5F6MA

Isotropic trypsin model for comparison of diffuse scattering
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
223
structure length
223
Chain Sequence
b'IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cationic trypsin
publication title Measuring and modeling diffuse scattering in protein X-ray crystallography.
pubmed doi rcsb
molecule tags Hydrolase
total genus 62
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2015-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 5f6mA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 5f6mA02
2Z9LA 1C1OA 1C2GA 1GI8B 3ZVEA 1BITA 2Z9KA 2B9LA 1GBAA 2W3IA 1SOTA 2ZDKA 5FBIA 6GCHF 1AWHB 4Y8ZA 3QN7A 2ZHDA 4IN2A 4K1EA 2ZO3H 3RXKA 1OWEA 1VGCB 3SJIA 1TNHA 3MOCA 1FY5A 3MU8A 2PFEA 2FOFA 1DY9A 2HPQH 4BXWA 1C2FA 1S81A 2UUJB 4E05H 2H6MA 4INKA 1ELCA 5EXNA 1RTKA 2WPKS 1GVLA 1HYLA 2FX4A 1NZQH 1TMTH 1FLEE 2GGVB 3RMNH 1LQDB 3F68H 1BQYA 2ZU2A 1CA0C 3TGJE 1F5KU 1A5HA 1FQ3A 1GHAF 1TMUH 2Z94A 1TAWA 5JPMH 3RXTA 2FS9A 1V2JT 1YCPM 2GP9B 1JIRA 3AAVA 2ZFQH 2IOTA 4WMEA 4CRBA 5LGOA 3EA7A 4IGDA 3PMAB 1UHBA 3GY6A 1O34A 2HNTE 1Y3VA 1XVMA 4BXSA 1DWDH 1L0ZA 4AN7A 3TU7H 2B8OH 2C8ZB 1LDTT 1TPAE 2F9UA 1GHBG 2XW9A 2Y7ZA 1CBWC 3P8NA 4XBCA 3ZV9A 4FUCA 2O8MA 1V2UT 3TGKE 2ZHQH 2WV4A 4X2WA 4CRGA 4K5ZA 4DW2U 1ANEA 1ETRH 4HI3A 1ELGA 1C9PA 1O3EA 3T2NA 5EXLA 1WQVH 3BTTE 3SGQE 3SU0A 1Y3WA 4R0IA 3SJKA 1T4UH 5T6GA 4IS5A 4MG3A 1HGTH 3HPTB 2A2XH 2G4UA 1Z8GA 4GHTA 4K1TA 2CHAC 4GHQA 1QR3E 2ZHWH 3T25A 4UONA 1ZTLA 1IOEA 5FAHA 2VGCB 2BXUH 3RXDA 1ETTH 1ZOMA 3NUMA 2STBE 6GCHG 4ZKOU 1C1NA 1VJAU 1ESAA 4GAWA 1DE7H 1Q3XA 5AF9H 1AFQB 3T5FH 1HAIH 3S9BA 1SB1H 1YPKH 2CF8H 5AFYH 3V0XA 2BLWA 1CVWH 4MNXA 4X8TH 5GXPA 3RXAA 2XCNA 2PKAB 1YYY1 2EC9H 3RLYH 5GWZA 2BHGA 3MU1A 3TLOA 4O3TA 1K22H 3HK3B 4IC6A 1ACBE 1FI8A 2NU1E 4XBDA 1ZMJA 2CF9H 3RXMA 3A8AA 3E3TA 5HYOA 2RA3A 4TPIZ 1IQHA 2J4IA 1IQMA 3SW2B 3K65B 1GHXH 1GHAG 3QLPH 1YPMH 1NC6A 1Q31A 2C4FH 1VR1H 4FUIA 2R2MB 1DX5M 1DXWA 2F9BH 2ZFTA 1Z6JH 5EXMA 2YNAA 1HAVB 2CXVA 2DE9A 4X6OA 2VWLA 5PTPA 1P2IA 4U2WA 3A88A 1HPGA 4KELA 4YLUA 1QIXB 2G55A 1E34B 1F2SE 3KQDA 3ZVBA 1EP6A 1P05A 3QK1A 1CT2E 1GJAB 3KCGH 1AO5A 1A1RA 3KQBA 2Z9JA 3SUGA 1WOFA 1BBRK 3PTNA 1W7XH 5GPIB 1TGCA 3SUDA 1UTKA 5AFZH 1VCPA 4VGCC 1GBHA 1W11U 1DUEA 3MH5A 1DITH 4AFZA 2Y81A 2J2UA 3AW1A 4NFFA 1IQGA 2V35A 1XVOA 2WPHS 4DCDA 1ZPCA 1H8IH 1C2HA 1PPGE 3LGTA 4WH6A 1W0ZU 3HATH 1C5LH 5FPSA 2A7CA 3RDZA 5DP5A 3MH7A 1BHXF 3D62A 1D9IA 2P8OC 2P94A 1FXYA 4Q2KA 2A7HA 2ZFFH 3SJ8A 4OS4A 2K1QA 4CH8B 1Q2WA 1MAXA 1ZHPA 2J38A 1O2WA 4BANB 1GWAA 1O3AA 2Z3CA 2F3CE 4E7RG 1SLVB 3LJOA 1THRH 4ZROA 1O2PA 2SNVA 5GDSH 2PV9B 1O5EH 5J4QA 5A0AE 5J4SA 1K28D 2ZFRH 5EW2H 3ZZAA 2GMTC 3UNQA 1THSH 1WYKA 4O3UA 3SN8A 1SGPE 1S85A 2TGTA 3DFLA 4AB9A 8LPRA 3K6ZA 1AUTC 2BD8A 3A84A 1O3JA 3BN9A 2XBVA 1S83A 1TOMH 2QCYA 1HJ9A 3QWCH 3MI4A 2ZGCA 1UK4A 4WWYA 2FIRH 3BTWE 1FMGA 1OP2A 5FX6A 4ZUHA 1BZXE 1QBOA 3GDSA 1O3PB 4M7GA 1ZSJA 1S84A 2BYAX 2ZCKP 1WV7H 4Y0ZE 3N7OA 1HFDA 3SGAE 1LHDH 4DVAU 2ILNA 1O3BA 5T3HA 3T29A 5E0GA 2FYQA 1D3DB 1TFXA 1NFUA 2OD3B 3ATMA 1UVOA 1GBBA 1JWTA 3U69H 4BTIB 4HTCH 1HDTH 2G52A 3AW0A 4YM9A 5A8ZA 1DT2A 2RG3A 1O2KA 2ZDLA 3MYWA 2FLBH 2ZCHP 4Z6AH 4BAOB 4DT7B 3KL6A 3QUMP 3SO3A 4B1TA 1GDNA 1YPJH 1GJBB 1TA2A 3KF2A 1V2RT 1G2MA 4LOYH 1MUEB 2BQWB 1CA8B 4X6NA 2R0LA 1XUHA 1S0RA 1TPSA 3EDXB 2FXRA 1ZTJA 2TPIZ 1EB1H 3LH1A 3A7TA 2BVXH 3RXEA 3UWIA 1BHXB 3VEQB 5JBTA 3BEIB 4JMYA 1JBUH 3RXQA 1A0HB 2ZKSA 1HCGA 4BAKB 1QRXA 2BZ6H 2SGEE 3F9GA 3M5NA 4K8YA 1LVYA 1F0UA 1O3IA 3P70B 4X8SH 4UE7H 2UUKB 4ABBA 3SOSA 4MDSA 1O37A 1RRKA 1G37A 4U01A 2GV7A 3A81A 3RUOA 4I33A 1B0FA 1OPHB 2WV5A 1KXDA 2VWOA 3HGNA 1SFQB 1EPTC 1E0FD 3LGUA 1ANCA 1BBRE 3K9XB 4Y7BA 2TBSA 1HAGE 2CN0H 2W5EA 1S82A 4CBNA 2Y6TA 3TJUA 1UJ1A 2D2DA 1C2JA 4H4FA 4ISIH 1NO9H 5EW1H 2VIDA 4ZKSU 2PSYA 1LVOA 1LPGB 2ZGXH 2HALA 4ZXXH 2ZECA 2VVVA 2XNIA 1WTGH 3RXCA 3TJVA 3ZZ5A 1GGDB 3M7QA 3MHWU 4NIXA 1A3BH 3H7TA 3QO6A 5DO4H 1C1RA 2W3KA 1UMAH 1MCVA 2HLCA 1EUFA 5E2OA 1C1QA 1AVXA 1HNEE 3LOXA 4CRCA 3KQEA 2UUFB 1CGHA 2Y5FA 4CREA 3VB6A 4TPYA 1MTUA 2VNTA 1Z7KA 4D7GA 1FIWA 5H4IB 2QXJA 1VGCC 3P8GA 1F0TA 5E2PA 1T8NA 4WMDA 2BD4A 3S7HB 1A61H 4X2XA 3RXGA 1IQJA 2ZTYA 3VXEH 1EPTA 1UCYH 4XFQA 1JRSA 1EKBB 2RDLA 4YT7H 1WSSH 1S6FA 3LC3A 3Q3YA 1QJ1B 4NWKA 1YGCH 3E16B 2HGTH 1PFXC 1SLXB 2DE8A 4X6PA 3RXSA 1P0SH 2QN5T 4I31A 3Q76A 3M3SA 2BVRH 1ELAA 1MQ5A 2LNCA 4Z0KA 2A4GA 1OWHA 2AMQA 2FI4E 3NPSA 2HNTC 1GJCB 1BRAA 2AERH 3QTVH 1DS2E 4JZIA 1KSNA 1GBDA 3RMLH 3I78A 1PQ5A 2JH0D 3M5LA 5A2MH 1G2LA 1LO6A 1MBMA 4NWLA 1JOUB 1JMOH 1XUKA 2XRCA 2ZPSA 1P10A 1V2ST 4F4OC 2FX6A 1CHOF 1G3CA 3ZZ8A 1QURH 1C1SA 2V6NA 1KYNA 4Y6DA 4JYUH 4YOIA 2P16A 1OSSA 1AKSB 1KDQB 1O2VA 2EI8A 1A7SA 1GDQA 5E0JA 1W12U 4E06H 5ESTE 2WYGA 1K1NA 3BIUH 1FN6A 2GT8A 1Z8RA 1AFQC 5C3NA 8GCHF 1EAWA 2A4QA 1SGFA 2BDGA 3NZIA 1TGNA 3DHKH 3UR6A 4A1TA 2W26A 3BTDE 2XBYA 2FOMB 3RU4D 1GVZA 1H4WA 1D3PB 4B2AA 1CU1A 2UWLA 3VXFH 4NSYA 3ZZ7A 4OS7A 2Z9IA 3URDA 1DXPA 5TJXA 2H5CA 5GJ4B 1C5WB 1AZ8A 1J15A 4Q7ZA 2OBOA 1C4U2 3UIRA 1K1JA 2FODA 1YCPK 5I46H 3FP7E 4H42U 3MMGA 1D4PB 3TH4H 6LPRA 2P95A 1C2IA 4IN1A 4XOJA 1O5FH 3TPIZ 4O9VA 8KME2 2AMPA 4XBBA 3SU6A 2BDHA 1RXPA 1UVSH 3ZVAA 5I25A 2OC8A 2VJ1A 1UVPA 1AIXH 1BMAA 1PPZA 3TITA 1B5GH 2FM2A 1BRUP 1WUNH 1INCA 2VWMA 1KLTA 4WY3A 2FI5E 1DWEH 2BDYA 4X1RU 3M61U 2IN2A 2WINI 1ID5H 1LKAA 2R9PA 4NA7A 1Y5AT 3RXLA 1C5QA 3E0NB 4MPUA 1C1TA 5DPAA 1ELVA 1P11E 3GOVB 4NA9H 2SGAA 4K3JA 3SU4A 2QXHA 1FY3A 2BY5X 1NS3A 4ASHA 3FZZA 4Q7YA 2Z9GA 3RC4A 4NZQA 1GJ9B 4KTUA 3O8CA 8GCHG 1QJ7B 2NU4E 3SV9A 5GCHG 2WPMS 3MU5A 1TX6A 3O8RA 3KIDU 3RU4T 1AMHA 3HK6B 2KAIA 4CR5A 1Y3UA 1MCTA 1K1PA 4FVDA 3UPEA 1FV9A 3GCNA 1CQQA 1LQEA 2EI6A 1C5YB 2HRVA 3ZVGA 2ZFPH 3AAUA 3Q00A 4ESTE 2OUAA 1W14U 4UD9H 5DG6A 1GBJA 3K2UA 3KHVA 4NG9H 1MZDA 1SMFE 3PMJA 2Z3EA 3SV6A 1MTSA 4NZLA 2R3UA 1SFIA 2VB0A 1J9CH 1ZR0A 4DJZB 4YOJA 1OWIA 4DG4A 2FMJA 1W8BH 1N8OC 3PMBB 1SOZA 2HVXA 4D7FA 1UO6A 1OP0A 1BTZA 2BVSH 2BX4A 3GY5A 4ZAEA 1HAZB 2ZU3A 4FUDA 2FP7B 3E91A 1NT1A 1C2DA 1JXPA 3Q77A 2GV6A 5C67A 1L1GA 3ZZ6A 3GY8A 1HJ8A 3S0NA 4KKDA 5DP4A 2W7SA 1TRNA 3M36A 3LGYA 4GVUA 3U98H 1O2HA 1GBFA 1RGQA 3ZZ3A 1GHZA 1G3DA 1DOJA 3RU4E 3VB7A 1LHFH 3SUFA 4AB8A 1TOCB 1O33A 2VIPA 2XTTB 2GDEH 1E37B 2JH5D 1PYTC 1T7CA 4THNH 4U30A 8ESTE 4LZ4B 3O8DA 2PKSC 1SGFG 1NY22 2NU2E 1QB6A 5HGGA 3K6YA 1XUJA 1PPCE 1C5RA 1MH0A 2C8XB 2ZIQH 5LPFA 2BOKA 1SL3A 1NRPH 1H9HE 2BM2A 1A5IA 1ANDA 1MTNC 1BIOA 2A7JA 4IW4E 3RXVA 1NESE 2ZWLH 1TRYA 4D8NA 3QGJA 1Y5BT 1ELTA 3TNTA 1A4WH 4ZXYH 3UNRA 4RSPA 4UFEH 3Q3KA 2RA0A 1PQAA 1N1LA 1BTYA 1C5PA 1GI2A 2QXGA 1EOLA 3A7ZA 3GDUA 1EZUC 3PTBA 4SGBE 3A80A 2A5KA 1WAYB 3A8BA 5DJ7A 1UTMA 2OLGA 4Q7XA 1C5TA 2W7UA 1FJSA 1PYTD 4WXIA 4TWYA 4BAMB 5K7RA 1BMNH 2A4RA 2QV1A 1ELDE 3F9EA 1GG6C 2AMDA 1S0QA 3SNEA 4CHAB 1GCTB 1O2LA 1EX3A 2WUBA 2FOCA 4JYVH 4OS5A 4OGYA 5EQRA 1NM6A 4U32A 3V13A 4Q80A 2ANKH 1TNIA 3KNXA 6CHAB 1UK2A 3O8BA 3BG4B 3FP8E 4KTSA 4UFGH 3TJNA 5EPYA 2O9QA 1O3NA 1X7AC 1QHRB 9LPRA 3M5MA 1QFKH 4X8VH 1BJVA 1F92A 4JZ1A 3E8LA 4ZH8A 5F6MA 1TB6H 5DKMA 1OWKA 2BD9A 2ODYB 4WF8A 1GJ5H 3I29A 5E8EH 2ZPQA 1GJDB 2R2WU 1TBRH 2A45B 1BA8B 2CMYA 1W10U 3L6PA 5CHAB 1OS8A 1HJAB 2SGQE 3ENSB 3DUXH 1GHWH 1P09A 2BMGB 2FZZA 1AB9B 3LIWA 1V3XA 2QY0B 4WVPE 5JB8S 1Z1JA 1ZTKA 2SFAA 3RXJA 1NFWA 3W94A 4ISLA 2P59A 5A0BA 2TGDA 2VVUA 1YPGH 3PWBA 4YESB 2H9EH 2FOEA 1G3EA 3HKJB 2ZI2H 4YO9A 1P2OA 4JZEH 1ABJH 2OBQA 3VGCB 1HUTH 2F9NA 2ZGHA 2AIPA 1V2WT 1C5SA 4I8LA 1AUJA 4OGXA 3STIA 2UWOA 2PUXB 1CT4E 1JIMA 2STAE 5FHTA 2B5TB 3NXPA 5HMAA 2BXTH 2J92A 2TRMA 3EQ0H 2OQUA 1RIWB 4ZHAA 1QBNA 3PV4A 2JETC 4A1VA 4ABDA 1O2TA 1LHEH 1TX7A 2Y5HA 3QX5H 4AG1A 1ZZZA 4FUHA 3BG8A 1HIAA 1GHVH 4YT6H 3R0FA 2F83A 2FTLE 1O2SA 3PLKA 3VB3A 1BBRH 3RXPA 4MPVA 1UHBB 4AGKA 1TPOA 3JZ1B 2GZ7A 2AS9A 3D23A 1GI5A 1S6HA 1A2CH 2G8TA 4Y11E 1MKWK 5DP3A 3U9AH 1UTNA 2I6QA 5C1UA 4K60A 3GISB 1NRRH 2A4OA 4Y0YE 3EA8A 1HAXB 4H6SB 1BTPA 4O03A 4Y7AA 1O2ZA 1UTPA 1O3HA 4HFPB 3ZYDA 1U6QA 1FY4A 1NROH 1YPLH 2AH4X 2EEKA 3ATLA 3PLBA 3PO1C 3QGNB 1A3EH 2VU8E 1B0EA 4KTCA 1PQ8A 1AVGH 1ELFA 2XC4A 2WPLS 2ZA5A 1GI0A 4J1YA 2P3UB 2ALVA 1EASA 1CA0B 1IQNA 2AGGX 3SI4H 1T8LA 5EQSA 2CV3A 1RD3B 1ZMLA 4X0WU 1ARBA 3UOUA 1FDPA 3SJOA 1O3KA 5EODA 1J17T 1MKXK 3SORA 5JB9S 2J9NA 4WXVA 1BMMH 1QB9A 2VH6A 1GI3A 2Q1JA 3PM3A 1FAXA 1XUGA 3ZVCA 1CGIE 4I8GA 5BRRE 3C27B 4MPXA 1NRQH 2TIOA 3BTQE 2TGPZ 1C4Y2 1O3OA 2VIQA 3F9HA 2A0QB 1WQSA 3OY6U 3UY9A 3NWUA 1BB0B 1V2LT 2PTCE 2C3SA 1C2EA 1A5GH 3U1IB 3SV7A 2G5NA 2H5DA 1UTOA 4FUBA 3BTKE 3LDXH 4O97A 1MZAA 2XWBI 1LMWB 4MNVA 3SV2H 2ODPA 2M5TA 2F9OA 4GPGA 1IQIA 5F8TA 1YC0A 1YPHE 3SUEA 4KP0A 1A46H 1C9TA 1O2YA 2CHAB 2FTMA 4XSKU 1AHTH 2CJIA 4B74A 3U1JB 2GZ9A 1UVUH 1FY1A 1GBEA 5EPNA 5AHGH 2WPIS 5HXFA 3WY8A 1DDJA 5DP6A 3IWMA 4MPWA 2O8WA 1FIZA 3UREA 4JK5A 2CGAA 4FUEA 2JH6D 3GY3A 1SQTA 2VIVA 1FPCH 1O35A 5EG4A 3ZZ9A 1TRMA 1TMBH 2QIQA 3GCHB 5CMXH 2FPZA 1BTWA 1DFPA 1EP5A 1L1NA 1LTOA 2BTCE 3NCLA 3PROA 4ABFA 4I7YH 1O3LA 2OXSA 5T6FA 5FBEA 1RTLA 4B75A 1UTLM 1H1BA 1SGDE 1XMNB 2PTNA 3RXUA 1N6XA 1H9IE 2JKHA 2ZNKH 2ZFSA 1K1OA 1C1MA 1TONA 1GMCF 3M37A 2BB4A 1C5VA 1IQEA 4ISHH 1O5AB 3D65E 1OWDA 5JBCS 1O2QA 1SGTA 2PGQB 4MQAA 5IYTA 1TBZH 1C1WH 1IQFA 3SNDA 2BY8X 2BQ6B 2QF0A 4NIWA 3UNSA 2FOGA 1P2KA 4FU9A 4WJG2 3LGIA 3OY5U 1SLWB 2RCEA 4X6MA 3B9FH 2G5VA 2QAAA 3RM2H 1XKAC 1YPEH 2ZQ2A 5B6OA 1GDUA 1TE0A 1GJ7B 3TK5A 2OTVA 1V2PT 4ABEA 5L2ZH 1IQLA 4X1NU 2ZGBH 5A8YA 4VGCB 1MU8B 1ZJDA 2VINA 1HAYB 2BDAA 2BDBA 1O2NA 2GKVE 4MLFB 1J14A 4UFFH 4GSOA 1KXFA 1AE8H 1EOJA 4Y71A 4JK6A 1SLUB 1CGJE 1MD8A 4BTTB 4INHA 4AORA 3ZYEA 4YTAA 1C1UH 1SGEE 2PR3A 2WYJA 1GL1A 1GVKB 1C2LA 1DICA 1IQKA 3FFGA 3D49H 1C1PA 2ZDAH 1GBLA 4FVBA 2G4TA 1OP8A 1DUAA 1DWBH 2ZHFH 4Y8YA 1SPJA 1HB0B 2J34A 1XUIA 5T6DA 2VGCC 2XYAA 3RXOA 4MTBA 3TNSA 1TABE 3RXRA 3A82A 2AYWA 3GCOA 1LHGH 1P06A 1MBQA 1Y5UT 1GMCG 1BTUA 1QBVH 1D3QB 2GCTB 2GMTB 4INLA 4BOHA 1KY9A 4JZFH 3LH3A 4AZ2B 2OCVB 2Y5GA 1OOKB 5GCHF 1TLDA 5EGMA 5DP8A 1PPFE 4ZMAH 2ANMH 3MNCA 5FCRA 4J2YB 3JZ2B 1O32A 2AIQA 1TYNA 1CT0E 1F7ZA 4IMZA 1TPPA 3BEFB 1XKBC 4KGAA 3SZNA 3H5CB 3GYLB 2SGDE 3TJOA 1RFNA 1Z8IB 1ZRBA 3QTOH 3QZQA 1DLEA 1EQ9A 1G36A 4Y79A 4FU7A 2ZTXA 1O3CA 4IBLH 4A6LA 4H6TA 2C90B 3SHCH 5F8XA 4YLQH 2BY7X 1T4VH 1THPB 6CHAC 5ABWA 4A5TS 4LZ1H 4AOQA 1ZYOA 3OSYA 1OX1A 4NIVA 3V12A 3BTGE 4CRDA 4ZHLU 3RXIA 4TY7A 3HKIB 2Y82A 3ESTA 1XXFA 1OWJA 3M7TA 3VFEA 1ESBA 2BD5A 5F8ZA 5BPEA 4TY6A 3RXFA 2V3OH 3RP2A 1C5XB 1PJPA 1QQ4A 1CE5A 2PKAA 1W2KH 3A87A 3BTEE 3T62A 1V2VT 2XC5A 3SV8A 1G3BA 1V2NT 1ZPZA 5CHAC 2P3FH 1QA0A 4Y8XA 4AFUA 1Y8TA 2ZP0H 2A5AA 1AB9C 2G51A 4K1SA 3BF6H 1HBTH 2A5IA 2HNTF 4R8TB 1KXBA 1NN6A 2Y7XA 1ZGIA 2BQ7B 4UDWH 1HAVA 3A7YA 1O0DH 5LPEA 1AY6H 2Q6GA 1W3CA 1ZPBA 1NU9A 1FY8E 2GVFA 2FOAA 2VWNA 1BCUH 1EPTB 1O5BB 1V2OT 1IHSH 5JDUB 3A8CA 1YCPH 4ISOA 1KTTB 3EE0B 1SG8B 4OS6A 3UQOA 4B71A 5L6NH 1DANH 3M7UA 2FLRH 1ZSLA 7GCHG 2A32A 4NGAH 4X1PU 1L4DA 1DY8A 1SQOA 4I8KA 1NFYA 1OYQA 3L33A 1SBWA 1GI6A 4LXBH 4PROA 1QRWA 3TVJB 1MQ6A 4ABIA 1DM4B 4DIIH 2Z3DA 1GL0E 1LVBA 1VITH 2I6SA 3LU9B 2THFB 1ETSH 5FPTA 1GBCA 1AFEH 3U8TH 1ZHRA 5ESBA 1ANBA 2ULLA 2OC0A 3ATWA 3T27A 4NA8A 4X2VA 4IMQA 1C5ZB 4JCNA 3B8JA 1PPBH 1VITF 1K2I1 1T31A 1C2KA 1ESTA 1E35B 2G00A 4A1XA 1SGCA 2UUYA 4LK4A 2AGIX 2FEQH 4BAHB 2IJOB 1J8AA 2FOHA 1NRNH 3RC5A 5A8XA 1KIGH 5EU8A 3A7VA 1P12E 3U8RH 2Z7FE 4OS1A 3E0PB 1ZSKA 3GICB 3SHAH 3SU3A 4I8HA 2BLQA 1EXFA 4F49A 1O2MA 5C1YA 4CR9A 3DA9B 7ESTE 2H9TH 2F9VA 2LPRA 1EZQA 2PWXA 3B23B 2HOBA 3ZZBA 2FO9A 5FX5A 1QL8A 3GDVA 2C93B 2H1UA 3TH2H 3P8FA 4ISNA 2A2QH 2XCFA 2D8WA 1BMLA 1RJXB 3UTUH 2GX4A 1D6RA 1BTHH 2GTBA 3PB1E 2GDDA 3E90B 1V2QT 3STJA 3RLWH 3W95A 3M3VA 3URCA 3HGPA 1TQ0B 3ZV8A 1YM0A 1A0LA 1KLIH 2XBXA 3E6PH 4JYTA 1E36B 1EJAA 1WU1A 2BX3A 1QRZA 3DT0H 3UFAA 1FUJA 1YPHC 3EAJA 2ESTE 1OXGA 1QL9A 1PPHE 1P04A 1O2IA 3ATKA 4D76A 3SU5A 2YOLA 1ZLRA 1F5LA 1QB1A 2G81E 1HXEH 3GY2A 2J94A 4B76A 4ZKRU 1VITG 1GI1A 1S5SA 1FAKH 3MO3A 1Y3XA 1GMDF 3A7WA 3ZZ4A 5FXLA 1GGDC 3MNSA 1QQUA 3GCHC 2XXLA 1KXEA 3KN2A 2ZU5A 1QTFA 9ESTA 1K9OE 1O5DH 3A83A 1XX9A 1HAHH 3GY4A 5F03A 4I8JA 3IG6B 1UTJA 2QC2A 1EAIA 2AFQB 1P8VC 1VCWA 2PW8H 2FI3E 1BRCE 4WMFA 1O2UA 1N6YA 3BTHE 4DY7B 3F1SB 3CP7A 1F5RA 1DSTA 2B7DH 2F9PA 1C1VH 4NCYA 1O30A 1O2JA 5C1XA 1AGJA 1P2NA 3U8OH 3VB4A 3I77A 2B0FA 1QGFA 1XXDA 1BDAA 1P9UA 1UK3A 3A86A 1FZZA 5A09A 1LCYA 3MFJA 1E38B 3S9AA 4D9QA 2KAIB 3QDZB 1SR5C 1TGTA 3PYHA 3KEEA 2VIWA 1K21H 1GI7B 3MO9A 2FWWA 1P02A 3S9CA 1MMJN 1OKXA 2F91A 5EOKA 3LPRA 5L2YH 1C4V2 3MU0A 2EI7A 3RMOH 4AYVB 4AYYB 1O3MA 4XE4A 4RKOB 1EZXC 1HLTH 2ZU4A 2R3YA 1HXFH 5DK1A 1DWCH 2HPPH 3PWCA 1HAPH 4AG2A 2BD3A 3CENA 1TALA 1EAUA 1MD7A 2ZQ1A 1GHYH 1ZGVA 1W7GH 4I32A 1P9SA 1VJ9U 1SGNE 1SVPA 2A1DB 1K1IA 4AGJA 2UWPA 1AZZA 5GIBA 3A89A 2ZDMA 4RKJB 4NIYA 1O5GH 3P6ZB 3TIUA 3L3TA 1ARCA 3QZRA 1HV7A 1AQ7A 5C20A 1P2JA 1GMDG 3ATIA 1L1JA 1W13U 2VH0A 1H8DH 1T8MA 3PMHB 3FP6E 4MNWA 1GJ8B 2QF3A 2SGPE 3UUZA 1AI8H 1GPZA 1V2MT 1O31A 3KGPA 1CSOE 1T32A 1T8OA 1L4ZA 1ZRKA 5ETXA 1XM1A 1EB2A 2C8WB 2HWLB 1O39A 2ZF0H 3LC5A 3MNXA 2GCTC 3MO6A 3V7TA 1QJ6B 1FPHH 5SGAE 2PLXA 5A0CA 1C5MD 1P3CA 3SNBA 1V6DA 1W0YH 2OP9A 4X8UH 1KXCA 1N8OB 2C8YB 5DGJA 3ODDA 2J95A 1TGSZ 1OYTH 4ZHMU 2OC1A 1SSXA 3P17H 1G32B 1AE5A 5JBAS 1SC8U 3A8DA 3M35A 3A85A 2BLOA 1GMHF 1KLJH 1PPEE 4SGAE 4ABAA 1TNLA 4A92A 1SGYE 1Z71A 1ORFA 2Y80A 4GCHF 2ODQA 1LPZB 2ZDNA 1ZJKA 2V3HH 1C2MA 2VVCA 1XUFA 2PHBA 1AKSA 1KDQA 1QA7A 3OYPA 6ESTA 3FVFB 5LH8A 3ODFA 1GBMA 4Y76A 2ALPA 3SNCA 2ASUB 5DP9A 1MTWA 1K1MA 4AFQA 4K69A 2BY9X 1H9LB 2NU0E 1CBWB 4UFDH 1V2KT 4CBOA 4AX9H 5CE1A 1TBQH 3SQEE 1AWFH 2PKSB 1RS0A 1LHCH 3RXBA 2H9HA 3EYDA 1AVWA 3RC6A 3LT3A 1QY6A 1Y59T 2R0KA 2QA9E 1MKWH 3ZZDA 2DUCA 1HAOH 4K2YA 1YKTA 2O8LA 2VIOA 1F0SA 2P3TB 3MNBA 1IAUA 1SQAA 3ITIA 1O38A 1MTNB 5L30H 1SHYA 2XC0A 2FOBA 2H2ZA 3OTJE 1G9IE 4CRAA 1YF4A 5C5NA 4X1SU 1ZMNA 4B73A 3DD2H 1O5CB 3EGKH 3P8OA 3ZZCA 3FAOA 1UCYK 3GYMA 2BLVA 1YLDA 4DGJA 3P95A 1TQ7B 2YNBA 2ZDVH 3SGBE 2TGAA 1TGBA 5AVDA 2AEIH 2D26C 3UOPA 5DP7A 2V0BA 1BUIA 2ZPRA 3TH3H 3VPKA 2OC7A 3CS7A 3P92A 1NU7B 3ZVFA 1MKXH 4FU8A 1O2RA 2ZG0H 3TK9A 2SNWA 5E0HA 1M9UA 3MH4A 2Z6BD 1BTXA 3H7OA 5JYIA 1GG6B 1J16A 1GMHG 3OU0A 1YP9A 4E7NA 1ZHMA 1LKBA 2FS8A 1VCQA 5G4BA 4GCHG 3TK6A 1PQ7A 1CO7E 5C2ZA 4AFSA 2ZEBA 2GT7A 3SNAA 4NSVA 3BV9B 1FN8A 2ZU1A 1EZSC 1O2XA 4FUGA 5IDKA 5JBBS 1P2QA 1QNJA 1WCZA 2PGBB 3AVZA 4UEHH 1GJ4H 4BAQB 3LKWA 3SBKA 4K8BA 1LPKB 1P3EA 2PSXA 1FONA 3NKKA 3R3GB 1DVAH 2NU3E 1DLKB 3LGVA 4ZKNU 3S7KB 3AASA 4IC5A 3GY7A 1F0RA 3UWJH 1VZQH 2A31A 4MVNA 3UR9A 1D3TB 1NRSH 1GCDA 1HIAB 1GBKA 3OX7U 4B2CA 2BZAA 1IHTH 2ZTZA 1ABIH 2QYIA 4RN6A 4QT8C 1BJUA 1RTFB 3A7XA 3SU1A 3F9FA 1O36A 5FCKA 1TX8A 1WTHD 3CS0A 1P03A 2ZHEH 4YOGA 2SGFE 2OQ5A 1WBGB 1GBIA 3FANA 1O2GH 2P8OB 1TWXB 3RMMH 4NFEA 2ANWA 4TWWA 1SGIB 4HZHA 1C5OH 1NTPA 2WPJS 4BTUB 3PLPA 2FYRA 1QCPA 3EA9A 1HRTH 4X2YA 2ZZUH 1B7XB 3SQHE 1SHHB 1O2OA 4A7IB 3SU2A 1FNIA 2BD7A 1EATA 1BT7A 2FESH 2JETB 1MAYA 3Q3XA 1SGRE 1O3DA 3GCTF 3T28A 4JZDH 5HM9A 2P93A 2O8UA 1Z8JB 2BDCA 4FUJA 4BNRA 1TNGA 1MTVA 1O3FA 1UTQA 2QGRA 4FXGH 4HGCA 1P2MA 1MU6B 2ZGJA 3S69A 3LONA 1CHGA 2FDAA 2AGEX 3ELAH 1P57B 1DSUA 1KTSB 3SI3H 2EA3A 2GCHF 2ZCLP 4X1QU 4Y10E 7GCHF 1TNKA 4ABJA 1JRTA 4MNYA 3UQVA 1DPOA 1G30B 2BD2A 3M3TA 3MWIU 4CHAC 1GCTC 1TA6A 1O3GA 3BIVH 5TCCA 1GI9B 3V3MA 1UVTH 2BY6X 4GUXA 2BDIA 3PO1B 4CRFA 5FPYA 1UCYE 4XDEA 1NPMA 3LGWA 1ELBA 3BG4C 1C5UA 1K1LA 5EQQA 1QL7A 3ZVDA 1YBWA 5LPRA 1Y3YA 2D1JA 2GZ8A 3BSQA 2O8TA 3MH6A 2IPHA 4GLYA 1EAXA 3E1XB 2ZC9H 3BEUA 1GJ6A 3RXHA 3RM0H 2NWNA 4DIHH 4B2BA 1EJNA 2PUQH 1HJAC 1AN1E 1A0JA 3LJJA 7LPRA 7KMEH 4OS2A 4TYDA 1L2EA 1TNJA 4D9RA 1YLCA 2OINA 1AD8H 1SGQE 1GBTA 4DURA 2Q6FA 1BRBE 4ABHA 1CHOG 4FUFA 3GCTG 3MTYA 1Z1IA 1V2TT 4CH2B 3M5OA 1Z6EA 3KQCA 1TIOA 1EJMA 2XWAA 1SI5H 3VGCC 2ANYA 3FZDA 2XBWA 3T26A 1ELEE 1GHBF 1LVMA 3BTME 2QXIA 4ABGA 5K0HA 3IITA 4WH8A 2GCHG 3C1KA 3F6UH 3G01A 5TCAA 3TGIE 1AU8A 2Q6DA 1RIWC 1P01A 2GD4B 2BOHB 1KXAA 3BTFE 1C5NH 2WUCA 4YZUA 1D6WA 1NFXA 5HM2A 1GI4A 3DFJA 3SJ9A 5C5OA 3MU4A 1BOQA 3NK8A 4DOQA 3VB5A
chains in the Genus database with same CATH superfamily
2K0QA 2Z9LA 1C1OA 1C2GA 1GI8B 3ZVEA 3GS9A 1BITA 2Z9KA 2B9LA 1GBAA 5EJZA 2W3IA 1SOTA 2ZDKA 5FBIA 6GCHF 1AWHB 4Y8ZA 3QN7A 2ZHDA 4IN2A 4K1EA 2ZO3H 3RXKA 1OWEA 1VGCB 3SJIA 1TNHA 3MOCA 1FY5A 3MU8A 1H8ED 2PFEA 2FOFA 3OAAD 1DY9A 2HPQH 4BXWA 1C2FA 2HLDD 1S81A 2UUJB 4E05H 2H6MA 4INKA 1ELCA 5EXNA 1RTKA 2WPKS 1GVLA 3N99A 3H09A 1HYLA 2FX4A 1NZQH 1TMTH 1FLEE 2GGVB 3RMNH 1LQDB 3F68H 1BQYA 2ZU2A 1CA0C 4P02A 3TGJE 1F5KU 1A5HA 1FQ3A 1GHAF 1TMUH 2Z94A 1TAWA 5JPMH 3OE7D 3RXTA 2FS9A 1V2JT 1YCPM 2GP9B 1JIRA 3AAVA 2ZFQH 2IOTA 4WMEA 4CRBA 5LGOA 3EA7A 4IGDA 3PMAB 1UHBA 3GY6A 1OHHD 1O34A 2HNTE 1Y3VA 1XVMA 4BXSA 1DWDH 1L0ZA 4AN7A 2JJ1D 3TU7H 2B8OH 2C8ZB 2JIZD 1LDTT 1TPAE 2F9UA 1GHBG 2XW9A 2Y7ZA 1CBWC 3P8NA 4XBCA 3ZV9A 4FUCA 1WXRA 2O8MA 3F2FA 1V2UT 3TGKE 2ZHQH 2WV4A 4X2WA 4CRGA 4K5ZA 4DW2U 1ANEA 1ETRH 4HI3A 1ELGA 1C9PA 1O3EA 3T2NA 5EXLA 1WQVH 3BTTE 3SGQE 3SU0A 1Y3WA 4R0IA 3SJKA 1T4UH 5T6GA 4IS5A 4MG3A 1HGTH 3HPTB 2KCYA 2A2XH 2G4UA 1Z8GA 4GHTA 4K1TA 2CHAC 4GHQA 1QR3E 2ZHWH 3T25A 4UONA 1ZTLA 1IOEA 5FAHA 2KZ4A 2VGCB 2BXUH 3RXDA 1ETTH 1ZOMA 3NUMA 2STBE 6GCHG 4ZKOU 1C1NA 1VJAU 1ESAA 4GAWA 1DE7H 1Q3XA 5AF9H 1AFQB 3T5FH 1HAIH 3S9BA 1SB1H 1YPKH 2CF8H 5AFYH 3V0XA 2BLWA 1CVWH 4MNXA 4X8TH 5GXPA 3RXAA 2XCNA 2PKAB 1YYY1 2EC9H 3RLYH 5GWZA 2BHGA 3MU1A 3TLOA 4O3TA 1K22H 3HK3B 4IC6A 1ACBE 1FI8A 2NU1E 4XBDA 1ZMJA 2CF9H 3RXMA 3A8AA 3E3TA 5HYOA 2RA3A 4TPIZ 1IQHA 5B6LA 2J4IA 2L6OA 1IQMA 3SW2B 5KECA 3K65B 1GHXH 1GHAG 3QLPH 1YPMH 1NC6A 1Q31A 2C4FH 1VR1H 4FUIA 2R2MB 1DX5M 1DXWA 2F9BH 2ZFTA 1Z6JH 5EXMA 2YNAA 1HAVB 1E1RD 2CXVA 2DE9A 4X6OA 2VWLA 5PTPA 1P2IA 4U2WA 3A88A 1HPGA 4KELA 4YLUA 1QIXB 2G55A 1E34B 1F2SE 3KQDA 3ZVBA 1EP6A 1P05A 3QK1A 1CT2E 1GJAB 3KCGH 5EJLA 1AO5A 2W6ID 1A1RA 3KQBA 2Z9JA 3SUGA 1WOFA 1BBRK 3PTNA 1W7XH 5GPIB 1TGCA 3SZEA 3SUDA 1UTKA 5AFZH 2KCPA 1VCPA 1UW7A 4VGCC 1GBHA 1W11U 1DUEA 3MH5A 1DITH 4AFZA 2Y81A 2J2UA 3AW1A 4NFFA 1IQGA 2V35A 1XVOA 2WPHS 4DCDA 1ZPCA 1H8IH 1C2HA 1PPGE 3LGTA 4WH6A 1W0ZU 3HATH 1C5LH 5FPSA 2A7CA 3RDZA 5DP5A 3MH7A 1BHXF 3D62A 1D9IA 2P8OC 2P94A 1FXYA 4Q2KA 2A7HA 2ZFFH 3SJ8A 4OS4A 2K1QA 4CH8B 1Q2WA 1MAXA 1ZHPA 2J38A 1O2WA 4BANB 1GWAA 1O3AA 2Z3CA 2F3CE 4E7RG 1SLVB 3LJOA 1THRH 4ZROA 1O2PA 2SNVA 5GDSH 3F3BA 2PV9B 1O5EH 5J4QA 5A0AE 5J4SA 1K28D 2ZFRH 5EW2H 3ZZAA 2GMTC 2J98B 3UNQA 1THSH 1WYKA 4O3UA 3SN8A 1SGPE 1S85A 2TGTA 3DFLA 4AB9A 8LPRA 3K6ZA 1AUTC 2BD8A 3A84A 1O3JA 2KM0A 3BN9A 2XBVA 1S83A 1TOMH 2QCYA 1HJ9A 3QWCH 3MI4A 2ZGCA 1UK4A 4WWYA 4F48B 2FIRH 3BTWE 1FMGA 1OP2A 5FX6A 4ZUHA 1BZXE 1QBOA 3GDSA 1O3PB 4M7GA 1ZSJA 1S84A 2BYAX 2ZCKP 1WV7H 4Y0ZE 3N7OA 1HFDA 3SGAE 1LHDH 4DVAU 2ILNA 1O3BA 5T3HA 3T29A 5E0GA 2FYQA 1D3DB 1TFXA 1NFUA 2OD3B 3ATMA 1UVOA 1GBBA 1JWTA 5GNDA 3U69H 4BTIB 4HTCH 1HDTH 2G52A 3AW0A 4YM9A 5A8ZA 1DT2A 2RG3A 1O2KA 2ZDLA 3MYWA 2FLBH 2ZCHP 4DT4A 4BAOB 4Z6AH 4DT7B 3KL6A 3QUMP 3SO3A 4B1TA 1GDNA 1YPJH 1GJBB 1TA2A 3KF2A 1V2RT 1G2MA 4LOYH 1MUEB 2BQWB 1CA8B 4X6NA 2R0LA 3UAIC 1XUHA 4B6FA 1S0RA 1TPSA 3EDXB 2FXRA 1ZTJA 2TPIZ 2J97A 1EB1H 3LH1A 3A7TA 2BVXH 3RXEA 3UWIA 1BHXB 3VEQB 5JBTA 3BEIB 4JMYA 1JBUH 3RXQA 1A0HB 2ZKSA 1HCGA 4BAKB 1QRXA 2BZ6H 2SGEE 3F9GA 3FOAA 3M5NA 4K8YA 1LVYA 1F0UA 1O3IA 3P70B 4X8SH 4UE7H 2UUKB 4ABBA 3SOSA 4MDSA 1O37A 1RRKA 1G37A 4U01A 2GV7A 3A81A 3RUOA 4I33A 1B0FA 1OPHB 2WV5A 1KXDA 4HG6A 2VWOA 3HGNA 1SFQB 1EPTC 2WSSD 1E0FD 1H8HD 3F2HA 3LGUA 1ANCA 1BBRE 3K9XB 4Y7BA 2TBSA 1HAGE 2CN0H 2W5EA 1S82A 4CBNA 5KEDA 2Y6TA 3TJUA 1UJ1A 2D2DA 1C2JA 4H4FA 4ISIH 1NO9H 5EW1H 2VIDA 4ZKSU 2PSYA 1LVOA 1LPGB 2ZGXH 2HALA 4ZXXH 2ZECA 2VVVA 2XNIA 1WTGH 3RXCA 3TJVA 3ZZ5A 1GGDB 3M7QA 3MHWU 4NIXA 1A3BH 3H7TA 3EE7A 3QO6A 5DO4H 1C1RA 2W3KA 1UMAH 1MCVA 2HLCA 1EUFA 5E2OA 1C1QA 1AVXA 1HNEE 3LOXA 4CRCA 3KQEA 2UUFB 1CGHA 2Y5FA 4CREA 3VB6A 4TPYA 1MTUA 2VNTA 1Z7KA 4D7GA 1FIWA 5H4IB 2QXJA 2EQNA 2V7QD 1VGCC 3P8GA 1F0TA 5E2PA 1T8NA 4WMDA 2BD4A 3S7HB 1A61H 4X2XA 3RXGA 1IQJA 2ZTYA 3VXEH 1EPTA 1UCYH 4XFQA 1JRSA 1SQRA 1EKBB 2RDLA 4YT7H 1WSSH 1S6FA 3LC3A 3Q3YA 1QJ1B 4NWKA 1YGCH 3E16B 2HGTH 1PFXC 1SLXB 2DE8A 4X6PA 3RXSA 1P0SH 2QN5T 4I31A 3Q76A 3M3SA 2BVRH 1ELAA 1MQ5A 2LNCA 4Z0KA 2A4GA 1OWHA 2AMQA 2FI4E 3NPSA 2HNTC 1GJCB 3U28C 1BRAA 2AERH 3QTVH 1DS2E 4JZIA 1KSNA 1GBDA 3RMLH 3I78A 1PQ5A 2JH0D 2GJGA 3M5LA 3MQKC 5A2MH 2CK3D 1G2LA 1LO6A 2WV9A 1MBMA 4NWLA 1JOUB 1JMOH 1XUKA 2XRCA 2ZPSA 1P10A 1V2ST 1WDIA 4F4OC 2FX6A 1CHOF 1G3CA 3ZZ8A 1QURH 1C1SA 2V6NA 1KYNA 4Y6DA 4JYUH 4YOIA 2P16A 1OSSA 1AKSB 1KDQB 1O2VA 2F4LA 2EI8A 1A7SA 1GDQA 5E0JA 1W12U 4E06H 5ESTE 2WYGA 1K1NA 3BIUH 1FN6A 2GT8A 1Z8RA 1AFQC 5C3NA 8GCHF 1EAWA 2A4QA 1SGFA 2EY4C 2BDGA 3NZIA 1TGNA 3DHKH 3UR6A 4A1TA 2W26A 3BTDE 2XBYA 2FOMB 3RU4D 1GVZA 1H4WA 1D3PB 3WW7A 2QE7D 4B2AA 1CU1A 2UWLA 3VXFH 4NSYA 3ZZ7A 4OS7A 2Z9IA 3URDA 1DXPA 5TJXA 2H5CA 3F2GA 5GJ4B 1C5WB 1AZ8A 1J15A 4Q7ZA 2OBOA 1C4U2 3UIRA 1K1JA 2FODA 1YCPK 5C0UA 3FP7E 5I46H 4H42U 3MMGA 1D4PB 3TH4H 6LPRA 2P95A 1C2IA 4IN1A 4XOJA 1O5FH 3TPIZ 4O9VA 8KME2 2AMPA 4XBBA 3SU6A 2BDHA 1RXPA 1UVSH 3ZVAA 5I25A 2OC8A 2VJ1A 1UVPA 1AIXH 1BMAA 1PPZA 3TITA 1B5GH 2FM2A 1BRUP 1WUNH 1INCA 2VWMA 1KLTA 4WY3A 2FI5E 5F53A 1DWEH 2BDYA 4X1RU 3M61U 2IN2A 2WINI 1ID5H 1LKAA 2R9PA 3AK5A 4NA7A 1Y5AT 3RXLA 1C5QA 3E0NB 4MPUA 1C1TA 5DPAA 1ELVA 1P11E 3GOVB 4NA9H 2SGAA 4K3JA 3SU4A 2QXHA 1FY3A 2BY5X 1NS3A 2L74A 4ASHA 3FZZA 4Q7YA 2Z9GA 3RC4A 4NZQA 1GJ9B 4KTUA 3O8CA 8GCHG 1QJ7B 2NU4E 3SV9A 4XRNA 5GCHG 2WPMS 3MU5A 1TX6A 5DN6D 3O8RA 3KIDU 3RU4T 1AMHA 3HK6B 2KAIA 4CR5A 1Y3UA 1MCTA 1K1PA 4FVDA 3UPEA 1FV9A 3GCNA 1CQQA 1LQEA 2EI6A 1C5YB 2HRVA 3ZVGA 2ZFPH 3AAUA 3Q00A 4ESTE 2OUAA 1W14U 4UD9H 5DG6A 2QF5A 1GBJA 3K2UA 3KHVA 4NG9H 1MZDA 1SMFE 3PMJA 2Z3EA 3SV6A 1MTSA 4NZLA 2QF4A 2R3UA 1SFIA 2VB0A 1J9CH 1ZR0A 4DJZB 4YOJA 1OWIA 4DG4A 2FMJA 1W8BH 1N8OC 3PMBB 1SOZA 3ZIAD 2HVXA 4D7FA 1UO6A 1OP0A 1BTZA 2BVSH 2BX4A 3GY5A 4ZAEA 1HAZB 2ZU3A 4FUDA 2FP7B 3F0PA 3E91A 1NT1A 1C2DA 1JXPA 3Q77A 3WWBA 2GV6A 5C67A 1L1GA 3ZZ6A 3GY8A 1HJ8A 3S0NA 4KKDA 5DP4A 2W7SA 1TRNA 3M36A 3LGYA 4GVUA 3U98H 1O2HA 1GBFA 1RGQA 3ZZ3A 1GHZA 1G3DA 1DOJA 3RU4E 3VB7A 1LHFH 3SUFA 4AB8A 1TOCB 1O33A 2K8IA 2VIPA 2XTTB 2GDEH 1E37B 2JH5D 1PYTC 1T7CA 4THNH 4U30A 1COWD 8ESTE 4LZ4B 3O8DA 1KMHB 2PKSC 1SGFG 2KCOA 1NY22 2NU2E 1QB6A 5HGGA 3K6YA 1XUJA 1PPCE 3FO8D 1C5RA 1MH0A 2C8XB 2ZIQH 5LPFA 2BOKA 1SL3A 1NRPH 1H9HE 2BM2A 1A5IA 1ANDA 1MTNC 2M2AA 1BIOA 2A7JA 4IW4E 3RXVA 1NESE 2ZWLH 1TRYA 4D8NA 3QGJA 1Y5BT 1ELTA 2KFWA 3TNTA 1A4WH 4ZXYH 4YXWD 3UNRA 4RSPA 4UFEH 3Q3KA 2RA0A 1PQAA 1N1LA 1BTYA 1C5PA 1GI2A 2QXGA 1EOLA 3A7ZA 3GDUA 1EZUC 3OEHD 3PTBA 4SGBE 3PRBA 3A80A 2A5KA 1WAYB 3A8BA 5DJ7A 1UTMA 3FN8A 2HVYB 2OLGA 4Q7XA 1C5TA 2W7UA 1FJSA 1PYTD 4WXIA 4TWYA 4BAMB 5K7RA 1BMNH 2A4RA 2QV1A 1ELDE 3F9EA 1GG6C 2AMDA 1S0QA 3OFND 3SNEA 4CHAB 1GCTB 1O2LA 1EX3A 2WUBA 2FOCA 4JYVH 4OS5A 4OGYA 5EQRA 1NM6A 4U32A 3V13A 4Q80A 2ANKH 1TNIA 3KNXA 6CHAB 1UK2A 3O8BA 3BG4B 3FP8E 5T1VA 4KTSA 4UFGH 3TJNA 5EPYA 2O9QA 1O3NA 1X7AC 3WWFA 1QHRB 9LPRA 3M5MA 1QFKH 4X8VH 1BJVA 1F92A 4JZ1A 3E8LA 4ZH8A 5F6MA 1TB6H 5DKMA 1OWKA 2BD9A 2ODYB 4WF8A 1GJ5H 3I29A 5E8EH 2ZPQA 1GJDB 2R2WU 1TBRH 3OEED 2A45B 1BA8B 2CMYA 1W10U 3L6PA 5CHAB 1OS8A 1HJAB 4RT0A 2SGQE 3ENSB 3DUXH 1GHWH 2V3MA 1P09A 2BMGB 2FZZA 1AB9B 3LIWA 1V3XA 2QY0B 4WVPE 4FETA 5JB8S 1Z1JA 1ZTKA 2SFAA 3RXJA 1NFWA 3W94A 4ISLA 4RT1A 2P59A 5A0BA 2TGDA 2VVUA 1YPGH 3PWBA 4YESB 2H9EH 2FOEA 1G3EA 3HKJB 2ZI2H 4YO9A 1P2OA 4JZEH 1ABJH 2OBQA 3VGCB 1HUTH 2F9NA 2ZGHA 2AIPA 1V2WT 1C5SA 4I8LA 1AUJA 4OGXA 3STIA 2UWOA 2PUXB 1CT4E 1JIMA 2STAE 5FHTA 2B5TB 3NXPA 5HMAA 2BXTH 2J92A 2TRMA 3EQ0H 2OQUA 1RIWB 4ZHAA 4P00A 1QBNA 3PV4A 1W0KD 2JETC 4A1VA 4ABDA 1O2TA 1LHEH 1TX7A 2Y5HA 3QX5H 4AG1A 1ZZZA 4FUHA 3BG8A 1HIAA 1GHVH 4YT6H 3R0FA 2F83A 2FTLE 1O2SA 3PLKA 3VB3A 1BBRH 3RXPA 4MPVA 1UHBB 4AGKA 1TPOA 3JZ1B 2GZ7A 2AS9A 3D23A 1GI5A 1S6HA 1A2CH 2G8TA 3KYGA 4Y11E 1MKWK 5DP3A 3U9AH 1UTNA 2I6QA 5C1UA 2F43B 4K60A 3GISB 1NRRH 2A4OA 4Y0YE 3EA8A 1HAXB 4H6SB 1BTPA 4O03A 4Y7AA 1O2ZA 1UTPA 1O3HA 4HFPB 3ZYDA 1U6QA 1FY4A 1NROH 1YPLH 2AH4X 2EEKA 3ATLA 3PLBA 3PO1C 3QGNB 1A3EH 2VU8E 1B0EA 4KTCA 1PQ8A 1AVGH 1ELFA 2YMSB 3PV5A 2XC4A 2WPLS 2ZA5A 1GI0A 4J1YA 2P3UB 2ALVA 4TT3D 1EASA 1CA0B 1IQNA 2AGGX 2XNDD 3SI4H 1T8LA 5EQSA 2CV3A 1RD3B 1ZMLA 4X0WU 1ARBA 3UOUA 1FDPA 3SJOA 1O3KA 5EODA 1J17T 1MKXK 3SORA 5JB9S 2J9NA 4WXVA 1BMMH 1QB9A 2VH6A 1GI3A 2Q1JA 3PM3A 1FAXA 2WHXA 1XUGA 3ZVCA 1CGIE 4I8GA 5BRRE 3C27B 4MPXA 3PV2A 1NRQH 2TIOA 3BTQE 2TGPZ 1C4Y2 1O3OA 2VIQA 3F9HA 2A0QB 1WQSA 3OY6U 3UY9A 4F55A 3NWUA 1BB0B 1V2LT 2PTCE 2C3SA 2KR7A 1C2EA 1A5GH 3U1IB 3SV7A 1FX0B 2G5NA 2H5DA 1UTOA 4FUBA 3BTKE 3LDXH 4O97A 1MZAA 2XWBI 1LMWB 4MNVA 3PRDA 3SV2H 2ODPA 2M5TA 2F9OA 4GPGA 1IQIA 5F8TA 1YC0A 1YPHE 3SUEA 5FL7D 4KP0A 1A46H 1C9TA 1O2YA 2CHAB 2FTMA 4XSKU 1AHTH 2CJIA 4B74A 3U1JB 2RFKC 2GZ9A 1UVUH 1FY1A 1GBEA 5EPNA 5AHGH 2WPIS 5HXFA 3WY8A 1DDJA 5DP6A 3IWMA 4MPWA 2O8WA 5HIYA 1FIZA 3UREA 4JK5A 2CGAA 4FUEA 2JH6D 3GY3A 1SQTA 2VIVA 5DSFA 1FPCH 1O35A 5EG4A 3ZZ9A 1TRMA 1TMBH 2QIQA 3GCHB 5EIYA 5CMXH 2FPZA 1BTWA 1DFPA 1EP5A 1L1NA 1LTOA 2BTCE 3NCLA 3PROA 4ABFA 4I7YH 1O3LA 2OXSA 5T6FA 1NBMD 5FBEA 1RTLA 4B75A 1UTLM 4FOUC 1H1BA 1SGDE 1XMNB 2PTNA 3RXUA 1N6XA 1H9IE 2JKHA 2ZNKH 2LP6A 2ZFSA 1K1OA 1C1MA 1TONA 1GMCF 3M37A 2BB4A 1C5VA 1IQEA 4ISHH 1O5AB 3D65E 1OWDA 2KX4A 1O2QA 5JBCS 1SGTA 2PGQB 4MQAA 5IYTA 1TBZH 1C1WH 1IQFA 3SNDA 2BY8X 2J5UA 2BQ6B 2QF0A 4NIWA 3UNSA 2FOGA 1P2KA 4FU9A 4WJG2 3LGIA 3SYJA 3OY5U 1SLWB 2RCEA 4X6MA 3B9FH 2G5VA 2QAAA 3RM2H 1XKAC 1YPEH 2ZQ2A 5B6OA 1GDUA 1TE0A 1GJ7B 3TK5A 2OTVA 1V2PT 4ABEA 5L2ZH 1IQLA 3N7EA 4X1NU 2ZGBH 5A8YA 4VGCB 1MU8B 1ZJDA 2VINA 5KGOA 1HAYB 2BDAA 2BDBA 1O2NA 2GKVE 4MLFB 1J14A 4UFFH 4GSOA 1KXFA 1AE8H 1EOJA 4Y71A 4B6EA 4JK6A 1SLUB 1CGJE 1MD8A 4BTTB 4INHA 4AORA 3ZYEA 4YTAA 1C1UH 1SGEE 2PR3A 2WYJA 1GL1A 1GVKB 4RI0A 1C2LA 5C0TA 1DICA 1IQKA 3FFGA 3D49H 1C1PA 2ZDAH 1GBLA 4FVBA 2G4TA 1OP8A 1DUAA 1DWBH 2ZHFH 4Y8YA 1SPJA 1HB0B 2J34A 1XUIA 5T6DA 2VGCC 2XYAA 3RXOA 4MTBA 3TNSA 1TABE 3RXRA 3A82A 2AYWA 3GCOA 1LHGH 1P06A 1MBQA 1Y5UT 1GMCG 1BTUA 1QBVH 1D3QB 2GCTB 2GMTB 4INLA 4BOHA 1KY9A 4JZFH 3LH3A 4AZ2B 2OCVB 3UB0A 2Y5GA 1OOKB 5GCHF 1TLDA 5EGMA 5DP8A 1PPFE 4ZMAH 2ANMH 3MNCA 5FCRA 4J2YB 3JZ2B 1O32A 2AIQA 1TYNA 1CT0E 1F7ZA 4IMZA 1TPPA 3BEFB 1XKBC 4KGAA 3SZNA 3H5CB 3GYLB 2SGDE 3TJOA 1RFNA 1Z8IB 1ZRBA 3QTOH 3QZQA 1DLEA 1EQ9A 1G36A 4Y79A 4FU7A 2ZTXA 1O3CA 4ZCNA 4IBLH 4A6LA 4H6TA 2C90B 3SHCH 5F8XA 4YLQH 2BY7X 1T4VH 1THPB 6CHAC 5ABWA 4A5TS 4LZ1H 4AOQA 1ZYOA 3OSYA 1NBME 1OX1A 4NIVA 1YWUA 3V12A 3BTGE 4CRDA 4ZHLU 3RXIA 4TY7A 3HKIB 2Y82A 3ESTA 1XXFA 1OWJA 3M7TA 3VFEA 1ESBA 2BD5A 5F8ZA 5BPEA 4TY6A 3RXFA 3FKSD 2V3OH 2WPDD 3RP2A 1C5XB 1PJPA 1QQ4A 1CE5A 2PKAA 1W2KH 3A87A 3BTEE 3T62A 1V2VT 2XC5A 3SV8A 1G3BA 1V2NT 1ZPZA 5CHAC 2P3FH 2IJD1 4XD7D 1QA0A 4Y8XA 4AFUA 1Y8TA 2ZP0H 2A5AA 1AB9C 2G51A 4K1SA 3BF6H 1HBTH 2A5IA 2HNTF 4R8TB 1KXBA 1NN6A 2Y7XA 1ZGIA 2BQ7B 4Z1MD 4UDWH 1YY3A 1HAVA 3A7YA 1O0DH 5LPEA 1AY6H 2Q6GA 1W3CA 1ZPBA 1NU9A 1FY8E 2GVFA 3KQ5A 2FOAA 2VWNA 1BCUH 1EPTB 1O5BB 1V2OT 1IHSH 5JDUB 3A8CA 1YCPH 4ISOA 1KTTB 3EE0B 1SG8B 4OS6A 3UQOA 4B71A 5L6NH 1DANH 3M7UA 2FLRH 1ZSLA 7GCHG 2A32A 4NGAH 4X1PU 1L4DA 1DY8A 1SQOA 4I8KA 1NFYA 1OYQA 3L33A 5HIZA 1SBWA 1GI6A 4LXBH 4PROA 1QRWA 3TVJB 1MQ6A 4ABIA 1DM4B 4DIIH 2Z3DA 1GL0E 1LVBA 1VITH 2I6SA 3LU9B 2THFB 1ETSH 5FPTA 1GBCA 1AFEH 3U8TH 1ZHRA 5ESBA 1ANBA 2ULLA 2OC0A 3ATWA 3T27A 4NA8A 4X2VA 4IMQA 1C5ZB 3F0OA 4JCNA 3B8JA 1PPBH 1VITF 1K2I1 1T31A 1C2KA 1ESTA 1E35B 2G00A 4A1XA 1SGCA 2UUYA 4LK4A 2AGIX 2FEQH 4BAHB 2IJOB 1J8AA 2FOHA 1NRNH 3RC5A 5A8XA 1KIGH 5EU8A 3A7VA 1P12E 3U8RH 2Z7FE 2YMSC 4OS1A 3E0PB 1ZSKA 3GICB 3SHAH 3SU3A 4I8HA 2BLQA 1EXFA 4F49A 4ACBA 2J98A 1O2MA 5C1YA 4CR9A 3DA9B 1EFRD 7ESTE 2H9TH 2F9VA 2LPRA 1EZQA 2PWXA 3B23B 2HOBA 3ZZBA 2FO9A 5FX5A 1QL8A 3GDVA 2C93B 2H1UA 3TH2H 3P8FA 4ISNA 2A2QH 2XCFA 2D8WA 1BMLA 1RJXB 3UTUH 2GX4A 1D6RA 1BTHH 2GTBA 3PB1E 2GDDA 3E90B 1V2QT 3STJA 3RLWH 3W95A 3M3VA 3URCA 3HGPA 1TQ0B 3ZV8A 1YM0A 1A0LA 1KLIH 2XBXA 3E6PH 4JYTA 2PP6A 1E36B 1EJAA 1WU1A 2BX3A 1QRZA 3DT0H 3UFAA 1FUJA 1YPHC 3EAJA 2ESTE 1OXGA 1QL9A 1PPHE 2YMSD 1P04A 3CNRA 1O2IA 3ATKA 4D76A 3SU5A 2YOLA 1ZLRA 1F5LA 1QB1A 2G81E 1HXEH 3GY2A 2J94A 4B76A 4ZKRU 1VITG 1GI1A 1S5SA 1FAKH 3MO3A 1Y3XA 1GMDF 3A7WA 3ZZ4A 2W6JD 5FXLA 1GGDC 3MNSA 5CHBA 1QQUA 3GCHC 2XXLA 1KXEA 3KN2A 2ZU5A 1QTFA 9ESTA 1K9OE 1O5DH 1W0JD 3A83A 1XX9A 1HAHH 3GY4A 5F03A 4I8JA 3IG6B 1UTJA 2QC2A 1EAIA 2AFQB 1P8VC 1VCWA 2PW8H 2FI3E 1BRCE 4WMFA 1O2UA 1N6YA 3BTHE 4DY7B 3F1SB 3CP7A 1F5RA 1DSTA 2B7DH 2F9PA 1C1VH 4NCYA 1O30A 1O2JA 5IK2D 5C1XA 1AGJA 1P2NA 3DSOA 3U8OH 3VB4A 3I77A 2B0FA 1QGFA 1XXDA 1BDAA 1P9UA 1UK3A 3A86A 1FZZA 5A09A 2RDEA 1LCYA 3MFJA 5CDFE 1E38B 3S9AA 4D9QA 2KAIB 3QDZB 1SR5C 1TGTA 3PYHA 3KEEA 3DSGA 2VIWA 1K21H 1GI7B 3MO9A 2FWWA 1P02A 3S9CA 1MMJN 1OKXA 2F91A 2JDID 5EOKA 3LPRA 5L2YH 1C4V2 3MU0A 2EI7A 3RMOH 4AYVB 4AYYB 1O3MA 1YLNA 4XE4A 4RKOB 2IPQX 1EZXC 1HLTH 2ZU4A 2R3YA 1HXFH 5DK1A 1DWCH 2HPPH 3PWCA 1HAPH 4AG2A 2BD3A 3CENA 1TALA 1EAUA 1MD7A 2ZQ1A 1GHYH 1ZGVA 1W7GH 4I32A 1P9SA 1VJ9U 1SGNE 1SVPA 2A1DB 1K1IA 4AGJA 2UWPA 1AZZA 5GIBA 3A89A 2ZDMA 4RKJB 4NIYA 1O5GH 3P6ZB 3TIUA 3L3TA 1ARCA 3QZRA 1HV7A 1MABB 1AQ7A 5C20A 1P2JA 1GMDG 3ATIA 1L1JA 1W13U 2VH0A 4I86A 1H8DH 1T8MA 3PMHB 3FP6E 4MNWA 1GJ8B 2QF3A 2SGPE 3UUZA 1AI8H 1GPZA 1V2MT 1O31A 3KGPA 1CSOE 1T32A 1T8OA 2AHME 1L4ZA 1ZRKA 5ETXA 1XM1A 1EB2A 2C8WB 2HWLB 1O39A 2ZF0H 3LC5A 3MNXA 2GCTC 3MO6A 4OM9A 3V7TA 1QJ6B 1K0HA 1FPHH 5SGAE 2PLXA 5A0CA 1C5MD 1P3CA 3SNBA 1V6DA 1W0YH 2OP9A 4X8UH 1KXCA 1N8OB 2C8YB 5DGJA 3ODDA 2J95A 1TGSZ 1OYTH 4ZHMU 2OC1A 1SSXA 3P17H 1G32B 1AE5A 5JBAS 1SC8U 2KCAA 3A8DA 3M35A 3A85A 2BLOA 1GMHF 1KLJH 1PPEE 4SGAE 4ABAA 1TNLA 4A92A 1SGYE 1Z71A 1ORFA 2Y80A 4GCHF 2ODQA 1LPZB 2ZDNA 1ZJKA 2V3HH 1C2MA 2VVCA 1XUFA 2PHBA 1AKSA 1KDQA 4M9FA 1QA7A 3OYPA 6ESTA 3FVFB 5LH8A 3ODFA 1GBMA 4Y76A 2ALPA 3SNCA 2ASUB 5DP9A 1MTWA 1K1MA 4AFQA 4K69A 1S6LA 2BY9X 1H9LB 2NU0E 1CBWB 4UFDH 1V2KT 4CBOA 5C17A 4AX9H 5CE1A 1TBQH 3SQEE 1AWFH 2PKSB 1RS0A 1LHCH 3RXBA 2H9HA 3EYDA 3VG8A 1AVWA 3RC6A 3LT3A 1QY6A 1Y59T 2R0KA 2QA9E 1MKWH 3ZZDA 2DUCA 1HAOH 4K2YA 1YKTA 2O8LA 2VIOA 1F0SA 4Q4LA 2P3TB 3MNBA 1IAUA 1SQAA 3ITIA 1O38A 1MTNB 5L30H 1SHYA 2XC0A 2FOBA 2H2ZA 3OTJE 1G9IE 4CRAA 1YF4A 5C5NA 3DCLA 4X1SU 1ZMNA 4B73A 3DD2H 1O5CB 3EGKH 3P8OA 3ZZCA 3FAOA 1UCYK 3GYMA 2BLVA 1YLDA 4DGJA 2WZQA 3P95A 1TQ7B 2YNBA 2ZDVH 3SGBE 2TGAA 1TGBA 5AVDA 2AEIH 2D26C 3UOPA 1BMFD 5DP7A 2V0BA 1BUIA 2ZPRA 3TH3H 3VPKA 2OC7A 3CS7A 3P92A 1NU7B 3ZVFA 1MKXH 4FU8A 1O2RA 2ZG0H 3TK9A 2SNWA 5E0HA 1M9UA 3MH4A 2Z6BD 1BTXA 3H7OA 5JYIA 1GG6B 1J16A 1GMHG 3OU0A 1YP9A 4E7NA 1ZHMA 1LKBA 2FS8A 1VCQA 5G4BA 4GCHG 3TK6A 1PQ7A 1CO7E 5C2ZA 4AFSA 2ZEBA 2GT7A 3SNAA 4NSVA 3BV9B 1FN8A 2ZU1A 1EZSC 1O2XA 4FUGA 5IDKA 5JBBS 1P2QA 1QNJA 1WCZA 2PGBB 3AVZA 4UEHH 1GJ4H 4BAQB 3LKWA 3SBKA 4K8BA 1LPKB 1P3EA 2PSXA 1FONA 3NKKA 3R3GB 1DVAH 3W1EA 2NU3E 1DLKB 3LGVA 1E79D 4ZKNU 3S7KB 3AASA 4IC5A 3GY7A 1F0RA 3UWJH 1VZQH 2A31A 4Q63A 4MVNA 3UR9A 1D3TB 1NRSH 1GCDA 1HIAB 1GBKA 3OX7U 4B2CA 2BZAA 1IHTH 2ZTZA 1ABIH 2QYIA 4RN6A 4QT8C 1BJUA 1RTFB 3A7XA 3SU1A 3F9FA 1O36A 5FCKA 2LELA 1TX8A 1WTHD 1E1QD 3CS0A 2OK5A 1P03A 2ZHEH 4YOGA 2SGFE 2OQ5A 1WBGB 1GBIA 3FANA 1O2GH 2P8OB 1TWXB 3RMMH 4NFEA 2ANWA 4TWWA 1SGIB 4HZHA 1C5OH 1NTPA 2WPJS 4BTUB 3OTPA 2FYRA 1QCPA 3EA9A 1HRTH 3PLPA 2ZZUH 1B7XB 4X2YA 3SQHE 1SHHB 1O2OA 4A7IB 1VKYA 3SU2A 1FNIA 2BD7A 1EATA 1BT7A 2FESH 2JETB 1MAYA 3Q3XA 1SGRE 1O3DA 3GCTF 3T28A 4JZDH 5HM9A 2P93A 2O8UA 1Z8JB 2BDCA 4FUJA 4BNRA 1TNGA 1MTVA 1O3FA 1UTQA 2QGRA 4FXGH 4HGCA 1P2MA 1MU6B 2ZGJA 3S69A 5HKKD 3LONA 1CHGA 2FDAA 2AGEX 3ELAH 1P57B 1DSUA 1KTSB 3SI3H 2EA3A 2GCHF 2ZCLP 4X1QU 4Y10E 7GCHF 1TNKA 4ABJA 1JRTA 4MNYA 3UQVA 1DPOA 1G30B 1SKYE 2BD2A 3M3TA 3MWIU 4CHAC 1GCTC 1TA6A 3NRLA 1O3GA 3BIVH 5TCCA 1GI9B 4TSFD 3V3MA 1UVTH 2BY6X 4GUXA 2BDIA 3PO1B 4CRFA 5FPYA 1UCYE 4XDEA 1NPMA 3LGWA 1ELBA 3BG4C 1C5UA 1K1LA 5EQQA 1QL7A 3ZVDA 1YBWA 5LPRA 2VBCA 1Y3YA 2D1JA 2GZ8A 3BSQA 2O8TA 3MH6A 2IPHA 5C94A 4GLYA 1EAXA 3E1XB 2ZC9H 3BEUA 3KYFA 1GJ6A 3RXHA 3RM0H 2NWNA 4DIHH 4B2BA 1EJNA 2PUQH 1HJAC 1AN1E 1A0JA 3LJJA 1QZ8A 7LPRA 7KMEH 4OS2A 4TYDA 1L2EA 1TNJA 4D9RA 1YLCA 2OINA 1AD8H 1SGQE 1GBTA 4DURA 2Q6FA 1BRBE 4ABHA 2XOKD 1CHOG 4FUFA 3GCTG 3MTYA 1Z1IA 1V2TT 4CH2B 3M5OA 1Z6EA 3KQCA 1TIOA 1EJMA 3DSPA 2XWAA 1SI5H 3VGCC 2ANYA 3FZDA 2XBWA 3T26A 1ELEE 1GHBF 4AC9A 5EJ1A 1LVMA 3BTME 2QXIA 4ABGA 5K0HA 3IITA 4WH8A 2GCHG 3C1KA 3F6UH 2JJ2D 3G01A 5TCAA 4ACAA 3TGIE 1AU8A 2Q6DA 1RIWC 1P01A 2GD4B 2BOHB 1KXAA 3BTFE 1C5NH 2WUCA 4YZUA 4ASUD 1D6WA 1NFXA 5HM2A 3N7DA 1GI4A 3DFJA 3SJ9A 5C5OA 3MU4A 1BOQA 3NK8A 4DOQA 3VB5A
chains in the Genus database with same CATH topology
2Z9LA 1C1OA 1C2GA 1GI8B 3ZVEA 1BITA 2Z9KA 2B9LA 1GBAA 2W3IA 1SOTA 2ZDKA 5FBIA 6GCHF 1AWHB 4Y8ZA 3QN7A 2ZHDA 4IN2A 4K1EA 2ZO3H 3RXKA 1OWEA 1VGCB 3SJIA 1TNHA 3MOCA 1FY5A 3MU8A 2PFEA 2FOFA 1DY9A 2HPQH 4BXWA 1C2FA 1S81A 2UUJB 4E05H 2H6MA 4INKA 1ELCA 5EXNA 1RTKA 2WPKS 1GVLA 1HYLA 2FX4A 1NZQH 1TMTH 1FLEE 2GGVB 3RMNH 1LQDB 3F68H 1BQYA 2ZU2A 1CA0C 3TGJE 1F5KU 1A5HA 1FQ3A 1GHAF 1TMUH 2Z94A 1TAWA 5JPMH 3RXTA 2FS9A 1V2JT 1YCPM 2GP9B 1JIRA 3AAVA 2ZFQH 2IOTA 4WMEA 4CRBA 5LGOA 3EA7A 4IGDA 3PMAB 1UHBA 3GY6A 1O34A 2HNTE 1Y3VA 1XVMA 4BXSA 1DWDH 1L0ZA 4AN7A 3TU7H 2B8OH 2C8ZB 1LDTT 1TPAE 2F9UA 1GHBG 2XW9A 2Y7ZA 1CBWC 3P8NA 4XBCA 3ZV9A 4FUCA 2O8MA 1V2UT 3TGKE 2ZHQH 2WV4A 4X2WA 4CRGA 4K5ZA 4DW2U 1ANEA 1ETRH 4HI3A 1ELGA 1C9PA 1O3EA 3T2NA 5EXLA 1WQVH 3BTTE 3SGQE 3SU0A 1Y3WA 4R0IA 3SJKA 1T4UH 5T6GA 4IS5A 4MG3A 1HGTH 3HPTB 2A2XH 2G4UA 1Z8GA 4GHTA 4K1TA 2CHAC 4GHQA 1QR3E 2ZHWH 3T25A 4UONA 1ZTLA 1IOEA 5FAHA 2VGCB 2BXUH 3RXDA 1ETTH 1ZOMA 3NUMA 2STBE 6GCHG 4ZKOU 1C1NA 1VJAU 1ESAA 4GAWA 1DE7H 1Q3XA 5AF9H 1AFQB 3T5FH 1HAIH 3S9BA 1SB1H 1YPKH 2CF8H 5AFYH 3V0XA 2BLWA 1CVWH 4MNXA 4X8TH 5GXPA 3RXAA 2XCNA 2PKAB 1YYY1 2EC9H 3RLYH 5GWZA 2BHGA 3MU1A 3TLOA 4O3TA 1K22H 3HK3B 4IC6A 1ACBE 1FI8A 2NU1E 4XBDA 1ZMJA 2CF9H 3RXMA 3A8AA 3E3TA 5HYOA 2RA3A 4TPIZ 1IQHA 2J4IA 1IQMA 3SW2B 3K65B 1GHXH 1GHAG 3QLPH 1YPMH 1NC6A 1Q31A 2C4FH 1VR1H 4FUIA 2R2MB 1DX5M 1DXWA 2F9BH 2ZFTA 1Z6JH 5EXMA 2YNAA 1HAVB 2CXVA 2DE9A 4X6OA 2VWLA 5PTPA 1P2IA 4U2WA 3A88A 1HPGA 4KELA 4YLUA 1QIXB 2G55A 1E34B 1F2SE 3KQDA 3ZVBA 1EP6A 1P05A 3QK1A 1CT2E 1GJAB 3KCGH 1AO5A 1A1RA 3KQBA 2Z9JA 3SUGA 1WOFA 1BBRK 3PTNA 1W7XH 5GPIB 1TGCA 3SUDA 1UTKA 5AFZH 1VCPA 4VGCC 1GBHA 1W11U 1DUEA 3MH5A 1DITH 4AFZA 2Y81A 2J2UA 3AW1A 4NFFA 1IQGA 2V35A 1XVOA 2WPHS 4DCDA 1ZPCA 1H8IH 1C2HA 1PPGE 3LGTA 4WH6A 1W0ZU 3HATH 1C5LH 5FPSA 2A7CA 3RDZA 5DP5A 3MH7A 1BHXF 3D62A 1D9IA 2P8OC 2P94A 1FXYA 4Q2KA 2A7HA 2ZFFH 3SJ8A 4OS4A 2K1QA 4CH8B 1Q2WA 1MAXA 1ZHPA 2J38A 1O2WA 4BANB 1GWAA 1O3AA 2Z3CA 2F3CE 4E7RG 1SLVB 3LJOA 1THRH 4ZROA 1O2PA 2SNVA 5GDSH 2PV9B 1O5EH 5J4QA 5A0AE 5J4SA 1K28D 2ZFRH 5EW2H 3ZZAA 2GMTC 3UNQA 1THSH 1WYKA 4O3UA 3SN8A 1SGPE 1S85A 2TGTA 3DFLA 4AB9A 8LPRA 3K6ZA 1AUTC 2BD8A 3A84A 1O3JA 3BN9A 2XBVA 1S83A 1TOMH 2QCYA 1HJ9A 3QWCH 3MI4A 2ZGCA 1UK4A 4WWYA 2FIRH 3BTWE 1FMGA 1OP2A 5FX6A 4ZUHA 1BZXE 1QBOA 3GDSA 1O3PB 4M7GA 1ZSJA 1S84A 2BYAX 2ZCKP 1WV7H 4Y0ZE 3N7OA 1HFDA 3SGAE 1LHDH 4DVAU 2ILNA 1O3BA 5T3HA 3T29A 5E0GA 2FYQA 1D3DB 1TFXA 1NFUA 2OD3B 3ATMA 1UVOA 1GBBA 1JWTA 3U69H 4BTIB 4HTCH 1HDTH 2G52A 3AW0A 4YM9A 5A8ZA 1DT2A 2RG3A 1O2KA 2ZDLA 3MYWA 2FLBH 2ZCHP 4Z6AH 4BAOB 4DT7B 3KL6A 3QUMP 3SO3A 4B1TA 1GDNA 1YPJH 1GJBB 1TA2A 3KF2A 1V2RT 1G2MA 4LOYH 1MUEB 2BQWB 1CA8B 4X6NA 2R0LA 1XUHA 1S0RA 1TPSA 3EDXB 2FXRA 1ZTJA 2TPIZ 1EB1H 3LH1A 3A7TA 2BVXH 3RXEA 3UWIA 1BHXB 3VEQB 5JBTA 3BEIB 4JMYA 1JBUH 3RXQA 1A0HB 2ZKSA 1HCGA 4BAKB 1QRXA 2BZ6H 2SGEE 3F9GA 3M5NA 4K8YA 1LVYA 1F0UA 1O3IA 3P70B 4X8SH 4UE7H 2UUKB 4ABBA 3SOSA 4MDSA 1O37A 1RRKA 1G37A 4U01A 2GV7A 3A81A 3RUOA 4I33A 1B0FA 1OPHB 2WV5A 1KXDA 2VWOA 3HGNA 1SFQB 1EPTC 1E0FD 3LGUA 1ANCA 1BBRE 3K9XB 4Y7BA 2TBSA 1HAGE 2CN0H 2W5EA 1S82A 4CBNA 2Y6TA 3TJUA 1UJ1A 2D2DA 1C2JA 4H4FA 4ISIH 1NO9H 5EW1H 2VIDA 4ZKSU 2PSYA 1LVOA 1LPGB 2ZGXH 2HALA 4ZXXH 2ZECA 2VVVA 2XNIA 1WTGH 3RXCA 3TJVA 3ZZ5A 1GGDB 3M7QA 3MHWU 4NIXA 1A3BH 3H7TA 3QO6A 5DO4H 1C1RA 2W3KA 1UMAH 1MCVA 2HLCA 1EUFA 5E2OA 1C1QA 1AVXA 1HNEE 3LOXA 4CRCA 3KQEA 2UUFB 1CGHA 2Y5FA 4CREA 3VB6A 4TPYA 1MTUA 2VNTA 1Z7KA 4D7GA 1FIWA 5H4IB 2QXJA 1VGCC 3P8GA 1F0TA 5E2PA 1T8NA 4WMDA 2BD4A 3S7HB 1A61H 4X2XA 3RXGA 1IQJA 2ZTYA 3VXEH 1EPTA 1UCYH 4XFQA 1JRSA 1EKBB 2RDLA 4YT7H 1WSSH 1S6FA 3LC3A 3Q3YA 1QJ1B 4NWKA 1YGCH 3E16B 2HGTH 1PFXC 1SLXB 2DE8A 4X6PA 3RXSA 1P0SH 2QN5T 4I31A 3Q76A 3M3SA 2BVRH 1ELAA 1MQ5A 2LNCA 4Z0KA 2A4GA 1OWHA 2AMQA 2FI4E 3NPSA 2HNTC 1GJCB 1BRAA 2AERH 3QTVH 1DS2E 4JZIA 1KSNA 1GBDA 3RMLH 3I78A 1PQ5A 2JH0D 3M5LA 5A2MH 1G2LA 1LO6A 1MBMA 4NWLA 1JOUB 1JMOH 1XUKA 2XRCA 2ZPSA 1P10A 1V2ST 4F4OC 2FX6A 1CHOF 1G3CA 3ZZ8A 1QURH 1C1SA 2V6NA 1KYNA 4Y6DA 4JYUH 4YOIA 2P16A 1OSSA 1AKSB 1KDQB 1O2VA 2EI8A 1A7SA 1GDQA 5E0JA 1W12U 4E06H 5ESTE 2WYGA 1K1NA 3BIUH 1FN6A 2GT8A 1Z8RA 1AFQC 5C3NA 8GCHF 1EAWA 2A4QA 1SGFA 2BDGA 3NZIA 1TGNA 3DHKH 3UR6A 4A1TA 2W26A 3BTDE 2XBYA 2FOMB 3RU4D 1GVZA 1H4WA 1D3PB 4B2AA 1CU1A 2UWLA 3VXFH 4NSYA 3ZZ7A 4OS7A 2Z9IA 3URDA 1DXPA 5TJXA 2H5CA 5GJ4B 1C5WB 1AZ8A 1J15A 4Q7ZA 2OBOA 1C4U2 3UIRA 1K1JA 2FODA 1YCPK 5I46H 3FP7E 4H42U 3MMGA 1D4PB 3TH4H 6LPRA 2P95A 1C2IA 4IN1A 4XOJA 1O5FH 3TPIZ 4O9VA 8KME2 2AMPA 4XBBA 3SU6A 2BDHA 1RXPA 1UVSH 3ZVAA 5I25A 2OC8A 2VJ1A 1UVPA 1AIXH 1BMAA 1PPZA 3TITA 1B5GH 2FM2A 1BRUP 1WUNH 1INCA 2VWMA 1KLTA 4WY3A 2FI5E 1DWEH 2BDYA 4X1RU 3M61U 2IN2A 2WINI 1ID5H 1LKAA 2R9PA 4NA7A 1Y5AT 3RXLA 1C5QA 3E0NB 4MPUA 1C1TA 5DPAA 1ELVA 1P11E 3GOVB 4NA9H 2SGAA 4K3JA 3SU4A 2QXHA 1FY3A 2BY5X 1NS3A 4ASHA 3FZZA 4Q7YA 2Z9GA 3RC4A 4NZQA 1GJ9B 4KTUA 3O8CA 8GCHG 1QJ7B 2NU4E 3SV9A 5GCHG 2WPMS 3MU5A 1TX6A 3O8RA 3KIDU 3RU4T 1AMHA 3HK6B 2KAIA 4CR5A 1Y3UA 1MCTA 1K1PA 4FVDA 3UPEA 1FV9A 3GCNA 1CQQA 1LQEA 2EI6A 1C5YB 2HRVA 3ZVGA 2ZFPH 3AAUA 3Q00A 4ESTE 2OUAA 1W14U 4UD9H 5DG6A 1GBJA 3K2UA 3KHVA 4NG9H 1MZDA 1SMFE 3PMJA 2Z3EA 3SV6A 1MTSA 4NZLA 2R3UA 1SFIA 2VB0A 1J9CH 1ZR0A 4DJZB 4YOJA 1OWIA 4DG4A 2FMJA 1W8BH 1N8OC 3PMBB 1SOZA 2HVXA 4D7FA 1UO6A 1OP0A 1BTZA 2BVSH 2BX4A 3GY5A 4ZAEA 1HAZB 2ZU3A 4FUDA 2FP7B 3E91A 1NT1A 1C2DA 1JXPA 3Q77A 2GV6A 5C67A 1L1GA 3ZZ6A 3GY8A 1HJ8A 3S0NA 4KKDA 5DP4A 2W7SA 1TRNA 3M36A 3LGYA 4GVUA 3U98H 1O2HA 1GBFA 1RGQA 3ZZ3A 1GHZA 1G3DA 1DOJA 3RU4E 3VB7A 1LHFH 3SUFA 4AB8A 1TOCB 1O33A 2VIPA 2XTTB 2GDEH 1E37B 2JH5D 1PYTC 1T7CA 4THNH 4U30A 8ESTE 4LZ4B 3O8DA 2PKSC 1SGFG 1NY22 2NU2E 1QB6A 5HGGA 3K6YA 1XUJA 1PPCE 1C5RA 1MH0A 2C8XB 2ZIQH 5LPFA 2BOKA 1SL3A 1NRPH 1H9HE 2BM2A 1A5IA 1ANDA 1MTNC 1BIOA 2A7JA 4IW4E 3RXVA 1NESE 2ZWLH 1TRYA 4D8NA 3QGJA 1Y5BT 1ELTA 3TNTA 1A4WH 4ZXYH 3UNRA 4RSPA 4UFEH 3Q3KA 2RA0A 1PQAA 1N1LA 1BTYA 1C5PA 1GI2A 2QXGA 1EOLA 3A7ZA 3GDUA 1EZUC 3PTBA 4SGBE 3A80A 2A5KA 1WAYB 3A8BA 5DJ7A 1UTMA 2OLGA 4Q7XA 1C5TA 2W7UA 1FJSA 1PYTD 4WXIA 4TWYA 4BAMB 5K7RA 1BMNH 2A4RA 2QV1A 1ELDE 3F9EA 1GG6C 2AMDA 1S0QA 3SNEA 4CHAB 1GCTB 1O2LA 1EX3A 2WUBA 2FOCA 4JYVH 4OS5A 4OGYA 5EQRA 1NM6A 4U32A 3V13A 4Q80A 2ANKH 1TNIA 3KNXA 6CHAB 1UK2A 3O8BA 3BG4B 3FP8E 4KTSA 4UFGH 3TJNA 5EPYA 2O9QA 1O3NA 1X7AC 1QHRB 9LPRA 3M5MA 1QFKH 4X8VH 1BJVA 1F92A 4JZ1A 3E8LA 4ZH8A 5F6MA 1TB6H 5DKMA 1OWKA 2BD9A 2ODYB 4WF8A 1GJ5H 3I29A 5E8EH 2ZPQA 1GJDB 2R2WU 1TBRH 2A45B 1BA8B 2CMYA 1W10U 3L6PA 5CHAB 1OS8A 1HJAB 2SGQE 3ENSB 3DUXH 1GHWH 1P09A 2BMGB 2FZZA 1AB9B 3LIWA 1V3XA 2QY0B 4WVPE 5JB8S 1Z1JA 1ZTKA 2SFAA 3RXJA 1NFWA 3W94A 4ISLA 2P59A 5A0BA 2TGDA 2VVUA 1YPGH 3PWBA 4YESB 2H9EH 2FOEA 1G3EA 3HKJB 2ZI2H 4YO9A 1P2OA 4JZEH 1ABJH 2OBQA 3VGCB 1HUTH 2F9NA 2ZGHA 2AIPA 1V2WT 1C5SA 4I8LA 1AUJA 4OGXA 3STIA 2UWOA 2PUXB 1CT4E 1JIMA 2STAE 5FHTA 2B5TB 3NXPA 5HMAA 2BXTH 2J92A 2TRMA 3EQ0H 2OQUA 1RIWB 4ZHAA 1QBNA 3PV4A 2JETC 4A1VA 4ABDA 1O2TA 1LHEH 1TX7A 2Y5HA 3QX5H 4AG1A 1ZZZA 4FUHA 3BG8A 1HIAA 1GHVH 4YT6H 3R0FA 2F83A 2FTLE 1O2SA 3PLKA 3VB3A 1BBRH 3RXPA 4MPVA 1UHBB 4AGKA 1TPOA 3JZ1B 2GZ7A 2AS9A 3D23A 1GI5A 1S6HA 1A2CH 2G8TA 4Y11E 1MKWK 5DP3A 3U9AH 1UTNA 2I6QA 5C1UA 4K60A 3GISB 1NRRH 2A4OA 4Y0YE 3EA8A 1HAXB 4H6SB 1BTPA 4O03A 4Y7AA 1O2ZA 1UTPA 1O3HA 4HFPB 3ZYDA 1U6QA 1FY4A 1NROH 1YPLH 2AH4X 2EEKA 3ATLA 3PLBA 3PO1C 3QGNB 1A3EH 2VU8E 1B0EA 4KTCA 1PQ8A 1AVGH 1ELFA 2XC4A 2WPLS 2ZA5A 1GI0A 4J1YA 2P3UB 2ALVA 1EASA 1CA0B 1IQNA 2AGGX 3SI4H 1T8LA 5EQSA 2CV3A 1RD3B 1ZMLA 4X0WU 1ARBA 3UOUA 1FDPA 3SJOA 1O3KA 5EODA 1J17T 1MKXK 3SORA 5JB9S 2J9NA 4WXVA 1BMMH 1QB9A 2VH6A 1GI3A 2Q1JA 3PM3A 1FAXA 1XUGA 3ZVCA 1CGIE 4I8GA 5BRRE 3C27B 4MPXA 1NRQH 2TIOA 3BTQE 2TGPZ 1C4Y2 1O3OA 2VIQA 3F9HA 2A0QB 1WQSA 3OY6U 3UY9A 3NWUA 1BB0B 1V2LT 2PTCE 2C3SA 1C2EA 1A5GH 3U1IB 3SV7A