4FUEA

Crystal structure of the urokinase
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
246
structure length
246
Chain Sequence
b'IIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTIALPSMYNDPQFGTSCEITGFGKEQSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHTK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Urokinase-type plasminogen activator
publication title Crystal Structure of the Urokinase
rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 61
structure length 246
sequence length 246
ec nomenclature ec 3.4.21.73: U-plasminogen activator.
pdb deposition date 2012-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4fueA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4fueA01
4AX9H 2Z6BD 1NROH 1ZMNA 1KXAA 1SL3A 2ZDVH 1HJ9A 4AFZA 1AIXH 3P8OA 3V12A 2TPIZ 3NCLA 2ZO3H 2P94A 2P16A 5EU8A 3UNRA 1BITA 2BVRH 3EA8A 4K69A 1H1BA 3BIVH 1ZHRA 4K3JA 2BDIA 4WJG2 3ZZBA 3H7TA 1EAXA 1J8AA 2QCYA 3PMAB 2P95A 4DIIH 3A80A 3ELAH 1TB6H 2TGTA 3GY6A 4RSPA 4ABHA 5DKMA 2D26C 1O3GA 1BB0B 3T26A 1SLXB 2QXGA 1DVAH 1DE7H 4BXSA 1DUAA 1EP6A 3A8CA 4CHAC 2H9EH 3SI3H 3S9AA 2ZQ2A 4Q7XA 1IQFA 5C1UA 4UD9H 1V2KT 3UQVA 1LTOA 3A86A 3Q3XA 5HGGA 3SNAA 1C5MD 2TGAA 4JZDH 5C1YA 4MG3A 1Y5BT 3F9EA 5EPYA 1O5AB 4TPIZ 2RCEA 3SU1A 3U98H 2ZGCA 1DLEA 2NU1E 5I46H 5L30H 1YPJH 1ETRH 1BTUA 2VVUA 2JH0D 2GKVE 1ZHPA 1O2TA 1HIAB 1B7XB 3LC3A 1C5VA 3ZZ6A 1G3EA 4FUHA 1QQ4A 1C2DA 4B75A 1SB1H 2GVFA 5DG6A 4UDWH 2BLVA 2A45B 2Z3EA 4MPVA 2WPHS 3SJOA 2HPQH 1O5DH 1ZYOA 1LMWB 1CA0C 2OBQA 1YPGH 1C5XB 4I7YH 3WY8A 4AB8A 2BXUH 2G55A 2CHAC 3U1IB 4JK6A 3MU4A 1FY8E 1BDAA 1UTLM 1CBWB 1XXFA 1CVWH 1MTNC 2XNIA 1EAWA 1KTSB 1ZPZA 1JOUB 2WPLS 1BHXF 1K1MA 1O2JA 3TH4H 3VB7A 1P06A 1Y3VA 2O9QA 1C1PA 2P8OC 3PV4A 4WWYA 1NU7B 1ARBA 1O3IA 3RU4D 5JB8S 2WV5A 1BIOA 3P17H 3M5LA 1MQ6A 4AN7A 1P10A 1O3LA 3R0FA 2OQUA 4YO9A 2ZP0H 4KGAA 2G4TA 3V7TA 1D4PB 1T31A 3S7KB 4FU8A 1ZSJA 1BMNH 3Q3YA 1BHXB 1B5GH 1KLJH 4X8VH 1BRCE 3H5CB 3FZZA 3TU7H 3O8CA 1SSXA 1SMFE 3K9XB 2BOKA 4ZH8A 5LPEA 1GDNA 4BTIB 1B0FA 5AF9H 3OYPA 3SU2A 1GJAB 1ZTLA 4O9VA 4FUIA 5JBBS 2SGEE 3SV7A 1C5RA 1INCA 2C8WB 1OP8A 6CHAB 1GJ7B 1TNLA 1GBAA 3BN9A 1ZHMA 2VNTA 2AIQA 2QXHA 5EQRA 1O2VA 1K28D 4U2WA 3TH2H 4DVAU 5GCHF 2ZHDA 1NFUA 1G9IE 3RMMH 1QFKH 4ISNA 1OXGA 2ZCHP 4XBDA 1LQEA 5C5OA 2BY9X 2BD7A 2GDDA 4DG4A 2Z9IA 3GYLB 5E2OA 2B0FA 2GCHF 1EJNA 1WTGH 2BB4A 1A5GH 1A0HB 3PWCA 4BOHA 4JYUH 3PTNA 1YPKH 4I33A 1HAGE 1T8NA 8LPRA 3EE0B 1BTZA 1IQGA 1FIZA 3SUFA 1FZZA 2VIOA 4I31A 1QRXA 1GBDA 2XCNA 3M7UA 4NWKA 2F9OA 2FOFA 1P03A 4XBCA 3FP6E 2BX3A 2UWPA 1EPTA 4TYDA 3CS7A 3GDVA 2GZ8A 1LPZB 2O8UA 2EA3A 3S9CA 1OWEA 2VIWA 3GYMA 4Y0ZE 2FS8A 1C5QA 1WAYB 3TK5A 5JBAS 1O35A 1W8BH 5HXFA 2EI7A 1F92A 1QBOA 3DFLA 1EKBB 2ANYA 4NCYA 1JWTA 4AYYB 1OWIA 2G00A 3S69A 5L6NH 2FOCA 4XOJA 4AG1A 3ZZ3A 1GBIA 2VGCB 3EA9A 2C4FH 1DY8A 5LH8A 2OD3B 2BHGA 3MI4A 2Y5HA 5AHGH 1PPCE 1DUEA 1TQ0B 2BLWA 4I8HA 5A8XA 2QF0A 2R0LA 2G5NA 1GBCA 1HFDA 1HUTH 1TBQH 2O8LA 2ZU1A 1P9SA 4Y79A 1L1NA 1P9UA 2RG3A 4WH8A 2I6QA 2WPIS 3E16B 3E91A 4ZUHA 3EA7A 3L33A 2ZDNA 1JXPA 3MO6A 4WMFA 5EOKA 2FOAA 1SBWA 1P02A 1HV7A 5C67A 1K1IA 1V2ST 2F3CE 1DWBH 4BXWA 1DITH 2FOMB 4WF8A 3SJ9A 1RD3B 3STIA 5C3NA 1O3NA 1YYY1 5CMXH 1O34A 1EPTB 3A7XA 1ZRKA 3TGKE 3T62A 2H5DA 4FU9A 3K6ZA 1RXPA 1YPHE 3T2NA 1GMCF 2FMJA 5HM9A 1QQUA 2M5TA 5FPTA 1C5PA 4X2YA 1TMTH 2JH6D 4O3TA 1PYTD 4U32A 1IAUA 3V0XA 1QB1A 1HNEE 4FXGH 5A2MH 2ZFQH 1MCVA 3SGQE 5EW1H 1O3BA 2WPMS 1CBWC 3FANA 1AD8H 1HGTH 2K1QA 3LOXA 4I8LA 1SGRE 2XBYA 5GIBA 1EXFA 4X1SU 1LPKB 5F6MA 5EQQA 4PROA 3K65B 2UUFB 1Y59T 4ZHMU 2HNTC 4GLYA 4ASHA 3RXPA 1MU6B 1ORFA 1HAOH 3ENSB 1M9UA 4ABJA 1CE5A 1LHFH 2XWBI 3QTOH 1YF4A 4NZQA 4OS2A 2ILNA 4B2BA 2FP7B 1QRZA 3SJ8A 1OSSA 4Q7ZA 1GVZA 1E36B 1BMMH 4HI3A 1AE8H 3RXEA 1PJPA 4KKDA 3SHAH 1AB9C 2VIQA 1PPBH 1HDTH 5E0JA 1GI8B 1O3JA 3I78A 2R2WU 2GD4B 2ZU2A 3DT0H 3HKJB 1F5KU 2BDHA 1PQ7A 4GSOA 3ZYDA 2FS9A 1WUNH 1ARCA 3DHKH 3SV2H 2FI5E 2BDYA 1WBGB 4HGCA 1CGIE 4ZROA 2ZDLA 4NFEA 1UVPA 4X8TH 1Y5AT 1V3XA 2OTVA 2Q6DA 1ZGVA 1LHCH 3NXPA 3T29A 1G36A 2GTBA 1W2KH 2FODA 3SZNA 3F9FA 1TOCB 4A1TA 1GI1A 1C2KA 5HM2A 3FVFB 1XUIA 1ESTA 2O8TA 2HALA 4ISHH 3MO3A 3ZVCA 2OBOA 1OPHB 5GPIB 1O2QA 4DIHH 4X1PU 4FUFA 1E35B 2QXJA 3PM3A 1BT7A 3ATMA 2Q6GA 3B23B 1BUIA 1SPJA 3C27B 1V2LT 3VPKA 2PFEA 1RTLA 3BEFB 2G52A 4YOGA 1SG8B 3VFEA 3A7TA 3O8BA 2FI3E 1ELAA 1K2I1 3BG4B 2BDGA 1EJAA 1YLDA 4AORA 4NSYA 3CS0A 4CH2B 3KQEA 1C4U2 4H6SB 1QA7A 1TPOA 2J34A 3SJKA 4AFQA 4DOQA 2ZGBH 3A83A 3CENA 4ABEA 5FCKA 3KL6A 3RC4A 1C2HA 2A0QB 4ABBA 1TNJA 5EGMA 1DXWA 2RA3A 4X6PA 4XE4A 4HTCH 1Z8GA 5F8XA 1UHBA 4ABGA 2BXTH 4SGBE 3URDA 4AFUA 1J14A 3AAVA 4A7IB 1MKXK 2FO9A 1NRPH 1Z8IB 1BBRH 1VGCB 1Y3YA 2ZQ1A 2PKAA 1MTSA 2VGCC 1C1OA 1KXDA 1GI6A 1UVOA 1O2RA 1WCZA 2OC7A 3RXVA 3M3TA 4IMZA 4BAHB 1GJDB 1O2UA 4MPWA 1EQ9A 2ZPRA 3UR6A 4I8JA 2FLRH 1AVWA 4ZKRU 1J17T 2W26A 4AZ2B 2C3SA 1QJ6B 5PTPA 1ZMJA 1OOKB 3GICB 4NIYA 2NU0E 1O5FH 4FVDA 3QK1A 4NFFA 1GJ8B 2THFB 3BTTE 1CA0B 3KGPA 3MWIU 1ZSKA 3RM2H 1GBBA 1YCPH 1EPTC 4IC6A 1ZPCA 1AO5A 1HPGA 1GHWH 1K1PA 1ZOMA 1JIMA 5FX6A 1MTNB 3LT3A 2F91A 2VINA 3Q00A 4X1QU 5GDSH 4MLFB 5TJXA 1V2TT 3RMOH 3G01A 1O2HA 1UHBB 1V2RT 3KEEA 1O3OA 4FUEA 1QBVH 1PFXC 2FWWA 1W12U 1LCYA 2G51A 1AVXA 3ATKA 5FCRA 3RXSA 1FMGA 4UFFH 4FUBA 1DY9A 3RLWH 1IQLA 2J95A 1V2NT 5AVDA 1UTQA 1W3CA 1TX6A 2ZFPH 4E7RG 1WSSH 2XC5A 4TWYA 2TGDA 1P2QA 4SGAE 1GGDB 2BQ7B 4CBOA 1GI0A 3KCGH 2ZCLP 3SHCH 1IQHA 3HPTB 3KIDU 3E0NB 3MMGA 5IYTA 2Z7FE 1FAXA 2WYGA 3GCNA 2CN0H 2BD3A 3M37A 2D2DA 2A2XH 3MTYA 2FEQH 2ALVA 1UVUH 2GMTC 2BDBA 5ESBA 3JZ1B 1KXCA 1O39A 2NWNA 5BPEA 1UTMA 3V13A 5FBIA 1SLVB 3W94A 1TX7A 3PLBA 1GHBG 1Y8TA 2AGGX 4MQAA 3ZZ4A 1GL0E 2PW8H 2PSXA 5DP8A 2C8XB 1S85A 1GI4A 2HGTH 4OS5A 3D23A 4I32A 2V3HH 1SGNE 4NA7A 1LQDB 5A0BA 1DWCH 4FUGA 1SGIB 1P01A 4BNRA 3UOUA 2A5AA 2AEIH 1A2CH 1V2WT 4I8KA 1C1VH 4JK5A 2FLBH 1TPPA 2RDLA 1QIXB 4K1SA 1GMDG 1W7XH 4NWLA 1SLUB 3UWIA 1YC0A 4ESTE 1Q3XA 1C5YB 1LPGB 1KXBA 5DP5A 4X6OA 2BQ6B 5EG4A 2PGBB 2TBSA 5LPRA 4JZEH 3KN2A 1TA6A 3RXRA 1QL8A 3BG4C 1D3QB 3M35A 1SGTA 3HK6B 1T8MA 2F83A 2W7SA 5EW2H 2TRMA 3PO1B 3M7QA 4VGCB 4OS4A 4OS6A 2HOBA 3KQBA 2ANWA 1BQYA 2VJ1A 1YLCA 2GZ9A 1TX8A 2ODPA 3ZZ9A 1MMJN 3E8LA 2BD8A 3O8RA 3PLPA 1TMBH 1Y3UA 1HXEH 4AFSA 3UQOA 3A7ZA 3IG6B 1BBRK 1BTPA 3UNSA 2BY5X 2BZ6H 2QF3A 2A5IA 3ZZ8A 2BZAA 3TK6A 1VGCC 3QUMP 4NIVA 3M5OA 1YPLH 3E1XB 2F9UA 3ZZ7A 2R3UA 3GCTG 1AI8H 2BLQA 4IBLH 3SGAE 1O2OA 2PHBA 1Z1IA 4RN6A 4BTTB 1FY3A 4YESB 1ELCA 3RXMA 1MKWK 1MD7A 2FTMA 3HKIB 4R8TB 3LGYA 3RXHA 1EASA 4FUJA 2BY8X 2ZDMA 3A7VA 2Y82A 2JETC 3GY5A 1MQ5A 4A92A 1D9IA 3TLOA 2HNTF 2BVXH 4JYVH 1GMHG 4E7NA 3ZV9A 4IMQA 1GHAG 1GBKA 3A8AA 2UUYA 3MHWU 3MOCA 1A46H 1EUFA 4YTAA 1LVBA 3MNBA 2GV7A 1GI9B 4FVBA 2ZGHA 3EAJA 8ESTE 3OY5U 3TGJE 1V2MT 5CE1A 2D1JA 1Q2WA 5JBTA 4K5ZA 1E34B 1IQEA 1HAIH 3ZVDA 2ZI2H 1EOLA 5T6DA 1O3AA 1MD8A 1O38A 1C2FA 4QT8C 3ZZCA 3A89A 3SN8A 1C9PA 2BYAX 1THRH 4X6MA 1QR3E 3W95A 5AFYH 4LZ4B 1LVYA 4DJZB 1AZ8A 4B73A 3M5MA 3U69H 2XRCA 4NA8A 3VB3A 2FX6A 2ZIQH 3GDUA 2ZWLH 2PUQH 4OGXA 4U30A 1NRRH 1UCYH 3RXOA 4BTUB 3LH3A 1SHHB 2ZU3A 1SGFG 4CR5A 2SGDE 2W7UA 1K1OA 2VIPA 3DUXH 2WPKS 1GGDC 2BX4A 1S0QA 4Y7AA 1O2ZA 2FYQA 4GVUA 2A4GA 1AB9B 1HLTH 1OP0A 1VITG 1LHEH 1XKAC 1A5HA 1YBWA 3ODDA 2VH6A 3AAUA 3ODFA 3KF2A 1FQ3A 3MO9A 1BTHH 1GJ4H 4JCNA 1P3EA 5ABWA 1NRNH 2OC8A 1XUHA 1S82A 1W0YH 1GVKB 1GWAA 1GDQA 1TNIA 2ZGJA 3SQHE 3EQ0H 2W5EA 2ZF0H 5DP3A 1V6DA 2EI6A 1H9HE 1XX9A 3IWMA 3VGCC 1A5IA 4Y8ZA 3D65E 2EEKA 4BAKB 4D9RA 4TY7A 2EI8A 2FI4E 3GDSA 2NU3E 2GZ7A 3AVZA 3MNSA 1UTNA 3F9HA 5L2YH 5JYIA 1IHTH 1OWKA 3Q77A 4INHA 2F9NA 4LZ1H 1VZQH 3BEIB 3T27A 1HAYB 4KTSA 1SQAA 4DGJA 1ZTKA 1C1SA 2BY7X 4OS7A 1WYKA 2BD4A 2FPZA 3CP7A 3D62A 1GBMA 4Y76A 2Z3DA 3ATIA 1YCPM 3PO1C 2SGQE 4VGCC 1P12E 1BZXE 2XTTB 3GISB 2ANMH 1CGHA 1PQAA 5H4IB 1DFPA 1QGFA 1C5SA 2GT7A 4Y8YA 1ZZZA 3RXLA 1H9LB 4CRCA 3QLPH 4KELA 1PPGE 1WU1A 1DSUA 2ODQA 3SNEA 3RXFA 3RXUA 3ZVGA 5A8ZA 1N1LA 3MNCA 4NGAH 1UO6A 5SGAE 1P8VC 1TPSA 2XXLA 1W11U 5DP7A 3SBKA 1SQTA 1QURH 2HLCA 1NS3A 1O3CA 1LKAA 1WQSA 1Z6EA 2OCVB 1AGJA 1GJBB 1CT2E 3GCHB 2ANKH 3VB4A 5GJ4B 2A1DB 1FY5A 2Y7ZA 1P0SH 1QCPA 1THPB 2R9PA 2SGAA 5DP4A 3RXKA 3UY9A 3SI4H 1GJ9B 1DWDH 1E38B 1O2MA 1GCTB 1VCQA 1Z6JH 1C5LH 1O30A 1TYNA 1G3CA 1SC8U 3A8DA 1B0EA 3UTUH 1GHZA 4OS1A 2DE9A 1KDQA 1HAXB 1L1JA 3RMLH 1VR1H 1P2MA 3RXGA 3H7OA 1VCWA 3URCA 1JRTA 2BDAA 6LPRA 2VU8E 1W13U 1GBFA 1LVMA 1UK3A 2BDCA 3RXDA 7GCHG 1F0UA 2ZKSA 8GCHG 3A82A 3LJJA 4AG2A 2SGFE 4INKA 3BTEE 1FAKH 1MZDA 4RKJB 2UUKB 2C8YB 3IITA 2QC2A 3BTME 2ULLA 1NRSH 2HRVA 1O5CB 2OLGA 4O97A 4YLQH 1FUJA 1C2LA 4X2XA 3T25A 3VB6A 1O5GH 1UVSH 2HNTE 1E0FD 3RC6A 2WUCA 5C20A 3OY6U 1O33A 3MU5A 1F2SE 4JZ1A 2ODYB 2B9LA 3B8JA 4AGKA 4J2YB 1Z7KA 4OGYA 1ESAA 1P57B 1CT0E 2GMTB 1Q31A 5G4BA 5J4SA 1TGBA 3T28A 1EZUC 1C5WB 5JB9S 4CH8B 3ZZ5A 1ELFA 1EX3A 1OX1A 4X1NU 4NZLA 1TQ7B 2NU4E 3AW0A 3ZV8A 2BMGB 1DXPA 2W3KA 1EB1H 2BD9A 2FOEA 1C4Y2 1V2QT 2J9NA 1GJ5H 5HMAA 3SU0A 4JYTA 4AB9A 3ZVEA 2ZECA 1O2WA 2J38A 2XWAA 1BJVA 2QYIA 4K60A 2H2ZA 2AH4X 4F49A 4GUXA 2J2UA 1KIGH 4FUCA 4WXVA 1MZAA 3MH6A 1D3TB 4A1XA 1FV9A 3ZZAA 1FY4A 2JKHA 4ABIA 3N7OA 1SGPE 3MH7A 1GHBF 1TWXB 1AUJA 3BEUA 1OWJA 1LDTT 1F5RA 4XSKU 1TABE 1BTYA 1O2GH 1ZJKA 1AFQC 8KME2 5TCAA 2LPRA 1UTKA 1K1JA 1TMUH 3AW1A 1FI8A 1ZPBA 4FU7A 2IPHA 1ELVA 2JH5D 4LK4A 2AYWA 4YZUA 1C1RA 3TNSA 1NFYA 3U9AH 2DUCA 5A0CA 1GHYH 1DS2E 1TGTA 5JPMH 1KLIH 5L2ZH 1S5SA 3A84A 3U1JB 3A7YA 4Z0KA 1DSTA 1C5OH 2QIQA 1GMDF 1RFNA 1TGCA 1TRMA 3HATH 4AGJA 5DK1A 3GY2A 1LHGH 3EYDA 1VJ9U 3TJOA 3SO3A 1C1NA 1HYLA 3PMJA 2CF8H 3ITIA 1NT1A 1V2UT 1TALA 2FDAA 3A7WA 2PTCE 3LGWA 1KY9A 4WVPE 3PWBA 3F1SB 4ZHAA 1DWEH 1EB2A 1GJ6A 1S83A 2C8ZB 2QY0B 4ISIH 6ESTA 1XM1A 3Q76A 5FHTA 2BOHB 2PGQB 3RU4T 7ESTE 2A7JA 1MU8B 1FPCH 1YPMH 2AMPA 3K6YA 2ASUB 1TNKA 4GCHG 3OU0A 3BTQE 9LPRA 2BY6X 3SV6A 4NSVA 4B2CA 3GCHC 4YLUA 4A6LA 2OC1A 2JETB 1O37A 4X6NA 2STAE 2XCFA 3P92A 2AMDA 3SV8A 2P3TB 2ZHEH 3GCTF 5FAHA 5BRRE 2SFAA 1WV7H 1GCTC 1S0RA 1GL1A 3SU5A 3QZQA 1QNJA 1IOEA 3QX5H 5C5NA 3QZRA 2A32A 2F9BH 1CHOG 4KTCA 1QL7A 4ZHLU 3A8BA 1OYTH 1C5TA 1BRAA 1GMHF 4NIWA 1GHAF 4ABDA 3ATWA 4TY6A 3NUMA 2FX4A 1UK2A 1E37B 4ABAA 4AYVB 3RXAA 3MNXA 3QWCH 1A4WH 1SGFA 1LVOA 1UTPA 1MAYA 3KNXA 4GPGA 4CREA 2PKAB 1K1LA 4MVNA 5A8YA 3SV9A 2XC0A 3SU4A 3UUZA 2QXIA 3VEQB 2HVXA 2VIDA 2ZHFH 3M3SA 5ESTE 4D7FA 3LH1A 4YOJA 1K21H 1V2VT 3PB1E 1RTFB 1V2PT 2GT8A 2EC9H 3M5NA 1OYQA 1ELGA 2UWOA 2QA9E 2C93B 4WMEA 1TA2A 1QB6A 1AKSA 4CRGA 5A09A 5E0GA 3RUOA 3BTGE 1OKXA 4MNYA 2BD5A 2W3IA 2Z9GA 1N6XA 1BTXA 3JZ2B 2OQ5A 3ESTA 1P2NA 2G4UA 5C1XA 1H8DH 3S0NA 3S9BA 1OWDA 3SNDA 2Y5GA 1L4DA 2CJIA 3UFAA 3RXJA 2Y81A 3BIUH 1SGCA 2YOLA 1KTTB 3F6UH 1VITF 3GCOA 4B2AA 1XUFA 2ZTYA 3M7TA 5CHAB 1N6YA 2CF9H 1DDJA 2FYRA 1QY6A 3SJIA 3VGCB 2HWLB 2BVSH 4UFGH 2ZCKP 2A4OA 1LO6A 3LDXH 1F7ZA 2YNAA 3EDXB 5IDKA 5J4QA 2OC0A 1EOJA 1G30B 2CV3A 3RP2A 4Y11E 3GY4A 1F0TA 1IQNA 3LIWA 1Z1JA 4IGDA 1O31A 1RGQA 4H4FA 1YKTA 1HBTH 1SFQB 1AWHB 1GI3A 4ZKSU 3P8FA 1MBQA 1W0ZU 3LU9B 1SGQE 3L3TA 5F8TA 4D9QA 3BTWE 4UONA 2PKSB 4B74A 3SW2B 4E05H 2Y6TA 1ANCA 1G32B 1G3BA 1Y3XA 4YT7H 3FZDA 1AMHA 2IN2A 3ZYEA 2WV4A 1PYTC 5T6FA 2AMQA 4TWWA 3I77A 3D49H 1O5BB 1CA8B 1GI7B 3BTHE 3GY3A 5FX5A 1CU1A 1TBZH 1PPHE 2CMYA 2BTCE 3F9GA 2GCTC 4K1EA 3QTVH 1ELTA 1KXFA 1UTJA 1CSOE 1XVOA 3UPEA 1OP2A 5F8ZA 4CBNA 3LGTA 1C2JA 3SNBA 1NFXA 6GCHG 1NY22 2P3FH 2A31A 3DD2H 2VIVA 1D6WA 1L4ZA 5LGOA 1PQ5A 1C5ZB 5EXNA 1OS8A 5I25A 2VVVA 1ABIH 1P11E 2CGAA 3MH5A 1CQQA 1XUGA 2XBWA 4DW2U 2A7HA 1NU9A 4IC5A 1GI2A 4IW4E 1TIOA 5EXMA 4D76A 3LPRA 1GPZA 1KSNA 2R2MB 3TNTA 3RC5A 1BRUP 1XVMA 5DO4H 1C5UA 4IS5A 3TGIE 1G37A 2C90B 2H6MA 1FPHH 1QTFA 7LPRA 3PYHA 1GBHA 1Y5UT 1C2GA 1LKBA 1YCPK 3U8OH 1SOZA 1BJUA 1SGYE 2H9TH 1YP9A 3DA9B 1QRWA 2WINI 1KLTA 2FXRA 1CT4E 2V35A 1GHXH 2ZGXH 2BD2A 1RIWB 1XKBC 3LC5A 1H8IH 3VB5A 3HK3B 1RS0A 4IN1A 3LKWA 2HPPH 4HFPB 1N8OB 7KMEH 1DOJA 1MTVA 1SLWB 4X0WU 1CGJE 2AGEX 1GI5A 2STBE 1QJ1B 3ZVAA 1T4VH 1XXDA 1ELBA 1C1UH 4MTBA 2QAAA 1HJ8A 1NO9H 1HB0B 4XDEA 4B76A 4CRDA 3NPSA 2R0KA 2WPJS 1SR5C 4BAQB 2PV9B 4THNH 2B8OH 5DPAA 2UUJB 3BTFE 7GCHF 1ACBE 8GCHF 1VJAU 1L0ZA 3ZVFA 3SGBE 1TBRH 1QHRB 1S81A 2Y80A 5E8EH 4ZMAH 5FPYA 4JMYA 1HAPH 3L6PA 5K7RA 2VWLA 5TCCA 2AIPA 3SUEA 3KQCA 3RXTA 1HXFH 1IQJA 2V3OH 1UVTH 3Q3KA 4DT7B 1FN6A 4M7GA 1FDPA 3UNQA 1RTKA 3PMBB 3BG8A 2QGRA 3EGKH 4MNWA 1T32A 2V6NA 1UTOA 3SNCA 5CHAC 1GHVH 1O0DH 3MH4A 3OTJE 1DX5M 2A2QH 3OSYA 1FXYA 3BTKE 4UEHH 3MU8A 1C1WH 1ID5H 1O3KA 1ZRBA 3UIRA 1ZR0A 3NWUA 1FN8A 3QDZB 2G81E 1GBJA 1P05A 3A81A 2Q6FA 3NZIA 4UE7H 1BTWA 1C1QA 3F68H 4Y8XA 1Z8JB 3R3GB 2A4QA 2ZTXA 1J9CH 1HJAC 3MYWA 4FUDA 1EATA 1AFQB 4IN2A 1DLKB 2PTNA 2FOGA 2P93A 2F9PA 4X1RU 1L2EA 4MPXA 4YM9A 1O3HA 1ETTH 3LONA 3MU1A 4ZXXH 1U6QA 2PKSC 1KXEA 2ZHWH 3LGUA 1BMLA 4Y71A 1O2IA 2BM2A 3LJOA 4KTUA 2PLXA 2Y5FA 3TVJB 1P2KA 2H5CA 1C2MA 3VXEH 1S6HA 4Q2KA 3K2UA 1GJCB 1MAXA 3P8NA 2G5VA 3QO6A 4K2YA 5K0HA 1O2KA 2UWLA 2ZFFH 1ZGIA 1EZXC 3B9FH 4BAMB 1CO7E 1O2YA 2ZFRH 3E90B 2GP9B 1A3BH 1TNGA 3TH3H 3SU6A 2Z9LA 3ATLA 1O2PA 3PTBA 2ZEBA 5AFZH 1MTWA 2ZZUH 5DP6A 1GCDA 1A0JA 3STJA 1UJ1A 1HAZB 4ZAEA 1P09A 5GXPA 1PPZA 1Y3WA 1SGEE 3E3TA 3RXQA 1BOQA 2FIRH 4WMDA 1MKXH 4ZXYH 1QL9A 3UOPA 4LXBH 2F9VA 2SNVA 2ZPQA 4BANB 3DFJA 4Y7BA 5FXLA 4O3UA 1O2LA 1HCGA 3P95A 3FP8E 2ZU5A 3ZVBA 1K1NA 2D8WA 1TGNA 2GGVB 3M3VA 1J16A 5EPNA 3SUDA 2ZDAH 4GCHF 1ESBA 1YPHC 1DPOA 1ELDE 2FOHA 2ZC9H 1NC6A 1NN6A 1MCTA 2PWXA 4DCDA 5DP9A 1RIWC 1BBRE 1AUTC 2KAIA 4B71A 1FIWA 1KYNA 2AS9A 3TITA 3UR9A 1AVGH 2A7CA 1N8OC 1SHYA 1A1RA 2GDEH 1O3PB 1SGDE 1D6RA 1RRKA 1O5EH 4ISLA 2P59A 1FNIA 1TAWA 2O8MA 1CHOF 1S6FA 1TRYA 3M36A 1UCYK 4K8YA 5JBCS 4Q80A 4YT6H 1BA8B 3U8TH 4ABFA 2A4RA 1TFXA 3O8DA 1G2LA 3E0PB 5FPSA 2CXVA 1EP5A 2VWNA 2SGPE 5E2PA 1ZJDA 4ZKOU 1V2OT 1YM0A 4A1VA 1IQKA 2R3YA 2ALPA 1F0SA 3QGJA 1AN1E 1IHSH 1H9IE 1HRTH 3M61U 2AGIX 4Y0YE 1NFWA 1LHDH 1MUEB 3BV9B 1AWFH 3A87A 2VB0A 1MH0A 1P04A 1ANDA 1PPFE 1ZTJA 2ZPSA 1TPAE 1YPEH 1BMAA 2B5TB 4BAOB 3OX7U 3TJVA 1EZSC 2FM2A 2GV6A 2O8WA 4B1TA 2OUAA 1KDQB 1SQOA 5GCHG 3TIUA 2WYJA 5HYOA 3FAOA 2XYAA 1O3FA 1F0RA 1BCUH 1WTHD 3C1KA 1SVPA 2PUXB 3KHVA 4DY7B 1ETSH 1ZSLA 2IJOB 2KAIB 4WXIA 4Y10E 5EQSA 2GCHG 1O2XA 1GDUA 2V0BA 1P2JA 4JZFH 4X2VA 1NPMA 3P8GA 4Q7YA 1EZQA 6CHAC 1VITH 2AFQB 1C5NH 1C2EA 3E6PH 1ANBA 3GOVB 1MTUA 4Z6AH 5C2ZA 2QN5T 4E06H 1XMNB 1MBMA 3RXBA 1SOTA 4H6TA 5T3HA 3MU0A 1THSH 1G3DA 4X8UH 5ETXA 1W7GH 1GG6B 2H9HA 1HAVA 3S7HB 4MPUA 3LGVA 2FOBA 1QJ7B 2J94A 3A85A 3RDZA 5FBEA 1O32A 2LNCA 4X8SH 1T4UH 1GVLA 2ZA5A 3TJNA 4CRBA 4CRFA 3V3MA 2VWMA 1A3EH 1SI5H 1EAIA 1NZQH 4XFQA 3RXCA 2ZDKA 2TGPZ 4JZIA 1S84A 2FTLE 2VH0A 1DANH 2GCTB 3LGIA 2B7DH 1GBLA 2FZZA 4Y6DA 1JIRA 1DT2A 1GBTA 2YNBA 1NM6A 4ZKNU 2WUBA 1H4WA 5B6OA 2VVCA 1QBNA 2PR3A 3UREA 1C2IA 4I8GA 1RJXB 4ISOA 1C1TA 1IQIA 3RMNH 5GWZA 1ANEA 1W10U 1WQVH 3PMHB 3TK9A 4CHAB 2ZTZA 1C4V2 1ELEE 2IOTA 2ZU4A 3P6ZB 2XBVA 2OINA 2BLOA 1AHTH 4NA9H 2OP9A 1SFIA 1V2JT 4NIXA 1TRNA 1AY6H 3RU4E 1PPEE 1CHGA 2SNWA 4U01A 2FESH 6GCHF 1XUKA 1HAVB 3SU3A 2DE8A 3HGNA 1FY1A 2I6SA 1O3EA 4CR9A 3A88A 1FJSA 4UFDH 1YGCH 3GY8A 2P3UB 1T8OA 1GMCG 2A5KA 3UWJH 1AE5A 1MKWH 4UFEH 1AFEH 4J1YA 4INLA 3TJUA 1OWHA 4F4OC 2XC4A 2NU2E 3SUGA 5E0HA 4R0IA 3NKKA 2Y7XA 2Z9KA 2GX4A 1EAUA 1G2MA 3TPIZ 2ZNKH 3SQEE 1K9OE 4MNVA 1JBUH 3VXFH 1WOFA 3RLYH 1NESE 3PROA 5DJ7A 4A5TS 3MFJA 2CHAB 2J92A 3I29A 5JDUB 1D3DB 1O3DA 3NK8A 2XW9A 1NRQH 4NG9H 1O36A 2Z94A 1FLEE 2ZHQH 4X2WA 3BF6H 1P3CA 4WY3A 3KQDA 2P8OB 3HGPA 4MDSA 1T7CA 4LOYH 2PSYA 1A0LA 1ZLRA 1F5LA 1TLDA 1Z8RA 3GY7A 3RM0H 2Z9JA 4K8BA 1C1MA 1XUJA 4GAWA 4HZHA 2ESTE 3BSQA 3SOSA 1BRBE 1AU8A 1EJMA 2Z3CA 3BTDE 5EXLA 1O2NA 2VWOA 1DICA 1D3PB 1TGSZ 3P70B 1IQMA 1NTPA 1O3MA 4TPYA 2OXSA 1AZZA 2QV1A 3FP7E 3FFGA 1C9TA 1TONA 2H1UA 1FONA 2ZFTA 1JRSA 2TIOA 4KP0A 3SORA 1TNHA 2AERH 4H42U 3U8RH 5F03A 4DURA 3ZZDA 3RXIA 5DGJA 1QA0A 1UMAH 5LPFA 1ABJH 9ESTA 1ZMLA 1UK4A 1P2OA 2BQWB 2G8TA 2ZFSA 4GHQA 1TE0A 2J4IA 2Q1JA 2RA0A 1PQ8A 1UCYE 1W14U 1O2SA 1VCPA 4D7GA 1GBEA 1J15A 4D8NA 3T5FH 1HJAB 1Z71A 1HAHH 1QB9A 4RKOB 4O03A 1X7AC 3AASA 3PLKA 1A7SA 4AOQA 1TOMH 5A0AE 1P2IA 4K1TA 1A61H 1L1GA 1GG6C 4WH6A 3QN7A 1JMOH 1AQ7A 4MNXA 4XBBA 3QGNB 1T8LA 5T6GA 1DM4B 2XBXA 1K22H 1AKSB 5EODA 4YOIA 1HIAA 4CRAA 2ZG0H 4GHTA
chains in the Genus database with same CATH superfamily
4AX9H 2Z6BD 1NROH 1ZMNA 1KXAA 1SL3A 1BMFD 1HJ9A 2ZDVH 4AFZA 1AIXH 3P8OA 3V12A 2TPIZ 5T1VA 3NCLA 2ZO3H 2P94A 2P16A 5EU8A 3UNRA 1BITA 2BVRH 3EA8A 4K69A 1H1BA 3BIVH 1ZHRA 4K3JA 2BDIA 4WJG2 3ZZBA 3H7TA 1EAXA 1J8AA 2QCYA 2L6OA 3PMAB 2P95A 4DIIH 3A80A 3ELAH 1TB6H 2TGTA 3GY6A 4RSPA 4ABHA 5DKMA 2D26C 1O3GA 1BB0B 3T26A 1SLXB 2QXGA 1DVAH 1DE7H 4BXSA 1DUAA 4OM9A 1EP6A 3A8CA 4CHAC 2H9EH 3SI3H 3S9AA 2ZQ2A 4Q7XA 1IQFA 5C1UA 4UD9H 1V2KT 3UQVA 1LTOA 3A86A 3Q3XA 5HGGA 3SNAA 1C5MD 2TGAA 4JZDH 5C1YA 4ASUD 4MG3A 1Y5BT 3F9EA 5EPYA 1O5AB 4TPIZ 2RCEA 3SU1A 3U98H 2ZGCA 1DLEA 2NU1E 5I46H 5L30H 1YPJH 1ETRH 1BTUA 2VVUA 2JH0D 2GKVE 1ZHPA 1O2TA 1HIAB 2J98B 1B7XB 3LC3A 1C5VA 3ZZ6A 1G3EA 4FUHA 1QQ4A 1C2DA 4B75A 1SB1H 2GVFA 5DG6A 4UDWH 2BLVA 1FX0B 2A45B 2Z3EA 4MPVA 3UAIC 2WPHS 3SJOA 2HPQH 1O5DH 1ZYOA 1LMWB 1CA0C 2OBQA 1YPGH 1C5XB 4I7YH 3WY8A 4AB8A 2BXUH 2G55A 2CHAC 3U1IB 4JK6A 3MU4A 1FY8E 1BDAA 1UTLM 1CBWB 1XXFA 1CVWH 1MTNC 2WSSD 2XNIA 1EAWA 4GHTA 1KTSB 1ZPZA 1JOUB 2WPLS 1BHXF 1K1MA 1O2JA 3TH4H 3VB7A 1P06A 1Y3VA 2O9QA 1C1PA 2P8OC 3PV4A 4WWYA 1NU7B 1ARBA 1O3IA 3RU4D 5JB8S 2WV5A 1BIOA 3P17H 3M5LA 1MQ6A 4Z1MD 4AN7A 1P10A 1O3LA 3R0FA 2OQUA 4YO9A 2ZP0H 4KGAA 2G4TA 3V7TA 1D4PB 1T31A 3S7KB 1NBME 4FU8A 1ZSJA 1BMNH 3Q3YA 1BHXB 1B5GH 1KLJH 4X8VH 1BRCE 3H5CB 3FZZA 3TU7H 3O8CA 1SSXA 1SMFE 3K9XB 2BOKA 4ZH8A 5LPEA 1GDNA 4BTIB 2KM0A 1B0FA 5AF9H 3OYPA 3SU2A 1GJAB 1ZTLA 4O9VA 4FUIA 5JBBS 2SGEE 3SV7A 1C5RA 1INCA 2C8WB 1OP8A 6CHAB 1GJ7B 1TNLA 1GBAA 3BN9A 1ZHMA 2VNTA 2AIQA 2QXHA 5EQRA 1O2VA 1K28D 4U2WA 3TH2H 4DVAU 5GCHF 2ZHDA 1NFUA 1G9IE 3RMMH 1QFKH 4ISNA 1OXGA 2ZCHP 4XBDA 1LQEA 5C5OA 2BY9X 2BD7A 2GDDA 2WHXA 2Z9IA 3GYLB 5E2OA 4DG4A 1K0HA 2B0FA 2GCHF 1EJNA 1WTGH 2BB4A 1A5GH 1A0HB 3PWCA 4BOHA 4JYUH 2HVYB 3PTNA 1YPKH 4I33A 1HAGE 1T8NA 8LPRA 3EE0B 1BTZA 1SQRA 1IQGA 1FIZA 3SUFA 1FZZA 2VIOA 4I31A 1QRXA 1GBDA 2XCNA 3M7UA 4NWKA 2F9OA 2FOFA 1P03A 4XBCA 3FP6E 2BX3A 2UWPA 1EPTA 4TYDA 3CS7A 3GDVA 2QE7D 2GZ8A 1LPZB 2O8UA 2EA3A 3S9CA 1OWEA 2VIWA 3GYMA 4Y0ZE 2FS8A 1C5QA 1WAYB 3TK5A 5JBAS 1O35A 1W8BH 5HXFA 1VKYA 5F53A 2EI7A 3SYJA 1F92A 1QBOA 3DFLA 1EKBB 2ANYA 4NCYA 1JWTA 4AYYB 1OWIA 2G00A 3S69A 5L6NH 2FOCA 4XOJA 4AG1A 3ZZ3A 1GBIA 2VGCB 3EA9A 2C4FH 1DY8A 1KMHB 5LH8A 2OD3B 3UB0A 2BHGA 3MI4A 2Y5HA 5AHGH 2EQNA 1PPCE 1DUEA 1TQ0B 2BLWA 4I8HA 5A8XA 2QF0A 2R0LA 2G5NA 1GBCA 1HFDA 1HUTH 1TBQH 2O8LA 2ZU1A 1P9SA 5KEDA 4Y79A 1L1NA 1P9UA 2RG3A 4WH8A 2I6QA 2WPIS 3E16B 3E91A 4ZUHA 3EA7A 3L33A 2ZDNA 1JXPA 3MO6A 4WMFA 5EOKA 2FOAA 1SBWA 3CNRA 1P02A 1HV7A 5C67A 1K1IA 1V2ST 2F3CE 1DWBH 4BXWA 1DITH 2FOMB 4WF8A 3SJ9A 1RD3B 3STIA 5C3NA 1O3NA 1YYY1 5CMXH 1O34A 1EPTB 3A7XA 1ZRKA 3TGKE 3T62A 2H5DA 4FU9A 3K6ZA 1RXPA 1YPHE 3T2NA 1GMCF 2FMJA 5HM9A 2L74A 1QQUA 2M5TA 5FPTA 1C5PA 4X2YA 1TMTH 2JH6D 4O3TA 1PYTD 4U32A 1EFRD 1IAUA 3V0XA 1QB1A 1HNEE 4FXGH 5A2MH 2ZFQH 1MCVA 3SGQE 5EW1H 1O3BA 2WPMS 1CBWC 3FANA 1AD8H 1HGTH 2K1QA 3LOXA 4I8LA 1SGRE 2XBYA 5GIBA 1EXFA 4X1SU 1LPKB 2KX4A 1MABB 5F6MA 5EQQA 4PROA 3K65B 2UUFB 1Y59T 4ZHMU 2HNTC 4GLYA 4ASHA 3RXPA 1MU6B 1ORFA 1HAOH 3ENSB 1M9UA 4ABJA 1CE5A 2YMSD 1LHFH 2XWBI 3QTOH 1YF4A 4NZQA 4OS2A 2ILNA 3MQKC 4P02A 4B2BA 2FP7B 1QRZA 3SJ8A 1OSSA 4Q7ZA 1GVZA 1E36B 1BMMH 4HI3A 1AE8H 3RXEA 1PJPA 4KKDA 3SHAH 1AB9C 2VIQA 2WZQA 1PPBH 1HDTH 3WWBA 2PP6A 5E0JA 1GI8B 1O3JA 3I78A 2R2WU 2GD4B 2ZU2A 3DT0H 3HKJB 1F5KU 5C94A 2BDHA 1PQ7A 3WWFA 4GSOA 3ZYDA 2FS9A 1WUNH 1ARCA 3DHKH 3SV2H 2FI5E 1SKYE 2BDYA 1WBGB 4HGCA 5HIYA 1CGIE 4ZROA 2ZDLA 4NFEA 1UVPA 4X8TH 1Y5AT 1V3XA 2OTVA 2Q6DA 1ZGVA 1LHCH 3NXPA 3T29A 1G36A 2GTBA 1W2KH 2FODA 3SZNA 3F9FA 1TOCB 4A1TA 1GI1A 1C2KA 5HM2A 3FVFB 1XUIA 1ESTA 2O8TA 2HALA 3AK5A 3PRBA 4ISHH 3MO3A 3ZVCA 2OBOA 1OPHB 5GPIB 5C0TA 1O2QA 4DIHH 4X1PU 4FUFA 1E35B 2QXJA 3PM3A 1BT7A 3ATMA 2Q6GA 3B23B 1BUIA 1SPJA 3C27B 1V2LT 3VPKA 4Q4LA 2PFEA 1RTLA 3BEFB 4B6EA 2G52A 4YOGA 1SG8B 3VFEA 3A7TA 3O8BA 2FI3E 1ELAA 1K2I1 3BG4B 2BDGA 1EJAA 1YLDA 4AORA 4NSYA 3CS0A 4CH2B 3KQEA 1C4U2 4H6SB 1QA7A 1TPOA 2J34A 4RI0A 3SJKA 4AFQA 4DOQA 2ZGBH 3A83A 3CENA 4ABEA 5FCKA 3KL6A 3RC4A 1C2HA 2A0QB 4ABBA 1TNJA 5EGMA 1DXWA 2KFWA 2RA3A 4X6PA 1YWUA 4XE4A 4HTCH 1Z8GA 5F8XA 3DCLA 1UHBA 4ABGA 2BXTH 4SGBE 3URDA 4AFUA 1J14A 3AAVA 4A7IB 1MKXK 2FO9A 1NRPH 1Z8IB 1BBRH 1VGCB 1Y3YA 2ZQ1A 2PKAA 1MTSA 2VGCC 4ACBA 1C1OA 1KXDA 1GI6A 1UVOA 1O2RA 1WCZA 2OC7A 3RXVA 3M3TA 4IMZA 4BAHB 1GJDB 1O2UA 4MPWA 1EQ9A 2ZPRA 3UR6A 4I8JA 2FLRH 1AVWA 4ZKRU 1J17T 2W26A 4AZ2B 2C3SA 1QJ6B 5PTPA 1ZMJA 1OOKB 3GICB 4NIYA 2NU0E 1O5FH 4FVDA 3QK1A 4NFFA 1GJ8B 2THFB 3BTTE 1CA0B 3KGPA 3MWIU 1ZSKA 3RM2H 1GBBA 1YCPH 1EPTC 4IC6A 1ZPCA 1AO5A 1HPGA 1GHWH 1K1PA 1ZOMA 1JIMA 5FX6A 1MTNB 3LT3A 2F91A 2VINA 3Q00A 4X1QU 5GDSH 4MLFB 5TJXA 1V2TT 3RMOH 3G01A 1O2HA 1UHBB 1V2RT 3KEEA 1O3OA 4FUEA 1QBVH 1PFXC 2FWWA 3F3BA 1W12U 1LCYA 2G51A 1AVXA 3ATKA 5FCRA 3RXSA 1FMGA 4UFFH 4FUBA 1DY9A 3RLWH 1IQLA 2J95A 1V2NT 5AVDA 1UTQA 1W3CA 1TX6A 2ZFPH 4E7RG 1WSSH 2XC5A 4TWYA 2TGDA 1P2QA 4SGAE 2LP6A 1GGDB 2BQ7B 4CBOA 1GI0A 3KCGH 2ZCLP 3SHCH 1IQHA 3HPTB 3KIDU 3KYGA 3E0NB 3MMGA 5IYTA 2Z7FE 4DT4A 1FAXA 2WYGA 3GCNA 2CN0H 2BD3A 3M37A 2D2DA 2A2XH 3MTYA 2FEQH 2ALVA 1UVUH 2GMTC 5DSFA 2BDBA 5ESBA 3JZ1B 1KXCA 1O39A 2NWNA 5BPEA 1UTMA 3V13A 5FBIA 1SLVB 3W94A 1TX7A 3PLBA 1GHBG 1Y8TA 2AGGX 4MQAA 3ZZ4A 1GL0E 2PW8H 2PSXA 5DP8A 2C8XB 1S85A 1GI4A 2HGTH 4OS5A 3D23A 4I32A 2F43B 2V3HH 1SGNE 4NA7A 1LQDB 2IJD1 5A0BA 1DWCH 4FUGA 1SGIB 1P01A 4BNRA 3UOUA 2A5AA 2AEIH 1A2CH 1V2WT 4I8KA 1C1VH 4JK5A 2FLBH 1TPPA 2RDLA 1QIXB 4K1SA 1GMDG 1W7XH 4NWLA 1SLUB 3UWIA 3VG8A 1YC0A 4ESTE 1Q3XA 1C5YB 1LPGB 1KXBA 5DP5A 4X6OA 2BQ6B 5EG4A 2PGBB 2TBSA 5LPRA 4JZEH 3KN2A 1TA6A 3RXRA 1QL8A 3BG4C 1D3QB 3M35A 1SGTA 3HK6B 1T8MA 2F83A 2W7SA 5EW2H 2TRMA 3PO1B 3M7QA 4VGCB 4OS4A 4OS6A 2HOBA 3KQBA 2ANWA 1BQYA 2VJ1A 1YLCA 4XRNA 2GZ9A 1TX8A 2ODPA 3ZZ9A 1MMJN 3E8LA 2BD8A 3O8RA 3PLPA 1TMBH 1Y3UA 1HXEH 4AFSA 5HKKD 3UQOA 3A7ZA 3IG6B 1BBRK 1BTPA 3UNSA 2BY5X 2BZ6H 2QF3A 2A5IA 3ZZ8A 2BZAA 3TK6A 1VGCC 3QUMP 4NIVA 2KZ4A 3M5OA 1YPLH 3E1XB 2F9UA 3ZZ7A 2R3UA 3GCTG 1AI8H 2BLQA 4IBLH 3SGAE 1O2OA 2PHBA 1Z1IA 4RN6A 4BTTB 1FY3A 4YESB 1ELCA 3RXMA 1COWD 1MKWK 1MD7A 2FTMA 3HKIB 4R8TB 3LGYA 3RXHA 1EASA 4FUJA 2BY8X 2ZDMA 3A7VA 2Y82A 2JETC 3GY5A 1MQ5A 4A92A 1D9IA 3TLOA 2HNTF 2BVXH 4JYVH 1GMHG 4E7NA 3ZV9A 4IMQA 1GHAG 1GBKA 3A8AA 2UUYA 3MHWU 3MOCA 1A46H 1EUFA 4YTAA 1LVBA 3MNBA 2GV7A 1GI9B 4FVBA 2ZGHA 3EAJA 8ESTE 3OY5U 3TGJE 1V2MT 5CE1A 2D1JA 1Q2WA 5JBTA 4K5ZA 1E34B 1IQEA 1HAIH 3ZVDA 2ZI2H 1EOLA 5T6DA 1O3AA 1MD8A 1O38A 1C2FA 4QT8C 3ZZCA 3A89A 3SN8A 1C9PA 2BYAX 1THRH 4X6MA 1QR3E 3W95A 5AFYH 4LZ4B 1LVYA 4DJZB 1AZ8A 4B73A 3M5MA 3U69H 2XRCA 3H09A 4NA8A 3VB3A 2FX6A 2ZIQH 3GDUA 2ZWLH 2PUQH 4OGXA 4U30A 1NRRH 1UCYH 2GJGA 3RXOA 4BTUB 3LH3A 1SHHB 2ZU3A 1W0KD 1SGFG 4CR5A 2SGDE 5DN6D 2W7UA 1K1OA 2VIPA 3DUXH 2WPKS 1GGDC 2BX4A 2AHME 1S0QA 4Y7AA 1O2ZA 2FYQA 4GVUA 2A4GA 2KCOA 1AB9B 1HLTH 1OP0A 1VITG 1LHEH 1XKAC 1A5HA 1YBWA 3ODDA 2VH6A 3AAUA 3ODFA 3KF2A 1FQ3A 3MO9A 1BTHH 1GJ4H 4JCNA 1P3EA 5ABWA 1NRNH 2OC8A 1XUHA 1S82A 4YXWD 1W0YH 1GVKB 1GWAA 1GDQA 1TNIA 2ZGJA 3SQHE 3EQ0H 2W5EA 2ZF0H 5DP3A 1V6DA 2EI6A 1H9HE 1XX9A 3IWMA 3VGCC 1A5IA 4Y8ZA 3D65E 2EEKA 4BAKB 4D9RA 4TY7A 2EI8A 2FI4E 2KCPA 3GDSA 2NU3E 2KR7A 4HG6A 2GZ7A 3AVZA 3MNSA 1UTNA 3F9HA 5L2YH 5JYIA 2XNDD 1IHTH 1OWKA 3Q77A 4INHA 2F9NA 4LZ1H 1VZQH 3BEIB 3T27A 1HAYB 4KTSA 5FL7D 1SQAA 4DGJA 1ZTKA 1C1SA 3KQ5A 2BY7X 4OS7A 1WYKA 2BD4A 2FPZA 3CP7A 3D62A 1GBMA 4Y76A 2Z3DA 3ATIA 1YCPM 4XD7D 3PO1C 2SGQE 4VGCC 1P12E 1BZXE 2XTTB 3GISB 2ANMH 1CGHA 1PQAA 5H4IB 1DFPA 1QGFA 1C5SA 2GT7A 4Y8YA 1ZZZA 3RXLA 1H9LB 4CRCA 3QLPH 4KELA 1PPGE 1WU1A 1DSUA 2ODQA 3SNEA 3RXFA 3RXUA 3ZVGA 5A8ZA 1N1LA 3MNCA 4NGAH 1UO6A 5SGAE 1P8VC 1TPSA 2XXLA 1W11U 5DP7A 2RFKC 3SBKA 1SQTA 1QURH 2HLCA 1NS3A 1O3CA 1S6LA 1LKAA 1WQSA 1Z6EA 2OCVB 1AGJA 1GJBB 1CT2E 3GCHB 2ANKH 3PV5A 3VB4A 4ACAA 5GJ4B 2A1DB 1FY5A 2Y7ZA 1P0SH 1QCPA 1THPB 2R9PA 2SGAA 5DP4A 3RXKA 3UY9A 3SI4H 1GJ9B 1DWDH 1E38B 1O2MA 1GCTB 1VCQA 1Z6JH 3FKSD 4FETA 1C5LH 1O30A 1TYNA 1G3CA 1SC8U 3A8DA 1B0EA 3UTUH 1GHZA 3DSOA 4OS1A 2DE9A 1KDQA 1HAXB 1L1JA 3RMLH 1VR1H 1P2MA 3RXGA 3H7OA 1VCWA 2J97A 3URCA 1JRTA 2BDAA 6LPRA 2VU8E 1W13U 1GBFA 1LVMA 1UK3A 2BDCA 3RXDA 7GCHG 1F0UA 2ZKSA 8GCHG 3A82A 5EJ1A 3LJJA 4AG2A 2SGFE 4INKA 3BTEE 1FAKH 1MZDA 4RKJB 2UUKB 2C8YB 3IITA 2QC2A 3BTME 2ULLA 1NRSH 2HRVA 3SZEA 1O5CB 2OLGA 4O97A 4YLQH 1FUJA 2V3MA 1C2LA 4X2XA 3T25A 3VB6A 1O5GH 1UVSH 2HNTE 1E0FD 3RC6A 2WUCA 5C20A 3OY6U 1O33A 3MU5A 1F2SE 4JZ1A 2ODYB 2B9LA 3B8JA 4AGKA 4J2YB 1Z7KA 2JJ1D 4OGYA 1ESAA 1P57B 1CT0E 2GMTB 1Q31A 5G4BA 5J4SA 1TGBA 3T28A 1EZUC 1C5WB 5B6LA 5IK2D 5JB9S 4CH8B 5EJLA 3ZZ5A 1ELFA 1EX3A 1OX1A 4X1NU 4NZLA 1TQ7B 2NU4E 3AW0A 2JJ2D 2BMGB 1DXPA 2HLDD 1EB1H 2BD9A 2FOEA 1C4Y2 1V2QT 2J9NA 1GJ5H 2W3KA 5HMAA 4JYTA 3SU0A 4AB9A 3ZVEA 2ZECA 1O2WA 2J38A 2XWAA 1BJVA 2QYIA 4FOUC 4K60A 2H2ZA 2AH4X 4F49A 4GUXA 2J2UA 1KIGH 4FUCA 4WXVA 1MZAA 3MH6A 1D3TB 4A1XA 1FV9A 3ZZAA 1FY4A 1E1QD 2JKHA 4ABIA 3N7OA 1SGPE 3MH7A 1GHBF 1TWXB 1AUJA 3BEUA 1OWJA 1LDTT 1F5RA 4XSKU 1TABE 1BTYA 1O2GH 1ZJKA 1AFQC 8KME2 5TCAA 2LPRA 1UTKA 1K1JA 1TMUH 3AW1A 1FI8A 1ZPBA 4FU7A 2IPHA 1ELVA 2JH5D 4LK4A 2AYWA 4YZUA 1C1RA 3TNSA 1NFYA 3U9AH 2DUCA 5A0CA 1GHYH 1DS2E 1TGTA 1NBMD 5JPMH 1KLIH 5L2ZH 1S5SA 3A84A 3U1JB 3A7YA 4Z0KA 1DSTA 1C5OH 2QIQA 1GMDF 1RFNA 1TGCA 1TRMA 3HATH 4AGJA 2K0QA 5DK1A 3GY2A 1LHGH 3EYDA 1VJ9U 3TJOA 3SO3A 1C1NA 1HYLA 3PMJA 2CF8H 3ITIA 1NT1A 1V2UT 1TALA 2FDAA 3A7WA 2PTCE 3LGWA 1KY9A 4WVPE 3PWBA 3F1SB 4ZHAA 1DWEH 1EB2A 1GJ6A 1S83A 2C8ZB 2QY0B 4ISIH 6ESTA 1XM1A 3Q76A 5FHTA 2BOHB 2PGQB 3RU4T 7ESTE 2A7JA 1MU8B 1FPCH 2M2AA 1YPMH 2AMPA 2OK5A 3K6YA 2ASUB 1TNKA 4GCHG 3OU0A 3BTQE 9LPRA 2BY6X 3SV6A 2F4LA 4NSVA 4B2CA 3GCHC 4YLUA 4A6LA 2OC1A 2JETB 1O37A 5EIYA 4X6NA 2STAE 2XCFA 3P92A 2AMDA 3SV8A 2P3TB 2ZHEH 3GCTF 5FAHA 5BRRE 2SFAA 1WV7H 4TT3D 1GCTC 1S0RA 1GL1A 3SU5A 3QZQA 1QNJA 1IOEA 3QX5H 5C5NA 3QZRA 2A32A 2F9BH 1CHOG 4KTCA 1QL7A 4ZHLU 3A8BA 1OYTH 1C5TA 1BRAA 1GMHF 3KYFA 4NIWA 1GHAF 4ABDA 3ATWA 4TY6A 3NUMA 2FX4A 1UK2A 1E37B 4ABAA 4AYVB 2WV9A 3RXAA 3MNXA 3QWCH 4RT0A 4TSFD 1A4WH 1SGFA 1LVOA 1UTPA 1MAYA 3KNXA 4GPGA 4CREA 2PKAB 1K1LA 4MVNA 5A8YA 3SV9A 2XC0A 3SU4A 3UUZA 2QXIA 3VEQB 2HVXA 2VIDA 2ZHFH 3M3SA 5ESTE 4D7FA 3LH1A 4YOJA 3DSPA 1K21H 3FO8D 1V2VT 3PB1E 1RTFB 1V2PT 2GT8A 3U28C 2EC9H 3M5NA 1OYQA 1ELGA 2UWOA 2QA9E 2C93B 4WMEA 1TA2A 1QB6A 1AKSA 4CRGA 5A09A 5E0GA 3FOAA 3RUOA 3BTGE 1W0JD 2JIZD 1OKXA 4MNYA 2BD5A 2W3IA 2Z9GA 1N6XA 1BTXA 3JZ2B 2OQ5A 3ESTA 1P2NA 2G4UA 5C1XA 1H8DH 4F55A 3S0NA 3S9BA 1OWDA 3SNDA 2Y5GA 1L4DA 2CJIA 3UFAA 3RXJA 2Y81A 2IPQX 3BIUH 1SGCA 2YOLA 1KTTB 3F6UH 1VITF 3GCOA 3WW7A 4B2AA 1XUFA 2ZTYA 3M7TA 5CHAB 1N6YA 2CF9H 1DDJA 1OHHD 2FYRA 1QY6A 3SJIA 3VGCB 2HWLB 2BVSH 4UFGH 2ZCKP 2A4OA 1LO6A 3LDXH 1F7ZA 2YNAA 3EDXB 5IDKA 5J4QA 2OC0A 1EOJA 1G30B 2CV3A 3RP2A 4Y11E 3GY4A 1F0TA 1IQNA 3LIWA 4F48B 1Z1JA 4IGDA 1O31A 1RGQA 4H4FA 1YKTA 1HBTH 1SFQB 1AWHB 1GI3A 4ZKSU 3P8FA 3EE7A 1MBQA 1W0ZU 3LU9B 3F0OA 1SGQE 3L3TA 5F8TA 4D9QA 3BTWE 4UONA 3OE7D 2PKSB 5EJZA 4B74A 3SW2B 4E05H 2Y6TA 1ANCA 1G32B 1G3BA 1Y3XA 4YT7H 3FZDA 1AMHA 2IN2A 3ZYEA 2WV4A 1PYTC 5T6FA 2AMQA 4TWWA 3I77A 3D49H 1O5BB 1CA8B 1GI7B 3BTHE 3GY3A 5FX5A 1CU1A 1TBZH 1PPHE 2JDID 2CMYA 2BTCE 4Q63A 3F9GA 2GCTC 4K1EA 3QTVH 1ELTA 1KXFA 1UTJA 1CSOE 3ZV8A 1XVOA 3GS9A 3UPEA 1OP2A 5F8ZA 4CBNA 3LGTA 2YMSC 1C2JA 3SNBA 1NFXA 6GCHG 1NY22 2P3FH 2A31A 3DD2H 2VIVA 3N7EA 1D6WA 1L4ZA 5LGOA 1PQ5A 1C5ZB 5EXNA 1OS8A 2K8IA 5I25A 2VVVA 1ABIH 1P11E 2CGAA 3MH5A 1CQQA 1XUGA 2XBWA 4DW2U 2A7HA 1NU9A 4IC5A 1GI2A 4IW4E 1TIOA 5EXMA 4D76A 3LPRA 1GPZA 1KSNA 2R2MB 3TNTA 3RC5A 1BRUP 1XVMA 5DO4H 1C5UA 4IS5A 3TGIE 1G37A 2C90B 2H6MA 1FPHH 1QTFA 3OAAD 7LPRA 3PYHA 1GBHA 1Y5UT 1C2GA 1LKBA 3NRLA 1UW7A 1H8ED 1YCPK 3U8OH 1SOZA 1BJUA 1SGYE 2H9TH 1YP9A 3DA9B 1QRWA 2V7QD 2WINI 1KLTA 2FXRA 1CT4E 2V35A 1GHXH 2ZGXH 2BD2A 1RIWB 1XKBC 3LC5A 1H8IH 2EY4C 3VB5A 3HK3B 1RS0A 4IN1A 3LKWA 3DSGA 2HPPH 4HFPB 1N8OB 7KMEH 1DOJA 1MTVA 1SLWB 4X0WU 1CGJE 2AGEX 1GI5A 2STBE 1QJ1B 3ZVAA 2WPDD 1T4VH 1XXDA 1ELBA 1C1UH 4MTBA 2QAAA 1HJ8A 1NO9H 1HB0B 4XDEA 4B76A 4CRDA 3NPSA 2R0KA 2WPJS 1SR5C 3F2GA 2PV9B 4AC9A 4BAQB 5CDFE 4THNH 2B8OH 5DPAA 2UUJB 3BTFE 7GCHF 1ACBE 8GCHF 1VJAU 1L0ZA 3ZVFA 3SGBE 1TBRH 1QHRB 1S81A 2CK3D 2Y80A 5E8EH 4ZMAH 5FPYA 4JMYA 1HAPH 3L6PA 5K7RA 2VWLA 5TCCA 2AIPA 3SUEA 3KQCA 3RXTA 1HXFH 1IQJA 2V3OH 1UVTH 3Q3KA 4DT7B 1FN6A 4M7GA 1FDPA 3FN8A 1RTKA 3UNQA 3PMBB 3BG8A 2QGRA 3EGKH 4MNWA 1T32A 2V6NA 1UTOA 3SNCA 5CHAC 1GHVH 1O0DH 3MH4A 3OTJE 1DX5M 2A2QH 3OSYA 1FXYA 3BTKE 4UEHH 3MU8A 3F2HA 1C1WH 1ID5H 1O3KA 1ZRBA 3UIRA 1ZR0A 3NWUA 1FN8A 3QDZB 2G81E 1GBJA 1P05A 3A81A 2Q6FA 3OFND 3NZIA 4UE7H 1BTWA 1C1QA 3F68H 4Y8XA 1Z8JB 3R3GB 2A4QA 2ZTXA 1J9CH 1HJAC 3MYWA 4FUDA 1EATA 1AFQB 4IN2A 1DLKB 2PTNA 2FOGA 2P93A 2F9PA 4X1RU 1L2EA 4MPXA 4YM9A 1O3HA 1ETTH 3LONA 3MU1A 4ZXXH 1U6QA 2PKSC 1KXEA 2ZHWH 3LGUA 1BMLA 4Y71A 1O2IA 4M9FA 2BM2A 3LJOA 4KTUA 2PLXA 2Y5FA 3TVJB 1P2KA 2H5CA 1C2MA 3VXEH 1S6HA 4Q2KA 3K2UA 1GJCB 1MAXA 3P8NA 2LELA 2G5VA 3QO6A 4K2YA 5K0HA 1O2KA 2UWLA 2ZFFH 1ZGIA 1EZXC 3B9FH 4BAMB 1CO7E 1O2YA 2ZFRH 3E90B 2GP9B 1A3BH 1TNGA 3TH3H 3SU6A 2Z9LA 3ATLA 1O2PA 3PTBA 2ZEBA 5AFZH 3N7DA 1MTWA 2ZZUH 5DP6A 1GCDA 1A0JA 3PV2A 3STJA 1UJ1A 1HAZB 4ZAEA 1P09A 5GXPA 1PPZA 1Y3WA 1SGEE 3E3TA 3RXQA 1BOQA 2FIRH 4WMDA 1MKXH 4ZXYH 1QL9A 3UOPA 4LXBH 2F9VA 2SNVA 2ZPQA 4BANB 3DFJA 4Y7BA 5FXLA 4O3UA 1O2LA 1HCGA 3P95A 3FP8E 2ZU5A 3ZVBA 1K1NA 2D8WA 1TGNA 2GGVB 3M3VA 1J16A 5EPNA 3SUDA 2ZDAH 4GCHF 1ESBA 1YPHC 1DPOA 1ELDE 2FOHA 2ZC9H 1NC6A 1NN6A 5KECA 1MCTA 2PWXA 4DCDA 5DP9A 1RIWC 1BBRE 1AUTC 2KAIA 4B71A 1FIWA 1KYNA 2AS9A 3TITA 3UR9A 2KCAA 1AVGH 2A7CA 1N8OC 1SHYA 1A1RA 2GDEH 1WXRA 1O3PB 1SGDE 1D6RA 1RRKA 1O5EH 4ISLA 2P59A 1FNIA 1TAWA 2O8MA 1CHOF 1S6FA 1TRYA 3M36A 1UCYK 3PRDA 4K8YA 5JBCS 4Q80A 4YT6H 1BA8B 3U8TH 4ABFA 2A4RA 1TFXA 3O8DA 1G2LA 3E0PB 5FPSA 2CXVA 1EP5A 2VWNA 2SGPE 5E2PA 1ZJDA 4ZKOU 1V2OT 1YM0A 4A1VA 1IQKA 2R3YA 2ALPA 1F0SA 3QGJA 1AN1E 1IHSH 1H9IE 1HRTH 3M61U 5HIZA 2AGIX 4Y0YE 1NFWA 5KGOA 1LHDH 1MUEB 3BV9B 1AWFH 3A87A 2VB0A 1MH0A 1P04A 1ANDA 1PPFE 1ZTJA 2ZPSA 1TPAE 1YPEH 1BMAA 2B5TB 4BAOB 3OX7U 3TJVA 1EZSC 2FM2A 2GV6A 2O8WA 4B1TA 2OUAA 1KDQB 1SQOA 5GCHG 3TIUA 2WYJA 5HYOA 3FAOA 2XYAA 1O3FA 1F0RA 1BCUH 1WTHD 3C1KA 1SVPA 2PUXB 3KHVA 4DY7B 1ETSH 1ZSLA 2IJOB 2KAIB 4WXIA 4Y10E 5EQSA 2GCHG 1O2XA 1GDUA 2V0BA 1P2JA 4JZFH 4X2VA 1NPMA 3P8GA 4Q7YA 1EZQA 6CHAC 1VITH 2AFQB 1C5NH 1C2EA 3E6PH 1ANBA 3GOVB 1MTUA 4Z6AH 3ZIAD 3F2FA 5C2ZA 2QN5T 4E06H 1XMNB 1MBMA 3RXBA 1SOTA 4H6TA 5T3HA 3MU0A 1THSH 1G3DA 4X8UH 3OEHD 5ETXA 1W7GH 1GG6B 2H9HA 1HAVA 3S7HB 4MPUA 3LGVA 2FOBA 1QJ7B 2J94A 3A85A 3RDZA 5FBEA 1O32A 2LNCA 4X8SH 5C0UA 1T4UH 1GVLA 3OEED 2ZA5A 3TJNA 4CRBA 4CRFA 3V3MA 2VWMA 1A3EH 1SI5H 1EAIA 1NZQH 4XFQA 3RXCA 2ZDKA 2TGPZ 4JZIA 1S84A 2FTLE 2VH0A 1DANH 2GCTB 3LGIA 2B7DH 1GBLA 2FZZA 4Y6DA 1JIRA 4B6FA 1DT2A 1GBTA 2YNBA 1NM6A 4ZKNU 2WUBA 2RDEA 1H4WA 5B6OA 2VVCA 1QBNA 2PR3A 2YMSB 3UREA 1C2IA 1YY3A 4I8GA 5CHBA 1RJXB 4ISOA 1C1TA 1IQIA 3RMNH 5GWZA 1ANEA 1W10U 1WQVH 3PMHB 3TK9A 4CHAB 2ZTZA 1C4V2 1ELEE 2IOTA 2ZU4A 2J5UA 4ZCNA 3P6ZB 2XBVA 2OINA 2BLOA 4RT1A 1AHTH 4NA9H 2OP9A 1SFIA 1V2JT 4NIXA 1TRNA 1AY6H 3RU4E 2W6ID 4I86A 1PPEE 1CHGA 2SNWA 4U01A 2FESH 2KCYA 6GCHF 5C17A 1XUKA 1HAVB 3SU3A 2DE8A 3HGNA 1FY1A 2I6SA 1O3EA 4CR9A 3A88A 1FJSA 4UFDH 1YGCH 3GY8A 2P3UB 1T8OA 1GMCG 2A5KA 3UWJH 1AE5A 1MKWH 4UFEH 1AFEH 4J1YA 4INLA 3TJUA 1OWHA 4F4OC 2XC4A 2NU2E 3SUGA 5E0HA 4R0IA 3NKKA 2Y7XA 2Z9KA 2GX4A 1EAUA 1G2MA 3TPIZ 2ZNKH 3SQEE 1K9OE 4MNVA 1JBUH 3VXFH 1WOFA 3RLYH 1NESE 3PROA 5GNDA 1YLNA 4P00A 5DJ7A 3MFJA 4A5TS 2CHAB 2J92A 3I29A 5JDUB 1D3DB 1O3DA 3NK8A 2XW9A 3W1EA 1NRQH 4NG9H 1O36A 2Z94A 1FLEE 2ZHQH 4X2WA 1H8HD 3BF6H 1P3CA 4WY3A 3KQDA 2P8OB 3HGPA 4MDSA 1T7CA 4LOYH 2PSYA 1A0LA 1ZLRA 1F5LA 2QF4A 1TLDA 1Z8RA 3GY7A 3RM0H 2Z9JA 4K8BA 1C1MA 1XUJA 4GAWA 4HZHA 2ESTE 3BSQA 3SOSA 1BRBE 1AU8A 1EJMA 2Z3CA 3BTDE 5EXLA 1O2NA 2VWOA 1DICA 1D3PB 1QZ8A 1TGSZ 3P70B 1IQMA 1NTPA 1O3MA 4TPYA 2OXSA 1AZZA 2QV1A 3FP7E 3FFGA 1C9TA 1TONA 2H1UA 1FONA 2ZFTA 1JRSA 2TIOA 3F0PA 4KP0A 3SORA 1TNHA 2AERH 2W6JD 4H42U 5F03A 3U8RH 4DURA 3ZZDA 2QF5A 5DGJA 1QA0A 1UMAH 3RXIA 1ABJH 9ESTA 1ZMLA 5LPFA 1UK4A 1P2OA 2BQWB 2G8TA 2ZFSA 4GHQA 1TE0A 2J4IA 3OTPA 2Q1JA 2RA0A 1PQ8A 1UCYE 1W14U 1O2SA 1VCPA 2XOKD 4D7GA 1GBEA 1J15A 4D8NA 3T5FH 1HJAB 1Z71A 1E79D 1HAHH 1QB9A 4RKOB 4O03A 1X7AC 3AASA 3PLKA 1A7SA 4AOQA 1TOMH 5A0AE 1E1RD 1P2IA 4K1TA 1A61H 1L1GA 1GG6C 4WH6A 3QN7A 1JMOH 1AQ7A 4MNXA 4XBBA 3QGNB 1T8LA 5T6GA 1DM4B 1WDIA 2XBXA 1K22H 3N99A 1AKSB 2VBCA 5EODA 4YOIA 1HIAA 4CRAA 2ZG0H 2J98A
chains in the Genus database with same CATH topology
4AX9H 2Z6BD 1NROH 1ZMNA 1KXAA 1SL3A 2ZDVH 1HJ9A 4AFZA 1AIXH 3P8OA 3V12A 2TPIZ 3NCLA 2ZO3H 2P94A 2P16A 5EU8A 3UNRA 1BITA 2BVRH 3EA8A 4K69A 1H1BA 3BIVH 1ZHRA 4K3JA 2BDIA 4WJG2 3ZZBA 3H7TA 1EAXA 1J8AA 2QCYA 3PMAB 2P95A 4DIIH 3A80A 3ELAH 1TB6H 2TGTA 3GY6A 4RSPA 4ABHA 5DKMA 2D26C 1O3GA 1BB0B 3T26A 1SLXB 2QXGA 1DVAH 1DE7H 4BXSA 1DUAA 1EP6A 3A8CA 4CHAC 2H9EH 3SI3H 3S9AA 2ZQ2A 4Q7XA 1IQFA 5C1UA 4UD9H 1V2KT 3UQVA 1LTOA 3A86A 3Q3XA 5HGGA 3SNAA 1C5MD 2TGAA 4JZDH 5C1YA 4MG3A 1Y5BT 3F9EA 5EPYA 1O5AB 4TPIZ 2RCEA 3SU1A 3U98H 2ZGCA 1DLEA 2NU1E 5I46H 5L30H 1YPJH 1ETRH 1BTUA 2VVUA 2JH0D 2GKVE 1ZHPA 1O2TA 1HIAB 1B7XB 3LC3A 1C5VA 3ZZ6A 1G3EA 4FUHA 1QQ4A 1C2DA 4B75A 1SB1H 2GVFA 5DG6A 4UDWH 2BLVA 2A45B 2Z3EA 4MPVA 2WPHS 3SJOA 2HPQH 1O5DH 1ZYOA 1LMWB 1CA0C 2OBQA 1YPGH 1C5XB 4I7YH 3WY8A 4AB8A 2BXUH 2G55A 2CHAC 3U1IB 4JK6A 3MU4A 1FY8E 1BDAA 1UTLM 1CBWB 1XXFA 1CVWH 1MTNC 2XNIA 1EAWA 1KTSB 1ZPZA 1JOUB 2WPLS 1BHXF 1K1MA 1O2JA 3TH4H 3VB7A 1P06A 1Y3VA 2O9QA 1C1PA 2P8OC 3PV4A 4WWYA 1NU7B 1ARBA 1O3IA 3RU4D 5JB8S 2WV5A 1BIOA 3P17H 3M5LA 1MQ6A 4AN7A 1P10A 1O3LA 3R0FA 2OQUA 4YO9A 2ZP0H 4KGAA 2G4TA 3V7TA 1D4PB 1T31A 3S7KB 4FU8A 1ZSJA 1BMNH 3Q3YA 1BHXB 1B5GH 1KLJH 4X8VH 1BRCE 3H5CB 3FZZA 3TU7H 3O8CA 1SSXA 1SMFE 3K9XB 2BOKA 4ZH8A 5LPEA 1GDNA 4BTIB 1B0FA 5AF9H 3OYPA 3SU2A 1GJAB 1ZTLA 4O9VA 4FUIA 5JBBS 2SGEE 3SV7A 1C5RA 1INCA 2C8WB 1OP8A 6CHAB 1GJ7B 1TNLA 1GBAA 3BN9A 1ZHMA 2VNTA 2AIQA 2QXHA 5EQRA 1O2VA 1K28D 4U2WA 3TH2H 4DVAU 5GCHF 2ZHDA 1NFUA 1G9IE 3RMMH 1QFKH 4ISNA 1OXGA 2ZCHP 4XBDA 1LQEA 5C5OA 2BY9X 2BD7A 2GDDA 4DG4A 2Z9IA 3GYLB 5E2OA 2B0FA 2GCHF 1EJNA 1WTGH 2BB4A 1A5GH 1A0HB 3PWCA 4BOHA 4JYUH 3PTNA 1YPKH 4I33A 1HAGE 1T8NA 8LPRA 3EE0B 1BTZA 1IQGA 1FIZA 3SUFA 1FZZA 2VIOA 4I31A 1QRXA 1GBDA 2XCNA 3M7UA 4NWKA 2F9OA 2FOFA 1P03A 4XBCA 3FP6E 2BX3A 2UWPA 1EPTA 4TYDA 3CS7A 3GDVA 2GZ8A 1LPZB 2O8UA 2EA3A 3S9CA 1OWEA 2VIWA 3GYMA 4Y0ZE 2FS8A 1C5QA 1WAYB 3TK5A 5JBAS 1O35A 1W8BH 5HXFA 2EI7A 1F92A 1QBOA 3DFLA 1EKBB 2ANYA 4NCYA 1JWTA 4AYYB 1OWIA 2G00A 3S69A 5L6NH 2FOCA 4XOJA 4AG1A 3ZZ3A 1GBIA 2VGCB 3EA9A 2C4FH 1DY8A 5LH8A 2OD3B 2BHGA 3MI4A 2Y5HA 5AHGH 1PPCE 1DUEA 1TQ0B 2BLWA 4I8HA 5A8XA 2QF0A 2R0LA 2G5NA 1GBCA 1HFDA 1HUTH 1TBQH 2O8LA 2ZU1A 1P9SA 4Y79A 1L1NA 1P9UA 2RG3A 4WH8A 2I6QA 2WPIS 3E16B 3E91A 4ZUHA 3EA7A 3L33A 2ZDNA 1JXPA 3MO6A 4WMFA 5EOKA 2FOAA 1SBWA 1P02A 1HV7A 5C67A 1K1IA 1V2ST 2F3CE 1DWBH 4BXWA 1DITH 2FOMB 4WF8A 3SJ9A 1RD3B 3STIA 5C3NA 1O3NA 1YYY1 5CMXH 1O34A 1EPTB 3A7XA 1ZRKA 3TGKE 3T62A 2H5DA 4FU9A 3K6ZA 1RXPA 1YPHE 3T2NA 1GMCF 2FMJA 5HM9A 1QQUA 2M5TA 5FPTA 1C5PA 4X2YA 1TMTH 2JH6D 4O3TA 1PYTD 4U32A 1IAUA 3V0XA 1QB1A 1HNEE 4FXGH 5A2MH 2ZFQH 1MCVA 3SGQE 5EW1H 1O3BA 2WPMS 1CBWC 3FANA 1AD8H 1HGTH 2K1QA 3LOXA 4I8LA 1SGRE 2XBYA 5GIBA 1EXFA 4X1SU 1LPKB 5F6MA 5EQQA 4PROA 3K65B 2UUFB 1Y59T 4ZHMU 2HNTC 4GLYA 4ASHA 3RXPA 1MU6B 1ORFA 1HAOH 3ENSB 1M9UA 4ABJA 1CE5A 1LHFH 2XWBI 3QTOH 1YF4A 4NZQA 4OS2A 2ILNA 4B2BA 2FP7B 1QRZA 3SJ8A 1OSSA 4Q7ZA 1GVZA 1E36B 1BMMH 4HI3A 1AE8H 3RXEA 1PJPA 4KKDA 3SHAH 1AB9C 2VIQA 1PPBH 1HDTH 5E0JA 1GI8B 1O3JA 3I78A 2R2WU 2GD4B 2ZU2A 3DT0H 3HKJB 1F5KU 2BDHA 1PQ7A 4GSOA 3ZYDA 2FS9A 1WUNH 1ARCA 3DHKH 3SV2H 2FI5E 2BDYA 1WBGB 4HGCA 1CGIE 4ZROA 2ZDLA 4NFEA 1UVPA 4X8TH 1Y5AT 1V3XA 2OTVA 2Q6DA 1ZGVA 1LHCH 3NXPA 3T29A 1G36A 2GTBA 1W2KH 2FODA 3SZNA 3F9FA 1TOCB 4A1TA 1GI1A 1C2KA 5HM2A 3FVFB 1XUIA 1ESTA 2O8TA 2HALA 4ISHH 3MO3A 3ZVCA 2OBOA 1OPHB 5GPIB 1O2QA 4DIHH 4X1PU 4FUFA 1E35B 2QXJA 3PM3A 1BT7A 3ATMA 2Q6GA 3B23B 1BUIA 1SPJA 3C27B 1V2LT 3VPKA 2PFEA 1RTLA 3BEFB 2G52A 4YOGA 1SG8B 3VFEA 3A7TA 3O8BA 2FI3E 1ELAA 1K2I1 3BG4B 2BDGA 1EJAA 1YLDA 4AORA 4NSYA 3CS0A 4CH2B 3KQEA 1C4U2 4H6SB 1QA7A 1TPOA 2J34A 3SJKA 4AFQA 4DOQA 2ZGBH 3A83A 3CENA 4ABEA 5FCKA 3KL6A 3RC4A 1C2HA 2A0QB 4ABBA 1TNJA 5EGMA 1DXWA 2RA3A 4X6PA 4XE4A 4HTCH 1Z8GA 5F8XA 1UHBA 4ABGA 2BXTH 4SGBE 3URDA 4AFUA 1J14A 3AAVA 4A7IB 1MKXK 2FO9A 1NRPH 1Z8IB 1BBRH 1VGCB 1Y3YA 2ZQ1A 2PKAA 1MTSA 2VGCC 1C1OA 1KXDA 1GI6A 1UVOA 1O2RA 1WCZA 2OC7A 3RXVA 3M3TA 4IMZA 4BAHB 1GJDB 1O2UA 4MPWA 1EQ9A 2ZPRA 3UR6A 4I8JA 2FLRH 1AVWA 4ZKRU 1J17T 2W26A 4AZ2B 2C3SA 1QJ6B 5PTPA 1ZMJA 1OOKB 3GICB 4NIYA 2NU0E 1O5FH 4FVDA 3QK1A 4NFFA 1GJ8B 2THFB 3BTTE 1CA0B 3KGPA 3MWIU 1ZSKA 3RM2H 1GBBA 1YCPH 1EPTC 4IC6A 1ZPCA 1AO5A 1HPGA 1GHWH 1K1PA 1ZOMA 1JIMA 5FX6A 1MTNB 3LT3A 2F91A 2VINA 3Q00A 4X1QU 5GDSH 4MLFB 5TJXA 1V2TT 3RMOH 3G01A 1O2HA 1UHBB 1V2RT 3KEEA 1O3OA 4FUEA 1QBVH 1PFXC 2FWWA 1W12U 1LCYA 2G51A 1AVXA 3ATKA 5FCRA 3RXSA 1FMGA 4UFFH 4FUBA 1DY9A 3RLWH 1IQLA 2J95A 1V2NT 5AVDA 1UTQA 1W3CA 1TX6A 2ZFPH 4E7RG 1WSSH 2XC5A 4TWYA 2TGDA 1P2QA 4SGAE 1GGDB 2BQ7B 4CBOA 1GI0A 3KCGH 2ZCLP 3SHCH 1IQHA 3HPTB 3KIDU 3E0NB 3MMGA 5IYTA 2Z7FE 1FAXA 2WYGA 3GCNA 2CN0H 2BD3A 3M37A 2D2DA 2A2XH 3MTYA 2FEQH 2ALVA 1UVUH 2GMTC 2BDBA 5ESBA 3JZ1B 1KXCA 1O39A 2NWNA 5BPEA 1UTMA 3V13A 5FBIA 1SLVB 3W94A 1TX7A 3PLBA 1GHBG 1Y8TA 2AGGX 4MQAA 3ZZ4A 1GL0E 2PW8H 2PSXA 5DP8A 2C8XB 1S85A 1GI4A 2HGTH 4OS5A 3D23A 4I32A 2V3HH 1SGNE 4NA7A 1LQDB 5A0BA 1DWCH 4FUGA 1SGIB 1P01A 4BNRA 3UOUA 2A5AA 2AEIH 1A2CH 1V2WT 4I8KA 1C1VH 4JK5A 2FLBH 1TPPA 2RDLA 1QIXB 4K1SA 1GMDG 1W7XH 4NWLA 1SLUB 3UWIA 1YC0A 4ESTE 1Q3XA 1C5YB 1LPGB 1KXBA 5DP5A 4X6OA 2BQ6B 5EG4A 2PGBB 2TBSA 5LPRA 4JZEH 3KN2A 1TA6A 3RXRA 1QL8A 3BG4C 1D3QB 3M35A 1SGTA 3HK6B 1T8MA 2F83A 2W7SA 5EW2H 2TRMA 3PO1B 3M7QA 4VGCB 4OS4A 4OS6A 2HOBA 3KQBA 2ANWA 1BQYA 2VJ1A 1YLCA 2GZ9A 1TX8A 2ODPA 3ZZ9A 1MMJN 3E8LA 2BD8A 3O8RA 3PLPA 1TMBH 1Y3UA 1HXEH 4AFSA 3UQOA 3A7ZA 3IG6B 1BBRK 1BTPA 3UNSA 2BY5X 2BZ6H 2QF3A 2A5IA 3ZZ8A 2BZAA 3TK6A 1VGCC 3QUMP 4NIVA 3M5OA 1YPLH 3E1XB 2F9UA 3ZZ7A 2R3UA 3GCTG 1AI8H 2BLQA 4IBLH 3SGAE 1O2OA 2PHBA 1Z1IA 4RN6A 4BTTB 1FY3A 4YESB 1ELCA 3RXMA 1MKWK 1MD7A 2FTMA 3HKIB 4R8TB 3LGYA 3RXHA 1EASA 4FUJA 2BY8X 2ZDMA 3A7VA 2Y82A 2JETC 3GY5A 1MQ5A 4A92A 1D9IA 3TLOA 2HNTF 2BVXH 4JYVH 1GMHG 4E7NA 3ZV9A 4IMQA 1GHAG 1GBKA 3A8AA 2UUYA 3MHWU 3MOCA 1A46H 1EUFA 4YTAA 1LVBA 3MNBA 2GV7A 1GI9B 4FVBA 2ZGHA 3EAJA 8ESTE 3OY5U 3TGJE 1V2MT 5CE1A 2D1JA 1Q2WA 5JBTA 4K5ZA 1E34B 1IQEA 1HAIH 3ZVDA 2ZI2H 1EOLA 5T6DA 1O3AA 1MD8A 1O38A 1C2FA 4QT8C 3ZZCA 3A89A 3SN8A 1C9PA 2BYAX 1THRH 4X6MA 1QR3E 3W95A 5AFYH 4LZ4B 1LVYA 4DJZB 1AZ8A 4B73A 3M5MA 3U69H 2XRCA 4NA8A 3VB3A 2FX6A 2ZIQH 3GDUA 2ZWLH 2PUQH 4OGXA 4U30A 1NRRH 1UCYH 3RXOA 4BTUB 3LH3A 1SHHB 2ZU3A 1SGFG 4CR5A 2SGDE 2W7UA 1K1OA 2VIPA 3DUXH 2WPKS 1GGDC 2BX4A 1S0QA 4Y7AA 1O2ZA 2FYQA 4GVUA 2A4GA 1AB9B 1HLTH 1OP0A 1VITG 1LHEH 1XKAC 1A5HA 1YBWA 3ODDA 2VH6A 3AAUA 3ODFA 3KF2A 1FQ3A 3MO9A 1BTHH 1GJ4H 4JCNA 1P3EA 5ABWA 1NRNH 2OC8A 1XUHA 1S82A 1W0YH 1GVKB 1GWAA 1GDQA 1TNIA 2ZGJA 3SQHE 3EQ0H 2W5EA 2ZF0H 5DP3A 1V6DA 2EI6A 1H9HE 1XX9A 3IWMA 3VGCC 1A5IA 4Y8ZA 3D65E 2EEKA 4BAKB 4D9RA 4TY7A 2EI8A 2FI4E 3GDSA 2NU3E 2GZ7A 3AVZA 3MNSA 1UTNA 3F9HA 5L2YH 5JYIA 1IHTH 1OWKA 3Q77A 4INHA 2F9NA 4LZ1H 1VZQH 3BEIB 3T27A 1HAYB 4KTSA 1SQAA 4DGJA 1ZTKA 1C1SA 2BY7X 4OS7A 1WYKA 2BD4A 2FPZA 3CP7A 3D62A 1GBMA 4Y76A 2Z3DA 3ATIA 1YCPM 3PO1C 2SGQE 4VGCC 1P12E 1BZXE 2XTTB 3GISB 2ANMH 1CGHA 1PQAA 5H4IB 1DFPA 1QGFA 1C5SA 2GT7A 4Y8YA 1ZZZA 3RXLA 1H9LB 4CRCA 3QLPH 4KELA 1PPGE 1WU1A 1DSUA 2ODQA 3SNEA 3RXFA 3RXUA 3ZVGA 5A8ZA 1N1LA 3MNCA 4NGAH 1UO6A 5SGAE 1P8VC 1TPSA 2XXLA 1W11U 5DP7A 3SBKA 1SQTA 1QURH 2HLCA 1NS3A 1O3CA 1LKAA 1WQSA 1Z6EA 2OCVB 1AGJA 1GJBB 1CT2E 3GCHB 2ANKH 3VB4A 5GJ4B 2A1DB 1FY5A 2Y7ZA 1P0SH 1QCPA 1THPB 2R9PA 2SGAA 5DP4A 3RXKA 3UY9A 3SI4H 1GJ9B 1DWDH 1E38B 1O2MA 1GCTB 1VCQA 1Z6JH 1C5LH 1O30A 1TYNA 1G3CA 1SC8U 3A8DA 1B0EA 3UTUH 1GHZA 4OS1A 2DE9A 1KDQA 1HAXB 1L1JA 3RMLH 1VR1H 1P2MA 3RXGA 3H7OA 1VCWA 3URCA 1JRTA 2BDAA 6LPRA 2VU8E 1W13U 1GBFA 1LVMA 1UK3A 2BDCA 3RXDA 7GCHG 1F0UA 2ZKSA 8GCHG 3A82A 3LJJA 4AG2A 2SGFE 4INKA 3BTEE 1FAKH 1MZDA 4RKJB 2UUKB 2C8YB 3IITA 2QC2A 3BTME 2ULLA 1NRSH 2HRVA 1O5CB 2OLGA 4O97A 4YLQH 1FUJA 1C2LA 4X2XA 3T25A 3VB6A 1O5GH 1UVSH 2HNTE 1E0FD 3RC6A 2WUCA 5C20A 3OY6U <