1GVLA

Human prokallikrein 6 (hk6)/ prozyme/ proprotease m/ proneurosin
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
223
structure length
223
Chain Sequence
KLVHGGPCDKTSHPYQAALYTSGHLLCGGVLIHPLWVLTAAHCKKPNLQVFLGKHNLRQQESSQEQSSVVRAVIHPDYDAASHDQDIMLLRLARPAKLSELIQPLPLERDCSAQTTSCHILGWGKTADGDFPDTIQCAYIHLVSREECEHAYPGQITQNMLCAGDEKYGKDSCQGDSGGPLVCGDHLRGLVSWGNIPCGSKEKPGVYTNVCRYTNWIQKTIQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Structure of Human Prokallikrein 6 Reveals a Novel Activation Mechanism for the Kallikrein Family.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords KALLIKREIN 6
total genus 49
structure length 223
sequence length 223
ec nomenclature
pdb deposition date 2002-02-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1gvlA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1gvlA02
1FN8A 3MFJA 2VWNA 5I46H 1P8VC 1UCYK 4NA8A 4AYYB 2BHGA 1GJ4H 4MPUA 3PO1C 1K22H 2RA3A 1QJ1B 1C5LH 1XUHA 2ZQ1A 1GBHA 2ZG0H 1RTLA 4ZKNU 1O2XA 3ZYDA 1VJAU 5A8ZA 4UDWH 4NIXA 2BD3A 3UOUA 2WUBA 2F91A 1DVAH 1RIWC 4CBNA 2P94A 4D7FA 1ZHRA 2Z6BD 1UVOA 1V2ST 1S0QA 4MG3A 2P16A 4VGCB 2BLWA 1ZPZA 2ZHQH 3SJ8A 1YF4A 1DLKB 1C1RA 2A5IA 3KN2A 5EODA 1HJ9A 2BDAA 5EXNA 1O3MA 1SL3A 5F6MA 3UQVA 1UTMA 1RXPA 2I6QA 2CN0H 1W14U 1QURH 3RMMH 3DFLA 1NFUA 1H1BA 2AMPA 5JBTA 2RA0A 1LVBA 2M5TA 2Q1JA 4UD9H 1LVOA 3PLBA 2ZPSA 5A8XA 2FM2A 1A46H 2G52A 1P2OA 1B0EA 2HRVA 1Z1IA 1W13U 4BXSA 3FP7E 1VITG 1O3PB 4Y7AA 2Z3EA 4UFEH 1EZXC 2ZGHA 3KF2A 1LO6A 1YLCA 2FI4E 3TJOA 2FZZA 2C90B 5L6NH 4CR9A 1WQVH 2GCHF 4Y10E 3SI4H 3OU0A 3L3TA 1T31A 3W95A 1FY8E 1WSSH 3FAOA 3QTVH 5HMAA 4FU8A 4I8HA 1H9HE 3H7TA 1CA8B 1W3CA 2BD7A 3BF6H 1P3CA 3GY5A 1JWTA 1MD7A 1HAGE 1K1PA 1L2EA 2UUJB 3DT0H 1GI7B 1Q3XA 3VGCC 3P70B 3D23A 2A31A 4AFUA 1GMCF 1FV9A 1A3EH 1IHTH 5A0AE 1P11E 2BQWB 2C3SA 2UWOA 4TWWA 3PTBA 3MU0A 2GDDA 1TALA 3EA9A 2TRMA 5AVDA 3A87A 3AAVA 1TFXA 1P09A 3OY5U 5JDUB 1D3DB 3SUGA 1V2JT 3BV9B 1AKSA 1HV7A 1CA0B 5F03A 2SGDE 4YOGA 3SU5A 3T62A 1BOQA 1DY9A 2BD8A 3M36A 1HJ8A 5FPYA 2YNBA 1O2ZA 2PTNA 2STBE 1GHAF 1MBMA 1O2LA 2R0LA 2FS9A 3SU4A 5C2ZA 1HDTH 4OGXA 4Y0YE 3VGCB 3VPKA 1ZMNA 3UY9A 1L0ZA 1FY4A 2ANMH 1HNEE 2ZTXA 2J9NA 1EJMA 3NUMA 2Y5GA 1GHBG 4ZH8A 3IWMA 1YPEH 2OXSA 2Z9IA 2OBQA 2Y7XA 2EA3A 1FN6A 3LONA 3WY8A 3DD2H 1TOMH 1KLIH 1YC0A 1ZJDA 4ISLA 4B1TA 3SORA 1DX5M 1SGDE 4GAWA 3U98H 3BTKE 3TU7H 1CHOF 1AFQC 1HAPH 4D8NA 4MDSA 1L4DA 4ISNA 1GBJA 1SGYE 3RXCA 3LPRA 1DXWA 1TOCB 3JZ1B 4B2CA 1AFQB 2OTVA 3SNAA 1O38A 3BIVH 4IN2A 2J94A 1TQ0B 1NT1A 3SI3H 1BITA 1P57B 1IHSH 2VIWA 1CHGA 1BT7A 2VIOA 2ZEBA 1GMCG 2BOHB 5HXFA 4FUGA 4I8JA 2BVXH 8ESTE 1V2QT 1GI2A 5L2YH 1VCPA 1MH0A 5E0JA 5L2ZH 3GCHC 4KELA 1EASA 5FPSA 5JB9S 1MU6B 1V2PT 1TB6H 3KEEA 4HTCH 1G3BA 2SFAA 4KTCA 2HPPH 3HATH 1Z6EA 1NM6A 1V6DA 3MU8A 2R3UA 2OP9A 4Q7XA 5CMXH 3LDXH 1SFQB 1Z8RA 4O9VA 1S6HA 4Y8ZA 2BM2A 1QIXB 1AVGH 3A7WA 4Q80A 2WPHS 3FANA 3STIA 4H42U 1O3DA 4GCHF 5EQRA 1LPGB 2OC8A 1DITH 2ZPQA 4X6NA 1MBQA 2ESTE 3LGUA 2QC2A 1GJDB 3SV8A 4FUHA 1C2DA 5DP9A 4DVAU 1UO6A 2XC5A 4ISIH 4IS5A 1AHTH 2VB0A 1XKBC 2BD2A 1NO9H 5DGJA 1MAXA 3PLKA 5CHAB 1GJAB 1ZTJA 3M3TA 3MWIU 2AGGX 2IN2A 4WH6A 1T8LA 5GIBA 3TH4H 1KXCA 1C5PA 3SQHE 1JBUH 1GBDA 4Y6DA 3Q3XA 4MPWA 5EXMA 1C2FA 3ENSB 5C67A 3S9BA 1SI5H 1C2EA 3FP6E 2VIVA 1CGIE 3DFJA 3BEIB 1C4V2 1P12E 3RUOA 2OCVB 1TX8A 1FUJA 1GHXH 1UVPA 2H5DA 4F49A 4JK6A 2CGAA 1QTFA 1S0RA 1TRMA 1A1RA 3ZVFA 3GISB 2H6MA 3SJIA 4XDEA 1N6YA 3A7ZA 1C1SA 2VVUA 2AIQA 3LGWA 4MQAA 1A0JA 4XFQA 1A0HB 5HGGA 3U69H 1TA2A 2PKAA 3TNTA 1TABE 2P8OB 1J14A 4NFFA 1A4WH 1HXFH 2QA9E 3M7UA 1DOJA 1C2LA 1C5UA 2QY0B 2ALPA 5DP7A 1XX9A 4X1QU 2HOBA 3V3MA 1H4WA 1Y3VA 1AI8H 2ZTYA 4NG9H 3A8DA 1EUFA 2ZWLH 1BIOA 2ZU1A 3NCLA 1TNKA 1TPPA 1KXAA 1CBWC 1RFNA 1MU8B 1Z8IB 2HPQH 2H1UA 1PPFE 3A83A 3GDVA 1V2UT 1C5QA 2XW9A 1A7SA 1WAYB 1UTKA 2PR3A 2EEKA 2GDEH 2AH4X 1AGJA 3AAUA 1P03A 3ITIA 1IQIA 1Y5AT 1K2I1 2BLOA 2BD4A 3RU4T 2ZCHP 2Z9GA 1QL7A 3BTGE 4DGJA 1GI5A 1SOZA 3RXMA 3PM3A 2VWOA 1O3LA 1O2WA 3GICB 2R2WU 3ZZ6A 1O3IA 2O8TA 1ZRKA 3T25A 3KL6A 3NZIA 1CT2E 2A7HA 3QGNB 1E0FD 2RDLA 1S81A 3PTNA 1SFIA 5AF9H 3A82A 3KQDA 3F9GA 1D9IA 3LH1A 1P2IA 2VIQA 2C8XB 1EATA 1MD8A 1O35A 1JRSA 1QGFA 2PW8H 2EI6A 5JBAS 1QRWA 2BLQA 1HRTH 1DANH 3QLPH 7ESTE 1ZZZA 2F9OA 1AD8H 4RKJB 4THNH 1O3FA 1P01A 4DY7B 1W10U 3ZZ8A 3S9AA 4MVNA 1DWEH 2Z7FE 2EC9H 3PLPA 1B5GH 1BBRK 1GHYH 3GYMA 4TPYA 1BB0B 1KTTB 1FIZA 3RXBA 1VCWA 3S7KB 3PV4A 1UK4A 3TK6A 3ZVDA 5GJ4B 1HUTH 2A0QB 3MU4A 2BDGA 2XBWA 5AHGH 1OWKA 4X6OA 4WMDA 4BAHB 1IQNA 3LJJA 3QK1A 3LT3A 1G2MA 2GV6A 3HPTB 1BRBE 1GBKA 2ANWA 4Q7YA 1NRPH 1EB1H 2WPLS 5EU8A 1GI8B 3TGJE 3A84A 4LK4A 1GMDG 4X6MA 1O3KA 3CS7A 1BTZA 2ZC9H 2YOLA 1SHYA 1UCYH 4INHA 3UNRA 1CGJE 2BMGB 2ZGXH 1C1PA 2VU8E 2F9UA 4X1SU 1VR1H 1AMHA 1W0ZU 4NFEA 4CRCA 3KQBA 3O8CA 2FOMB 3VFEA 4O3UA 5DP8A 1ZR0A 1C5TA 1JIMA 4JCNA 1KTSB 3GDUA 2STAE 1T4VH 4FXGH 5F8XA 1EXFA 1TMBH 2R2MB 4CRBA 4TYDA 1GCTC 4DURA 1SMFE 3BTME 3SW2B 1O2PA 7LPRA 3KQCA 1IQJA 2KAIA 4TPIZ 3BEFB 3URCA 1YPGH 4XBBA 2FXRA 4H6SB 3A8AA 2Z3DA 3F6UH 2AGIX 1FPCH 1WCZA 3M3SA 1XMNB 2ZHEH 1E34B 2PV9B 4BTIB 3BTHE 3GDSA 1GVLA 2B7DH 1RS0A 1T8NA 1TGBA 3GY6A 1RJXB 1FAXA 1OX1A 3E0PB 3E1XB 4R0IA 3S69A 1QCPA 4NIWA 1HAOH 3MO3A 2OINA 2FOAA 3LGIA 1XUJA 1HJAB 2Y81A 4U2WA 3UWIA 4GLYA 4FUFA 4YM9A 4K60A 3S9CA 2ZECA 1UK2A 2DE8A 4ZKSU 4CBOA 4X8TH 2F9PA 2FOEA 1C5YB 1QA0A 2GCHG 2PHBA 3F9EA 1C2HA 2BVRH 1HIAB 3SV9A 3D62A 3ELAH 1HBTH 5CE1A 3T29A 3RXJA 2GKVE 2LPRA 1EZUC 1YPHE 1GJBB 1O5FH 2GCTB 5B6OA 1LVYA 3UREA 4UEHH 5A0BA 3ATKA 2JH5D 2GCTC 1O2SA 2V35A 3SN8A 4TY6A 1RD3B 3NKKA 3S7HB 1O3OA 2Z94A 1GHZA 4WY3A 3LKWA 3A80A 3K6ZA 1UHBB 1O36A 2OD3B 3GCNA 5BPEA 1HYLA 1FONA 2Z9JA 1F0UA 2ZPRA 1OWIA 3BTDE 4YOJA 4IC5A 1AVXA 1E37B 3EDXB 3PMBB 2BTCE 4BAMB 1GI0A 4RKOB 1TBQH 2PKAB 4DW2U 3M5NA 5FXLA 1TGSZ 3PMAB 1SVPA 3RC4A 1GMHF 4X2XA 1BHXB 3P8NA 1AUTC 3ATLA 5DP4A 3SHCH 2W5EA 4GSOA 1NN6A 1ZLRA 3ZVEA 2PUQH 3FZDA 4DG4A 3U8TH 1O3NA 2FP7B 1EAIA 5DJ7A 2A4OA 4AB8A 4AN7A 4DCDA 1GCTB 2A2XH 1M9UA 4NZLA 2BXUH 1G32B 1V2MT 4KTSA 3UIRA 1LPKB 4INKA 1SLXB 2C4FH 4XBCA 1UMAH 1MTNB 3F1SB 5EQQA 2ZGBH 2IJOB 3TNSA 3ATWA 4QT8C 1C1UH 1VZQH 5EGMA 1ZGIA 1NFXA 4IW4E 1QHRB 3E3TA 3MMGA 3M35A 3VB5A 1PPHE 1TGNA 1TRYA 3TJUA 4ZROA 1WUNH 3LGVA 2NU2E 4U30A 1VGCB 1MQ6A 5JBCS 5LPRA 5EOKA 2A5KA 3E91A 3T27A 1BTUA 5C3NA 3E8LA 1UTOA 4Y79A 4ISOA 4I32A 1GDNA 2ZNKH 2OC0A 1C4U2 2TIOA 1C4Y2 2CHAC 4GVUA 4LZ1H 1Z6JH 4UFFH 2VGCC 1OSSA 1XKAC 1AB9C 1OWJA 5HM2A 1WTGH 1EOJA 1F5RA 4I31A 2BLVA 2H9EH 1AN1E 2XYAA 5TCAA 2JETB 1UJ1A 2SGEE 3PB1E 3ZV8A 1TIOA 2A2QH 3RXKA 1XVMA 4K2YA 5EXLA 1EQ9A 3CS0A 1OWDA 4ZMAH 1Q31A 1G3EA 5E2PA 1VITF 3D49H 3MNCA 3MH4A 3EE0B 1NRSH 1EJNA 1SGNE 3RXTA 3GCTF 2RG3A 1J17T 5ESBA 4XOJA 4NIVA 3MO9A 1XM1A 3TJNA 2BDBA 1AIXH 1GL1A 1O2JA 1T8MA 4A7IB 1C5WB 1O2GH 1Z1JA 2AGEX 1FAKH 1C5NH 4I7YH 1TMTH 3LGYA 4NSYA 2P3FH 1DY8A 2B5TB 2QXHA 2H2ZA 1AQ7A 1C9PA 2UUKB 3SHAH 3ZZ3A 2BY6X 1AB9B 1ACBE 1LHEH 2VGCB 1ETTH 4WWYA 1B7XB 2CHAB 1THSH 3ZZ5A 2ZI2H 2GP9B 2ZGCA 4MTBA 1ETSH 1FY5A 2A7JA 4B73A 1NTPA 4YLQH 3ZZ4A 5FBIA 1BRAA 2OC1A 4LOYH 1AKSB 1CBWB 4OS1A 1JXPA 1ABIH 1ELGA 5HM9A 4AFQA 2EI7A 1VGCC 1Y8TA 3SU0A 1Y3XA 3KGPA 1Q2WA 3KQEA 1Z8GA 5EQSA 2BY7X 3DUXH 1C5VA 1XXDA 2XWAA 3QX5H 4Q7ZA 1Z8JB 5DP5A 2VNTA 2YNAA 2C8WB 1LQDB 2ZCKP 3LIWA 4X2VA 5DO4H 2ZQ2A 1GJ7B 2OLGA 1O3HA 5C1XA 2PSYA 2BDCA 1C2KA 5DG6A 4UFGH 2A4RA 2BYAX 3GOVB 4AG1A 4Z0KA 6CHAB 2J34A 2Z9LA 4H6TA 1PQ7A 1O2NA 1L1GA 2SGFE 2QYIA 3Q77A 4GHQA 1OOKB 4YT7H 3L6PA 4K69A 2FTLE 1LQEA 3RXIA 2UWPA 1PYTC 1K1NA 5FAHA 1Z7KA 1YPLH 2A32A 1QQUA 2QAAA 2XC4A 1L1NA 2QN5T 4KTUA 4X1NU 1BRUP 1BA8B 1QFKH 4A1XA 1P9UA 1TNJA 2BY8X 3QZRA 2XCFA 1SR5C 1GHWH 1V2WT 3FP8E 1V2RT 4B71A 2FTMA 1NS3A 5DP6A 1S5SA 4ZHLU 4IBLH 5T6GA 1GWAA 2J4IA 1WBGB 4OS6A 5G4BA 2AMQA 1DS2E 5TJXA 4E06H 1YCPK 1YM0A 3UR9A 1MKWH 1DUEA 3SQEE 3V0XA 1ZPCA 4J1YA 1F0RA 3UFAA 2FPZA 3RXLA 2ZCLP 5TCCA 3M3VA 2Y6TA 1O32A 4YOIA 2FOCA 1P04A 3A7VA 2ANKH 3P8OA 1OKXA 3SU6A 1PJPA 4D76A 2WPIS 3LH3A 1A5HA 3RDZA 3A7TA 1DPOA 1GJ5H 4CRDA 3RM2H 3SJ9A 4B75A 1SHHB 2K1QA 3TGIE 1HJAC 4DIHH 2HNTC 1DWCH 4WF8A 3IITA 4KKDA 4NWKA 1PYTD 1AWFH 3TITA 1ARCA 1ANBA 3A7XA 3P95A 1EP5A 1ZRBA 2F3CE 2BDYA 2J95A 3PWBA 1BBRE 3M61U 1ZSLA 2ZDMA 4OS2A 4AGKA 1GI1A 1E38B 1UTJA 5EPYA 5LPEA 5F8TA 3SV6A 2ZFRH 1EP6A 3QWCH 3SNBA 1GMDF 1VITH 3I78A 2XBVA 3RU4E 1ELTA 2ZTZA 1D3TB 4D9RA 1O3BA 1SC8U 3GYLB 3T2NA 3TIUA 6ESTA 3RXRA 2HWLB 3UNQA 1N8OC 4X2YA 4MPVA 1VJ9U 1QBVH 1GDQA 1BRCE 1W8BH 3EGKH 2J2UA 2R9PA 1D3PB 1GI4A 4AOQA 1MCVA 4H4FA 2JKHA 1K1OA 5DP3A 9LPRA 2ZDNA 2ZDVH 1V2KT 3C27B 1WU1A 4NSVA 1ELBA 1GDUA 1JRTA 4ABFA 1MTSA 1IQEA 1KXBA 2FI3E 1CU1A 1D4PB 5ETXA 1GBCA 3A86A 1HIAA 5J4QA 2GVFA 3F68H 4GPGA 4K5ZA 1W11U 4JZEH 3PROA 1C2IA 2ZU4A 3A7YA 2SGQE 1WYKA 4B2AA 1EPTB 1TAWA 1IQHA 2VH6A 1CGHA 1VCQA 4CREA 1GI9B 2BX4A 1YPJH 1GL0E 3E90B 2R3YA 4MLFB 4ZUHA 4YO9A 1V2NT 3NPSA 2WV5A 3IG6B 4O97A 3FZZA 3M5OA 1INCA 2UUYA 3RXAA 4X0WU 3A81A 3OTJE 4OS4A 1GJCB 1SG8B 1ELDE 3LC3A 3Q3KA 1ABJH 1OWEA 4MNVA 4F4OC 2FI5E 1SOTA 4FUJA 1J9CH 1BZXE 1ZTKA 1EKBB 3U1JB 1W2KH 3JZ2B 5PTPA 1YP9A 3TK9A 1SGEE 3F9HA 4U32A 1ANEA 2C93B 2QF0A 1C1VH 1TMUH 1OP0A 3EAJA 1PPZA 2WPKS 1SBWA 1QJ6B 4K1EA 2B9LA 5EW2H 2GTBA 1L4ZA 2PKSB 2SNVA 2FESH 1GHAG 1N6XA 1PPBH 2AS9A 3AASA 1C5OH 5GXPA 2HGTH 2FX4A 3CP7A 2O8WA 4IC6A 1KY9A 1DLEA 1GJ6A 3MNBA 1DWBH 1O3AA 1QQ4A 4E7RG 1FJSA 1LHCH 2ZFFH 2BQ6B 1J8AA 1G37A 4ZKRU 3FVFB 4ABDA 1E36B 1DICA 5A0CA 1QB9A 3P92A 1HAVB 3P6ZB 4FU9A 4A1VA 3S0NA 3RXVA 1SGPE 3A88A 2F83A 1ANDA 1PQ8A 2PSXA 3TH3H 1EAXA 2AYWA 3MTYA 3OX7U 5JBBS 3RXUA 4AGJA 5E0GA 1S6FA 1LPZB 2ZFTA 4VGCC 2A45B 3KCGH 1MTWA 2C8YB 2A1DB 4LXBH 1QJ7B 2AIPA 3T26A 2HVXA 4ZHAA 3RXGA 3N7OA 4KP0A 3RXHA 3B8JA 1A5GH 1WV7H 2ZHWH 1ELVA 2BD5A 1W7XH 1GBLA 4FUDA 1Y5UT 3P17H 2ZO3H 4Y71A 1C1NA 1KXFA 5JB8S 3U1IB 1WQSA 1O5BB 1P10A 1AY6H 3SO3A 2ULLA 3SV7A 5C20A 2FX6A 1C1OA 2ZFPH 3E0NB 1NU9A 3TK5A 1TGCA 3NK8A 1ZGVA 1DWDH 1GG6C 2BZ6H 2BQ7B 2FWWA 3MH5A 5A2MH 2NU0E 1P0SH 2JH0D 2FLBH 2PKSC 4JK5A 2J38A 3TH2H 1ZTLA 5A8YA 1C9TA 1SGRE 1O5GH 4PROA 1TLDA 4E7NA 2XRCA 1EAWA 5K7RA 4ABIA 1ELFA 3BTFE 2NU3E 2QGRA 1CSOE 1O2OA 1TX7A 1ELEE 1P3EA 2ZFSA 3TVJB 3ESTA 3ZVCA 1IQLA 1XUIA 2HLCA 3LJOA 4FUBA 3LU9B 1F0SA 1YLDA 5CHAC 1BMLA 2XTTB 2GGVB 1V2OT 4INLA 1NESE 5H4IB 1IAUA 1EAUA 1GG6B 1BTHH 7GCHF 3UPEA 2PWXA 2AFQB 2Q6DA 4M7GA 1F0TA 3MO6A 1THPB 2V3HH 1K9OE 2ILNA 4XSKU 2TGDA 1IQGA 2PUXB 2G4UA 1GHBF 1BTYA 2A7CA 4GUXA 3RXOA 1UK3A 3ZZBA 4CHAB 1K1IA 1IQFA 1BMNH 2Y7ZA 1HLTH 4JYUH 1HFDA 2V6NA 3W94A 1ESAA 5C5OA 5EG4A 3OYPA 4NA7A 3GCHB 3T5FH 3RLYH 1GVZA 2VVCA 2ASUB 3MH7A 3R3GB 1NFYA 2WYJA 1U6QA 2NU1E 4IN1A 1OPHB 4Y8YA 2ZU5A 1CT0E 4CRAA 1UTNA 2QIQA 1UVSH 4Y0ZE 1HAXB 1XUKA 1ZOMA 1A5IA 1DDJA 1P2KA 3ZZDA 4WXVA 3VXEH 1NRNH 2FO9A 3RXEA 2VIPA 1AWHB 1NRRH 1Z71A 2B8OH 1RTFB 1O5CB 2DUCA 1H8DH 3Q00A 1MUEB 2THFB 1ORFA 3U8OH 1GMHG 1Y59T 3ATIA 3BSQA 4LZ4B 1QBNA 4HI3A 5EPNA 4FVBA 1SB1H 2QF3A 1FDPA 4ZXYH 3UWJH 4JZIA 3ZZCA 3QO6A 1C1WH 1O2VA 4FUEA 1PFXC 2WINI 1CHOG 3SNCA 1F92A 1BJUA 1HPGA 4HZHA 3VB6A 7KMEH 8GCHG 3SUEA 1NROH 1ZMLA 2G00A 3SU1A 1O3CA 4ABBA 2OBOA 2VWLA 1TNHA 2QXJA 1NZQH 2G4TA 4CH8B 4BAOB 1UVUH 1AZZA 4YZUA 3K65B 4HGCA 2ZHFH 3MI4A 2DE9A 1TE0A 3DHKH 4RSPA 4X8SH 2UUFB 1LDTT 1O2UA 2FOFA 1YYY1 5AFYH 2VWMA 1C2MA 1Y3YA 3NWUA 1FY1A 1PPCE 3V7TA 1QA7A 1V2TT 1AE8H 4WMEA 2O8UA 1B0FA 2V3OH 1CA0C 1ZHMA 2ZDLA 1QBOA 2EI8A 4BNRA 1NY22 1BBRH 4CRFA 1MZAA 3OSYA 3R0FA 1V2VT 4AZ2B 1TONA 3M5LA 3SJOA 1TPSA 3RXSA 5LPFA 5DK1A 2Q6FA 4SGAE 4AB9A 3GY4A 2P3UB 2XCNA 3QZQA 1EPTA 1EPTC 2P59A 3KHVA 1ARBA 5FX5A 2SGPE 3H7OA 1MKXK 4YTAA 4GCHG 1WTHD 1YPKH 2H9TH 1X7AC 5ABWA 1ZMJA 1NPMA 2FLRH 1GHVH 2SGAA 3UNSA 1HAIH 1O31A 1BTPA 3BTTE 4OS7A 1QRZA 4DOQA 4A1TA 2XBXA 2ZDAH 4X6PA 3O8BA 3SOSA 2TGAA 2GMTB 2HALA 3ZZ9A 4R8TB 5SGAE 3ZZ7A 1AUJA 1FLEE 5I25A 1EOLA 1TNGA 1BTXA 4BTUB 4YLUA 2ZGJA 3TPIZ 4NGAH 1T8OA 1YCPH 3CENA 1H8IH 3Q76A 9ESTA 1O37A 1GI6A 6CHAC 1SGIB 1N8OB 3H5CB 3RC6A 1SLUB 3GCTG 1XUFA 2XWBI 4B74A 1SSXA 2CF9H 4TWYA 6GCHF 3KNXA 2FYRA 1BUIA 3P8FA 1MQ5A 3A8CA 3ZVBA 5C1UA 1DXPA 4BANB 1SGQE 4YT6H 4ABHA 1D6WA 3E16B 2ZKSA 2BD9A 1YPMH 1SLWB 3AW1A 1GBFA 3SBKA 3UTUH 5ESTE 4I8GA 1G3DA 1GI3A 4AFSA 4FUCA 1AO5A 3M7TA 2G51A 2A4GA 1SGFG 3EA7A 1LCYA 3RXQA 1BDAA 3G01A 2VIDA 1RIWB 1C5XB 1LKAA 1KYNA 5L30H 1K1LA 1A0LA 2IPHA 1D6RA 1KDQA 4OS5A 2BOKA 2HNTE 4HFPB 2Z3CA 1HB0B 2HNTF 3NXPA 1P2MA 4X1PU 3ZZAA 3LOXA 2C8ZB 1FY3A 5GCHG 3EYDA 3ZVGA 3PO1B 1DFPA 1FMGA 3K9XB 1K28D 2TGTA 3RC5A 2ZF0H 1HAHH 1SQOA 1KDQB 1T4UH 2BVSH 1AFEH 2D26C 2WUCA 2WV4A 1O3EA 1GBEA 1K21H 1ZSJA 1OP2A 4ESTE 1UCYE 3HGPA 3LC5A 1C5RA 3UR6A 1G3CA 2QXIA 5E8EH 2BX3A 5FBEA 1AE5A 1EZQA 1Y3WA 2Y82A 5FCRA 2W7SA 2B0FA 1H9LB 2FIRH 1O2QA 2FDAA 1O5DH 4E05H 4MNXA 1AU8A 1SGFA 3LGTA 4ZAEA 2D2DA 1QL9A 4FU7A 1LVMA 2VJ1A 3B9FH 1P2NA 1YKTA 3FFGA 3A8BA 4O3TA 1CE5A 1ID5H 1OP8A 1P2QA 2W26A 2G8TA 2A5AA 2OQ5A 3GCOA 3ATMA 1FQ3A 2SNWA 1L1JA 4NCYA 3EA8A 3TJVA 2ODPA 1Y3UA 3K2UA 4A92A 1TGTA 4UFDH 3TLOA 3UUZA 4Y7BA 5T3HA 1SQTA 1TBRH 3BG4C 4NZQA 1ELAA 1EB2A 4K3JA 1D3QB 3RMLH 5HYOA 1C2JA 1O2KA 3HKIB 3AW0A 3RM0H 4FVDA 1W7GH 3SNDA 1HAYB 3BTEE 1UVTH 4MNWA 2G5VA 3VB3A 4ZKOU 1HXEH 1OS8A 3ODDA 1GGDB 3I29A 3MNSA 2QCYA 3TGKE 2ZA5A 5K0HA 1AZ8A 3MOCA 4Q2KA 4SGBE 3STJA 4BAKB 3K6YA 1Y5BT 5AFZH 1MTNC 4AORA 2H5CA 2FOBA 2PFEA 3SUDA 2ALVA 2ODQA 4Y76A 4JMYA 3ZYEA 1J16A 2G5NA 3EQ0H 1PQ5A 4ZXXH 3BG4B 4UONA 4TY7A 1EX3A 1KLJH 2W3IA 1BQYA 3BTWE 1QB1A 3RU4D 1BMAA 5T6FA 3SJKA 2F9VA 3GY7A 1C2GA 3RMOH 4I8KA 2H9HA 1O2RA 3SV2H 1JMOH 4Z6AH 2J92A 1KXDA 4K8BA 2ZZUH 4NIYA 4Y11E 1IQKA 2RCEA 1O0DH 4X8VH 3SGBE 1THRH 1P06A 1O5AB 2PTCE 1GJ8B 3VXFH 1G9IE 1KIGH 2CJIA 2GZ8A 1UTPA 1QL8A 1FNIA 2AEIH 1UTLM 3QUMP 3QN7A 2BDHA 1ESTA 4WXIA 1SLVB 4X1RU 3D65E 3GY2A 8LPRA 1ZJKA 1W0YH 3A85A 2TPIZ 2O8LA 3M5MA 3M37A 2OUAA 4D9QA 2GZ9A 4D7GA 3O8DA 3GY8A 1AVWA 4AX9H 5DKMA 1HCGA 5LH8A 1ELCA 1J15A 2JETC 4CH2B 1O3GA 1O34A 3Q3YA 2TGPZ 3U8RH 4RN6A 2O8MA 1MAYA 3HK3B 3V13A 1IQMA 1KLTA 1HGTH 1YPHC 1C5MD 1MCTA 1O2YA 2QXGA 1N1LA 1PPGE 3VB7A 5C5NA 1TWXB 1DSUA 4JZDH 3PWCA 1TBZH 1SPJA 1P2JA 2VH0A 1V3XA 1C5ZB 2LNCA 4MNYA 2JH6D 1FPHH 4B2BA 1O39A 2TBSA 3MHWU 3RLWH 4K1TA 3KIDU 1ESBA 4WH8A 1TNIA 1UHBA 1ETRH 2WPMS 2Q6GA 4U01A 1NFWA 1MZDA 3SU2A 1GVKB 1K1JA 1F5LA 1G2LA 1BCUH 1O33A 3AVZA 4BTTB 1MTUA 2ZHDA 3M7QA 5T6DA 2G81E 4BAQB 1F5KU 2NWNA 1OYTH 1C1MA 2ZDKA 4IMQA 2CMYA 1O5EH 5E0HA 1UTQA 2P95A 2W7UA 4DJZB 2XBYA 1FIWA 1LHGH 2AERH 6LPRA 3OY6U 4X2WA 1FXYA 3RMNH 1G30B 4ISHH 4WJG2 1OXGA 2FOGA 2IOTA 1O2TA 1W12U 2FYQA 2F9NA 1C5SA 4XE4A 1H9IE 2GMTC 5GCHF 1JIRA 1DSTA 1QB6A 3A89A 4JYTA 1WOFA 2XNIA 1GCDA 1HAVA 4K1SA 1TPOA 5F8ZA 1DM4B 7GCHG 1S83A 1S82A 1MTVA 5BRRE 1BJVA 1O2HA 2AMDA 2BDIA 4ABAA 2D8WA 3ODFA 1GJ9B 1T32A 4O03A 1NC6A 1RTKA 4A5TS 1CQQA 1ANCA 1RGQA 1GPZA 1ZYOA 2ZFQH 2XC0A 3QDZB 5A09A 2BXTH 3DA9B 2OQUA 3SZNA 3RXFA 2GD4B 5LGOA 1SGTA 5JPMH 1NRQH 1OYQA 1S85A 2CXVA 2A4QA 2F9BH 3U9AH 1SQAA 2QV1A 3BG8A 4WMFA 3SGAE 1EJAA 2GV7A 1O3JA 1FZZA 1G36A 1P02A 2BZAA 3P8GA 5E2OA 3SU3A 1GBTA 1TRNA 2GT8A 4MPXA 3HKJB 4B76A 4OGYA 3SUFA 2V0BA 1KXEA 1P9SA 2PGQB 1ZSKA 3RP2A 4ABEA 5FCKA 1QY6A 2P93A 4JZ1A 5JYIA 2PGBB 1TPAE 1A2CH 1ZPBA 1PQAA 1YGCH 1XVOA 1XUGA 2BY5X 1P05A 2ZU3A 3RXDA 4K8YA 3MU1A 1LKBA 1BTWA 4FUIA 8KME2 4J2YB 1JOUB 1SGCA 3QGJA 3PMJA 4KGAA 1A61H 1E35B 1YBWA 1C1TA 1OWHA 5GDSH 3SNEA 4DIIH 2FODA 2ZP0H 2KAIB 1S84A 2CF8H 1LHFH 2GT7A 1O2MA 1MMJN 4A6LA 1DE7H 3GY3A 4GHTA 4CR5A 3BIUH 5DPAA 3MH6A 5GPIB 4NWLA 4I33A 3ZVAA 2UWLA 1QR3E 3BEUA 2ZIQH 2PLXA 4UE7H 4AFZA 1O30A 1NU7B 4XBDA 2I6SA 1RRKA 2FOHA 2FEQH 5J4SA 3I77A 1EZSC 3MNXA 1GBMA 4JZFH 3VEQB 1LMWB 1CT4E 1GBIA 4NA9H 4YESB 2GX4A 1MKXH 4WVPE 4X8UH 5FX6A 1LTOA 1T7CA 2ANYA 4BOHA 3BTQE 6GCHG 1XXFA 2VINA 1GGDC 2Y5HA 4ASHA 2BY9X 4IMZA 2XXLA 2FS8A 4IGDA 2Z9KA 3HGNA 4CRGA 4Y8XA 1DT2A 1LHDH 2Y80A 3B23B 3PMHB 3T28A 3ZV9A 4CHAC 2P8OC 5GWZA 2R0KA 4AYVB 3UQOA 2OC7A 2CV3A 1CO7E 2D1JA 2WYGA 1GBAA 1GBBA 1TQ7B 2P3TB 1TX6A 2W3KA 1HAZB 2NU4E 3O8RA 1F2SE 3F9FA 4AG2A 3UOPA 2GZ7A 4I8LA 2VVVA 2ODYB 3VB4A 1TNLA 1BHXF 2BB4A 3PYHA 2WPJS 3E6PH 1PPEE 1QNJA 1V2LT 3MYWA 2Y5FA 3L33A 2G55A 1CVWH 1TYNA 5EW1H 3URDA 1BMMH 1QRXA 1C1QA 5FPTA 4JYVH 3HK6B 3BN9A 2ZU2A 1FI8A 1YCPM 5C1YA 1TA6A 5FHTA 5IDKA 4ZHMU 1A3BH 8GCHF 3V12A 5IYTA 3MU5A 1ZHPA 2O9QA 1F7ZA 3SGQE 3RXPA 4BXWA 4ABJA 1MKWK 2FMJA 1DUAA 1O2IA 3QTOH 1K1MA 1KSNA 4DT7B 4ABGA 3C1KA 1IOEA
chains in the Genus database with same CATH superfamily
1FN8A 3MFJA 2VWNA 5I46H 1P8VC 1UCYK 4NA8A 4AYYB 2BHGA 1GJ4H 4MPUA 3PO1C 1K22H 2RA3A 1QJ1B 5IK2D 3FOAA 1C5LH 1XUHA 2ZQ1A 1GBHA 2ZG0H 1RTLA 4ZKNU 1O2XA 3ZYDA 1VJAU 5A8ZA 4UDWH 4NIXA 2BD3A 3UOUA 2WUBA 2F91A 1DVAH 1RIWC 4CBNA 2P94A 4D7FA 1ZHRA 2Z6BD 1UVOA 1V2ST 1S0QA 4MG3A 2P16A 4VGCB 2BLWA 1ZPZA 2ZHQH 3SJ8A 1YF4A 1DLKB 1C1RA 2A5IA 3KN2A 5EODA 1HJ9A 2BDAA 5EXNA 1O3MA 1SL3A 5F6MA 3UQVA 1UTMA 1RXPA 2I6QA 4RT1A 2CN0H 1W14U 1QURH 3RMMH 3DFLA 1NFUA 1H1BA 2AMPA 5JBTA 2RA0A 1LVBA 2M5TA 2Q1JA 3GS9A 4UD9H 1LVOA 2XOKD 2ZPSA 3PLBA 5A8XA 2FM2A 1A46H 2G52A 1P2OA 5KGOA 2HRVA 1B0EA 1Z1IA 1W13U 4BXSA 3FP7E 1VITG 3SZEA 1O3PB 4Y7AA 2Z3EA 4UFEH 1EZXC 2ZGHA 3KF2A 1LO6A 1YLCA 2FI4E 3TJOA 2FZZA 2C90B 5L6NH 4CR9A 1WQVH 2GCHF 4Y10E 3SI4H 3OU0A 3L3TA 5T1VA 1T31A 3W95A 1FY8E 1WSSH 3FAOA 3N99A 3QTVH 5HMAA 4FU8A 4I8HA 1H9HE 3H7TA 4P00A 1CA8B 1W3CA 2BD7A 3BF6H 1P3CA 3GY5A 1JWTA 1MD7A 1HAGE 1K1PA 1L2EA 2UUJB 3DT0H 1GI7B 1Q3XA 3VGCC 2KCYA 3OEHD 3EE7A 3P70B 3D23A 2A31A 4AFUA 1GMCF 1FV9A 1A3EH 2QF5A 1IHTH 5A0AE 1P11E 2BQWB 2C3SA 2UWOA 4TWWA 3PTBA 3MU0A 2GDDA 1TALA 3EA9A 2TRMA 5AVDA 3A87A 3AAVA 1TFXA 1P09A 3OY5U 5JDUB 1D3DB 2W6ID 3SUGA 1V2JT 3BV9B 1AKSA 1HV7A 1CA0B 5F03A 2SGDE 4YOGA 3SU5A 3T62A 1BOQA 4YXWD 1DY9A 2BD8A 3M36A 1HJ8A 2RFKC 5FPYA 2YNBA 2VBCA 1O2ZA 2PTNA 2STBE 1GHAF 1MBMA 1O2LA 2R0LA 2FS9A 3SU4A 5C2ZA 1HDTH 4OGXA 4Y0YE 3VGCB 3VPKA 1ZMNA 3UY9A 1L0ZA 1FY4A 2ANMH 1HNEE 2ZTXA 2J9NA 1EJMA 3NUMA 2Y5GA 1GHBG 4ZH8A 3IWMA 1YPEH 2OXSA 2Z9IA 2OBQA 2Y7XA 2EA3A 1FN6A 3LONA 3WY8A 3DD2H 1TOMH 1KLIH 1YC0A 1ZJDA 4ISLA 4B1TA 3SORA 1DX5M 1SGDE 4GAWA 3U98H 3BTKE 3TU7H 1CHOF 1AFQC 1HAPH 4D8NA 4MDSA 1L4DA 4ISNA 1GBJA 1SGYE 3RXCA 3LPRA 1DXWA 1TOCB 3JZ1B 3F0OA 4B2CA 1AFQB 2OTVA 3SNAA 1O38A 3BIVH 4IN2A 2J94A 1TQ0B 1NT1A 3SI3H 1BITA 1P57B 1IHSH 2J98A 2VIWA 1CHGA 1BT7A 2VIOA 2ZEBA 1GMCG 2BOHB 5HXFA 4FUGA 4I8JA 2BVXH 8ESTE 1V2QT 1GI2A 5L2YH 1VCPA 1MH0A 5E0JA 5L2ZH 3GCHC 4KELA 1EASA 5FPSA 5JB9S 1MU6B 1V2PT 1TB6H 3KEEA 4HTCH 2J97A 1G3BA 2SFAA 3WWFA 4KTCA 2HPPH 2WZQA 3HATH 1Z6EA 1NM6A 1V6DA 3MU8A 2R3UA 2OP9A 4Q7XA 5CMXH 3LDXH 1SFQB 1Z8RA 4O9VA 1S6HA 4Y8ZA 2BM2A 1QIXB 5HIYA 3WW7A 1AVGH 3A7WA 4Q80A 2WPHS 3FANA 3STIA 4H42U 1O3DA 4GCHF 5EQRA 1LPGB 2OC8A 1DITH 2ZPQA 4X6NA 1MBQA 2ESTE 3LGUA 2QC2A 1GJDB 3NRLA 4FUHA 1C2DA 3SV8A 5DP9A 4DVAU 1UO6A 2XC5A 4ISIH 4IS5A 1AHTH 3N7DA 2VB0A 1XKBC 2BD2A 1NO9H 5C0UA 5DGJA 1MAXA 3PLKA 5CHAB 1GJAB 4TSFD 1ZTJA 3M3TA 3MWIU 2AGGX 2IN2A 4WH6A 1T8LA 5GIBA 3TH4H 1KXCA 1C5PA 3SQHE 1JBUH 1GBDA 4Y6DA 3OFND 3Q3XA 4MPWA 5EXMA 1C2FA 3ENSB 5C67A 3S9BA 1SI5H 1C2EA 3FP6E 2VIVA 3DSGA 1CGIE 3DFJA 3BEIB 1C4V2 1P12E 3RUOA 2OCVB 3UAIC 1TX8A 1FUJA 1GHXH 1UVPA 2H5DA 4F49A 2F43B 4JK6A 2CGAA 1QTFA 1E1RD 1S0RA 1TRMA 1A1RA 3ZVFA 3GISB 2H6MA 4ZCNA 3SJIA 4XDEA 1N6YA 3A7ZA 1C1SA 2VVUA 2AIQA 3LGWA 4MQAA 1A0JA 4XFQA 1A0HB 5HGGA 3U69H 1TA2A 2PKAA 3TNTA 1TABE 2P8OB 1J14A 4NFFA 1A4WH 1HXFH 2QA9E 3M7UA 1DOJA 1C2LA 1C5UA 2QY0B 2ALPA 5DP7A 1XX9A 4X1QU 2HOBA 3V3MA 1H4WA 1Y3VA 1AI8H 2ZTYA 4NG9H 3A8DA 1EUFA 2ZWLH 3OAAD 1BIOA 1NBME 2ZU1A 3NCLA 1TNKA 1TPPA 1KXAA 1CBWC 1RFNA 1MU8B 1Z8IB 2HPQH 2H1UA 1PPFE 3A83A 3GDVA 1V2UT 1C5QA 2L74A 2XW9A 1A7SA 1WAYB 1UTKA 2PR3A 2EEKA 2GDEH 2AH4X 1AGJA 3AAUA 5KEDA 1P03A 3ITIA 1IQIA 1Y5AT 1K2I1 2BLOA 2BD4A 3RU4T 2ZCHP 2Z9GA 1QL7A 1UW7A 3OE7D 3BTGE 4DGJA 1GI5A 1SOZA 3RXMA 3PM3A 2VWOA 1O3LA 1O2WA 3GICB 2R2WU 3ZZ6A 1O3IA 2O8TA 1ZRKA 3T25A 3KL6A 3NZIA 1CT2E 2A7HA 3QGNB 1E0FD 2RDLA 1S81A 3PTNA 1SFIA 5AF9H 3A82A 2KCPA 3F9GA 3KQDA 1D9IA 3LH1A 1P2IA 2VIQA 2C8XB 1EATA 1MD8A 1O35A 1JRSA 1QGFA 2PW8H 2EI6A 3FO8D 5JBAS 1H8HD 1QRWA 1HRTH 2BLQA 1DANH 3QLPH 7ESTE 1ZZZA 2F9OA 1AD8H 4RKJB 4THNH 1O3FA 1P01A 4DY7B 1W10U 3ZZ8A 3S9AA 4MVNA 1DWEH 2Z7FE 2EC9H 3PLPA 1B5GH 1BBRK 1GHYH 3GYMA 4TPYA 1BB0B 1KTTB 1FIZA 3RXBA 1VCWA 3S7KB 3PV4A 1UK4A 3TK6A 3ZVDA 5GJ4B 1HUTH 2A0QB 3MU4A 2BDGA 2V7QD 2XBWA 5AHGH 1OWKA 4X6OA 4WMDA 4BAHB 1IQNA 3LJJA 3QK1A 3LT3A 1G2MA 2GV6A 3HPTB 1BRBE 1GBKA 2ANWA 4Q7YA 1NRPH 1EB1H 2WPLS 5EU8A 1GI8B 3TGJE 3A84A 4LK4A 1GMDG 4X6MA 1O3KA 3CS7A 1BTZA 2ZC9H 2YOLA 1SHYA 1UCYH 1YLNA 4INHA 3UNRA 1CGJE 2BMGB 2QE7D 2ZGXH 1C1PA 2VU8E 2F9UA 4X1SU 1VR1H 1AMHA 1W0ZU 4NFEA 1W0JD 4CRCA 5FL7D 3KQBA 3O8CA 2FOMB 3VFEA 4O3UA 5DP8A 1ZR0A 1C5TA 1JIMA 4JCNA 1KTSB 3GDUA 2STAE 1T4VH 4FXGH 5F8XA 1EXFA 1TMBH 4ACAA 2R2MB 4CRBA 4TYDA 1GCTC 3FN8A 1MABB 4DURA 1SMFE 3BTME 3SW2B 1O2PA 7LPRA 3KQCA 1IQJA 2KAIA 4TPIZ 3BEFB 3F0PA 3URCA 1YPGH 4XBBA 2FXRA 4H6SB 3A8AA 2Z3DA 3F6UH 2AGIX 1FPCH 1WCZA 2HLDD 1XMNB 3M3SA 2ZHEH 1E34B 2PV9B 4BTIB 3BTHE 3GDSA 1GVLA 2B7DH 1RS0A 1T8NA 1TGBA 3GY6A 1RJXB 1FAXA 1OX1A 3E0PB 3E1XB 4R0IA 3S69A 1QCPA 4NIWA 1HAOH 3MO3A 2OINA 1K0HA 2FOAA 3LGIA 1XUJA 1HJAB 2Y81A 4U2WA 3UWIA 4GLYA 4FUFA 4YM9A 4K60A 3S9CA 2ZECA 1UK2A 2DE8A 4ZKSU 4CBOA 4X8TH 2F9PA 2FOEA 1C5YB 1EFRD 1QA0A 2GCHG 2PHBA 5DSFA 3F9EA 1C2HA 2BVRH 1HIAB 3SV9A 3D62A 3ELAH 1HBTH 5CE1A 3T29A 3RXJA 2GKVE 2LPRA 1EZUC 1YPHE 3UB0A 1GJBB 1O5FH 2GCTB 5B6OA 1LVYA 3UREA 4UEHH 5A0BA 3ATKA 2JH5D 2GCTC 1O2SA 2V35A 3SN8A 4TY6A 1RD3B 3NKKA 3S7HB 1O3OA 2Z94A 1GHZA 4WY3A 3LKWA 3A80A 3K6ZA 1UHBB 1O36A 2OD3B 3GCNA 5BPEA 1HYLA 1FONA 2Z9JA 1F0UA 2ZPRA 1OWIA 3BTDE 4YOJA 4IC5A 1AVXA 1E37B 3EDXB 3PMBB 2BTCE 4BAMB 1GI0A 4RKOB 1TBQH 2PKAB 4DW2U 3M5NA 5FXLA 1TGSZ 3PMAB 1SVPA 3RC4A 1GMHF 4X2XA 1BHXB 3P8NA 1AUTC 3ATLA 5DP4A 3SHCH 2W5EA 4GSOA 1NN6A 1ZLRA 3ZVEA 2PUQH 3FZDA 4DG4A 3U8TH 1O3NA 2FP7B 1EAIA 5DJ7A 2A4OA 4AB8A 4AN7A 4DCDA 1GCTB 2A2XH 1M9UA 4NZLA 2BXUH 1G32B 1V2MT 2JIZD 4KTSA 3UIRA 1LPKB 4INKA 1SLXB 2C4FH 4XBCA 1UMAH 1MTNB 3F1SB 5EQQA 2ZGBH 2IJOB 3TNSA 3ATWA 4QT8C 1C1UH 1VZQH 5EGMA 1ZGIA 1NFXA 4IW4E 1QHRB 3E3TA 3MMGA 3M35A 3VB5A 1PPHE 3OTPA 3MQKC 1TGNA 1TRYA 3TJUA 4ZROA 1WUNH 3LGVA 2NU2E 4U30A 1VGCB 1MQ6A 5JBCS 5LPRA 5EOKA 5F53A 2A5KA 3E91A 3T27A 1BTUA 5C3NA 4Q4LA 3E8LA 1UTOA 4Y79A 4ISOA 4I32A 2KFWA 1GDNA 2ZNKH 2OC0A 1C4U2 2TIOA 1C4Y2 2CHAC 4GVUA 4LZ1H 1Z6JH 4UFFH 2VGCC 3U28C 1OSSA 1XKAC 1AB9C 1OWJA 5HM2A 1WTGH 1EOJA 1F5RA 4I31A 3AK5A 2BLVA 2H9EH 1AN1E 2XYAA 3DCLA 5TCAA 2JETB 1UJ1A 2SGEE 3PB1E 3ZV8A 1VKYA 1TIOA 2A2QH 3RXKA 1XVMA 4K2YA 5EXLA 1EQ9A 3CS0A 1OWDA 4ZMAH 1Q31A 2WPDD 1G3EA 5E2PA 1VITF 3D49H 3MNCA 3MH4A 3EE0B 1NRSH 1EJNA 1SGNE 3RXTA 3GCTF 2RG3A 1J17T 5ESBA 4XOJA 4NIVA 3MO9A 1WXRA 1XM1A 3TJNA 2BDBA 1AIXH 1GL1A 1O2JA 1T8MA 1YY3A 4A7IB 1C5WB 2K0QA 1O2GH 1Z1JA 2AGEX 1FAKH 1C5NH 4I7YH 1TMTH 3LGYA 4NSYA 2P3FH 1DY8A 2B5TB 2UUKB 2H2ZA 1AQ7A 1C9PA 2QXHA 2OK5A 3SHAH 3ZZ3A 2BY6X 1AB9B 1ACBE 1LHEH 4XD7D 2VGCB 1ETTH 4WWYA 1B7XB 2CHAB 1THSH 3ZZ5A 2ZI2H 2GP9B 2ZGCA 4MTBA 1ETSH 1FY5A 2A7JA 4B73A 1NTPA 4YLQH 3ZZ4A 5FBIA 1BRAA 2OC1A 4LOYH 1AKSB 1CBWB 4OS1A 1JXPA 1ABIH 1ELGA 5HM9A 4AFQA 5C0TA 2EI7A 2JJ1D 1VGCC 1Y8TA 3SU0A 1Y3XA 3KGPA 1Q2WA 3KQEA 1Z8GA 5EQSA 2BY7X 3DUXH 1C5VA 1XXDA 2XWAA 2KZ4A 3QX5H 4Q7ZA 1Z8JB 5DP5A 2VNTA 2YNAA 2C8WB 3W1EA 5GNDA 1LQDB 2ZCKP 3LIWA 4X2VA 5DO4H 2ZQ2A 1GJ7B 2OLGA 1O3HA 1SKYE 5C1XA 1H8ED 2PSYA 2BDCA 1C2KA 5DG6A 4UFGH 2AHME 2A4RA 2BYAX 3GOVB 2KM0A 4AG1A 4Z0KA 2WHXA 2J34A 6CHAB 2Z9LA 4H6TA 1PQ7A 1O2NA 1L1GA 2SGFE 2QYIA 3Q77A 4GHQA 1OOKB 4Q63A 4YT7H 3L6PA 4K69A 2FTLE 1LQEA 3RXIA 2UWPA 1PYTC 1BMFD 1K1NA 5FAHA 1Z7KA 1YPLH 2A32A 1QQUA 2QAAA 2QN5T 1L1NA 2XC4A 4KTUA 4X1NU 1BRUP 1BA8B 1QFKH 4A1XA 1P9UA 1TNJA 2BY8X 3QZRA 1WDIA 2XCFA 1SR5C 1GHWH 1V2WT 3FP8E 1V2RT 4B71A 2FTMA 1NS3A 5DP6A 1S5SA 4ZHLU 4IBLH 5T6GA 1GWAA 2J4IA 1WBGB 4OS6A 5G4BA 2AMQA 1DS2E 5TJXA 4E06H 1YCPK 1YM0A 3UR9A 1MKWH 1DUEA 3SQEE 3V0XA 1ZPCA 4J1YA 1F0RA 3UFAA 2FPZA 3RXLA 2ZCLP 5TCCA 3M3VA 2Y6TA 1O32A 4YOIA 2FOCA 1P04A 3A7VA 2ANKH 3P8OA 3WWBA 1OKXA 3SU6A 1PJPA 4D76A 2WPIS 3LH3A 1A5HA 3RDZA 3A7TA 1DPOA 1GJ5H 4CRDA 3RM2H 3SJ9A 2LP6A 4B75A 1SHHB 2K1QA 3TGIE 1HJAC 1SQRA 4DIHH 2HNTC 1DWCH 4WF8A 3IITA 4KKDA 4NWKA 1PYTD 1AWFH 3FKSD 3TITA 2JDID 1ARCA 1ANBA 3A7XA 3P95A 1EP5A 1ZRBA 2F3CE 2BDYA 2J95A 3PWBA 1BBRE 3M61U 1ZSLA 2ZDMA 4OS2A 3N7EA 4AGKA 1GI1A 2J98B 1E38B 1UTJA 3DSOA 5EPYA 5DN6D 5LPEA 5F8TA 2XNDD 3SV6A 2ZFRH 1EP6A 3QWCH 3SNBA 5EJZA 1GMDF 1VITH 3I78A 2XBVA 3RU4E 1ELTA 5C17A 2ZTZA 1D3TB 4D9RA 1O3BA 1SC8U 3GYLB 3T2NA 3TIUA 4RI0A 6ESTA 3RXRA 2HWLB 3UNQA 1N8OC 4X2YA 4MPVA 4I86A 1VJ9U 1QBVH 1GDQA 1BRCE 1W8BH 3EGKH 2J2UA 2R9PA 1D3PB 1GI4A 4AOQA 1MCVA 4H4FA 2KCAA 2JKHA 1K1OA 5DP3A 5B6LA 9LPRA 2ZDNA 2ZDVH 1V2KT 3C27B 1WU1A 4NSVA 1ELBA 1GDUA 1JRTA 4ABFA 1MTSA 1IQEA 1KXBA 2FI3E 1CU1A 1D4PB 5ETXA 1GBCA 3A86A 1HIAA 5J4QA 2GVFA 3F68H 4GPGA 4K5ZA 1W11U 4JZEH 3PROA 1C2IA 2ZU4A 3A7YA 2SGQE 1WYKA 4B2AA 1EPTB 1TAWA 1IQHA 2VH6A 1CGHA 1VCQA 4CREA 1GI9B 2BX4A 1YPJH 1GL0E 3E90B 2R3YA 4MLFB 4ZUHA 4YO9A 1V2NT 3NPSA 2WV5A 3IG6B 4O97A 3FZZA 3M5OA 1INCA 2UUYA 3RXAA 4X0WU 3A81A 3OTJE 4OS4A 1GJCB 1SG8B 1ELDE 3LC3A 3Q3KA 1ABJH 1OWEA 4MNVA 4F4OC 2FI5E 1SOTA 4FUJA 1J9CH 4FETA 1BZXE 1ZTKA 1EKBB 3U1JB 1W2KH 3JZ2B 5PTPA 1YP9A 3TK9A 1SGEE 3F9HA 4U32A 1ANEA 2C93B 2KR7A 1C1VH 2QF0A 1TMUH 1OP0A 3EAJA 1PPZA 2WPKS 1SBWA 1QJ6B 4K1EA 2B9LA 5EW2H 2GTBA 1L4ZA 2PKSB 2SNVA 2FESH 1GHAG 1N6XA 1PPBH 2AS9A 3AASA 1C5OH 5GXPA 2HGTH 2FX4A 3CP7A 2O8WA 4IC6A 1KY9A 4B6FA 1DLEA 1GJ6A 3MNBA 1DWBH 1O3AA 1QQ4A 4E7RG 1FJSA 1LHCH 2ZFFH 2BQ6B 1J8AA 1G37A 4ZKRU 3FVFB 4ABDA 2J5UA 1E36B 1DICA 5A0CA 3OEED 1QB9A 3P92A 1HAVB 3P6ZB 4FU9A 4A1VA 3S0NA 3RXVA 1SGPE 3A88A 2F83A 1ANDA 1PQ8A 2PSXA 3TH3H 1EAXA 2AYWA 3MTYA 3OX7U 5JBBS 3RXUA 4AGJA 5E0GA 1S6FA 1LPZB 2ZFTA 4VGCC 2A45B 3KCGH 1MTWA 2C8YB 2A1DB 4LXBH 1QJ7B 2AIPA 3T26A 3SYJA 2HVXA 4ZHAA 3RXGA 3N7OA 3F2GA 4KP0A 3RXHA 3B8JA 1A5GH 1WV7H 2ZHWH 1ELVA 2BD5A 5C94A 1W7XH 1GBLA 4FUDA 1Y5UT 3P17H 2ZO3H 4Y71A 1C1NA 1KXFA 5JB8S 3U1IB 1WQSA 1O5BB 1P10A 1AY6H 3SO3A 2ULLA 3SV7A 5C20A 2FX6A 1C1OA 2ZFPH 3E0NB 1NU9A 2HVYB 3TK5A 5KECA 1TGCA 3NK8A 1ZGVA 1DWDH 1GG6C 2BZ6H 2BQ7B 2FWWA 3MH5A 5A2MH 2NU0E 1P0SH 2JH0D 2FLBH 2PKSC 2W6JD 4JK5A 2J38A 3TH2H 1ZTLA 5A8YA 1C9TA 1SGRE 1O5GH 4PROA 1TLDA 4E7NA 4AC9A 2XRCA 1EAWA 5K7RA 4ABIA 1ELFA 3BTFE 2NU3E 2QGRA 1CSOE 1O2OA 1TX7A 1ELEE 1P3EA 2ZFSA 3TVJB 3ESTA 3ZVCA 1IQLA 1XUIA 2HLCA 3LJOA 4FUBA 3LU9B 1F0SA 1YLDA 5CHAC 1BMLA 2XTTB 3KYGA 2GGVB 1V2OT 4INLA 1NESE 5H4IB 1IAUA 1EAUA 1GG6B 1BTHH 7GCHF 3UPEA 2PWXA 2AFQB 2Q6DA 4M7GA 1F0TA 3MO6A 1THPB 2V3HH 1K9OE 2ILNA 4XSKU 2TGDA 1IQGA 2PUXB 2G4UA 1GHBF 1BTYA 2A7CA 4GUXA 3RXOA 1UK3A 3ZZBA 4CHAB 1K1IA 1IQFA 1BMNH 2Y7ZA 1HLTH 4JYUH 1HFDA 2V6NA 3W94A 1ESAA 5C5OA 5EG4A 1COWD 3OYPA 4NA7A 3GCHB 3T5FH 3RLYH 1GVZA 2VVCA 2ASUB 3MH7A 3R3GB 1NFYA 2WYJA 1U6QA 2NU1E 4IN1A 1OPHB 4Y8YA 2ZU5A 1CT0E 4CRAA 1UTNA 2QIQA 1UVSH 4Y0ZE 1HAXB 1XUKA 1ZOMA 1A5IA 1DDJA 1P2KA 3ZZDA 4WXVA 3VXEH 1NRNH 2FO9A 3RXEA 2VIPA 1AWHB 1NRRH 1Z71A 2B8OH 5HKKD 1RTFB 1O5CB 2DUCA 1H8DH 3Q00A 4TT3D 1MUEB 2THFB 1ORFA 3U8OH 1GMHG 1Y59T 3ATIA 3BSQA 4LZ4B 1QBNA 4HI3A 5EPNA 4FVBA 1SB1H 2QF3A 1FDPA 4ZXYH 3UWJH 4JZIA 3ZZCA 3QO6A 1C1WH 1O2VA 4FUEA 3ZIAD 1PFXC 2WINI 1CHOG 3SNCA 1F92A 1BJUA 1HPGA 3PRDA 4HZHA 3VB6A 7KMEH 8GCHG 3SUEA 1NROH 1ZMLA 2G00A 3SU1A 1O3CA 4ABBA 2OBOA 2VWLA 4HG6A 1TNHA 2QXJA 1NZQH 2G4TA 4CH8B 4BAOB 1UVUH 1AZZA 4YZUA 3K65B 4B6EA 4HGCA 2ZHFH 3MI4A 2DE9A 1TE0A 3DHKH 2CK3D 4RSPA 4X8SH 2UUFB 1LDTT 1O2UA 2FOFA 1YYY1 5AFYH 2VWMA 1C2MA 1Y3YA 3NWUA 1FY1A 1PPCE 3V7TA 1QA7A 1V2TT 1AE8H 4WMEA 2O8UA 1B0FA 1CA0C 2V3OH 1ZHMA 2ZDLA 1QBOA 2EI8A 4BNRA 1NY22 1BBRH 4CRFA 1MZAA 3CNRA 3OSYA 3R0FA 2RDEA 1V2VT 4AZ2B 1TONA 3M5LA 3SJOA 1TPSA 3RXSA 5LPFA 5DK1A 2Q6FA 4SGAE 4AB9A 3GY4A 2P3UB 2XCNA 3QZQA 1EPTA 1EPTC 2P59A 3KHVA 1ARBA 5FX5A 2SGPE 3H7OA 1MKXK 3F3BA 4YTAA 4GCHG 1WTHD 1YPKH 4XRNA 2H9TH 1YWUA 1X7AC 5ABWA 2EY4C 1ZMJA 1NPMA 2FLRH 1GHVH 2SGAA 3UNSA 1HAIH 1O31A 1BTPA 3BTTE 4OS7A 1QRZA 4DOQA 4A1TA 2XBXA 2ZDAH 4X6PA 3O8BA 3SOSA 2TGAA 2IPQX 2GMTB 2HALA 3ZZ9A 4ACBA 4R8TB 5SGAE 3ZZ7A 1AUJA 1FLEE 5I25A 1EOLA 1TNGA 1BTXA 4BTUB 4YLUA 2ZGJA 3TPIZ 4NGAH 1T8OA 1YCPH 3CENA 1H8IH 3Q76A 9ESTA 1O37A 1GI6A 6CHAC 1SGIB 1N8OB 3H5CB 3RC6A 1SLUB 3GCTG 1XUFA 2XWBI 4B74A 1SSXA 2CF9H 4TWYA 6GCHF 3KNXA 2FYRA 1BUIA 3P8FA 1MQ5A 3A8CA 3ZVBA 4F48B 5C1UA 1DXPA 4BANB 1SGQE 4YT6H 4ABHA 1D6WA 3E16B 2ZKSA 2BD9A 1YPMH 1SLWB 4M9FA 3AW1A 1GBFA 3SBKA 3UTUH 5ESTE 4I8GA 1G3DA 1GI3A 4AFSA 4FUCA 1AO5A 3M7TA 2G51A 2A4GA 1SGFG 3EA7A 4P02A 1LCYA 3RXQA 1BDAA 3G01A 4ASUD 2VIDA 1RIWB 1C5XB 1LKAA 1KYNA 5L30H 1K1LA 1A0LA 2IPHA 1D6RA 1KDQA 4OS5A 1KMHB 2BOKA 2HNTE 4HFPB 2Z3CA 1HB0B 2HNTF 3NXPA 1P2MA 4X1PU 3ZZAA 3LOXA 2C8ZB 1FY3A 5GCHG 3EYDA 3ZVGA 3PO1B 1DFPA 1FMGA 3K9XB 1K28D 2TGTA 3RC5A 2ZF0H 1HAHH 1SQOA 1KDQB 1T4UH 2BVSH 1AFEH 2D26C 2WUCA 2WV4A 1O3EA 1GBEA 1K21H 2EQNA 1ZSJA 1OP2A 4ESTE 2GJGA 1UCYE 1QZ8A 3HGPA 3LC5A 5EIYA 1C5RA 3UR6A 1G3CA 2QXIA 5E8EH 2BX3A 5FBEA 1AE5A 2YMSB 1EZQA 1Y3WA 2Y82A 5FCRA 2W7SA 2B0FA 1H9LB 2FIRH 1O2QA 2FDAA 1O5DH 3PV2A 4E05H 4MNXA 1AU8A 1SGFA 3LGTA 2JJ2D 4ZAEA 2D2DA 1QL9A 4FU7A 1LVMA 2VJ1A 3B9FH 1P2NA 1YKTA 3FFGA 3A8BA 4O3TA 1CE5A 1ID5H 1OP8A 1P2QA 2W26A 2G8TA 3DSPA 2A5AA 2OQ5A 3GCOA 3ATMA 1FQ3A 2SNWA 1L1JA 4NCYA 3EA8A 3TJVA 3VG8A 2ODPA 1Y3UA 3K2UA 4A92A 1TGTA 4UFDH 3TLOA 3UUZA 4Y7BA 5T3HA 1SQTA 1TBRH 3BG4C 4NZQA 1ELAA 1EB2A 4K3JA 1D3QB 3RMLH 5HYOA 1C2JA 1O2KA 3HKIB 3AW0A 3RM0H 4FVDA 1W7GH 3SNDA 1HAYB 3BTEE 1UVTH 4MNWA 2G5VA 3VB3A 4ZKOU 1HXEH 1OS8A 3ODDA 4DT4A 1GGDB 3I29A 3MNSA 2QCYA 2K8IA 3TGKE 2ZA5A 5K0HA 1AZ8A 3MOCA 4Q2KA 4SGBE 3KQ5A 3STJA 5EJLA 4BAKB 3K6YA 1Y5BT 5AFZH 1MTNC 4AORA 2H5CA 2FOBA 2PFEA 3SUDA 2ALVA 2ODQA 4Y76A 4JMYA 3ZYEA 1J16A 2G5NA 3EQ0H 1PQ5A 4ZXXH 3BG4B 4UONA 4TY7A 1EX3A 1KLJH 2W3IA 1BQYA 3BTWE 1QB1A 3RU4D 1BMAA 5T6FA 3SJKA 2F9VA 3GY7A 1C2GA 3RMOH 4I8KA 2H9HA 1O2RA 3SV2H 2IJD1 1JMOH 4Z6AH 2J92A 1KXDA 4K8BA 2ZZUH 4NIYA 4Y11E 1IQKA 2RCEA 1O0DH 4X8VH 3SGBE 1THRH 1P06A 1O5AB 2PTCE 1GJ8B 3VXFH 1G9IE 3F2FA 1KIGH 2CJIA 2GZ8A 1UTPA 1QL8A 1FNIA 2AEIH 1UTLM 3QUMP 3QN7A 2BDHA 1ESTA 4WXIA 1SLVB 4X1RU 3D65E 3GY2A 8LPRA 1ZJKA 1W0YH 3A85A 2YMSC 2TPIZ 2O8LA 3M5MA 3M37A 2OUAA 4D9QA 2GZ9A 1W0KD 4D7GA 3O8DA 3GY8A 1AVWA 4AX9H 5DKMA 1HCGA 5LH8A 1ELCA 1J15A 2JETC 4CH2B 1O3GA 1O34A 3Q3YA 2TGPZ 3U8RH 4RN6A 2O8MA 1MAYA 3HK3B 3V13A 1IQMA 1KLTA 1HGTH 1YPHC 1C5MD 1MCTA 1O2YA 2QXGA 5EJ1A 1N1LA 1PPGE 3VB7A 5C5NA 1TWXB 1DSUA 4JZDH 3PWCA 3PRBA 1TBZH 1SPJA 1P2JA 2VH0A 1V3XA 1C5ZB 2LNCA 4MNYA 2JH6D 1FPHH 4B2BA 1O39A 2TBSA 3F2HA 3MHWU 3RLWH 4K1TA 3KIDU 1ESBA 4WH8A 1TNIA 1UHBA 2WV9A 1ETRH 2WPMS 2Q6GA 4U01A 1NFWA 4OM9A 1MZDA 3SU2A 1GVKB 1K1JA 1F5LA 1G2LA 1BCUH 1O33A 3AVZA 4BTTB 1MTUA 2ZHDA 3M7QA 5T6DA 2G81E 4BAQB 1F5KU 2NWNA 1OYTH 1C1MA 2ZDKA 4IMQA 2CMYA 1O5EH 5E0HA 1UTQA 2P95A 5CDFE 2W7UA 4DJZB 2XBYA 1FIWA 1LHGH 2AERH 6LPRA 3OY6U 4X2WA 1FXYA 3RMNH 1G30B 4ISHH 4WJG2 1OXGA 2FOGA 2IOTA 1O2TA 1W12U 2FYQA 2F9NA 1C5SA 4XE4A 1H9IE 2GMTC 5GCHF 1JIRA 1DSTA 1QB6A 3A89A 4JYTA 1WOFA 2YMSD 2XNIA 1GCDA 1HAVA 4K1SA 1TPOA 5F8ZA 1DM4B 1OHHD 7GCHG 1S83A 1S82A 1MTVA 5BRRE 1BJVA 1O2HA 2AMDA 2BDIA 2V3MA 4ABAA 5CHBA 2D8WA 3ODFA 1GJ9B 1T32A 4O03A 1NC6A 1RTKA 4A5TS 1CQQA 1ANCA 1RGQA 1GPZA 1ZYOA 2ZFQH 2XC0A 3QDZB 5A09A 2BXTH 3DA9B 2OQUA 3SZNA 3RXFA 2GD4B 5LGOA 1SGTA 5JPMH 1NRQH 1OYQA 1S85A 2CXVA 2A4QA 2F9BH 3U9AH 1SQAA 2QV1A 3BG8A 4WMFA 3SGAE 4FOUC 1EJAA 2GV7A 1O3JA 1E79D 1FZZA 1G36A 1P02A 2BZAA 3P8GA 5E2OA 3SU3A 1GBTA 1TRNA 2GT8A 4MPXA 3HKJB 4B76A 4OGYA 3SUFA 2V0BA 1KXEA 1P9SA 2PGQB 1ZSKA 3RP2A 4ABEA 5FCKA 1QY6A 2P93A 4JZ1A 2PP6A 5JYIA 2PGBB 1TPAE 1A2CH 1ZPBA 1PQAA 1YGCH 1XVOA 1XUGA 2BY5X 1P05A 2ZU3A 3KYFA 3RXDA 4K8YA 3MU1A 1LKBA 2QF4A 1BTWA 4FUIA 8KME2 4J2YB 1S6LA 1JOUB 1SGCA 3QGJA 3PMJA 4KGAA 1A61H 1E35B 1YBWA 1C1TA 1OWHA 5GDSH 3SNEA 4DIIH 2FODA 2ZP0H 2KAIB 1S84A 2CF8H 2LELA 1LHFH 2GT7A 1O2MA 1MMJN 4A6LA 1DE7H 3GY3A 4GHTA 4CR5A 3BIUH 5DPAA 3MH6A 5GPIB 4NWLA 4I33A 3ZVAA 4Z1MD 4RT0A 2UWLA 1FX0B 1QR3E 3BEUA 2ZIQH 2PLXA 4UE7H 4AFZA 1O30A 1NU7B 4XBDA 2I6SA 1RRKA 2FOHA 2M2AA 2FEQH 5J4SA 3I77A 1EZSC 3MNXA 1GBMA 4JZFH 2F4LA 3VEQB 1LMWB 1CT4E 1GBIA 4NA9H 4YESB 3PV5A 2GX4A 1MKXH 4WVPE 4X8UH 5FX6A 1LTOA 1T7CA 2ANYA 4BOHA 3BTQE 6GCHG 4F55A 1XXFA 2VINA 1GGDC 2Y5HA 4ASHA 2BY9X 4IMZA 2XXLA 2FS8A 4IGDA 2Z9KA 3HGNA 4CRGA 4Y8XA 1DT2A 1LHDH 2Y80A 3B23B 3PMHB 3T28A 3ZV9A 4CHAC 2P8OC 5GWZA 2R0KA 4AYVB 3UQOA 2OC7A 1NBMD 2CV3A 1CO7E 2D1JA 2L6OA 1GBAA 2WYGA 1GBBA 2KX4A 1TQ7B 2P3TB 1TX6A 2W3KA 1HAZB 2NU4E 3O8RA 1F2SE 3F9FA 4AG2A 3UOPA 2GZ7A 4I8LA 2VVVA 1E1QD 5HIZA 2ODYB 3VB4A 1TNLA 1BHXF 2BB4A 3PYHA 2WPJS 3E6PH 1PPEE 1QNJA 1V2LT 3MYWA 2Y5FA 3L33A 2G55A 1CVWH 3H09A 1TYNA 5EW1H 3URDA 1BMMH 1QRXA 1C1QA 5FPTA 4JYVH 3HK6B 3BN9A 2ZU2A 2KCOA 1FI8A 1YCPM 5C1YA 1TA6A 5FHTA 5IDKA 4ZHMU 1A3BH 8GCHF 3V12A 5IYTA 3MU5A 1ZHPA 2O9QA 1F7ZA 3SGQE 3RXPA 4BXWA 2WSSD 4ABJA 1MKWK 2FMJA 1DUAA 1O2IA 3QTOH 1K1MA 1KSNA 4DT7B 4ABGA 3C1KA 1IOEA
chains in the Genus database with same CATH topology
1FN8A 3MFJA 2VWNA 5I46H 1P8VC 1UCYK 4NA8A 4AYYB 2BHGA 1GJ4H 4MPUA 3PO1C 1K22H 2RA3A 1QJ1B 1C5LH 1XUHA 2ZQ1A 1GBHA 2ZG0H 1RTLA 4ZKNU 1O2XA 3ZYDA 1VJAU 5A8ZA 4UDWH 4NIXA 2BD3A 3UOUA 2WUBA 2F91A 1DVAH 1RIWC 4CBNA 2P94A 4D7FA 1ZHRA 2Z6BD 1UVOA 1V2ST 1S0QA 4MG3A 2P16A 4VGCB 2BLWA 1ZPZA 2ZHQH 3SJ8A 1YF4A 1DLKB 1C1RA 2A5IA 3KN2A 5EODA 1HJ9A 2BDAA 5EXNA 1O3MA 1SL3A 5F6MA 3UQVA 1UTMA 1RXPA 2I6QA 2CN0H 1W14U 1QURH 3RMMH 3DFLA 1NFUA 1H1BA 2AMPA 5JBTA 2RA0A 1LVBA 2M5TA 2Q1JA 4UD9H 1LVOA 3PLBA 2ZPSA 5A8XA 2FM2A 1A46H 2G52A 1P2OA 1B0EA 2HRVA 1Z1IA 1W13U 4BXSA 3FP7E 1VITG 1O3PB 4Y7AA 2Z3EA 4UFEH 1EZXC 2ZGHA 3KF2A 1LO6A 1YLCA 2FI4E 3TJOA 2FZZA 2C90B 5L6NH 4CR9A 1WQVH 2GCHF 4Y10E 3SI4H 3OU0A 3L3TA 1T31A 3W95A 1FY8E 1WSSH 3FAOA 3QTVH 5HMAA 4FU8A 4I8HA 1H9HE 3H7TA 1CA8B 1W3CA 2BD7A 3BF6H 1P3CA 3GY5A 1JWTA 1MD7A 1HAGE 1K1PA 1L2EA 2UUJB 3DT0H 1GI7B 1Q3XA 3VGCC 3P70B 3D23A 2A31A 4AFUA 1GMCF 1FV9A 1A3EH 1IHTH 5A0AE 1P11E 2BQWB 2C3SA 2UWOA 4TWWA 3PTBA 3MU0A 2GDDA 1TALA 3EA9A 2TRMA 5AVDA 3A87A 3AAVA 1TFXA 1P09A 3OY5U 5JDUB 1D3DB 3SUGA 1V2JT 3BV9B 1AKSA 1HV7A 1CA0B 5F03A 2SGDE 4YOGA 3SU5A 3T62A 1BOQA 1DY9A 2BD8A 3M36A 1HJ8A 5FPYA 2YNBA 1O2ZA 2PTNA 2STBE 1GHAF 1MBMA 1O2LA 2R0LA 2FS9A 3SU4A 5C2ZA 1HDTH 4OGXA 4Y0YE 3VGCB 3VPKA 1ZMNA 3UY9A 1L0ZA 1FY4A 2ANMH 1HNEE 2ZTXA 2J9NA 1EJMA 3NUMA 2Y5GA 1GHBG 4ZH8A 3IWMA 1YPEH 2OXSA 2Z9IA 2OBQA 2Y7XA 2EA3A 1FN6A 3LONA 3WY8A 3DD2H 1TOMH 1KLIH 1YC0A 1ZJDA 4ISLA 4B1TA 3SORA 1DX5M 1SGDE 4GAWA 3U98H 3BTKE 3TU7H 1CHOF 1AFQC 1HAPH 4D8NA 4MDSA 1L4DA 4ISNA 1GBJA 1SGYE 3RXCA 3LPRA 1DXWA 1TOCB 3JZ1B 4B2CA 1AFQB 2OTVA 3SNAA 1O38A 3BIVH 4IN2A 2J94A 1TQ0B 1NT1A 3SI3H 1BITA 1P57B 1IHSH 2VIWA 1CHGA 1BT7A 2VIOA 2ZEBA 1GMCG 2BOHB 5HXFA 4FUGA 4I8JA 2BVXH 8ESTE 1V2QT 1GI2A 5L2YH 1VCPA 1MH0A 5E0JA 5L2ZH 3GCHC 4KELA 1EASA 5FPSA 5JB9S 1MU6B 1V2PT 1TB6H 3KEEA 4HTCH 1G3BA 2SFAA 4KTCA 2HPPH 3HATH 1Z6EA 1NM6A 1V6DA 3MU8A 2R3UA 2OP9A 4Q7XA 5CMXH 3LDXH 1SFQB 1Z8RA 4O9VA 1S6HA 4Y8ZA 2BM2A 1QIXB 1AVGH 3A7WA 4Q80A 2WPHS 3FANA 3STIA 4H42U 1O3DA 4GCHF 5EQRA 1LPGB 2OC8A 1DITH 2ZPQA 4X6NA 1MBQA 2ESTE 3LGUA 2QC2A 1GJDB 3SV8A 4FUHA 1C2DA 5DP9A 4DVAU 1UO6A 2XC5A 4ISIH 4IS5A 1AHTH 2VB0A 1XKBC 2BD2A 1NO9H 5DGJA 1MAXA 3PLKA 5CHAB 1GJAB 1ZTJA 3M3TA 3MWIU 2AGGX 2IN2A 4WH6A 1T8LA 5GIBA 3TH4H 1KXCA 1C5PA 3SQHE 1JBUH 1GBDA 4Y6DA 3Q3XA 4MPWA 5EXMA 1C2FA 3ENSB 5C67A 3S9BA 1SI5H 1C2EA 3FP6E 2VIVA 1CGIE 3DFJA 3BEIB 1C4V2 1P12E 3RUOA 2OCVB 1TX8A 1FUJA 1GHXH 1UVPA 2H5DA 4F49A 4JK6A 2CGAA 1QTFA 1S0RA 1TRMA 1A1RA 3ZVFA 3GISB 2H6MA 3SJIA 4XDEA 1N6YA 3A7ZA 1C1SA 2VVUA 2AIQA 3LGWA 4MQAA 1A0JA 4XFQA 1A0HB 5HGGA 3U69H 1TA2A 2PKAA 3TNTA 1TABE 2P8OB 1J14A 4NFFA 1A4WH 1HXFH 2QA9E 3M7UA 1DOJA 1C2LA 1C5UA 2QY0B 2ALPA 5DP7A 1XX9A 4X1QU 2HOBA 3V3MA 1H4WA 1Y3VA 1AI8H 2ZTYA 4NG9H 3A8DA 1EUFA 2ZWLH 1BIOA 2ZU1A 3NCLA 1TNKA 1TPPA 1KXAA 1CBWC 1RFNA 1MU8B 1Z8IB 2HPQH 2H1UA 1PPFE 3A83A 3GDVA 1V2UT 1C5QA 2XW9A 1A7SA 1WAYB 1UTKA 2PR3A 2EEKA 2GDEH 2AH4X 1AGJA 3AAUA 1P03A 3ITIA 1IQIA 1Y5AT 1K2I1 2BLOA 2BD4A 3RU4T 2ZCHP 2Z9GA 1QL7A 3BTGE 4DGJA 1GI5A 1SOZA 3RXMA 3PM3A 2VWOA 1O3LA 1O2WA 3GICB 2R2WU 3ZZ6A 1O3IA 2O8TA 1ZRKA 3T25A 3KL6A 3NZIA 1CT2E 2A7HA 3QGNB 1E0FD 2RDLA 1S81A 3PTNA 1SFIA 5AF9H 3A82A 3KQDA 3F9GA 1D9IA 3LH1A 1P2IA 2VIQA 2C8XB 1EATA 1MD8A 1O35A 1JRSA 1QGFA 2PW8H 2EI6A 5JBAS 1QRWA 2BLQA 1HRTH 1DANH 3QLPH 7ESTE 1ZZZA 2F9OA 1AD8H 4RKJB 4THNH 1O3FA 1P01A 4DY7B 1W10U 3ZZ8A 3S9AA 4MVNA 1DWEH 2Z7FE 2EC9H 3PLPA 1B5GH 1BBRK 1GHYH 3GYMA 4TPYA 1BB0B 1KTTB 1FIZA 3RXBA 1VCWA 3S7KB 3PV4A 1UK4A 3TK6A 3ZVDA 5GJ4B 1HUTH 2A0QB 3MU4A 2BDGA 2XBWA 5AHGH 1OWKA 4X6OA 4WMDA 4BAHB 1IQNA 3LJJA 3QK1A 3LT3A 1G2MA 2GV6A 3HPTB 1BRBE 1GBKA 2ANWA 4Q7YA 1NRPH 1EB1H 2WPLS 5EU8A 1GI8B 3TGJE 3A84A 4LK4A 1GMDG 4X6MA 1O3KA 3CS7A 1BTZA 2ZC9H 2YOLA 1SHYA 1UCYH 4INHA 3UNRA 1CGJE 2BMGB 2ZGXH 1C1PA 2VU8E 2F9UA 4X1SU 1VR1H 1AMHA 1W0ZU 4NFEA 4CRCA 3KQBA 3O8CA 2FOMB 3VFEA 4O3UA 5DP8A 1ZR0A 1C5TA 1JIMA 4JCNA 1KTSB 3GDUA 2STAE 1T4VH 4FXGH 5F8XA 1EXFA 1TMBH 2R2MB 4CRBA 4TYDA 1GCTC 4DURA 1SMFE 3BTME 3SW2B 1O2PA 7LPRA 3KQCA 1IQJA 2KAIA 4TPIZ 3BEFB 3URCA 1YPGH 4XBBA 2FXRA 4H6SB 3A8AA 2Z3DA 3F6UH 2AGIX 1FPCH 1WCZA 3M3SA 1XMNB 2ZHEH 1E34B 2PV9B 4BTIB 3BTHE 3GDSA 1GVLA 2B7DH 1RS0A 1T8NA 1TGBA 3GY6A 1RJXB 1FAXA 1OX1A 3E0PB 3E1XB 4R0IA 3S69A 1QCPA 4NIWA 1HAOH 3MO3A 2OINA 2FOAA 3LGIA 1XUJA 1HJAB 2Y81A 4U2WA 3UWIA 4GLYA 4FUFA 4YM9A 4K60A 3S9CA 2ZECA 1UK2A 2DE8A 4ZKSU 4CBOA 4X8TH 2F9PA 2FOEA 1C5YB 1QA0A 2GCHG 2PHBA 3F9EA 1C2HA 2BVRH 1HIAB 3SV9A 3D62A 3ELAH 1HBTH 5CE1A 3T29A 3RXJA 2GKVE 2LPRA 1EZUC 1YPHE 1GJBB 1O5FH 2GCTB 5B6OA 1LVYA 3UREA 4UEHH 5A0BA 3ATKA 2JH5D 2GCTC 1O2SA 2V35A 3SN8A 4TY6A 1RD3B 3NKKA 3S7HB 1O3OA 2Z94A 1GHZA 4WY3A 3LKWA 3A80A 3K6ZA 1UHBB 1O36A 2OD3B 3GCNA 5BPEA 1HYLA 1FONA 2Z9JA 1F0UA 2ZPRA 1OWIA 3BTDE 4YOJA 4IC5A 1AVXA 1E37B 3EDXB 3PMBB 2BTCE 4BAMB 1GI0A 4RKOB 1TBQH 2PKAB 4DW2U 3M5NA 5FXLA 1TGSZ 3PMAB 1SVPA 3RC4A 1GMHF 4X2XA 1BHXB 3P8NA 1AUTC 3ATLA 5DP4A 3SHCH 2W5EA 4GSOA 1NN6A 1ZLRA 3ZVEA 2PUQH 3FZDA 4DG4A 3U8TH 1O3NA 2FP7B 1EAIA 5DJ7A 2A4OA 4AB8A 4AN7A 4DCDA 1GCTB 2A2XH 1M9UA 4NZLA 2BXUH 1G32B 1V2MT 4KTSA 3UIRA 1LPKB 4INKA 1SLXB 2C4FH 4XBCA 1UMAH 1MTNB 3F1SB 5EQQA 2ZGBH 2IJOB 3TNSA 3ATWA 4QT8C 1C1UH 1VZQH 5EGMA 1ZGIA 1NFXA 4IW4E 1QHRB 3E3TA 3MMGA 3M35A 3VB5A 1PPHE 1TGNA 1TRYA 3TJUA 4ZROA 1WUNH 3LGVA 2NU2E 4U30A 1VGCB 1MQ6A 5JBCS 5LPRA 5EOKA 2A5KA 3E91A 3T27A 1BTUA 5C3NA 3E8LA 1UTOA 4Y79A 4ISOA 4I32A 1GDNA 2ZNKH 2OC0A 1C4U2 2TIOA 1C4Y2 2CHAC 4GVUA 4LZ1H 1Z6JH 4UFFH 2VGCC 1OSSA 1XKAC 1AB9C 1OWJA 5HM2A 1WTGH 1EOJA 1F5RA 4I31A 2BLVA 2H9EH 1AN1E 2XYAA 5TCAA 2JETB 1UJ1A 2SGEE 3PB1E 3ZV8A 1TIOA 2A2QH 3RXKA 1XVMA 4K2YA 5EXLA 1EQ9A 3CS0A 1OWDA 4ZMAH 1Q31A 1G3EA 5E2PA 1VITF 3D49H 3MNCA 3MH4A 3EE0B 1NRSH 1EJNA 1SGNE 3RXTA 3GCTF 2RG3A 1J17T 5ESBA 4XOJA 4NIVA 3MO9A 1XM1A 3TJNA 2BDBA 1AIXH 1GL1A 1O2JA 1T8MA 4A7IB 1C5WB 1O2GH 1Z1JA 2AGEX 1FAKH 1C5NH 4I7YH 1TMTH 3LGYA 4NSYA 2P3FH 1DY8A 2B5TB 2QXHA 2H2ZA 1AQ7A 1C9PA 2UUKB 3SHAH 3ZZ3A 2BY6X 1AB9B 1ACBE 1LHEH 2VGCB 1ETTH 4WWYA 1B7XB 2CHAB 1THSH 3ZZ5A 2ZI2H 2GP9B 2ZGCA 4MTBA 1ETSH 1FY5A 2A7JA 4B73A 1NTPA 4YLQH 3ZZ4A 5FBIA 1BRAA 2OC1A 4LOYH 1AKSB 1CBWB 4OS1A 1JXPA 1ABIH 1ELGA 5HM9A 4AFQA 2EI7A 1VGCC 1Y8TA 3SU0A 1Y3XA 3KGPA 1Q2WA 3KQEA 1Z8GA 5EQSA 2BY7X 3DUXH 1C5VA 1XXDA 2XWAA 3QX5H 4Q7ZA 1Z8JB 5DP5A 2VNTA 2YNAA 2C8WB 1LQDB 2ZCKP 3LIWA 4X2VA 5DO4H 2ZQ2A 1GJ7B 2OLGA 1O3HA 5C1XA 2PSYA 2BDCA 1C2KA 5DG6A 4UFGH 2A4RA 2BYAX 3GOVB 4AG1A 4Z0KA 6CHAB 2J34A 2Z9LA 4H6TA 1PQ7A 1O2NA 1L1GA 2SGFE 2QYIA 3Q77A 4GHQA 1OOKB 4YT7H 3L6PA 4K69A 2FTLE 1LQEA 3RXIA 2UWPA 1PYTC 1K1NA 5FAHA 1Z7KA 1YPLH 2A32A 1QQUA 2QAAA 2XC4A 1L1NA 2QN5T 4KTUA 4X1NU 1BRUP 1BA8B 1QFKH 4A1XA 1P9UA 1TNJA 2BY8X 3QZRA 2XCFA 1SR5C 1GHWH 1V2WT 3FP8E 1V2RT 4B71A 2FTMA 1NS3A 5DP6A 1S5SA 4ZHLU 4IBLH 5T6GA 1GWAA 2J4IA 1WBGB 4OS6A 5G4BA 2AMQA 1DS2E 5TJXA 4E06H 1YCPK 1YM0A 3UR9A 1MKWH 1DUEA 3SQEE 3V0XA 1ZPCA 4J1YA 1F0RA 3UFAA 2FPZA 3RXLA 2ZCLP 5TCCA 3M3VA 2Y6TA 1O32A 4YOIA 2FOCA 1P04A 3A7VA 2ANKH 3P8OA 1OKXA 3SU6A 1PJPA 4D76A 2WPIS 3LH3A 1A5HA 3RDZA 3A7TA 1DPOA 1GJ5H 4CRDA 3RM2H 3SJ9A 4B75A 1SHHB 2K1QA 3TGIE 1HJAC 4DIHH 2HNTC 1DWCH 4WF8A 3IITA 4KKDA 4NWKA 1PYTD 1AWFH 3TITA 1ARCA 1ANBA 3A7XA 3P95A 1EP5A 1ZRBA 2F3CE 2BDYA 2J95A 3PWBA 1BBRE 3M61U 1ZSLA 2ZDMA 4OS2A 4AGKA 1GI1A 1E38B 1UTJA 5EPYA 5LPEA 5F8TA 3SV6A 2ZFRH 1EP6A 3QWCH 3SNBA 1GMDF 1VITH 3I78A 2XBVA 3RU4E 1ELTA 2ZTZA 1D3TB 4D9RA 1O3BA 1SC8U 3GYLB 3T2NA 3TIUA 6ESTA 3RXRA 2HWLB 3UNQA 1N8OC 4X2YA 4MPVA 1VJ9U 1QBVH 1GDQA 1BRCE 1W8BH 3EGKH 2J2UA 2R9PA 1D3PB 1GI4A 4AOQA 1MCVA 4H4FA 2JKHA 1K1OA 5DP3A 9LPRA 2ZDNA 2ZDVH 1V2KT 3C27B 1WU1A 4NSVA 1ELBA 1GDUA 1JRTA 4ABFA 1MTSA 1IQEA 1KXBA 2FI3E 1CU1A 1D4PB 5ETXA 1GBCA 3A86A 1HIAA 5J4QA 2GVFA 3F68H 4GPGA 4K5ZA 1W11U 4JZEH 3PROA 1C2IA 2ZU4A 3A7YA 2SGQE 1WYKA 4B2AA 1EPTB 1TAWA 1IQHA 2VH6A 1CGHA