4FUEA

Crystal structure of the urokinase
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
246
structure length
246
Chain Sequence
IIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTIALPSMYNDPQFGTSCEITGFGKEQSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Urokinase-type plasminogen activator
publication title Crystal Structure of the Urokinase
rcsb
source organism Homo sapiens
total genus 61
structure length 246
sequence length 246
ec nomenclature ec 3.4.21.73: U-plasminogen activator.
pdb deposition date 2012-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4fueA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4fueA01
1P12E 3SBKA 4ZHAA 3P8FA 2O8TA 4AN7A 3SV7A 2W5EA 4JMYA 5AFZH 1DWBH 1W10U 1T7CA 2XC0A 2FYQA 1B7XB 3GDVA 2CMYA 2ZPQA 1SFQB 4WMDA 1FNIA 1G2MA 4AB8A 2NU1E 2Y7XA 2BY5X 1P02A 3SI3H 1MTNC 4Q7XA 4FUJA 3SUDA 3ZV8A 1C9PA 2JH5D 4AGKA 3A8CA 1C5WB 4X8SH 2ZTZA 3LOXA 3VB3A 3K6ZA 3GY6A 1PPBH 3KEEA 3ESTA 4THNH 1YCPK 3PMHB 2ZFQH 2BVRH 1VCPA 1LQDB 1C5QA 1FY5A 4NSYA 1OWJA 1HAZB 1J8AA 1GBTA 1TYNA 1P3CA 2H5CA 3L6PA 2G4UA 3BG8A 5C1UA 1MTVA 1IQMA 2RA3A 1DM4B 1GBBA 1XUFA 1Y5UT 1L1JA 1XXDA 2PKSC 2H9HA 1G3EA 2FM2A 1C2IA 1GI3A 1ZMNA 1PQ5A 4JYUH 2BY7X 1GMCG 1LKAA 2G51A 2JETB 4YOJA 1YPLH 2VGCC 1AVGH 5EPYA 2GGVB 2Q6GA 1T8NA 1KXEA 2ZHWH 1VGCC 4X1NU 3RDZA 1TQ0B 2ZU3A 3TK9A 1IHTH 1DUEA 3M7QA 1AE8H 1P9UA 4OS5A 2Y6TA 1OSSA 2I6SA 4FUIA 3SUGA 2BD4A 1AB9C 1UK3A 2EEKA 5C1YA 3ATMA 1YYY1 3MNXA 3UIRA 1UCYE 2A5KA 4GCHG 3DHKH 1TPAE 1GDNA 1P10A 2A4GA 3NZIA 5H4IB 2PR3A 2VH0A 1MD8A 1BUIA 1O2MA 6CHAB 2HPQH 4FXGH 2IJOB 3TJOA 3LGIA 1O5EH 1SG8B 1OWDA 1WCZA 2ZKSA 4MNXA 3RXHA 2NU0E 2UWLA 4UFEH 5EW2H 2VVCA 3RXVA 1F7ZA 1A2CH 2VIQA 1GI5A 2J94A 1HV7A 3KL6A 1FAKH 1O2LA 2B8OH 4TYDA 1NRSH 1BRBE 1ZLRA 2F91A 4RKOB 3KN2A 4D9QA 3EA7A 1LHDH 3TK5A 1H8DH 1MCVA 2GCHF 1O3FA 1Z6EA 2ZU5A 1TAWA 4K5ZA 2AGGX 5DP7A 3SUEA 2ZI2H 1Z8GA 6GCHG 3KQCA 1AFQC 1TBRH 2BDIA 5FBEA 1J17T 2LNCA 5CE1A 4ZROA 1LDTT 1DLKB 1WTGH 4TPIZ 3LJJA 5JBCS 2XW9A 4AZ2B 3A86A 4E7RG 4CH8B 1TWXB 1TNJA 5FPYA 5SGAE 3QWCH 1SBWA 2TRMA 4MPVA 1ELFA 1PFXC 1ETRH 1UTMA 4CR5A 3SJ8A 3IITA 2O9QA 3E3TA 1Q2WA 1BTHH 3ITIA 3TH4H 2BY8X 3NWUA 2W7UA 5FX5A 4MNVA 1V2LT 1DWCH 2CGAA 2J34A 2OLGA 4GHTA 2VH6A 2ZZUH 1HAIH 1XVMA 3GDSA 1ZTLA 2XWAA 4B73A 4KTSA 5C5NA 1A1RA 1UTJA 2F83A 3GDUA 4M7GA 4I8GA 2QXHA 3RXDA 1O2JA 4X8VH 1W2KH 1EZXC 3I78A 1ELBA 1RGQA 1C2LA 4CRFA 1QRZA 1FY1A 1ZRBA 3ZZ8A 1JRSA 3BTTE 1C2KA 1O3KA 2Z9IA 1V3XA 3BEUA 1Z1JA 4LXBH 1V2JT 2OUAA 3MH7A 2GZ7A 1A4WH 1GBJA 1P2MA 2QIQA 1TMBH 5GWZA 3STJA 4K1EA 4NZLA 3EGKH 2TBSA 1GJBB 1AZZA 4ZKSU 1GHWH 2DE9A 2GV7A 1K2I1 2XBWA 3E6PH 3SGAE 1TPPA 4ABAA 1EAXA 1AVXA 1EB1H 1C2MA 1OWKA 2STAE 2G5VA 1FAXA 1GI1A 3M61U 3VB6A 2DUCA 2OCVB 1GI8B 2QV1A 1L2EA 2AGIX 1MTUA 1FZZA 1OX1A 5DP6A 3MU8A 1FN6A 1MCTA 5A2MH 1EASA 1UCYK 2ZGBH 3F9EA 1O3DA 1G32B 1XUHA 1SQAA 1K22H 4X8UH 4Y10E 2J4IA 1QJ1B 4ABDA 1EATA 1GMDG 3BEIB 2A4OA 3CS0A 1O3PB 1OYQA 2BDAA 1ESAA 3AW1A 3RU4T 1WOFA 1P2KA 3ATIA 3TGIE 1HJAB 4Y0ZE 1DE7H 2TGTA 1ANCA 1GMHF 2HWLB 1GBEA 1T4UH 2FEQH 2UUJB 1AUTC 1TALA 3RP2A 1CHGA 2GD4B 1SHYA 3E0PB 1AUJA 2V35A 1C5XB 3VGCB 1LVBA 7ESTE 3UOUA 3OU0A 1AU8A 1ARBA 1SGDE 1LHGH 1XM1A 1C5UA 1C5NH 3ZZ7A 3LGWA 1C5SA 3E8LA 1SGFG 2XYAA 1V2UT 3LGVA 1O3NA 1Y59T 2BDYA 1O2XA 2OBOA 2Z7FE 1FN8A 3RXMA 3I77A 3U8TH 2FZZA 1AWHB 2OC1A 2WV4A 3HPTB 3MO3A 1QB1A 1GHBG 3F9GA 1SGEE 4YO9A 3SZNA 2AIQA 1BZXE 1LVMA 5EG4A 1EX3A 1ZHMA 1ZPBA 2CN0H 1DDJA 3BTFE 4E05H 2CF8H 3S7KB 2RA0A 3V0XA 3IWMA 4Z6AH 3D65E 4U32A 1X7AC 1TE0A 3RXGA 5GXPA 1GI2A 3QGJA 3ZZBA 2GV6A 1UVTH 4JK5A 2FI4E 2OC0A 2PTNA 4TY6A 1ELCA 3A81A 4CHAB 5A0CA 4B71A 5GCHF 1A7SA 4CR9A 1ARCA 3B9FH 1SB1H 4VGCC 1O31A 4I8LA 4D7FA 4O9VA 1KSNA 1K1MA 1QBNA 3A87A 1E34B 1DXWA 5DPAA 3VXEH 1FXYA 3EA9A 2BDBA 1N8OC 1DWEH 1TX7A 1GJ4H 2PWXA 9LPRA 5L30H 5A8XA 1BTYA 1TMUH 1IQEA 2BZAA 1S81A 1ZSKA 1HAYB 1A5GH 1XUGA 4Y76A 5CMXH 1QHRB 2FLBH 2FI3E 1S6HA 1K9OE 3KNXA 1TA2A 2QXIA 4UONA 3K65B 4DT7B 2UUYA 3PV4A 4Y6DA 4UFGH 2BY6X 3RXEA 4AGJA 3S69A 4K69A 1TONA 3M5LA 4Y7AA 5HM2A 1GBKA 1W7GH 1O30A 1GI4A 2RDLA 1A3EH 1GMHG 1MAYA 1DSTA 2QN5T 4WJG2 3PO1B 3UWJH 2ZNKH 1MU8B 4YOGA 1THSH 2Q6DA 4UE7H 5E0HA 1IQIA 1C2EA 3Q3XA 2BVXH 1O2IA 1PPEE 5HGGA 1LPKB 4K8BA 1BBRE 5L2ZH 4NSVA 2W26A 3UWIA 4DJZB 1PYTD 2NU2E 4AG1A 5JBBS 5T6FA 2O8MA 2XCNA 1IQNA 1E36B 2F9PA 1BA8B 2QC2A 2VJ1A 4ZKOU 1P11E 3H7OA 4DVAU 1MH0A 1SGQE 1W13U 3VFEA 7GCHF 3BF6H 4AFZA 1QURH 4MPXA 3T26A 2PFEA 2BQ6B 3EE0B 1BMLA 1YGCH 5C5OA 1GGDC 3HATH 1TA6A 2Z9KA 1F0RA 4K60A 3RXIA 4JZ1A 4Y7BA 2NU4E 3SV6A 5GDSH 2Z9JA 2VU8E 4MVNA 2C8XB 4F4OC 1HAGE 1QB9A 2PKAA 2G4TA 2HNTF 2J95A 1XMNB 1QBVH 1IQHA 2SGQE 3MU5A 2V3OH 4MDSA 1DY9A 2AFQB 3A85A 3RU4E 3TGKE 3RXSA 3SI4H 1AVWA 2ANMH 1GI7B 1H1BA 3GY8A 3A80A 1CA0C 1ZOMA 2XNIA 4WMFA 4ESTE 2W7SA 2GVFA 4X2VA 1C5MD 4GPGA 2ZGXH 1G9IE 3BTDE 2GCTC 1QR3E 1TPSA 2ZF0H 1CA8B 3M3SA 3PLBA 1ZGIA 1QY6A 1YLDA 2A45B 3SJKA 2VIDA 1NM6A 1SGRE 2ZHQH 1H9HE 1QNJA 5E0JA 1K1PA 1OPHB 4CREA 1MKXK 2G81E 1CT2E 1W12U 1EB2A 2BDGA 2ZDNA 5EOKA 1PPGE 1F5RA 3KQBA 2OC7A 3HKIB 3QLPH 1CHOF 5DP5A 1MKWK 1V2NT 5TCCA 3AASA 4AB9A 1YLCA 1T8OA 2Y81A 3TJUA 1PPFE 2FO9A 1DT2A 1DX5M 3QX5H 4AFQA 3RXPA 1GVLA 1RTFB 1AN1E 1RTLA 1DLEA 1CGHA 1V2VT 3BTGE 3BG4C 3DUXH 2HLCA 1SGIB 2O8LA 3UY9A 5FCKA 3K2UA 4KKDA 2G00A 3GY4A 1HXFH 3BV9B 2A7CA 3GICB 4K1TA 1LTOA 5GPIB 1O2YA 2ZPRA 3QK1A 3QTVH 1SFIA 1ELVA 1WQVH 1TRNA 4NWKA 2ZGJA 4DCDA 4FUGA 2HVXA 2VWLA 1NU9A 2QYIA 1VITG 1MTNB 3FZZA 3LKWA 3A8AA 2B7DH 4ASHA 5EW1H 1PPZA 3MHWU 7GCHG 3MNSA 1BHXB 1NO9H 1RRKA 4AYVB 2A2XH 1ANDA 2D2DA 2NWNA 1LVYA 1BBRK 2I6QA 2BHGA 3OYPA 2P59A 1C5VA 1FDPA 3SJOA 1TBZH 2H2ZA 4FU8A 1JIRA 2YOLA 2BM2A 3A84A 3GY2A 2Z3EA 2BMGB 2OD3B 1FMGA 3KF2A 5T6DA 5F8TA 2P3FH 3OSYA 4YT6H 4CRDA 5FPTA 3T27A 1A3BH 1VCWA 4H4FA 1BITA 5HYOA 2J9NA 5K0HA 2PKSB 1SSXA 1ZJDA 4BAHB 1GI0A 1C1TA 1C1MA 1V2ST 3GYLB 5C67A 3SV9A 1F0TA 5DP3A 3S9BA 4A6LA 5LPRA 2Z9GA 1O2ZA 4X2WA 4ABGA 2AIPA 2ZCLP 3RM2H 1TABE 1YPEH 2O8WA 2A32A 4SGBE 2QA9E 3ZVBA 4DY7B 1JOUB 1YC0A 1T8LA 5ETXA 2VGCB 4ISIH 2AMDA 1VGCB 5FBIA 3V13A 2BYAX 3GCHC 1P3EA 4WY3A 2ZFPH 3Q3KA 2P8OC 3PMAB 1HAHH 3AVZA 2SNWA 3HGNA 3MH6A 3RXJA 1YCPH 1UTQA 1MZAA 5EPNA 8LPRA 1VITH 5LH8A 1FQ3A 1SOZA 1AB9B 3R3GB 3R0FA 3ZV9A 1FJSA 3SN8A 1V6DA 1TGTA 1O5FH 1D3DB 1TNKA 3AW0A 1THRH 1E38B 1O2PA 2PTCE 1ELAA 5DK1A 3UNQA 1ID5H 1RD3B 1AO5A 3LJOA 1OP8A 3UQVA 1W14U 2HGTH 3LH3A 2VNTA 5E2OA 4ZUHA 4DW2U 1V2KT 3GCTG 1OWEA 4H42U 3H5CB 4HFPB 1BTPA 4IS5A 5JBTA 1XKAC 2W3KA 1UVOA 2R9PA 4KP0A 2WPKS 3NXPA 1OP2A 3P70B 3G01A 3ATWA 3RLWH 1GDUA 1GBMA 1BQYA 1SQTA 2BQWB 3ODDA 5A09A 1BMAA 2FODA 1Z8RA 1A46H 2P16A 1AWFH 4D7GA 1BRUP 1C5ZB 3P8NA 2P94A 1W0YH 4BXSA 4YTAA 1ESBA 1V2WT 2QGRA 2BVSH 3PYHA 1AFQB 1PQ8A 4HI3A 2H1UA 4BNRA 1SLUB 1VZQH 2HNTC 3UREA 4BAQB 2YNBA 1XKBC 2PUXB 2PSYA 5FPSA 3HKJB 3VPKA 1ETSH 3S7HB 1BB0B 1MTSA 1KLJH 3TITA 1BTZA 4O3TA 1TNGA 3BN9A 2JETC 3M5NA 2K1QA 3F6UH 1C2FA 3P8OA 4OS1A 1CT0E 1LMWB 2QXGA 4XBBA 1EXFA 5G4BA 1IQFA 4AYYB 3E1XB 1BTUA 4DG4A 4UFFH 1K1NA 1SR5C 1ELEE 1T32A 1ETTH 1RTKA 3UNSA 2B5TB 1ZPCA 3GYMA 1C1NA 1RIWC 2UWPA 1DXPA 3Q00A 4WH8A 2BB4A 3FFGA 2Z9LA 4X2XA 1DUAA 4I33A 1VJ9U 3ZVAA 1C4U2 2A7JA 3HGPA 4JZEH 3SU4A 9ESTA 1O2SA 1SGPE 4FUBA 3RXTA 2TGDA 2VWNA 2P95A 1ZRKA 3TJVA 1PPHE 4CBOA 1TNIA 1GHAF 3RXKA 3VB5A 2A5AA 1AFEH 1LHFH 1HAVB 4E06H 3VB4A 1QFKH 3SHCH 1F5KU 3UR9A 3MU4A 1AQ7A 3ZVFA 3SGBE 3M5MA 1XUIA 1ELDE 4B2AA 4X2YA 1GHYH 1K1JA 1TQ7B 1GG6C 1SI5H 3TVJB 3GOVB 3HK6B 4AFUA 2F9NA 2VIVA 1EP6A 1GL0E 2BD9A 3U1JB 1O2VA 2SGAA 1HFDA 4WMEA 3W94A 3TIUA 1SQOA 2IN2A 1XX9A 1KDQB 3TNTA 3W95A 8GCHF 2GZ9A 2FOEA 1C1OA 1NRNH 3GY3A 2FOGA 3U1IB 2PUQH 2FS9A 5A8ZA 4J1YA 1P8VC 1O32A 1TGCA 1C1WH 1UTLM 4H6TA 2CHAC 1FY8E 4FUDA 4RSPA 1QJ6B 5E0GA 1W7XH 1AGJA 2FOCA 2FLRH 3Q3YA 1TFXA 1YPHE 4GAWA 2GDDA 1T4VH 4CH2B 4JZFH 1JXPA 4CBNA 1NPMA 2Y80A 2UWOA 2ZGHA 1NRRH 1IHSH 1SC8U 1NRPH 3SJ9A 1SGNE 4DURA 1OWIA 2R3YA 2VWOA 3RXOA 3KIDU 1AI8H 3SQHE 1FI8A 2G8TA 1UCYH 3OX7U 4JZDH 1EAIA 1O2GH 3PMJA 1VJAU 3P92A 1AE5A 2SNVA 2BY9X 2GCHG 4UEHH 1C4V2 1ZYOA 1O2RA 1FY3A 3A7TA 2Z6BD 3SNEA 2WPLS 1S84A 4IMZA 2A7HA 2BX3A 4I31A 1L4DA 2AERH 4YT7H 3M3VA 3PLKA 1BMMH 4ZAEA 4ZHMU 1GBCA 1W0ZU 2ZU2A 3UTUH 3PLPA 1TPOA 1GHXH 1S82A 1K1OA 2PW8H 1L0ZA 1O3GA 3ZYDA 4F49A 5LGOA 5ABWA 1Y5BT 4WVPE 1EZQA 4X0WU 2BD5A 3LGTA 1KDQA 2P93A 4VGCB 4X6PA 3U69H 3S0NA 2V0BA 3QDZB 1GJ6A 4TPYA 1A5HA 5PTPA 1O5GH 1V2RT 1GHAG 1LHCH 4IC6A 5DG6A 1ABJH 1G3DA 4YLUA 4WXIA 2A4QA 2Y5GA 4B76A 3SV2H 1DITH 2J38A 1XVOA 1NFWA 1GPZA 1C1SA 4MG3A 1D4PB 3MNBA 1L4ZA 3KCGH 1QJ7B 1K28D 2ZCHP 5HXFA 5FX6A 1GCTC 3D23A 1IQGA 3A88A 5FAHA 2NU3E 1SLXB 2ODQA 3V3MA 3ZZ4A 2VIWA 1GBAA 1C1QA 1UMAH 3FP7E 3RMMH 1S5SA 3T2NA 1AIXH 4FVBA 1C1PA 1UTNA 4IGDA 2BLWA 3EQ0H 2WUCA 3MMGA 1O34A 2LPRA 2OXSA 8GCHG 1OXGA 3T5FH 3RC4A 5EXLA 2CJIA 1TB6H 3FVFB 5AHGH 3BEFB 4YESB 1NFYA 3TH3H 1KXDA 1P2QA 1P09A 2F9VA 2FOMB 2Q1JA 2AMPA 1THPB 4ZXXH 1GVZA 1Y3YA 2R0LA 4ABBA 3U98H 1K21H 4LZ4B 1M9UA 1QL7A 3NKKA 2G55A 1ZZZA 1H9IE 5LPFA 1WYKA 3SU3A 3M5OA 2A31A 5A0AE 4XSKU 7KMEH 1TGSZ 4XDEA 2C8WB 1GI9B 1BDAA 3F68H 2KAIB 4U01A 2BLOA 1MUEB 3MH4A 2OQ5A 2BLQA 2HPPH 3Q76A 1UVSH 4BTUB 2M5TA 3TLOA 1MZDA 3LDXH 5L2YH 3M37A 1P9SA 1GGDB 1ESTA 5JBAS 1GJ7B 4ABFA 3OY6U 3GCNA 4CHAC 3BTWE 2C93B 3P6ZB 1LVOA 3H7TA 4Y79A 1YCPM 2QF0A 4D8NA 3UUZA 3RXQA 1ANBA 1O0DH 2ZPSA 5DP4A 2VIOA 3WY8A 4GLYA 4YM9A 5CHAC 1IOEA 1O3OA 1TX6A 4AORA 4U30A 1YM0A 3SW2B 4TWWA 2J92A 4Y8YA 2FXRA 1GL1A 3ELAH 1O3JA 2FYRA 5C3NA 4NIXA 2IOTA 1S0QA 1YPHC 1QRWA 4Y8XA 1TX8A 4I7YH 5FCRA 1P57B 3SQEE 4MLFB 2QAAA 1SMFE 1CU1A 1MTWA 2WYJA 1YF4A 5DJ7A 1CA0B 3UQOA 1EJNA 4WF8A 2EI8A 2SGEE 1O39A 1Z1IA 1L1NA 1IAUA 1SGFA 1AY6H 3SU0A 5L6NH 3BIUH 3UFAA 1PQAA 4ISHH 1O36A 1HB0B 4ZHLU 2OC8A 5AVDA 3DD2H 1JMOH 5B6OA 3ZZ6A 1TGBA 1FV9A 1QB6A 4B2BA 1TRYA 2PHBA 4A1XA 2AGEX 3TPIZ 3ZZ5A 2PLXA 1TOMH 2CXVA 3M3TA 2D26C 1ELGA 2PV9B 1XUJA 1HXEH 4ABIA 6ESTA 1HAPH 3A7ZA 5GCHG 1EPTC 2ANYA 4YOIA 2KAIA 2TPIZ 1HYLA 3PB1E 4ZKNU 2Y5FA 5JB8S 4KTUA 4Q7ZA 3GY7A 4NFFA 2A5IA 3CENA 4X1PU 4CRAA 4YZUA 2AMQA 1Y3XA 1ZSLA 5BRRE 4ZMAH 5C2ZA 1AMHA 1CQQA 1O35A 4Z0KA 3BG4B 2ZFFH 2GDEH 4NA9H 5LPEA 2ZTXA 1GVKB 1MAXA 1FUJA 1NT1A 3RMLH 4A1VA 1HPGA 1BRAA 1PPCE 4O03A 1MKXH 1V2PT 2D1JA 1DOJA 3GY5A 5JB9S 2WPIS 2GX4A 4INKA 3BTEE 3SU5A 2B9LA 3IG6B 2SFAA 4OGXA 4O3UA 2BOKA 3RXRA 5FXLA 1VCQA 3SHAH 1LHEH 2ZA5A 1N1LA 1Z71A 5GIBA 5A0BA 1MKWH 1GJ9B 3SNAA 1C1UH 1ZHPA 1C1VH 1P2OA 3RXLA 2Z3DA 2HOBA 2FIRH 1C2DA 1CBWC 1EAUA 1GMCF 1DANH 1HNEE 3RXCA 2ZFTA 1P2NA 1OP0A 4WH6A 2WPMS 3UPEA 4INHA 4I8KA 1ZGVA 3QZQA 1G37A 3ZZDA 6LPRA 2RG3A 1QQUA 2O8UA 5F6MA 5T3HA 1O3CA 4ZKRU 3SNDA 2GT8A 2Z94A 4A1TA 2A0QB 3JZ1B 3VXFH 1FY4A 4ABEA 1OKXA 1LO6A 1O5DH 1V2MT 4Y11E 4CRCA 4XE4A 2V3HH 1HJ9A 2F3CE 3UOPA 4MNWA 3PTNA 3O8RA 3C27B 1QA0A 4B74A 1UVUH 1KY9A 4JCNA 1AHTH 1SL3A 2THFB 2UUFB 1P04A 4FUFA 2HALA 3GCHB 4GCHF 1DSUA 5J4SA 1HAXB 3TU7H 2P8OB 2ESTE 1WUNH 1JWTA 1UO6A 1LKBA 1O2UA 1BBRH 3FANA 2GMTC 2FOFA 5I46H 1P0SH 1TBQH 4MQAA 2FI5E 1WAYB 3A8DA 1PQ7A 2FX6A 2R2MB 3ZZ3A 3K6YA 1C5LH 1O38A 2ZQ1A 2VIPA 2A1DB 1YBWA 2ZU1A 4IN1A 1EKBB 1ZMLA 2XXLA 4YLQH 1ZHRA 1U6QA 3T28A 4H6SB 2ANKH 1GHZA 4DIHH 5IDKA 2ZP0H 1G36A 2GKVE 2ZHEH 2V6NA 3ATLA 3TH2H 2JKHA 1GJ5H 6GCHF 2R2WU 1BIOA 4Y0YE 2BX4A 1KXBA 1P2JA 1GBDA 2ZU4A 1D6RA 1KXAA 2H5DA 4A7IB 1O3LA 2HRVA 4I8JA 1PYTC 2AEIH 3BTME 3PROA 1NRQH 2ZO3H 1CHOG 4DIIH 2QXJA 3MYWA 1C1RA 2ZFSA 4K3JA 3SNCA 5F03A 5DO4H 1SGCA 1P03A 2C8ZB 1CO7E 2EI6A 3RXUA 5AFYH 1C4Y2 3F1SB 1W11U 1N6XA 4CRBA 1UTPA 3AAUA 3VB7A 2Y5HA 1GHVH 2XCFA 1ABIH 1F0UA 1UK4A 4FU7A 3SV8A 3SUFA 3TNSA 3B8JA 1YPKH 3Q77A 4IMQA 3U8RH 3KQEA 1QTFA 2XBVA 3RXBA 2FTMA 2VB0A 4RKJB 2OQUA 1KIGH 4AG2A 1LCYA 2R0KA 3SO3A 3MTYA 1FONA 1BCUH 3T29A 5JPMH 1YPMH 2OBQA 1A0HB 3D62A 2PSXA 2FTLE 4LK4A 2OTVA 1CVWH 1S85A 2ILNA 4WXVA 2BXUH 5DKMA 1WQSA 1RIWB 4HZHA 1H8IH 3O8BA 3ZVDA 4JK6A 1HGTH 4KELA 1WBGB 3UNRA 2ZIQH 3LGYA 1O2NA 2OINA 3MO6A 1DICA 7LPRA 1RFNA 1GBIA 5DGJA 1ZMJA 2FP7B 2AH4X 1RXPA 1Z8IB 1SLWB 2FWWA 1DPOA 2BD3A 3RC6A 2FS8A 4KGAA 1WSSH 1BJUA 1S6FA 1Q3XA 1G30B 3LGUA 1QL8A 3SORA 3DFLA 1GBHA 1LPZB 1FIZA 2QY0B 2QCYA 1ZSJA 2H9TH 1KXFA 3LU9B 1J14A 3L33A 1NY22 2PGQB 1E0FD 2GT7A 1EQ9A 3E91A 1ZPZA 2VINA 3EYDA 1AKSB 1SGYE 4XFQA 1GMDF 4MPWA 1MBMA 3MNCA 3NK8A 1O3EA 1J15A 1TNHA 1GG6B 3DT0H 1CGJE 1ELTA 3A8BA 3A7WA 4NIWA 4A92A 1RJXB 2D8WA 3LH1A 4NG9H 4BXWA 1YKTA 1O3MA 2ZC9H 1V2TT 3QZRA 5EQRA 4FVDA 2TGPZ 1OOKB 6CHAC 3PTBA 3EAJA 1DY8A 8ESTE 5TJXA 4BAOB 2W3IA 1EZUC 2EC9H 3KHVA 2CHAB 3EA8A 1NZQH 2ULLA 2Y7ZA 3A7XA 2ANWA 1NFXA 2JH6D 3RLYH 1O33A 2CV3A 4JYVH 4OS7A 3ZVCA 1S0RA 1XUKA 5JYIA 2H9EH 3LT3A 3V12A 4I32A 3BSQA 3MO9A 3P17H 2FOAA 2ODYB 1IQJA 1GHBF 3SU1A 1SHHB 1Z8JB 2XC4A 1P2IA 3ZVGA 1EOJA 3A89A 4ISLA 2ZG0H 1OS8A 5AF9H 2PGBB 4XBCA 4SGAE 3V7TA 3U8OH 2FMJA 3MOCA 1TOCB 4LOYH 2C8YB 1C5RA 2ZHDA 5EQSA 2ZECA 4QT8C 4Q7YA 1PJPA 1BJVA 1HCGA 2G5NA 4K8YA 4Q80A 1INCA 1KYNA 2R3UA 4O97A 4U2WA 5HM9A 4J2YB 3ZZAA 3ODFA 5DP9A 1Y8TA 1C5YB 1N6YA 1E37B 4OS4A 3QO6A 3BTKE 1UTKA 2B0FA 2YNAA 4BAMB 1MQ6A 1B0FA 1AKSA 1LQEA 2UUKB 2WINI 4Q2KA 1G2LA 1NFUA 2GP9B 4IN2A 2ZHFH 2BDHA 1MMJN 2TIOA 2ZDMA 2GTBA 4OGYA 4ABHA 1UHBB 1FIWA 1V2QT 1NC6A 3GISB 1ZTJA 1QRXA 3PMBB 2BD2A 2WPHS 1ANEA 3O8DA 1GCDA 5F8XA 1Y3VA 2BXTH 4UDWH 3TGJE 4UD9H 1WTHD 1Y3WA 3OTJE 2ZTYA 4E7NA 1O2TA 2C90B 1S83A 2C3SA 3A7YA 4K1SA 1AD8H 3MWIU 1GWAA 4GVUA 2ZQ2A 5A8YA 4WWYA 4X6MA 1BT7A 4ISOA 5E8EH 3MH5A 2Z3CA 2GZ8A 5F8ZA 1HAVA 1BTWA 3A83A 2ZCKP 2ALVA 3BTQE 3LC3A 5IYTA 1IQKA 1J16A 3FP6E 5EQQA 1GCTB 1HBTH 3F9FA 3RXFA 3RMOH 2STBE 1HRTH 1GI6A 1K1LA 4BOHA 4B75A 1C2GA 1EOLA 4MTBA 1QBOA 1DFPA 3C1KA 3O8CA 1D3TB 1HUTH 1Y3UA 3RXAA 1CE5A 1KTSB 1J9CH 4BAKB 3MI4A 1MBQA 3URCA 1ACBE 4JYTA 1O37A 1Q31A 4NA8A 3PWBA 1TRMA 1EUFA 4BANB 5BPEA 2C4FH 2FOHA 3DFJA 1NN6A 1N8OB 1TNLA 1NESE 1TLDA 2ZDLA 4FUCA 2RCEA 3SOSA 4GSOA 4XBDA 1A0JA 4DOQA 4OS6A 3SU6A 1RS0A 2FOBA 4R8TB 3NUMA 1ZR0A 1H9LB 4AFSA 4NCYA 1UHBA 1SVPA 1QIXB 1C2HA 1GDQA 1HJAC 1HIAB 2FPZA 1SLVB 3JZ2B 3E0NB 1E35B 1C5OH 4UFDH 1F92A 3K9XB 1G3BA 5HMAA 4ISNA 2IPHA 3S9AA 3DA9B 4RN6A 3SU2A 3VGCC 2ZDKA 1BOQA 4NZQA 1O5CB 1A0LA 2BD7A 2VVUA 5EU8A 2BDCA 1Y5AT 3D49H 2TGAA 1FLEE 1ORFA 3E16B 1D3PB 1JIMA 1P01A 3GCOA 1CT4E 3F9HA 4DGJA 2EI7A 4NFEA 4OS2A 3QN7A 3MU0A 4TY7A 1C5PA 1NU7B 3I29A 1L1GA 2ZDAH 1O5AB 5CHAB 5E2PA 4INLA 2ODPA 4GUXA 5GJ4B 4CRGA 3MFJA 2BTCE 3M7UA 1K1IA 4IBLH 4I8HA 1IQLA 1MU6B 4AOQA 2BOHB 1MQ5A 1Z7KA 1WU1A 1BTXA 5JDUB 1HAOH 3RMNH 2ZFRH 4NGAH 2WUBA 1YPJH 1O3HA 3AAVA 4LZ1H 1C5TA 1O2HA 1BHXF 1VR1H 2J2UA 3ATKA 4GHQA 1TGNA 4R0IA 2PKAB 5EXMA 4D76A 1EJAA 1KTTB 2BD8A 3A7VA 2WYGA 1OWHA 5T6GA 3KQDA 3L3TA 3OY5U 2SGFE 1EP5A 1T8MA 1O3IA 1QL9A 4IC5A 1TMTH 4ZH8A 1HIAA 1HDTH 2WV5A 1GBLA 4FUEA 2SGPE 1GJDB 1C2JA 3P8GA 1HJ8A 3CP7A 1EPTB 2XRCA 1B5GH 4X1RU 1FPCH 4HGCA 2XTTB 2BLVA 2A4RA 1O2KA 4ZXYH 2GCTB 1GJ8B 2XWBI 3SJIA 1VITF 4B2CA 8KME2 5TCAA 3M7TA 1B0EA 2H6MA 4NWLA 4X1SU 1A5IA 3QGNB 1P06A 1D6WA 3SNBA 3URDA 2XBYA 5DP8A 3PM3A 4X6OA 4D9RA 4TWYA 2ZWLH 1G3CA 3ENSB 2Y82A 4Y71A 2FESH 1D9IA 1GBFA 3LPRA 1DWDH 3S9CA 1OYTH 3VEQB 1KLIH 1EAWA 2JH0D 1ZJKA 3KGPA 5J4QA 2ZDVH 3PO1C 1F5LA 4MNYA 1GJCB 4X8TH 5ESBA 2SGDE 3RU4D 3BIVH 4B1TA 1YP9A 3LC5A 4KTCA 3TJNA 2XBXA 1F2SE 3RUOA 3NCLA 2AYWA 4XOJA 3FAOA 1UK2A 2FDAA 4JZIA 3RM0H 1QA7A 4X6NA 1SGTA 3ZZ9A 1GJAB 2XC5A 4FU9A 5EXNA 5FHTA 1C9TA 1O2OA 3T62A 2ZEBA 5EODA 3B23B 1CBWB 2QF3A 1UVPA 3MU1A 1QCPA 4BTIB 2ASUB 1BRCE 3T25A 1YPGH 3P95A 1O5BB 2OP9A 1SPJA 3RC5A 3U9AH 1MD7A 4X1QU 5EGMA 4NIVA 1EPTA 1TIOA 1DVAH 3M36A 2P3UB 3LONA 4HTCH 1UTOA 3BTHE 1CSOE 1Z6JH 3ZVEA 1KXCA 2HNTE 3STIA 2BZ6H 2FX4A 1EZSC 2F9BH 3N7OA 3QUMP 1NROH 1JRTA 3EDXB 4K2YA 3PWCA 2F9OA 3ZYEA 2WPJS 3FP8E 1O3AA 1HLTH 2GMTB 2EA3A 1A61H 2VWMA 3GCTF 1W8BH 3UR6A 2Q6FA 4A5TS 1NTPA 3M35A 1O3BA 4PROA 4MPUA 2F9UA 3CS7A 2G52A 2VVVA 4NIYA 3E90B 1T31A 1UJ1A 5K7RA 3HK3B 1O2WA 2ZGCA 1ZTKA 1V2OT 1XXFA 2A2QH 2P3TB 1FPHH 1F0SA 1P05A 3QTOH 4BTTB 1W3CA 3SGQE 1QGFA 2AS9A 2BQ7B 3ZZCA 4ABJA 1O2QA 4NA7A 5I25A 1NS3A 3TK6A 1DS2E 1BMNH 1AZ8A 1SOTA 1WV7H 4FUHA 3A82A 1LPGB 1CGIE 5C20A 5ESTE 1QQ4A 4AX9H 1D3QB 4Y8ZA 2CF9H 3LIWA 4IW4E 2DE8A 2ALPA 3FZDA 3NPSA 1KLTA 1EJMA 1H4WA 1JBUH 5C1XA
chains in the Genus database with same CATH superfamily
1P12E 3SBKA 4ZHAA 3P8FA 2O8TA 4AN7A 3SV7A 2W5EA 4JMYA 5AFZH 1DWBH 2L6OA 2V7QD 1H8ED 1T7CA 1W10U 2XC0A 2FYQA 1B7XB 3GDVA 2CMYA 2ZPQA 1SFQB 4WMDA 1FNIA 1G2MA 4AB8A 2NU1E 2Y7XA 2BY5X 1P02A 3SI3H 1MTNC 4Q7XA 2LP6A 4FUJA 3SUDA 3ZV8A 1C9PA 2JH5D 4AGKA 3A8CA 1UW7A 1C5WB 4X8SH 4M9FA 2ZTZA 3LOXA 2YMSC 3VB3A 1OHHD 3K6ZA 3GY6A 1PPBH 3KEEA 3EE7A 3ESTA 2L74A 4THNH 1YCPK 3PMHB 2ZFQH 2BVRH 1VCPA 1LQDB 1C5QA 1FY5A 3KYFA 4NSYA 1OWJA 1HAZB 1J8AA 1GBTA 1TYNA 1P3CA 2H5CA 3L6PA 2G4UA 3BG8A 5C1UA 1MTVA 1IQMA 2RA3A 1DM4B 1GBBA 1XUFA 1Y5UT 1L1JA 1XXDA 2PKSC 2H9HA 1G3EA 2FM2A 1C2IA 1GI3A 1ZMNA 1PQ5A 4JYUH 2BY7X 4FOUC 1GMCG 1LKAA 2G51A 2JETB 4YOJA 1YPLH 2VGCC 1AVGH 5EPYA 4OM9A 2GGVB 2Q6GA 1T8NA 1KXEA 2ZHWH 3U28C 1VGCC 4X1NU 3RDZA 1TQ0B 2ZU3A 3TK9A 1IHTH 1DUEA 3M7QA 1AE8H 1P9UA 4OS5A 2Y6TA 1OSSA 2I6SA 4FUIA 3SUGA 2BD4A 1AB9C 1UK3A 2EEKA 5C1YA 2W6JD 3ATMA 1YYY1 3MNXA 3UIRA 1UCYE 2A5KA 4GCHG 3DHKH 1TPAE 1GDNA 1P10A 2A4GA 3NZIA 5H4IB 1COWD 5EJ1A 2PR3A 2VH0A 1MD8A 1BUIA 1O2MA 6CHAB 2HPQH 4FXGH 2IJOB 3TJOA 3LGIA 1O5EH 1SG8B 1OWDA 1WCZA 2ZKSA 4MNXA 3RXHA 2NU0E 2UWLA 4DT4A 4UFEH 5EW2H 2QF4A 2VVCA 3RXVA 1F7ZA 1A2CH 2VIQA 1GI5A 2J94A 1HV7A 3KL6A 1FAKH 1O2LA 2B8OH 4TYDA 1NRSH 1BRBE 1ZLRA 2F91A 4RKOB 3KN2A 4D9QA 3EA7A 1LHDH 3TK5A 1H8DH 1MCVA 2GCHF 1O3FA 1Z6EA 2ZU5A 1TAWA 4K5ZA 2AGGX 5DP7A 3SUEA 2ZI2H 1Z8GA 6GCHG 3KQCA 1AFQC 1TBRH 2BDIA 5FBEA 1J17T 2LNCA 5CE1A 4ZROA 3F3BA 1LDTT 1DLKB 1WTGH 4TPIZ 3LJJA 5JBCS 2XW9A 4AZ2B 3A86A 4E7RG 4CH8B 1TWXB 1TNJA 5FPYA 5SGAE 3QWCH 1SBWA 2TRMA 4MPVA 5C0TA 1ELFA 1PFXC 1ETRH 1UTMA 4CR5A 5HKKD 3SJ8A 3IITA 2O9QA 3E3TA 1Q2WA 1BTHH 3ITIA 3TH4H 2BY8X 3NWUA 2W7UA 5FX5A 4MNVA 1V2LT 1DWCH 2CGAA 2J34A 2OLGA 4GHTA 2VH6A 2ZZUH 1HAIH 1XVMA 3GDSA 1ZTLA 2XWAA 2WSSD 4B73A 4KTSA 5C5NA 1A1RA 1UTJA 2F83A 3GDUA 4M7GA 4I8GA 2QXHA 3RXDA 1O2JA 4X8VH 1W2KH 1EZXC 3I78A 1ELBA 2K0QA 1RGQA 1C2LA 4CRFA 1QRZA 1FY1A 3SYJA 1ZRBA 3ZZ8A 1JRSA 3BTTE 1C2KA 1O3KA 2Z9IA 1V3XA 3BEUA 1Z1JA 4LXBH 2WZQA 1V2JT 2OUAA 3MH7A 3PV2A 2GZ7A 1A4WH 1GBJA 1P2MA 2QIQA 4ACBA 1TMBH 5GWZA 3STJA 4K1EA 4NZLA 3EGKH 2TBSA 1GJBB 1AZZA 2JDID 4ZKSU 1GHWH 2DE9A 3OEED 2GV7A 5KEDA 1YWUA 1K2I1 2XBWA 3E6PH 3SGAE 1TPPA 4ABAA 1EAXA 1AVXA 1EB1H 1C2MA 1OWKA 2STAE 2G5VA 1FAXA 3VG8A 1GI1A 3M61U 3VB6A 2DUCA 2OCVB 1GI8B 2QV1A 5F53A 1L2EA 2AGIX 1MTUA 1FZZA 1OX1A 5DP6A 3MU8A 1FN6A 1MCTA 5A2MH 1EASA 1UCYK 2ZGBH 3F9EA 1O3DA 1G32B 1XUHA 1SQAA 1K22H 4X8UH 4Y10E 3F2GA 2J4IA 1QJ1B 4ABDA 1EATA 1GMDG 3BEIB 2A4OA 3CS0A 1O3PB 1OYQA 2BDAA 3F0PA 1ESAA 3AW1A 3RU4T 1WOFA 1P2KA 3ATIA 3TGIE 1HJAB 4Y0ZE 1DE7H 2TGTA 1ANCA 1GMHF 2HWLB 1GBEA 1T4UH 2FEQH 2UUJB 1AUTC 1TALA 2QF5A 3RP2A 1CHGA 2GD4B 1SHYA 3E0PB 1AUJA 2V35A 1C5XB 3VGCB 3OEHD 1LVBA 7ESTE 3UOUA 3OU0A 1AU8A 1ARBA 1SGDE 1LHGH 1XM1A 1C5UA 1C5NH 3ZZ7A 3LGWA 1C5SA 3E8LA 1SGFG 2XYAA 1V2UT 3LGVA 1O3NA 1Y59T 2BDYA 1O2XA 2OBOA 2Z7FE 1FN8A 1W0JD 3RXMA 3I77A 3U8TH 2FZZA 1AWHB 2OC1A 2WV4A 3HPTB 3MO3A 1QB1A 1GHBG 3F9GA 1SGEE 4YO9A 3SZNA 2AIQA 1BZXE 1LVMA 5EG4A 1EX3A 1ZHMA 1ZPBA 2CN0H 5B6LA 1K0HA 1DDJA 3BTFE 4E05H 2CF8H 3S7KB 2RA0A 3V0XA 3IWMA 4RT1A 4Z6AH 3D65E 3FO8D 1X7AC 4U32A 1TE0A 3RXGA 5GXPA 5C94A 1GI2A 3QGJA 3ZZBA 2GV6A 1UVTH 4JK5A 2FI4E 2OC0A 2PTNA 4TY6A 1ELCA 3A81A 4CHAB 1W0KD 4B71A 5A0CA 5GCHF 1A7SA 4CR9A 1ARCA 3B9FH 1SB1H 4VGCC 1O31A 4I8LA 4D7FA 4O9VA 3PV5A 1KSNA 1K1MA 1QBNA 3A87A 1E34B 1DXWA 5DPAA 3VXEH 1FXYA 3EA9A 2BDBA 1N8OC 1DWEH 1TX7A 2EY4C 1GJ4H 2PWXA 9LPRA 5L30H 5A8XA 1BTYA 1TMUH 1IQEA 2BZAA 1S81A 1ZSKA 1HAYB 1A5GH 1XUGA 4Y76A 5CMXH 1QHRB 2FLBH 2FI3E 1S6HA 1K9OE 1KMHB 3KNXA 1TA2A 2QXIA 4UONA 3K65B 4DT7B 3PRBA 2UUYA 3PV4A 4Y6DA 4UFGH 2BY6X 3RXEA 4B6FA 4AGJA 3S69A 4K69A 1TONA 3M5LA 4Y7AA 5HM2A 1GBKA 1W7GH 3PRDA 1O30A 1GI4A 2RDLA 1A3EH 1GMHG 1MAYA 1DSTA 2QN5T 4WJG2 3PO1B 3UWJH 2ZNKH 3DCLA 1MU8B 4YOGA 1THSH 2Q6DA 4UE7H 5E0HA 1IQIA 1C2EA 3Q3XA 2BVXH 1O2IA 1PPEE 5HGGA 1LPKB 4K8BA 1BBRE 5L2ZH 4NSVA 2W26A 3UWIA 4DJZB 1PYTD 2NU2E 4AG1A 5JBBS 5T6FA 2O8MA 2XCNA 4YXWD 1IQNA 1E36B 2F9PA 1BA8B 2QC2A 2VJ1A 4ZKOU 1P11E 3H7OA 4DVAU 1MH0A 1SGQE 1W13U 3VFEA 7GCHF 3BF6H 4AFZA 1QURH 4MPXA 3T26A 2PFEA 5FL7D 2BQ6B 3AK5A 3EE0B 1E1RD 1BMLA 1YGCH 5C5OA 1GGDC 3HATH 4ASUD 1TA6A 2Z9KA 1F0RA 4K60A 3RXIA 3UAIC 4JZ1A 4Y7BA 2NU4E 3SV6A 5GDSH 2Z9JA 2VU8E 4MVNA 2W6ID 2C8XB 4F4OC 3OFND 1HAGE 1QB9A 2PKAA 2G4TA 2HNTF 2J95A 1XMNB 4I86A 1QBVH 1IQHA 2SGQE 2KFWA 3MU5A 3NRLA 2V3OH 4MDSA 1DY9A 2AFQB 3A85A 3RU4E 3TGKE 3RXSA 3SI4H 1AVWA 2ANMH 1GI7B 1H1BA 3GY8A 3A80A 1CA0C 1NBMD 1ZOMA 2XNIA 4WMFA 4ESTE 4XD7D 1MABB 2W7SA 2GVFA 4X2VA 1C5MD 4GPGA 2ZGXH 1G9IE 3BTDE 2GCTC 1QR3E 1TPSA 2ZF0H 1CA8B 3M3SA 3PLBA 1ZGIA 1QY6A 1YLDA 2A45B 3SJKA 2VIDA 1NM6A 1SGRE 2ZHQH 1H9HE 1QNJA 5E0JA 1K1PA 1E1QD 1OPHB 1MKXK 4CREA 2G81E 1CT2E 1W12U 1EB2A 2BDGA 4Q63A 2ZDNA 5HIYA 5EOKA 1PPGE 1BMFD 1F5RA 3KQBA 2OC7A 3HKIB 3QLPH 1CHOF 5DP5A 1MKWK 1V2NT 5TCCA 3AASA 3DSPA 4AB9A 1YLCA 2RFKC 1T8OA 2Y81A 3TJUA 1PPFE 2FO9A 1DT2A 1DX5M 2KM0A 3QX5H 4AFQA 3RXPA 1GVLA 1RTFB 1AN1E 3DSGA 1RTLA 1DLEA 2XOKD 1CGHA 1V2VT 3BTGE 3BG4C 3DUXH 2HLCA 1SGIB 2O8LA 3UY9A 5FCKA 3K2UA 4KKDA 2G00A 2XNDD 3GY4A 1HXFH 5KECA 3BV9B 2A7CA 3GICB 4K1TA 1LTOA 5GPIB 1O2YA 2ZPRA 3QK1A 5CDFE 3QTVH 1SFIA 1ELVA 1WQVH 1TRNA 4NWKA 2ZGJA 4DCDA 4FUGA 2HVXA 2VWLA 1NU9A 2QYIA 1VITG 1MTNB 3FZZA 3LKWA 3A8AA 2B7DH 4ASHA 5EW1H 1PPZA 2YMSB 3MHWU 7GCHG 3MNSA 1BHXB 1NO9H 1RRKA 4AYVB 2A2XH 1ANDA 2D2DA 2NWNA 1LVYA 1BBRK 2I6QA 5C0UA 2BHGA 3OYPA 2P59A 1C5VA 1FDPA 3SJOA 1TBZH 2H2ZA 4FU8A 1JIRA 2YOLA 2BM2A 3A84A 3GY2A 2Z3EA 2BMGB 4ZCNA 2OD3B 1FMGA 3KF2A 5T6DA 5F8TA 2P3FH 3OSYA 4YT6H 4CRDA 5FPTA 3T27A 1A3BH 1VCWA 4H4FA 1BITA 5HYOA 2J9NA 5K0HA 2PKSB 1SSXA 1ZJDA 4BAHB 1GI0A 1C1TA 1C1MA 1V2ST 3GYLB 5C67A 3SV9A 1F0TA 5DP3A 3S9BA 4A6LA 5LPRA 2Z9GA 1O2ZA 4X2WA 4ABGA 2AIPA 2ZCLP 3RM2H 1TABE 1YPEH 2O8WA 2A32A 1YLNA 4SGBE 2QA9E 3ZVBA 4DY7B 1JOUB 1YC0A 1T8LA 5ETXA 2VGCB 4ISIH 2AMDA 1VGCB 5FBIA 2KZ4A 3V13A 2BYAX 3GCHC 1P3EA 4WY3A 2ZFPH 3Q3KA 2P8OC 3PMAB 1HAHH 3AVZA 2SNWA 3HGNA 3MH6A 5T1VA 3RXJA 1YCPH 1UTQA 2IPQX 1MZAA 5EPNA 8LPRA 1VITH 5LH8A 1FQ3A 1SOZA 1AB9B 2KR7A 3H09A 3R3GB 3R0FA 3ZV9A 1FJSA 3SN8A 1V6DA 1TGTA 1O5FH 1D3DB 1TNKA 3AW0A 1THRH 1E38B 1O2PA 2PTCE 1ELAA 5DK1A 3UNQA 1ID5H 1RD3B 1AO5A 3LJOA 1OP8A 3UQVA 1W14U 2HGTH 3LH3A 2VNTA 5E2OA 4ZUHA 4DW2U 1V2KT 3GCTG 1OWEA 4H42U 3H5CB 4HFPB 1BTPA 4IS5A 5JBTA 2JJ1D 1XKAC 2W3KA 1UVOA 1SKYE 2R9PA 4KP0A 2WPKS 3NXPA 1OP2A 3P70B 3G01A 3ATWA 3RLWH 1GDUA 1GBMA 1BQYA 3WW7A 1SQTA 2BQWB 3ODDA 4RI0A 5A09A 1BMAA 2FODA 1Z8RA 1A46H 2P16A 1AWFH 4D7GA 1BRUP 1C5ZB 2VBCA 3P8NA 2P94A 1W0YH 4BXSA 4YTAA 1ESBA 1V2WT 2QGRA 2BVSH 3PYHA 1AFQB 3CNRA 1PQ8A 4TT3D 4HI3A 2H1UA 4BNRA 1SLUB 1VZQH 2HNTC 3UREA 4BAQB 2YNBA 3W1EA 1XKBC 2PUXB 2PSYA 5FPSA 3HKJB 2QE7D 3VPKA 1ETSH 3S7HB 1BB0B 1MTSA 1KLJH 3TITA 1BTZA 4O3TA 2JJ2D 1TNGA 3BN9A 2JETC 3M5NA 2K1QA 3F6UH 1C2FA 3P8OA 4OS1A 1CT0E 1LMWB 2QXGA 4XBBA 1EXFA 3DSOA 1IQFA 5G4BA 4AYYB 3E1XB 1BTUA 3F2FA 4DG4A 4UFFH 4AC9A 1K1NA 1SR5C 1ELEE 1T32A 1ETTH 1RTKA 3UNSA 2B5TB 1ZPCA 3GYMA 1C1NA 1RIWC 2UWPA 1DXPA 2M2AA 3WWFA 3Q00A 4WH8A 2BB4A 3FFGA 2Z9LA 4X2XA 1DUAA 4I33A 1VJ9U 3ZVAA 1C4U2 2A7JA 3HGPA 4JZEH 3SU4A 9ESTA 1O2SA 1SGPE 4FUBA 3RXTA 2TGDA 2VWNA 2P95A 1ZRKA 3TJVA 1PPHE 4CBOA 2WV9A 1TNIA 1GHAF 3RXKA 3VB5A 2A5AA 1AFEH 5DN6D 1LHFH 1HAVB 4E06H 3VB4A 1QFKH 3SHCH 1F5KU 3UR9A 3MU4A 1AQ7A 3ZVFA 3SGBE 3M5MA 1XUIA 1ELDE 4B2AA 4X2YA 1GHYH 1K1JA 3F2HA 1TQ7B 1GG6C 1SI5H 3TVJB 3GOVB 3HK6B 4AFUA 2F9NA 3KYGA 2VIVA 1EP6A 1GL0E 2BD9A 3U1JB 1O2VA 2SGAA 1HFDA 4WMEA 5IK2D 3W94A 3TIUA 1SQOA 2IN2A 1XX9A 1KDQB 3TNTA 3W95A 8GCHF 2GZ9A 2FOEA 1C1OA 1NRNH 3GY3A 2FOGA 3U1IB 2PUQH 2FS9A 5A8ZA 4J1YA 1P8VC 2IJD1 1O32A 1TGCA 1C1WH 1UTLM 4H6TA 2CHAC 3ZIAD 1FY8E 4FUDA 4RSPA 1QJ6B 5E0GA 1W7XH 1AGJA 2FOCA 2FLRH 3Q3YA 1TFXA 1YPHE 4GAWA 2GDDA 1T4VH 4CH2B 4JZFH 1JXPA 4CBNA 1NPMA 2Y80A 2UWOA 2ZGHA 1NRRH 1IHSH 1SC8U 1NRPH 3SJ9A 1SGNE 4DURA 4F55A 1OWIA 2R3YA 2VWOA 3RXOA 3KIDU 1AI8H 3SQHE 1FI8A 2G8TA 1UCYH 3OX7U 4FETA 4JZDH 1EAIA 1O2GH 3PMJA 1VJAU 3P92A 1AE5A 2SNVA 2BY9X 2GCHG 2RDEA 4UEHH 1C4V2 1ZYOA 1O2RA 1FY3A 3A7TA 2Z6BD 3SNEA 2WPLS 1S84A 4IMZA 2A7HA 2BX3A 4I31A 1L4DA 2GJGA 2AERH 4YT7H 3M3VA 3PLKA 1BMMH 4ZAEA 4ZHMU 1GBCA 1W0ZU 2ZU2A 3UTUH 3PLPA 1TPOA 1GHXH 1S82A 1K1OA 2PW8H 1L0ZA 1O3GA 3ZYDA 4F49A 5LGOA 4F48B 5ABWA 1Y5BT 4WVPE 1EZQA 4X0WU 2BD5A 3LGTA 1KDQA 1WDIA 2P93A 4VGCB 4X6PA 3U69H 3S0NA 2V0BA 3QDZB 1GJ6A 4TPYA 1A5HA 5PTPA 1O5GH 1V2RT 1GHAG 1LHCH 4IC6A 5DG6A 1ABJH 1G3DA 4YLUA 4WXIA 2A4QA 2Y5GA 4B76A 3SV2H 1DITH 2J38A 1XVOA 1NFWA 1GPZA 1C1SA 4MG3A 1D4PB 3MNBA 1L4ZA 3KCGH 1QJ7B 1K28D 2ZCHP 5HXFA 5FX6A 1GCTC 3D23A 1IQGA 3A88A 5FAHA 2NU3E 1SLXB 2ODQA 3V3MA 3ZZ4A 2VIWA 1GBAA 1C1QA 1UMAH 3FP7E 3RMMH 1S5SA 3T2NA 1AIXH 4FVBA 1C1PA 1UTNA 4IGDA 2BLWA 3EQ0H 2WUCA 3MMGA 1O34A 2LPRA 5EIYA 2OXSA 8GCHG 1OXGA 3T5FH 3RC4A 5EXLA 2CJIA 1TB6H 3FVFB 5AHGH 3BEFB 4YESB 3UB0A 1NFYA 3TH3H 1KXDA 1P2QA 1P09A 2F9VA 2JIZD 2FOMB 2Q1JA 5C17A 2AMPA 1THPB 4ZXXH 1GVZA 1Y3YA 2R0LA 4ABBA 3U98H 1K21H 4LZ4B 1M9UA 1QL7A 3NKKA 4Z1MD 2G55A 1ZZZA 1H9IE 5LPFA 1WYKA 3SU3A 3M5OA 2A31A 5A0AE 4XSKU 7KMEH 1TGSZ 4XDEA 2C8WB 1GI9B 1BDAA 3F68H 2KAIB 4U01A 5KGOA 2BLOA 1MUEB 3MH4A 2OQ5A 2BLQA 2HPPH 3Q76A 1UVSH 4BTUB 2M5TA 3TLOA 1MZDA 3LDXH 5L2YH 3M37A 1P9SA 1GGDB 1ESTA 5JBAS 1GJ7B 4ABFA 3OY6U 3GCNA 4CHAC 3BTWE 2C93B 3P6ZB 2YMSD 1LVOA 3H7TA 4Y79A 1YCPM 2QF0A 4D8NA 3UUZA 3RXQA 1ANBA 1O0DH 2ZPSA 5DP4A 2VIOA 3WY8A 4GLYA 3FN8A 4YM9A 5CHAC 1IOEA 1O3OA 1TX6A 2KCOA 4AORA 4U30A 1YM0A 3SW2B 4TWWA 2J92A 4Y8YA 2FXRA 1GL1A 3ELAH 1O3JA 2FYRA 5C3NA 4NIXA 2IOTA 1S0QA 1YPHC 1QRWA 3FOAA 4Y8XA 1TX8A 4I7YH 5FCRA 1P57B 3SQEE 4MLFB 2QAAA 1SMFE 1CU1A 1MTWA 2WYJA 1YF4A 5DJ7A 1CA0B 3UQOA 1EJNA 4WF8A 2EI8A 2SGEE 1O39A 1Z1IA 1L1NA 1IAUA 1SGFA 1AY6H 3SU0A 5L6NH 3BIUH 3UFAA 1PQAA 4ISHH 1O36A 1HB0B 4ZHLU 2OC8A 5AVDA 3DD2H 1JMOH 4Q4LA 5B6OA 3ZZ6A 1TGBA 1FV9A 1QB6A 4B2BA 1TRYA 4P00A 2PHBA 4A1XA 2AGEX 3TPIZ 3ZZ5A 2PLXA 1TOMH 2CXVA 3M3TA 2D26C 1ELGA 2PV9B 1XUJA 1HXEH 4ABIA 6ESTA 1HAPH 3A7ZA 5GCHG 1EPTC 2ANYA 4YOIA 2KAIA 2TPIZ 1HYLA 3PB1E 4ZKNU 2Y5FA 5JB8S 1H8HD 4KTUA 4Q7ZA 3GY7A 4NFFA 2A5IA 3CENA 4X1PU 4CRAA 4YZUA 2AMQA 1Y3XA 1ZSLA 5BRRE 4ZMAH 5C2ZA 1AMHA 1CQQA 1O35A 4Z0KA 3BG4B 2ZFFH 2GDEH 4NA9H 4TSFD 5LPEA 3WWBA 2ZTXA 1GVKB 1MAXA 1FUJA 1NBME 1NT1A 3RMLH 4A1VA 1HPGA 1BRAA 1PPCE 4O03A 1MKXH 1V2PT 2D1JA 1DOJA 3GY5A 5JB9S 2WPIS 2GX4A 4INKA 3BTEE 3SU5A 2B9LA 3IG6B 2SFAA 4OGXA 4O3UA 2BOKA 3RXRA 5FXLA 1VCQA 3SHAH 1LHEH 2ZA5A 1N1LA 1Z71A 5GIBA 5A0BA 1MKWH 1GJ9B 3SNAA 1C1UH 1ZHPA 1C1VH 1P2OA 3RXLA 2Z3DA 2HOBA 2FIRH 1C2DA 1CBWC 1EAUA 1GMCF 1DANH 1HNEE 3RXCA 2ZFTA 1P2NA 1OP0A 4WH6A 2WPMS 3UPEA 4INHA 4I8KA 1ZGVA 3QZQA 1G37A 3ZZDA 6LPRA 2RG3A 1QQUA 2O8UA 5F6MA 5T3HA 1O3CA 4ZKRU 3SNDA 2GT8A 2Z94A 4A1TA 2A0QB 3JZ1B 3N7EA 3VXFH 1FY4A 4ABEA 1OKXA 1LO6A 1O5DH 1V2MT 4Y11E 4CRCA 4XE4A 2V3HH 1HJ9A 2F3CE 3UOPA 4MNWA 3PTNA 3O8RA 3C27B 1QA0A 4B74A 1UVUH 1KY9A 4JCNA 1AHTH 1SL3A 2THFB 2UUFB 1P04A 4FUFA 2HALA 3GCHB 4GCHF 1DSUA 5J4SA 1HAXB 3TU7H 2P8OB 2ESTE 1WUNH 1JWTA 1UO6A 1LKBA 2J98B 1O2UA 1BBRH 3FANA 2GMTC 2FOFA 5I46H 1P0SH 1TBQH 4MQAA 2FI5E 3OTPA 3OE7D 1WAYB 3A8DA 1PQ7A 2FX6A 2R2MB 3ZZ3A 3OAAD 3K6YA 1C5LH 1O38A 2ZQ1A 2VIPA 2A1DB 1YBWA 2ZU1A 4IN1A 1EKBB 1ZMLA 2XXLA 4YLQH 1ZHRA 1U6QA 3T28A 4H6SB 2ANKH 1GHZA 4DIHH 5IDKA 2ZP0H 1G36A 2GKVE 2ZHEH 2V6NA 1FX0B 3ATLA 3TH2H 2JKHA 1GJ5H 6GCHF 2R2WU 1BIOA 4Y0YE 2BX4A 1KXBA 1P2JA 1GBDA 2ZU4A 1D6RA 1KXAA 2H5DA 2HLDD 4A7IB 1O3LA 2HRVA 4I8JA 1PYTC 2AHME 2AEIH 3GS9A 3BTME 3PROA 1NRQH 2ZO3H 1CHOG 4DIIH 2QXJA 3MYWA 1C1RA 2ZFSA 4K3JA 3SNCA 5F03A 5DO4H 1SGCA 2KCPA 1P03A 2C8ZB 1CO7E 2EI6A 3RXUA 5AFYH 1C4Y2 3F1SB 1W11U 1N6XA 4CRBA 1UTPA 3AAUA 3VB7A 2J98A 2Y5HA 1GHVH 2XCFA 1ABIH 1F0UA 1UK4A 4FU7A 3SV8A 3SUFA 3TNSA 3B8JA 1YPKH 3Q77A 4IMQA 3U8RH 3KQEA 1QTFA 2XBVA 3RXBA 2FTMA 2VB0A 4RKJB 1QZ8A 2OQUA 1KIGH 4AG2A 1LCYA 2R0KA 3SO3A 3MTYA 1FONA 1BCUH 3T29A 5JPMH 1YPMH 2OBQA 1A0HB 3D62A 2PSXA 2FTLE 4LK4A 2OTVA 1CVWH 1S85A 2ILNA 4WXVA 2BXUH 5DKMA 1WQSA 1RIWB 4HZHA 1H8IH 3O8BA 3ZVDA 4JK6A 1HGTH 2J97A 3N7DA 4KELA 1WBGB 3UNRA 2ZIQH 2F43B 3LGYA 2KCAA 1O2NA 2OINA 3MO6A 1DICA 7LPRA 1RFNA 1GBIA 5DGJA 1ZMJA 2FP7B 2AH4X 1RXPA 1Z8IB 1SLWB 2FWWA 2K8IA 1DPOA 2BD3A 2HVYB 3RC6A 2FS8A 4KGAA 1WSSH 1BJUA 1S6FA 1Q3XA 5GNDA 1G30B 3LGUA 1QL8A 3SORA 3DFLA 1GBHA 1LPZB 1FIZA 2QY0B 2QCYA 1ZSJA 2H9TH 1KXFA 3LU9B 1J14A 3L33A 1NY22 2PGQB 1E0FD 2GT7A 1EQ9A 3E91A 1ZPZA 2VINA 3EYDA 1AKSB 1EFRD 1SGYE 4XFQA 1GMDF 4MPWA 1MBMA 3MNCA 3NK8A 1O3EA 2EQNA 1J15A 1TNHA 1GG6B 3DT0H 1CGJE 1ELTA 3A8BA 3A7WA 4NIWA 2WHXA 4A92A 1RJXB 1VKYA 2D8WA 3LH1A 4NG9H 4BXWA 1YKTA 1O3MA 4XRNA 2ZC9H 1V2TT 3QZRA 5EQRA 4FVDA 2TGPZ 1OOKB 6CHAC 3PTBA 3EAJA 1DY8A 8ESTE 5TJXA 2KCYA 4BAOB 2W3IA 1EZUC 2EC9H 3KHVA 2CHAB 3N99A 3EA8A 1NZQH 2ULLA 2Y7ZA 3A7XA 2ANWA 1NFXA 2JH6D 3RLYH 1O33A 2CV3A 4JYVH 4OS7A 3ZVCA 1S0RA 1XUKA 5JYIA 2H9EH 3LT3A 3V12A 4I32A 3BSQA 3MO9A 2OK5A 3P17H 2FOAA 2ODYB 1IQJA 1GHBF 3SU1A 1SHHB 1Z8JB 2XC4A 1P2IA 3ZVGA 1EOJA 3A89A 4ISLA 2ZG0H 1OS8A 5AF9H 2PGBB 4XBCA 4SGAE 2PP6A 3V7TA 3U8OH 2FMJA 3MOCA 1TOCB 4LOYH 2C8YB 1C5RA 2ZHDA 5EQSA 2ZECA 4QT8C 4Q7YA 1PJPA 1BJVA 1HCGA 3FKSD 2G5NA 5EJZA 4K8YA 4Q80A 1INCA 1KYNA 2R3UA 4O97A 4U2WA 5HM9A 4J2YB 3ZZAA 3ODFA 5DP9A 1Y8TA 1C5YB 1N6YA 1E37B 4OS4A 3QO6A 3BTKE 1UTKA 2B0FA 2YNAA 4BAMB 1MQ6A 1B0FA 1AKSA 1LQEA 2UUKB 2WINI 4Q2KA 1G2LA 1NFUA 2GP9B 4IN2A 2ZHFH 3SZEA 2BDHA 1MMJN 2TIOA 2ZDMA 2GTBA 4OGYA 4ABHA 1UHBB 1FIWA 1V2QT 1NC6A 3GISB 1ZTJA 1QRXA 3PMBB 2BD2A 2WPHS 1ANEA 3O8DA 1GCDA 4RT0A 5F8XA 1Y3VA 2BXTH 4UDWH 3TGJE 4UD9H 1WTHD 1Y3WA 3OTJE 2ZTYA 4E7NA 1O2TA 2C90B 1S83A 2C3SA 3A7YA 4K1SA 1AD8H 3MWIU 1GWAA 4GVUA 2ZQ2A 5A8YA 4WWYA 4X6MA 1BT7A 4ISOA 5E8EH 3MH5A 2Z3CA 2GZ8A 5F8ZA 1HAVA 1BTWA 3A83A 2ZCKP 2ALVA 3BTQE 3LC3A 5IYTA 1IQKA 1J16A 3FP6E 5EQQA 1GCTB 1HBTH 3F9FA 3RXFA 3RMOH 2STBE 1HRTH 1GI6A 1K1LA 4BOHA 4B75A 1C2GA 1EOLA 4MTBA 1QBOA 1DFPA 3C1KA 3O8CA 1D3TB 1HUTH 1Y3UA 3RXAA 1CE5A 1KTSB 1J9CH 4BAKB 3MI4A 1MBQA 3URCA 1ACBE 4JYTA 1O37A 1Q31A 4NA8A 3PWBA 1TRMA 4P02A 1EUFA 4BANB 5BPEA 2C4FH 2FOHA 3DFJA 1NN6A 1N8OB 1TNLA 1NESE 1TLDA 2ZDLA 4FUCA 2RCEA 4ACAA 3SOSA 4GSOA 4XBDA 1A0JA 4DOQA 4OS6A 3SU6A 1RS0A 2FOBA 4R8TB 3NUMA 1ZR0A 1H9LB 4AFSA 4NCYA 1UHBA 1SVPA 1QIXB 1C2HA 1GDQA 1HJAC 1HIAB 2FPZA 1SLVB 3JZ2B 3E0NB 1E35B 1C5OH 4UFDH 1F92A 3K9XB 1G3BA 5HMAA 4ISNA 2IPHA 3MQKC 3S9AA 3DA9B 4RN6A 3SU2A 3VGCC 3F0OA 2ZDKA 1BOQA 4NZQA 2WPDD 1O5CB 1A0LA 2BD7A 2VVUA 5EU8A 2BDCA 1Y5AT 3D49H 2TGAA 1FLEE 1ORFA 3E16B 1D3PB 1JIMA 1P01A 3GCOA 1CT4E 3F9HA 4DGJA 2EI7A 4NFEA 4OS2A 3QN7A 3MU0A 4TY7A 1C5PA 1NU7B 3I29A 1L1GA 2ZDAH 1O5AB 5CHAB 5E2PA 4INLA 2ODPA 4GUXA 5GJ4B 4CRGA 3MFJA 2BTCE 3M7UA 1K1IA 4IBLH 4I8HA 1IQLA 1MU6B 1S6LA 4AOQA 2BOHB 1MQ5A 1Z7KA 1WU1A 1BTXA 5JDUB 1HAOH 3RMNH 2ZFRH 4NGAH 2WUBA 1YPJH 5DSFA 1O3HA 3AAVA 4LZ1H 1C5TA 2V3MA 1O2HA 1BHXF 1VR1H 2J2UA 3ATKA 4GHQA 1TGNA 4R0IA 2PKAB 5EXMA 4D76A 1EJAA 1KTTB 2BD8A 3A7VA 2WYGA 1OWHA 5T6GA 3KQDA 3L3TA 3OY5U 2SGFE 1EP5A 1T8MA 1O3IA 1QL9A 4IC5A 1TMTH 4ZH8A 1HIAA 1HDTH 2WV5A 1GBLA 4FUEA 2SGPE 1GJDB 1C2JA 3P8GA 1HJ8A 3CP7A 1EPTB 2CK3D 2XRCA 1B5GH 4X1RU 1YY3A 1FPCH 4HGCA 2XTTB 2BLVA 2A4RA 1O2KA 5EJLA 5HIZA 4ZXYH 2GCTB 1GJ8B 2XWBI 3SJIA 1VITF 4B2CA 8KME2 5TCAA 3M7TA 1B0EA 2H6MA 4NWLA 4X1SU 1A5IA 3QGNB 1P06A 1D6WA 3SNBA 3URDA 2XBYA 5DP8A 3PM3A 4X6OA 4D9RA 4TWYA 2ZWLH 1G3CA 3ENSB 2F4LA 2Y82A 4Y71A 2FESH 1D9IA 1GBFA 3LPRA 1DWDH 3S9CA 1OYTH 3VEQB 1KLIH 1EAWA 2JH0D 1ZJKA 3KGPA 5J4QA 2KX4A 2ZDVH 3PO1C 1F5LA 4MNYA 1GJCB 4X8TH 5ESBA 2SGDE 5CHBA 3RU4D 3BIVH 4B1TA 1YP9A 3LC5A 4KTCA 3TJNA 2XBXA 1F2SE 3RUOA 3NCLA 2AYWA 4XOJA 3FAOA 1UK2A 2FDAA 4JZIA 3RM0H 1QA7A 4X6NA 1SGTA 3ZZ9A 1GJAB 2XC5A 4FU9A 5EXNA 5FHTA 1C9TA 1O2OA 3T62A 2J5UA 2ZEBA 5EODA 3B23B 1CBWB 2QF3A 1UVPA 3MU1A 1QCPA 4BTIB 2ASUB 1SQRA 1BRCE 3T25A 1YPGH 3P95A 1O5BB 2OP9A 1SPJA 3RC5A 3U9AH 1MD7A 4X1QU 5EGMA 4NIVA 1EPTA 1TIOA 1DVAH 3M36A 2P3UB 3LONA 4HTCH 4B6EA 1UTOA 3BTHE 1CSOE 1Z6JH 3ZVEA 1KXCA 2HNTE 3STIA 2BZ6H 2FX4A 4HG6A 1EZSC 2F9BH 3N7OA 3QUMP 1NROH 1JRTA 3EDXB 4K2YA 3PWCA 2F9OA 3ZYEA 2WPJS 3FP8E 1O3AA 1E79D 1HLTH 2GMTB 2EA3A 1A61H 2VWMA 3GCTF 1W8BH 3UR6A 2Q6FA 4A5TS 1NTPA 3M35A 1O3BA 4PROA 4MPUA 2F9UA 3CS7A 2G52A 2VVVA 4NIYA 3E90B 1T31A 3KQ5A 1UJ1A 5K7RA 3HK3B 1O2WA 2ZGCA 1ZTKA 1V2OT 1XXFA 2A2QH 2P3TB 1FPHH 1F0SA 1P05A 3QTOH 4BTTB 1W3CA 3SGQE 1QGFA 2AS9A 2BQ7B 3ZZCA 2LELA 4ABJA 1O2QA 4NA7A 5I25A 1NS3A 3TK6A 1DS2E 1BMNH 1AZ8A 1SOTA 1WV7H 1WXRA 4FUHA 3A82A 1LPGB 1CGIE 5C20A 5ESTE 1QQ4A 4AX9H 1D3QB 4Y8ZA 2CF9H 3LIWA 4IW4E 2DE8A 2ALPA 3FZDA 3NPSA 1KLTA 1EJMA 1H4WA 1JBUH 5C1XA
chains in the Genus database with same CATH topology
1P12E 3SBKA 4ZHAA 3P8FA 2O8TA 4AN7A 3SV7A 2W5EA 4JMYA 5AFZH 1DWBH 1W10U 1T7CA 2XC0A 2FYQA 1B7XB 3GDVA 2CMYA 2ZPQA 1SFQB 4WMDA 1FNIA 1G2MA 4AB8A 2NU1E 2Y7XA 2BY5X 1P02A 3SI3H 1MTNC 4Q7XA 4FUJA 3SUDA 3ZV8A 1C9PA 2JH5D 4AGKA 3A8CA 1C5WB 4X8SH 2ZTZA 3LOXA 3VB3A 3K6ZA 3GY6A 1PPBH 3KEEA 3ESTA 4THNH 1YCPK 3PMHB 2ZFQH 2BVRH 1VCPA 1LQDB 1C5QA 1FY5A 4NSYA 1OWJA 1HAZB 1J8AA 1GBTA 1TYNA 1P3CA 2H5CA 3L6PA 2G4UA 3BG8A 5C1UA 1MTVA 1IQMA 2RA3A 1DM4B 1GBBA 1XUFA 1Y5UT 1L1JA 1XXDA 2PKSC 2H9HA 1G3EA 2FM2A 1C2IA 1GI3A 1ZMNA 1PQ5A 4JYUH 2BY7X 1GMCG 1LKAA 2G51A 2JETB 4YOJA 1YPLH 2VGCC 1AVGH 5EPYA 2GGVB 2Q6GA 1T8NA 1KXEA 2ZHWH 1VGCC 4X1NU 3RDZA 1TQ0B 2ZU3A 3TK9A 1IHTH 1DUEA 3M7QA 1AE8H 1P9UA 4OS5A 2Y6TA 1OSSA 2I6SA 4FUIA 3SUGA 2BD4A 1AB9C 1UK3A 2EEKA 5C1YA 3ATMA 1YYY1 3MNXA 3UIRA 1UCYE 2A5KA 4GCHG 3DHKH 1TPAE 1GDNA 1P10A 2A4GA 3NZIA 5H4IB 2PR3A 2VH0A 1MD8A 1BUIA 1O2MA 6CHAB 2HPQH 4FXGH 2IJOB 3TJOA 3LGIA 1O5EH 1SG8B 1OWDA 1WCZA 2ZKSA 4MNXA 3RXHA 2NU0E 2UWLA 4UFEH 5EW2H 2VVCA 3RXVA 1F7ZA 1A2CH 2VIQA 1GI5A 2J94A 1HV7A 3KL6A 1FAKH 1O2LA 2B8OH 4TYDA 1NRSH 1BRBE 1ZLRA 2F91A 4RKOB 3KN2A 4D9QA 3EA7A 1LHDH 3TK5A 1H8DH 1MCVA 2GCHF 1O3FA 1Z6EA 2ZU5A 1TAWA 4K5ZA 2AGGX 5DP7A 3SUEA 2ZI2H 1Z8GA 6GCHG 3KQCA 1AFQC 1TBRH 2BDIA 5FBEA 1J17T 2LNCA 5CE1A 4ZROA 1LDTT 1DLKB 1WTGH 4TPIZ 3LJJA 5JBCS 2XW9A 4AZ2B 3A86A 4E7RG 4CH8B 1TWXB 1TNJA 5FPYA 5SGAE 3QWCH 1SBWA 2TRMA 4MPVA 1ELFA 1PFXC 1ETRH 1UTMA 4CR5A 3SJ8A 3IITA 2O9QA 3E3TA 1Q2WA 1BTHH 3ITIA 3TH4H 2BY8X 3NWUA 2W7UA 5FX5A 4MNVA 1V2LT 1DWCH 2CGAA 2J34A 2OLGA 4GHTA 2VH6A 2ZZUH 1HAIH 1XVMA 3GDSA 1ZTLA 2XWAA 4B73A 4KTSA 5C5NA 1A1RA 1UTJA 2F83A 3GDUA 4M7GA 4I8GA 2QXHA 3RXDA 1O2JA 4X8VH 1W2KH 1EZXC 3I78A 1ELBA 1RGQA 1C2LA 4CRFA 1QRZA 1FY1A 1ZRBA 3ZZ8A 1JRSA 3BTTE 1C2KA 1O3KA 2Z9IA 1V3XA 3BEUA 1Z1JA 4LXBH 1V2JT 2OUAA 3MH7A 2GZ7A 1A4WH 1GBJA 1P2MA 2QIQA 1TMBH 5GWZA 3STJA 4K1EA 4NZLA 3EGKH 2TBSA 1GJBB 1AZZA 4ZKSU 1GHWH 2DE9A 2GV7A 1K2I1 2XBWA 3E6PH 3SGAE 1TPPA 4ABAA 1EAXA 1AVXA 1EB1H 1C2MA 1OWKA 2STAE 2G5VA 1FAXA 1GI1A 3M61U 3VB6A 2DUCA 2OCVB 1GI8B 2QV1A 1L2EA 2AGIX 1MTUA 1FZZA 1OX1A 5DP6A 3MU8A 1FN6A 1MCTA 5A2MH 1EASA 1UCYK 2ZGBH 3F9EA 1O3DA 1G32B 1XUHA 1SQAA 1K22H 4X8UH 4Y10E 2J4IA 1QJ1B 4ABDA 1EATA 1GMDG 3BEIB 2A4OA 3CS0A 1O3PB 1OYQA 2BDAA 1ESAA 3AW1A 3RU4T 1WOFA 1P2KA 3ATIA 3TGIE 1HJAB 4Y0ZE 1DE7H 2TGTA 1ANCA 1GMHF 2HWLB 1GBEA 1T4UH 2FEQH 2UUJB 1AUTC 1TALA 3RP2A 1CHGA 2GD4B 1SHYA 3E0PB 1AUJA 2V35A 1C5XB 3VGCB 1LVBA 7ESTE 3UOUA 3OU0A 1AU8A 1ARBA 1SGDE 1LHGH 1XM1A 1C5UA 1C5NH 3ZZ7A 3LGWA 1C5SA 3E8LA 1SGFG 2XYAA 1V2UT 3LGVA 1O3NA 1Y59T 2BDYA 1O2XA 2OBOA 2Z7FE 1FN8A 3RXMA 3I77A 3U8TH 2FZZA 1AWHB 2OC1A 2WV4A 3HPTB 3MO3A 1QB1A 1GHBG 3F9GA 1SGEE 4YO9A 3SZNA 2AIQA 1BZXE 1LVMA 5EG4A 1EX3A 1ZHMA 1ZPBA 2CN0H 1DDJA 3BTFE 4E05H 2CF8H 3S7KB 2RA0A 3V0XA 3IWMA 4Z6AH 3D65E 4U32A 1X7AC 1TE0A 3RXGA 5GXPA 1GI2A 3QGJA 3ZZBA 2GV6A 1UVTH 4JK5A 2FI4E 2OC0A 2PTNA 4TY6A 1ELCA 3A81A 4CHAB 5A0CA 4B71A 5GCHF 1A7SA 4CR9A 1ARCA 3B9FH 1SB1H 4VGCC 1O31A 4I8LA 4D7FA 4O9VA 1KSNA 1K1MA 1QBNA 3A87A 1E34B 1DXWA 5DPAA 3VXEH 1FXYA 3EA9A 2BDBA 1N8OC 1DWEH 1TX7A 1GJ4H 2PWXA 9LPRA 5L30H 5A8XA 1BTYA 1TMUH 1IQEA 2BZAA 1S81A 1ZSKA 1HAYB 1A5GH 1XUGA 4Y76A 5CMXH 1QHRB 2FLBH 2FI3E 1S6HA 1K9OE 3KNXA 1TA2A 2QXIA 4UONA 3K65B 4DT7B 2UUYA 3PV4A 4Y6DA 4UFGH 2BY6X 3RXEA 4AGJA 3S69A 4K69A 1TONA 3M5LA 4Y7AA 5HM2A 1GBKA 1W7GH 1O30A 1GI4A 2RDLA 1A3EH 1GMHG 1MAYA 1DSTA 2QN5T 4WJG2 3PO1B 3UWJH 2ZNKH 1MU8B 4YOGA 1THSH 2Q6DA 4UE7H 5E0HA 1IQIA 1C2EA 3Q3XA 2BVXH 1O2IA 1PPEE 5HGGA 1LPKB 4K8BA 1BBRE 5L2ZH 4NSVA 2W26A 3UWIA 4DJZB 1PYTD 2NU2E 4AG1A 5JBBS 5T6FA 2O8MA 2XCNA 1IQNA 1E36B 2F9PA 1BA8B 2QC2A 2VJ1A 4ZKOU 1P11E 3H7OA 4DVAU 1MH0A 1SGQE 1W13U 3VFEA 7GCHF 3BF6H 4AFZA 1QURH 4MPXA 3T26A 2PFEA 2BQ6B 3EE0B 1BMLA 1YGCH 5C5OA 1GGDC 3HATH 1TA6A 2Z9KA 1F0RA 4K60A 3RXIA 4JZ1A 4Y7BA 2NU4E 3SV6A 5GDSH 2Z9JA 2VU8E 4MVNA 2C8XB 4F4OC 1HAGE 1QB9A 2PKAA 2G4TA 2HNTF 2J95A 1XMNB 1QBVH 1IQHA 2SGQE 3MU5A 2V3OH 4MDSA 1DY9A 2AFQB 3A85A 3RU4E 3TGKE 3RXSA 3SI4H 1AVWA 2ANMH 1GI7B 1H1BA 3GY8A 3A80A 1CA0C 1ZOMA 2XNIA 4WMFA 4ESTE 2W7SA 2GVFA 4X2VA 1C5MD 4GPGA 2ZGXH 1G9IE 3BTDE 2GCTC 1QR3E 1TPSA 2ZF0H 1CA8B 3M3SA 3PLBA 1ZGIA 1QY6A 1YLDA 2A45B 3SJKA 2VIDA 1NM6A 1SGRE 2ZHQH 1H9HE 1QNJA 5E0JA 1K1PA 1OPHB 4CREA 1MKXK 2G81E 1CT2E 1W12U 1EB2A 2BDGA 2ZDNA 5EOKA 1PPGE 1F5RA 3KQBA 2OC7A 3HKIB 3QLPH 1CHOF 5DP5A 1MKWK 1V2NT 5TCCA 3AASA 4AB9A 1YLCA 1T8OA 2Y81A 3TJUA 1PPFE 2FO9A 1DT2A 1DX5M 3QX5H 4AFQA 3RXPA 1GVLA 1RTFB 1AN1E 1RTLA 1DLEA 1CGHA 1V2VT 3BTGE 3BG4C 3DUXH 2HLCA 1SGIB 2O8LA 3UY9A 5FCKA 3K2UA 4KKDA 2G00A 3GY4A 1HXFH 3BV9B 2A7CA 3GICB 4K1TA 1LTOA 5GPIB 1O2YA 2ZPRA 3QK1A 3QTVH 1SFIA 1ELVA 1WQVH 1TRNA 4NWKA 2ZGJA 4DCDA 4FUGA 2HVXA 2VWLA 1NU9A 2QYIA 1VITG 1MTNB 3FZZA 3LKWA 3A8AA 2B7DH 4ASHA 5EW1H 1PPZA 3MHWU 7GCHG 3MNSA 1BHXB 1NO9H 1RRKA 4AYVB 2A2XH 1ANDA 2D2DA 2NWNA 1LVYA 1BBRK 2I6QA 2BHGA 3OYPA 2P59A 1C5VA 1FDPA 3SJOA 1TBZH 2H2ZA 4FU8A 1JIRA 2YOLA 2BM2A 3A84A 3GY2A 2Z3EA 2BMGB 2OD3B 1FMGA 3KF2A 5T6DA 5F8TA 2P3FH 3OSYA 4YT6H 4CRDA 5FPTA 3T27A 1A3BH 1VCWA 4H4FA 1BITA 5HYOA 2J9NA 5K0HA 2PKSB 1SSXA 1ZJDA 4BAHB 1GI0A 1C1TA 1C1MA 1V2ST 3GYLB 5C67A 3SV9A 1F0TA 5DP3A 3S9BA 4A6LA 5LPRA 2Z9GA 1O2ZA 4X2WA 4ABGA 2AIPA 2ZCLP 3RM2H 1TABE 1YPEH 2O8WA 2A32A 4SGBE 2QA9E 3ZVBA 4DY7B 1JOUB 1YC0A 1T8LA 5ETXA 2VGCB 4ISIH 2AMDA 1VGCB 5FBIA 3V13A 2BYAX 3GCHC 1P3EA 4WY3A 2ZFPH 3Q3KA 2P8OC 3PMAB 1HAHH 3AVZA 2SNWA 3HGNA 3MH6A 3RXJA 1YCPH 1UTQA 1MZAA 5EPNA 8LPRA 1VITH 5LH8A 1FQ3A 1SOZA 1AB9B 3R3GB 3R0FA 3ZV9A 1FJSA 3SN8A 1V6DA 1TGTA 1O5FH 1D3DB 1TNKA 3AW0A 1THRH 1E38B 1O2PA 2PTCE 1ELAA 5DK1A 3UNQA 1ID5H 1RD3B 1AO5A 3LJOA 1OP8A 3UQVA 1W14U 2HGTH 3LH3A 2VNTA 5E2OA 4ZUHA 4DW2U 1V2KT 3GCTG 1OWEA 4H42U 3H5CB 4HFPB 1BTPA 4IS5A 5JBTA 1XKAC 2W3KA 1UVOA 2R9PA 4KP0A 2WPKS 3NXPA 1OP2A 3P70B 3G01A 3ATWA 3RLWH 1GDUA 1GBMA 1BQYA 1SQTA 2BQWB 3ODDA 5A09A 1BMAA 2FODA 1Z8RA 1A46H 2P16A 1AWFH 4D7GA 1BRUP 1C5ZB 3P8NA 2P94A 1W0YH 4BXSA 4YTAA 1ESBA 1V2WT 2QGRA 2BVSH 3PYHA 1AFQB 1PQ8A 4HI3A 2H1UA 4BNRA 1SLUB 1VZQH 2HNTC 3UREA 4BAQB 2YNBA 1XKBC 2PUXB 2PSYA 5FPSA 3HKJB 3VPKA 1ETSH 3S7HB 1BB0B 1MTSA 1KLJH 3TITA 1BTZA 4O3TA 1TNGA 3BN9A 2JETC 3M5NA 2K1QA 3F6UH 1C2FA 3P8OA 4OS1A 1CT0E 1LMWB 2QXGA 4XBBA 1EXFA 5G4BA 1IQFA 4AYYB 3E1XB 1BTUA 4DG4A 4UFFH 1K1NA 1SR5C 1ELEE 1T32A 1ETTH 1RTKA 3UNSA 2B5TB 1ZPCA 3GYMA 1C1NA 1RIWC 2UWPA 1DXPA 3Q00A 4WH8A 2BB4A 3FFGA 2Z9LA 4X2XA 1DUAA 4I33A 1VJ9U 3ZVAA 1C4U2 2A7JA 3HGPA 4JZEH 3SU4A 9ESTA 1O2SA 1SGPE 4FUBA 3RXTA 2TGDA 2VWNA 2P95A 1ZRKA 3TJVA 1PPHE 4CBOA 1TNIA 1GHAF 3RXKA 3VB5A 2A5AA 1AFEH 1LHFH 1HAVB 4E06H 3VB4A 1QFKH 3SHCH 1F5KU 3UR9A 3MU4A 1AQ7A 3ZVFA 3SGBE 3M5MA 1XUIA 1ELDE 4B2AA 4X2YA 1GHYH 1K1JA 1TQ7B 1GG6C 1SI5H 3TVJB 3GOVB 3HK6B 4AFUA 2F9NA 2VIVA 1EP6A 1GL0E 2BD9A 3U1JB 1O2VA 2SGAA 1HFDA 4WMEA 3W94A 3TIUA 1SQOA 2IN2A 1XX9A 1KDQB 3TNTA 3W95A 8GCHF 2GZ9A 2FOEA 1C1OA 1NRNH 3GY3A 2FOGA 3U1IB 2PUQH 2FS9A 5A8ZA 4J1YA 1P8VC 1O32A 1TGCA 1C1WH 1UTLM 4H6TA 2CHAC 1FY8E 4FUDA 4RSPA 1QJ6B 5E0GA 1W7XH 1AGJA 2FOCA 2FLRH 3Q3YA 1TFXA 1YPHE 4GAWA 2GDDA 1T4VH 4CH2B 4JZFH 1JXPA 4CBNA 1NPMA 2Y80A 2UWOA 2ZGHA 1NRRH 1IHSH 1SC8U 1NRPH 3SJ9A 1SGNE 4DURA 1OWIA 2R3YA 2VWOA 3RXOA 3KIDU 1AI8H 3SQHE 1FI8A 2G8TA 1UCYH 3OX7U 4JZDH 1EAIA 1O2GH 3PMJA 1VJAU 3P92A 1AE5A 2SNVA 2BY9X 2GCHG 4UEHH 1C4V2 1ZYOA 1O2RA 1FY3A 3A7TA 2Z6BD 3SNEA 2WPLS 1S84A 4IMZA 2A7HA 2BX3A 4I31A 1L4DA 2AERH 4YT7H 3M3VA 3PLKA 1BMMH 4ZAEA 4ZHMU 1GBCA 1W0ZU 2ZU2A 3UTUH 3PLPA 1TPOA 1GHXH 1S82A 1K1OA 2PW8H 1L0ZA 1O3GA 3ZYDA 4F49A 5LGOA 5ABWA 1Y5BT 4WVPE 1EZQA 4X0WU 2BD5A 3LGTA 1KDQA 2P93A 4VGCB 4X6PA 3U69H 3S0NA 2V0BA 3QDZB 1GJ6A 4TPYA 1A5HA 5PTPA 1O5GH 1V2RT 1GHAG 1LHCH 4IC6A 5DG6A 1ABJH 1G3DA 4YLUA 4WXIA 2A4QA 2Y5GA 4B76A 3SV2H 1DITH 2J38A 1XVOA 1NFWA 1GPZA 1C1SA 4MG3A 1D4PB 3MNBA 1L4ZA 3KCGH 1QJ7B 1K28D 2ZCHP 5HXFA 5FX6A 1GCTC 3D23A