4FUEA

Crystal structure of the urokinase
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
246
structure length
246
Chain Sequence
IIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTIALPSMYNDPQFGTSCEITGFGKEQSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Urokinase-type plasminogen activator
publication title Crystal Structure of the Urokinase
rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 61
structure length 246
sequence length 246
ec nomenclature ec 3.4.21.73: U-plasminogen activator.
pdb deposition date 2012-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4fueA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4fueA01
1O2XA 3GOVB 1O2ZA 2WV4A 4U32A 2JKHA 4MVNA 6ESTA 5C67A 2CHAC 1F0SA 5L6NH 4XBBA 1A4WH 1ZMLA 2ZDAH 3A8DA 3RXGA 2ZDKA 1MMJN 3UIRA 1V6DA 2HWLB 3RXIA 1MKXH 1G36A 3BF6H 1A5GH 2QY0B 4ISHH 5CE1A 1FNIA 2XBVA 1KXBA 1ELDE 3VB6A 2H9EH 3FZDA 4FU8A 1VGCB 1TOCB 2FM2A 1A46H 1QIXB 2BMGB 1P03A 4M7GA 5FCKA 3A88A 4UD9H 4B74A 3PLBA 2VIVA 1YPGH 1U6QA 4I33A 1O2QA 2FEQH 4CREA 3CS0A 1HAIH 1UTOA 8KME2 1M9UA 3A83A 3E16B 1GHBF 1IQKA 1N6YA 1B7XB 3KHVA 4FVBA 2BTCE 3LPRA 3MWIU 1BCUH 4ABEA 2O8LA 2GT8A 3ZV9A 1IQJA 4ISNA 2W26A 2QAAA 4VGCB 1KXFA 1MU6B 3RMMH 1BJVA 5C20A 1TB6H 1UTMA 4IGDA 4AB8A 3NCLA 3LDXH 1DS2E 1EUFA 3I78A 1C1SA 3LKWA 5T6GA 3RUOA 1H8DH 2JH6D 2VWMA 2P8OB 3S69A 5C5OA 3C27B 2ZFQH 1BHXF 4ZXXH 2PUXB 5AFYH 2PLXA 4MNXA 1ELEE 5DP4A 2RG3A 3AASA 3NZIA 2XWBI 2Z6BD 1XUJA 3B8JA 3SUGA 1BRUP 4JZ1A 4YO9A 2GTBA 3SI3H 1BT7A 1QR3E 3SV6A 3KEEA 3LONA 1JRTA 1OXGA 1P2NA 2G81E 3BTHE 5JPMH 3VEQB 1V2JT 1C5UA 3MH6A 4MTBA 1MTSA 1F7ZA 3O8DA 1TYNA 2GCTC 1GI9B 3LGUA 2GDDA 4THNH 5EQRA 3U8OH 7ESTE 2Y80A 1W10U 1DT2A 1IHSH 2FOHA 1ELGA 4SGBE 1NROH 1WU1A 3MO9A 1O2OA 1WBGB 3O8BA 3U1JB 4K1EA 3NUMA 3RU4D 1D6WA 3LGWA 4GAWA 1JMOH 4Y7AA 5B6OA 1S83A 4JK5A 2CMYA 4RKOB 4Q2KA 2ZDVH 5E8EH 1GBCA 2CN0H 2NWNA 1HIAB 1W8BH 4Y6DA 3ITIA 1O3AA 2AS9A 3SUFA 2TBSA 1QB1A 2BOKA 2KAIB 1ZRKA 3D49H 1YPHC 3MMGA 1TNGA 3QX5H 1S5SA 1YCPM 1BRAA 2OP9A 1QJ1B 3F9FA 3BIVH 4O3TA 3NWUA 1TGBA 4DJZB 2ZIQH 4HZHA 7GCHF 1O37A 2ANWA 1SLWB 1NM6A 1O33A 1C5OH 1MD8A 1YCPH 3HATH 3IWMA 1BBRK 1TGSZ 3A80A 3K9XB 1HXEH 2OTVA 1GGDC 2ZCLP 4FUFA 1O5AB 2BQWB 2QXIA 1DWDH 1O3FA 1YBWA 2TIOA 1IQIA 4MPXA 4TY6A 2NU1E 1AD8H 1F92A 1YC0A 4CRCA 2HALA 1GI7B 2Y5FA 1F2SE 5E0HA 3E8LA 1O2HA 1CA0B 1PFXC 1GBAA 4CH2B 1P57B 1DUEA 2ZI2H 1X7AC 2BX3A 3M37A 4UFFH 4X2YA 1C5TA 4Y76A 2FTMA 1EAXA 1Q2WA 4NGAH 1ELAA 2BQ6B 1P3EA 2VIDA 3SGAE 5LGOA 1DE7H 5HM2A 1C2DA 4GCHF 3V7TA 1P04A 1CGJE 3VXEH 4NZLA 1GBJA 2WV5A 2PHBA 2QXGA 4JCNA 1C5VA 1G3CA 2FOBA 1S0QA 1B0FA 1MZDA 3RC6A 1TX8A 1C1PA 1K28D 1HCGA 2THFB 2C8XB 4X1NU 4NG9H 2G8TA 2A5KA 1K2I1 1HFDA 4X2XA 1KDQB 5FBIA 3FANA 3GYMA 4BAKB 2XXLA 2GMTB 3KF2A 2P16A 1BTZA 3LIWA 1OWDA 1JBUH 4ABAA 2F83A 3RM2H 2OCVB 5TJXA 4BXSA 4YZUA 5T6FA 1E38B 3LGIA 5DKMA 1N1LA 3TNTA 1L1GA 7GCHG 3GICB 1DFPA 2BZ6H 2NU4E 3UOUA 6CHAB 2W3KA 1C4V2 2G52A 1AZZA 1K1MA 2P94A 4WJG2 2BLQA 1UK3A 4Y8ZA 2BY6X 3PWCA 1O35A 3KQCA 2PWXA 1TQ7B 5ABWA 5JB9S 1CT4E 6LPRA 5EOKA 2ZGXH 1T7CA 3QZQA 4YESB 2HVXA 2ZU4A 3V12A 3LGVA 3MU1A 2ZTZA 1LTOA 1XM1A 4AZ2B 2OQUA 4WMFA 1XVOA 1W0ZU 2CGAA 1YPEH 4ABJA 3DFJA 1THPB 3BEFB 4X6OA 1GBEA 1P02A 1QGFA 4K60A 3ENSB 1GI1A 1SGNE 4HTCH 3MU4A 4UEHH 1A0LA 1H9IE 2OXSA 4Y0YE 1ZGVA 1SGPE 1AB9C 1GJAB 1SI5H 3LC3A 3LJJA 1CGIE 4GCHG 1FIWA 2TRMA 1ZPBA 3A8BA 1O5EH 3GCNA 1DDJA 1O3HA 1AZ8A 1PQ5A 4XE4A 2HPQH 5JBTA 4AGKA 1SVPA 1BRCE 3PWBA 1AWFH 1W11U 2ZHWH 3STIA 1GG6B 3TGJE 1GMDF 3GY3A 3GYLB 1GBMA 1ANCA 3U8RH 4U01A 5DP7A 1O2RA 2A2QH 2QXJA 1P09A 3UOPA 3PM3A 1QRZA 1O3LA 1GI8B 3CS7A 1P11E 2R2WU 1NZQH 1P9UA 1O2IA 1QA7A 5AHGH 1D9IA 5LPRA 1DXWA 1PPBH 3ODDA 1OWIA 2CJIA 2W7UA 5A0BA 1Y3UA 3FP6E 1EPTA 2AFQB 3T29A 4E06H 2QA9E 3RXUA 1MD7A 1FZZA 1O2YA 1J17T 1J9CH 1QB9A 3GCTF 2OINA 3H5CB 2SGEE 1Z8GA 5F8TA 1BB0B 2FX4A 5TCCA 3ELAH 3Q77A 4ZKOU 1V2NT 4H6SB 1GHZA 4IC5A 1SB1H 2ZFFH 5FPTA 1CSOE 1P8VC 1C1TA 1UTJA 1XMNB 1O3NA 1TBZH 2G5NA 4X8SH 1YPLH 3T26A 1C5PA 1K21H 3BTQE 2HNTF 1E0FD 1T32A 4UFEH 2VVUA 1V2KT 1UVUH 9LPRA 1QBOA 2BDCA 1A61H 2BVRH 2P3FH 1AN1E 3RXHA 3BIUH 3EYDA 4CHAC 1NS3A 3Q76A 3QWCH 3TIUA 1O2UA 3RXTA 3QUMP 4UONA 1Y5BT 1T8LA 3SV9A 3OY6U 1QFKH 3U69H 3RXOA 3LGYA 1IQFA 2FS9A 1HAXB 5DO4H 1GHAF 3KIDU 4I32A 2BDHA 1HRTH 1GCDA 3ESTA 1O3JA 2AYWA 3RXCA 1GI2A 3F6UH 1GJDB 2WPJS 1NRNH 1W13U 4KKDA 1GMDG 1GWAA 2J95A 3E90B 5FX5A 2Z3CA 5GDSH 4F4OC 1TA2A 1QJ6B 1SLXB 5DP6A 2BLOA 2BQ7B 1NN6A 3DFLA 1DOJA 2A7HA 3SORA 3LH1A 1HGTH 1B0EA 1SFQB 5GXPA 3VGCB 2Q6FA 2ASUB 3RLYH 2HOBA 2A4OA 1CA8B 3SHAH 4Y11E 3UTUH 3RC4A 1YLDA 1ZPCA 1SGYE 3M5NA 1XXFA 8LPRA 3B9FH 3GCTG 1L1NA 1W14U 1AVXA 4OGYA 2XCFA 4MLFB 1AUJA 2KAIA 4LK4A 1C5NH 1AVWA 1TA6A 3EQ0H 1G2MA 3I77A 3PO1C 3WY8A 2ZFRH 3RXPA 3P95A 2GV6A 4Z6AH 3UR6A 4AORA 1QCPA 2ILNA 1O5GH 5ESTE 3MH4A 3TGKE 1XVMA 1HNEE 2BHGA 4WF8A 2O8UA 3TITA 1SGQE 4ISLA 4ZHAA 1JRSA 1FXYA 4K5ZA 1SR5C 1ABIH 2FOMB 3T28A 3LT3A 3TU7H 1NFXA 1V2LT 2FDAA 2UUYA 4AB9A 1NRSH 3A86A 1LQEA 1ZTJA 1P0SH 2A4RA 2B7DH 1GJ7B 2C4FH 1AUTC 2QIQA 1GJBB 2ODYB 1ANDA 2AMDA 1GHAG 1GBKA 2JETC 1EB1H 1EXFA 2FOGA 5L2YH 4A1VA 2A31A 2R3UA 1YGCH 2ZO3H 5EXNA 2GGVB 3Q3YA 4FUHA 1IHTH 1WTHD 4IBLH 3SNDA 2R3YA 2ZF0H 1EOJA 2CHAB 1YKTA 2FYRA 5A2MH 1T8NA 1FAKH 3GY6A 5A0AE 1ANEA 2BVXH 1TFXA 4FUJA 1O5FH 2J9NA 3KCGH 1FQ3A 2FI3E 2BD2A 1C9TA 2FXRA 3QGJA 1AFQB 4WY3A 3QK1A 4ZKNU 1QBNA 1OWKA 2ZECA 1IAUA 3ATLA 4I8GA 1KLJH 2VJ1A 1ZR0A 4GVUA 1K9OE 2ZA5A 4WWYA 1Z1JA 1BTPA 3MNBA 4NWLA 1KDQA 3JZ1B 1GBIA 1RTLA 1MQ6A 2W7SA 2BDBA 2BOHB 1YP9A 1GCTC 1W7XH 2QN5T 4SGAE 4B2BA 1NRPH 2J92A 1HYLA 1TX7A 4FUCA 3FP7E 1QHRB 4IMZA 4NA9H 3U1IB 2ZDNA 3RXLA 4ABDA 1OWJA 1C2MA 5FBEA 1UHBA 1DWCH 1V2PT 4CRFA 1BTXA 4ZHMU 3SU5A 1V2QT 1Y59T 4QT8C 5GPIB 3UWIA 3SU2A 2VGCB 2A45B 1JWTA 1UTLM 1NFYA 2BXUH 1OP0A 2Q6DA 1DITH 3RXKA 2IJOB 3ATIA 4E7RG 1C4U2 1NTPA 4MPVA 1ACBE 1P3CA 1RD3B 1C1OA 4WVPE 1LVOA 4AG1A 3DD2H 1KXDA 1OOKB 5F8XA 3G01A 2OQ5A 1GBTA 1K1IA 4X6PA 2BD7A 5CHAB 1GJCB 2SNWA 4CH8B 1V2MT 1OX1A 4YOJA 1FMGA 3SN8A 1KLIH 2XTTB 3BTFE 4E05H 5PTPA 1Z8RA 1FDPA 2QCYA 3O8CA 4X1RU 3NK8A 4FVDA 2HRVA 2A32A 3UNQA 1XUKA 1UCYK 2NU2E 2BX4A 1HAYB 3KQBA 1E34B 1TRYA 2XYAA 1TIOA 3SZNA 3QLPH 1EPTB 1GMCF 1V2OT 4FUDA 1K1PA 1MTNB 4HFPB 4ABHA 2Z94A 3KL6A 1G30B 3GY7A 1MTWA 4ZKSU 3OSYA 1IQNA 2OC8A 1OYQA 1FV9A 5FPYA 1SMFE 2ANYA 2F9OA 2Y5GA 1C2HA 1MBMA 1H8IH 1HAZB 5C1UA 2A0QB 3MO3A 3W94A 1E37B 1PPZA 4OS7A 1QL9A 3EDXB 2ALVA 3D23A 3EE0B 4I8JA 2PKSC 3SV8A 1WQSA 1ESAA 4WXIA 1RIWB 1WCZA 1LHCH 1O2GH 3NPSA 3FAOA 1S0RA 1Z6EA 2VNTA 2AGIX 1E35B 3MU5A 5AVDA 4B75A 1O3BA 2ANKH 1FIZA 2BDIA 3ZVCA 2ZHEH 1K1OA 3ATMA 1FY5A 1O5CB 3M7QA 1P2IA 4O3UA 3RXVA 1XUHA 1O38A 1SGIB 1TWXB 3LOXA 4DG4A 1V2ST 3S9CA 2BD9A 1BTWA 3TK9A 3BG8A 3GISB 4RKJB 4ABGA 2Y82A 4ESTE 1V2UT 1DY8A 2O9QA 1GBBA 1L2EA 2ZU1A 4BAMB 1ZPZA 2W3IA 2GX4A 1W2KH 1P2KA 2GDEH 3LH3A 4O97A 5E0JA 1EKBB 3P8GA 1KTTB 1XKAC 1ESTA 1ELTA 1Z8IB 2EEKA 3SU1A 1GBHA 3URCA 1VGCC 3L33A 4AYYB 1HAHH 2DE8A 1SHHB 1GI5A 4X6MA 3SNBA 1EJNA 4KP0A 3RXSA 2C8ZB 1GMCG 4Y10E 5AF9H 4DOQA 1GHBG 2P59A 3M61U 4GHQA 4NIWA 1NFUA 4FUGA 1BTUA 1OPHB 3ATWA 2BDGA 1H1BA 1LPGB 2FLBH 3L3TA 4K8BA 2CF9H 4LZ1H 4VGCC 2XBXA 1G2LA 3MU0A 3L6PA 5FXLA 3IG6B 3PMBB 5FPSA 2F9UA 3ZYEA 2C8WB 1LVBA 3P92A 3SI4H 3PMAB 2SGFE 1O2LA 5GJ4B 3BV9B 3F9HA 1DM4B 3GCHB 4ABBA 4NZQA 1S81A 4A1TA 5K0HA 1FN6A 1A5HA 3ZZAA 1TBRH 2G4UA 4KELA 1MCTA 1N8OB 1TRNA 2F9PA 2XBWA 4MDSA 4B2CA 4CRBA 2BY5X 1C1NA 1TGTA 3GDVA 2FMJA 1C1MA 2J38A 1E36B 2FODA 4NWKA 4ZUHA 1KY9A 1MUEB 5DG6A 1OP8A 1PPCE 1UCYH 3SJIA 5DP9A 3P70B 2D8WA 3URDA 3V3MA 3SJ8A 1D3PB 4CR5A 1FUJA 3PMHB 1CBWB 2ZTYA 1GI3A 3F9GA 4GUXA 4FUIA 1ZTLA 5C2ZA 1A0JA 2YNAA 3OU0A 4INHA 1BMNH 3ZVDA 1ZSJA 3Q3KA 2QXHA 2O8MA 1ARBA 5DJ7A 1O2VA 5EPYA 2BYAX 2FTLE 2PKAA 2ZDMA 2OUAA 1AB9B 1VJAU 3E1XB 5BPEA 3DHKH 3A7WA 1O3KA 3A7XA 3S7KB 1MU8B 2C3SA 1LHFH 3AW0A 2PTCE 3SGBE 3A8CA 1VCQA 2ALPA 4IN2A 5GCHF 5HGGA 1T4UH 1UHBB 2FOFA 1O2SA 3UQOA 4MNVA 1CT0E 3SW2B 3SUDA 1GVKB 3OX7U 2F91A 2V35A 2JH5D 1V2RT 5DGJA 3D62A 5EGMA 1J16A 2J34A 1SPJA 4XSKU 4XFQA 4X8UH 4NIVA 4D7GA 4MPUA 2FO9A 4WXVA 3GY8A 2ZU2A 2VWOA 2A4QA 4YLUA 1ZGIA 3BTKE 2ZU3A 2Z7FE 3W95A 1O0DH 1D6RA 2EI7A 2P93A 4JYTA 3P17H 2H1UA 1KXEA 1KIGH 2GVFA 4U2WA 1NO9H 2PR3A 3PTBA 1NPMA 2HPPH 1TX6A 1MKWK 5LH8A 4DIIH 1F0RA 3TJUA 3SQHE 2D26C 4Q80A 1CU1A 3RP2A 5JBCS 4D9RA 1P2QA 2WPLS 1ZJKA 2TPIZ 3R0FA 4ABFA 1ZYOA 1IQGA 3NKKA 1V3XA 1GDNA 3GDUA 5H4IB 1HAGE 2A1DB 4YT6H 1C2JA 1W7GH 1PQ8A 8GCHF 2QGRA 1BRBE 2H2ZA 1UTKA 2ZG0H 5ETXA 3SV7A 1QQUA 3TPIZ 2WPHS 4X0WU 3UR9A 2TGAA 1RXPA 3RMOH 2OLGA 1O2JA 1G9IE 3A7ZA 2GMTC 2H9TH 1KLTA 1BBRH 1TONA 1F5KU 3PTNA 1P12E 1SQAA 5G4BA 2EA3A 3PLPA 1HLTH 2FI4E 4UE7H 2B8OH 2BZAA 2DUCA 3LU9B 2F9BH 3VFEA 5GCHG 1YYY1 4FU7A 2Z9IA 3MOCA 3E91A 1W0YH 5TCAA 1AU8A 1ZMJA 6CHAC 1THSH 1A7SA 1DANH 5HMAA 4DURA 1SC8U 3M5MA 3H7OA 1GJ6A 4NSYA 1VCWA 2ZPRA 1TQ0B 1UK4A 2VWLA 1C9PA 3ZZ7A 1OYTH 4K2YA 5C1XA 1H9HE 1FPCH 4ASHA 4ZKRU 4B71A 1FN8A 4BAHB 3ZZCA 4OS5A 3SV2H 1F5LA 1GI0A 1TOMH 1TNHA 3T27A 3BTDE 1WAYB 1D3TB 1THRH 1LVYA 3MYWA 2ZFTA 1L1JA 3Q3XA 2XCNA 5GIBA 1Y3WA 1AGJA 2V6NA 3BTGE 1S6FA 3SU4A 3VPKA 3CENA 4D8NA 4BOHA 5JB8S 3A7VA 3MO6A 4OGXA 2F9NA 1HJ9A 2SGAA 2BY7X 1LCYA 2J2UA 3EGKH 5C5NA 1SL3A 2ZKSA 1EP6A 5IYTA 1ZJDA 4JYVH 3A89A 4AX9H 3AVZA 1O2NA 4BAQB 2STAE 1O3OA 1WOFA 3FP8E 8GCHG 4BXWA 1AY6H 1O5BB 1TPSA 1SGCA 1DVAH 1GG6C 4DCDA 2Z3EA 4BANB 1ELCA 3MU8A 1ZLRA 2ZCKP 4RSPA 2VVCA 3U8TH 3ZV8A 4A92A 4DW2U 2ZEBA 1K1LA 2XC4A 1C1UH 3BN9A 2AMPA 7LPRA 1NU9A 4JZFH 1CT2E 1BJUA 5SGAE 1BUIA 4X1QU 4X1SU 1TPAE 1Y5UT 2IPHA 2Q1JA 4D76A 2GZ8A 1C5XB 4UFGH 4AFQA 1GBLA 1PPEE 1MTVA 3TH3H 1FY3A 1UMAH 4Y0ZE 3FFGA 1GHVH 4FUBA 1ESBA 1YPHE 2Y7ZA 4OS2A 3ZVFA 1P2OA 1HJAB 1MKXK 3M5LA 2XW9A 2FP7B 4B1TA 1HPGA 3BG4B 4AFUA 1BITA 2GP9B 2P3TB 1EZXC 1LO6A 3KNXA 2A5AA 2BB4A 5I46H 1BDAA 1IQMA 2V3OH 2A4GA 4ZAEA 2EI6A 3SU0A 2PSYA 1DLEA 2ZDLA 1SG8B 5J4SA 4GLYA 3RXQA 1TGNA 1SSXA 1UTNA 1G3EA 1O3DA 2C93B 1WTGH 1ELVA 4Y71A 1FONA 4NA8A 1T31A 1BTYA 3ZVEA 1O31A 1TABE 3T5FH 5HM9A 4I31A 1HAVA 2SGQE 1TRMA 4AFSA 2ZHQH 1F0TA 1O5DH 1HJ8A 1EB2A 2JH0D 2PKAB 4IN1A 3ZZ8A 3TH4H 2K1QA 3E0PB 2ZGBH 2QV1A 1C5QA 4AGJA 4A7IB 3A8AA 3GDSA 4AOQA 1MH0A 2BD4A 4MNWA 3VB4A 6GCHF 2ZQ1A 3ZYDA 4JK6A 1T8OA 1LVMA 1SGFG 1P05A 1OKXA 1OS8A 1FJSA 5A09A 3M3SA 2LPRA 1O30A 1BMMH 3M5OA 2TGDA 3M7TA 3MHWU 1ETTH 3A7YA 1IOEA 1Y3VA 1IQLA 2I6SA 1EAIA 1H4WA 4KTCA 2VINA 1J14A 2AMQA 1NU7B 3TNSA 3VGCC 1HDTH 4UFDH 4IW4E 4PROA 2D2DA 4WH6A 5T6DA 4TPYA 1EP5A 4H4FA 3E6PH 1DSTA 1RGQA 2BVSH 2I6QA 1ZSKA 4BTTB 2Z9LA 2G00A 2FOAA 4E7NA 1B5GH 4ZROA 4FU9A 1D3DB 1EQ9A 5F6MA 4WMEA 1VR1H 4CBNA 4IS5A 1C5YB 1G3DA 3S9BA 1SGEE 4X8VH 1JIMA 4Y8XA 1ZSLA 1TPOA 4Q7YA 1BMAA 1GVZA 2UWPA 3ZZ4A 1G37A 1SLVB 2A7CA 4GSOA 4KTSA 2ANMH 4JMYA 2SGDE 2AGGX 3LC5A 4NFFA 1W3CA 1NT1A 3RXMA 2G5VA 3SQEE 3LJOA 4DVAU 3SUEA 5E2OA 5JBAS 2ZCHP 4GHTA 2AIQA 1AFEH 1P2MA 2C8YB 2O8TA 1SLUB 1ZMNA 1C5MD 1LDTT 1QL8A 2SNVA 3U9AH 3ZVGA 1P06A 3C1KA 3ZZ5A 4DY7B 4CRDA 1K22H 4CRAA 6GCHG 1FY4A 3RXDA 3TGIE 1CQQA 4YLQH 1C4Y2 2FLRH 3OY5U 3QGNB 4ZHLU 3A84A 5DP3A 2UUKB 1ABJH 1FY1A 1BTHH 1FI8A 2GCTB 3E3TA 1VITF 1S85A 2AIPA 2P3UB 5HYOA 1EJMA 1ORFA 3FVFB 4J2YB 1AFQC 4I8KA 4D7FA 9ESTA 3RXEA 4JYUH 2ZP0H 1HXFH 1AQ7A 1A3EH 1TE0A 5JDUB 2WPMS 3UUZA 1DX5M 1G32B 2VIPA 5C3NA 1KSNA 5BRRE 2ZPSA 4NIXA 3Q00A 3RC5A 3HKJB 2FPZA 2XRCA 3EAJA 5DK1A 3K65B 1L4DA 3SU3A 3T2NA 2Y6TA 2ZU5A 4D9QA 1P10A 5FCRA 4I7YH 2ESTE 2PGQB 1KXAA 5FAHA 1TNKA 1ELFA 3BSQA 1Y3XA 2BD8A 2HLCA 1Y8TA 2VIOA 3BTTE 4A1XA 1O3IA 2VGCC 1SHYA 5IDKA 2Y81A 1ARCA 2YOLA 2XWAA 3VB3A 3TK5A 4MPWA 3SO3A 1GGDB 3BEUA 5ESBA 3TJNA 4AYVB 2ZGJA 4B73A 3PV4A 2VVVA 1QURH 1O2KA 1C1QA 4YM9A 2VB0A 1UCYE 5CHAC 4ZXYH 1GHYH 1BA8B 1J15A 2WINI 3EA8A 4XBCA 2WUCA 3PMJA 2R0KA 3QZRA 1O3MA 2VH6A 3SOSA 2B0FA 5LPFA 4NCYA 1AKSB 1FLEE 1PYTC 1QBVH 1MCVA 1QRWA 1LMWB 2V3HH 3B23B 3QO6A 3STJA 1AVGH 4NSVA 2J94A 3HK6B 1MZAA 4HI3A 1BHXB 1RTFB 1VITG 3MI4A 5LPEA 1PYTD 1EPTC 2VU8E 1PPFE 1MTNC 3AAVA 5EQQA 1Q31A 2TGPZ 5A0CA 1CO7E 3GY2A 5FX6A 3SU6A 3M7UA 1EJAA 2TGTA 3HGPA 1WV7H 3ZVBA 1SOTA 4OS4A 3A81A 4R8TB 2QYIA 3I29A 3SBKA 2STBE 4K8YA 1C1WH 1PQ7A 1QB6A 1ETRH 2OBOA 1ANBA 3M3VA 8ESTE 1C5RA 4I8LA 2ZFSA 2P8OC 1O39A 1GMHF 2XNIA 1ZHPA 5C1YA 2Z9KA 3ZZDA 3S7HB 2SFAA 1C2IA 1RIWC 4BTUB 4WMDA 2ZGCA 1LHEH 1XUIA 1LQDB 1L4ZA 2OC1A 1DWEH 1HAVB 1KYNA 2RA3A 2UWLA 1ELBA 3SNEA 1LKBA 3PROA 3TVJB 4H6TA 2NU0E 1HV7A 3CP7A 5A8XA 3VXFH 2ZWLH 2BLVA 3V13A 1DPOA 4XDEA 1UO6A 2A2XH 1XKBC 1GJ8B 3BTEE 5EXLA 4X6NA 3VB5A 1AWHB 1Y3YA 3NXPA 5L30H 1Z1IA 1YLCA 3P8FA 1QL7A 1D4PB 1ZZZA 1SGFA 2CXVA 3M35A 1MBQA 4K1TA 3UFAA 4TWWA 5E2PA 4DGJA 2AERH 3TJVA 2Y5HA 1XX9A 3ZZ9A 3ATKA 1GJ4H 4INKA 1SBWA 2IN2A 3QDZB 1HAOH 1O3EA 1C1VH 1O2WA 5DP8A 2GT7A 2Z9JA 5L2ZH 4TWYA 5EG4A 1Y5AT 2D1JA 1RTKA 1SGRE 2C90B 1RJXB 1D3QB 5CMXH 3HK3B 3UPEA 5GWZA 3QN7A 2ULLA 1MAYA 2HNTE 1BBRE 1GBDA 4H42U 1JOUB 3GCOA 1N6XA 1GJ5H 3OYPA 1JXPA 4NA7A 3A7TA 3P8NA 1TMUH 1F0UA 2PTNA 2OBQA 3QTVH 1TMTH 3T25A 4R0IA 4K3JA 3BTWE 2XC5A 1GHXH 4Z0KA 3MNCA 5F8ZA 1V2TT 1GMHG 4ABIA 3SJ9A 1YPMH 3SJOA 1O3GA 3ODFA 1CVWH 1EX3A 1KTSB 3RXRA 1CGHA 2VWNA 1DLKB 1HB0B 4YOGA 3RXAA 2ZQ2A 3GCHC 2BXTH 1S6HA 1EAWA 2PUQH 2VIQA 4K1SA 4ZMAH 2ODPA 4IMQA 1N8OC 2PFEA 1A1RA 4CRGA 2H9HA 2H5DA 1DSUA 5EQSA 3RXJA 1FY8E 1C5ZB 4A6LA 1Q3XA 5FHTA 1C2EA 1RS0A 2GKVE 4BAOB 2FESH 1MTUA 4U30A 2CF8H 1CA0C 4WH8A 4MQAA 5J4QA 1C5WB 1O2TA 3MTYA 2WUBA 1DUAA 3K6YA 1GJ9B 2A7JA 3DUXH 2A5IA 2GZ7A 1QRXA 2QC2A 2AEIH 3ZZ3A 4NIYA 1XXDA 1DXPA 4TY7A 2GV7A 4ZH8A 4AG2A 1CBWC 2EC9H 3RXBA 2RDLA 5DPAA 1ID5H 3GY5A 1T8MA 2EI8A 1AE5A 3D65E 3N7OA 1HUTH 3PB1E 4JZEH 1AE8H 2Y7XA 3A82A 4LXBH 3S9AA 1ETSH 1QJ7B 1Z71A 1GL0E 1NESE 2G51A 4CHAB 1C5LH 1L0ZA 2WYJA 1LPKB 1SQTA 1O36A 2O8WA 1UVSH 1NRQH 1YM0A 1ZOMA 1LHDH 2NU3E 3SNCA 2ZHDA 3ZZ6A 1AO5A 1TNIA 2ZPQA 1EZSC 4A5TS 4JZDH 1O34A 3TK6A 4O9VA 5EU8A 3ZVAA 4ISOA 3V0XA 4FXGH 1S82A 1INCA 2UUJB 2BM2A 2FS8A 1LHGH 1GHWH 4X1PU 2GCHF 4DIHH 1ZHMA 3T62A 1OP2A 5EW2H 1C2GA 2R0LA 3P8OA 4Y79A 3SJKA 2OC7A 2BY8X 1OWEA 1LKAA 1IQHA 1GBFA 1DWBH 1C2LA 3A87A 2ZTXA 5E0GA 1P01A 2FI5E 1EZQA 3TJOA 1C1RA 3MH5A 4JZIA 1RFNA 2FZZA 4RN6A 1Z7KA 5I25A 4ISIH 1XUFA 1Z6JH 4KTUA 2B9LA 5F03A 1LPZB 1OSSA 1ZRBA 3TLOA 4LOYH 2G55A 3LGTA 1SOZA 3E0NB 1QTFA 4UDWH 2QF0A 4X2WA 3KQDA 2SGPE 2XBYA 1CE5A 4CR9A 5EXMA 1UTPA 2UWOA 2CV3A 3BTME 3RXFA 1AHTH 4X2VA 1KXCA 4MG3A 2XC0A 3PO1B 4Q7ZA 4TYDA 3PYHA 2G4TA 5JYIA 1Z8JB 2PGBB 4INLA 1O3CA 4AN7A 1TLDA 1IQEA 1NFWA 1PPGE 1PPHE 3RLWH 1TGCA 2H5CA 2ZFPH 1GPZA 2ZNKH 4F49A 3RU4E 1EATA 2RCEA 2ZC9H 1GDUA 3IITA 2R9PA 3O8RA 3F9EA 1O2MA 2YNBA 4YTAA 5K7RA 1WSSH 1RRKA 4Y7BA 1A3BH 4XBDA 1BQYA 1G3BA 1MQ5A 1BIOA 3OTJE 1EZUC 5T3HA 4CBOA 1TALA 5JBBS 2FYQA 1TPPA 3UY9A 1CHGA 1AKSA 3H7TA 1V2VT 1YPJH 2JETB 1NC6A 2BLWA 3DA9B 1UVOA 1UTQA 1GI4A 2W5EA 2AH4X 3KGPA 1HBTH 1ZTKA 1P2JA 1CHOF 1SQOA 5A8ZA 1J8AA 3RMLH 2GCHG 1O2PA 2WPIS 4BNRA 1AI8H 1FAXA 1AMHA 1T4VH 3RU4T 1OWHA 1EASA 4TPIZ 4GPGA 2Q6GA 3M36A 1WUNH 3BEIB 3M3TA 3F1SB 2B5TB 1C2KA 2WYGA 3UNRA 1TBQH 1SFIA 3K2UA 2BD5A 1NY22 4XOJA 4B2AA 2BD3A 1MKWH 2GZ9A 2ODQA 1HIAA 1W12U 7KMEH 1QQ4A 1TMBH 3EA9A 3TH2H 2M5TA 2FWWA 3SHCH 1GCTB 1SGTA 2HGTH 4HGCA 1MAXA 3MNXA 4Q7XA 1WQVH 2OC0A 2LNCA 2R2MB 4I8HA 1F5RA 3UQVA 3F68H 4MNYA 1S84A 2IOTA 2BDYA 1QY6A 2WPKS 2PW8H 5EW1H 3MFJA 5DP5A 1C2FA 3P6ZB 4KGAA 4IC6A 2RA0A 2UUFB 1GDQA 4K69A 1JIRA 4FUEA 1H9LB 1A5IA 1EOLA 1WYKA 3KN2A 3VB7A 1K1JA 3GY4A 1BOQA 4DT7B 2PV9B 3SGQE 3A85A 3R3GB 2FX6A 1ZHRA 1YPKH 1GVLA 4LZ4B 3KQEA 1DICA 1SGDE 3HKIB 4OS1A 1P9SA 2F3CE 2F9VA 2ZHFH 1UK2A 1GL1A 1O3PB 3ZZBA 4NFEA 4YT7H 1TAWA 2P95A 1DY9A 2Z3DA 5HXFA 1UVPA 1EAUA 4B76A 1CHOG 3K6ZA 3RMNH 3QTOH 2VH0A 1UVTH 2ZZUH 3RM0H 2HNTC 2VIWA 5EPNA 3PLKA 3HPTB 2FOCA 1FPHH 1PJPA 2OD3B 1O32A 1HJAC 3FZZA 1V2WT 3MH7A 4YOIA 3BG4C 5AFZH 2FIRH 4AFZA 1XUGA 3JZ2B 3UREA 1HAPH 3EA7A 1TNJA 3AAUA 2AGEX 2BDAA 3UNSA 4X8TH 5EODA 1VITH 3S0NA 4O03A 1YF4A 2FOEA 1QA0A 1UJ1A 3HGNA 1BZXE 1VCPA 3UWJH 1PQAA 1VJ9U 4J1YA 4OS6A 1GI6A 1A0HB 2ZGHA 1QNJA 1K1NA 3DT0H 2PKSB 3SNAA 2V0BA 2DE9A 1AIXH 2PSXA 4BTIB 1VZQH 2J4IA 2GD4B 1TNLA 3MNSA 5A8YA 1BMLA 3AW1A 1NRRH 1C5SA 2Z9GA 4Y8YA 3RDZA 1YCPK 2BY9X 2QF3A 2H6MA 1A2CH 3U98H
chains in the Genus database with same CATH superfamily
1O2XA 3GOVB 1O2ZA 2WV4A 4U32A 2JKHA 3WWFA 4MVNA 6ESTA 5C67A 2CHAC 1F0SA 5DN6D 5L6NH 4XBBA 1A4WH 1ZMLA 2ZDAH 3A8DA 3RXGA 2ZDKA 1MMJN 3UIRA 1V6DA 2HWLB 3RXIA 1MKXH 1G36A 3BF6H 2IJD1 1A5GH 2QY0B 4ISHH 5CE1A 1FNIA 2XBVA 1KXBA 1ELDE 3VB6A 2L6OA 2H9EH 3FZDA 4FU8A 1VGCB 1TOCB 2FM2A 1A46H 1QIXB 2BMGB 1P03A 4M7GA 5FCKA 3A88A 1YLNA 4UD9H 4B74A 3PLBA 2VIVA 3WW7A 1YPGH 1U6QA 4I33A 1O2QA 2FEQH 4CREA 3CS0A 1HAIH 1UTOA 2LP6A 8KME2 1M9UA 5KEDA 3A83A 3E16B 1GHBF 1IQKA 1N6YA 1B7XB 3FN8A 3KHVA 4FVBA 2BTCE 3LPRA 3MWIU 1BCUH 4ABEA 2O8LA 2GT8A 3ZV9A 1IQJA 4ISNA 2W26A 2QAAA 4VGCB 1KXFA 1MU6B 3RMMH 1BJVA 4HG6A 5C20A 1TB6H 1UTMA 4IGDA 4AB8A 3NCLA 3LDXH 1DS2E 1EUFA 3I78A 1C1SA 3LKWA 5T6GA 3RUOA 1H8DH 2JH6D 2VWMA 2P8OB 3S69A 3F3BA 5C5OA 3C27B 2ZFQH 1BHXF 4ZXXH 2PUXB 5AFYH 3F2FA 2PLXA 4MNXA 1ELEE 5DP4A 2RG3A 3AASA 3NZIA 2WZQA 2XWBI 2Z6BD 1XUJA 3B8JA 3SUGA 1BRUP 4JZ1A 4YO9A 2GTBA 3SI3H 2RFKC 1BT7A 1QR3E 3SV6A 3KEEA 3LONA 1JRTA 1OXGA 1P2NA 2G81E 3BTHE 5JPMH 3VEQB 1V2JT 1C5UA 3MH6A 4MTBA 1MTSA 1F7ZA 3O8DA 1TYNA 2GCTC 1GI9B 3LGUA 2GDDA 4THNH 5EQRA 3U8OH 7ESTE 2Y80A 1W10U 1DT2A 1IHSH 2FOHA 1ELGA 4SGBE 1NROH 1WU1A 3F2HA 3MO9A 1O2OA 1WBGB 3O8BA 3U1JB 4K1EA 3NUMA 3RU4D 1D6WA 3LGWA 4GAWA 1JMOH 4Y7AA 5B6OA 1S83A 4JK5A 2CMYA 4RKOB 4Q2KA 2ZDVH 5E8EH 1GBCA 2CN0H 2NWNA 1HIAB 1W8BH 4Y6DA 3ITIA 1O3AA 2AS9A 3SUFA 2TBSA 1QB1A 2BOKA 2KAIB 1ZRKA 3D49H 1YPHC 3MMGA 1TNGA 3QX5H 1S5SA 1YCPM 1BRAA 2OP9A 3UB0A 1QJ1B 3F9FA 3BIVH 4O3TA 3NWUA 1TGBA 2EY4C 4DJZB 2ZIQH 4HZHA 7GCHF 1O37A 2ANWA 1SLWB 1NM6A 1O33A 1C5OH 1MD8A 1YCPH 3HATH 3IWMA 1BBRK 1TGSZ 3A80A 3K9XB 1HXEH 2OTVA 1GGDC 2ZCLP 4FUFA 1O5AB 2BQWB 2QXIA 1DWDH 1O3FA 1YBWA 2TIOA 1IQIA 4MPXA 4TY6A 3AK5A 2NU1E 1AD8H 1F92A 1YC0A 4CRCA 2HALA 1GI7B 2Y5FA 1F2SE 5E0HA 3E8LA 1H8ED 1O2HA 1CA0B 1PFXC 1GBAA 4CH2B 1P57B 1DUEA 2ZI2H 2WPDD 1X7AC 2BX3A 3M37A 3NRLA 4UFFH 4X2YA 1C5TA 4Y76A 2FTMA 1EAXA 1Q2WA 4NGAH 1ELAA 2BQ6B 1P3EA 2VIDA 3SGAE 5LGOA 1DE7H 4XRNA 5HM2A 1C2DA 4GCHF 3V7TA 1P04A 1CGJE 3VXEH 4NZLA 1GBJA 2WV5A 2PHBA 2QXGA 4JCNA 1C5VA 1G3CA 2FOBA 1S0QA 1B0FA 1MZDA 3RC6A 1TX8A 1C1PA 1K28D 1HCGA 2GJGA 2THFB 2C8XB 4X1NU 4NG9H 2G8TA 2A5KA 1K2I1 1HFDA 4X2XA 1KDQB 5FBIA 3FANA 3GYMA 4BAKB 2XXLA 2GMTB 3KF2A 2P16A 1BTZA 3LIWA 1OWDA 1JBUH 4ABAA 2F83A 3RM2H 3U28C 2OCVB 3F0OA 5IK2D 5TJXA 4BXSA 4YZUA 5T6FA 1E38B 3LGIA 5DKMA 1N1LA 3TNTA 1L1GA 7GCHG 1NBME 3GICB 1DFPA 2BZ6H 2NU4E 3N7DA 3UOUA 6CHAB 4FOUC 4Z1MD 2W3KA 1C4V2 2G52A 1AZZA 1K1MA 2P94A 4WJG2 2BLQA 1UK3A 4Y8ZA 2BY6X 3PWCA 1O35A 3KQCA 2PWXA 1TQ7B 5ABWA 5JB9S 1CT4E 6LPRA 5EOKA 2ZGXH 1T7CA 3QZQA 5HIZA 4YESB 2HVXA 2ZU4A 3V12A 3LGVA 3MU1A 2ZTZA 1LTOA 1XM1A 4AZ2B 2OQUA 4WMFA 1XVOA 1W0ZU 2CGAA 1YPEH 4ABJA 5DSFA 3DFJA 1THPB 4B6EA 3BEFB 4X6OA 1GBEA 1P02A 1QGFA 4K60A 3ENSB 1GI1A 1SGNE 4HTCH 3MU4A 4UEHH 1A0LA 1H9IE 2OXSA 4Y0YE 1ZGVA 1SGPE 1AB9C 1GJAB 1SI5H 3LC3A 3LJJA 1CGIE 4GCHG 1FIWA 2TRMA 1ZPBA 3A8BA 1O5EH 3GCNA 1DDJA 1O3HA 1AZ8A 1PQ5A 4XE4A 2HPQH 5JBTA 4AGKA 1SVPA 1BRCE 3PWBA 1AWFH 1W11U 2ZHWH 3STIA 1GG6B 3TGJE 1GMDF 4ASUD 3GY3A 3GYLB 1GBMA 1ANCA 3U8RH 4U01A 5DP7A 1O2RA 2A2QH 2QXJA 1P09A 3UOPA 3PM3A 1QRZA 1O3LA 1GI8B 3CS7A 1P11E 2R2WU 1NZQH 1P9UA 1O2IA 1QA7A 5AHGH 1D9IA 5LPRA 1DXWA 1PPBH 3ODDA 1OWIA 2CJIA 2W7UA 5A0BA 1Y3UA 3FP6E 1EPTA 2AFQB 3T29A 4E06H 2QA9E 2J97A 3RXUA 1MD7A 1FZZA 1O2YA 1J17T 1J9CH 1QB9A 3GCTF 2OINA 3H5CB 2SGEE 1Z8GA 5F8TA 1BB0B 2FX4A 2XOKD 5TCCA 3ELAH 3Q77A 4ZKOU 1V2NT 4H6SB 1GHZA 4IC5A 2WHXA 1SB1H 2ZFFH 5FPTA 1CSOE 1P8VC 1C1TA 1UTJA 1XMNB 1O3NA 1TBZH 2G5NA 4X8SH 1YPLH 3T26A 1C5PA 1K21H 5EIYA 3BTQE 2HNTF 1E0FD 1T32A 4UFEH 2VVUA 1V2KT 1UVUH 9LPRA 1QBOA 2BDCA 1A61H 2BVRH 3OEED 2P3FH 1AN1E 3RXHA 3BIUH 3EYDA 4CHAC 1NS3A 3Q76A 2W6ID 3QWCH 3TIUA 1O2UA 3RXTA 3QUMP 4UONA 1Y5BT 1T8LA 3SV9A 3OY6U 1QFKH 4DT4A 3U69H 3RXOA 3LGYA 1IQFA 2FS9A 1HAXB 5DO4H 1GHAF 3KIDU 4I32A 5C94A 2BDHA 1HRTH 5F53A 1GCDA 3ESTA 1O3JA 2AYWA 5EJ1A 3RXCA 4B6FA 1GI2A 3F6UH 1GJDB 2WPJS 1NRNH 1W13U 4KKDA 1GMDG 1GWAA 2J95A 3E90B 5FX5A 2Z3CA 5GDSH 4F4OC 1TA2A 1QJ6B 1SLXB 5DP6A 2BLOA 2WV9A 2BQ7B 1NN6A 3DFLA 1DOJA 2A7HA 3SORA 3LH1A 1HGTH 1B0EA 1SFQB 5GXPA 3VGCB 2Q6FA 2ASUB 3RLYH 2HOBA 2A4OA 1CA8B 3SHAH 4Y11E 3UTUH 3RC4A 1YLDA 1ZPCA 1SGYE 3M5NA 1XXFA 5C0TA 8LPRA 3B9FH 3GCTG 1L1NA 1W14U 1AVXA 2W6JD 2XCFA 4MLFB 4OGYA 1AUJA 2KAIA 4LK4A 1C5NH 1SKYE 1AVWA 1TA6A 3EQ0H 3MQKC 1G2MA 3I77A 3PO1C 3WY8A 2ZFRH 3RXPA 3P95A 2GV6A 4Z6AH 3UR6A 4AORA 1QCPA 2ILNA 1O5GH 5ESTE 3MH4A 3TGKE 1XVMA 1HNEE 2BHGA 4WF8A 2O8UA 3PV5A 3TITA 1SGQE 4ISLA 4ZHAA 1JRSA 1FXYA 4K5ZA 1SR5C 1ABIH 2FOMB 3T28A 3LT3A 3TU7H 1NFXA 1V2LT 2FDAA 2UUYA 4AB9A 1NRSH 3A86A 1LQEA 1ZTJA 1P0SH 2A4RA 2B7DH 1GJ7B 2C4FH 1AUTC 2QIQA 1GJBB 3DSOA 2ODYB 1ANDA 2AMDA 1GHAG 1GBKA 2JETC 1EB1H 1EXFA 2FOGA 5L2YH 4M9FA 4A1VA 2A31A 1W0JD 1YGCH 2R3UA 2ZO3H 2GGVB 5EXNA 3Q3YA 4FUHA 1IHTH 1WTHD 4IBLH 3SNDA 2R3YA 2ZF0H 1EOJA 2CHAB 1YKTA 2FYRA 5A2MH 1T8NA 1FAKH 3GY6A 5A0AE 1ANEA 2BVXH 1TFXA 4FUJA 1O5FH 2J9NA 3KCGH 1FQ3A 2FI3E 2BD2A 1C9TA 2FXRA 3QGJA 1AFQB 4WY3A 4I86A 3QK1A 4ZKNU 1QBNA 1OWKA 2ZECA 1IAUA 3ATLA 4I8GA 1KLJH 2VJ1A 1ZR0A 2F43B 4GVUA 1K9OE 2ZA5A 4WWYA 1Z1JA 1BTPA 2V7QD 3MNBA 4NWLA 1KDQA 3JZ1B 1GBIA 1RTLA 1MQ6A 2W7SA 2BDBA 2BOHB 1YP9A 1GCTC 1W7XH 2QN5T 4SGAE 4B2BA 1NRPH 2J92A 1HYLA 1TX7A 4FUCA 3FP7E 1QHRB 4IMZA 4NA9H 3U1IB 2ZDNA 3RXLA 4ABDA 1OWJA 1C2MA 5FBEA 1UHBA 1DWCH 1V2PT 4CRFA 1BTXA 4ZHMU 3SU5A 1V2QT 1Y59T 4QT8C 5GPIB 1NBMD 4Q63A 3UWIA 3SU2A 2VGCB 2A45B 1JWTA 1UTLM 1NFYA 2HLDD 2BXUH 1OP0A 2Q6DA 1DITH 3RXKA 2IJOB 3ATIA 4E7RG 1C4U2 1NTPA 4MPVA 1ACBE 1P3CA 1RD3B 1C1OA 2KM0A 4WVPE 1LVOA 4AG1A 3DD2H 1KXDA 1OOKB 5F8XA 3G01A 2OQ5A 4AC9A 1GBTA 1K1IA 4X6PA 2BD7A 4XD7D 2KCPA 5CHAB 1GJCB 2KCAA 2SNWA 4CH8B 1V2MT 1OX1A 4YOJA 1FMGA 3SN8A 1KLIH 2XTTB 3BTFE 4E05H 5PTPA 1Z8RA 1FDPA 3PRDA 2QCYA 3O8CA 4X1RU 3NK8A 4FVDA 2HRVA 2A32A 3UNQA 1XUKA 1UCYK 2NU2E 2BX4A 1HAYB 3KQBA 1E34B 1TRYA 2XYAA 1TIOA 3SZNA 3QLPH 1EPTB 1GMCF 1V2OT 4FUDA 1K1PA 1MTNB 3KQ5A 4HFPB 2Z94A 3KL6A 1G30B 4ABHA 3GY7A 1MTWA 4ZKSU 3OSYA 1IQNA 2OC8A 1OYQA 1FV9A 5FPYA 1SMFE 2ANYA 2F9OA 2Y5GA 1C2HA 1MBMA 3FO8D 1H8IH 1HAZB 5C1UA 2A0QB 3MO3A 1WDIA 3W94A 1E37B 1KMHB 1PPZA 4OS7A 1QL9A 3EDXB 2ALVA 3D23A 3EE0B 4I8JA 2PKSC 3SV8A 1WQSA 1ESAA 4WXIA 1RIWB 1WCZA 1LHCH 1O2GH 4ACAA 3NPSA 3FAOA 1S0RA 1Z6EA 1QZ8A 2VNTA 2AGIX 1E35B 3MU5A 5AVDA 4B75A 2LELA 1O3BA 2ANKH 1FIZA 2BDIA 3ZVCA 2ZHEH 1K1OA 3ATMA 1FY5A 1O5CB 3M7QA 1P2IA 4O3UA 3RXVA 1XUHA 1O38A 1SGIB 1TWXB 3F0PA 3LOXA 4DG4A 1V2ST 3S9CA 2BD9A 3W1EA 1BTWA 3TK9A 3BG8A 3GISB 4RKJB 4F48B 4ABGA 2Y82A 4ESTE 1V2UT 2V3MA 1DY8A 2O9QA 1GBBA 1L2EA 2ZU1A 4BAMB 1ZPZA 2W3IA 2GX4A 1W2KH 1P2KA 2GDEH 3LH3A 4O97A 5E0JA 1EKBB 3P8GA 1KTTB 1E79D 1XKAC 1ESTA 1ELTA 1Z8IB 1W0KD 2EEKA 3SU1A 1GBHA 3URCA 1VGCC 3L33A 4AYYB 1HAHH 4YXWD 2DE8A 1SHHB 1GI5A 4X6MA 3SNBA 1EJNA 4KP0A 3RXSA 2C8ZB 1GMCG 4Y10E 5AF9H 4DOQA 1GHBG 2P59A 3M61U 4GHQA 4NIWA 2YMSB 1NFUA 4FUGA 1BTUA 1OPHB 3ATWA 2BDGA 1H1BA 1LPGB 2FLBH 3L3TA 4K8BA 2CF9H 4LZ1H 4VGCC 2XBXA 1G2LA 3MU0A 2QE7D 3L6PA 5FXLA 3IG6B 3PMBB 5FPSA 2F9UA 3ZYEA 2C8WB 1LVBA 3P92A 3SI4H 3PMAB 2SGFE 1O2LA 5GJ4B 2IPQX 3BV9B 3F9HA 1DM4B 3GCHB 4ABBA 4NZQA 1S81A 4A1TA 5K0HA 1FN6A 1A5HA 3ZZAA 1TBRH 2G4UA 4KELA 1MCTA 1N8OB 1TRNA 1WXRA 2F9PA 2XBWA 4MDSA 4B2CA 4CRBA 2BY5X 1C1NA 1TGTA 3GDVA 3EE7A 2FMJA 1C1MA 2J38A 1E36B 2FODA 4NWKA 4ZUHA 1KY9A 1MUEB 5DG6A 1OP8A 1PPCE 1UCYH 3SJIA 5DP9A 3P70B 5CHBA 2D8WA 3URDA 3V3MA 3SJ8A 1D3PB 4CR5A 1FUJA 3PMHB 1CBWB 2ZTYA 1GI3A 3F9GA 4GUXA 4FUIA 1ZTLA 5C2ZA 1A0JA 2YNAA 3OU0A 4INHA 1BMNH 3ZVDA 1ZSJA 3Q3KA 2QXHA 2O8MA 1ARBA 5DJ7A 2KCYA 1O2VA 5EPYA 5HKKD 2BYAX 2FTLE 2PKAA 2ZDMA 2OUAA 1AB9B 1VJAU 3E1XB 5BPEA 3DHKH 3A7WA 1O3KA 3A7XA 3S7KB 1MU8B 2C3SA 1LHFH 3AW0A 2PTCE 3SGBE 3A8CA 1VCQA 2ALPA 4IN2A 5GCHF 5HGGA 1T4UH 1UHBB 2FOFA 1O2SA 3UQOA 4MNVA 3ZIAD 1CT0E 3SW2B 3SUDA 1GVKB 3OX7U 2F91A 2V35A 2JH5D 1V2RT 5DGJA 3D62A 5EGMA 1J16A 2J34A 1SPJA 4XSKU 4XFQA 4X8UH 4NIVA 4D7GA 4MPUA 2KR7A 2FO9A 4WXVA 3GY8A 2ZU2A 2JJ1D 2VWOA 2A4QA 4YLUA 1ZGIA 3BTKE 2ZU3A 2Z7FE 3W95A 1O0DH 1D6RA 2EI7A 2P93A 4JYTA 3P17H 2H1UA 1KXEA 1KIGH 2GVFA 2F4LA 4U2WA 1NO9H 2PR3A 3PTBA 1NPMA 2HPPH 1TX6A 1MKWK 3DCLA 4TSFD 5LH8A 4DIIH 1F0RA 3TJUA 3SQHE 2D26C 4Q80A 1CU1A 3RP2A 5JBCS 4D9RA 1P2QA 2WPLS 1E1QD 1ZJKA 2J98B 2TPIZ 3R0FA 1ZYOA 4ABFA 1IQGA 3NKKA 1V3XA 1GDNA 3GDUA 5H4IB 1HAGE 2A1DB 4YT6H 1C2JA 1W7GH 1PQ8A 8GCHF 2QGRA 1BRBE 2H2ZA 1UTKA 2ZG0H 1S6LA 5ETXA 3SV7A 1QQUA 3TPIZ 2WPHS 4X0WU 3UR9A 2TGAA 1RXPA 3RMOH 2OLGA 1O2JA 1G9IE 3A7ZA 2GMTC 2H9TH 1KLTA 1BBRH 1TONA 1F5KU 3PTNA 1P12E 1SQAA 5G4BA 2EA3A 3PLPA 1HLTH 2FI4E 4UE7H 2B8OH 2BZAA 2DUCA 3LU9B 2F9BH 3VFEA 5GCHG 1YYY1 4FU7A 2Z9IA 3MOCA 3E91A 1W0YH 5TCAA 1AU8A 1ZMJA 6CHAC 1THSH 5B6LA 1A7SA 1DANH 5HMAA 4DURA 1SC8U 3M5MA 3OE7D 3H7OA 1GJ6A 4NSYA 1VCWA 2ZPRA 1TQ0B 1UK4A 2VWLA 1C9PA 3ZZ7A 1OYTH 4K2YA 5C1XA 1H9HE 3SZEA 1FPCH 4ASHA 4ZKRU 4B71A 1FN8A 4BAHB 3ZZCA 4OS5A 3SV2H 1F5LA 1GI0A 1TOMH 1TNHA 3T27A 3BTDE 1WAYB 1D3TB 1THRH 1LVYA 3MYWA 2ZFTA 1L1JA 3Q3XA 4RT0A 2XCNA 5GIBA 1Y3WA 1AGJA 2V6NA 3SYJA 3BTGE 1S6FA 3SU4A 3VPKA 3CENA 4D8NA 4BOHA 5JB8S 3A7VA 1UW7A 3MO6A 4OGXA 2F9NA 1HJ9A 2SGAA 2BY7X 1LCYA 2J2UA 3EGKH 5C5NA 1SL3A 2ZKSA 1EP6A 5IYTA 1ZJDA 4JYVH 3A89A 4AX9H 3AVZA 1K0HA 1O2NA 4BAQB 2STAE 1O3OA 1WOFA 3FP8E 8GCHG 4BXWA 1AY6H 1O5BB 1TPSA 1SGCA 1DVAH 1E1RD 1GG6C 4DCDA 2Z3EA 4BANB 1ELCA 3MU8A 3OTPA 1ZLRA 2ZCKP 5KGOA 4RSPA 2VVCA 3U8TH 3ZV8A 4A92A 3WWBA 4DW2U 2ZEBA 1K1LA 2XC4A 1C1UH 3BN9A 2AMPA 2M2AA 5GNDA 1NU9A 4JZFH 7LPRA 1CT2E 1BJUA 5SGAE 1BUIA 4X1QU 4X1SU 1TPAE 1Y5UT 2IPHA 2Q1JA 4D76A 2GZ8A 1C5XB 4RT1A 4UFGH 1GBLA 1PPEE 4AFQA 1MTVA 3TH3H 1FY3A 1UMAH 4Y0ZE 3FFGA 1GHVH 4FUBA 1ESBA 1YPHE 2Y7ZA 4OS2A 3ZVFA 1P2OA 1HJAB 1MKXK 3M5LA 2XW9A 2FP7B 4B1TA 1HPGA 3BG4B 4AFUA 1BITA 2GP9B 2P3TB 1EZXC 1LO6A 3KNXA 2A5AA 2BB4A 5I46H 1BDAA 1IQMA 5EJZA 2V3OH 5C17A 2A4GA 4ZAEA 2EI6A 3SU0A 2PSYA 1DLEA 2ZDLA 1SG8B 5J4SA 4GLYA 3RXQA 1TGNA 1SSXA 2J5UA 1UTNA 1G3EA 1O3DA 2C93B 1WTGH 1ELVA 4Y71A 1FONA 4NA8A 2K8IA 1T31A 1BTYA 3ZVEA 1O31A 1TABE 3T5FH 4OM9A 3DSGA 5HM9A 4I31A 1HAVA 2SGQE 1TRMA 4AFSA 2ZHQH 1F0TA 1O5DH 1HJ8A 1EB2A 2JH0D 2PKAB 4IN1A 5FL7D 3ZZ8A 3TH4H 2K1QA 3E0PB 2ZGBH 3FKSD 2QV1A 1C5QA 4AGJA 4A7IB 3A8AA 3GDSA 4AOQA 1MH0A 2BD4A 4MNWA 3VB4A 6GCHF 2ZQ1A 3ZYDA 4JK6A 1T8OA 1LVMA 1SGFG 1P05A 1OKXA 1OS8A 1FJSA 5A09A 3M3SA 2LPRA 2CK3D 1O30A 1BMMH 3M5OA 2TGDA 3M7TA 3MHWU 1ETTH 3A7YA 1IOEA 1Y3VA 1IQLA 2I6SA 1EAIA 1H4WA 4KTCA 2VINA 1J14A 2AMQA 1NU7B 3TNSA 3VGCC 1HDTH 4UFDH 4IW4E 4PROA 2D2DA 4WH6A 5T6DA 4TPYA 1EP5A 4H4FA 3E6PH 1DSTA 1RGQA 2BVSH 2I6QA 1ZSKA 4BTTB 2Z9LA 2G00A 2FOAA 4E7NA 1B5GH 4ZROA 4FU9A 1D3DB 1EQ9A 5F6MA 4WMEA 1VR1H 4CBNA 4IS5A 1C5YB 1FX0B 1G3DA 3S9BA 1SGEE 4X8VH 1JIMA 4Y8XA 1ZSLA 1TPOA 4Q7YA 1BMAA 1GVZA 2UWPA 3ZZ4A 1G37A 1SLVB 2A7CA 4GSOA 4KTSA 3UAIC 2ANMH 4JMYA 2SGDE 3H09A 2AGGX 1H8HD 3LC5A 4NFFA 1W3CA 1NT1A 3RXMA 2G5VA 3SQEE 3LJOA 4DVAU 3SUEA 5E2OA 5JBAS 2ZCHP 4GHTA 2AIQA 1AFEH 1P2MA 2C8YB 2O8TA 1SLUB 1ZMNA 1C5MD 1LDTT 1QL8A 2SNVA 2K0QA 3U9AH 1P06A 3C1KA 3ZVGA 3ZZ5A 4DY7B 4CRDA 1K22H 4CRAA 2AHME 6GCHG 1FY4A 3RXDA 3TGIE 1CQQA 4P02A 4YLQH 1C4Y2 2FLRH 3OY5U 3QGNB 4ZHLU 3A84A 5DP3A 2UUKB 1ABJH 1FY1A 1BTHH 1FI8A 2GCTB 3E3TA 1VITF 1S85A 2AIPA 2P3UB 5HYOA 1EJMA 1COWD 1ORFA 3FVFB 2J98A 4J2YB 1AFQC 4I8KA 4D7FA 9ESTA 3RXEA 4JYUH 3OEHD 2ZP0H 1HXFH 1AQ7A 1A3EH 1TE0A 5JDUB 2WPMS 3UUZA 1DX5M 1G32B 2VIPA 5C3NA 1KSNA 2JIZD 5BRRE 2ZPSA 4NIXA 3Q00A 3RC5A 3HKJB 2FPZA 2XRCA 3EAJA 5DK1A 3K65B 1L4DA 3SU3A 3T2NA 2Y6TA 2ZU5A 4D9QA 1P10A 5FCRA 4I7YH 2ESTE 2PGQB 1KXAA 5FAHA 1TNKA 1ELFA 3BSQA 1Y3XA 1YY3A 2BD8A 2HLCA 1Y8TA 2VIOA 3BTTE 4A1XA 1O3IA 2VGCC 1SHYA 5IDKA 2Y81A 1ARCA 2YOLA 2XWAA 3VB3A 3TK5A 4MPWA 3SO3A 1GGDB 3BEUA 3N99A 5ESBA 3TJNA 4AYVB 2ZGJA 4B73A 3PV4A 2VVVA 1QURH 1O2KA 1C1QA 4YM9A 2VB0A 1UCYE 5CHAC 4ZXYH 1SQRA 1GHYH 1BA8B 1J15A 2WINI 3EA8A 4XBCA 2WUCA 3PMJA 2R0KA 3QZRA 3DSPA 1O3MA 2VH6A 3SOSA 2B0FA 5LPFA 4NCYA 1AKSB 1FLEE 1PYTC 1QBVH 1MCVA 1QRWA 1LMWB 2V3HH 3B23B 3QO6A 3STJA 1AVGH 4NSVA 2J94A 3HK6B 3VG8A 1MZAA 4HI3A 1BHXB 1RTFB 1VITG 3MI4A 5LPEA 1PYTD 1EPTC 1MABB 2VU8E 1PPFE 1MTNC 3AAVA 5EQQA 1Q31A 2TGPZ 5A0CA 1CO7E 3GY2A 5FX6A 3SU6A 3M7UA 1EJAA 2TGTA 3HGPA 1WV7H 3ZVBA 1SOTA 4OS4A 3A81A 2KZ4A 4R8TB 2QYIA 3I29A 3SBKA 2STBE 5EJLA 4K8YA 1C1WH 1PQ7A 1QB6A 1ETRH 2OBOA 1ANBA 3M3VA 8ESTE 1C5RA 4I8LA 2ZFSA 1O39A 1GMHF 2P8OC 2XNIA 1ZHPA 5C1YA 2Z9KA 3ZZDA 3S7HB 2SFAA 1C2IA 1RIWC 4BTUB 5C0UA 4WMDA 2ZGCA 1LHEH 1XUIA 2WSSD 1LQDB 1L4ZA 2OC1A 1DWEH 1HAVB 1KYNA 2RA3A 2UWLA 1ELBA 3SNEA 1LKBA 3PROA 3TVJB 4H6TA 2NU0E 1HV7A 3CP7A 5A8XA 1OHHD 3VXFH 2ZWLH 2BLVA 3N7EA 3V13A 1DPOA 4XDEA 1UO6A 2A2XH 1XKBC 1GJ8B 3BTEE 5EXLA 4X6NA 3VB5A 1EFRD 4RI0A 1AWHB 1Y3YA 3NXPA 5L30H 1Z1IA 1YLCA 3P8FA 1QL7A 4ACBA 1D4PB 1ZZZA 1SGFA 2CXVA 3M35A 1MBQA 4K1TA 3UFAA 4TWWA 5E2PA 4DGJA 2AERH 3TJVA 2Y5HA 2KX4A 1XX9A 3ZZ9A 3ATKA 1GJ4H 4INKA 1SBWA 2IN2A 3QDZB 1HAOH 1O3EA 1C1VH 1O2WA 5DP8A 2GT7A 2Z9JA 5L2ZH 2HVYB 4TWYA 3CNRA 5EG4A 1Y5AT 2D1JA 1RTKA 1SGRE 2C90B 1RJXB 1D3QB 5CMXH 3HK3B 3UPEA 2YMSC 2QF4A 5GWZA 3QN7A 2ULLA 1MAYA 2HNTE 1BBRE 1GBDA 5CDFE 4H42U 1JOUB 3GCOA 1N6XA 1GJ5H 3OYPA 1JXPA 4NA7A 3A7TA 3P8NA 1TMUH 1F0UA 2PTNA 2OBQA 3QTVH 1TMTH 3T25A 2YMSD 4R0IA 4K3JA 3BTWE 2XC5A 1GHXH 4Z0KA 3MNCA 5F8ZA 1V2TT 1GMHG 4ABIA 3SJ9A 1YPMH 3F2GA 1O3GA 3ODFA 1CVWH 3SJOA 1EX3A 1KTSB 3RXRA 1CGHA 2VWNA 1DLKB 1HB0B 4YOGA 3RXAA 2ZQ2A 3GCHC 5HIYA 2BXTH 1S6HA 1EAWA 2PUQH 2VIQA 4K1SA 4ZMAH 2ODPA 4IMQA 1N8OC 2PFEA 1A1RA 4CRGA 2H9HA 2H5DA 1DSUA 5EQSA 3RXJA 4P00A 1FY8E 1C5ZB 4A6LA 1Q3XA 5FHTA 1C2EA 1RS0A 2GKVE 4BAOB 2FESH 1MTUA 4U30A 2CF8H 1CA0C 2JDID 4WH8A 4MQAA 5J4QA 1C5WB 1O2TA 3MTYA 2WUBA 1DUAA 3K6YA 1GJ9B 2A7JA 3DUXH 2A5IA 2GZ7A 1QRXA 2QC2A 2AEIH 3ZZ3A 4NIYA 3OAAD 1XXDA 1DXPA 4TY7A 2GV7A 4ZH8A 4AG2A 1CBWC 2EC9H 3KYGA 3RXBA 2RDLA 2VBCA 5DPAA 1ID5H 3GY5A 1T8MA 2EI8A 1AE5A 3D65E 3N7OA 1HUTH 3PB1E 4JZEH 1AE8H 2Y7XA 1VKYA 3A82A 4LXBH 3S9AA 1ETSH 1QJ7B 1Z71A 1GL0E 1NESE 2G51A 4CHAB 1C5LH 1L0ZA 2EQNA 2WYJA 1LPKB 1SQTA 1O36A 2O8WA 1UVSH 1NRQH 1YM0A 1ZOMA 1LHDH 2NU3E 3SNCA 2ZHDA 3ZZ6A 1AO5A 1TNIA 2ZPQA 1EZSC 4A5TS 4JZDH 1O34A 3TK6A 4O9VA 5EU8A 3ZVAA 4ISOA 3V0XA 4FXGH 1S82A 1INCA 2UUJB 2BM2A 2FS8A 1LHGH 1GHWH 4X1PU 2GCHF 4DIHH 1ZHMA 3T62A 1OP2A 5EW2H 1C2GA 2R0LA 3P8OA 4Y79A 3SJKA 2OC7A 2BY8X 1OWEA 1LKAA 1IQHA 1GBFA 4Q4LA 1DWBH 1C2LA 3A87A 2ZTXA 5E0GA 1P01A 2FI5E 1EZQA 3TJOA 1C1RA 3MH5A 4JZIA 1RFNA 2FZZA 4RN6A 1Z7KA 5I25A 4ISIH 1XUFA 1Z6JH 4KTUA 2B9LA 5F03A 1LPZB 1OSSA 4ZCNA 3PV2A 1ZRBA 3TLOA 4LOYH 2G55A 3LGTA 1SOZA 4F55A 3E0NB 1QTFA 4UDWH 2QF0A 2QF5A 3KQDA 4X2WA 2SGPE 2XBYA 1CE5A 4CR9A 5EXMA 1UTPA 2UWOA 2CV3A 1BMFD 3BTME 3RXFA 1AHTH 2PP6A 4X2VA 1KXCA 4MG3A 2XC0A 3PO1B 4Q7ZA 5T1VA 4TYDA 3PYHA 2G4TA 5JYIA 1Z8JB 2PGBB 4INLA 1O3CA 4AN7A 1TLDA 5KECA 1IQEA 1NFWA 1PPGE 1PPHE 3RLWH 1TGCA 2H5CA 2ZFPH 1GPZA 2ZNKH 4F49A 3RU4E 1EATA 2RCEA 2ZC9H 1GDUA 3IITA 2R9PA 3O8RA 3F9EA 1O2MA 2YNBA 4YTAA 5K7RA 1WSSH 1RRKA 4Y7BA 1A3BH 4XBDA 1BQYA 1G3BA 1MQ5A 1BIOA 3OTJE 1EZUC 5T3HA 4CBOA 1TALA 1YWUA 5JBBS 3OFND 2FYQA 1TPPA 3UY9A 1CHGA 1AKSA 3H7TA 1V2VT 1YPJH 2JETB 1NC6A 2BLWA 3DA9B 1UVOA 1UTQA 1GI4A 2W5EA 2AH4X 3KGPA 1HBTH 1ZTKA 1P2JA 1CHOF 1SQOA 5A8ZA 1J8AA 3RMLH 2GCHG 1O2PA 2WPIS 4BNRA 1AI8H 1FAXA 1AMHA 1T4VH 3RU4T 1OWHA 1EASA 4TPIZ 4GPGA 2Q6GA 3M36A 1WUNH 3BEIB 3M3TA 3F1SB 2B5TB 1C2KA 2WYGA 3UNRA 1TBQH 1SFIA 3K2UA 2BD5A 1NY22 3FOAA 4XOJA 4B2AA 2BD3A 1MKWH 2GZ9A 2ODQA 1HIAA 1W12U 4TT3D 7KMEH 1QQ4A 1TMBH 3EA9A 3TH2H 2M5TA 2FWWA 3SHCH 1GCTB 1SGTA 2HGTH 4HGCA 1MAXA 3MNXA 4Q7XA 1WQVH 2OC0A 2LNCA 2R2MB 4I8HA 1F5RA 3UQVA 3F68H 4MNYA 1S84A 2IOTA 2BDYA 1QY6A 2WPKS 2PW8H 5EW1H 3MFJA 5DP5A 1C2FA 3P6ZB 4KGAA 4IC6A 2RA0A 2UUFB 1GDQA 4K69A 1JIRA 4FUEA 1H9LB 2XNDD 1A5IA 1EOLA 1WYKA 3KN2A 2OK5A 3VB7A 1K1JA 3GY4A 1BOQA 4DT7B 2PV9B 3SGQE 3A85A 3R3GB 2FX6A 2KFWA 1ZHRA 1YPKH 1GVLA 4LZ4B 3KQEA 1DICA 1SGDE 3HKIB 4OS1A 3KYFA 1P9SA 2F3CE 2F9VA 2ZHFH 1UK2A 1GL1A 1O3PB 3ZZBA 4NFEA 4YT7H 1TAWA 2P95A 1DY9A 2Z3DA 2RDEA 5HXFA 1UVPA 1EAUA 4B76A 1CHOG 3K6ZA 3RMNH 3QTOH 2VH0A 1UVTH 2ZZUH 3RM0H 2HNTC 2VIWA 5EPNA 3PLKA 3HPTB 2FOCA 1FPHH 1PJPA 2OD3B 2JJ2D 1O32A 1HJAC 3FZZA 3PRBA 1V2WT 4FETA 3MH7A 4YOIA 3BG4C 2KCOA 5AFZH 2FIRH 4AFZA 1XUGA 3JZ2B 3UREA 1HAPH 3EA7A 1TNJA 3AAUA 2AGEX 2BDAA 3UNSA 4X8TH 5EODA 1VITH 3S0NA 4O03A 1YF4A 2FOEA 1QA0A 1UJ1A 3HGNA 1BZXE 1VCPA 3UWJH 1PQAA 1VJ9U 4J1YA 4OS6A 1GI6A 1A0HB 2ZGHA 1QNJA 1K1NA 3DT0H 2PKSB 3SNAA 2V0BA 2DE9A 1AIXH 2PSXA 4BTIB 1VZQH 2J4IA 2GD4B 1TNLA 3MNSA 5A8YA 1BMLA 2L74A 3AW1A 1NRRH 3GS9A 1C5SA 2Z9GA 4Y8YA 3RDZA 1YCPK 2BY9X 2QF3A 2H6MA 1A2CH 3U98H
chains in the Genus database with same CATH topology
1O2XA 3GOVB 1O2ZA 2WV4A 4U32A 2JKHA 4MVNA 6ESTA 5C67A 2CHAC 1F0SA 5L6NH 4XBBA 1A4WH 1ZMLA 2ZDAH 3A8DA 3RXGA 2ZDKA 1MMJN 3UIRA 1V6DA 2HWLB 3RXIA 1MKXH 1G36A 3BF6H 1A5GH 2QY0B 4ISHH 5CE1A 1FNIA 2XBVA 1KXBA 1ELDE 3VB6A 2H9EH 3FZDA 4FU8A 1VGCB 1TOCB 2FM2A 1A46H 1QIXB 2BMGB 1P03A 4M7GA 5FCKA 3A88A 4UD9H 4B74A 3PLBA 2VIVA 1YPGH 1U6QA 4I33A 1O2QA 2FEQH 4CREA 3CS0A 1HAIH 1UTOA 8KME2 1M9UA 3A83A 3E16B 1GHBF 1IQKA 1N6YA 1B7XB 3KHVA 4FVBA 2BTCE 3LPRA 3MWIU 1BCUH 4ABEA 2O8LA 2GT8A 3ZV9A 1IQJA 4ISNA 2W26A 2QAAA 4VGCB 1KXFA 1MU6B 3RMMH 1BJVA 5C20A 1TB6H 1UTMA 4IGDA 4AB8A 3NCLA 3LDXH 1DS2E 1EUFA 3I78A 1C1SA 3LKWA 5T6GA 3RUOA 1H8DH 2JH6D 2VWMA 2P8OB 3S69A 5C5OA 3C27B 2ZFQH 1BHXF 4ZXXH 2PUXB 5AFYH 2PLXA 4MNXA 1ELEE 5DP4A 2RG3A 3AASA 3NZIA 2XWBI 2Z6BD 1XUJA 3B8JA 3SUGA 1BRUP 4JZ1A 4YO9A 2GTBA 3SI3H 1BT7A 1QR3E 3SV6A 3KEEA 3LONA 1JRTA 1OXGA 1P2NA 2G81E 3BTHE 5JPMH 3VEQB 1V2JT 1C5UA 3MH6A 4MTBA 1MTSA 1F7ZA 3O8DA 1TYNA 2GCTC 1GI9B 3LGUA 2GDDA 4THNH 5EQRA 3U8OH 7ESTE 2Y80A 1W10U 1DT2A 1IHSH 2FOHA 1ELGA 4SGBE 1NROH 1WU1A 3MO9A 1O2OA 1WBGB 3O8BA 3U1JB 4K1EA 3NUMA 3RU4D 1D6WA 3LGWA 4GAWA 1JMOH 4Y7AA 5B6OA 1S83A 4JK5A 2CMYA 4RKOB 4Q2KA 2ZDVH 5E8EH 1GBCA 2CN0H 2NWNA 1HIAB 1W8BH 4Y6DA 3ITIA 1O3AA 2AS9A 3SUFA 2TBSA 1QB1A 2BOKA 2KAIB 1ZRKA 3D49H 1YPHC 3MMGA 1TNGA 3QX5H 1S5SA 1YCPM 1BRAA 2OP9A 1QJ1B 3F9FA 3BIVH 4O3TA 3NWUA 1TGBA 4DJZB 2ZIQH 4HZHA 7GCHF 1O37A 2ANWA 1SLWB 1NM6A 1O33A 1C5OH 1MD8A 1YCPH 3HATH 3IWMA 1BBRK 1TGSZ 3A80A 3K9XB 1HXEH 2OTVA 1GGDC 2ZCLP 4FUFA 1O5AB 2BQWB 2QXIA 1DWDH 1O3FA 1YBWA 2TIOA 1IQIA 4MPXA 4TY6A 2NU1E 1AD8H 1F92A 1YC0A 4CRCA 2HALA 1GI7B 2Y5FA 1F2SE 5E0HA 3E8LA 1O2HA 1CA0B 1PFXC 1GBAA 4CH2B 1P57B 1DUEA 2ZI2H 1X7AC 2BX3A 3M37A 4UFFH 4X2YA 1C5TA 4Y76A 2FTMA 1EAXA 1Q2WA 4NGAH 1ELAA 2BQ6B 1P3EA 2VIDA 3SGAE 5LGOA 1DE7H 5HM2A 1C2DA 4GCHF 3V7TA 1P04A 1CGJE 3VXEH 4NZLA 1GBJA 2WV5A 2PHBA 2QXGA 4JCNA 1C5VA 1G3CA 2FOBA 1S0QA 1B0FA 1MZDA 3RC6A 1TX8A 1C1PA 1K28D 1HCGA 2THFB 2C8XB 4X1NU 4NG9H 2G8TA 2A5KA 1K2I1 1HFDA 4X2XA 1KDQB 5FBIA 3FANA 3GYMA 4BAKB 2XXLA 2GMTB 3KF2A 2P16A 1BTZA 3LIWA 1OWDA 1JBUH 4ABAA 2F83A 3RM2H 2OCVB 5TJXA 4BXSA 4YZUA 5T6FA 1E38B 3LGIA 5DKMA 1N1LA 3TNTA 1L1GA 7GCHG 3GICB 1DFPA 2BZ6H 2NU4E 3UOUA 6CHAB 2W3KA 1C4V2 2G52A 1AZZA 1K1MA 2P94A 4WJG2 2BLQA 1UK3A 4Y8ZA 2BY6X 3PWCA 1O35A 3KQCA 2PWXA 1TQ7B 5ABWA 5JB9S 1CT4E 6LPRA 5EOKA 2ZGXH 1T7CA 3QZQA 4YESB 2HVXA 2ZU4A 3V12A 3LGVA 3MU1A 2ZTZA 1LTOA 1XM1A 4AZ2B 2OQUA 4WMFA 1XVOA 1W0ZU 2CGAA 1YPEH 4ABJA 3DFJA 1THPB 3BEFB 4X6OA 1GBEA 1P02A 1QGFA 4K60A 3ENSB 1GI1A 1SGNE 4HTCH 3MU4A 4UEHH 1A0LA 1H9IE 2OXSA 4Y0YE 1ZGVA 1SGPE 1AB9C 1GJAB 1SI5H 3LC3A 3LJJA 1CGIE 4GCHG 1FIWA 2TRMA 1ZPBA 3A8BA 1O5EH 3GCNA 1DDJA 1O3HA 1AZ8A 1PQ5A 4XE4A 2HPQH 5JBTA 4AGKA 1SVPA 1BRCE 3PWBA 1AWFH 1W11U 2ZHWH 3STIA 1GG6B 3TGJE 1GMDF 3GY3A 3GYLB 1GBMA 1ANCA 3U8RH 4U01A 5DP7A 1O2RA 2A2QH 2QXJA 1P09A 3UOPA 3PM3A 1QRZA 1O3LA 1GI8B 3CS7A 1P11E 2R2WU 1NZQH 1P9UA 1O2IA 1QA7A 5AHGH 1D9IA 5LPRA 1DXWA 1PPBH 3ODDA 1OWIA 2CJIA 2W7UA 5A0BA 1Y3UA 3FP6E 1EPTA 2AFQB 3T29A 4E06H 2QA9E 3RXUA 1MD7A 1FZZA 1O2YA 1J17T 1J9CH 1QB9A 3GCTF 2OINA 3H5CB 2SGEE 1Z8GA 5F8TA 1BB0B 2FX4A 5TCCA 3ELAH 3Q77A 4ZKOU 1V2NT 4H6SB 1GHZA 4IC5A 1SB1H 2ZFFH 5FPTA 1CSOE 1P8VC 1C1TA 1UTJA 1XMNB 1O3NA 1TBZH 2G5NA 4X8SH 1YPLH 3T26A 1C5PA 1K21H 3BTQE 2HNTF 1E0FD 1T32A 4UFEH 2VVUA 1V2KT 1UVUH 9LPRA 1QBOA 2BDCA 1A61H 2BVRH 2P3FH 1AN1E 3RXHA 3BIUH 3EYDA 4CHAC 1NS3A 3Q76A 3QWCH 3TIUA 1O2UA 3RXTA 3QUMP 4UONA 1Y5BT 1T8LA 3SV9A 3OY6U 1QFKH 3U69H 3RXOA 3LGYA 1IQFA 2FS9A 1HAXB 5DO4H 1GHAF 3KIDU 4I32A 2BDHA 1HRTH 1GCDA 3ESTA 1O3JA 2AYWA 3RXCA 1GI2A 3F6UH 1GJDB 2WPJS 1NRNH 1W13U 4KKDA 1GMDG 1GWAA 2J95A 3E90B 5FX5A 2Z3CA 5GDSH 4F4OC 1TA2A 1QJ6B 1SLXB 5DP6A 2BLOA 2BQ7B 1NN6A 3DFLA 1DOJA 2A7HA 3SORA 3LH1A 1HGTH 1B0EA 1SFQB 5GXPA 3VGCB 2Q6FA 2ASUB 3RLYH 2HOBA 2A4OA 1CA8B 3SHAH 4Y11E 3UTUH 3RC4A 1YLDA 1ZPCA 1SGYE 3M5NA 1XXFA 8LPRA 3B9FH 3GCTG 1L1NA 1W14U 1AVXA 4OGYA 2XCFA 4MLFB 1AUJA 2KAIA 4LK4A 1C5NH 1AVWA 1TA6A 3EQ0H 1G2MA 3I77A 3PO1C 3WY8A 2ZFRH 3RXPA 3P95A 2GV6A 4Z6AH 3UR6A 4AORA 1QCPA 2ILNA 1O5GH 5ESTE 3MH4A 3TGKE 1XVMA 1HNEE 2BHGA 4WF8A 2O8UA 3TITA 1SGQE 4ISLA 4ZHAA 1JRSA 1FXYA 4K5ZA 1SR5C 1ABIH 2FOMB 3T28A 3LT3A 3TU7H 1NFXA 1V2LT 2FDAA 2UUYA 4AB9A 1NRSH 3A86A 1LQEA 1ZTJA 1P0SH 2A4RA 2B7DH 1GJ7B 2C4FH 1AUTC 2QIQA 1GJBB 2ODYB 1ANDA 2AMDA 1GHAG 1GBKA 2JETC 1EB1H 1EXFA 2FOGA 5L2YH 4A1VA 2A31A 2R3UA 1YGCH 2ZO3H 5EXNA 2GGVB 3Q3YA 4FUHA 1IHTH 1WTHD 4IBLH 3SNDA 2R3YA 2ZF0H 1EOJA 2CHAB 1YKTA 2FYRA 5A2MH 1T8NA 1FAKH 3GY6A 5A0AE 1ANEA 2BVXH 1TFXA 4FUJA 1O5FH 2J9NA 3KCGH 1FQ3A 2FI3E 2BD2A 1C9TA 2FXRA 3QGJA 1AFQB 4WY3A 3QK1A 4ZKNU 1QBNA 1OWKA 2ZECA 1IAUA 3ATLA 4I8GA 1KLJH 2VJ1A 1ZR0A 4GVUA 1K9OE 2ZA5A 4WWYA 1Z1JA 1BTPA 3MNBA 4NWLA 1KDQA 3JZ1B 1GBIA 1RTLA 1MQ6A 2W7SA 2BDBA 2BOHB 1YP9A 1GCTC 1W7XH 2QN5T 4SGAE 4B2BA 1NRPH 2J92A 1HYLA 1TX7A 4FUCA 3FP7E 1QHRB 4IMZA 4NA9H 3U1IB 2ZDNA 3RXLA 4ABDA 1OWJA 1C2MA 5FBEA 1UHBA 1DWCH 1V2PT 4CRFA 1BTXA 4ZHMU 3SU5A 1V2QT 1Y59T 4QT8C 5GPIB 3UWIA 3SU2A 2VGCB 2A45B 1JWTA 1UTLM 1NFYA 2BXUH 1OP0A 2Q6DA 1DITH 3RXKA 2IJOB 3ATIA 4E7RG 1C4U2 1NTPA 4MPVA 1ACBE 1P3CA 1RD3B 1C1OA 4WVPE 1LVOA 4AG1A 3DD2H 1KXDA 1OOKB 5F8XA 3G01A 2OQ5A 1GBTA 1K1IA 4X6PA 2BD7A 5CHAB 1GJCB 2SNWA 4CH8B 1V2MT 1OX1A 4YOJA 1FMGA 3SN8A 1KLIH 2XTTB 3BTFE 4E05H 5PTPA 1Z8RA 1FDPA 2QCYA 3O8CA 4X1RU 3NK8A 4FVDA 2HRVA 2A32A 3UNQA 1XUKA 1UCYK 2NU2E 2BX4A 1HAYB 3KQBA 1E34B 1TRYA 2XYAA 1TIOA 3SZNA 3QLPH 1EPTB 1GMCF 1V2OT 4FUDA 1K1PA 1MTNB 4HFPB 4ABHA 2Z94A 3KL6A 1G30B 3GY7A 1MTWA 4ZKSU 3OSYA 1IQNA 2OC8A 1OYQA 1FV9A 5FPYA 1SMFE 2ANYA 2F9OA 2Y5GA 1C2HA 1MBMA 1H8IH 1HAZB 5C1UA 2A0QB 3MO3A 3W94A 1E37B 1PPZA 4OS7A 1QL9A 3EDXB 2ALVA 3D23A 3EE0B 4I8JA 2PKSC 3SV8A 1WQSA 1ESAA 4WXIA 1RIWB 1WCZA 1LHCH 1O2GH 3NPSA 3FAOA 1S0RA 1Z6EA 2VNTA 2AGIX 1E35B 3MU5A 5AVDA 4B75A 1O3BA 2ANKH 1FIZA 2BDIA 3ZVCA 2ZHEH 1K1OA 3ATMA 1FY5A 1O5CB 3M7QA 1P2IA 4O3UA 3RXVA 1XUHA 1O38A 1SGIB 1TWXB 3LOXA 4DG4A 1V2ST 3S9CA 2BD9A 1BTWA 3TK9A 3BG8A 3GISB 4RKJB 4ABGA 2Y82A 4ESTE 1V2UT 1DY8A 2O9QA 1GBBA 1L2EA 2ZU1A 4BAMB 1ZPZA 2W3IA 2GX4A 1W2KH 1P2KA 2GDEH 3LH3A 4O97A 5E0JA 1EKBB 3P8GA 1KTTB 1XKAC 1ESTA 1ELTA 1Z8IB 2EEKA 3SU1A 1GBHA 3URCA 1VGCC 3L33A 4AYYB 1HAHH 2DE8A 1SHHB 1GI5A 4X6MA 3SNBA 1EJNA 4KP0A 3RXSA 2C8ZB 1GMCG 4Y10E 5AF9H 4DOQA 1GHBG 2P59A 3M61U 4GHQA 4NIWA 1NFUA 4FUGA 1BTUA 1OPHB 3ATWA 2BDGA 1H1BA 1LPGB 2FLBH 3L3TA 4K8BA 2CF9H 4LZ1H 4VGCC 2XBXA 1G2LA 3MU0A 3L6PA 5FXLA 3IG6B 3PMBB 5FPSA 2F9UA 3ZYEA 2C8WB 1LVBA 3P92A 3SI4H 3PMAB 2SGFE 1O2LA 5GJ4B 3BV9B 3F9HA 1DM4B 3GCHB 4ABBA 4NZQA 1S81A 4A1TA 5K0HA 1FN6A 1A5HA 3ZZAA 1TBRH 2G4UA 4KELA 1MCTA 1N8OB 1TRNA 2F9PA 2XBWA 4MDSA 4B2CA 4CRBA 2BY5X 1C1NA 1TGTA 3GDVA 2FMJA 1C1MA 2J38A 1E36B 2FODA 4NWKA 4ZUHA 1KY9A 1MUEB 5DG6A 1OP8A 1PPCE 1UCYH 3SJIA 5DP9A 3P70B 2D8WA 3URDA 3V3MA 3SJ8A 1D3PB 4CR5A 1FUJA 3PMHB 1CBWB 2ZTYA 1GI3A 3F9GA 4GUXA 4FUIA 1ZTLA 5C2ZA 1A0JA 2YNAA 3OU0A 4INHA 1BMNH 3ZVDA 1ZSJA 3Q3KA 2QXHA 2O8MA 1ARBA 5DJ7A 1O2VA 5EPYA 2BYAX 2FTLE 2PKAA 2ZDMA 2OUAA 1AB9B 1VJAU 3E1XB 5BPEA 3DHKH 3A7WA 1O3KA 3A7XA 3S7KB 1MU8B 2C3SA 1LHFH 3AW0A 2PTCE 3SGBE 3A8CA 1VCQA 2ALPA 4IN2A 5GCHF 5HGGA 1T4UH 1UHBB 2FOFA 1O2SA 3UQOA 4MNVA 1CT0E 3SW2B 3SUDA 1GVKB 3OX7U 2F91A 2V35A 2JH5D 1V2RT 5DGJA 3D62A 5EGMA 1J16A 2J34A 1SPJA 4XSKU 4XFQA 4X8UH 4NIVA 4D7GA 4MPUA 2FO9A 4WXVA 3GY8A 2ZU2A 2VWOA 2A4QA 4YLUA 1ZGIA 3BTKE 2ZU3A 2Z7FE 3W95A 1O0DH 1D6RA 2EI7A 2P93A 4JYTA 3P17H 2H1UA 1KXEA 1KIGH 2GVFA 4U2WA 1NO9H 2PR3A 3PTBA 1NPMA 2HPPH 1TX6A 1MKWK 5LH8A 4DIIH 1F0RA 3TJUA 3SQHE 2D26C 4Q80A 1CU1A 3RP2A 5JBCS 4D9RA 1P2QA 2WPLS 1ZJKA 2TPIZ 3R0FA 4ABFA 1ZYOA 1IQGA 3NKKA 1V3XA 1GDNA 3GDUA 5H4IB 1HAGE 2A1DB 4YT6H 1C2JA 1W7GH 1PQ8A 8GCHF 2QGRA 1BRBE 2H2ZA 1UTKA 2ZG0H 5ETXA 3SV7A 1QQUA 3TPIZ 2WPHS 4X0WU 3UR9A 2TGAA 1RXPA 3RMOH 2OLGA 1O2JA 1G9IE 3A7ZA 2GMTC