J9CH 3OE7D 3UNRA 3L6PA 3N7DA 1IHTH 2RCEA 2YMSC 2PSXA 1TABE 2GMTC 2GT8A 2BHGA 4Y0YE 1S84A 3ZIAD 2AIQA 3FZZA 4CH8B 4ZKOU 1Z8JB 1WOFA 1Q31A 1FIWA 3RXDA 4UONA 1V2OT 3RXAA 3TK9A 5DP3A 2W3KA 3RU4E 1INCA 1O35A 1LHCH 1XVOA 3M3SA 5PTPA 1K28D 1H9LB 1TMBH 2TGTA 2ZTZA 3F9EA 2XNDD 4LXBH 1Y3VA 4CR9A 1ELTA 2AMPA 2HPQH 1SGFG 4BAMB 1SQTA 2EY4C 3K9XB 1ZHMA 3SZEA 1C5TA 1CHOG 1MQ6A 3ATWA 1A5IA 1WQVH 1AQ7A 3UQOA 5HYOA 1TNHA 2BDAA 1ZGIA 2ANYA 2GDEH 1EZSC 3RXGA 1ZTJA 3BEFB 3BTTE 1KLIH 2WHXA 1MCVA 5DP9A 1Z6EA 4K1TA 2C8XB 4Y0ZE 1VITF 1HDTH 2A2XH 1NBMD 1DWBH 1BJUA 2V3MA 2FDAA 4X1QU 2ALPA 2IJOB 1BT7A 2EI6A 5FAHA 1GJBB 1BB0B 3DD2H 2XCNA 3ZZAA 1BHXF 2PHBA 2RDLA 1A0LA 2NU2E 1LHEH 2H9HA 5EGMA 5C5OA 1SQOA 1YLNA 1QNJA 1S83A 4BANB 4B6FA 1HNEE 3E0PB 1BCUH 1K1OA 5EQQA 1A3BH 2AS9A 3P8FA 4XBDA 3GISB 3Q00A 5SGAE 1LCYA 2BOKA 2C3SA 1O5BB 1PQAA 4ISLA 4RKJB 5DG6A 4ASUD 2W7UA 3ELAH 1OWDA 2HRVA 1ZHRA 3P92A 1YPHC 3BTEE 1WSSH 2GX4A 4KKDA 5EJLA 2AGEX 1Z8IB 3P8NA 1GDUA 2WPMS 4DVAU 4MNXA 1UCYK 1XKBC 2F43B 5EIYA 5JBTA 3PB1E 1JXPA 2SNWA 3SQEE 1P2QA 4WMEA 3A7VA 1ETTH 2G55A 1QA0A 3U8TH 1MTNC 1QA7A 4O97A 2K0QA 2BQ7B 2QXHA 3WY8A 2Z6BD 1WAYB 1SPJA 4Z6AH 1O2HA 5CMXH 3PM3A 1TALA 1G36A 3K6YA 1C5OH 1KXFA 1C4Y2 3SU1A 3SU3A 1O30A 2V35A 5LH8A 1Y3XA 1GCDA 1BTXA 1NC6A 1MBMA 2A7HA 3ZZ6A 1ABIH 1DPOA 1RXPA 3SI3H 1DLEA 1F0UA 4FXGH 3RXJA 1VCPA 4INHA 1TQ7B 2UUJB 5FX5A 1WU1A 4NZQA 5E0JA 1HIAB 1KXDA 3A89A 2FTLE 3ODFA 1ZGVA 2QXGA 2H5DA 3L33A 1GJAB 3IG6B 1QIXB 3MNCA 1DVAH 1O0DH 1RD3B 4OS5A 4AZ2B 1HBTH 4P02A 3N99A 4KTUA 2GT7A 3SHCH 2FI4E 4HGCA 1O2IA 4E7NA 1DXPA 3A83A 9LPRA 4IMZA 5C0TA 5T3HA 1Z1JA 1L4ZA 1QJ6B 5CHAC 3RXPA 3A8AA 1ESBA 1DWCH 5J4QA 4A1TA 1AMHA 1ELAA 1O2WA 1YPGH 4NIWA 4UEHH 2GCTB 4XBCA 1GI2A 1MTWA 2OINA 6ESTA 1O5FH 2F3CE 3TH2H 1PPEE 1HAZB 3D49H 2A32A 3VB3A 3ITIA 4HI3A 2PW8H 5C0UA 5HMAA 3TIUA 1AVWA 4NSYA 3O8DA 2A2QH 4ZUHA 2AGGX 3LJJA 1IQJA 3N7EA 4NIVA 1C5VA 1MKXH 2PFEA 3ENSB 3FANA 4WXIA 1T8NA 3UOUA 5CE1A 2D1JA 1GBCA 1SGNE 1HAOH 5IK2D 1C1QA 1NN6A 1A1RA 4FUIA 4B1TA 5TJXA 1E36B 2YMSD 3F3BA 4ABBA 1O2TA 1VCWA 1ZRKA 2ZU1A 3DSOA 3JZ1B 1O39A 1A5HA 4VGCC 1G3EA 2XWAA 1ANBA 2NWNA 4GCHG 1S85A 1D3QB 1QB1A 4H4FA 3RU4D 1D9IA 3FOAA 1BTYA 1UJ1A 1F0TA 3O8CA 2VBCA 2Y82A 1ZR0A 2QGRA 5DSFA 2F9VA 2FOEA 1XUIA 2ZQ2A 1D3TB 1SQAA 4JYUH 1O5CB 1PPHE 4K2YA 4NSVA 3RXHA 2ZWLH 2F91A 1GJDB 1P10A 3EQ0H 4XBBA 2H9EH 3DFJA 3OX7U 4K1EA 3ATMA 3DFLA 1OWJA 1GCTC 3MH4A 4A7IB 1SGDE 3SJOA 4ABIA 1GHBF 2XOKD 3M3TA 2SGFE 2THFB 3MWIU 3KYGA 1G2LA 2ZCKP 5T1VA 1AHTH 1FAKH 4ZKSU 4RT1A 1GJ7B 4BAKB 2XBVA 2GP9B 1EAXA 2FX6A 1QQ4A 2BDIA 3SOSA 2FO9A 2ZDKA 4ESTE 2G8TA 1DS2E 2ZGCA 3NCLA 4K3JA 4GHTA 1TONA 1UTMA 1NS3A 2A0QB 3MNBA 1C5UA 1MU6B 1IQEA 5DK1A 5K0HA 3QWCH 2AGIX 1F92A 2ZO3H 5C3NA 1AN1E 2RG3A 4AB8A 9ESTA 1MABB 1EAWA 2R9PA 4WY3A 4X1NU 4DURA 1QL9A 2HNTE 1XUFA 3TK5A 1LVMA 4GHQA 1ESAA 1OP0A 2FOHA 4I8JA 4B6EA 2FM2A 1LO6A 1P2MA 3K2UA 1C2HA 4MLFB 4OS7A 1P0SH 5B6LA 1YM0A 4HFPB 1WBGB 2PKSC 3LGVA 2WYGA 2WZQA 1BUIA 3QN7A 1OWEA 1CHGA 5F8ZA 1BJVA 1G3CA 2A45B 1YPEH 1ELFA 3U28C 5C20A 4ISHH 5GIBA 5BPEA 2IOTA 4Q63A 1UTNA 1P06A 1N8OB 2H5CA 3OEHD 1SLUB 1GL1A 4SGBE 2P3UB 1H8DH 2BDCA 3I78A 1O5AB 2I6QA 5KEDA 1BMAA 2JKHA 2QF5A 1IQFA 3BTHE 1ELVA 2Y80A 5HM2A 1FPCH 2ZA5A 3TH4H 1HAGE 1RTLA 2NU4E 3M36A 4MNYA 3V0XA 1YPJH 1W7GH 1C5MD 1OPHB 5GDSH 2OP9A 2IJD1 1ESTA 1LQDB 1O3NA 1P3CA 1BQYA 3B23B 1HPGA 3M5OA 5JB9S 4P00A 3SW2B 1YPMH 1E1QD 1HRTH 1F7ZA 3KQEA 3F1SB 1UVOA 3GICB 1A0JA 4D9RA 5A8XA 3FKSD 1SLXB 1K1PA 3EA7A 3LU9B 2QXIA 2AMQA 3F6UH 3SU2A 3MH7A 1J17T 3SJIA 4CHAB 1GBHA 4I7YH 1G30B 1DOJA 4U32A 2WSSD 2KCPA 1ID5H 2GZ7A 2ZCHP 4XSKU 1PYTC 8GCHF 1P02A 5EODA 2BZ6H 2PR3A 3GYLB 5FPTA 1YCPH 4AGJA 4KP0A 3BN9A 4FU9A 3S7HB 4K8BA 3QK1A 2OC0A 3BTGE 1N1LA 3STIA 2VB0A 3Q76A 4DIHH 1TQ0B 3LOXA 2Z9JA 2YMSB 1FXYA 4A1XA 1ZOMA 1DXWA 2TGPZ 3NRLA 1OSSA 2GD4B 1AWHB 2ZIQH 2FI5E 2OQUA 2ZHFH 3F9HA 4ISIH 1CO7E 3VG8A 1SGPE 1AB9C 1XM1A 1S6HA 4BTIB 1A3EH 1P9SA 2ZDAH 1TGSZ 1CT2E 4J2YB 5B6OA 1ZSLA 1DUAA 2WYJA 5LGOA 1SGIB 3KQDA 4AX9H 5E8EH 4JYTA 3W1EA 5GNDA 3NXPA 3GYMA 1NBME 4YLQH 4ASHA 1DSUA 1EQ9A 1QZ8A 4MVNA 4MDSA 2HNTF 4F55A 5C94A 1DE7H 1AU8A 3VB4A 1AVGH 2J34A 1EAIA 5TCCA 1SGFA 3UTUH 4NFFA 1EOLA 1UMAH 4LOYH 2FYQA 1MKXK 3MH6A 4DGJA 1AWFH 2ZEBA 2FOCA 4NWLA 4AFQA 3DT0H 1KDQA 4NCYA 1TRYA 1QHRB 2ZU3A 5FL7D 2FS9A 3MOCA 1CSOE 4DW2U 2ZGXH 1EUFA 2D2DA 1V2WT 1P8VC 1QB9A 1O5GH 2G5NA 3SNAA 4ABDA 2BLQA 1GVZA 1O36A 1O2LA 3H5CB 2EI8A 1PPFE 1ZTKA 1JIRA 1XMNB 5E2PA 3VPKA 1GBAA 2BD5A 2XRCA 1TBQH 3PRDA 1FONA 1F5LA 2C8WB 1C5PA 1FUJA 1V2MT 3DSGA 3A7XA 3MQKC 2W5EA 1TGTA 1SMFE 1SQRA 3A7TA 2BYAX 4ABAA 3AW0A 1HCGA 2H2ZA 4UFDH 1MZAA 2XTTB
chains in the Genus database with same CATH topology
4B2AA 3QX5H 1L1JA 1LDTT 2BY7X 2FOFA 4ISNA 1AD8H 2V3OH 3SU0A 3S0NA 1D6WA 1QFKH 2W7SA 4E05H 5A09A 1A4WH 3MO3A 2B8OH 3DUXH 1FMGA 4B76A 1XUHA 3LKWA 2VVVA 1O3FA 1NFYA 1F2SE 1AO5A 1NFWA 1ZHPA 7LPRA 2FTMA 1UVPA 4OS6A 4B75A 2UWPA 4UFFH 3SGBE 5J4SA 4BTTB 3MH5A 4WVPE 5H4IB 4OS2A 1O34A 2XC5A 1G37A 1AUJA 2VIVA 1GBMA 4JMYA 1ANDA 5HGGA 3T2NA 2FLRH 4CH2B 6GCHG 2GDDA 2BTCE 1C2DA 3SUEA 1KLJH 1TX6A 5CHAB 1K1IA 5EQSA 3PMJA 3ZVBA 4X8TH 3KCGH 5F03A 1K2I1 2BLVA 2UWOA 1O2KA 3UR9A 1H4WA 1XX9A 3OSYA 3BTWE 3HATH 4Y8XA 5A0BA 4WXVA 2CMYA 2ILNA 4X6NA 1LQEA 4YOIA 3TLOA 4NIXA 2A4RA 4CRBA 1KSNA 1EB2A 4I8HA 4TWWA 1Z8RA 1CVWH 2BY8X 3PTBA 3MO6A 3GY2A 3LH3A 1PYTD 4YLUA 1YPLH 2P94A 1C2IA 2J94A 4JZEH 1L1NA 2YNAA 2ZECA 2ANKH 1C2EA 4K1SA 3SNCA 1V2QT 1O2ZA 2UUYA 3TPIZ 1GVKB 1ZMLA 1UK3A 4XFQA 4ABJA 1QCPA 3URDA 3RXRA 3QTOH 2BLOA 1SVPA 1TGNA 4VGCB 1MH0A 1HV7A 5AF9H 1GDQA 1EP5A 1GBKA 2AYWA 4ABHA 1SHHB 2HVXA 3MU5A 3T25A 3Q3YA 1Y3WA 1A7SA 2UWLA 1O3LA 3RLYH 1DM4B 4I32A 1QBVH 1V2JT 4MPWA 1HXEH 4Y10E 1XUKA 3MTYA 2XWBI 3CP7A 2ZU5A 4BOHA 2GVFA 1IAUA 4MNVA 1C5RA 1K1NA 1EJMA 1AY6H 1TGCA 4GVUA 1E0FD 1GCTB 1G3BA 1NRNH 4XOJA 3BTDE 4ZH8A 1GMDF 1OYQA 2VH6A 2VIWA 3L3TA 1GI9B 1FNIA 3E1XB 6LPRA 1M9UA 2BZAA 1YCPK 1T4UH 2G52A 1Y3YA 1LPZB 1OX1A 5EU8A 2O8TA 1L2EA 4FU7A 4TY7A 2VU8E 1SB1H 4ZHLU 1YGCH 1T32A 2ODQA 2P93A 4BXWA 5C1UA 4GAWA 2V0BA 1UVSH 1JBUH 1O2NA 2BDGA 1YPHE 4J1YA 1A61H 3M5NA 1EAUA 2BLWA 1K1JA 2ALVA 1VZQH 2CGAA 3TGJE 4DY7B 3QZRA 1WCZA 5FBIA 1TYNA 1TA2A 4Q2KA 2FESH 4F49A 3A7YA 1ACBE 1P2OA 1AIXH 1Z7KA 3QUMP 4NGAH 1C2FA 3P95A 3OY6U 3A80A 2J2UA 4Y8YA 1W14U 2FYRA 2PKSB 1TPSA 2ZDMA 3RXFA 1CA0B 2BDBA 4LZ4B 5AFYH 2CV3A 4Q7ZA 3TITA 1FPHH 3M5MA 2WPJS 3SJ9A 2A4GA 1RGQA 3RUOA 2VIDA 1FY1A 3PMBB 1TFXA 1ZJKA 3SZNA 1C1SA 4DCDA 5HM9A 2QYIA 3PO1B 3T29A 2STAE 3TU7H 3KHVA 4ZHMU 1V2TT 3KN2A 1NO9H 1A0HB 2Y7ZA 3I29A 5GXPA 2QC2A 2ZFPH 1VITG 1UTQA 2XC4A 1ZMNA 1IQIA 3M7TA 2VWMA 1GWAA 4OS1A 1W0YH 2SFAA 3JZ2B 1LHFH 1P01A 2RA0A 2XYAA 3KL6A 1CT0E 1O3EA 2AH4X 5DP4A 1Y5AT 1FIZA 3C27B 3A87A 1W10U 1BRBE 4TPYA 2EA3A 2AERH 2ZPRA 1GI5A 3VFEA 2JH0D 1KLTA 2OD3B 1DANH 1KDQB 1MTUA 4X0WU 1OP2A 1O3KA 4JYVH 2ASUB 1GBFA 3K65B 3NK8A 3F9FA 1TPPA 2VIOA 3Q77A 3RMNH 1Z71A 2DE8A 4TYDA 1NFUA 1FY5A 4WWYA 2HPPH 2ZG0H 5DKMA 4B73A 3TGKE 2EI7A 1TWXB 4I8KA 3QGJA 1AE8H 1V2ST 3H7OA 3H7TA 1ZPBA 3RXKA 1MTVA 1AI8H 1UTLM 4BNRA 1V2UT 2TRMA 1NU9A 5EOKA 1UTKA 1EKBB 3ATKA 4YO9A 3PV4A 3TNTA 3PMAB 1D3DB 2ZGJA 1BMMH 4ZKNU 1O2YA 1YBWA 1GBLA 2VH0A 4LK4A 1KXBA 1S0RA 2I6SA 1S5SA 2R0KA 3FP8E 3E16B 1C1WH 5EPNA 3S9BA 2PWXA 3ZVEA 2GZ9A 1O3OA 1QURH 1AB9B 1O3AA 4Y76A 5AFZH 3VGCC 2XBXA 2D8WA 4B71A 2GCHF 2FX4A 1BMLA 1GPZA 1O3PB 4F4OC 5EPYA 3P8OA 1CT4E 1MUEB 1BBRH 2Q1JA 1GI0A 2Q6GA 1LHGH 3F68H 2B7DH 1WV7H 2AIPA 2ESTE 1O2QA 1NFXA 2ZFQH 1TGBA 1C5QA 3RXQA 2SGEE 4QT8C 4ZROA 2ZGHA 2WPHS 5GCHF 2P8OC 1Y59T 4GLYA 3W94A 1H1BA 4UDWH 8KME2 1V2VT 3GCHC 1FI8A 2B9LA 1MKWH 2H1UA 4M7GA 1OWIA 4E7RG 1JWTA 1G32B 3ZZBA 4IN1A 1L0ZA 1DWEH 3EYDA 2XCFA 3UWJH 2ULLA 1GJ6A 3BG4C 2BY9X 4YESB 5A8YA 4X8VH 1C5ZB 3SBKA 3SN8A 5A8ZA 3ZZ7A 1X7AC 1B5GH 1FJSA 4WH8A 1ZYOA 5JPMH 5FCRA 2OCVB 2V6NA 1BDAA 1SGCA 1IQHA 4X2YA 3UFAA 1CA0C 3FZDA 2R2WU 1JRSA 3V3MA 1CGHA 3LGIA 5L2ZH 3TJVA 4I8GA 4R8TB 5EXMA 4DJZB 1W13U 5K7RA 1E34B 2ZHQH 1O2VA 2QF0A 4CRFA 1P03A 2GZ8A 4Z0KA 1GBBA 3PO1C 2OUAA 1TOMH 2M5TA 3RDZA 5FHTA 4YOGA 1OOKB 3A82A 3PLBA 1O3GA 1THPB 1MAYA 1TAWA 1FN8A 7GCHF 2AEIH 1D3PB 2FIRH 3RLWH 1L4DA 3BIVH 4CRDA 1GJ9B 4ZHAA 2CXVA 1O31A 2QV1A 3QDZB 4Y8ZA 2ZDNA 1DY8A 1HJAB 3MMGA 1XVMA 3CS7A 1TMTH 2F83A 2LPRA 1GI3A 1QTFA 1GL0E 1GHBG 1P57B 1G2MA 1AFEH 5EQRA 2GCHG 1A5GH 4D7FA 2ODPA 3TGIE 2A4OA 4UE7H 3UNQA 4IN2A 1LVBA 2O8LA 2ZFTA 2SGDE 3IWMA 1SGEE 1TRNA 1V2LT 2BOHB 1LVYA 1KTTB 3MHWU 3VXEH 1DT2A 1O2PA 1NESE 2Y5HA 1PQ5A 3KF2A 1O2OA 3FP7E 1YKTA 3OYPA 1C5NH 1LPKB 3BSQA 3V12A 4ZAEA 3AW1A 4KGAA 2F9PA 3UUZA 2G5VA 2Q6DA 3LH1A 3HK3B 1HUTH 3UR6A 4YOJA 3RMOH 1RRKA 3SV8A 1EPTC 4DIIH 2Q6FA 3VB6A 4CBNA 1UTPA 2A5IA 3SJ8A 1ELBA 4ISOA 3ZVAA 5FPYA 3SUFA 1BMNH 1DY9A 1BA8B 1CGJE 2WV4A 3U8RH 4IW4E 1GMCF 3HKIB 1GGDC 4X8UH 5C2ZA 1VJAU 1J15A 4AG1A 1ZMJA 5C1YA 5F8XA 4H42U 1HAVA 3ZV8A 3LDXH 1U6QA 1LHDH 1UK4A 1UK2A 2ZFFH 2Y7XA 5AHGH 1O2GH 1O32A 5EXLA 2TGDA 1P04A 3ZVDA 1LVOA 1QR3E 5DP5A 1EJAA 2VWOA 3GY6A 1SR5C 1O2RA 1GI7B 1TB6H 4JZFH 2BDHA 1QQUA 3HKJB 1VITH 3SGAE 4R0IA 3DHKH 1NPMA 1P3EA 1SI5H 5EXNA 2CJIA 4FUHA 4NZLA 2PKAA 1FN6A 4A1VA 4BAHB 2VGCC 5E2OA 2ZTXA 4K69A 2FODA 4OGXA 3OU0A 4YM9A 2P16A 5ABWA 1TBZH 3AAVA 4JZ1A 1TPOA 1UCYE 4MPXA 4K60A 2A5AA 2FP7B 2R3UA 2R3YA 4NFEA 2PGBB 4DG4A 1AE5A 3RXIA 2HALA 1Z1IA 2Z3DA 2Z9IA 2CF9H 3ZVCA 1THRH 1TA6A 5LPFA 1GMHF 1RIWC 5G4BA 2ZGBH 1O5DH 2ZHWH 3T27A 1MZDA 4RSPA 1PQ7A 1CU1A 3GDUA 4U01A 4H6TA 4BAOB 1GI8B 1EPTA 2SGQE 2EC9H 1N6YA 4X1PU 5A0CA 3LC5A 5A2MH 2BX3A 1NRQH 3RXTA 1F0SA 5GPIB 1NM6A 1NROH 1MCTA 4NIYA 4AGKA 4LZ1H 4WMDA 8GCHG 4DT7B 4WMFA 2OBQA 5L6NH 4AG2A 1BITA 1C1NA 1EXFA 4K5ZA 1C4U2 1L1GA 2QA9E 4AYVB 1RTKA 1XKAC 2ZFSA 5BRRE 3D65E 1AKSA 1E37B 1CE5A 3U1JB 3ZZDA 1ANCA 1CBWC 3ZV9A 4A6LA 5EW1H 1HAPH 2ANMH 1C1TA 4MPVA 1NY22 5C5NA 1KXAA 2O8MA 1BBRK 1NTPA 1UHBA 3LPRA 3OY5U 1HJAC 3BG8A 1QBOA 2Z9GA 1O2XA 5ETXA 1QRZA 3UY9A 1TNLA 3G01A 1GJ5H 1YPKH 1BTZA 4GSOA 1YYY1 1MD7A 3BEIB 2F9NA 4WH6A 4BAQB 1XUGA 4Y71A 2XW9A 3U1IB 3RXCA 1NRPH 2H6MA 1W2KH 2Z94A 4XDEA 1CHOF 3SNBA 1PPBH 2CF8H 1O3DA 1C9TA 3D23A 3LONA 4OGYA 2G4TA 2GV7A 1MKWK 3MU4A 1T8OA 1SG8B 2FOBA 1ABJH 4U30A 1GJ4H 1DITH 2AMDA 3BTME 2FS8A 4UFGH 5DP6A 1AUTC 3PMHB 2XBYA 2C8YB 1KIGH 2PTNA 4IC5A 4FUBA 2JH6D 1B7XB 1C5XB 1QRXA 2VNTA 3E91A 1SL3A 5JBCS 1LMWB 2GTBA 3RC6A 2K1QA 3O8BA 3R0FA 4I33A 3SV6A 1EASA 4AORA 1C2MA 3TH3H 1NT1A 1AFQB 2GGVB 2ZC9H 2A31A 2GKVE 4O3UA 7KMEH 2J38A 2BVSH 2IPHA 4FUCA 6CHAC 2FLBH 3S7KB 1J14A 1TRMA 2ANWA 5LPEA 2ZQ1A 5I25A 3AASA 3U69H 3AAUA 3S9AA 8ESTE 2DE9A 1UTJA 3KEEA 2Y5GA 4KTCA 5E0GA 3RC5A 1K1MA 3BIUH 3U98H 1BTUA 4AOQA 1QGFA 3RM2H 1SOTA 4Q7XA 3GOVB 3QTVH 4TPIZ 1MTSA 1DFPA 2BMGB 3ESTA 1GI1A 3M7UA 1K1LA 2UUFB 1V6DA 1RJXB 3QZQA 5DPAA 3MNXA 4AFZA 1MD8A 1RS0A 4X1SU 2B0FA 3NPSA 1TBRH 4NA9H 3GCNA 3T26A 2PTCE 3RXVA 5TCAA 5JYIA 1HJ9A 3FFGA 2CHAC 2RA3A 2G51A 5F8TA 1QB6A 1Z6JH 1GHXH 3Q3XA 2FOMB 2O8UA 4I31A 3BTKE 1YCPM 5E0HA 1FY3A 1ZSKA 3RXSA 1SBWA 1O3MA 2C4FH 2ZPSA 1Y5BT 5T6GA 2ZKSA 2TBSA 1OXGA 1D4PB 2FMJA 1DLKB 2Z9KA 2ZZUH 2O8WA 5I46H 1NRSH 1ZSJA 3BF6H 3EA8A 3TVJB 3VGCB 5L2YH 1OP8A 1ARCA 2BM2A 5C67A 1T31A 2QY0B 1YP9A 1C5SA 1KY9A 4X1RU 1OYTH 1F5RA 3CENA 1OWKA 2BXTH 1J16A 4I8LA 2PSYA 1MU8B 3RXOA 4TY6A 1P11E 3FAOA 3CS0A 4IGDA 1TIOA 4JK6A 1QJ1B 2BB4A 5JBBS 2ZPQA 1MAXA 2H9TH 1CGIE 1K21H 1TMUH 1UVTH 2VINA 3M37A 4PROA 2P8OB 1QL7A 4X2XA 3GCHB 2TIOA 3PROA 4CRAA 2VVCA 1V2NT 1TOCB 1O3IA 1XXFA 4RN6A 4KELA 5DO4H 1ETSH 3SUDA 3FVFB 3V7TA 1S82A 3GDVA 2QCYA 1DX5M 1TNKA 2C8ZB 4OS4A 3BG4B 2QIQA 5FPSA 1W8BH 3QLPH 3RXLA 1S6FA 2WINI 1OKXA 3GY8A 1HAXB 3A8BA 1O38A 1GHWH 3MI4A 3R3GB 4D7GA 4ZMAH 3A8DA 1JOUB 3SU4A 3V13A 2BD3A 4ABGA 4GCHF 3A8CA 3P70B 5DGJA 2STBE 4FUEA 2WPLS 3RXUA 3URCA 1WQSA 3EAJA 3GY7A 1BTWA 1BRCE 3NWUA 2ZTYA 4K8YA 1GHZA 2XBWA 1ETRH 1MQ5A 1HAYB 3E3TA 1IOEA 3I77A 2SGPE 1E35B 3A84A 1ANEA 1ORFA 1RFNA 1WTGH 2G4UA 3E6PH 4AFSA 1MMJN 1H9IE 1T7CA 2F9UA 2WV5A 2ODYB 1O3HA 3RMMH 1HAVB 2O9QA 4BXSA 3RC4A 3E8LA 4UD9H 2OLGA 5DJ7A 4X6MA 1C1MA 1TX7A 3U9AH 4E06H 1GBJA 2BY5X 2FXRA 3RXEA 1SFQB 2OQ5A 1Y8TA 1GVLA 1LKBA 5FX6A 2QAAA 1AFQC 2C90B 2OXSA 3GY5A 2A1DB 3TJNA 3ZYEA 2VVUA 3QO6A 3P6ZB 4TWYA 3UQVA 1GMDG 3MYWA 1DICA 3KQBA 4Y11E 4B74A 2WPIS 5IYTA 2HWLB 1B0FA 1H8IH 3LGYA 1C2GA 2PKAB 2C93B 3DA9B 1V2PT 5DP7A 1LKAA 2JETB 2NU0E 4X8SH 1VGCC 3PLPA 1EP6A 1KYNA 1P2NA 1DUEA 2G00A 2BD8A 2ZDLA 3QGNB 2J92A 3HGPA 1TNGA 3RU4T 1YC0A 1CQQA 4Q7YA 1JRTA 3ZYDA 1XUJA 1SGRE 1QRWA 2GV6A 3NKKA 1KXEA 3VB5A 3AVZA 5LPRA 1O5EH 3B9FH 4NA7A 3TNSA 1SLVB 5GJ4B 1FY8E 1IQKA 2IN2A 1KTSB 2Y81A 2AFQB 3M5LA 4X2WA 1FV9A 3UREA 3MU1A 3LIWA 2FZZA 4U2WA 3TK6A 2XNIA