1RIWB

Thrombin in complex with natural product inhibitor oscillarin
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
147
structure length
147
Chain Sequence
IVEGSDAEIGMSPWQVMLFRKSPQELLCGASLISDRWVLTAAHCLLYPPWDKNFTENDLLVRIGKHSRTRYERNIEKISMLEKIYIHPRYNWRENLDRDIALMKLKKPVAFSDYIHPVCLPDRETAASLLQAGYKGRVTGWGNLKET
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords thrombin light chain
publication title The N-acyloxyiminium ion aza-Prins route to octahydroindoles: total synthesis and structural confirmation of the antithrombotic marine natural product oscillarin
pubmed doi rcsb
molecule tags Hydrolase/hydrolase inhibitor
total genus 28
structure length 147
sequence length 147
ec nomenclature ec 3.4.21.5: Thrombin.
pdb deposition date 2003-11-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1riwB00
1OKXA 1HAHH 5C1YA 2VH6A 2GT8A 1K21H 1HAVB 1YM0A 3A7TA 3MNXA 3BG4B 4DT7B 1C1UH 1G9IE 5ESTE 2GX4A 5BRRE 2GKVE 2XWAA 1G3CA 2H1UA 2HPQH 2V3HH 3RXAA 3UWJH 1QTFA 3GCHC 1MD8A 1KTTB 1SHYA 3M7QA 4BAKB 1UHBA 1UVSH 1B7XB 2PGBB 2FTMA 2ZO3H 3TPIZ 1S81A 3FZZA 1LQDB 4H6TA 1SGTA 2QC2A 2ZCLP 5ABWA 3MHWU 2LPRA 1TMTH 2QXJA 2ZZUH 3ATIA 3RU4T 2AEIH 4FVBA 1SC8U 4B73A 4HTCH 1PQ7A 2OC0A 2THFB 1NFYA 3RXEA 5J4QA 2BTCE 4NIWA 1VITH 1O2UA 2AS9A 2BOHB 1EP5A 1DS2E 1S0QA 1B0FA 3QGNB 1W8BH 1FPCH 1AKSB 4O9VA 2TBSA 3ZVDA 4ZXYH 3DUXH 4NFFA 3BEUA 1F5LA 3M7TA 3V3MA 2BDYA 1SLXB 1GJ4H 1O3MA 2W3KA 4ABEA 4MNYA 1YP9A 2Y5HA 2ZEBA 1TX6A 2XW9A 3C27B 3GCNA 3KL6A 4CH8B 2BLVA 1ANDA 4D76A 4K5ZA 4FU9A 3E6PH 1QQUA 1VCPA 1O3LA 1GBAA 1ELBA 5GIBA 2FESH 1A5GH 3PMHB 3SNAA 3R0FA 1O2LA 1TRYA 1Z1JA 3A7WA 1BCUH 1AQ7A 3UWIA 1D4PB 4Z6AH 1YPJH 3E91A 2BDBA 1OS8A 3K9XB 2C8WB 2HNTE 2AMPA 4X1RU 2BOKA 1S6HA 3EQ0H 3TITA 1L1GA 1CGIE 1EAWA 3RUOA 1NC6A 1V2JT 4NWKA 1AMHA 1OWKA 1GBEA 3RC5A 4AX9H 4ZKOU 1KLTA 1Y3YA 5G4BA 1ANEA 3VFEA 3BIVH 1C5ZB 1BTZA 3GY7A 3LKWA 4FU7A 2G4TA 2B0FA 2HLCA 1DSTA 1QBOA 3Q77A 2VVVA 1K1JA 1MKXH 1KXCA 3TNTA 2A31A 3VGCB 1CA8B 8LPRA 2FI4E 2BLWA 1DE7H 3L6PA 1QB6A 2BD3A 1RS0A 3LGYA 2PHBA 4MPUA 1NZQH 3TJUA 2SFAA 3QTOH 5AFYH 2D8WA 3A84A 4E06H 2FO9A 1A5HA 4D7GA 1SMFE 3P70B 3PTBA 3UQVA 1O3OA 1O2HA 3SJ9A 1O2SA 2VGCC 2ZHWH 1MQ5A 4MDSA 2F3CE 2AH4X 5E0JA 1A3EH 1FONA 3EE0B 2QXGA 2BD2A 4AG2A 4I8HA 2OTVA 4F4OC 1GPZA 1TYNA 4Y0YE 2G51A 1H9LB 3P6ZB 3ENSB 1RTLA 3RXRA 1HAVA 2TGDA 4K8YA 1PPGE 4I8LA 2XC4A 5DO4H 1MKXK 1O39A 1YPMH 1ZTLA 2CF8H 1IQIA 1DLEA 4INKA 4U32A 2ZU1A 2HOBA 2BD7A 4AYVB 3U9AH 2C8XB 2EI7A 5CMXH 3SZNA 3A88A 1RIWC 4X8SH 2RCEA 3HKIB 5EU8A 3B8JA 3GCOA 4ABBA 2ANMH 1GDUA 1NRQH 5LGOA 1SQTA 3JZ2B 1FY5A 1O3CA 1SGDE 1TOMH 1KLIH 1CT0E 3HPTB 3H7OA 4Y71A 4X8VH 1BITA 2BDGA 2FOFA 3C1KA 1AVWA 4NFEA 2GGVB 3OX7U 1SR5C 1EJNA 1C1RA 2BM2A 1WOFA 2JETC 3T29A 2BZ6H 4XE4A 2UUYA 1AKSA 1JXPA 1LPZB 4ABDA 1ARCA 2EI6A 2A32A 3CENA 1C2JA 3SU0A 1AUTC 3U98H 2ZHQH 1MQ6A 1ZR0A 2ZU5A 4MPXA 2SGQE 1MBMA 4YOGA 1XUKA 1ZTJA 1GVZA 1GDNA 2UWPA 1XXFA 1AB9B 2GCTC 1TMUH 1O2TA 4KGAA 3NPSA 2XBWA 2FOHA 1AGJA 1O0DH 4X1PU 1ZSKA 2VVUA 1YYY1 5C20A 3RMLH 2FP7B 2VIDA 1IOEA 1BRCE 2WUBA 1C5SA 1H9IE 1GI2A 1FAKH 2ZDLA 1O2VA 1FI8A 1ELGA 3Q3YA 1C2GA 1BDAA 3NUMA 3KCGH 3ZZ7A 2CF9H 3IITA 5T6DA 4WXVA 4XBDA 1MTSA 1O2ZA 1KSNA 5LH8A 5HM9A 5EQSA 1KDQB 1HB0B 1BTPA 4HZHA 1SVPA 3CS7A 1H1BA 1OOKB 4UFDH 2WPHS 2ZPQA 6CHAC 1HLTH 2ZDNA 1N6XA 1OYTH 1BRAA 3KGPA 4F49A 2B9LA 2O8MA 1O3BA 3SU6A 1T4VH 2A0QB 1ZSLA 3E16B 3K6YA 1C5TA 4X8UH 2CMYA 2ZFFH 3GCTG 4ZHLU 3QK1A 1BTYA 2O8LA 3RXBA 3MYWA 2FYRA 3UR6A 1O3NA 2H9TH 4Y10E 3SI4H 3P8GA 1O37A 4ZROA 1GI5A 2O8WA 4AFSA 4IC6A 1TIOA 1A2CH 1QURH 2Z3EA 3E1XB 2GD4B 1SPJA 2VWNA 2ZDAH 1SFQB 1C5RA 1SHHB 2R2WU 4TY6A 2PKSB 1DUAA 1O2XA 1F0UA 1XXDA 1K1LA 1MU8B 1TQ0B 2W26A 3UUZA 4X6OA 3TIUA 3RLYH 1CVWH 1LKAA 4M7GA 2UWLA 4RKOB 1MU6B 3PROA 2FI3E 3PO1B 4WVPE 1HXEH 1W14U 1TPAE 3O8BA 1SGQE 1V3XA 1QB9A 1A0JA 3SV7A 1T31A 1HJAC 1A4WH 2XBXA 6GCHG 2HNTC 3A80A 4ISIH 5ETXA 3K6ZA 2STBE 1O5CB 1NFUA 4YTAA 4GHQA 1UMAH 1WQVH 1H8IH 2HALA 2R0KA 1GI9B 2PTCE 4Q2KA 1OWIA 4B2CA 1ZMNA 3LGTA 5IYTA 1GBHA 1Z6JH 1GCTB 1V2NT 1THRH 4FUDA 5EGMA 4Y7AA 1GGDC 1TWXB 2QN5T 1BRUP 4INLA 5C2ZA 3ATKA 1O38A 4PROA 4CH2B 4X8TH 2PV9B 2Y6TA 7LPRA 4BTUB 1V6DA 1IQMA 2BD8A 2GMTC 3H7TA 4JCNA 1KXFA 1G3BA 2FXRA 1O31A 4LZ1H 3BTWE 2VNTA 2P3TB 2BX3A 3KQEA 1JIRA 2ZGCA 4UD9H 3LONA 1C4V2 4GAWA 2PUQH 1W7XH 3LH3A 5AFZH 2WPIS 4A1VA 2GZ7A 3Q3XA 3KN2A 5A09A 1DUEA 3M5LA 1ZOMA 7ESTE 2P95A 1EP6A 2AIQA 5J4SA 3T5FH 1P9SA 1UVPA 1V2RT 5GDSH 1PPFE 1C1PA 4DJZB 1V2WT 1GMDG 1O32A 3ZZAA 4Y8XA 1C2KA 1QNJA 2RG3A 2TPIZ 2WYJA 3RP2A 3HK6B 1KDQA 1O3EA 4WMFA 1N8OB 1L1NA 1D6RA 2NU1E 5DP6A 1CT4E 2I6SA 1QR3E 1O2IA 3GCTF 1LPGB 1HAOH 4CR9A 1T8OA 4DCDA 4FUHA 1AFQB 3VB6A 2ULLA 4JZ1A 3PMBB 1B0EA 2C93B 2FYQA 2NU4E 1BT7A 1P12E 1NFWA 2XTTB 4GPGA 3TGJE 4JYVH 4AGJA 3BTGE 4DW2U 4TYDA 5EXNA 1FLEE 3OYPA 3SV9A 3F9GA 2VINA 1AUJA 4GSOA 4NZLA 3MU8A 3NXPA 1C5OH 4FUIA 5JBBS 1EZQA 1AE8H 1EZUC 4FXGH 4D8NA 2J2UA 5A8YA 1P2JA 3MOCA 1KXDA 4TWYA 3ZYEA 1O5AB 1V2KT 1GG6B 3GYMA 3MO9A 4AOQA 3GY8A 1SGFG 4BAQB 2G4UA 2AGGX 1JRTA 1O3AA 4HGCA 3EA8A 5EXLA 1FAXA 1ZHPA 1YCPH 3D62A 4JZFH 1AN1E 3MU0A 2OXSA 1LVOA 2BQ7B 1W7GH 1XUHA 4JYTA 3LU9B 1HJ8A 1UTOA 1SGNE 1L2EA 1RJXB 1V2QT 6GCHF 1C2LA 3VEQB 1Z8JB 5JBCS 2ZKSA 1G37A 1QJ7B 2VIPA 1O3PB 3SQHE 1O3JA 1CBWB 1GJAB 1W12U 5FPTA 1GHWH 4ISNA 4FUJA 1AE5A 1ZJDA 1YLCA 1T8MA 3FP8E 2XXLA 4ISHH 1P3CA 3GY6A 3SNEA 2GCHG 1QRZA 2G5NA 3L3TA 1SQOA 2SGEE 3A83A 3A8BA 1ARBA 1WTGH 2BVXH 3P95A 2W3IA 1Z8IB 1PPEE 4SGAE 1C1MA 1HJ9A 4U30A 4I8JA 3AVZA 3RMNH 2JH5D 1HPGA 1NTPA 4O3TA 3UOUA 1QA0A 3UPEA 3M3VA 2ZGXH 1ZGIA 1YCPK 1VGCB 3ZVCA 5FCRA 5F8ZA 1A5IA 1DWBH 3S9CA 3KQBA 3ZZCA 1SLWB 3M3SA 3DD2H 2Q1JA 5HYOA 1P05A 2Y81A 1MH0A 5JBTA 2EC9H 2BY5X 2NU3E 2GT7A 1SG8B 4AYYB 5IDKA 2UWOA 4Q7YA 1MAXA 2TIOA 1P02A 4D7FA 3QGJA 3V12A 1P11E 1S82A 3BV9B 1IQJA 3P92A 1BMLA 3HATH 3F1SB 4X1QU 3RC6A 4GCHG 3LT3A 1YPKH 1GMDF 2DE8A 5AVDA 1KY9A 4BAHB 2YNBA 3E8LA 1OP0A 1YPEH 4SGBE 4BXWA 4KTUA 4ESTE 2CV3A 1DVAH 2SNVA 4Y8YA 3SU3A 5I46H 4E05H 2WPJS 1TNHA 4WWYA 2IOTA 2XCFA 3A85A 4MPWA 2BDIA 5HMAA 2VWLA 4D9RA 1IQHA 2ZCHP 1KXAA 8KME2 1JRSA 2W5EA 1C5QA 2D26C 2P16A 1HRTH 4LOYH 3MU5A 1ZJKA 2AERH 9ESTA 2Z9KA 1EQ9A 4OS1A 1OXGA 2QGRA 4Q80A 3U69H 1UTNA 1FIZA 3VXFH 3RC4A 1ELFA 2NU0E 1YC0A 2HNTF 4UDWH 1EAIA 1TRMA 1RGQA 5C1XA 4H6SB 2BY6X 3MNCA 1G2LA 1NRSH 2GDDA 3BTQE 2ZF0H 5LPRA 2JH6D 2ANWA 4OS4A 5DP9A 5LPFA 1J9CH 4I8GA 5F6MA 2FOEA 3SU5A 3ZZ8A 2HPPH 1FV9A 5EOKA 2BY7X 3BTEE 3UIRA 3RLWH 2WV5A 1Y5BT 3BSQA 1E0FD 3E0NB 2H2ZA 1C1TA 4YOJA 1FMGA 3MH4A 5DGJA 3S9AA 2YNAA 4HFPB 3NK8A 2A4OA 3MH7A 2BD5A 3ATLA 5C3NA 4Y0ZE 4IMQA 4CRFA 4OGXA 1AD8H 2ZC9H 4AB8A 1C4Y2 2G55A 3QUMP 1BMAA 1SGCA 4MLFB 1KXEA 4RKJB 1O30A 1FN6A 1P10A 3SUEA 1TGSZ 3Q3KA 2GCHF 1DICA 3B23B 1GHBG 4IN2A 2ZHFH 5JDUB 1K1MA 1Z7KA 5L2ZH 5JPMH 4XBCA 2O8TA 5FX5A 4DY7B 1V2TT 2A5KA 2AMDA 3T28A 1GJ6A 2FOCA 2WINI 2JH0D 3KEEA 1K2I1 4I7YH 4Y11E 1AFEH 1EATA 1CSOE 1WBGB 3UFAA 2OC1A 1DWDH 1O2KA 2YOLA 5A0CA 3P17H 2A4QA 4NZQA 3A7ZA 3RXMA 1O2QA 1BHXF 4FUCA 1QA7A 1E37B 1LHEH 6CHAB 3EGKH 1C2HA 2ZQ1A 5JB8S 4GLYA 5DG6A 3A86A 1GJ7B 2VWOA 1OSSA 3VB7A 5FHTA 4NIXA 4DURA 4NA9H 2ZFTA 2W7SA 3M61U 1GHXH 3HGPA 1Y3WA 4ASHA 2QA9E 4GCHF 2ZI2H 1TALA 2ILNA 1G36A 1QIXB 3SOSA 1C5VA 2VH0A 3T27A 4JMYA 1Z8GA 3AAUA 3UOPA 5EW2H 1GBDA 1A1RA 4KTSA 5CHAB 3BEFB 1UVTH 1P57B 2F9UA 1QBNA 2QY0B 1SL3A 1PFXC 2ZWLH 1QBVH 1NROH 3F9EA 1S83A 1TB6H 9LPRA 2F83A 1ZGVA 4A6LA 5E8EH 1OP8A 4UONA 2AMQA 3T25A 4YM9A 3W95A 1ELVA 3STJA 1GDQA 2AFQB 5F03A 1FXYA 1P2OA 3BG4C 1HAPH 2HWLB 1HAXB 4K69A 2ZU3A 4XBBA 1C2FA 5DKMA 1GJCB 3MU1A 3RXFA 3GYLB 2A1DB 2BLQA 4DIHH 1O2JA 1VITG 4IS5A 2OBQA 5E2OA 1TBRH 1GVKB 2PSYA 3SV6A 3FP7E 3BN9A 1H4WA 3F9HA 1RXPA 1GBJA 1WTHD 1S5SA 1NU7B 4X2VA 3GICB 1AWHB 1CA0C 1JWTA 1XUGA 4Y8ZA 3RM2H 3SUDA 1JMOH 1Y3XA 3UTUH 4BNRA 1OP2A 1IQEA 1EOLA 4AFZA 2FX4A 3BTTE 3JZ1B 1O2YA 3GY3A 3CS0A 2TGTA 1MTNB 1PPCE 4BANB 2H9HA 2AGEX 2XWBI 4KTCA 4RN6A 1IQFA 1O36A 2J38A 3F68H 2NWNA 4LK4A 2QIQA 3D49H 2A4GA 3BG8A 1VJ9U 2ZIQH 1GHBF 1OWHA 4NGAH 4X6MA 1BUIA 3A81A 5DP8A 1X7AC 4Q7XA 1QY6A 4ZKSU 1A7SA 3E0PB 1K28D 4Y79A 1ORFA 2FX6A 1UJ1A 1ID5H 4XDEA 1GJ9B 1ESBA 3IG6B 4XSKU 3FZDA 1YF4A 2PSXA 2HVXA 3ZZ6A 2J4IA 1F0TA 1LO6A 1EB2A 1HUTH 1OYQA 1P2IA 3FFGA 3Q00A 1AVXA 3GDUA 5L2YH 4VGCB 4NG9H 1V2LT 2R2MB 5GCHG 3TJVA 1HAGE 3PWCA 2FPZA 4ZUHA 2CHAB 2FEQH 3FP6E 1BRBE 1MTUA 1GVLA 3L33A 2PWXA 2QXIA 1GI8B 1T32A 3HKJB 4X6NA 1NS3A 3P8OA 1TNKA 3EYDA 3OY5U 4K1SA 4CHAB 2QYIA 2R3YA 1GCDA 2Z3DA 3BTFE 2TRMA 2V3OH 3RU4E 1TX8A 2BMGB 3LIWA 1K1OA 1QHRB 1GJ8B 2QV1A 1GBBA 1MUEB 3SBKA 1EPTB 4NSVA 3LGVA 3TH4H 3B9FH 4NSYA 2ZDVH 1EAXA 4ZXXH 4CRGA 1ZRBA 1C5MD 1O3IA 1INCA 3ZZ3A 1GJ5H 4UFFH 3VGCC 2P8OB 3V7TA 4ZMAH 2WV4A 2M5TA 1W2KH 2ZGHA 1ZMLA 3KQCA 1S85A 1BTUA 1JOUB 1TFXA 4B76A 1AHTH 1O3HA 3RDZA 1CHGA 4TWWA 3RXPA 3IWMA 2FMJA 2ZG0H 1MTWA 5FPYA 4WMEA 1V2VT 1P8VC 3A8CA 1LVBA 1GJBB 5PTPA 2F9OA 1ABIH 2PLXA 3ZVAA 3S7HB 2ZU2A 4H4FA 3SW2B 1XKAC 4ABJA 3M36A 3RXKA 3ZZBA 1F2SE 1LDTT 1V2PT 1V2ST 3AW0A 4IMZA 4MNWA 1BTHH 1TNLA 1VITF 2XCNA 2FS9A 4NIVA 4GUXA 4AZ2B 4BTTB 1TNGA 2W7UA 3LC3A 3SJ8A 4FUGA 1K22H 3SNDA 2GVFA 1N6YA 2PUXB 2ZFRH 4X2WA 1BJVA 2ZFPH 2TGPZ 3SN8A 5JB9S 4KKDA 1GMHG 1L0ZA 5FXLA 1F7ZA 1SOTA 3Q76A 6LPRA 1LVMA 2ZFSA 2GZ9A 1D3DB 4X0WU 3MU4A 4NWLA 4XOJA 3ESTA 1WU1A 2ODYB 3QN7A 1DXWA 3LGIA 1XVMA 4IW4E 4LZ4B 1W0ZU 2ZGJA 2ZP0H 1NRNH 2DE9A 2Z7FE 2FOGA 1T4UH 2NU2E 1H8DH 1P9UA 3NZIA 1P2NA 1HFDA 2OQUA 3SGQE 3ZVEA 3VPKA 1LHFH 4UE7H 1GL0E 3QWCH 1G2MA 1SBWA 3MNSA 3SI3H 1TONA 2BVRH 2EI8A 1GJDB 1PPZA 2GTBA 4A1TA 1C5YB 2OC8A 1P2MA 1UCYE 4X1NU 1ZPCA 4K3JA 3GDSA 3BEIB 2Y5GA 1SLVB 1EUFA 4X1SU 3ATWA 1D6WA 5DP3A 3SHAH 3V13A 2ANYA 3SUFA 5DP7A 4YOIA 2A5AA 4BAOB 1IQNA 3PLKA 1O2OA 4JZDH 4ZHAA 3TK6A 1CU1A 2ASUB 1TRNA 5GCHF 5TCCA 1AB9C 3I29A 3DT0H 3O8DA 3A89A 2SGPE 5C5OA 3RXOA 1O5EH 3URDA 1EASA 2BXTH 2H5CA 4IBLH 1P04A 1ELEE 2SGDE 1TLDA 1ESTA 4ZKNU 1PJPA 4BAMB 1SB1H 1FDPA 1H9HE 1Q3XA 3RXIA 1DANH 2PKAB 2XBVA 3QDZB 2QXHA 1PQ5A 3KF2A 1DWEH 5HXFA 4CBNA 5K0HA 4R8TB 2ZTZA 3O8RA 3GCHB 1GBLA 3S7KB 4YT7H 3KQDA 2H6MA 1EPTA 4X2XA 2C3SA 1OWEA 1VCWA 3FVFB 4QT8C 1J17T 5C5NA 2C8YB 3VB4A 2FIRH 5DJ7A 3LJJA 4FU8A 2FLRH 3DFJA 2XRCA 2Z9IA 1MCVA 3SGBE 3SHCH 3TU7H 1HAYB 1LMWB 3ODFA 1SI5H 1Y59T 5A8XA 4OS6A 3UNRA 1LHCH 3BTME 2FTLE 1J14A 1A0HB 4O3UA 3KIDU 1FY3A 2J34A 3FANA 3R3GB 3KNXA 5EG4A 2STAE 2PKSC 3TK9A 1UO6A 1CT2E 3GOVB 1TOCB 1UK2A 1W3CA 1VZQH 1QGFA 4OGYA 1C2IA 5DP5A 1O3GA 1Q2WA 4YESB 1QJ1B 1GMHF 1DT2A 1C5XB 1W13U 1JIMA 5C67A 3ZZ9A 1DM4B 3PO1C 2J95A 3WY8A 3RXHA 1M9UA 1F92A 1NM6A 1F5RA 3LPRA 5BPEA 1LKBA 2XBYA 1WSSH 2H5DA 3EAJA 2B8OH 2IJOB 1C1VH 1HXFH 1DY8A 1Y5UT 1SQAA 1LHDH 1C1QA 4NA8A 2BDHA 5A8ZA 1TGTA 2CN0H 1YPGH 3MH5A 3TJOA 2TGAA 5DPAA 5EW1H 2Z6BD 1ANBA 1C2MA 1LQEA 2Z9LA 1VCQA 3ATMA 3GDVA 3OSYA 1EOJA 4BXSA 4H42U 1YPHE 1O2RA 3D65E 1ZHRA 1IQGA 1GCTC 4IGDA 3SJOA 2ZHDA 1CQQA 2BB4A 1EX3A 1E36B 5HGGA 1UTJA 5T6GA 1JBUH 1TX7A 1UTKA 2EEKA 2GV7A 2VIOA 4A1XA 1TABE 4I31A 2VGCB 2KAIB 4BTIB 3PV4A 5F8TA 3A7XA 3HGNA 1HYLA 1ZYOA 2Q6GA 3K65B 3MMGA 5K7RA 1RTFB 1D3TB 4AB9A 2HGTH 4CRAA 4BOHA 1MZAA 1ESAA 5SGAE 3SORA 4GHTA 3RXVA 3TH3H 3ZYDA 4B2BA 1DPOA 1GBTA 1BQYA 1SGRE 4J1YA 4Q7ZA 3ZV8A 1BA8B 1OWDA 4JZIA 4YLQH 1A0LA 5L30H 1TNJA 1GHAG 2WPMS 2PTNA 1O35A 5FCKA 1AU8A 3TH2H 4IC5A 1O33A 4B75A 4B2AA 3K2UA 1P3EA 1GI0A 5H4IB 2FOBA 2PKAA 3RMOH 1YKTA 4A7IB 1O2MA 1D9IA 1NN6A 3D23A 1RIWB 3QTVH 1HV7A 1HNEE 1V2OT 1UK4A 4O97A 3T62A 4O03A 1QJ6B 5DK1A 1L4DA 3TLOA 2P93A 1N8OC 1UCYH 4DOQA 1BBRE 1NFXA 3M5OA 4ABGA 1HAZB 1MTVA 3FAOA 5GPIB 1YLDA 3RXDA 1K9OE 1AO5A 2FS8A 1CGHA 1MBQA 2VIWA 1NRPH 2ESTE 4WF8A 2OD3B 1AFQC 3V0XA 1CA0B 2F91A 2JETB 4OS2A 2Z9GA 2F9NA 2WPLS 1QL9A 1F5KU 4MNXA 1AWFH 1O3FA 1BB0B 4LXBH 4MG3A 3BTDE 1OX1A 1ZHMA 1HIAB 1GI3A 4ZH8A 1ZLRA 1SFIA 3UQOA 5HM2A 1C5WB 1ELAA 1Z8RA 2V0BA 2SGFE 2ZFQH 5E2PA 1Y3UA 4TPIZ 2UUFB 3SQEE 2Q6FA 1GG6C 8GCHG 5EPNA 3BTKE 3PYHA 3SGAE 4X6PA 2GCTB 1Z6EA 5T3HA 3OTJE 1PYTC 2Y80A 3LH1A 3BIUH 1DY9A 1IQKA 1MZDA 1CE5A 1SSXA 1UCYK 1YPLH 3S9BA 5FBEA 2C8ZB 1AY6H 3MH6A 2OQ5A 3OU0A 1EXFA 4CR5A 1XX9A 4ZHMU 2ZTXA 5E0GA 4Y76A 1P2KA 2C4FH 4K1EA 3SU2A 4CBOA 4YO9A 1EZXC 3GY5A 1J8AA 4E7RG 3UNSA 5AF9H 1CBWC 1V2UT 3F9FA 2FOAA 1KIGH 4THNH 2R3UA 2AIPA 3F6UH 3RXQA 1UTPA 3EA7A 2CJIA 2ZPRA 3QZQA 2JKHA 4GVUA 3LGWA 4FUFA 2BLOA 1GHZA 2OINA 2ODQA 5CE1A 3W94A 2VVCA 4ISLA 3AW1A 4K8BA 3I78A 2ANKH 1J16A 1SLUB 2AGIX 2QCYA 1TGCA 2O8UA 1VGCC 1A61H 1P01A 1W11U 1SGIB 1C2DA 2ODPA 3A87A 1G32B 2KAIA 1FNIA 1ZRKA 5LPEA 4MPVA 2Q6DA 1LTOA 4HI3A 3M3TA 4CRDA 1C1NA 5FPSA 3P8NA 4KP0A 5JYIA 1GHAF 2BQWB 4AN7A 5L6NH 2G8TA 4CREA 1GI1A 3PTNA 1O2GH 1C1OA 1E35B 3PM3A 2VJ1A 3NCLA 3U8RH 5A0AE 3KHVA 1V2MT 1DSUA 3SU4A 2BD9A 1NY22 2BHGA 1XUIA 2LNCA 2QF0A 4A92A 4X2YA 1HJAB 1C5NH 3TVJB 1SOZA 2C90B 2GV6A 2P3UB 2Z94A 1O5BB 4ABFA 5GJ4B 4AORA 2VU8E 1TBZH 1C9TA 1QCPA 5JBAS 3RU4D 1O3DA 1QRXA 1BJUA 1TA2A 1BTWA 3ODDA 1KLJH 1NRRH 4OS7A 1AVGH 4RSPA 3I77A 1KTSB 1UTLM 4K1TA 1S6FA 5ESBA 2ZCKP 2IPHA 1FJSA 2FM2A 4K2YA 1WQSA 1GGDB 1YPHC 3TJNA 2OP9A 2P59A 3SJKA 3RM0H 1VJAU 2B5TB 3MFJA 2FWWA 3PMAB 4ISOA 1ANCA 1G3EA 8GCHF 2FOMB 4WMDA 3PMJA 4IN1A 5EQRA 1HIAA 1ZPBA 2F9BH 2GMTB 4A5TS 3ZVBA 1U6QA 5DP4A 1GBMA 2OUAA 1TAWA 1YCPM 4Y7BA 3ZV9A 5FAHA 1THPB 1GBIA 1WCZA 5I25A 4TY7A 4AG1A 1IQLA 5C1UA 1ZTKA 4AFUA 1QL7A 1TQ7B 2PR3A 1A46H 1C5LH 4WY3A 3OY6U 1GBCA 1GBFA 4WH6A 3ZZDA 2XC5A 1BBRH 2D1JA 1DDJA 4UFEH 3TGIE 1IHTH 1WYKA 2XYAA 1UVOA 2ZGBH 2FODA 3A7VA 3ELAH 3RXTA 2ZPSA 1GL1A 1O34A 1BHXB 1P06A 1AI8H 2FZZA 3CP7A 2V6NA 1ACBE 2GP9B 3ZVGA 4U2WA 1N1LA 2ALPA 2P3FH 4MNVA 2FI5E 1FY4A 2GDEH 2GZ8A 2Z9JA 3LDXH 5F8XA 2UUKB 2ZECA 1NO9H 5EPYA 1PPBH 3ITIA 2BX4A 1DXPA 2A4RA 1HDTH 1CO7E 4TPYA 3SJIA 3H5CB 2BYAX 2BD4A 1EAUA 2VWMA 3PLBA 3E3TA 2H9EH 1YGCH 5AHGH 4ZKRU 1GMCG 1EKBB 2VB0A 1BBRK 1GHYH 1O2WA 2ALVA 3EDXB 1TPSA 1GI7B 1LCYA 1O5FH 2PFEA 4JK6A 2BDAA 3LGUA 1B5GH 4WXIA 1UTQA 1P2QA 1ZPZA 3SU1A 1K1PA 1PYTD 3MNBA 2BXUH 1EJMA 2BQ6B 1BMMH 3LJOA 3G01A 2ZQ2A 3A8DA 2ZU4A 3A7YA 4JYUH 4MTBA 4DIIH 3MO3A 4ABHA 2ZHEH 5CHAC 3E90B 4AFQA 1O5GH 3VB3A 1CGJE 2A2QH 2OBOA 3QO6A 3AASA 3NWUA 4ABIA 2ZDKA 1FZZA 2J94A 3S69A 2Z3CA 1LPKB 2J92A 2O9QA 4FUBA 1S0RA 1NPMA 3RXLA 2VIQA 3RXCA 1QFKH 2P94A 1E38B 3ZZ4A 1GHVH 2RA3A 1UK3A 1Y5AT 1Y8TA 5GWZA 3U1JB 3DFLA 2HRVA 1GWAA 1UTMA 3VXEH 1QL8A 1FUJA 1NU9A 8ESTE 1W0YH 1HBTH 1G30B 1SGFA 4JZEH 3RMMH 1J15A 2WYGA 1S84A 1KYNA 2QF3A 1Z1IA 2UUJB 2Y5FA 1RRKA 3MTYA 2Y7ZA 2R9PA 1O5DH 2XC0A 4NIYA 4OS5A 1FY8E 2A45B 1D3PB 1FPHH 1OWJA 1SGEE 3SV8A 1MMJN 1MKWH 2EA3A 4CRBA 1MD7A 1LVYA 1DITH 1Q31A 3A8AA 4D9QA 1FIWA 3URCA 2V35A 4AGKA 1THSH 1XVOA 1MTNC 1Y3VA 1L4ZA 4YZUA 3SUGA 2ZA5A 4FVDA 2F9VA 2FLBH 3RXSA 4MVNA 4NA7A 1BZXE 3NKKA 1GI4A 1CHOG 4WH8A 1G3DA 1AIXH 2R0LA 2BVSH 3STIA 4B74A 3RXUA 4XFQA 2K1QA 4B1TA 1PPHE 1WV7H 1ELCA 1QB1A 1A3BH 3MO6A 1PQ8A 1O3KA 1BTXA 2FDAA 3UNQA 4B71A 1C4U2 1K1NA 1L1JA 1TPPA 3M35A 1F0RA 1MKWK 3RXGA 4I8KA 1C5PA 2G00A 1BMNH 1WUNH 5GXPA 1RD3B 1FN8A 5EODA 2A7CA 4VGCC 2DUCA 3SO3A 7GCHG 1HGTH 5B6OA 1WAYB 1TPOA 2CHAC 3T26A 2SGAA 2AYWA 1TGNA 3ZVFA 2A7HA 2OLGA 2A5IA 1GMCF 2BZAA 1GBKA 3BTHE 1O2NA 1TBQH 4CHAC 1XUJA 1UHBB 2QAAA 3UR9A 5TCAA 4YLUA 3PLPA 2RDLA 1YBWA 1DFPA 1T8LA 2ZTYA 3UREA 3TGKE 1XM1A 1DOJA 3M7UA 1EPTC 3SV2H 2BDCA 2F9PA 2G81E 5A2MH 4JK5A 2SNWA 1TE0A 1FY1A 2VIVA 4I32A 1C1WH 3GY2A 4CRCA 4E7NA 2CXVA 2P8OC 2Y82A 2A7JA 1BIOA 3U8OH 1XMNB 5EQQA 1XUFA 3PB1E 1ZZZA 1RFNA 3U1IB 1ABJH 1VR1H 1P09A 2IN2A 1W10U 1ETTH 1ZSJA 1C2EA 3TK5A 3SNBA 1OPHB 5T6FA 6ESTA 1TNIA 1D3QB 4YT6H 1EB1H 1O2PA 4J2YB 1MCTA 4FUEA 1XKBC 1DLKB 1EJAA 1TMBH 2WUCA 2PGQB 4DGJA 1QQ4A 2RA0A 2BY9X 1AZ8A 2G52A 3MI4A 1Z71A 3QX5H 1QRWA 1TGBA 2ZDMA 2A2XH 1ZMJA 1KXBA 2I6QA 4I33A 1IHSH 3AAVA 3HK3B 4Z0KA 2J9NA 3A82A 3GISB 1T8NA 3LC5A 3LOXA 1HAIH 1UVUH 1P0SH 2BY8X 2PW8H 3DA9B 4Y6DA 4ABAA 1C9PA 1F0SA 1ELTA 1LHGH 3TNSA 4R0IA 5TJXA 4U01A 3QLPH 4MQAA 4UEHH 5E0HA 3P8FA 3SNCA 3EA9A 2G5VA 1E34B 3U8TH 3UY9A 1DWCH 3QZRA 1NT1A 3ZZ5A 4ZAEA 1GI6A 1P03A 1HCGA 1IAUA 1DX5M 3VB5A 4DG4A 4KELA 2ZNKH 3M5MA 1K1IA 3BF6H 1CHOF 1MAYA 3N7OA 5EXMA 1ETSH 2B7DH 3MWIU 4WJG2 1ELDE 1T7CA 1SGPE 1C5UA 1NESE 3DHKH 4K60A 4INHA 1PQAA 3PWBA 3T2NA 3GY4A 3S0NA 5FX6A 1ETRH 1RTKA 1TA6A 2XNIA 7KMEH 2Y7XA 1EZSC 5A0BA 1SGYE 2D2DA 5FBIA 2CGAA 1C1SA 2OC7A 1AZZA 2WPKS 3RXJA 3O8CA 4NCYA 1BOQA 7GCHF 3M37A 4UFGH 2OCVB 3M5NA 4DVAU 1FQ3A
chains in the Genus database with same CATH superfamily
1OKXA 1HAHH 5C1YA 2VH6A 2GT8A 1K21H 1HAVB 1YM0A 3A7TA 3MNXA 3BG4B 4DT7B 1C1UH 1G9IE 5ESTE 3DSOA 2GX4A 5BRRE 2GKVE 2XWAA 1G3CA 2H1UA 2HPQH 2V3HH 3RXAA 3UWJH 1QTFA 2PP6A 3GCHC 1MD8A 1KTTB 1SHYA 3M7QA 4BAKB 1UHBA 1UVSH 1B7XB 2PGBB 2FTMA 2ZO3H 3TPIZ 1S81A 3FZZA 1LQDB 2LP6A 4H6TA 1SGTA 2QC2A 2ZCLP 5ABWA 3MHWU 2LPRA 1TMTH 2QXJA 2ZZUH 3ATIA 3RU4T 2AEIH 4FVBA 1SC8U 4B73A 3F0PA 4HTCH 1PQ7A 2OC0A 2THFB 1NFYA 3RXEA 5J4QA 2BTCE 4NIWA 1VITH 1O2UA 2AS9A 2BOHB 1EP5A 1DS2E 2K0QA 1S0QA 1B0FA 3QGNB 1W8BH 1FPCH 1AKSB 4O9VA 2TBSA 3ZVDA 4ZXYH 3DUXH 4NFFA 3BEUA 1F5LA 3M7TA 3V3MA 2BDYA 1SLXB 1GJ4H 1O3MA 2W3KA 4ABEA 4MNYA 1YP9A 2Y5HA 2KFWA 2ZEBA 1TX6A 2XW9A 3C27B 3GCNA 3KL6A 4CH8B 2BLVA 1ANDA 4D76A 4K5ZA 4FU9A 3E6PH 1QQUA 2YMSB 1VCPA 1O3LA 1GBAA 1ELBA 5GIBA 2FESH 1A5GH 1WXRA 3PMHB 3SNAA 3R0FA 1O2LA 1TRYA 1Z1JA 3A7WA 1BCUH 1AQ7A 3UWIA 1D4PB 2JJ1D 4Z6AH 1YPJH 3E91A 2BDBA 1OS8A 3K9XB 2C8WB 2HNTE 2AMPA 4X1RU 2BOKA 1S6HA 3EQ0H 3TITA 1L1GA 1CGIE 1EAWA 3RUOA 1NC6A 1V2JT 4NWKA 1AMHA 1OWKA 1GBEA 3RC5A 4AX9H 4ZKOU 1KLTA 1Y3YA 5G4BA 1ANEA 3VFEA 3BIVH 3WWBA 1C5ZB 1BTZA 3GY7A 3LKWA 4FU7A 2G4TA 2B0FA 2HLCA 1DSTA 1QBOA 3Q77A 2VVVA 3AK5A 1K1JA 1MKXH 1KXCA 4XRNA 3TNTA 2A31A 5C0TA 3VGCB 1CA8B 8LPRA 2FI4E 2BLWA 1DE7H 3L6PA 1QB6A 2BD3A 1RS0A 3LGYA 2PHBA 4MPUA 1NZQH 3TJUA 2SFAA 3QTOH 5AFYH 2D8WA 3A84A 4E06H 2FO9A 1A5HA 4D7GA 1SMFE 3P70B 3PTBA 5C0UA 3UQVA 1O3OA 1O2HA 3SJ9A 1O2SA 2VGCC 2ZHWH 1MQ5A 4MDSA 2F3CE 2AH4X 2J97A 5E0JA 3N99A 1A3EH 1FONA 3EE0B 2QXGA 2BD2A 4AG2A 4I8HA 2OTVA 4F4OC 1GPZA 1TYNA 2GJGA 4Y0YE 5EJZA 2G51A 1H9LB 3P6ZB 3ENSB 1RTLA 3RXRA 1HAVA 2TGDA 4K8YA 1PPGE 4I8LA 2XC4A 5DO4H 1MKXK 1O39A 1YPMH 1ZTLA 2CF8H 1IQIA 1DLEA 4INKA 4U32A 2ZU1A 2HOBA 2BD7A 4AYVB 3U9AH 2C8XB 2EI7A 5CMXH 3SZNA 3A88A 1RIWC 4X8SH 2RCEA 3HKIB 5EU8A 3B8JA 3GCOA 4ABBA 2ANMH 1GDUA 1NRQH 5LGOA 1SQTA 3JZ2B 1FY5A 1O3CA 1SGDE 1TOMH 1KLIH 1CT0E 3HPTB 3H7OA 4Y71A 4X8VH 1BITA 2BDGA 2FOFA 3C1KA 1AVWA 3OEED 4NFEA 2GGVB 3OX7U 1SR5C 1EJNA 1C1RA 2BM2A 1WOFA 2JETC 3T29A 2BZ6H 4XE4A 2UUYA 1AKSA 1JXPA 1LPZB 4ABDA 2KCOA 1ARCA 2EI6A 2A32A 3CENA 1C2JA 5F53A 3SU0A 1AUTC 3U98H 2ZHQH 1MQ6A 1ZR0A 2ZU5A 4MPXA 2SGQE 1MBMA 4YOGA 1XUKA 1ZTJA 1GVZA 1GDNA 2UWPA 1XXFA 1AB9B 2GCTC 1TMUH 1O2TA 4KGAA 3NPSA 2XBWA 5HIZA 2FOHA 1AGJA 1O0DH 2WPDD 1ZSKA 2VVUA 4X1PU 1YYY1 5C20A 3RMLH 2FP7B 2VIDA 1IOEA 1BRCE 2WUBA 1C5SA 1H9IE 1GI2A 1FAKH 2ZDLA 1O2VA 1FI8A 1ELGA 3Q3YA 1C2GA 2CK3D 1BDAA 3NUMA 3KCGH 3ZZ7A 2CF9H 3IITA 5T6DA 2QF5A 4WXVA 4XBDA 1MTSA 1O2ZA 1KSNA 5LH8A 5DN6D 5HM9A 5EQSA 1KDQB 1HB0B 1BTPA 4HZHA 2KZ4A 1SVPA 3CS7A 1H1BA 1OOKB 4UFDH 2WPHS 2ZPQA 6CHAC 1HLTH 2ZDNA 1N6XA 1OYTH 1BRAA 3KGPA 4F49A 2B9LA 2O8MA 1O3BA 3SU6A 1T4VH 2A0QB 1ZSLA 3E16B 3K6YA 1C5TA 4X8UH 2CMYA 2ZFFH 3GCTG 4ZHLU 3QK1A 1BTYA 2O8LA 3RXBA 3MYWA 2FYRA 3UR6A 1O3NA 2H9TH 4Y10E 2LELA 3SI4H 3P8GA 1O37A 4ZROA 1GI5A 2O8WA 4AFSA 4IC6A 1TIOA 1A2CH 1QURH 2Z3EA 3E1XB 2GD4B 1SPJA 2VWNA 2ZDAH 1SFQB 1C5RA 1SHHB 2R2WU 4TY6A 2PKSB 1DUAA 1O2XA 1F0UA 1XXDA 1K1LA 1MU8B 1TQ0B 2W26A 3UUZA 4X6OA 3TIUA 3RLYH 1CVWH 1LKAA 4M7GA 2UWLA 4RKOB 1MU6B 3PROA 2FI3E 3PO1B 4WVPE 1HXEH 1W14U 1TPAE 3O8BA 1SGQE 3PV5A 1V3XA 1QB9A 1A0JA 3SV7A 4FETA 1T31A 5DSFA 1HJAC 1A4WH 2XBXA 6GCHG 2HNTC 3A80A 4ISIH 5ETXA 3K6ZA 5EIYA 2STBE 1O5CB 1NFUA 4YTAA 4GHQA 1UMAH 1WQVH 1H8IH 2HALA 2L74A 2R0KA 1GI9B 2PTCE 4Q2KA 1OWIA 5KGOA 4B2CA 1ZMNA 3LGTA 5IYTA 1MABB 1GBHA 1Z6JH 1GCTB 1V2NT 1THRH 4FUDA 5EGMA 4Y7AA 1GGDC 1TWXB 2QN5T 1BRUP 4INLA 5C2ZA 3ATKA 1O38A 4PROA 4CH2B 4X8TH 2PV9B 2Y6TA 7LPRA 4BTUB 1V6DA 1IQMA 2BD8A 2V3MA 2GMTC 2HVYB 3H7TA 4JCNA 1KXFA 1G3BA 2FXRA 1O31A 4LZ1H 3BTWE 2VNTA 2P3TB 2BX3A 3KQEA 1JIRA 2ZGCA 4UD9H 3LONA 1C4V2 4GAWA 2PUQH 1W7XH 3LH3A 5AFZH 2WPIS 4A1VA 2GZ7A 3Q3XA 3KN2A 5A09A 1DUEA 3M5LA 1UW7A 1ZOMA 7ESTE 2P95A 1EP6A 2AIQA 5J4SA 3T5FH 1P9SA 1UVPA 1V2RT 5GDSH 1PPFE 1C1PA 4DJZB 1V2WT 1GMDG 1O32A 3ZZAA 4Y8XA 1C2KA 1QNJA 2RG3A 2TPIZ 2WYJA 3RP2A 3HK6B 1KDQA 1O3EA 4WMFA 1N8OB 1L1NA 3ZIAD 1D6RA 2NU1E 5DP6A 1CT4E 2I6SA 1QR3E 1O2IA 3GCTF 5C17A 1LPGB 1HAOH 4CR9A 1T8OA 5CDFE 4DCDA 4FUHA 1AFQB 3VB6A 2ULLA 4JZ1A 3PMBB 1B0EA 2C93B 2FYQA 2NU4E 3MQKC 1BT7A 1P12E 1NFWA 2XTTB 4GPGA 3TGJE 4JYVH 4AGJA 3BTGE 4DW2U 4TYDA 5EXNA 5EJLA 1FLEE 3OYPA 3SV9A 3F9GA 2VINA 3OE7D 1AUJA 4GSOA 4NZLA 3MU8A 3SYJA 3NXPA 1C5OH 4FUIA 5JBBS 1EZQA 1AE8H 1EZUC 4FXGH 4D8NA 2J2UA 5A8YA 1P2JA 3MOCA 1KXDA 4TWYA 2KCAA 1O5AB 1V2KT 1GG6B 3GYMA 3MO9A 3ZYEA 4AOQA 3GY8A 2KCPA 1SGFG 4BAQB 2G4UA 2AGGX 2KX4A 1JRTA 1O3AA 4HGCA 5B6LA 3EA8A 5EXLA 1FAXA 1ZHPA 1YCPH 3D62A 4JZFH 1AN1E 3MU0A 2OXSA 1LVOA 2BQ7B 1W7GH 1XUHA 4JYTA 3LU9B 1HJ8A 1UTOA 1SGNE 1L2EA 1RJXB 1V2QT 6GCHF 1C2LA 3VEQB 1Z8JB 2YMSD 5JBCS 2ZKSA 1G37A 1QJ7B 2VIPA 1O3PB 3SQHE 1O3JA 1CBWB 1GJAB 1W12U 5FPTA 1GHWH 4ISNA 4FUJA 1AE5A 3H09A 1ZJDA 1YLCA 1T8MA 3FP8E 2XXLA 4ISHH 1P3CA 3GY6A 3SNEA 2GCHG 1QRZA 2G5NA 3L3TA 1SQOA 2SGEE 3A83A 3A8BA 1ARBA 1WTGH 2BVXH 3P95A 2W3IA 1Z8IB 1PPEE 4SGAE 1C1MA 3OEHD 1HJ9A 4U30A 4I8JA 3AVZA 4YXWD 3RMNH 2JH5D 1HPGA 1NTPA 4O3TA 3UOUA 5C94A 1QA0A 3UPEA 3M3VA 4RT0A 2ZGXH 1ZGIA 1YCPK 1VGCB 3ZVCA 5FCRA 5F8ZA 1A5IA 1DWBH 2IPQX 3S9CA 3KQBA 3ZZCA 1SLWB 3M3SA 4I86A 3DD2H 2Q1JA 5HYOA 1P05A 2Y81A 1MH0A 5JBTA 2EC9H 2BY5X 2NU3E 2GT7A 1SG8B 4AYYB 5IDKA 2UWOA 4Q7YA 1MAXA 2TIOA 1P02A 4D7FA 3QGJA 3V12A 1P11E 1S82A 3BV9B 3OAAD 1IQJA 3P92A 4M9FA 1BMLA 3HATH 3F1SB 4X1QU 3RC6A 2JIZD 4GCHG 3LT3A 1YPKH 1GMDF 2DE8A 5AVDA 1KY9A 4BAHB 2YNBA 3E8LA 1OP0A 1YPEH 4SGBE 4BXWA 4KTUA 4ESTE 2CV3A 1DVAH 2SNVA 4Y8YA 3SU3A 5I46H 4E05H 2WPJS 1TNHA 4WWYA 2IOTA 2XCFA 3A85A 4MPWA 2BDIA 5HMAA 2VWLA 4D9RA 1IQHA 2ZCHP 1KXAA 8KME2 1JRSA 2W5EA 1C5QA 2D26C 2P16A 1HRTH 4LOYH 3MU5A 1ZJKA 2AERH 9ESTA 2Z9KA 1EQ9A 3PRDA 4OS1A 1OXGA 2QGRA 4P02A 4Q80A 3U69H 1UTNA 1FIZA 3VXFH 3RC4A 1ELFA 2NU0E 1YC0A 2HNTF 4UDWH 1EAIA 1TRMA 1RGQA 5C1XA 4H6SB 2BY6X 3MNCA 1G2LA 1NRSH 2GDDA 3BTQE 2ZF0H 5LPRA 2JH6D 2ANWA 4OS4A 5DP9A 5LPFA 1J9CH 4I8GA 5F6MA 2FOEA 3SU5A 2JDID 3ZZ8A 2HPPH 1FV9A 5EOKA 2BY7X 3BTEE 1VKYA 3UIRA 3RLWH 2WV5A 1Y5BT 3BSQA 1E0FD 3E0NB 2H2ZA 1C1TA 4YOJA 1FMGA 3MH4A 5DGJA 3S9AA 2YNAA 4HFPB 3NK8A 2A4OA 3MH7A 2BD5A 3ATLA 5C3NA 4Y0ZE 4IMQA 4CRFA 4OGXA 1AD8H 2ZC9H 4AB8A 1C4Y2 2G55A 3QUMP 1BMAA 1SGCA 4MLFB 1KXEA 4RKJB 1O30A 1FN6A 1P10A 3SUEA 1TGSZ 3Q3KA 2GCHF 5T1VA 1DICA 3B23B 1GHBG 4IN2A 2ZHFH 2M2AA 5JDUB 1K1MA 1Z7KA 5L2ZH 5JPMH 4XBCA 2O8TA 5FX5A 4DY7B 1V2TT 2A5KA 2AMDA 3T28A 1GJ6A 2FOCA 2WINI 2JH0D 3KQ5A 3KEEA 1K2I1 4I7YH 4Y11E 1AFEH 1EATA 1CSOE 1WBGB 3UFAA 1OHHD 2OC1A 1DWDH 1O2KA 2YOLA 5A0CA 3P17H 2A4QA 4NZQA 3A7ZA 3RXMA 1O2QA 1BHXF 4FUCA 1QA7A 1E37B 1LHEH 3NRLA 3WWFA 6CHAB 3EGKH 2QE7D 1C2HA 2ZQ1A 5JB8S 4ACAA 4GLYA 5DG6A 1E79D 3A86A 1GJ7B 1YWUA 2VWOA 1OSSA 3VB7A 5FHTA 4NIXA 4DURA 4NA9H 2ZFTA 2W7SA 3M61U 1COWD 1GHXH 3HGPA 1Y3WA 1YY3A 4B6EA 4ASHA 2QA9E 4GCHF 2ZI2H 1TALA 2ILNA 1G36A 1QIXB 3SOSA 1C5VA 2VH0A 3T27A 4JMYA 1Z8GA 3AAUA 3UOPA 5EW2H 1GBDA 1A1RA 4KTSA 5CHAB 3BEFB 1UVTH 1P57B 2F9UA 4OM9A 1QBNA 2QY0B 1SL3A 1PFXC 2ZWLH 1QBVH 5FL7D 1NROH 3F9EA 1S83A 1TB6H 9LPRA 2F83A 1ZGVA 4A6LA 5E8EH 1OP8A 4UONA 2AMQA 3T25A 4YM9A 3W95A 1ELVA 2WZQA 3STJA 1GDQA 2AFQB 5F03A 1FXYA 1P2OA 3BG4C 1HAPH 2HWLB 1HAXB 2JJ2D 4K69A 2ZU3A 4XBBA 1C2FA 5DKMA 1GJCB 3MU1A 3RXFA 3GYLB 2A1DB 2BLQA 4DIHH 1O2JA 1VITG 4IS5A 2OBQA 1YLNA 1TBRH 1GVKB 5E2OA 2IJD1 2PSYA 3SV6A 3FP7E 3BN9A 1H4WA 3F9HA 1RXPA 1GBJA 1WTHD 1S5SA 4ACBA 1NU7B 4X2VA 3GICB 1AWHB 1CA0C 1JWTA 1XUGA 4Y8ZA 3RM2H 3SUDA 1JMOH 1Y3XA 3UTUH 4BNRA 1OP2A 1IQEA 1EOLA 4AFZA 2FX4A 3BTTE 3JZ1B 1O2YA 3GY3A 4P00A 3CS0A 1SQRA 1MTNB 1PPCE 2TGTA 4BANB 2H9HA 2AGEX 2XWBI 4KTCA 4RN6A 1IQFA 1O36A 2J38A 3F68H 2NWNA 4LK4A 3N7DA 2QIQA 3D49H 2A4GA 3BG8A 1VJ9U 2ZIQH 1GHBF 1OWHA 4NGAH 4X6MA 1BUIA 3A81A 5DP8A 1X7AC 4Q7XA 1QY6A 4ZKSU 3DSGA 1A7SA 3E0PB 1K28D 4Y79A 1E1RD 1ORFA 2FX6A 1UJ1A 1ID5H 4XDEA 1GJ9B 4ASUD 1ESBA 3IG6B 4XSKU 3FZDA 1YF4A 2PSXA 2HVXA 3ZZ6A 2J4IA 2YMSC 1F0TA 1LO6A 1EB2A 1HUTH 1OYQA 1P2IA 3FFGA 3Q00A 1AVXA 3GDUA 5L2YH 4VGCB 4NG9H 1V2LT 2R2MB 5GCHG 3TJVA 1HAGE 3PWCA 2FPZA 4ZUHA 2CHAB 2FEQH 3FP6E 1BRBE 1MTUA 1GVLA 3L33A 2PWXA 2QXIA 4FOUC 1GI8B 1T32A 3HKJB 4X6NA 1NS3A 2XNDD 1TNKA 3P8OA 3EYDA 3OY5U 4K1SA 4CHAB 2QYIA 2R3YA 1GCDA 2Z3DA 3F2GA 3BTFE 2TRMA 2V3OH 3RU4E 1TX8A 2BMGB 3LIWA 1K1OA 1QHRB 1GJ8B 2QV1A 1GBBA 1MUEB 3SBKA 1EPTB 4NSVA 3LGVA 3TH4H 3B9FH 4NSYA 2ZDVH 1EAXA 4ZXXH 4CRGA 1ZRBA 1C5MD 1O3IA 1INCA 2RDEA 3ZZ3A 3WW7A 1GJ5H 4UFFH 3VGCC 2P8OB 3V7TA 4ZMAH 2WV4A 3FO8D 2M5TA 1W2KH 2ZGHA 1ZMLA 3KQCA 1S85A 1BTUA 1JOUB 1TFXA 4B76A 1AHTH 1O3HA 3RDZA 1CHGA 4TWWA 3RXPA 3IWMA 2FMJA 2ZG0H 1MTWA 5FPYA 4WMEA 1V2VT 1P8VC 3A8CA 1LVBA 1GJBB 5IK2D 5PTPA 2F9OA 1ABIH 2PLXA 3ZVAA 3S7HB 2ZU2A 2XOKD 4H4FA 3SW2B 1XKAC 4ABJA 3M36A 3RXKA 3ZZBA 1F2SE 1LDTT 1V2PT 1V2ST 3AW0A 4IMZA 4MNWA 1BTHH 1TNLA 1VITF 4F55A 2XCNA 2FS9A 4NIVA 4GUXA 4AZ2B 4BTTB 1TNGA 2W7UA 3LC3A 3SJ8A 4FUGA 1K22H 3SNDA 2GVFA 1N6YA 2PUXB 2ZFRH 4X2WA 1BJVA 2ZFPH 2TGPZ 3SN8A 5JB9S 4KKDA 1GMHG 1L0ZA 5FXLA 1F7ZA 1SOTA 3Q76A 6LPRA 1LVMA 2ZFSA 2GZ9A 1D3DB 3PRBA 4X0WU 3MU4A 4NWLA 4XOJA 5GNDA 3ESTA 1WU1A 2ODYB 3QN7A 1DXWA 3LGIA 1XVMA 4IW4E 4LZ4B 1W0ZU 2ZGJA 2ZP0H 1NRNH 2DE9A 2Z7FE 2FOGA 1T4UH 2NU2E 1H8DH 1P9UA 3CNRA 3NZIA 1P2NA 1HFDA 2OQUA 3SGQE 3ZVEA 3VPKA 1LHFH 4UE7H 1GL0E 3QWCH 1G2MA 1SBWA 3MNSA 3SI3H 1TONA 2BVRH 4B6FA 2EI8A 1GJDB 1PPZA 2GTBA 4A1TA 1C5YB 2OC8A 1P2MA 1UCYE 4X1NU 1ZPCA 4K3JA 3GDSA 3BEIB 2Y5GA 1SLVB 1EUFA 4X1SU 3ATWA 1D6WA 5DP3A 5KEDA 3SHAH 3V13A 2ANYA 3SUFA 5DP7A 4YOIA 2A5AA 4BAOB 1IQNA 3PLKA 1O2OA 4JZDH 4ZHAA 3TK6A 1CU1A 2ASUB 1TRNA 5GCHF 5TCCA 1AB9C 3I29A 3DT0H 3O8DA 3A89A 2SGPE 5C5OA 3RXOA 1O5EH 3URDA 1EASA 2BXTH 2H5CA 4IBLH 1P04A 1ELEE 2SGDE 1TLDA 1ESTA 4ZKNU 1PJPA 4BAMB 1SB1H 1FDPA 1H9HE 1Q3XA 3RXIA 1DANH 2PKAB 2XBVA 3QDZB 2QXHA 1PQ5A 3KF2A 1DWEH 5HXFA 4CBNA 5K0HA 4R8TB 2ZTZA 3O8RA 3GCHB 2F43B 1GBLA 3S7KB 4YT7H 3KQDA 2H6MA 1EPTA 4X2XA 2C3SA 1OWEA 1VCWA 3FVFB 4QT8C 1J17T 5C5NA 2C8YB 3VB4A 2FIRH 5DJ7A 3LJJA 4FU8A 2FLRH 3DFJA 2XRCA 2Z9IA 1MCVA 3SGBE 3SHCH 3TU7H 1HAYB 1LMWB 3ODFA 1SI5H 1Y59T 5A8XA 4OS6A 3UNRA 1LHCH 3BTME 2FTLE 1J14A 1A0HB 4Z1MD 4O3UA 3KIDU 1FY3A 2J34A 3FANA 3R3GB 3KNXA 5EG4A 2STAE 2WHXA 2PKSC 3TK9A 1UO6A 1CT2E 3GOVB 1TOCB 1UK2A 1W3CA 1VZQH 1QGFA 4OGYA 1C2IA 5DP5A 1O3GA 1Q2WA 4YESB 1QJ1B 1GMHF 1DT2A 1C5XB 1W13U 3DSPA 1JIMA 5C67A 3ZZ9A 1DM4B 3PO1C 2J95A 3WY8A 3RXHA 1M9UA 1F92A 1NM6A 1F5RA 3LPRA 3KYFA 2WSSD 5BPEA 1LKBA 2XBYA 1WSSH 2H5DA 3EAJA 2B8OH 2IJOB 1C1VH 1HXFH 1DY8A 2OK5A 1Y5UT 1SQAA 1LHDH 1C1QA 4NA8A 2BDHA 5A8ZA 1TGTA 2CN0H 1YPGH 3MH5A 3TJOA 2TGAA 5DPAA 5EW1H 2Z6BD 1ANBA 1C2MA 1LQEA 2Z9LA 1VCQA 3ATMA 3GDVA 3OSYA 1EOJA 4BXSA 1BMFD 4H42U 1YPHE 1O2RA 3F3BA 4DT4A 3D65E 1ZHRA 1IQGA 1GCTC 4IGDA 3SJOA 2ZHDA 1CQQA 2BB4A 1EX3A 1E36B 5HGGA 1UTJA 5T6GA 1JBUH 1TX7A 1UTKA 2EEKA 2GV7A 2VIOA 4A1XA 4F48B 1TABE 4I31A 2VGCB 2KAIB 4BTIB 3PV4A 5F8TA 3A7XA 3HGNA 1HYLA 1ZYOA 2Q6GA 3K65B 3MMGA 5K7RA 1RTFB 1D3TB 4AB9A 2HGTH 4CRAA 4BOHA 1MZAA 1ESAA 5SGAE 3SORA 4GHTA 3RXVA 5HKKD 3TH3H 3ZYDA 4B2BA 1DPOA 1GBTA 1BQYA 1SGRE 4J1YA 4Q7ZA 3ZV8A 1BA8B 3U28C 1OWDA 4JZIA 4YLQH 1A0LA 2J98B 5L30H 1TNJA 1GHAG 1S6LA 2WPMS 2PTNA 1O35A 5FCKA 1AU8A 3TH2H 4IC5A 1O33A 4B75A 4B2AA 3K2UA 1P3EA 1GI0A 2HLDD 5H4IB 2FOBA 2PKAA 3RMOH 1YKTA 4A7IB 3UAIC 1K0HA 1O2MA 1D9IA 1NN6A 3D23A 1RIWB 3QTVH 1HV7A 1HNEE 1V2OT 1UK4A 4O97A 3T62A 4O03A 3EE7A 1QJ6B 5DK1A 1L4DA 3TLOA 2P93A 1N8OC 1UCYH 4DOQA 1BBRE 1NFXA 3M5OA 4ABGA 1HAZB 1MTVA 3FAOA 5GPIB 1YLDA 3RXDA 1K9OE 1AO5A 2FS8A 1CGHA 1MBQA 2VIWA 1NRPH 2ESTE 4WF8A 2KM0A 2OD3B 1AFQC 3V0XA 1CA0B 2F91A 2JETB 4OS2A 2Z9GA 2F9NA 2WPLS 1QL9A 1F5KU 4MNXA 1AWFH 1O3FA 1BB0B 4LXBH 4MG3A 3BTDE 1OX1A 1ZHMA 1HIAB 1GI3A 4ZH8A 1ZLRA 1SFIA 3UQOA 5HM2A 1C5WB 1ELAA 1Z8RA 2V0BA 2SGFE 2ZFQH 5E2PA 1Y3UA 2J5UA 4TPIZ 2UUFB 3SQEE 1H8ED 2Q6FA 1GG6C 8GCHG 5EPNA 3BTKE 3PYHA 3SGAE 4X6PA 2GCTB 1Z6EA 5T3HA 3OTJE 1PYTC 2Y80A 3LH1A 3BIUH 1DY9A 1IQKA 1MZDA 1CE5A 1SSXA 1UCYK 1YPLH 3S9BA 5FBEA 2C8ZB 1AY6H 3MH6A 2OQ5A 3OU0A 1EXFA 4CR5A 1XX9A 4ZHMU 2ZTXA 5E0GA 4Y76A 1P2KA 2C4FH 4K1EA 3SU2A 4CBOA 4YO9A 1EZXC 3GY5A 1J8AA 4E7RG 3UNSA 5AF9H 1CBWC 1V2UT 3F9FA 2FOAA 1KIGH 4THNH 2R3UA 2AIPA 3F6UH 3RXQA 1UTPA 3EA7A 2CJIA 2ZPRA 3QZQA 2JKHA 4GVUA 3LGWA 4FUFA 2BLOA 1GHZA 2OINA 2ODQA 5CE1A 3W94A 2VVCA 4ISLA 3AW1A 4K8BA 3I78A 2ANKH 1J16A 1SLUB 2AGIX 2QCYA 1TGCA 2O8UA 1VGCC 1A61H 1P01A 1W11U 3VG8A 1SGIB 1C2DA 2ODPA 3A87A 1G32B 2KAIA 1FNIA 1ZRKA 5LPEA 4MPVA 2Q6DA 1LTOA 4HI3A 3M3TA 4CRDA 1C1NA 5FPSA 3P8NA 4KP0A 5JYIA 1GHAF 2BQWB 4AN7A 5L6NH 2G8TA 4CREA 1QZ8A 2W6ID 1GI1A 3PTNA 1O2GH 1C1OA 1E35B 2J98A 3PM3A 2VJ1A 3NCLA 3U8RH 5A0AE 3KHVA 1V2MT 1DSUA 4AC9A 3SU4A 2BD9A 1NY22 2BHGA 1XUIA 3F2FA 2LNCA 2VBCA 2QF0A 3FKSD 2KCYA 4A92A 4X2YA 1HJAB 1C5NH 3TVJB 4TSFD 2W6JD 1SOZA 2C90B 1SKYE 2GV6A 2P3UB 2Z94A 1O5BB 4ABFA 5GJ4B 4AORA 2VU8E 1TBZH 2AHME 1C9TA 1NBMD 1QCPA 5JBAS 3RU4D 1O3DA 1QRXA 1BJUA 1TA2A 1BTWA 3ODDA 3OFND 1KLJH 1NRRH 4OS7A 1AVGH 4RSPA 3I77A 1KTSB 1UTLM 4K1TA 1S6FA 5ESBA 2ZCKP 2IPHA 1FJSA 2FM2A 4K2YA 1WQSA 1GGDB 3F2HA 1YPHC 3TJNA 2OP9A 2P59A 3SJKA 3RM0H 1VJAU 2B5TB 3MFJA 2FWWA 3PMAB 4ISOA 1ANCA 1E1QD 1G3EA 8GCHF 2FOMB 4WMDA 3PMJA 4IN1A 5EQRA 1HIAA 1ZPBA 2F9BH 2GMTB 4A5TS 3ZVBA 1U6QA 5DP4A 1GBMA 2OUAA 1TAWA 1YCPM 4Y7BA 3ZV9A 5FAHA 1THPB 5EJ1A 1GBIA 1WCZA 5I25A 3W1EA 4TY7A 4AG1A 1IQLA 5C1UA 1ZTKA 4AFUA 1QL7A 1TQ7B 2PR3A 1A46H 1C5LH 4WY3A 3OY6U 1GBCA 1GBFA 3OTPA 4WH6A 3ZZDA 2XC5A 1BBRH 2D1JA 1DDJA 4UFEH 3TGIE 1IHTH 1WYKA 2XYAA 1UVOA 2ZGBH 2FODA 3A7VA 3ELAH 3RXTA 2ZPSA 1GL1A 1O34A 1BHXB 1P06A 1AI8H 2FZZA 3CP7A 2V6NA 1NBME 1ACBE 2GP9B 3ZVGA 4U2WA 1N1LA 2ALPA 2P3FH 4MNVA 2FI5E 1W0KD 1FY4A 2GDEH 2GZ8A 2Z9JA 3LDXH 5F8XA 2UUKB 2ZECA 1NO9H 5EPYA 1PPBH 3ITIA 2BX4A 1DXPA 2A4RA 1HDTH 1CO7E 2WV9A 4TPYA 3SJIA 3H5CB 2BYAX 2BD4A 1EAUA 2VWMA 3PLBA 3E3TA 2H9EH 3KYGA 1YGCH 5AHGH 4ZKRU 1GMCG 1EKBB 2VB0A 1BBRK 1GHYH 1O2WA 2ALVA 3EDXB 1TPSA 1GI7B 1LCYA 1O5FH 2PFEA 4JK6A 2BDAA 3UB0A 3LGUA 5CHBA 1B5GH 4WXIA 1UTQA 1P2QA 1ZPZA 3SU1A 1K1PA 1PYTD 3MNBA 2BXUH 1EJMA 2BQ6B 1FX0B 1BMMH 3LJOA 1WDIA 3G01A 2ZQ2A 3A8DA 2ZU4A 3A7YA 4JYUH 2EQNA 4MTBA 4DIIH 3MO3A 4ABHA 2ZHEH 5CHAC 3E90B 4AFQA 1O5GH 3VB3A 1CGJE 2A2QH 2OBOA 4TT3D 1H8HD 3QO6A 3AASA 3NWUA 4ABIA 2ZDKA 1FZZA 2J94A 3GS9A 3S69A 2Z3CA 1LPKB 2J92A 2O9QA 4FUBA 1S0RA 1NPMA 3RXLA 2VIQA 3RXCA 1QFKH 2P94A 1E38B 3ZZ4A 1GHVH 2RA3A 1UK3A 1W0JD 1Y5AT 1Y8TA 5GWZA 3U1JB 3DFLA 2HRVA 1GWAA 1UTMA 3VXEH 1QL8A 1FUJA 1NU9A 8ESTE 1W0YH 1HBTH 1G30B 1SGFA 4JZEH 3RMMH 1J15A 2WYGA 3FOAA 1S84A 1KYNA 2QF3A 1Z1IA 2UUJB 2Y5FA 1RRKA 3MTYA 2Y7ZA 2R9PA 1O5DH 2XC0A 4NIYA 4OS5A 1FY8E 2A45B 1D3PB 1FPHH 1OWJA 1SGEE 3SV8A 1MMJN 1MKWH 2EA3A 4CRBA 1MD7A 1LVYA 1DITH 1Q31A 3A8AA 4D9QA 1FIWA 3URCA 2V35A 4AGKA 1THSH 1XVOA 1MTNC 1Y3VA 1L4ZA 4YZUA 2V7QD 2EY4C 2ZA5A 4FVDA 3SUGA 2F9VA 2FLBH 3RXSA 4MVNA 4NA7A 4ZCNA 1BZXE 3N7EA 3NKKA 1GI4A 1CHOG 4WH8A 1G3DA 1AIXH 2R0LA 4HG6A 2BVSH 3STIA 4B74A 3RXUA 4XFQA 2K1QA 4B1TA 1PPHE 1WV7H 1ELCA 1QB1A 4RI0A 1A3BH 3MO6A 1PQ8A 1O3KA 5KECA 1BTXA 2FDAA 3UNQA 4B71A 1C4U2 1K1NA 1L1JA 1TPPA 3M35A 1F0RA 1MKWK 3RXGA 4I8KA 1C5PA 2G00A 4RT1A 1BMNH 1WUNH 5GXPA 1RD3B 1FN8A 5EODA 2A7CA 4VGCC 2DUCA 3SO3A 5HIYA 7GCHG 1HGTH 5B6OA 1WAYB 1TPOA 2CHAC 4XD7D 3T26A 2SGAA 2AYWA 1TGNA 3ZVFA 2A7HA 2OLGA 2A5IA 1GMCF 2BZAA 1GBKA 3BTHE 1O2NA 1TBQH 4CHAC 1XUJA 1UHBB 2QAAA 3DCLA 5TCAA 3UR9A 4YLUA 3PLPA 2RDLA 1YBWA 1DFPA 1T8LA 2ZTYA 3UREA 3TGKE 1XM1A 1DOJA 3M7UA 1EPTC 3SV2H 2BDCA 2F9PA 2G81E 5A2MH 2L6OA 4JK5A 2SNWA 1TE0A 1FY1A 2VIVA 4I32A 1C1WH 3GY2A 4CRCA 4E7NA 2KR7A 2CXVA 2P8OC 2Y82A 2A7JA 1BIOA 3U8OH 1XMNB 3PV2A 5EQQA 1XUFA 3PB1E 1ZZZA 1RFNA 3U1IB 1ABJH 1VR1H 1P09A 2IN2A 1W10U 1ETTH 1ZSJA 1C2EA 3TK5A 3SNBA 1OPHB 5T6FA 6ESTA 1TNIA 1D3QB 4YT6H 1EB1H 1O2PA 4J2YB 1MCTA 4FUEA 1XKBC 1DLKB 1EJAA 1TMBH 2WUCA 2PGQB 4DGJA 1QQ4A 2RA0A 2BY9X 1AZ8A 2G52A 3MI4A 1Z71A 3QX5H 1QRWA 1TGBA 2ZDMA 3SZEA 1EFRD 2A2XH 1ZMJA 1KXBA 2I6QA 4I33A 1IHSH 3AAVA 3HK3B 4Z0KA 2J9NA 3A82A 3GISB 1T8NA 3LC5A 3LOXA 1HAIH 1UVUH 1P0SH 2BY8X 2PW8H 3DA9B 4Y6DA 3FN8A 4ABAA 1C9PA 1F0SA 1ELTA 1LHGH 2K8IA 3TNSA 4R0IA 5TJXA 4U01A 3QLPH 4MQAA 4UEHH 5E0HA 3P8FA 3SNCA 3EA9A 2G5VA 1E34B 3U8TH 3UY9A 1DWCH 3QZRA 1NT1A 3ZZ5A 4ZAEA 1GI6A 1P03A 1HCGA 4Q4LA 1IAUA 1DX5M 3VB5A 4DG4A 4KELA 2ZNKH 3F0OA 3M5MA 1K1IA 3BF6H 1CHOF 1MAYA 3N7OA 5EXMA 1ETSH 2B7DH 3MWIU 4WJG2 1ELDE 1T7CA 1SGPE 1C5UA 1NESE 3DHKH 4K60A 4INHA 1PQAA 3PWBA 3T2NA 3GY4A 3S0NA 5FX6A 1ETRH 1RTKA 1TA6A 2XNIA 7KMEH 2Y7XA 4Q63A 1EZSC 5A0BA 1SGYE 2D2DA 1KMHB 5FBIA 2QF4A 2CGAA 1C1SA 2OC7A 1AZZA 2WPKS 3RXJA 3O8CA 4NCYA 2RFKC 1BOQA 7GCHF 3M37A 4UFGH 2OCVB 3M5NA 4DVAU 1FQ3A 2F4LA
chains in the Genus database with same CATH topology
1OKXA 1HAHH 5C1YA 2VH6A 2GT8A 1K21H 1HAVB 1YM0A 3A7TA 3MNXA 3BG4B 4DT7B 1C1UH 1G9IE 5ESTE 2GX4A 5BRRE 2GKVE 2XWAA 1G3CA 2H1UA 2HPQH 2V3HH 3RXAA 3UWJH 1QTFA 3GCHC 1MD8A 1KTTB 1SHYA 3M7QA 4BAKB 1UHBA 1UVSH 1B7XB 2PGBB 2FTMA 2ZO3H 3TPIZ 1S81A 3FZZA 1LQDB 4H6TA 1SGTA 2QC2A 2ZCLP 5ABWA 3MHWU 2LPRA 1TMTH 2QXJA 2ZZUH 3ATIA 3RU4T 2AEIH 4FVBA 1SC8U 4B73A 4HTCH 1PQ7A 2OC0A 2THFB 1NFYA 3RXEA 5J4QA 2BTCE 4NIWA 1VITH 1O2UA 2AS9A 2BOHB 1EP5A 1DS2E 1S0QA 1B0FA 3QGNB 1W8BH 1FPCH 1AKSB 4O9VA 2TBSA 3ZVDA 4ZXYH 3DUXH 4NFFA 3BEUA 1F5LA 3M7TA 3V3MA 2BDYA 1SLXB 1GJ4H 1O3MA 2W3KA 4ABEA 4MNYA 1YP9A 2Y5HA 2ZEBA 1TX6A 2XW9A 3C27B 3GCNA 3KL6A 4CH8B 2BLVA 1ANDA 4D76A 4K5ZA 4FU9A 3E6PH 1QQUA 1VCPA 1O3LA 1GBAA 1ELBA 5GIBA 2FESH 1A5GH 3PMHB 3SNAA 3R0FA 1O2LA 1TRYA 1Z1JA 3A7WA 1BCUH 1AQ7A 3UWIA 1D4PB 4Z6AH 1YPJH 3E91A 2BDBA 1OS8A 3K9XB 2C8WB 2HNTE 2AMPA 4X1RU 2BOKA 1S6HA 3EQ0H 3TITA 1L1GA 1CGIE 1EAWA 3RUOA 1NC6A 1V2JT 4NWKA 1AMHA 1OWKA 1GBEA 3RC5A 4AX9H 4ZKOU 1KLTA 1Y3YA 5G4BA 1ANEA 3VFEA 3BIVH 1C5ZB 1BTZA 3GY7A 3LKWA 4FU7A 2G4TA 2B0FA 2HLCA 1DSTA 1QBOA 3Q77A 2VVVA 1K1JA 1MKXH 1KXCA 3TNTA 2A31A 3VGCB 1CA8B 8LPRA 2FI4E 2BLWA 1DE7H 3L6PA 1QB6A 2BD3A 1RS0A 3LGYA 2PHBA 4MPUA 1NZQH 3TJUA 2SFAA 3QTOH 5AFYH 2D8WA 3A84A 4E06H 2FO9A 1A5HA 4D7GA 1SMFE 3P70B 3PTBA 3UQVA 1O3OA 1O2HA 3SJ9A 1O2SA 2VGCC 2ZHWH 1MQ5A 4MDSA 2F3CE 2AH4X 5E0JA 1A3EH 1FONA 3EE0B 2QXGA 2BD2A 4AG2A 4I8HA 2OTVA 4F4OC 1GPZA 1TYNA 4Y0YE 2G51A 1H9LB 3P6ZB 3ENSB 1RTLA 3RXRA 1HAVA 2TGDA 4K8YA 1PPGE 4I8LA 2XC4A 5DO4H 1MKXK 1O39A 1YPMH 1ZTLA 2CF8H 1IQIA 1DLEA 4INKA 4U32A 2ZU1A 2HOBA 2BD7A 4AYVB 3U9AH 2C8XB 2EI7A 5CMXH 3SZNA 3A88A 1RIWC 4X8SH 2RCEA 3HKIB 5EU8A 3B8JA 3GCOA 4ABBA 2ANMH 1GDUA 1NRQH 5LGOA 1SQTA 3JZ2B 1FY5A 1O3CA 1SGDE 1TOMH 1KLIH 1CT0E 3HPTB 3H7OA 4Y71A 4X8VH 1BITA 2BDGA 2FOFA 3C1KA 1AVWA 4NFEA 2GGVB 3OX7U 1SR5C 1EJNA 1C1RA 2BM2A 1WOFA 2JETC 3T29A 2BZ6H 4XE4A 2UUYA 1AKSA 1JXPA 1LPZB 4ABDA 1ARCA 2EI6A 2A32A 3CENA 1C2JA 3SU0A 1AUTC 3U98H 2ZHQH 1MQ6A 1ZR0A 2ZU5A 4MPXA 2SGQE 1MBMA 4YOGA 1XUKA 1ZTJA 1GVZA 1GDNA 2UWPA 1XXFA 1AB9B 2GCTC 1TMUH 1O2TA 4KGAA 3NPSA 2XBWA 2FOHA 1AGJA 1O0DH 4X1PU 1ZSKA 2VVUA 1YYY1 5C20A 3RMLH 2FP7B 2VIDA 1IOEA 1BRCE 2WUBA 1C5SA 1H9IE 1GI2A 1FAKH 2ZDLA 1O2VA 1FI8A 1ELGA 3Q3YA 1C2GA 1BDAA 3NUMA 3KCGH 3ZZ7A 2CF9H 3IITA 5T6DA 4WXVA 4XBDA 1MTSA 1O2ZA 1KSNA 5LH8A 5HM9A 5EQSA 1KDQB 1HB0B 1BTPA 4HZHA 1SVPA 3CS7A 1H1BA 1OOKB 4UFDH 2WPHS 2ZPQA 6CHAC 1HLTH 2ZDNA 1N6XA 1OYTH 1BRAA 3KGPA 4F49A 2B9LA 2O8MA 1O3BA 3SU6A 1T4VH 2A0QB 1ZSLA 3E16B 3K6YA 1C5TA 4X8UH 2CMYA 2ZFFH 3GCTG 4ZHLU 3QK1A 1BTYA 2O8LA 3RXBA 3MYWA 2FYRA 3UR6A 1O3NA 2H9TH 4Y10E 3SI4H 3P8GA 1O37A 4ZROA 1GI5A 2O8WA 4AFSA 4IC6A 1TIOA 1A2CH 1QURH 2Z3EA 3E1XB 2GD4B 1SPJA 2VWNA 2ZDAH 1SFQB 1C5RA 1SHHB 2R2WU 4TY6A 2PKSB 1DUAA 1O2XA 1F0UA 1XXDA 1K1LA 1MU8B 1TQ0B 2W26A 3UUZA 4X6OA 3TIUA 3RLYH 1CVWH 1LKAA 4M7GA 2UWLA 4RKOB 1MU6B 3PROA 2FI3E 3PO1B 4WVPE 1HXEH 1W14U 1TPAE 3O8BA 1SGQE 1V3XA 1QB9A 1A0JA 3SV7A 1T31A 1HJAC 1A4WH 2XBXA 6GCHG 2HNTC 3A80A 4ISIH 5ETXA 3K6ZA 2STBE 1O5CB 1NFUA 4YTAA 4GHQA 1UMAH 1WQVH 1H8IH 2HALA 2R0KA 1GI9B 2PTCE 4Q2KA 1OWIA 4B2CA 1ZMNA 3LGTA 5IYTA 1GBHA 1Z6JH 1GCTB 1V2NT 1THRH 4FUDA 5EGMA 4Y7AA 1GGDC 1TWXB 2QN5T 1BRUP 4INLA 5C2ZA 3ATKA 1O38A 4PROA 4CH2B 4X8TH 2PV9B 2Y6TA 7LPRA 4BTUB 1V6DA 1IQMA 2BD8A 2GMTC 3H7TA 4JCNA 1KXFA 1G3BA 2FXRA 1O31A 4LZ1H 3BTWE 2VNTA 2P3TB 2BX3A 3KQEA 1JIRA 2ZGCA 4UD9H 3LONA 1C4V2 4GAWA 2PUQH 1W7XH 3LH3A 5AFZH 2WPIS 4A1VA 2GZ7A 3Q3XA 3KN2A 5A09A 1DUEA 3M5LA 1ZOMA 7ESTE 2P95A 1EP6A 2AIQA 5J4SA 3T5FH 1P9SA 1UVPA 1V2RT 5GDSH 1PPFE 1C1PA 4DJZB 1V2WT 1GMDG 1O32A 3ZZAA 4Y8XA 1C2KA 1QNJA 2RG3A 2TPIZ 2WYJA 3RP2A 3HK6B 1KDQA 1O3EA 4WMFA 1N8OB 1L1NA 1D6RA 2NU1E 5DP6A 1CT4E 2I6SA 1QR3E 1O2IA 3GCTF 1LPGB 1HAOH 4CR9A 1T8OA 4DCDA 4FUHA 1AFQB 3VB6A 2ULLA 4JZ1A 3PMBB 1B0EA 2C93B 2FYQA 2NU4E 1BT7A 1P12E 1NFWA 2XTTB 4GPGA 3TGJE 4JYVH 4AGJA 3BTGE 4DW2U 4TYDA 5EXNA 1FLEE 3OYPA 3SV9A 3F9GA 2VINA 1AUJA 4GSOA 4NZLA 3MU8A 3NXPA 1C5OH 4FUIA 5JBBS 1EZQA 1AE8H 1EZUC 4FXGH 4D8NA 2J2UA 5A8YA 1P2JA 3MOCA 1KXDA 4TWYA 3ZYEA 1O5AB 1V2KT 1GG6B 3GYMA 3MO9A 4AOQA 3GY8A 1SGFG 4BAQB 2G4UA 2AGGX 1JRTA 1O3AA 4HGCA 3EA8A 5EXLA 1FAXA 1ZHPA 1YCPH 3D62A 4JZFH 1AN1E 3MU0A 2OXSA 1LVOA 2BQ7B 1W7GH 1XUHA 4JYTA 3LU9B 1HJ8A 1UTOA 1SGNE 1L2EA 1RJXB 1V2QT 6GCHF 1C2LA 3VEQB 1Z8JB 5JBCS 2ZKSA 1G37A 1QJ7B 2VIPA 1O3PB 3SQHE 1O3JA 1CBWB 1GJAB 1W12U 5FPTA 1GHWH 4ISNA 4FUJA 1AE5A 1ZJDA 1YLCA 1T8MA 3FP8E 2XXLA 4ISHH 1P3CA 3GY6A 3SNEA 2GCHG 1QRZA 2G5NA 3L3TA 1SQOA 2SGEE 3A83A 3A8BA 1ARBA 1WTGH 2BVXH 3P95A 2W3IA 1Z8IB 1PPEE 4SGAE 1C1MA 1HJ9A 4U30A 4I8JA 3AVZA 3RMNH 2JH5D 1HPGA 1NTPA 4O3TA 3UOUA 1QA0A 3UPEA 3M3VA 2ZGXH 1ZGIA 1YCPK 1VGCB 3ZVCA 5FCRA 5F8ZA 1A5IA 1DWBH 3S9CA 3KQBA 3ZZCA 1SLWB 3M3SA 3DD2H 2Q1JA 5HYOA 1P05A 2Y81A 1MH0A 5JBTA 2EC9H 2BY5X 2NU3E 2GT7A 1SG8B 4AYYB 5IDKA 2UWOA 4Q7YA 1MAXA 2TIOA 1P02A 4D7FA 3QGJA 3V12A 1P11E 1S82A 3BV9B 1IQJA 3P92A 1BMLA 3HATH 3F1SB 4X1QU 3RC6A 4GCHG 3LT3A 1YPKH 1GMDF 2DE8A 5AVDA 1KY9A 4BAHB 2YNBA 3E8LA 1OP0A 1YPEH 4SGBE 4BXWA 4KTUA 4ESTE 2CV3A 1DVAH 2SNVA 4Y8YA 3SU3A 5I46H 4E05H 2WPJS 1TNHA 4WWYA 2IOTA 2XCFA 3A85A 4MPWA 2BDIA 5HMAA 2VWLA 4D9RA 1IQHA 2ZCHP 1KXAA 8KME2 1JRSA 2W5EA 1C5QA 2D26C 2P16A 1HRTH 4LOYH 3MU5A 1ZJKA 2AERH 9ESTA 2Z9KA 1EQ9A 4OS1A 1OXGA 2QGRA 4Q80A 3U69H 1UTNA 1FIZA 3VXFH 3RC4A 1ELFA 2NU0E 1YC0A 2HNTF 4UDWH 1EAIA 1TRMA 1RGQA 5C1XA 4H6SB 2BY6X 3MNCA 1G2LA 1NRSH 2GDDA 3BTQE 2ZF0H 5LPRA 2JH6D 2ANWA 4OS4A 5DP9A 5LPFA 1J9CH 4I8GA 5F6MA 2FOEA 3SU5A 3ZZ8A 2HPPH 1FV9A 5EOKA 2BY7X 3BTEE 3UIRA 3RLWH 2WV5A 1Y5BT 3BSQA 1E0FD 3E0NB 2H2ZA 1C1TA 4YOJA 1FMGA 3MH4A 5DGJA 3S9AA 2YNAA 4HFPB 3NK8A 2A4OA 3MH7A 2BD5A 3ATLA 5C3NA 4Y0ZE 4IMQA 4CRFA 4OGXA 1AD8H 2ZC9H 4AB8A 1C4Y2 2G55A 3QUMP 1BMAA 1SGCA 4MLFB 1KXEA 4RKJB 1O30A 1FN6A 1P10A 3SUEA 1TGSZ 3Q3KA 2GCHF 1DICA 3B23B 1GHBG 4IN2A 2ZHFH 5JDUB 1K1MA 1Z7KA 5L2ZH 5JPMH 4XBCA 2O8TA 5FX5A 4DY7B 1V2TT 2A5KA 2AMDA 3T28A 1GJ6A 2FOCA 2WINI 2JH0D 3KEEA 1K2I1 4I7YH 4Y11E 1AFEH 1EATA 1CSOE 1WBGB 3UFAA 2OC1A 1DWDH 1O2KA 2YOLA 5A0CA 3P17H 2A4QA 4NZQA 3A7ZA 3RXMA 1O2QA 1BHXF 4FUCA 1QA7A 1E37B 1LHEH 6CHAB 3EGKH 1C2HA 2ZQ1A 5JB8S 4GLYA 5DG6A 3A86A 1GJ7B 2VWOA 1OSSA 3VB7A 5FHTA 4NIXA 4DURA 4NA9H 2ZFTA 2W7SA 3M61U 1GHXH 3HGPA 1Y3WA 4ASHA 2QA9E 4GCHF 2ZI2H 1TALA 2ILNA 1G36A 1QIXB 3SOSA 1C5VA 2VH0A 3T27A 4JMYA 1Z8GA 3AAUA 3UOPA 5EW2H 1GBDA 1A1RA 4KTSA 5CHAB 3BEFB 1UVTH 1P57B 2F9UA 1QBNA 2QY0B 1SL3A 1PFXC 2ZWLH 1QBVH 1NROH 3F9EA 1S83A 1TB6H 9LPRA 2F83A 1ZGVA 4A6LA 5E8EH 1OP8A 4UONA 2AMQA 3T25A 4YM9A 3W95A 1ELVA 3STJA 1GDQA 2AFQB 5F03A 1FXYA 1P2OA 3BG4C 1HAPH 2HWLB 1HAXB 4K69A 2ZU3A 4XBBA 1C2FA 5DKMA 1GJCB 3MU1A 3RXFA 3GYLB 2A1DB 2BLQA 4DIHH 1O2JA 1VITG 4IS5A 2OBQA 5E2OA 1TBRH 1GVKB 2PSYA 3SV6A 3FP7E 3BN9A 1H4WA 3F9HA 1RXPA 1GBJA 1WTHD 1S5SA 1NU7B 4X2VA 3GICB 1AWHB 1CA0C 1JWTA 1XUGA 4Y8ZA 3RM2H 3SUDA 1JMOH 1Y3XA 3UTUH 4BNRA 1OP2A 1IQEA 1EOLA 4AFZA 2FX4A 3BTTE 3JZ1B 1O2YA 3GY3A 3CS0A 2TGTA 1MTNB 1PPCE 4BANB 2H9HA 2AGEX 2XWBI 4KTCA 4RN6A 1IQFA 1O36A 2J38A 3F68H 2NWNA 4LK4A 2QIQA 3D49H 2A4GA 3BG8A 1VJ9U 2ZIQH 1GHBF 1OWHA 4NGAH 4X6MA 1BUIA 3A81A 5DP8A 1X7AC 4Q7XA 1QY6A 4ZKSU 1A7SA 3E0PB 1K28D 4Y79A 1ORFA 2FX6A 1UJ1A 1ID5H 4XDEA 1GJ9B 1ESBA 3IG6B 4XSKU 3FZDA 1YF4A 2PSXA 2HVXA 3ZZ6A 2J4IA 1F0TA 1LO6A 1EB2A 1HUTH 1OYQA 1P2IA 3FFGA 3Q00A 1AVXA 3GDUA 5L2YH 4VGCB 4NG9H 1V2LT 2R2MB 5GCHG 3TJVA 1HAGE 3PWCA 2FPZA 4ZUHA 2CHAB 2FEQH 3FP6E 1BRBE 1MTUA 1GVLA 3L33A 2PWXA 2QXIA 1GI8B 1T32A 3HKJB 4X6NA 1NS3A 3P8OA 1TNKA 3EYDA 3OY5U 4K1SA 4CHAB 2QYIA 2R3YA 1GCDA 2Z3DA 3BTFE 2TRMA 2V3OH 3RU4E 1TX8A 2BMGB 3LIWA 1K1OA 1QHRB 1GJ8B 2QV1A 1GBBA 1MUEB 3SBKA 1EPTB 4NSVA 3LGVA 3TH4H 3B9FH 4NSYA 2ZDVH 1EAXA 4ZXXH 4CRGA 1ZRBA 1C5MD 1O3IA 1INCA 3ZZ3A 1GJ5H 4UFFH 3VGCC 2P8OB 3V7TA 4ZMAH 2WV4A 2M5TA 1W2KH 2ZGHA 1ZMLA 3KQCA 1S85A 1BTUA 1JOUB 1TFXA 4B76A 1AHTH 1O3HA 3RDZA 1CHGA 4TWWA 3RXPA 3IWMA 2FMJA