1GVLA

Human prokallikrein 6 (hk6)/ prozyme/ proprotease m/ proneurosin
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
223
structure length
223
Chain Sequence
KLVHGGPCDKTSHPYQAALYTSGHLLCGGVLIHPLWVLTAAHCKKPNLQVFLGKHNLRQQESSQEQSSVVRAVIHPDYDAASHDQDIMLLRLARPAKLSELIQPLPLERDCSAQTTSCHILGWGKTADGDFPDTIQCAYIHLVSREECEHAYPGQITQNMLCAGDEKYGKDSCQGDSGGPLVCGDHLRGLVSWGNIPCGSKEKPGVYTNVCRYTNWIQKTIQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords KALLIKREIN 6
publication title The Structure of Human Prokallikrein 6 Reveals a Novel Activation Mechanism for the Kallikrein Family.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 49
structure length 223
sequence length 223
ec nomenclature
pdb deposition date 2002-02-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1gvlA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1gvlA02
3LH3A 4X1RU 2GMTC 1UMAH 5C5OA 1GJBB 1ETSH 2GX4A 2NU4E 2BXUH 1FONA 3BG4B 1YCPM 1ZTLA 3W94A 1N8OC 3LGTA 2BD3A 1WBGB 4DURA 4KTCA 1TE0A 3TK5A 4MNXA 2BOHB 2JETC 3RU4T 1HYLA 1C5RA 2P93A 4HFPB 1THSH 2ZU5A 4D7GA 1TA6A 1XMNB 2FYRA 2ZHWH 3EDXB 1PQ7A 3A83A 3SJKA 1MQ5A 1V3XA 1P2NA 3A8BA 3VFEA 2QY0B 1JRSA 3ESTA 3RXOA 4LOYH 3P8GA 3GY8A 1L1JA 4HGCA 3BSQA 2P95A 1W8BH 1GBFA 2AIQA 3RDZA 1ZMJA 2I6SA 1ARBA 4ISIH 1ZTJA 2YNBA 1OWIA 1J16A 1SGFG 1ZHMA 2ZHDA 3LONA 2D1JA 1XX9A 2WPJS 1NM6A 1FY1A 3M37A 1GI0A 1ZMLA 2BDHA 4WMEA 2WUCA 3SZNA 4YOGA 2ALVA 1VCWA 1NRSH 4X8SH 1H9LB 2I6QA 1QBVH 4SGBE 1B5GH 1C5TA 1E34B 1FY8E 1O3AA 3QGJA 4FUCA 1OOKB 1V2NT 4CRGA 5F8TA 2WPMS 3FP7E 4K8BA 4ZKNU 3NKKA 1Z8GA 3T28A 5DGJA 3ZZ5A 2FOAA 1C1PA 1EB2A 5T3HA 1P0SH 4NG9H 3TGJE 3HGNA 4FU9A 5L30H 1XUFA 2VVCA 1AD8H 3MO6A 2SFAA 4ISNA 1AE8H 1GCTB 1TAWA 1SGDE 2XYAA 3S0NA 1XVMA 1G2MA 1SOZA 1A2CH 1XUKA 4AG1A 4UFEH 2Y6TA 2Q6DA 2BOKA 1A7SA 1RD3B 1VCPA 1PQ5A 1IAUA 4O3TA 5CE1A 2OCVB 1GG6C 4U01A 1G3CA 2IPHA 1D4PB 1SGEE 1K1LA 1WOFA 1S85A 3MH5A 3FFGA 3UWIA 4Y11E 1GHXH 3P17H 1VITF 3KN2A 2PKSB 1G3DA 1ELDE 2ZGBH 1EASA 1EZSC 2JH0D 2GV6A 1GI2A 3H7TA 1KDQA 1TGBA 1GBIA 1SVPA 5E0GA 1S6HA 1IQNA 1SLWB 4FXGH 1HIAB 3ZZCA 4D76A 4BXWA 2XC0A 1JRTA 1W14U 1BITA 1A4WH 1C2IA 1V2KT 2GGVB 3SUDA 1HAZB 1V2VT 3ZZ3A 4ABJA 2O8LA 2B0FA 1CHGA 5JBCS 1SQOA 2QAAA 1GBAA 3OX7U 2C8ZB 4Q80A 3SJ8A 1C1WH 3HK3B 2Q1JA 3A87A 3BG8A 1IQFA 1TX6A 3UY9A 3AW1A 1HXFH 4RKOB 3PV4A 2WV5A 4AZ2B 1O34A 4IC6A 3ELAH 3FVFB 1WTGH 3UQOA 1TOMH 2VB0A 3ODFA 5C67A 1SPJA 4MLFB 2OD3B 1ZHPA 1AGJA 1NFWA 1ZOMA 5T6GA 5J4SA 4GSOA 1KXAA 1ZHRA 1O2KA 1N6YA 2CF9H 4RSPA 3M7UA 4X6PA 3L3TA 2F9PA 2QXIA 2ZU1A 1FPCH 1HDTH 3STIA 3B23B 2CF8H 3GCOA 2FWWA 5I46H 3M3SA 3TGKE 1Y3WA 1W10U 2OQUA 1NT1A 1BHXB 2OBOA 4SGAE 1C2MA 1LHFH 2ZHQH 2BDYA 1O2NA 1EX3A 2JKHA 3QK1A 3A7WA 4CH2B 4XFQA 4KTSA 3HGPA 4ABBA 4E06H 5DKMA 1ANCA 1GHAG 1P57B 5CMXH 5BRRE 2HNTF 3SORA 3AAVA 1O3FA 5A8ZA 1NRRH 4CR5A 4ABDA 3N7OA 2FX4A 1SFIA 1GJ8B 1L2EA 4MPVA 4DW2U 2Z94A 2EI8A 1ZSKA 2Q6FA 3TJVA 2GDDA 1HJAB 1YPJH 3HKJB 1OS8A 1EKBB 2SGDE 1J9CH 3K2UA 2CHAC 5SGAE 1NFYA 3A7TA 4WF8A 1S83A 2RA3A 3UNSA 3RXUA 5HXFA 3ATWA 3PM3A 1KLIH 3TIUA 3ZZBA 1TX7A 1C2LA 5FX6A 1S5SA 1TBZH 1RJXB 2BZ6H 7KMEH 4U2WA 1NU9A 2AEIH 3A85A 3NCLA 2ZDKA 2AFQB 1C5VA 4JZ1A 3UOUA 4ABAA 1ID5H 1TQ0B 3GY2A 3ATKA 1KY9A 1O33A 2F9BH 4O9VA 1TBQH 1QURH 1DFPA 1BZXE 1EPTA 1P8VC 4X1NU 2FX6A 1NROH 1FAXA 1N8OB 2AMDA 1QTFA 1MCVA 4Y0ZE 3K6YA 1TLDA 2GCHF 2JETB 3V12A 1PPCE 1UTMA 2PGBB 1KYNA 1PYTD 1DUAA 3F9GA 1HBTH 5FCRA 3E3TA 4A1VA 2BQWB 1O36A 2FEQH 2WV4A 5EXMA 2G00A 1CT0E 1L1GA 6GCHG 1IOEA 1G36A 1O5FH 1TABE 2ZKSA 4K69A 1EOJA 3EGKH 1O3PB 2WPLS 1YPKH 4CRBA 1HFDA 1MU6B 1BUIA 3LKWA 5BPEA 2O8WA 1FY5A 1G30B 2GZ8A 1P10A 2J38A 3HPTB 3SU3A 1DDJA 3CS7A 2ZFTA 4MVNA 1YP9A 3MH4A 1C5XB 1G37A 2BTCE 3BTDE 2IOTA 3C27B 4E7RG 1AWFH 1W11U 1AFQC 1P2IA 3UNQA 4ZKOU 3FP6E 1HGTH 1EUFA 1GMDG 2FDAA 1WCZA 2GD4B 2SGQE 1AIXH 3LC5A 1HAPH 1RTFB 1TRMA 2AYWA 4GHTA 3RU4E 2ZDNA 4WH6A 5DP6A 2HPPH 1LVMA 4Z0KA 4BNRA 2A4QA 2Y82A 3KCGH 3ZYDA 4ISOA 3A8CA 2FM2A 1F7ZA 4CBOA 3ZV8A 4B1TA 2WUBA 2JH6D 2G5NA 2Y5GA 2ZDLA 1WQSA 6LPRA 1UK4A 5EQRA 1FN8A 1GI1A 1GHWH 4UFDH 3S7HB 1W0YH 1V2PT 1YBWA 1MTUA 3SJOA 1GBBA 3PB1E 4UE7H 1BTHH 2F9NA 1G32B 1VGCC 5A0BA 1DANH 3ZVCA 3RXQA 4MG3A 1CO7E 1MU8B 1EATA 1W2KH 3E91A 2TGPZ 4WXIA 4I8JA 1BMLA 1DOJA 4ABEA 1QY6A 4ZKSU 1FY4A 5EXNA 3U8RH 1CBWC 2GCTB 1Z8JB 4Q2KA 3VGCC 3MU1A 2BQ6B 4TY7A 1PJPA 1OWHA 1QL8A 2VJ1A 4E7NA 2J94A 1T8OA 1SGTA 1D3TB 2EI6A 3LOXA 5EQQA 1C1QA 4O03A 7LPRA 3S9BA 4VGCB 2W7UA 2P8OC 1SQTA 2VIWA 2GP9B 4ZUHA 4XBDA 2BZAA 5C3NA 2FLBH 1C1UH 1MTNB 2QV1A 5JDUB 1ORFA 1HCGA 2F9OA 1AKSA 4A1TA 4AFUA 2AS9A 1F0RA 2QC2A 2SGEE 1FAKH 1HNEE 1ABJH 2P3TB 4NSVA 1P3CA 1BBRE 2A4RA 3UNRA 1MBMA 4XBBA 1C2JA 1BCUH 1GPZA 4I31A 2C8XB 1HJ9A 2G4UA 1PPFE 2PTNA 2GT8A 5GWZA 1F0UA 1ZMNA 2CV3A 3UOPA 4A92A 1TPOA 1GJ9B 3SU2A 4DIHH 4OS1A 4ABHA 2FOMB 1GBCA 3R0FA 3GY5A 1TMBH 1C5ZB 1LTOA 2TRMA 4OS6A 1OWKA 4CREA 2PKAA 3SI4H 3KF2A 3OY5U 1M9UA 4LXBH 3RXJA 2BY8X 2QN5T 5A0CA 5TJXA 1C1OA 1W3CA 4PROA 1K1JA 3T26A 3BIUH 4NA7A 1ESAA 1BA8B 2TGDA 3TITA 1RXPA 1ANEA 1O5BB 1FY3A 1P3EA 1A0LA 2YNAA 2ANYA 4FUEA 4JYUH 1O2YA 1DXPA 1L0ZA 1AFEH 1V2QT 1MQ6A 3K65B 3A7YA 1YPHC 1YPLH 1UTKA 1A0JA 2HRVA 3PTBA 5GXPA 4JCNA 1GMHG 1MD8A 1GBEA 2OC8A 4X1SU 2BDCA 1O5CB 1KXBA 5A8YA 2BVSH 3A89A 3RXLA 3SHCH 6CHAC 4INKA 1Q3XA 1O2JA 1GMCF 1AMHA 1SHYA 1UHBA 4IC5A 2PV9B 3Q76A 1FN6A 3BEUA 1GHZA 1P2MA 2C3SA 1V2WT 1DUEA 1JBUH 1G9IE 3BTGE 1P03A 1PQAA 2CHAB 4OS2A 1DY8A 1Z8RA 1GDQA 1XXDA 2DE8A 3SV9A 1AO5A 1GJCB 4ZROA 4TWWA 1ELTA 3P6ZB 2V0BA 4NIVA 1XUIA 3GY6A 3GCTG 1K2I1 1AVXA 2FP7B 1MH0A 1A5HA 3BTQE 5DK1A 3DFLA 3SGQE 1UVSH 3ZVFA 4Y8ZA 2Y80A 2FOHA 3TK6A 3U8OH 3V13A 1AU8A 2XBVA 1TONA 2VH0A 2VIPA 1JMOH 3KQCA 1TNIA 1KXDA 4NSYA 2R2WU 4X1QU 4Y79A 5EU8A 2Z7FE 1AZZA 3GYMA 2KAIA 2FOCA 3SGAE 2F91A 4CHAB 2ZO3H 1K22H 4OS7A 4CRDA 3A8AA 3STJA 1BMNH 1BMMH 2XBXA 3QDZB 4Y8YA 4I8GA 4H6TA 3G01A 2B8OH 1BTYA 2ZG0H 1C2KA 1ZLRA 3F9FA 3RMLH 1UCYE 3MU0A 4CRFA 2C8YB 2ZECA 3MI4A 1Y3XA 1ZZZA 1TMUH 3D49H 3SJ9A 4CRAA 1BRAA 5EGMA 1OP8A 1SBWA 2A7JA 3T62A 1TNGA 1TPAE 1IQHA 1MKWH 1RIWC 2Z9KA 1ZRKA 5K0HA 1AB9C 3H7OA 1O3BA 5HYOA 1QJ7B 3ZZ4A 1EAIA 1DWDH 3GY7A 4AFQA 1J14A 1P01A 2W3KA 1K1MA 1NO9H 3TK9A 1GBJA 2ZDMA 1O5AB 1O2UA 1UTOA 4GHQA 1ELEE 1C5OH 4X8VH 2ZCLP 3FAOA 1UO6A 1SGCA 2XRCA 4Y7AA 3M61U 1XUGA 3U8TH 3O8DA 4K2YA 2STBE 2ZTZA 4BAKB 1UJ1A 4UONA 1DXWA 3IITA 2XTTB 2ZEBA 1KLTA 3LGUA 5E2PA 4WWYA 1KTTB 2WYGA 1QQ4A 1V6DA 4X2WA 1GGDC 2BX4A 2BDAA 1H9IE 2PHBA 3RXGA 4KP0A 1HAVA 3SI3H 1H9HE 4Y6DA 1SR5C 3EA8A 2UWPA 1MAXA 2Z3CA 3MFJA 1C5MD 5EPNA 4FUGA 1BT7A 2FYQA 4XDEA 4IS5A 5HMAA 2BLVA 3HK6B 2WINI 2HNTC 2ODYB 1LVOA 1UTJA 2ZQ2A 1EAXA 1TA2A 1Q31A 1D3QB 2FTLE 5FPSA 4DY7B 2R3UA 1G2LA 2FS9A 3RMNH 4BTUB 4FUBA 4WXVA 3O8CA 1ANDA 1O3GA 1CA0B 2ASUB 4OGXA 2ZHEH 1EP6A 1GI7B 1GHYH 2OP9A 3MMGA 1TALA 1O3KA 1WAYB 3GCHC 1CBWB 1TPSA 1OX1A 3RXMA 1ELCA 1NN6A 2Z3EA 4MNWA 3LGIA 2ZFPH 3RXDA 2ODQA 1SL3A 1P06A 2ZFSA 1BHXF 1SOTA 3GICB 2Z9LA 2CGAA 2A7CA 2P3UB 2GTBA 1MD7A 1LKBA 4AGKA 5EPYA 4U30A 4NCYA 5F8ZA 1ZR0A 2HPQH 2NU1E 5K7RA 4BOHA 1Z71A 4KTUA 2UUJB 5I25A 2ALPA 1MUEB 3VEQB 3RM0H 3M35A 1QB9A 3QUMP 2BXTH 1LVYA 4MQAA 2SGAA 3EAJA 1O5EH 1QBNA 5DP8A 3ENSB 2BLWA 2VIDA 3V7TA 2PR3A 1EJAA 1EZUC 3M5LA 2BY7X 2D8WA 1INCA 4IN2A 4DIIH 3TJUA 1AWHB 4ZHAA 3FZZA 5FHTA 3A7XA 4ESTE 1EAWA 1P11E 1TYNA 3SNCA 1Z8IB 3WY8A 4WH8A 2D2DA 1NZQH 3BTFE 4YT7H 9ESTA 2ZC9H 5DP3A 4X1PU 1ESTA 4DCDA 2R2MB 3QZQA 3MH6A 1O3OA 1TGNA 2PW8H 1GBTA 1O3EA 2PWXA 1O0DH 4MPXA 1A5GH 4IMQA 3A81A 3PLKA 2Y7XA 3QWCH 5FPTA 4D7FA 1GBHA 3ATIA 2R0LA 2RA0A 1C2FA 1GJ7B 2STAE 1GI3A 2QF0A 1GJ5H 3QTVH 4CBNA 1GHAF 1ZSJA 3EA7A 3MU5A 2A4OA 2XBYA 3D23A 3W95A 3F6UH 2UWOA 8KME2 6CHAB 4CH8B 1O2XA 4NIXA 4OS4A 3LJOA 1MKXH 1HLTH 1AUTC 3KQDA 3ODDA 4UD9H 2P59A 2FOEA 4Y71A 2UUKB 1FIZA 1SC8U 1SQAA 1GJ4H 5HGGA 2NU0E 4JYTA 2CJIA 1GVKB 1BRBE 2D26C 2GDEH 2SNVA 5DG6A 2Z9IA 1C5NH 1HB0B 3RM2H 1G3BA 1ABIH 1FLEE 1TBRH 1H1BA 1O3JA 1A0HB 2OUAA 1FIWA 4F49A 1DWCH 5E2OA 1KSNA 3DA9B 3EYDA 8LPRA 2NWNA 1BB0B 2ZGJA 1EPTB 3T5FH 1QB1A 1ANBA 1F5RA 2JH5D 2UWLA 3I77A 1S84A 2QXGA 3NPSA 3P70B 4Y76A 2DUCA 4Y7BA 3LT3A 4WJG2 3UQVA 1CGJE 1HAXB 2FZZA 3TH3H 1QJ6B 3F68H 3OY6U 3LU9B 1DE7H 2OC7A 4BAMB 1C9PA 1FNIA 4GVUA 2BY5X 1VJAU 5DP5A 1WQVH 5GIBA 1QJ1B 1IQMA 1E37B 2Z9JA 2ZFRH 4AN7A 4K1EA 2FOFA 1K9OE 4TPIZ 1C4V2 1JIMA 4YTAA 2FS8A 2FXRA 1A5IA 2J34A 3LGYA 4GAWA 2EI7A 3V0XA 4JYVH 1LHGH 2ZDVH 1T7CA 5L2YH 1LHEH 2GMTB 1PPZA 1T32A 3Q3XA 1L4DA 5AHGH 6GCHF 1ARCA 1O2ZA 1OYQA 3HATH 4IW4E 1CU1A 5ESTE 2BLQA 4INHA 5GJ4B 1ELBA 4UFFH 4AYVB 1C1SA 1CHOG 1LCYA 4IN1A 5PTPA 3S9AA 4ZMAH 1L4ZA 2SGFE 1W13U 1QRZA 1ZYOA 2YOLA 1SI5H 1N1LA 2VWOA 2TGAA 1ELVA 1H8IH 4K1SA 3UR6A 1O2HA 5LPFA 4R0IA 3SUFA 3SV8A 4RKJB 4B71A 1QL7A 2BD7A 1DLEA 4YM9A 1Y59T 2VIOA 1W12U 1TIOA 1GMDF 4D9QA 4I7YH 5HM2A 3RUOA 2ANMH 2BVRH 4YLQH 3ATMA 2OINA 3P95A 1WU1A 4Y10E 3LDXH 3VB6A 3ZZ9A 1O5GH 1V2TT 5ESBA 1VCQA 1ZRBA 1T8MA 4K3JA 4TY6A 5GCHG 3PMAB 2ZHFH 3DD2H 3BTHE 4LZ1H 2TBSA 1RTLA 3EE0B 1CGHA 1LO6A 1T8LA 3U1IB 1IHTH 1C4U2 2PSXA 3E16B 5DP4A 1H4WA 1GI5A 1GVZA 2LNCA 1MKWK 2H2ZA 2PFEA 3TJOA 2P94A 4ZKRU 3H5CB 1RRKA 1VR1H 1DITH 4X6NA 2FODA 1ACBE 3GCHB 2XC5A 1LMWB 1IQJA 1Z1JA 3M36A 2ZGHA 1T8NA 3KHVA 5EXLA 3KIDU 1QCPA 2J95A 3AASA 1MCTA 3TJNA 3A84A 5ABWA 1A61H 4RN6A 2ZU3A 1DX5M 1GG6B 1FMGA 1GVLA 3E8LA 5DP7A 3T29A 1O32A 4ABFA 3UTUH 3PROA 4HZHA 2XWBI 1YLCA 2Q6GA 2FO9A 3ZYEA 3CP7A 2VNTA 1O2LA 4ZHLU 1HAYB 3Q00A 1UTLM 3RC5A 1FXYA 1HV7A 2XWAA 2A4GA 5A8XA 2ZU2A 1QBOA 1Y5UT 5E8EH 3O8RA 2QF3A 4X8UH 3EQ0H 1D9IA 3BTEE 3T25A 1TB6H 2ILNA 1GJAB 1PPGE 1C2HA 3SNEA 2W3IA 1QR3E 1NY22 3U69H 3T2NA 3MNCA 3SOSA 1TNLA 2G81E 5HM9A 2BYAX 1CA8B 3P8FA 4GUXA 3SV6A 1TX8A 2BX3A 4NA9H 2AGIX 1NRPH 5DP9A 3RXEA 5FPYA 3RU4D 4ABGA 1J15A 2ZQ1A 1V2JT 5GPIB 3SU4A 2SNWA 1GBLA 3RC6A 3NZIA 4INLA 1ZPBA 2P16A 3SW2B 2ZIQH 4NA8A 5FBEA 2FTMA 3RMMH 3ZVAA 1C1RA 1D6WA 4JZEH 3LGWA 1C4Y2 1DS2E 2PKSC 1Y8TA 3SUGA 5LH8A 1S6FA 1O31A 5CHAC 1SSXA 3QX5H 3A7VA 2BY9X 2A5IA 1HPGA 1CT4E 1C2DA 3ZZDA 2A1DB 3QO6A 1ZGVA 1PFXC 4B2BA 3NK8A 1ZPCA 1VJ9U 1OP0A 4X0WU 1F92A 2EEKA 2BY6X 4BANB 2PGQB 2H9EH 1O2IA 2Y7ZA 3BN9A 1UCYH 4ZHMU 1HAOH 1O3HA 1XKBC 2ANKH 2QXJA 4O97A 1Y3VA 2H9HA 1O2PA 1DSTA 4WY3A 3LC3A 1O3MA 5T6DA 4X6MA 1AN1E 4YZUA 4THNH 3FZDA 4FU8A 1C1MA 2OXSA 1B0FA 1BIOA 1BJVA 1W7XH 1WUNH 2V35A 3GCTF 4YO9A 2A31A 1BRCE 2A45B 3A80A 4R8TB 9LPRA 1EJNA 4I8LA 4ZXYH 3UWJH 2W5EA 3RP2A 1QB6A 7GCHG 5IYTA 4HI3A 1KTSB 1GL1A 1EAUA 3ZVGA 4AG2A 5C1YA 1GHBG 1CVWH 2ZGCA 1YGCH 1C5UA 1NRQH 1J17T 3M5OA 3MU8A 5F03A 3M5MA 3JZ2B 2W7SA 1CQQA 3PMJA 3RXTA 3S7KB 3I29A 1DICA 1ELGA 5A09A 2BDGA 2BMGB 2A7HA 3PYHA 1OSSA 3URDA 2ZTXA 3BTWE 2A32A 2VVUA 1DT2A 4YOIA 4WVPE 1F5KU 3RXRA 3VB7A 1MKXK 1XM1A 3KGPA 1FPHH 4JZFH 5FBIA 1BTUA 2VWMA 4MDSA 2BQ7B 2BDBA 3Q77A 4Y0YE 3UPEA 1AI8H 1GMCG 4J1YA 2FLRH 1O30A 3SO3A 4I8KA 5DPAA 2M5TA 1MTSA 1SGPE 1SGQE 4X8TH 2H5CA 3SGBE 1A46H 2BM2A 1SFQB 1PQ8A 4FUIA 1WSSH 4X2XA 1MMJN 2Z3DA 1E35B 4ISHH 1HJAC 2IJOB 2P3FH 5C1XA 3KNXA 1E0FD 3PMBB 4A5TS 4B2CA 1S0RA 1IQIA 2QIQA 3TVJB 3SU6A 3GISB 1QA0A 1YPHE 2OLGA 4GCHG 4Z6AH 1O3IA 3MH7A 1HAVB 1F5LA 3TU7H 2G5VA 7ESTE 1O38A 1G3EA 4MTBA 2THFB 1BTWA 1FJSA 4H4FA 1TNHA 2PUQH 1EZQA 3GY3A 5EW1H 2BD2A 3P92A 3FANA 3MO9A 3NXPA 8GCHG 1GI4A 1W0ZU 2FOBA 2WPKS 3A82A 1SHHB 2HALA 1AFQB 1C1VH 1JIRA 1A3BH 2NU3E 4K60A 3ZZ6A 1FQ3A 2Y5HA 4NWLA 2GZ9A 3UUZA 1GBMA 1WYKA 5C5NA 2XCNA 5A0AE 3URCA 1TWXB 4JK6A 3RXCA 1GI8B 2TPIZ 4NZQA 1TQ7B 1AY6H 1GJ6A 1K1PA 5EG4A 1UVTH 4AORA 2CMYA 1U6QA 3GDVA 3RLWH 3GCNA 1ZSLA 4FUFA 4BAQB 2BVXH 2VGCC 3U98H 1UVOA 1UVUH 3ZZ8A 3I78A 2C4FH 3S9CA 3BTKE 4NWKA 1VZQH 2VWLA 1A1RA 2J92A 4OS5A 1DSUA 3RXVA 4CR9A 1GI9B 1VGCB 1T4VH 4ZAEA 2B7DH 1AQ7A 2ZCKP 2ZTYA 4NZLA 1ETRH 4A6LA 4DJZB 1NRNH 2XBWA 3MNBA 5EQSA 5FCKA 2QXHA 1KDQB 3F9EA 1DM4B 5LGOA 2RG3A 1BRUP 1K1NA 2VVVA 3SHAH 3VXFH 3MNXA 5FX5A 5F8XA 5L6NH 1DWBH 1D3PB 2OC0A 5AVDA 2F9VA 3KEEA 3M3TA 4DT7B 3VGCB 1AVWA 2BD8A 3SBKA 2OQ5A 2ZZUH 1HJ8A 1GCDA 3PTNA 4JZIA 4WMDA 2XCFA 2ZCHP 1O37A 1F2SE 2R0KA 3SV7A 1SG8B 1O2MA 3E90B 4YOJA 1GBDA 4FU7A 2O9QA 4XE4A 3D65E 1BBRK 2P8OB 1NC6A 1THRH 1XKAC 2GVFA 1LVBA 1LQEA 1B7XB 2PUXB 4AGJA 5LPRA 1DLKB 3Q3YA 3E1XB 2XNIA 5AF9H 1GBKA 1OWEA 4AB9A 3PMHB 2AIPA 2AGGX 4YESB 5GDSH 5TCCA 5FXLA 3T27A 1YF4A 1YPGH 3RXSA 1ZGIA 3TNSA 3A86A 1NPMA 1ZPZA 1GJDB 1O2RA 1JXPA 1PYTC 4Q7ZA 1C5PA 3SNAA 4X2YA 2BB4A 2ESTE 1MZDA 1D3DB 5LPEA 2H6MA 5CHAB 4UDWH 1AE5A 2CN0H 1BTXA 4I32A 2GCTC 3RC4A 3RLYH 5A2MH 2QA9E 1C2GA 2C93B 1MTWA 2VIVA 5H4IB 1YLDA 4H42U 2XW9A 4Y8XA 1MBQA 2VINA 1BQYA 1BJUA 1HAGE 1TFXA 4ABIA 2IN2A 4FUHA 1DY9A 3BV9B 2V6NA 5TCAA 1VITG 4VGCC 2FI5E 5E0HA 3B8JA 4B75A 3BTME 1FUJA 1C5QA 2HNTE 1EZXC 4ZXXH 3E6PH 1THPB 3PLPA 1OP2A 1Z1IA 1MTNC 3F1SB 1ELAA 1O35A 3DFJA 3PWBA 3M5NA 2AMPA 1T31A 3SUEA 1WTHD 2LPRA 1HAIH 1SLVB 1LPKB 4KKDA 8ESTE 4DGJA 4NIWA 2PSYA 1O2WA 1SGFA 3P8OA 4YT6H 1EOLA 1EJMA 4UEHH 3TPIZ 3PO1C 1SGYE 3ZVDA 1HUTH 2NU2E 3TGIE 3BTTE 1UK2A 2FESH 1C1NA 1HIAA 1Y5AT 2A5KA 4KELA 5DO4H 2BD4A 1T4UH 3BEFB 1W7GH 1LHCH 2A5AA 3MO3A 1Z7KA 3OU0A 1AHTH 3S69A 4AFSA 2HLCA 3QTOH 1HAHH 2BD9A 1TOCB 4AX9H 3ATLA 4BXSA 1EB1H 3NUMA 1ETTH 1P12E 1UVPA 1HRTH 1P2JA 1AZ8A 1QNJA 2J9NA 2ULLA 1DVAH 1SLXB 1TNKA 1KLJH 1A3EH 1ZJKA 3SNBA 1GI6A 1NFXA 5C2ZA 4TWYA 1BOQA 2A2QH 4MPWA 4K5ZA 3BIVH 3RXFA 5C1UA 2G4TA 4KGAA 2CXVA 3OYPA 2K1QA 1YPEH 3E0PB 2ZFFH 4B76A 1C5YB 3UIRA 1ELFA 1P2KA 1UCYK 1GWAA 3LGVA 4TYDA 4FUJA 1YCPH 4DOQA 1XUJA 2VU8E 3ZV9A 4GLYA 4Q7XA 3SJIA 3ITIA 2QCYA 4K1TA 2ZPSA 4D8NA 3QGNB 4JZDH 5EODA 2OBQA 4B2AA 1H8DH 2FI4E 4A1XA 3QZRA 1CHOF 1P9UA 1SGNE 4FUDA 5JYIA 3IWMA 1L1NA 1FZZA 1O5DH 2ZGXH 4BAHB 2Z9GA 1IQLA 2F9UA 4DG4A 1QA7A 3AAUA 1RIWB 2WPHS 5JB8S 1GHVH 4LZ4B 1AB9B 3DHKH 1GDNA 4X2VA 1UK3A 2Y81A 1RFNA 2AH4X 3EA9A 1K28D 1FI8A 1YPMH 2VIQA 3VXEH 4NFEA 1ZJDA 2O8UA 2GKVE 1C9TA 1Q2WA 1XUHA 1Z6EA 1WV7H 5FAHA 2FMJA 2ZPQA 4CHAC 1K1IA 4AYYB 5GCHF 2J4IA 4JMYA 4ASHA 1OWDA 3O8BA 3HKIB 3A8DA 3M7QA 3GYLB 2O8TA 1V2MT 2OTVA 3LJJA 4MNVA 2H5DA 1O3NA 1F0SA 1GGDB 1JWTA 3M7TA 1F0TA 1BTPA 2GZ7A 3MOCA 3R3GB 3PLBA 2VGCB 4JK5A 1NS3A 2B9LA 2GT7A 1OWJA 2FPZA 1O3LA 1V2LT 1GDUA 1RGQA 3D62A 3KQBA 2DE9A 3OTJE 5AFYH 1NTPA 3BG4C 4LK4A 2B5TB 2GCHG 1NU7B 3GDSA 1NESE 1V2RT 2HVXA 1BBRH 1RS0A 3Q3KA 5L2ZH 1LPZB 1YKTA 1TMTH 3TLOA 4U32A 1QRXA 2QGRA 3CENA 5JPMH 3GY4A 2V3OH 3C1KA 2G8TA 4J2YB 3SU5A 4A7IB 2AERH 4Q7YA 1TRYA 3UFAA 3K9XB 3QLPH 1P2QA 2ZU4A 3FP8E 2XXLA 2W26A 1P05A 2A2XH 6ESTA 1K1OA 2C90B 2HOBA 2TIOA 1QL9A 4ISLA 1AKSB 1O2QA 4GPGA 2UUYA 3ZVBA 1C5LH 1JOUB 1Z6JH 5B6OA 2FI3E 1S82A 1TGTA 2ZPRA 5T6FA 1O2VA 1AVGH 1C5SA 1PPEE 4XOJA 3MWIU 1O39A 1QIXB 3MU4A 3SU0A 1EXFA 1ESBA 3JZ1B 4MPUA 2O8MA 3SQEE 3MNSA 1QRWA 3LIWA 1V2ST 1ZTKA 3RXHA 5E0JA 2BHGA 1CA0C 1PPBH 2R3YA 1N6XA 1FV9A 2PKAB 4FVDA 4BTIB 3LPRA 2H9TH 3RXKA 4MNYA 2FIRH 1GCTC 1LKAA 2SGPE 1UTPA 4NIYA 1Y5BT 1BMAA 2QYIA 4FVBA 1C2EA 3L6PA 1DPOA 2OC1A 4XSKU 1B0EA 3RXBA 2ZDAH 3ZZAA 1QQUA 3BF6H 5F6MA 3A88A 2G51A 2VH6A 3GDUA 1EQ9A 4B73A 2RDLA 1P9SA 1O2SA 1Y3UA 5JBBS 1CSOE 1TGCA 2ZFQH 1YYY1 1MZAA 1LPGB 3RXAA 4QT8C 2BLOA 5C20A 1OKXA 1KIGH 3DUXH 3M3VA 1SGRE 2Z6BD 1UTQA 2ZNKH 1UHBB 1YM0A 1P02A 3K6ZA 1O2TA 4F4OC 3RXIA 1TGSZ 3UREA 3VB3A 3VPKA 1GMHF 1CT2E 1XXFA 3U9AH 2VWNA 1YC0A 3PO1B 1KXFA 4WMFA 3V3MA 3RXPA 3A7ZA 1LQDB 1RTKA 5JBTA 2FOGA 1IHSH 3PWCA 4DVAU 1FDPA 1QHRB 2WPIS 3VB4A 2A0QB 4D9RA 1GL0E 1K21H 2ZI2H 1OYTH 4NFFA 5G4BA 4BTTB 3AVZA 7GCHF 1SB1H 2GV7A 1CGIE 2ZP0H 1PPHE 1P04A 3NWUA 5JB9S 2F83A 3DT0H 2ANWA 1C1TA 3U1JB 4BAOB 3MHWU 3RMOH 2XC4A 1O2GH 1X7AC 2BDIA 1GHBF 5AFZH 1UTNA 3SU1A 5EOKA 2F3CE 1KXEA 3KL6A 4NGAH 5EW2H 1KXCA 1NFUA 2EA3A 4HTCH 2KAIB 3IG6B 1TRNA 3GOVB 3CS0A 1O3DA 3AW0A 1P2OA 1BTZA 4IMZA 1CE5A 1QFKH 3TH2H 1QGFA 3ZZ7A 1AUJA 1OXGA 3BEIB 4I33A 1J8AA 3KQEA 4I8HA 3F9HA 1IQKA 3SN8A 2R9PA 2ZF0H 1DWEH 3MTYA 2UUFB 1EP5A 4X6OA 4AFZA 3QN7A 2Y5FA 3MYWA 2G52A 5JBAS 2H1UA 4O3UA 4TPYA 5J4QA 3SNDA 4B74A 2AGEX 4H6SB 1E36B 1SMFE 4IBLH 1TNJA 2BD5A 2HGTH 4OGYA 4UFGH 4ZH8A 4YLUA 5ETXA 5DJ7A 2G55A 1Y3YA 1HXEH 2V3HH 3OSYA 3P8NA 1D6RA 1EPTC 1VITH 1V2OT 2C8WB 1BDAA 2RCEA 3B9FH 3L33A 4GCHF 1XVOA 1P09A 3UR9A 4AB8A 1SLUB 2ZA5A 4E05H 2J2UA 1S81A 1C5WB 1LHDH 1OPHB 2PLXA 1O3CA 1S0QA 2HWLB 1MAYA 4K8YA 2ODPA 3SV2H 1O2OA 3E0NB 2TGTA 1SGIB 3TH4H 8GCHF 2ZWLH 1MTVA 1LDTT 1TPPA 3ZVEA 3LH1A 2EC9H 1E38B 1V2UT 4M7GA 3TNTA 1IQEA 2PTCE 5IDKA 4CRCA 3SQHE 3VB5A 4AOQA 2WYJA 4XBCA 2AMQA 1YCPK 1IQGA 4IGDA
chains in the Genus database with same CATH superfamily
3LH3A 4X1RU 2GMTC 1UMAH 5C5OA 1GJBB 1ETSH 2GX4A 2NU4E 2BXUH 1FONA 3BG4B 1YCPM 1ZTLA 3W94A 1N8OC 3LGTA 2EQNA 2BD3A 1WBGB 4DURA 4KTCA 1TE0A 3TK5A 4MNXA 2BOHB 2JETC 3RU4T 1HYLA 1C5RA 2P93A 4HFPB 1THSH 2ZU5A 4ASUD 4D7GA 1TA6A 1XMNB 2FYRA 2ZHWH 3EDXB 1PQ7A 3A83A 3SJKA 1MQ5A 1V3XA 1P2NA 2J5UA 3A8BA 3VFEA 2QY0B 1JRSA 3ESTA 3RXOA 4LOYH 3P8GA 3GY8A 1L1JA 4FOUC 4HGCA 2OK5A 3BSQA 2P95A 1W8BH 1GBFA 1OHHD 2AIQA 1ZMJA 3RDZA 4DT4A 2I6SA 1ARBA 4ISIH 1ZTJA 2YNBA 1OWIA 1J16A 1SGFG 1ZHMA 2ZHDA 3OTPA 5C94A 3LONA 3F0PA 2D1JA 1XX9A 2WPJS 1NM6A 1FY1A 3M37A 1GI0A 1ZMLA 2BDHA 4WMEA 2WUCA 3SZNA 4Q63A 4YOGA 2ALVA 1VCWA 1NRSH 4X8SH 1H9LB 2I6QA 1QBVH 4SGBE 1B5GH 1C5TA 1E34B 1FY8E 1O3AA 3QGJA 4FUCA 1OOKB 1V2NT 4CRGA 5F8TA 2WPMS 3FP7E 4K8BA 4ZKNU 3NKKA 1Z8GA 3T28A 5DGJA 3ZZ5A 2FOAA 1C1PA 1EB2A 5T3HA 1P0SH 4NG9H 3TGJE 3HGNA 4FU9A 5L30H 1XUFA 2VVCA 1AD8H 3MO6A 2SFAA 4ISNA 1AE8H 1GCTB 1TAWA 1SGDE 2XYAA 3S0NA 1XVMA 1G2MA 1SOZA 1A2CH 1XUKA 1UW7A 3KYFA 4AG1A 4UFEH 2Y6TA 2Q6DA 2BOKA 1A7SA 1RD3B 1VCPA 1PQ5A 1IAUA 4O3TA 5CE1A 2OCVB 1GG6C 4U01A 1G3CA 2IPHA 1D4PB 1SGEE 1K1LA 1WOFA 1S85A 3MH5A 3FFGA 3UWIA 4Y11E 1GHXH 3P17H 1VITF 3KN2A 2PKSB 1G3DA 1ELDE 2ZGBH 1EASA 1EZSC 2JH0D 2GV6A 1GI2A 3H7TA 1KDQA 5C17A 1TGBA 1GBIA 1SVPA 2V7QD 5E0GA 1S6HA 1IQNA 1SLWB 4TSFD 4FXGH 1HIAB 3ZZCA 4D76A 4BXWA 2XC0A 1JRTA 1W14U 1BITA 1A4WH 1C2IA 1V2KT 2GGVB 3SUDA 1HAZB 1V2VT 3ZZ3A 4ABJA 2O8LA 2B0FA 1CHGA 5JBCS 1SQOA 2QAAA 1GBAA 3OX7U 2C8ZB 4Q80A 3SJ8A 1C1WH 3HK3B 2Q1JA 3A87A 3BG8A 3OAAD 1IQFA 1TX6A 3UY9A 3AW1A 1HXFH 4RKOB 3PV4A 2WV5A 4AZ2B 5EJLA 1O34A 4IC6A 3ELAH 3FVFB 1WTGH 3UQOA 1TOMH 2VB0A 1SQRA 3ODFA 5C67A 1SPJA 4MLFB 2OD3B 1ZHPA 1AGJA 1NFWA 1ZOMA 5T6GA 5J4SA 4GSOA 1KXAA 1ZHRA 1O2KA 1N6YA 2CF9H 4RSPA 3M7UA 4X6PA 3L3TA 2F9PA 2QXIA 2ZU1A 1FPCH 1HDTH 3STIA 3B23B 2CF8H 3GCOA 2FWWA 5I46H 3M3SA 3TGKE 1Y3WA 1W10U 2OQUA 1NT1A 1BHXB 2OBOA 4SGAE 1C2MA 1LHFH 2ZHQH 2BDYA 3FOAA 1O2NA 1EX3A 2JKHA 3QK1A 1W0JD 3A7WA 4CH2B 4XFQA 4KTSA 3HGPA 4ABBA 4E06H 2LP6A 5DKMA 3OEED 2KX4A 1ANCA 1GHAG 1P57B 5CMXH 5BRRE 2HNTF 3SORA 3AAVA 1O3FA 5A8ZA 1NRRH 4CR5A 4ABDA 3N7OA 2FX4A 1SFIA 4RI0A 1GJ8B 1L2EA 4MPVA 4DW2U 2Z94A 2EI8A 3WWBA 1ZSKA 2Q6FA 3TJVA 2GDDA 1HJAB 1YPJH 3HKJB 1OS8A 1EKBB 2SGDE 3AK5A 1J9CH 3K2UA 2CHAC 5SGAE 1NFYA 3A7TA 4WF8A 1S83A 2RA3A 3UNSA 3RXUA 5HXFA 3VG8A 3ATWA 3PM3A 1KLIH 3TIUA 3ZZBA 1TX7A 1C2LA 5FX6A 1S5SA 1TBZH 1RJXB 2BZ6H 7KMEH 4U2WA 1NU9A 2AEIH 3A85A 3NCLA 2ZDKA 2AFQB 4ACBA 2J98B 1C5VA 4JZ1A 3UOUA 4ABAA 1ID5H 1TQ0B 3GY2A 3ATKA 1KY9A 1O33A 2F9BH 4O9VA 1TBQH 1QURH 1DFPA 1BZXE 1EPTA 1P8VC 4X1NU 2FX6A 1NROH 1FAXA 1N8OB 2AMDA 1QTFA 1MCVA 4Y0ZE 3K6YA 1TLDA 2GCHF 2JETB 3V12A 1PPCE 1UTMA 2PGBB 1KYNA 1PYTD 1DUAA 3F9GA 1HBTH 5FCRA 3E3TA 5DSFA 4A1VA 2BQWB 1O36A 2FEQH 2WV4A 5EXMA 2G00A 1CT0E 1L1GA 6GCHG 1IOEA 1G36A 1O5FH 1TABE 2ZKSA 4K69A 1EOJA 3EGKH 1O3PB 2WPLS 1YPKH 4CRBA 1HFDA 1MU6B 2GJGA 1BUIA 3LKWA 5BPEA 2O8WA 1FY5A 1G30B 2GZ8A 3KQ5A 1P10A 2J38A 3HPTB 3SU3A 1DDJA 3CS7A 2ZFTA 4MVNA 1YP9A 3MH4A 1C5XB 1G37A 2BTCE 3BTDE 2IOTA 3C27B 4E7RG 1AWFH 1W11U 1AFQC 1P2IA 3UNQA 4ZKOU 3FP6E 1HGTH 1EUFA 1GMDG 2FDAA 1WCZA 2GD4B 2SGQE 1AIXH 3LC5A 1HAPH 1RTFB 1TRMA 2AYWA 4GHTA 3RU4E 2ZDNA 4WH6A 5DP6A 2HPPH 1LVMA 4Z0KA 4BNRA 2A4QA 2Y82A 3KCGH 3ZYDA 4ISOA 2F4LA 3A8CA 2FM2A 1F7ZA 4CBOA 4YXWD 3ZV8A 2XNDD 4B1TA 2WUBA 2JH6D 2G5NA 2Y5GA 2ZDLA 1WQSA 6LPRA 1UK4A 5EQRA 1FN8A 1GI1A 1GHWH 4UFDH 3S7HB 1W0YH 1V2PT 1YBWA 1MTUA 3SJOA 1GBBA 3PB1E 4UE7H 1BTHH 2F9NA 1G32B 1VGCC 5A0BA 1DANH 3ZVCA 3RXQA 4MG3A 1CO7E 5KEDA 1MU8B 1EATA 3N99A 5B6LA 1W2KH 3E91A 2TGPZ 4WXIA 4I8JA 1BMLA 2KR7A 3F2HA 3NRLA 1DOJA 4ABEA 1QY6A 4ZKSU 1FY4A 5EXNA 3U8RH 1CBWC 2GCTB 1Z8JB 4Q2KA 3VGCC 2KCYA 3MU1A 2BQ6B 4TY7A 1PJPA 1OWHA 1QL8A 2VJ1A 4E7NA 2J94A 1T8OA 1SGTA 1D3TB 2EI6A 3LOXA 5EQQA 1C1QA 1EFRD 4O03A 7LPRA 3S9BA 4VGCB 2W7UA 2LELA 2P8OC 4TT3D 1SQTA 2VIWA 2GP9B 4ZUHA 4XBDA 2BZAA 5C3NA 2FLBH 1C1UH 1MTNB 2QV1A 5JDUB 1ORFA 1HCGA 2F9OA 1AKSA 4A1TA 4AFUA 2AS9A 1F0RA 2QC2A 2SGEE 1FAKH 1HNEE 1ABJH 2P3TB 4NSVA 1P3CA 2XOKD 1BBRE 2A4RA 3UNRA 1MBMA 4XBBA 1C2JA 1BCUH 1GPZA 4I31A 2C8XB 1HJ9A 2G4UA 1PPFE 2PTNA 2GT8A 5GWZA 1F0UA 1ZMNA 2CV3A 3UOPA 4A92A 1TPOA 1GJ9B 3SU2A 4DIHH 4OS1A 4ABHA 2FOMB 1GBCA 3R0FA 3GY5A 1TMBH 1C5ZB 1LTOA 1VKYA 2TRMA 4OS6A 1OWKA 4CREA 2PKAA 3SI4H 3KF2A 3OY5U 2VBCA 1M9UA 4LXBH 3RXJA 2BY8X 2QN5T 2PP6A 5A0CA 5TJXA 1C1OA 1W3CA 4PROA 1K1JA 3T26A 3BIUH 4NA7A 1ESAA 1BA8B 2TGDA 3TITA 1RXPA 1ANEA 1O5BB 1FY3A 1P3EA 1A0LA 2YNAA 2ANYA 4FUEA 4JYUH 1O2YA 1DXPA 1L0ZA 1AFEH 1V2QT 1MQ6A 3K65B 3A7YA 1YPHC 1YPLH 1UTKA 1A0JA 2HRVA 3PTBA 5GXPA 4JCNA 1GMHG 1MD8A 1GBEA 2OC8A 1H8ED 4X1SU 2BDCA 1O5CB 1KXBA 5A8YA 2BVSH 3A89A 3RXLA 3SHCH 6CHAC 4INKA 1Q3XA 1O2JA 1MABB 1GMCF 1AMHA 1SHYA 1UHBA 4IC5A 2PV9B 3Q76A 1FN6A 3BEUA 3EE7A 1GHZA 1P2MA 2C3SA 1V2WT 1DUEA 1JBUH 1G9IE 3BTGE 1P03A 1PQAA 2CHAB 4OS2A 1DY8A 1Z8RA 1GDQA 1XXDA 2DE8A 3SV9A 1AO5A 1GJCB 4ZROA 4TWWA 1ELTA 3P6ZB 2V0BA 4NIVA 1XUIA 3GY6A 3GCTG 1K2I1 1AVXA 2FP7B 1MH0A 1A5HA 3BTQE 5DK1A 3DFLA 3SGQE 1UVSH 3ZVFA 4Y8ZA 2Y80A 2FOHA 3TK6A 3U8OH 3V13A 1AU8A 2EY4C 2XBVA 1TONA 2VH0A 2VIPA 1JMOH 3KQCA 1TNIA 1KXDA 4NSYA 2R2WU 4X1QU 4Y79A 5F53A 5EU8A 2Z7FE 1AZZA 3GYMA 2KAIA 2FOCA 3SGAE 2F91A 4CHAB 2ZO3H 1K22H 4OS7A 3U28C 4CRDA 3A8AA 3STJA 4OM9A 1BMNH 1BMMH 1NBME 2XBXA 3QDZB 4Y8YA 4I8GA 4H6TA 3G01A 2B8OH 1BTYA 2ZG0H 1C2KA 1ZLRA 3F9FA 3RMLH 1UCYE 3MU0A 4CRFA 2C8YB 5GNDA 2ZECA 3MI4A 1Y3XA 1ZZZA 1TMUH 3D49H 3SJ9A 4CRAA 1BRAA 5EGMA 1OP8A 1SBWA 2A7JA 3T62A 1TNGA 1TPAE 1IQHA 1MKWH 1RIWC 4F55A 2Z9KA 1ZRKA 5K0HA 1AB9C 3H7OA 1O3BA 5HYOA 1QJ7B 3ZZ4A 1EAIA 1DWDH 3GY7A 4AFQA 5KGOA 1J14A 1P01A 3UAIC 2W3KA 1K1MA 1NO9H 3TK9A 1GBJA 2ZDMA 1O5AB 1O2UA 1UTOA 4GHQA 1ELEE 1C5OH 4X8VH 2ZCLP 3FAOA 1UO6A 1SGCA 2XRCA 4Y7AA 3M61U 1XUGA 3U8TH 3O8DA 4K2YA 2STBE 2ZTZA 4BAKB 1UJ1A 4UONA 1DXWA 3IITA 2XTTB 2ZEBA 1KLTA 3LGUA 5E2PA 4WWYA 1KTTB 2WYGA 1QQ4A 1V6DA 2AHME 4X2WA 1GGDC 2BX4A 2BDAA 1H9IE 2PHBA 3RXGA 4KP0A 1HAVA 3SI3H 1H9HE 4Y6DA 1SR5C 3EA8A 2UWPA 1MAXA 2Z3CA 3MFJA 1C5MD 5EPNA 4FUGA 1BT7A 2FYQA 4XDEA 4IS5A 5HMAA 2BLVA 3HK6B 2WINI 2HNTC 2ODYB 1LVOA 1UTJA 2ZQ2A 1EAXA 1TA2A 1Q31A 1D3QB 2FTLE 5FPSA 4DY7B 2R3UA 2KCOA 1G2LA 2FS9A 3RMNH 4BTUB 4FUBA 4WXVA 3O8CA 1ANDA 1O3GA 1CA0B 2ASUB 4OGXA 2ZHEH 1EP6A 1GI7B 1GHYH 2OP9A 3F2FA 3MMGA 1TALA 1O3KA 1WAYB 3GCHC 1CBWB 1TPSA 1OX1A 3RXMA 1ELCA 1NN6A 2Z3EA 4MNWA 3LGIA 2ZFPH 3RXDA 2ODQA 1SL3A 1P06A 3SZEA 2ZFSA 1BHXF 1SOTA 3GICB 2Z9LA 2CGAA 2A7CA 2P3UB 2GTBA 1MD7A 2JIZD 1LKBA 4AGKA 5EPYA 4U30A 4NCYA 5F8ZA 4XRNA 1ZR0A 2HPQH 2NU1E 5K7RA 4BOHA 1Z71A 4KTUA 2UUJB 5I25A 2ALPA 1MUEB 3VEQB 3RM0H 3M35A 1QB9A 3PV2A 2BXTH 3QUMP 1LVYA 4MQAA 2SGAA 3EAJA 1O5EH 1QBNA 5DP8A 3ENSB 2BLWA 2WPDD 2VIDA 3V7TA 2PR3A 1EJAA 1EZUC 3M5LA 2BY7X 2D8WA 1INCA 4IN2A 4DIIH 3TJUA 1AWHB 4ZHAA 3FZZA 5FHTA 3A7XA 4ESTE 1EAWA 1P11E 1TYNA 1COWD 3SNCA 1Z8IB 3WY8A 4WH8A 2D2DA 1NZQH 4Z1MD 1FX0B 3BTFE 4YT7H 9ESTA 2ZC9H 5DP3A 4X1PU 1ESTA 4DCDA 2R2MB 3QZQA 3MH6A 1O3OA 1TGNA 2PW8H 1GBTA 1O3EA 2PWXA 1O0DH 4MPXA 1A5GH 3F3BA 4IMQA 3A81A 3PLKA 3F2GA 2Y7XA 3QWCH 5FPTA 4D7FA 1GBHA 3ATIA 2R0LA 2RA0A 1C2FA 1GJ7B 2STAE 1GI3A 2QF0A 1GJ5H 3QTVH 4CBNA 1GHAF 1ZSJA 3EA7A 3MU5A 2A4OA 2XBYA 3D23A 3W95A 3F6UH 2UWOA 8KME2 6CHAB 4CH8B 1O2XA 4NIXA 4OS4A 3LJOA 1MKXH 1HLTH 1AUTC 3KQDA 3ODDA 4UD9H 2P59A 2QF4A 2FOEA 4Y71A 2UUKB 1FIZA 1SC8U 1SQAA 1GJ4H 5HGGA 2L74A 2NU0E 4JYTA 2CJIA 1GVKB 1BRBE 2D26C 2GDEH 2SNVA 5DG6A 2Z9IA 1C5NH 1HB0B 3RM2H 1G3BA 1ABIH 1FLEE 1TBRH 1H1BA 1O3JA 1A0HB 2OUAA 1FIWA 4F49A 1DWCH 5E2OA 1KSNA 3DA9B 3EYDA 8LPRA 3CNRA 2NWNA 1BB0B 2ZGJA 1EPTB 3T5FH 1QB1A 1ANBA 1F5RA 2JH5D 2UWLA 3I77A 1S84A 2QXGA 3NPSA 3P70B 4Y76A 2DUCA 4Y7BA 3LT3A 1K0HA 4WJG2 4M9FA 3UQVA 1CGJE 1HAXB 2FZZA 3TH3H 1QJ6B 1H8HD 3F68H 3OY6U 3LU9B 1DE7H 2OC7A 3OE7D 4BAMB 1C9PA 1FNIA 4GVUA 2BY5X 1VJAU 5DP5A 1WQVH 5GIBA 1QJ1B 1IQMA 1E37B 2Z9JA 2ZFRH 4AN7A 4K1EA 2FOFA 1K9OE 4TPIZ 1C4V2 1JIMA 4YTAA 2FS8A 2FXRA 1A5IA 2J34A 3KYGA 3LGYA 4GAWA 2EI7A 3V0XA 4JYVH 1LHGH 2ZDVH 1T7CA 5L2YH 1LHEH 2GMTB 1PPZA 1T32A 3Q3XA 1L4DA 2YMSC 5AHGH 6GCHF 1ARCA 1O2ZA 1OYQA 3HATH 4IW4E 3WW7A 1CU1A 5ESTE 2BLQA 4INHA 5GJ4B 1ELBA 4UFFH 2HLDD 4AYVB 1C1SA 1CHOG 1LCYA 3OFND 4IN1A 5PTPA 3S9AA 4ZMAH 1L4ZA 2SGFE 1W13U 1QRZA 1ZYOA 2YOLA 1SI5H 1N1LA 2VWOA 2TGAA 1ELVA 1H8IH 4K1SA 3UR6A 1O2HA 2F43B 5LPFA 4R0IA 3SUFA 3SV8A 4RKJB 4B71A 1QL7A 2BD7A 3DSGA 1DLEA 4YM9A 1Y59T 2VIOA 1W12U 1TIOA 5EJ1A 1KMHB 1GMDF 4D9QA 4I7YH 5HM2A 3RUOA 5HIZA 2ANMH 2BVRH 4YLQH 3ATMA 2OINA 3P95A 1WU1A 4Y10E 3LDXH 3VB6A 3ZZ9A 1YWUA 4AC9A 1O5GH 1V2TT 5ESBA 1VCQA 1YY3A 1ZRBA 1T8MA 4K3JA 4TY6A 5GCHG 3PMAB 2ZHFH 3DD2H 3BTHE 4LZ1H 2TBSA 1RTLA 3EE0B 1CGHA 1LO6A 1T8LA 3U1IB 4B6EA 2W6JD 1IHTH 1C4U2 2PSXA 3E16B 5DP4A 1H4WA 3N7EA 1GI5A 1GVZA 2LNCA 1MKWK 2H2ZA 2PFEA 3TJOA 2P94A 4B6FA 1QZ8A 4ZKRU 3H5CB 1RRKA 1VR1H 1DITH 4X6NA 2FODA 1ACBE 3GCHB 2XC5A 1LMWB 1IQJA 1Z1JA 3M36A 2ZGHA 1T8NA 3KHVA 5EXLA 3KIDU 1QCPA 2J95A 3AASA 3N7DA 4ACAA 1MCTA 3TJNA 3A84A 5ABWA 1A61H 4RN6A 3FO8D 2ZU3A 1DX5M 1GG6B 1FMGA 1GVLA 3E8LA 5DP7A 4P00A 3T29A 1O32A 4ABFA 3UTUH 3PROA 4HZHA 2XWBI 1YLCA 2Q6GA 2FO9A 3ZYEA 3CP7A 2VNTA 1O2LA 4ZHLU 1HAYB 3Q00A 1UTLM 3RC5A 1FXYA 1HV7A 2XWAA 2A4GA 5A8XA 2ZU2A 1QBOA 1Y5UT 5E8EH 3O8RA 2QF3A 4X8UH 3EQ0H 1D9IA 3BTEE 3T25A 1TB6H 2ILNA 1GJAB 1PPGE 1C2HA 3SNEA 2W3IA 1QR3E 1NY22 3U69H 3T2NA 3MNCA 3SOSA 1TNLA 2G81E 5HM9A 2BYAX 1CA8B 3P8FA 4GUXA 3SV6A 1TX8A 2BX3A 5C0UA 4NA9H 2AGIX 5CDFE 1NRPH 5DP9A 3PV5A 3RXEA 5FPYA 3RU4D 4ABGA 1J15A 2ZQ1A 1V2JT 2M2AA 5GPIB 3SU4A 2SNWA 1GBLA 3RC6A 3NZIA 4INLA 1ZPBA 2P16A 3SW2B 2ZIQH 4NA8A 5FBEA 2FTMA 3RMMH 3ZVAA 1C1RA 1D6WA 4JZEH 3LGWA 1C4Y2 1DS2E 2PKSC 3UB0A 1Y8TA 3SUGA 5LH8A 1S6FA 1O31A 5CHAC 1SSXA 3QX5H 3A7VA 2BY9X 2A5IA 1HPGA 1CT4E 1C2DA 3ZZDA 2A1DB 3QO6A 1ZGVA 1PFXC 4B2BA 3NK8A 1ZPCA 1VJ9U 3H09A 4HG6A 1OP0A 4F48B 4X0WU 2JJ1D 1F92A 2QF5A 2EEKA 2BY6X 4BANB 2PGQB 2H9EH 1O2IA 2Y7ZA 3BN9A 1UCYH 4ZHMU 1HAOH 1O3HA 1XKBC 2ANKH 2QXJA 2JJ2D 4O97A 1Y3VA 5EJZA 2H9HA 1O2PA 1DSTA 4WY3A 3LC3A 1O3MA 5T6DA 4Q4LA 4X6MA 1AN1E 4YZUA 4THNH 3FZDA 4FU8A 1C1MA 2OXSA 1B0FA 1BIOA 1BJVA 1W7XH 1WUNH 2V35A 3GCTF 4YO9A 2A31A 1BRCE 2A45B 3A80A 4R8TB 9LPRA 1EJNA 4I8LA 4ZXYH 3UWJH 2W5EA 3RP2A 1QB6A 7GCHG 5IYTA 4HI3A 1KTSB 1GL1A 1EAUA 1E79D 3ZVGA 2WV9A 4AG2A 1WDIA 5C1YA 1GHBG 1CVWH 2ZGCA 1YGCH 1C5UA 1NRQH 1J17T 3M5OA 3MU8A 5F03A 3M5MA 3JZ2B 2W7SA 1CQQA 3PMJA 3RXTA 3S7KB 3I29A 1DICA 1ELGA 5A09A 2BDGA 2BMGB 2A7HA 3PYHA 1OSSA 3URDA 2ZTXA 3BTWE 2A32A 2VVUA 1DT2A 4YOIA 4WVPE 1F5KU 3RXRA 3VB7A 1MKXK 1XM1A 3KGPA 1FPHH 2CK3D 4JZFH 5FBIA 1BTUA 2VWMA 4MDSA 2BQ7B 2YMSB 2BDBA 3Q77A 4Y0YE 3UPEA 1AI8H 1GMCG 4J1YA 2FLRH 1O30A 3SO3A 4I8KA 5DPAA 1MTSA 1SGPE 1SGQE 2M5TA 4X8TH 2H5CA 2RDEA 3SGBE 1A46H 2BM2A 1SFQB 1PQ8A 4FUIA 1WSSH 4X2XA 1MMJN 2Z3DA 4P02A 1E35B 4ISHH 1HJAC 2IJOB 2P3FH 5C1XA 3KNXA 1E0FD 3PMBB 4A5TS 4B2CA 1S0RA 3PRBA 1IQIA 3MQKC 2QIQA 3TVJB 3SU6A 3GISB 1QA0A 1YPHE 2OLGA 4GCHG 4Z6AH 1O3IA 3MH7A 1HAVB 1F5LA 3TU7H 2G5VA 7ESTE 2WZQA 1O38A 1G3EA 4MTBA 2THFB 1BTWA 1FJSA 4H4FA 1TNHA 2PUQH 1EZQA 3GY3A 5EW1H 2BD2A 3P92A 3FANA 3MO9A 3NXPA 8GCHG 1GI4A 1W0ZU 1BMFD 2FOBA 2WPKS 3A82A 1SHHB 2HALA 1AFQB 1C1VH 1JIRA 1A3BH 2NU3E 4K60A 3ZZ6A 1FQ3A 2Y5HA 4NWLA 2GZ9A 2KFWA 3UUZA 1GBMA 1WYKA 5C5NA 2XCNA 5A0AE 3URCA 1TWXB 4JK6A 3RXCA 1GI8B 2KCPA 2TPIZ 4NZQA 1TQ7B 1AY6H 1GJ6A 1K1PA 5EG4A 1UVTH 4AORA 2CMYA 1U6QA 3GDVA 3RLWH 3GCNA 1ZSLA 4FUFA 4BAQB 2BVXH 2VGCC 3U98H 1UVOA 1UVUH 1NBMD 3ZZ8A 3I78A 2C4FH 3S9CA 3BTKE 4NWKA 1VZQH 2VWLA 1A1RA 2J92A 3OEHD 4OS5A 1DSUA 3RXVA 4CR9A 1GI9B 1VGCB 1T4VH 4ZAEA 2B7DH 1AQ7A 2ZCKP 2ZTYA 4NZLA 1ETRH 4XD7D 4A6LA 4DJZB 1NRNH 2XBWA 3MNBA 5EQSA 5FCKA 2QXHA 1KDQB 3F9EA 3WWFA 1DM4B 5LGOA 2RG3A 1BRUP 1K1NA 4ZCNA 2VVVA 3SHAH 3VXFH 3MNXA 5FX5A 5F8XA 5L6NH 1DWBH 1D3PB 2OC0A 5AVDA 2F9VA 3KEEA 3M3TA 4DT7B 3VGCB 1AVWA 2BD8A 2KZ4A 3SBKA 2OQ5A 2J97A 2ZZUH 1HJ8A 1GCDA 3PTNA 4JZIA 4WMDA 5EIYA 2XCFA 2ZCHP 1O37A 1F2SE 2R0KA 3SV7A 1SG8B 1O2MA 3E90B 4YOJA 1GBDA 4FU7A 2O9QA 4XE4A 3D65E 1BBRK 2P8OB 1NC6A 1THRH 1XKAC 2GVFA 1LVBA 1LQEA 1B7XB 2PUXB 4AGJA 5LPRA 1DLKB 3Q3YA 3E1XB 2XNIA 3FKSD 2IJD1 5AF9H 1GBKA 1OWEA 4AB9A 3PMHB 2AIPA 2AGGX 4YESB 5GDSH 5TCCA 5FXLA 3T27A 1YF4A 1YPGH 3RXSA 1ZGIA 3TNSA 3A86A 1NPMA 1ZPZA 1GJDB 1O2RA 1JXPA 1PYTC 2L6OA 4Q7ZA 1C5PA 5T1VA 3SNAA 4X2YA 2BB4A 2ESTE 1MZDA 1D3DB 5LPEA 2H6MA 5CHAB 4UDWH 1AE5A 5C0TA 2CN0H 1BTXA 4I32A 2GCTC 3RC4A 3RLYH 5A2MH 2QA9E 1C2GA 2C93B 1MTWA 2VIVA 2WHXA 5H4IB 1YLDA 4H42U 2XW9A 4Y8XA 1MBQA 2VINA 1BQYA 1BJUA 1HAGE 2V3MA 1TFXA 4ABIA 2IN2A 4FUHA 1DY9A 3BV9B 2JDID 2V6NA 5TCAA 1VITG 4VGCC 2FI5E 5E0HA 3B8JA 4B75A 3BTME 1FUJA 1C5QA 2HNTE 1EZXC 4ZXXH 3E6PH 1THPB 3PLPA 1OP2A 1Z1IA 1MTNC 3F1SB 1ELAA 1O35A 4RT0A 3DFJA 3PWBA 3M5NA 2AMPA 1T31A 3SUEA 1WTHD 2LPRA 1HAIH 1SLVB 1LPKB 4KKDA 8ESTE 4DGJA 4NIWA 2PSYA 1O2WA 1SGFA 3P8OA 4YT6H 3ZIAD 1EOLA 1EJMA 4UEHH 3TPIZ 3PO1C 1SGYE 3ZVDA 1HUTH 2NU2E 3TGIE 3BTTE 1UK2A 2FESH 2WSSD 1C1NA 1HIAA 1Y5AT 2A5KA 4KELA 4I86A 2BD4A 1T4UH 3BEFB 1W7GH 5DO4H 1LHCH 2A5AA 3MO3A 1Z7KA 3OU0A 1AHTH 3S69A 4AFSA 2HLCA 3QTOH 1HAHH 2BD9A 1TOCB 4AX9H 5IK2D 3ATLA 4BXSA 1EB1H 3NUMA 1ETTH 1P12E 1UVPA 1HRTH 1P2JA 1AZ8A 1QNJA 2J9NA 2ULLA 1DVAH 1SLXB 1TNKA 1KLJH 3DSOA 1A3EH 1ZJKA 3SNBA 1GI6A 1NFXA 5C2ZA 4TWYA 1BOQA 2A2QH 4MPWA 4K5ZA 3BIVH 3RXFA 5C1UA 2G4TA 4KGAA 2CXVA 3OYPA 2K1QA 5CHBA 1YPEH 3E0PB 2ZFFH 4B76A 1C5YB 3UIRA 1ELFA 1P2KA 1UCYK 1GWAA 3LGVA 4TYDA 4FUJA 1YCPH 4DOQA 1XUJA 2VU8E 3ZV9A 2W6ID 4GLYA 4Q7XA 3SJIA 3ITIA 2QCYA 4K1TA 2ZPSA 4D8NA 3QGNB 4JZDH 5EODA 2OBQA 4B2AA 1H8DH 2FI4E 4A1XA 3QZRA 1CHOF 1P9UA 2KCAA 1SGNE 4FUDA 5JYIA 3IWMA 1L1NA 1FZZA 1O5DH 2ZGXH 4BAHB 2Z9GA 1IQLA 2F9UA 4DG4A 1QA7A 3AAUA 1RIWB 2WPHS 5JB8S 1GHVH 4LZ4B 1AB9B 3DHKH 1GDNA 4X2VA 1UK3A 2Y81A 1RFNA 2AH4X 3EA9A 1K28D 3SYJA 1FI8A 1YPMH 2VIQA 3VXEH 4NFEA 1ZJDA 2O8UA 2GKVE 1C9TA 1Q2WA 1XUHA 1Z6EA 1WV7H 5FAHA 1S6LA 2FMJA 1YLNA 2ZPQA 4CHAC 1K1IA 4AYYB 5GCHF 2J4IA 4JMYA 5DN6D 4ASHA 1OWDA 3O8BA 3HKIB 3A8DA 3M7QA 5HIYA 3GYLB 2O8TA 1V2MT 2OTVA 3LJJA 4MNVA 2H5DA 1O3NA 1F0SA 1GGDB 1JWTA 3M7TA 1F0TA 1BTPA 2GZ7A 3MOCA 3R3GB 3PLBA 2VGCB 4JK5A 1NS3A 2B9LA 2GT7A 1OWJA 2FPZA 1O3LA 1V2LT 2J98A 1GDUA 1RGQA 3D62A 3KQBA 2DE9A 3OTJE 5AFYH 1NTPA 3BG4C 4LK4A 2B5TB 2GCHG 4RT1A 1NU7B 3GDSA 1NESE 1V2RT 2HVXA 1BBRH 2K0QA 1RS0A 3Q3KA 5L2ZH 1LPZB 1YKTA 1TMTH 3TLOA 4U32A 1QRXA 2QGRA 3CENA 5JPMH 3DCLA 3GY4A 4FETA 2V3OH 3C1KA 2G8TA 4J2YB 3SU5A 3W1EA 4A7IB 2AERH 4Q7YA 1TRYA 1SKYE 3UFAA 3K9XB 3QLPH 1P2QA 2ZU4A 3FP8E 2XXLA 2W26A 1P05A 2A2XH 6ESTA 1K1OA 2C90B 2HOBA 2TIOA 1QL9A 4ISLA 1AKSB 1O2QA 4GPGA 2UUYA 3ZVBA 1C5LH 1JOUB 1Z6JH 5B6OA 2FI3E 1S82A 1TGTA 2ZPRA 5T6FA 1O2VA 1WXRA 5KECA 1AVGH 1C5SA 1PPEE 2KM0A 4XOJA 3MWIU 1O39A 1QIXB 3MU4A 3SU0A 1EXFA 1ESBA 3JZ1B 4MPUA 2O8MA 3SQEE 3MNSA 2RFKC 1QRWA 3LIWA 1V2ST 1ZTKA 3RXHA 5E0JA 2BHGA 1CA0C 1PPBH 2R3YA 1N6XA 3DSPA 1FV9A 2PKAB 4FVDA 4BTIB 3LPRA 2H9TH 3RXKA 4MNYA 2FIRH 1GCTC 1LKAA 2SGPE 1UTPA 4NIYA 1Y5BT 1BMAA 2QYIA 4FVBA 1C2EA 3L6PA 1DPOA 2OC1A 4XSKU 1B0EA 3RXBA 2ZDAH 3ZZAA 1QQUA 3BF6H 5F6MA 3A88A 2G51A 2VH6A 3GDUA 1EQ9A 4B73A 2RDLA 1P9SA 1O2SA 1Y3UA 5JBBS 1CSOE 1TGCA 2ZFQH 1YYY1 1MZAA 1LPGB 3RXAA 4QT8C 2BLOA 5C20A 1OKXA 1KIGH 3DUXH 3M3VA 1SGRE 2Z6BD 1UTQA 2ZNKH 1UHBB 2YMSD 1YM0A 1P02A 3K6ZA 1O2TA 4F4OC 3RXIA 1TGSZ 3UREA 3VB3A 3VPKA 1GMHF 1CT2E 1XXFA 3U9AH 5FL7D 2VWNA 1YC0A 3PO1B 1KXFA 4WMFA 3V3MA 3RXPA 3A7ZA 1LQDB 1RTKA 5JBTA 2FOGA 1IHSH 2K8IA 3PWCA 4DVAU 2HVYB 1FDPA 1QHRB 2WPIS 3VB4A 2A0QB 4D9RA 1GL0E 1K21H 2ZI2H 1OYTH 4NFFA 5G4BA 4BTTB 3AVZA 7GCHF 1SB1H 2GV7A 1CGIE 2ZP0H 1PPHE 1P04A 3NWUA 3F0OA 2F83A 5JB9S 3DT0H 2ANWA 1C1TA 3U1JB 4BAOB 1E1RD 3MHWU 3RMOH 2XC4A 3FN8A 1O2GH 1X7AC 2BDIA 1GHBF 5AFZH 1UTNA 3SU1A 5EOKA 2F3CE 1KXEA 3KL6A 4NGAH 5EW2H 1KXCA 1NFUA 2EA3A 4HTCH 2KAIB 3IG6B 1TRNA 3GOVB 3CS0A 1O3DA 3AW0A 1P2OA 1BTZA 4IMZA 1CE5A 1QFKH 3TH2H 1QGFA 3ZZ7A 1AUJA 1OXGA 3BEIB 4I33A 1J8AA 3KQEA 4I8HA 3F9HA 1IQKA 3SN8A 2IPQX 2R9PA 2ZF0H 1DWEH 3MTYA 2UUFB 1EP5A 4X6OA 4AFZA 3QN7A 2Y5FA 3PRDA 3MYWA 2G52A 5JBAS 2H1UA 4O3UA 4TPYA 5HKKD 5J4QA 3SNDA 4B74A 2AGEX 4H6SB 1E36B 1SMFE 4IBLH 1TNJA 2BD5A 2HGTH 4OGYA 4UFGH 4ZH8A 4YLUA 5ETXA 5DJ7A 2G55A 1Y3YA 1HXEH 2QE7D 2V3HH 3OSYA 3P8NA 1D6RA 1EPTC 1VITH 1V2OT 2C8WB 1BDAA 2RCEA 3B9FH 3L33A 4GCHF 1XVOA 1P09A 3UR9A 4AB8A 1SLUB 3GS9A 2ZA5A 4E05H 2J2UA 1S81A 1C5WB 1LHDH 1OPHB 2PLXA 1O3CA 1S0QA 2HWLB 1MAYA 4K8YA 2ODPA 3SV2H 1O2OA 1E1QD 3E0NB 2TGTA 1SGIB 3TH4H 8GCHF 2ZWLH 1MTVA 1LDTT 1TPPA 3ZVEA 3LH1A 2EC9H 1E38B 1V2UT 4M7GA 3TNTA 1IQEA 1W0KD 2PTCE 5IDKA 4CRCA 3SQHE 3VB5A 4AOQA 2WYJA 4XBCA 2AMQA 1YCPK 1IQGA 4IGDA
chains in the Genus database with same CATH topology
3LH3A 4X1RU 2GMTC 1UMAH 5C5OA 1GJBB 1ETSH 2GX4A 2NU4E 2BXUH 1FONA 3BG4B 1YCPM 1ZTLA 3W94A 1N8OC 3LGTA 2BD3A 1WBGB 4DURA 4KTCA 1TE0A 3TK5A 4MNXA 2BOHB 2JETC 3RU4T 1HYLA 1C5RA 2P93A 4HFPB 1THSH 2ZU5A 4D7GA 1TA6A 1XMNB 2FYRA 2ZHWH 3EDXB 1PQ7A 3A83A 3SJKA 1MQ5A 1V3XA 1P2NA 3A8BA 3VFEA 2QY0B 1JRSA 3ESTA 3RXOA 4LOYH 3P8GA 3GY8A 1L1JA 4HGCA 3BSQA 2P95A 1W8BH 1GBFA 2AIQA 3RDZA 1ZMJA 2I6SA 1ARBA 4ISIH 1ZTJA 2YNBA 1OWIA 1J16A 1SGFG 1ZHMA 2ZHDA 3LONA 2D1JA 1XX9A 2WPJS 1NM6A 1FY1A 3M37A 1GI0A 1ZMLA 2BDHA 4WMEA 2WUCA 3SZNA 4YOGA 2ALVA 1VCWA 1NRSH 4X8SH 1H9LB 2I6QA 1QBVH 4SGBE 1B5GH 1C5TA 1E34B 1FY8E 1O3AA 3QGJA 4FUCA 1OOKB 1V2NT 4CRGA 5F8TA 2WPMS 3FP7E 4K8BA 4ZKNU 3NKKA 1Z8GA 3T28A 5DGJA 3ZZ5A 2FOAA 1C1PA 1EB2A 5T3HA 1P0SH 4NG9H 3TGJE 3HGNA 4FU9A 5L30H 1XUFA 2VVCA 1AD8H 3MO6A 2SFAA 4ISNA 1AE8H 1GCTB 1TAWA 1SGDE 2XYAA 3S0NA 1XVMA 1G2MA 1SOZA 1A2CH 1XUKA 4AG1A 4UFEH 2Y6TA 2Q6DA 2BOKA 1A7SA 1RD3B 1VCPA 1PQ5A 1IAUA 4O3TA 5CE1A 2OCVB 1GG6C 4U01A 1G3CA 2IPHA 1D4PB 1SGEE 1K1LA 1WOFA 1S85A 3MH5A 3FFGA 3UWIA 4Y11E 1GHXH 3P17H 1VITF 3KN2A 2PKSB 1G3DA 1ELDE 2ZGBH 1EASA 1EZSC 2JH0D 2GV6A 1GI2A 3H7TA 1KDQA 1TGBA 1GBIA 1SVPA 5E0GA 1S6HA 1IQNA 1SLWB 4FXGH 1HIAB 3ZZCA 4D76A 4BXWA 2XC0A 1JRTA 1W14U 1BITA 1A4WH 1C2IA 1V2KT 2GGVB 3SUDA 1HAZB 1V2VT 3ZZ3A 4ABJA 2O8LA 2B0FA 1CHGA 5JBCS 1SQOA 2QAAA 1GBAA 3OX7U 2C8ZB 4Q80A 3SJ8A 1C1WH 3HK3B 2Q1JA 3A87A 3BG8A 1IQFA 1TX6A 3UY9A 3AW1A 1HXFH 4RKOB 3PV4A 2WV5A 4AZ2B 1O34A 4IC6A 3ELAH 3FVFB 1WTGH 3UQOA 1TOMH 2VB0A 3ODFA 5C67A 1SPJA 4MLFB 2OD3B 1ZHPA 1AGJA 1NFWA 1ZOMA 5T6GA 5J4SA 4GSOA 1KXAA 1ZHRA 1O2KA 1N6YA 2CF9H 4RSPA 3M7UA 4X6PA 3L3TA 2F9PA 2QXIA 2ZU1A 1FPCH 1HDTH 3STIA 3B23B 2CF8H 3GCOA 2FWWA 5I46H 3M3SA 3TGKE 1Y3WA 1W10U 2OQUA 1NT1A 1BHXB 2OBOA 4SGAE 1C2MA 1LHFH 2ZHQH 2BDYA 1O2NA 1EX3A 2JKHA 3QK1A 3A7WA 4CH2B 4XFQA 4KTSA 3HGPA 4ABBA 4E06H 5DKMA 1ANCA 1GHAG 1P57B 5CMXH 5BRRE 2HNTF 3SORA 3AAVA 1O3FA 5A8ZA 1NRRH 4CR5A 4ABDA 3N7OA 2FX4A 1SFIA 1GJ8B 1L2EA 4MPVA 4DW2U 2Z94A 2EI8A 1ZSKA 2Q6FA 3TJVA 2GDDA 1HJAB 1YPJH 3HKJB 1OS8A 1EKBB 2SGDE 1J9CH 3K2UA 2CHAC 5SGAE 1NFYA 3A7TA 4WF8A 1S83A 2RA3A 3UNSA 3RXUA 5HXFA 3ATWA 3PM3A 1KLIH 3TIUA 3ZZBA 1TX7A 1C2LA 5FX6A 1S5SA 1TBZH 1RJXB 2BZ6H 7KMEH 4U2WA 1NU9A 2AEIH 3A85A 3NCLA 2ZDKA 2AFQB 1C5VA 4JZ1A 3UOUA 4ABAA 1ID5H 1TQ0B 3GY2A 3ATKA 1KY9A 1O33A 2F9BH 4O9VA 1TBQH 1QURH 1DFPA 1BZXE 1EPTA 1P8VC 4X1NU 2FX6A 1NROH 1FAXA 1N8OB 2AMDA 1QTFA 1MCVA 4Y0ZE 3K6YA 1TLDA 2GCHF 2JETB 3V12A 1PPCE 1UTMA 2PGBB 1KYNA 1PYTD 1DUAA 3F9GA 1HBTH 5FCRA 3E3TA 4A1VA 2BQWB 1O36A 2FEQH 2WV4A 5EXMA 2G00A 1CT0E 1L1GA 6GCHG 1IOEA 1G36A 1O5FH 1TABE 2ZKSA 4K69A 1EOJA 3EGKH 1O3PB 2WPLS 1YPKH 4CRBA 1HFDA 1MU6B 1BUIA 3LKWA 5BPEA 2O8WA 1FY5A 1G30B 2GZ8A 1P10A 2J38A 3HPTB 3SU3A 1DDJA 3CS7A 2ZFTA 4MVNA 1YP9A 3MH4A 1C5XB 1G37A 2BTCE 3BTDE 2IOTA 3C27B 4E7RG 1AWFH 1W11U 1AFQC 1P2IA 3UNQA 4ZKOU 3FP6E 1HGTH 1EUFA 1GMDG 2FDAA 1WCZA 2GD4B 2SGQE 1AIXH 3LC5A 1HAPH 1RTFB 1TRMA 2AYWA 4GHTA 3RU4E 2ZDNA 4WH6A 5DP6A 2HPPH 1LVMA 4Z0KA 4BNRA 2A4QA 2Y82A 3KCGH 3ZYDA 4ISOA 3A8CA 2FM2A 1F7ZA 4CBOA 3ZV8A 4B1TA 2WUBA 2JH6D 2G5NA 2Y5GA 2ZDLA 1WQSA 6LPRA 1UK4A 5EQRA 1FN8A 1GI1A 1GHWH 4UFDH 3S7HB 1W0YH 1V2PT 1YBWA 1MTUA 3SJOA 1GBBA 3PB1E 4UE7H 1BTHH 2F9NA 1G32B 1VGCC 5A0BA 1DANH 3ZVCA 3RXQA 4MG3A 1CO7E 1MU8B 1EATA 1W2KH 3E91A 2TGPZ 4WXIA 4I8JA 1BMLA 1DOJA 4ABEA 1QY6A 4ZKSU 1FY4A 5EXNA 3U8RH 1CBWC 2GCTB 1Z8JB 4Q2KA 3VGCC 3MU1A 2BQ6B 4TY7A 1PJPA 1OWHA 1QL8A 2VJ1A 4E7NA 2J94A 1T8OA 1SGTA 1D3TB 2EI6A 3LOXA 5EQQA 1C1QA 4O03A 7LPRA 3S9BA 4VGCB 2W7UA 2P8OC 1SQTA 2VIWA 2GP9B 4ZUHA 4XBDA 2BZAA 5C3NA 2FLBH 1C1UH 1MTNB 2QV1A 5JDUB 1ORFA 1HCGA 2F9OA 1AKSA 4A1TA 4AFUA 2AS9A 1F0RA 2QC2A 2SGEE 1FAKH 1HNEE 1ABJH 2P3TB 4NSVA 1P3CA 1BBRE 2A4RA 3UNRA 1MBMA 4XBBA 1C2JA 1BCUH 1GPZA 4I31A 2C8XB 1HJ9A 2G4UA 1PPFE 2PTNA 2GT8A 5GWZA 1F0UA 1ZMNA 2CV3A 3UOPA 4A92A 1TPOA 1GJ9B 3SU2A 4DIHH 4OS1A 4ABHA 2FOMB 1GBCA 3R0FA 3GY5A 1TMBH 1C5ZB 1LTOA 2TRMA 4OS6A 1OWKA 4CREA 2PKAA 3SI4H 3KF2A 3OY5U 1M9UA 4LXBH 3RXJA 2BY8X 2QN5T 5A0CA 5TJXA 1C1OA 1W3CA 4PROA 1K1JA 3T26A 3BIUH 4NA7A 1ESAA 1BA8B 2TGDA 3TITA 1RXPA 1ANEA 1O5BB 1FY3A 1P3EA 1A0LA 2YNAA 2ANYA 4FUEA 4JYUH 1O2YA 1DXPA 1L0ZA 1AFEH 1V2QT 1MQ6A 3K65B 3A7YA 1YPHC 1YPLH 1UTKA 1A0JA 2HRVA 3PTBA 5GXPA 4JCNA 1GMHG 1MD8A 1GBEA 2OC8A 4X1SU 2BDCA 1O5CB 1KXBA 5A8YA 2BVSH 3A89A 3RXLA 3SHCH 6CHAC 4INKA 1Q3XA 1O2JA 1GMCF 1AMHA 1SHYA 1UHBA 4IC5A 2PV9B 3Q76A 1FN6A 3BEUA 1GHZA 1P2MA 2C3SA 1V2WT 1DUEA 1JBUH 1G9IE 3BTGE 1P03A 1PQAA 2CHAB 4OS2A 1DY8A 1Z8RA 1GDQA 1XXDA 2DE8A 3SV9A 1AO5A 1GJCB 4ZROA 4TWWA 1ELTA 3P6ZB 2V0BA 4NIVA 1XUIA 3GY6A 3GCTG 1K2I1 1AVXA 2FP7B 1MH0A 1A5HA 3BTQE 5DK1A 3DFLA 3SGQE 1UVSH 3ZVFA 4Y8ZA 2Y80A 2FOHA 3TK6A 3U8OH 3V13A 1AU8A 2XBVA 1TONA 2VH0A 2VIPA 1JMOH 3KQCA 1TNIA 1KXDA 4NSYA 2R2WU 4X1QU 4Y79A 5EU8A 2Z7FE 1AZZA 3GYMA 2KAIA 2FOCA 3SGAE 2F91A 4CHAB 2ZO3H 1K22H 4OS7A 4CRDA 3A8AA 3STJA 1BMNH 1BMMH 2XBXA 3QDZB 4Y8YA 4I8GA 4H6TA 3G01A 2B8OH 1BTYA 2ZG0H 1C2KA 1ZLRA 3F9FA 3RMLH 1UCYE 3MU0A 4CRFA 2C8YB 2ZECA 3MI4A 1Y3XA 1ZZZA 1TMUH 3D49H 3SJ9A 4CRAA 1BRAA 5EGMA 1OP8A 1SBWA 2A7JA 3T62A 1TNGA 1TPAE 1IQHA 1MKWH 1RIWC 2Z9KA 1ZRKA 5K0HA 1AB9C 3H7OA 1O3BA 5HYOA 1QJ7B 3ZZ4A 1EAIA 1DWDH 3GY7A 4AFQA 1J14A 1P01A 2W3KA 1K1MA 1NO9H 3TK9A 1GBJA 2ZDMA 1O5AB 1O2UA 1UTOA 4GHQA 1ELEE 1C5OH 4X8VH 2ZCLP 3FAOA 1UO6A 1SGCA 2XRCA 4Y7AA 3M61U 1XUGA 3U8TH 3O8DA 4K2YA 2STBE 2ZTZA 4BAKB 1UJ1A 4UONA 1DXWA 3IITA 2XTTB 2ZEBA 1KLTA 3LGUA 5E2PA 4WWYA 1KTTB 2WYGA 1QQ4A 1V6DA 4X2WA 1GGDC 2BX4A 2BDAA 1H9IE 2PHBA 3RXGA 4KP0A 1HAVA 3SI3H 1H9HE 4Y6DA 1SR5C 3EA8A 2UWPA 1MAXA 2Z3CA 3MFJA 1C5MD 5EPNA 4FUGA 1BT7A 2FYQA 4XDEA 4IS5A 5HMAA 2BLVA 3HK6B 2WINI 2HNTC 2ODYB 1LVOA 1UTJA 2ZQ2A 1EAXA 1TA2A 1Q31A 1D3QB 2FTLE 5FPSA 4DY7B 2R3UA 1G2LA 2FS9A 3RMNH 4BTUB 4FUBA 4WXVA 3O8CA 1ANDA 1O3GA 1CA0B 2ASUB 4OGXA 2ZHEH 1EP6A 1GI7B 1GHYH 2OP9A 3MMGA 1TALA 1O3KA 1WAYB 3GCHC 1CBWB 1TPSA 1OX1A 3RXMA 1ELCA 1NN6A 2Z3EA 4MNWA 3LGIA 2ZFPH 3RXDA 2ODQA 1SL3A 1P06A 2ZFSA 1BHXF 1SOTA 3GICB 2Z9LA 2CGAA 2A7CA 2P3UB 2GTBA 1MD7A 1LKBA 4AGKA 5EPYA 4U30A 4NCYA 5F8ZA 1ZR0A 2HPQH 2NU1E 5K7RA 4BOHA 1Z71A 4KTUA 2UUJB 5I25A 2ALPA 1MUEB 3VEQB 3RM0H 3M35A 1QB9A 3QUMP 2BXTH 1LVYA 4MQAA 2SGAA 3EAJA 1O5EH 1QBNA 5DP8A 3ENSB 2BLWA 2VIDA 3V7TA 2PR3A 1EJAA 1EZUC 3M5LA 2BY7X 2D8WA 1INCA 4IN2A 4DIIH 3TJUA 1AWHB 4ZHAA 3FZZA 5FHTA 3A7XA 4ESTE 1EAWA 1P11E 1TYNA 3SNCA 1Z8IB 3WY8A 4WH8A 2D2DA 1NZQH 3BTFE 4YT7H 9ESTA 2ZC9H 5DP3A 4X1PU 1ESTA 4DCDA 2R2MB 3QZQA 3MH6A 1O3OA 1TGNA 2PW8H 1GBTA 1O3EA 2PWXA 1O0DH 4MPXA 1A5GH 4IMQA 3A81A 3PLKA 2Y7XA 3QWCH 5FPTA 4D7FA 1GBHA 3ATIA 2R0LA 2RA0A 1C2FA 1GJ7B 2STAE 1GI3A 2QF0A 1GJ5H 3QTVH 4CBNA 1GHAF 1ZSJA 3EA7A 3MU5A 2A4OA 2XBYA 3D23A 3W95A 3F6UH 2UWOA 8KME2 6CHAB 4CH8B 1O2XA 4NIXA 4OS4A 3LJOA 1MKXH 1HLTH 1AUTC 3KQDA 3ODDA 4UD9H 2P59A 2FOEA 4Y71A 2UUKB 1FIZA 1SC8U 1SQAA 1GJ4H 5HGGA 2NU0E 4JYTA 2CJIA 1GVKB 1BRBE 2D26C 2GDEH 2SNVA 5DG6A 2Z9IA 1C5NH 1HB0B 3RM2H 1G3BA 1ABIH 1FLEE 1TBRH 1H1BA 1O3JA 1A0HB 2OUAA 1FIWA 4F49A 1DWCH 5E2OA 1KSNA 3DA9B 3EYDA 8LPRA 2NWNA 1BB0B 2ZGJA 1EPTB 3T5FH 1QB1A 1ANBA 1F5RA 2JH5D 2UWLA 3I77A 1S84A 2QXGA 3NPSA 3P70B 4Y76A 2DUCA 4Y7BA 3LT3A 4WJG2 3UQVA 1CGJE 1HAXB 2FZZA 3TH3H 1QJ6B 3F68H 3OY6U 3LU9B 1DE7H 2OC7A 4BAMB 1C9PA 1FNIA 4GVUA 2BY5X 1VJAU 5DP5A 1WQVH 5GIBA 1QJ1B 1IQMA 1E37B 2Z9JA 2ZFRH 4AN7A 4K1EA 2FOFA 1K9OE 4TPIZ 1C4V2 1JIMA 4YTAA 2FS8A 2FXRA 1A5IA 2J34A 3LGYA 4GAWA 2EI7A 3V0XA 4JYVH 1LHGH 2ZDVH 1T7CA 5L2YH 1LHEH 2GMTB 1PPZA 1T32A 3Q3XA 1L4DA 5AHGH 6GCHF 1ARCA 1O2ZA 1OYQA 3HATH 4IW4E 1CU1A 5ESTE 2BLQA 4INHA 5GJ4B 1ELBA 4UFFH 4AYVB 1C1SA 1CHOG 1LCYA 4IN1A 5PTPA 3S9AA 4ZMAH 1L4ZA 2SGFE 1W13U 1QRZA 1ZYOA 2YOLA 1SI5H 1N1LA 2VWOA 2TGAA 1ELVA 1H8IH 4K1SA 3UR6A 1O2HA 5LPFA 4R0IA 3SUFA 3SV8A 4RKJB 4B71A 1QL7A 2BD7A 1DLEA 4YM9A 1Y59T 2VIOA 1W12U 1TIOA 1GMDF 4D9QA 4I7YH 5HM2A 3RUOA 2ANMH 2BVR