1RIWB

Thrombin in complex with natural product inhibitor oscillarin
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
147
structure length
147
Chain Sequence
b'IVEGSDAEIGMSPWQVMLFRKSPQELLCGASLISDRWVLTAAHCLLYPPWDKNFTENDLLVRIGKHSRTRYERNIEKISMLEKIYIHPRYNWRENLDRDIALMKLKKPVAFSDYIHPVCLPDRETAASLLQAGYKGRVTGWGNLKET'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords thrombin light chain
publication title The N-acyloxyiminium ion aza-Prins route to octahydroindoles: total synthesis and structural confirmation of the antithrombotic marine natural product oscillarin
pubmed doi rcsb
molecule tags Hydrolase/hydrolase inhibitor
total genus 28
structure length 147
sequence length 147
ec nomenclature ec 3.4.21.5: Thrombin.
pdb deposition date 2003-11-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1riwB00
1A61H 1FY8E 2H6MA 2GVFA 3H5CB 1C2IA 2ZFQH 3LGIA 3QGNB 1SQOA 6CHAB 1ELGA 4KGAA 4WY3A 5SGAE 1GHBG 4JZEH 4D9QA 1BTZA 4OS2A 2Q6GA 2ZKSA 1WAYB 5G4BA 1G2LA 2BB4A 1SGRE 3SOSA 1KTSB 3CS7A 2J94A 1EJNA 1G9IE 1CA8B 1F0TA 1TQ7B 1GBBA 3SGAE 4AG1A 1MTUA 4MDSA 2THFB 4MTBA 2ZECA 3TGKE 4TY7A 1J8AA 3RXCA 4YM9A 4B75A 1GJDB 1NRSH 5EXLA 3RXIA 1O3EA 1RIWC 5K7RA 1FPCH 1D6RA 1HAXB 1O30A 2H1UA 1A3BH 3UR6A 3ITIA 1IQMA 1VGCB 4X6NA 1EPTA 3H7OA 4AFSA 1C5XB 3ENSB 4OS5A 3HPTB 1BB0B 1FPHH 1O3CA 3QLPH 1BITA 1XUFA 2XBWA 3PB1E 1P11E 2VWLA 4XBDA 4DURA 1OX1A 1AVGH 1GHWH 1C4Y2 1MAXA 1GCTB 1GG6B 1RD3B 1DWEH 2ZFTA 1GHBF 1V2PT 5BRRE 4YLUA 1HFDA 1S81A 3GY3A 1O2IA 1CT4E 3Q77A 3BN9A 3HGPA 2FOFA 4RKOB 1FV9A 2ODPA 5FXLA 1UMAH 4BTIB 1A7SA 3U8OH 2BDYA 3U8TH 4AFQA 4DIHH 1ZHRA 2FIRH 1MU6B 1N8OB 2OC1A 4UDWH 4GCHG 2FWWA 1U6QA 5CHAB 3BIVH 1TWXB 2CN0H 1QB6A 1L4DA 1C5MD 1O2RA 2G81E 3BEFB 1K2I1 2EEKA 2DE8A 3FZZA 3T25A 2BOHB 3MO6A 2ZU4A 5JBBS 3RMMH 3RU4T 1E35B 2ESTE 4Y7AA 1GHXH 2GMTC 2JH0D 1GI5A 1C4V2 1WBGB 5ETXA 1GBIA 3EA8A 3O8RA 2W7UA 1IQEA 3PMJA 1Z8GA 3ZVCA 1IQNA 5T3HA 3PLKA 1GJCB 3IG6B 1PPZA 3QZQA 2ZA5A 1C1OA 2A4QA 5FHTA 1P9UA 1FI8A 3AAUA 3HK3B 1IOEA 2PKSB 3BG4B 5TCCA 4TWYA 1UVTH 1TIOA 1ZTJA 3P8NA 2H9EH 2QXIA 3FAOA 4MG3A 2FO9A 1FLEE 3RU4D 4BAMB 3RLYH 2Z9JA 2FEQH 3MH6A 1TONA 2HNTC 1YPGH 2XC0A 1F92A 1C5TA 1PJPA 1SSXA 5FPSA 4MPXA 1P2IA 2F9VA 7ESTE 4ZXXH 5A8XA 1AVXA 3RC6A 1ZMNA 1OXGA 1GBEA 1HGTH 4I8GA 3A7TA 1C2EA 5L2YH 4FU9A 2ANKH 1MTSA 1ABJH 3A8CA 1MQ6A 3RXAA 2RCEA 2RDLA 4CRDA 1GJ4H 1Z1JA 1OKXA 2FYQA 3NXPA 5DJ7A 5C1UA 4RN6A 5AFZH 2V35A 3GISB 1TLDA 4X8UH 3C1KA 2UUYA 2P3TB 1FNIA 1ZGIA 1O33A 1FDPA 2PWXA 2TRMA 4WMEA 2TGDA 1XMNB 4AFZA 1NFYA 4FVDA 3V12A 1UTNA 4B74A 1FIZA 1S5SA 3F9EA 4NFFA 3IWMA 4ZKRU 4JZ1A 5GCHG 3ZZAA 1DSTA 2A7HA 1KSNA 4GLYA 2VWOA 1LHFH 2STAE 1V2KT 1YBWA 5C5NA 3GY6A 3KCGH 4MPUA 5JBTA 5H4IB 3GICB 4UFEH 4CRAA 1B7XB 2FI4E 1J16A 2QV1A 4SGAE 2NU0E 1JWTA 3EDXB 1LO6A 1D3QB 1HLTH 4Q7XA 1GGDC 1O3MA 4CREA 1FJSA 2BY9X 1JRSA 3OTJE 4VGCB 3JZ1B 1SHHB 1B5GH 1Y8TA 1C2GA 4AFUA 1GI6A 3SU0A 1Q3XA 3BIUH 3QZRA 5E2PA 1QGFA 3SU6A 4TPYA 1C5OH 2ZCKP 4KKDA 1VITF 1V2QT 3ZVEA 5L6NH 1TMTH 2P94A 1A5HA 3KEEA 3QDZB 7GCHG 1A5GH 1OSSA 1G37A 1LTOA 2A4OA 1HUTH 2ALPA 4JYUH 4AB9A 1S0QA 3A7YA 1EZQA 1NRPH 2HNTE 1WSSH 2OXSA 1MU8B 5AFYH 1AWHB 4CH2B 2PGBB 2V3HH 1ZRKA 3EYDA 1MCTA 4AOQA 3OSYA 5GWZA 4NA8A 4DT7B 1O3KA 2GV6A 3OU0A 3RXOA 2LPRA 4MNYA 4WMFA 3RXTA 4Y8XA 3SHAH 1T7CA 3GDUA 2VJ1A 2ZTXA 1H1BA 1TQ0B 1NN6A 2A5KA 1YM0A 3RMOH 3GCOA 2H2ZA 2ANYA 1AVWA 1FAKH 1LMWB 4FUJA 1VZQH 5I25A 2TGPZ 4Y8YA 3P95A 2ZGJA 3TJOA 1TA6A 1TX7A 1H9HE 5GXPA 4F4OC 1IQHA 3F9GA 1E37B 2F9BH 2QXJA 3G01A 1WYKA 4BOHA 1O2HA 1FN8A 1MKWK 2ZU3A 2XBYA 7GCHF 4FUCA 3ZZ7A 1DICA 5TJXA 4BNRA 3L3TA 4D7FA 4F49A 1TBQH 2A7CA 3UNSA 1T32A 1YPLH 5EOKA 3NUMA 3EAJA 3E90B 1DWBH 4O3TA 2G5VA 2ZFSA 1ZSKA 3SI4H 1LCYA 4X6MA 4ZROA 1T8LA 3L33A 1ANEA 1LVBA 1ID5H 4INHA 4A1XA 3V7TA 3UNRA 1BRUP 4Q7ZA 3A80A 1C2HA 2OINA 2O8UA 3WY8A 1FMGA 3GCHB 1BMAA 1OWDA 1KDQA 1WCZA 4OGYA 1OP8A 1ZJDA 4NWLA 2VIWA 3SJKA 4CH8B 2HOBA 1G32B 5E2OA 3P6ZB 1O5EH 1WTHD 2NU1E 4O97A 3SU4A 1MTWA 1TOMH 4X8TH 3U69H 1O3BA 3A8BA 4BAHB 1V2ST 5EQQA 3D62A 1TGCA 1AQ7A 5IDKA 2BD3A 1QBVH 2C8YB 2ZU1A 3KQCA 1JOUB 1W0ZU 4GSOA 2H5DA 1QL7A 2ZPSA 1WQSA 3SU5A 4Y11E 4FUGA 4HTCH 3B8JA 2R3YA 2ZPQA 3NK8A 2GCTB 2EI8A 2VNTA 5DG6A 1AFEH 2SGFE 1O36A 3GYLB 3E0PB 4B2CA 1ZR0A 2R2WU 1EKBB 2VVCA 3PM3A 3PMHB 4ASHA 5FCRA 4DIIH 1QL9A 2UWLA 1C1NA 4K5ZA 1O3OA 1UHBA 1KYNA 3QTVH 3ZZ4A 1OWHA 2ZWLH 1KLJH 1TBZH 1OS8A 3A81A 1BCUH 3LGWA 2ZGCA 3TPIZ 1O3FA 2Y7ZA 1QBNA 1YP9A 1SGYE 1GPZA 4ISHH 1SR5C 2VH0A 4ISOA 1TNHA 2PGQB 1CU1A 3RXVA 3UR9A 1V2RT 2VH6A 4JZIA 1QIXB 2FZZA 2GGVB 3MH7A 1ELEE 1O2PA 3PV4A 3ZZ3A 3OY5U 1C5YB 3PO1C 1NRRH 3AVZA 3RLWH 5JDUB 3MU4A 3T29A 4Q7YA 3SI3H 2WPHS 1KXDA 2P95A 1ZHMA 2QIQA 3UREA 5A2MH 4X1PU 1C2JA 1UJ1A 4YOGA 4DGJA 3SNEA 1QCPA 3ODFA 4YOJA 1V2TT 1PQ8A 3QTOH 1XX9A 3RC5A 2D26C 1P04A 1EATA 1HJ9A 5PTPA 2ZFFH 3A82A 3P17H 4I31A 3LJJA 3KGPA 4YZUA 1XUGA 1Z1IA 3SUDA 2J2UA 2O8WA 1HAZB 4IBLH 5ESBA 2W5EA 3PMAB 4H4FA 2SGPE 1AUTC 4AX9H 1ARBA 2C93B 3ATIA 3ZZ8A 3GY4A 6GCHG 8KME2 2FESH 5LPRA 4AYVB 2J38A 1EAXA 2BOKA 3Q3XA 1O2WA 3M3SA 1E36B 3O8DA 1VJAU 3EQ0H 3LOXA 1GCDA 1QRZA 3BTHE 5T6GA 1NPMA 1QJ7B 2ZEBA 3LC5A 1HRTH 4UD9H 5FX5A 3LJOA 1AY6H 2HWLB 1Z6JH 2PSXA 3CS0A 2F9NA 5LGOA 1MCVA 3M61U 1IQKA 4CRCA 3VPKA 4FVBA 1FIWA 1MH0A 2Z3CA 7KMEH 1EX3A 2VU8E 4FUHA 1L1NA 3P92A 2FTLE 1Z6EA 4WWYA 4ABGA 2O9QA 1SI5H 1TMBH 3MNCA 4GAWA 2Y5GA 2ZHWH 1ESAA 2ZDKA 1NM6A 1BTHH 1ELDE 1SGFG 2BTCE 8ESTE 3MU5A 5ABWA 7LPRA 2V6NA 4U30A 1YPKH 2RA0A 1DWDH 1P3EA 2GTBA 3PWCA 3NCLA 4K60A 1K9OE 5HGGA 1AI8H 4NSYA 3TH4H 2FOAA 1VGCC 4IW4E 4IGDA 1BZXE 3CENA 4OGXA 1IHTH 1GMDG 2UWPA 1SGTA 3E3TA 1L1JA 4UFDH 1YCPM 1GBJA 3BF6H 5HXFA 1EUFA 1V3XA 2ANMH 2YNBA 1O3JA 1C5QA 2G52A 2BD4A 1V2NT 1BRCE 1LKAA 1XKBC 1O34A 4WVPE 1GJ6A 3DHKH 3SUEA 3E16B 3GDVA 2G8TA 3ZVAA 4INLA 1W7XH 4HGCA 2KAIA 3GCTG 2BD9A 2ILNA 3MTYA 4BXWA 2ZTZA 3AASA 4XFQA 2ODYB 1LPZB 1MAYA 1O2OA 3BSQA 3FP7E 4X6OA 1C2KA 2WPJS 4Q80A 3RXEA 1P01A 2C8XB 1FY5A 1UHBB 5EPNA 3GYMA 3F9FA 2FTMA 1CA0C 4IS5A 2XTTB 1V2MT 5CHAC 2J92A 2BLOA 2FPZA 3GY2A 1IQFA 1NFXA 1O37A 1TNLA 1GMDF 4OS4A 1HAYB 1NROH 3KQDA 1OWIA 1WOFA 1GJAB 1OOKB 1DSUA 1UVPA 2AYWA 3SW2B 1C1QA 1S6HA 3TNSA 1SGNE 3SHCH 4MQAA 3UOPA 1BHXF 3UQVA 1O2NA 2AS9A 2FP7B 1NRQH 2CF8H 3BTME 3KNXA 5LPFA 3BTEE 3RDZA 2SGEE 4XBBA 1EAWA 1IQJA 1ANCA 3MHWU 4WH6A 3VEQB 1BOQA 3LONA 2XNIA 3Q3YA 4X2XA 3A8DA 3SV9A 1G2MA 1X7AC 1C1PA 2AH4X 2AMDA 1D9IA 1NC6A 2BVXH 2BYAX 1O2LA 1DANH 1ZLRA 2PTCE 1ETRH 2QA9E 1DUAA 3BTWE 2Y5FA 4B76A 4O3UA 2HVXA 1DITH 2OQUA 3MFJA 1GMCG 1D3DB 2BY7X 2Z9IA 1V2VT 2DE9A 2VB0A 5JBAS 1OPHB 3TITA 1ETSH 2OD3B 4LK4A 1TABE 4QT8C 3BTFE 1EJAA 1YLCA 4IMZA 3S7HB 1P57B 4ZH8A 4JK6A 3TNTA 3A7VA 2CXVA 1SGCA 1DFPA 2VIVA 3FVFB 2AEIH 1C1SA 4GHTA 3KL6A 1AZ8A 2A5IA 3SJ8A 3R3GB 4CHAC 3SUGA 1GVLA 1QB1A 4JZFH 1UTQA 1TGNA 1EB1H 2W3KA 1F7ZA 2GZ8A 2H5CA 1BTYA 3ATKA 1GHAG 3PYHA 3RC4A 1PFXC 2BY8X 2D8WA 4WXIA 4AZ2B 3SV7A 3B9FH 1HAOH 1YPJH 3A84A 2A32A 3MYWA 1OYTH 2FOGA 1AN1E 1O5CB 1YCPK 1GI2A 3M5NA 2CF9H 3TVJB 1ZSLA 3A7XA 3OX7U 4H6TA 2I6SA 3ELAH 1SLVB 1A1RA 3NPSA 1DPOA 5E0HA 1BTWA 1GHZA 4ABIA 4E05H 3GY5A 1O0DH 2BZ6H 1CE5A 1ESTA 1IAUA 5FBEA 1BBRE 1UVOA 3MMGA 3TJUA 1MTNC 3VFEA 1O2JA 5A8ZA 1RRKA 4A92A 1N1LA 1ANBA 2FOEA 1TNGA 3SJIA 2NU3E 1AMHA 4YOIA 1P3CA 1QBOA 1UO6A 1EPTC 5DP9A 1BRBE 2BD8A 1GL0E 1Z71A 2PLXA 2XBXA 2P8OB 4K3JA 2SGQE 5GDSH 5F8XA 1EASA 5K0HA 1DX5M 2P3UB 1GHAF 2CHAB 3A8AA 1GDNA 1HV7A 1P10A 3V13A 4NA9H 2ZHDA 1HAIH 1UVSH 4GCHF 1K1OA 1QA0A 1SGFA 1WU1A 3RXBA 3ATMA 4FU8A 1FY1A 2PTNA 2BQWB 3AW1A 1H4WA 2PHBA 5GIBA 2QF3A 1DM4B 1LDTT 4NG9H 3A83A 1YCPH 3RXSA 3K6ZA 1F0SA 2KAIB 1OWEA 2WV4A 1GI0A 3S69A 1SHYA 1O2MA 2ZGBH 4ZXYH 1O2UA 2FOHA 4FUFA 3ZZBA 3E1XB 5LPEA 4X0WU 1EOLA 2D1JA 3SV6A 2Z7FE 1V2UT 1PQ5A 2ZG0H 3MNXA 1NESE 4XBCA 4CRGA 2BXUH 4ESTE 4ISIH 4O9VA 2F3CE 8LPRA 5HYOA 4ZKOU 1MZAA 4X8VH 3GOVB 1FN6A 1KY9A 1Y3XA 2OC7A 3KIDU 1DDJA 1Z7KA 1NFUA 4JYVH 3L6PA 4B2BA 4LOYH 5C2ZA 2WYGA 1PYTD 4FXGH 1HAVA 2VIDA 2BM2A 1A2CH 2TBSA 1TRNA 1KIGH 1TBRH 5DPAA 1C5SA 2SGAA 1PPFE 2BX3A 3PMBB 5F6MA 2BDHA 1QL8A 2CV3A 5EXMA 3W95A 1C5LH 3ESTA 1SGPE 2P3FH 4ZUHA 3U98H 1P02A 1ESBA 1AB9B 1HJAB 1ELAA 3D23A 1GBLA 1BUIA 5JB8S 1HIAA 3D65E 3SGBE 4I8LA 5A8YA 4MPWA 1GJ5H 4I7YH 5DGJA 1XKAC 5F03A 2GMTB 5GCHF 4AG2A 1ZRBA 3LGTA 1WV7H 1FAXA 1SQTA 5CE1A 3SU3A 9ESTA 1CBWC 4J1YA 3ZYDA 3TJVA 3T2NA 4ABJA 4BANB 1A5IA 1TX6A 2IN2A 3QUMP 1C5WB 1XM1A 2BDAA 5FX6A 3MNBA 1GBKA 5J4SA 1O3GA 1WTGH 1QR3E 2BQ7B 1DS2E 1FONA 3RXLA 3TH2H 3MU0A 4E7RG 5L2ZH 1GHVH 1CVWH 2F83A 2ZPRA 2FOCA 1LVOA 4LZ1H 4JMYA 1SLWB 2JETC 3UY9A 3BTKE 2QYIA 3SNBA 1SFIA 4FUBA 1YKTA 2ZGHA 1VITH 2BLVA 4KELA 1P03A 2VINA 1P9SA 1SFQB 3Q00A 3ZYEA 5EG4A 1GI1A 2AIQA 1ELVA 1NRNH 1GBAA 3A87A 1P2JA 3BV9B 2UUJB 4JK5A 5C5OA 3RXMA 4ZHLU 1RXPA 1SGIB 2FI3E 3BTGE 3RMNH 3F9HA 5HMAA 4HI3A 3R0FA 1T4UH 4ZHAA 2JH5D 2ASUB 3GCNA 4B73A 3RXFA 4YT6H 1T4VH 1UCYE 1W0YH 4Y8ZA 3FP8E 1KXCA 4K1TA 1THSH 4X1RU 3PLPA 4YTAA 1O2ZA 4IC6A 1PQ7A 2QN5T 1S84A 3LC3A 5LH8A 4R8TB 2HLCA 2AFQB 2A7JA 2BZAA 1AE5A 2HALA 3DFLA 3MU8A 2JH6D 4DOQA 2J9NA 1AGJA 1AHTH 3KQEA 1GI4A 1C9TA 3P70B 4A5TS 1FY3A 1PPCE 3W94A 5EODA 1CO7E 1GGDB 1AFQB 2OUAA 3ODDA 1GDUA 2ALVA 4FU7A 3A7ZA 2ZGXH 3T28A 4BTUB 2SFAA 2BVRH 1QQ4A 2AGEX 4GPGA 1ELCA 1Z8JB 2ZIQH 1E34B 4Y0YE 1RJXB 4NGAH 1QB9A 2OBOA 3RXQA 1XVMA 3E0NB 1MKXK 4D8NA 1THRH 1BIOA 1BTUA 3SN8A 1H9IE 4IC5A 1GJ8B 4AYYB 1UTOA 5GPIB 3OY6U 1W13U 3N7OA 1NTPA 1XVOA 3M7TA 5DP3A 1K1JA 2BQ6B 4CBNA 1YF4A 2NU2E 1G3DA 1H8DH 1O2YA 1LQDB 1C5ZB 1ANDA 3LIWA 2VIPA 1J17T 5AVDA 4ABHA 2C90B 1DT2A 2FS8A 1TNJA 1TMUH 5EGMA 1HAVB 1VCWA 3PTBA 1K22H 2FOBA 1TGBA 2BY5X 3PTNA 1C1TA 4ABFA 2A5AA 2OBQA 1AO5A 1HAHH 1DY9A 5TCAA 2GCHG 4UEHH 1L4ZA 2ZDNA 2WPIS 1YPEH 2PW8H 2K1QA 1SG8B 1GI9B 1HIAB 1QQUA 1FZZA 1MKXH 1P0SH 2WINI 3BG8A 4TY6A 2BLQA 5E0JA 1B0FA 3ZZ9A 2ZI2H 4XDEA 3TK6A 8GCHG 1DLKB 1IQLA 2WV5A 4K69A 4Y0ZE 3MNSA 2XWBI 2XRCA 2FYRA 1T8OA 2BXTH 1NY22 3ZZ5A 2G00A 5F8TA 1N6XA 3UPEA 1K1PA 1UK2A 2WPLS 1O3NA 2OLGA 2PFEA 2GCHF 3D49H 1W3CA 2OP9A 3ZZDA 3QK1A 1SQAA 2CGAA 1W12U 1BDAA 3V0XA 2C8WB 4BAOB 1UK4A 5C1YA 5FAHA 1L0ZA 5C20A 5IYTA 3S9CA 1K1IA 4YO9A 2IOTA 2F91A 2QCYA 1V2LT 1C1VH 2B7DH 3IITA 1LHCH 3BEIB 3A7WA 2BY6X 5A0CA 3VXEH 2GDDA 4WMDA 6CHAC 1P12E 2Z94A 1C5PA 4NIYA 1KXAA 4Q2KA 5A0BA 5EPYA 1XUIA 3M7UA 1GBDA 3ZZ6A 4A1TA 1FQ3A 1XXDA 4BAKB 2HNTF 1C5VA 1BTXA 2J4IA 3K9XB 2H9TH 3DD2H 1CQQA 4R0IA 1W8BH 3SV2H 2BMGB 3GDSA 2HPQH 4LXBH 1NT1A 4GVUA 2XC4A 6GCHF 3M3VA 4A6LA 4X8SH 1ZPZA 5CMXH 1UTPA 3KN2A 2G5NA 2GKVE 4X1SU 4Y10E 1TNKA 5DKMA 5C1XA 1QA7A 4I8HA 3HGNA 4O03A 3RM0H 1G36A 3VGCB 3NZIA 2QY0B 2IPHA 1O3HA 5B6OA 4AGJA 2ULLA 1O5DH 4MNXA 2P93A 2XW9A 3A88A 1P8VC 1EAIA 1S6FA 1UCYK 2PUQH 1ZTLA 1RTFB 1GCTC 3CP7A 5DP4A 3A86A 1GG6C 5E0GA 3PWBA 1J15A 1TYNA 3M3TA 1SC8U 1RTKA 2ZCHP 3GY8A 2V3OH 1NU9A 1VCQA 5A09A 1S0RA 3RU4E 3U1IB 3S9BA 1XUJA 1OWJA 1O3IA 4WJG2 4X1QU 1LPKB 3STIA 4DW2U 4YT7H 3SJ9A 5DP8A 3RXRA 1V2JT 3UUZA 1PPHE 1O5AB 4KTUA 1N8OC 5HM9A 2BD2A 3QX5H 3F6UH 4ABAA 1QFKH 2Y81A 4OS7A 1O39A 1MUEB 4X2YA 2GV7A 2G55A 1J9CH 1ABIH 2Z3EA 2A4RA 2OCVB 4NA7A 4DJZB 1F5LA 1QRXA 3LH3A 1T8MA 2WPKS 1VJ9U 1GJ9B 1SPJA 2GT7A 1EZUC 1O2TA 1CHGA 1F5RA 1ELBA 3ZV9A 1EP5A 1UCYH 2A31A 2Q1JA 2Y7XA 3LH1A 1CHOG 1C1RA 4NWKA 3GCTF 3UOUA 1J14A 2B9LA 2PKSC 2ZDAH 3BG4C 1HCGA 1LVYA 4I32A 2I6QA 2P8OC 4XE4A 1PPGE 1P09A 2DUCA 3I78A 1EXFA 1G30B 2PR3A 2UUKB 2Y80A 1P2KA 2CHAC 5DK1A 1QURH 1CSOE 1PQAA 3DFJA 3MU1A 2ZF0H 1MTVA 1SLXB 1QJ6B 2WUCA 3RXPA 2BLWA 3E8LA 4UONA 1Y3WA 3K2UA 2BDIA 3QGJA 4I8KA 3SNAA 2Y82A 2ZU5A 2UWOA 4I33A 3VB3A 2ZHEH 1L2EA 2XXLA 4OS6A 1Y5BT 2BD7A 3VB6A 3T62A 1BJVA 1L1GA 1DXPA 3LKWA 1EZXC 1LVMA 2XBVA 2FODA 2ZNKH 4ZMAH 1TALA 1PPBH 4NIVA 4E06H 1NZQH 1O2GH 2W3IA 3STJA 4K1EA 3SU1A 4THNH 1ZMLA 5FBIA 5EW2H 6LPRA 4FUIA 1QHRB 2AGIX 3M7QA 2TPIZ 3FANA 1CHOF 1O35A 5A0AE 1SMFE 2WPMS 3K6YA 2GT8A 3MH5A 3UWJH 2EA3A 1ZHPA 3ZZCA 1TOCB 1OP2A 4RKJB 1TA2A 2IJOB 2FX6A 1EAUA 1MZDA 2UUFB 3P8GA 4J2YB 1T31A 4BXSA 2WYJA 2VGCB 1DXWA 2PSYA 4XSKU 4Y71A 5EW1H 1GMCF 5AHGH 3RXHA 3UWIA 1ZOMA 1KXEA 3EA7A 4X2WA 1MMJN 3B23B 5JB9S 3M5OA 1S85A 2ZCLP 3BEUA 5J4QA 1C2FA 4NIXA 1YGCH 2LNCA 3KHVA 4A1VA 1C9PA 1DLEA 2GDEH 1Y5UT 4VGCC 2ZHQH 1GDQA 3O8CA 1Z8IB 3I29A 2RA3A 1CA0B 1HNEE 1LQEA 1IHSH 1AB9C 1HJAC 1OWKA 1Q31A 2F9OA 3FP6E 1TGTA 1GJ7B 3MWIU 3TK9A 3ZVGA 3LPRA 1GBCA 1C2DA 4D9RA 1SGEE 3A89A 1K28D 2ZHFH 2BX4A 1O3AA 4JCNA 2Z9GA 4YESB 3TIUA 1YPHC 2VIQA 1O31A 2F9UA 2FX4A 1G3EA 3TGJE 1O5FH 4ZKNU 1PPEE 3A85A 2EI6A 1HB0B 3UIRA 4WXVA 1TB6H 1SOZA 3VXFH 2FXRA 1K1LA 3BTDE 3F1SB 3Q3KA 1V2OT 2AERH 1GJBB 2GD4B 5BPEA 1GWAA 5C67A 1W10U 2QGRA 4NIWA 1V2WT 1KTTB 2TGTA 1ZPBA 2B0FA 4JZDH 1AU8A 1C1MA 3SO3A 2ZDVH 2SNVA 5JBCS 4DG4A 1RIWB 1XUHA 2B8OH 3P8OA 3T5FH 1ZMJA 3SV8A 3LT3A 1TPAE 1A4WH 2A45B 4K8YA 1ACBE 4AGKA 1Z8RA 1ZJKA 4GUXA 4OS1A 4DVAU 1DWCH 5DP7A 1HPGA 1HJ8A 1UTJA 1O5GH 4K8BA 4XOJA 5T6DA 3LGVA 1F0UA 3C27B 1O2KA 3ZV8A 1C2MA 1F0RA 1Y59T 1SLUB 1FXYA 2GP9B 1GBFA 2BDGA 3S9AA 1XUKA 1KLTA 1TX8A 1HXEH 1OP0A 5FPYA 2XWAA 2Q6FA 4B71A 4FUDA 1JRTA 3RMLH 3SGQE 1LHDH 1TFXA 1TPSA 2M5TA 3SQHE 4ZKSU 3TGIE 2AIPA 3HATH 1VITG 2G51A 5AF9H 5FCKA 2AGGX 2FDAA 1W7GH 1ORFA 4CHAB 3TK5A 3FFGA 9LPRA 1G3BA 1V6DA 1ZPCA 2NWNA 3GCHC 3ZVDA 2EI7A 1FY4A 1A0LA 5I46H 4BTTB 3ZVFA 1LPGB 1TPPA 1MD8A 3BTQE 2WUBA 3S7KB 3K65B 1GVKB 2A2QH 2A4GA 1TRMA 4IMQA 4Y79A 4H6SB 1YPHE 3F68H 2PV9B 4ZHMU 5T6FA 2J34A 1C2LA 1SGQE 4X1NU 2HRVA 3TJNA 2PKAA 1AFQC 3OYPA 2YNAA 4H42U 1MTNB 1P2QA 1Y3UA 4NZQA 2FOMB 5EXNA 2VVVA 2FMJA 3PLBA 1Y3YA 2AMPA 1TAWA 3UFAA 1O3PB 3EGKH 4ZAEA 5EQRA 2H9HA 2ZDMA 1EPTB 2GCTC 1DY8A 1YPMH 3HK6B 4MLFB 4WF8A 4UE7H 3M37A 1C5NH 4A7IB 1GVZA 1HXFH 4HFPB 4U32A 1Y5AT 1D3TB 1E0FD 1C5RA 2BVSH 1SGDE 3T27A 4TWWA 1H9LB 2ZU2A 2R0LA 1JIRA 2TIOA 4MVNA 2CMYA 2FLRH 2Z6BD 2Z9KA 4DY7B 1M9UA 1AUJA 3TLOA 3RP2A 1K1MA 2C3SA 2AMQA 2EC9H 3DA9B 3E91A 2VWMA 2Y5HA 2XCFA 1Y3VA 1DOJA 4CR9A 1ZSJA 4D7GA 2QAAA 4ABBA 4NSVA 4M7GA 2OC8A 3TU7H 2SNWA 5JYIA 3BTTE 1ELFA 1KXFA 2GZ9A 4CRFA 2FS9A 1RGQA 2R0KA 1P2NA 1S82A 3SU2A 2W7SA 5JPMH 3RXGA 1P06A 1CGJE 1D6WA 1KLIH 3SORA 5HM2A 4LZ4B 4B1TA 1EJMA 1C5UA 3URDA 4AN7A 3KF2A 1MBQA 2D2DA 2ZTYA 1E38B 1P2OA 4NFEA 1BBRK 1GL1A 3SNDA 3UQOA 1GI8B 3MH4A 4UFGH 4KP0A 1G3CA 4NCYA 2ZO3H 1SB1H 2Y6TA 1QY6A 1MBMA 1BRAA 1DVAH 4CBOA 1A0HB 1EQ9A 1YC0A 1W14U 3HKJB 1EP6A 4Z0KA 5L30H 2P16A 2NU4E 1BMLA 1F2SE 3V3MA 1BTPA 1TPOA 3LGYA 1HYLA 2W26A 4TPIZ 4ISNA 1IQIA 1MKWH 3RXUA 4DCDA 1TE0A 1O2XA 1CT2E 3LU9B 1N6YA 2SGDE 2VWNA 2ZQ2A 1GBMA 2HPPH 1WUNH 3RUOA 4K1SA 1SVPA 1CBWB 3SZNA 1YYY1 3T26A 2OTVA 2XYAA 2O8MA 1UTLM 5E8EH 3KQBA 1AKSA 4X2VA 1KXBA 1BHXB 1BBRH 2A0QB 2YOLA 1QNJA 1NS3A 3SJOA 4PROA 1TGSZ 5ESTE 1W11U 1BMNH 1O38A 3P8FA 1GI3A 3DT0H 1C4U2 1SBWA 3H7TA 2JETB 1LKBA 2R9PA 1JBUH 4D76A 5GJ4B 2ZFPH 3QN7A 2R3UA 4SGBE 1BA8B 1EB2A 2JKHA 3VGCC 5C3NA 3O8BA 4YLQH 1P05A 1NFWA 1JMOH 3M35A 2P59A 2PKAB 1SL3A 1LHGH 2O8LA 3EA9A 3SNCA 1BT7A 1AIXH 1WQVH 1O2SA 1MQ5A 2O8TA 2A2XH 4RSPA 3DUXH 1C1WH 2QF0A 4GHQA 2FI5E 3ATWA 3MI4A 1CGHA 2QXGA 1ELTA 4IN1A 2G4TA 1ZYOA 2BD5A 2Q6DA 3FZDA 1UTKA 2C4FH 1UVUH 2C8ZB 4U2WA 4AB8A 2G4UA 2ZDLA 5FPTA 3SBKA 3VB7A 1CGIE 1SOTA 2OC0A 2GX4A 5DP5A 3SUFA 5DP6A 1HAPH 1OYQA 3I77A 2BDCA 2FLBH 3E6PH 3M36A 4NZLA 1MD7A 1A0JA 1EOJA 2OQ5A 5EU8A 3RM2H 3RXDA 4B2AA 4CRBA 1C1UH 1RFNA 3NWUA 3UTUH 2GZ7A 3LGUA 3U8RH 1B0EA 1GHYH 4E7NA 3M5LA 4HZHA 1TRYA 8GCHF 3S0NA 1QJ1B 3EE0B 1K1NA 3M5MA 1FUJA 1O2QA 2ZC9H 3RXKA 2QXHA 1NO9H 2B5TB 1GBTA 4MNVA 3UNQA 3GY7A 1ZTKA 5EQSA 5F8ZA 1O3DA 4INKA 1UTMA 1D3PB 4Y7BA 1LHEH 4K2YA 2XCNA 3MOCA 4KTSA 1JXPA 2V0BA 1HAGE 1VCPA 2ZQ1A 1O32A 3ATLA 4UFFH 3URCA 4MPVA 5DO4H 2ZP0H 1HDTH 3QO6A 1ETTH 2F9PA 3JZ2B 1PYTC 2QC2A 1H8IH 4ABEA 3SQEE 1O3LA 2TGAA 4ABDA 1F5KU 1DUEA 2VIOA 2ANWA 3QWCH 4IN2A 1A46H 2J95A 1HBTH 3NKKA 3HKIB 1KDQB 1BQYA 1ARCA 1DE7H 4U01A 3PO1B 4JYTA 1INCA 1GMHG 1P2MA 3AAVA 1YLDA 1BJUA 4MNWA 1O2VA 6ESTA 4KTCA 4X6PA 1UK3A 2XC5A 3MO9A 3LDXH 4AORA 4FUEA 1XXFA 2R2MB 2Z9LA 2RG3A 1QTFA 1JIMA 2CJIA 1GBHA 4BAQB 1EZSC 3PROA 4ISLA 2STBE 3MO3A 4Y6DA 1THPB 2VGCC 3U9AH 1AWFH 1Q2WA 1AD8H 2ODQA 1ZZZA 2HGTH 1TNIA 1O5BB 3VB5A 1BMMH 3VB4A 1RS0A 1D4PB 1AKSB 3TH3H 2A1DB 1W2KH 1T8NA 1AE8H 3ZVBA 3U1JB 1RTLA 1AZZA 3AW0A 4Y76A 4Z6AH 1S83A 1CT0E 3Q76A 1K21H 2ZZUH 2ZFRH 2PUXB 4CR5A 3RXJA 1NU7B 1GMHF 4I8JA 1GI7B 2BHGA 2BDBA 2FM2A 1A3EH 2Z3DA 1ZGVA 4TYDA 4WH8A 2VVUA 1QRWA 1VR1H 1IQGA
chains in the Genus database with same CATH superfamily
1A61H 1FY8E 2H6MA 2GVFA 3H5CB 1C2IA 2ZFQH 3LGIA 3QGNB 1SQOA 3OEED 6CHAB 2L74A 4B6FA 1ELGA 4KGAA 4WY3A 5SGAE 1GHBG 4JZEH 4D9QA 1BTZA 4OS2A 2Q6GA 2ZKSA 1WAYB 5G4BA 1G2LA 2BB4A 1SGRE 3SOSA 1KTSB 3CS7A 2J94A 1EJNA 1G9IE 1CA8B 1F0TA 1TQ7B 1GBBA 3SGAE 4AG1A 1MTUA 4MDSA 2THFB 4MTBA 2ZECA 3TGKE 4TY7A 1H8HD 1J8AA 3RXCA 4YM9A 4B75A 1GJDB 1NRSH 5EXLA 3RXIA 2J5UA 1O3EA 1RIWC 5K7RA 1FPCH 1D6RA 1HAXB 1O30A 2H1UA 1A3BH 3UR6A 3ITIA 1IQMA 1VGCB 4X6NA 1EPTA 3H7OA 4AFSA 1C5XB 3ENSB 4OS5A 3HPTB 1BB0B 1FPHH 1O3CA 3QLPH 1BITA 1XUFA 2XBWA 3PB1E 1P11E 2VWLA 4XBDA 4DURA 1OX1A 1AVGH 1GHWH 1C4Y2 1MAXA 1GCTB 4Z1MD 1GG6B 1RD3B 1DWEH 2ZFTA 1GHBF 1V2PT 5BRRE 4YLUA 1HFDA 1S81A 3GY3A 1O2IA 1CT4E 3Q77A 3BN9A 3HGPA 2FOFA 4RKOB 1FV9A 1E1RD 2ODPA 1UMAH 5FXLA 4BTIB 1A7SA 3U8OH 2BDYA 3U8TH 4AFQA 4DIHH 1ZHRA 5C0UA 2FIRH 4HG6A 5FL7D 1MU6B 1N8OB 2OC1A 4UDWH 4GCHG 2FWWA 1U6QA 4M9FA 5CHAB 3BIVH 1TWXB 2CN0H 1QB6A 1L4DA 1C5MD 5CHBA 1O2RA 2G81E 3BEFB 1K2I1 2EEKA 2DE8A 3FZZA 2KR7A 3T25A 2BOHB 3MO6A 2ZU4A 5JBBS 3RMMH 3RU4T 4ASUD 1E35B 2ESTE 4Y7AA 1GHXH 2GMTC 2JH0D 1GI5A 1C4V2 1WBGB 5ETXA 1GBIA 3EA8A 3O8RA 2W7UA 1IQEA 3PMJA 1Z8GA 3ZVCA 1IQNA 5T3HA 3PLKA 1GJCB 3IG6B 3UAIC 1PPZA 3QZQA 2ZA5A 1C1OA 2A4QA 5FHTA 1P9UA 1FI8A 3AAUA 3HK3B 1IOEA 2PKSB 3BG4B 5TCCA 4TWYA 1UVTH 1TIOA 1ZTJA 3P8NA 2H9EH 3N7EA 4ACBA 2QXIA 3FAOA 4MG3A 2FO9A 3NRLA 1FLEE 3RU4D 4BAMB 3RLYH 2Z9JA 2FEQH 3MH6A 1TONA 2HNTC 1YPGH 2XC0A 1F92A 1C5TA 1PJPA 1SSXA 5FPSA 4MPXA 1P2IA 2F9VA 7ESTE 4ZXXH 5A8XA 1AVXA 3RC6A 1ZMNA 1OXGA 1GBEA 1HGTH 4I8GA 3A7TA 1C2EA 5L2YH 4FU9A 2ANKH 1MTSA 1ABJH 3A8CA 1MQ6A 3RXAA 2RCEA 2RDLA 4CRDA 1GJ4H 1Z1JA 1OKXA 2FYQA 3NXPA 5DJ7A 5C1UA 4RN6A 5AFZH 2V35A 3GISB 1TLDA 4X8UH 3C1KA 4OM9A 2UUYA 2P3TB 1FNIA 1ZGIA 1O33A 1FDPA 2PWXA 2TRMA 4WMEA 2TGDA 1XMNB 4AFZA 1NFYA 4FVDA 3V12A 1UTNA 4B74A 1FIZA 1S5SA 3F9EA 4NFFA 3IWMA 4ZKRU 4JZ1A 5GCHG 3ZZAA 1DSTA 2A7HA 1KSNA 4GLYA 2VWOA 1LHFH 2STAE 1V2KT 1YBWA 5C5NA 3GY6A 3KCGH 4MPUA 5JBTA 5H4IB 3GICB 4UFEH 4CRAA 1B7XB 2FI4E 1J16A 2QV1A 4SGAE 2NU0E 1JWTA 4XD7D 3EDXB 1LO6A 1D3QB 1HLTH 4Q7XA 1GGDC 2EY4C 1O3MA 4CREA 1FJSA 2BY9X 1JRSA 3OTJE 4VGCB 3JZ1B 3MQKC 1SHHB 1B5GH 1Y8TA 1C2GA 4AFUA 1GI6A 3SU0A 1NBME 1Q3XA 3BIUH 3QZRA 5E2PA 1QGFA 3SU6A 4TPYA 1C5OH 2ZCKP 4KKDA 1VITF 1V2QT 3ZVEA 5L6NH 1TMTH 2P94A 1A5HA 3KEEA 3QDZB 7GCHG 1A5GH 1OSSA 1G37A 1LTOA 2A4OA 1HUTH 2ALPA 4JYUH 4AB9A 1S0QA 3A7YA 1EZQA 1NRPH 2HNTE 1WSSH 2OXSA 1MU8B 5AFYH 1AWHB 4CH2B 2PGBB 2V3HH 1ZRKA 3EYDA 1MCTA 1YLNA 4AOQA 3OSYA 5GWZA 4NA8A 4DT7B 1O3KA 2GV6A 3OU0A 3RXOA 2LPRA 4MNYA 4WMFA 3RXTA 4Y8XA 3SHAH 1T7CA 3GDUA 2VJ1A 2ZTXA 2KCOA 1H1BA 1TQ0B 1NN6A 2A5KA 1YM0A 3RMOH 3GCOA 1FX0B 2H2ZA 2ANYA 1AVWA 1FAKH 1LMWB 4FUJA 1VZQH 5I25A 2TGPZ 4Y8YA 3P95A 2ZGJA 3TJOA 1TA6A 1TX7A 1H9HE 5GXPA 4F4OC 1IQHA 3F9GA 1E37B 2F9BH 2QXJA 3G01A 1WYKA 4BOHA 1O2HA 1FN8A 1MKWK 3F3BA 2ZU3A 2XBYA 7GCHF 4FUCA 3ZZ7A 1DICA 5TJXA 4BNRA 3L3TA 4D7FA 4F49A 1TBQH 2A7CA 3DSGA 3UNSA 1T32A 1YPLH 5EOKA 3NUMA 3EAJA 3E90B 4I86A 1DWBH 4O3TA 2G5VA 2ZFSA 1ZSKA 3FKSD 3SI4H 1LCYA 4X6MA 4ZROA 1T8LA 3L33A 1ANEA 1LVBA 2KCAA 1ID5H 4INHA 4A1XA 3V7TA 1H8ED 3UNRA 1BRUP 4Q7ZA 3A80A 1C2HA 2OINA 2O8UA 3WY8A 1FMGA 3GCHB 1BMAA 1OWDA 1KDQA 1WCZA 4OGYA 1OP8A 1ZJDA 4NWLA 2VIWA 3SJKA 4CH8B 2HOBA 2OK5A 1G32B 5E2OA 3P6ZB 1O5EH 1WTHD 2NU1E 4O97A 3SU4A 1MTWA 1TOMH 4X8TH 3U69H 1O3BA 3A8BA 4BAHB 1V2ST 5EQQA 3D62A 5KECA 1TGCA 1AQ7A 2WSSD 5IDKA 2BD3A 1QBVH 2C8YB 2ZU1A 3KQCA 1JOUB 1W0ZU 4GSOA 2H5DA 1QL7A 2ZPSA 1WQSA 3SU5A 4Y11E 4FUGA 4HTCH 3B8JA 2R3YA 2ZPQA 3NK8A 2GCTB 2EI8A 2VNTA 5DG6A 1AFEH 2SGFE 1O36A 3GYLB 3E0PB 4B2CA 1ZR0A 2R2WU 1EKBB 2VVCA 3PM3A 3PMHB 4ASHA 5FCRA 4DIIH 1QL9A 2UWLA 1C1NA 4K5ZA 1O3OA 1UHBA 1KYNA 3QTVH 3ZZ4A 1OWHA 2ZWLH 1KLJH 1TBZH 1OS8A 3A81A 1BCUH 3LGWA 2ZGCA 3TPIZ 1O3FA 2Y7ZA 1QBNA 1YP9A 1SGYE 1GPZA 4ISHH 1SR5C 2VH0A 4ISOA 1TNHA 2PGQB 1CU1A 3PRBA 3RXVA 3UR9A 1V2RT 2VH6A 4JZIA 1QIXB 2FZZA 2GGVB 3H09A 3MH7A 1ELEE 1O2PA 3PV4A 3ZZ3A 3OY5U 1C5YB 3PO1C 1NRRH 3AVZA 3RLWH 5JDUB 3SZEA 3MU4A 3T29A 4Q7YA 3SI3H 2WPHS 1KXDA 2P95A 1ZHMA 2QIQA 4P00A 3UREA 4X1PU 5A2MH 1C2JA 1UJ1A 4YOGA 4DGJA 3SNEA 1QCPA 3ODFA 4YOJA 1V2TT 1PQ8A 3QTOH 1XX9A 3RC5A 4RT1A 2D26C 1P04A 1EATA 1HJ9A 5PTPA 2ZFFH 3A82A 3P17H 4I31A 3LJJA 3KGPA 4YZUA 1XUGA 1Z1IA 3SUDA 2J2UA 2KFWA 2O8WA 1HAZB 4IBLH 5ESBA 2W5EA 3PMAB 4H4FA 2SGPE 4DT4A 1AUTC 4AX9H 1ARBA 2C93B 3ATIA 3ZZ8A 3GY4A 6GCHG 8KME2 2FESH 5LPRA 4AYVB 2J38A 1EAXA 2BOKA 5HIZA 3Q3XA 1O2WA 3M3SA 1E36B 3O8DA 1VJAU 3EQ0H 3LOXA 1GCDA 1QRZA 3BTHE 5T6GA 1NPMA 1QJ7B 2ZEBA 3LC5A 1HRTH 4UD9H 5FX5A 3LJOA 1AY6H 2HWLB 1Z6JH 2PSXA 3CS0A 2F9NA 5LGOA 1MCVA 3M61U 1IQKA 4CRCA 3VPKA 4FVBA 1FIWA 1MH0A 2Z3CA 7KMEH 1EX3A 2VU8E 4FUHA 1L1NA 2L6OA 3P92A 2FTLE 1Z6EA 4WWYA 4ABGA 2O9QA 1SI5H 1TMBH 3MNCA 4GAWA 2Y5GA 2ZHWH 1ESAA 2ZDKA 1NM6A 1BTHH 1ELDE 1SGFG 2BTCE 8ESTE 3MU5A 5ABWA 7LPRA 2V6NA 4U30A 1YPKH 2RA0A 1DWDH 1P3EA 2GTBA 3PWCA 3NCLA 4K60A 2J97A 1K9OE 5HGGA 1AI8H 4NSYA 3TH4H 2FOAA 1VGCC 4IW4E 4IGDA 1BZXE 3CENA 4OGXA 1IHTH 1GMDG 2UWPA 1SGTA 3E3TA 1L1JA 4UFDH 1YCPM 1GBJA 3BF6H 5HXFA 1EUFA 1V3XA 2ANMH 2YNBA 1O3JA 1C5QA 2G52A 2BD4A 1V2NT 1BRCE 1LKAA 1XKBC 1O34A 4WVPE 1GJ6A 3DHKH 3SUEA 3E16B 3GDVA 2QF5A 2G8TA 2V3MA 3ZVAA 3DSOA 4INLA 1W7XH 4HGCA 2KAIA 3GCTG 2BD9A 2ILNA 3MTYA 4BXWA 2ZTZA 3AASA 4XFQA 2ODYB 1LPZB 1MAYA 1O2OA 3BSQA 3FP7E 4X6OA 1C2KA 2WPJS 4Q80A 3RXEA 1P01A 2C8XB 1FY5A 1UHBB 2F4LA 3GYMA 3F9FA 5EPNA 2FTMA 1CA0C 4IS5A 2XTTB 1V2MT 5CHAC 2J92A 2BLOA 2FPZA 3GY2A 1IQFA 1NFXA 1O37A 1TNLA 1GMDF 4OS4A 1HAYB 1NROH 3KQDA 1OWIA 1WOFA 1GJAB 1OOKB 1DSUA 1UVPA 2AYWA 3SW2B 1C1QA 1S6HA 3TNSA 1SGNE 3SHCH 4MQAA 5KEDA 3UOPA 1BHXF 3UQVA 1O2NA 2AS9A 2FP7B 1NRQH 2CF8H 3BTME 3KNXA 5LPFA 3BTEE 3RDZA 2SGEE 2YMSB 4XBBA 1EAWA 1IQJA 1ANCA 3MHWU 4WH6A 3VEQB 1BOQA 3LONA 2XNIA 3Q3YA 4X2XA 2RDEA 3A8DA 3SV9A 1G2MA 1X7AC 1C1PA 2AH4X 2AMDA 1D9IA 1NC6A 2BVXH 2BYAX 1COWD 1O2LA 1DANH 1ZLRA 2PTCE 1ETRH 2QA9E 1DUAA 2J98A 3BTWE 2Y5FA 4B76A 4O3UA 2HVXA 1DITH 2OQUA 3MFJA 1GMCG 1D3DB 2BY7X 2Z9IA 1V2VT 2DE9A 2VB0A 5JBAS 1OPHB 3TITA 1ETSH 2OD3B 3OFND 4LK4A 1TABE 4QT8C 3BTFE 1EJAA 1YLCA 4IMZA 3S7HB 1P57B 4ZH8A 4JK6A 3TNTA 3A7VA 2CXVA 1SGCA 4F48B 1DFPA 2VIVA 3FVFB 2AEIH 1C1SA 4GHTA 3KL6A 1AZ8A 2A5IA 3SJ8A 3OAAD 3R3GB 4CHAC 3PRDA 1GVLA 3SUGA 1QB1A 4JZFH 1UTQA 1TGNA 1EB1H 2W3KA 1F7ZA 2GZ8A 2H5CA 1BTYA 3ATKA 1GHAG 3PYHA 3RC4A 1PFXC 2BY8X 2D8WA 4WXIA 4AZ2B 3SV7A 3B9FH 1HAOH 1YPJH 4YXWD 3A84A 2A32A 3MYWA 1OYTH 2FOGA 1AN1E 1O5CB 1YCPK 1GI2A 3M5NA 2CF9H 3TVJB 1ZSLA 3A7XA 3OX7U 4H6TA 2I6SA 3ELAH 1SLVB 1A1RA 3NPSA 1DPOA 5E0HA 1BTWA 1GHZA 4ABIA 4E05H 3GY5A 1O0DH 2BZ6H 1CE5A 1ESTA 1IAUA 5FBEA 4XRNA 1BBRE 1UVOA 3MMGA 3TJUA 4B6EA 1W0JD 1MTNC 3VFEA 1O2JA 5A8ZA 1RRKA 2JIZD 4A92A 1N1LA 1ANBA 2FOEA 1TNGA 3SJIA 2NU3E 1AMHA 4YOIA 1P3CA 1QBOA 1UO6A 1EPTC 5DP9A 1BRBE 2BD8A 2KX4A 1GL0E 1Z71A 2PLXA 2XBXA 5DN6D 2P8OB 4K3JA 2SGQE 5GDSH 5F8XA 1EASA 5K0HA 1DX5M 2P3UB 1GHAF 2CHAB 3A8AA 1GDNA 1HV7A 1P10A 3V13A 4NA9H 2ZHDA 1HAIH 2KCPA 1UVSH 4GCHF 1K1OA 1QA0A 1SGFA 1WU1A 3RXBA 3ATMA 4FU8A 1FY1A 2PTNA 2BQWB 3AW1A 1H4WA 2IPQX 2PHBA 5GIBA 2QF3A 1DM4B 1LDTT 4NG9H 3A83A 2QF4A 1YCPH 3RXSA 3K6ZA 1F0SA 2KAIB 1OWEA 1WXRA 2WV4A 1GI0A 3S69A 1SHYA 1O2MA 2ZGBH 4ZXYH 1O2UA 2FOHA 4FUFA 3ZZBA 3E1XB 5LPEA 4X0WU 1EOLA 3F2FA 2YMSD 2D1JA 3SV6A 2Z7FE 1V2UT 1PQ5A 2ZG0H 3MNXA 1NESE 4XBCA 4CRGA 2BXUH 4ESTE 5B6LA 4ISIH 4O9VA 2F3CE 8LPRA 5HYOA 4ZKOU 1MZAA 4X8VH 3GOVB 1FN6A 1KY9A 1Y3XA 2OC7A 3KIDU 1DDJA 1Z7KA 1NFUA 4JYVH 3L6PA 4B2BA 4LOYH 5C2ZA 2WYGA 1PYTD 4FXGH 1HAVA 2VIDA 2BM2A 1A2CH 2TBSA 1TRNA 1KIGH 1TBRH 5DPAA 1C5SA 2SGAA 1PPFE 2BX3A 3PMBB 5F6MA 2BDHA 1QL8A 2CV3A 5EXMA 3W95A 1C5LH 3ESTA 1SGPE 2P3FH 4ZUHA 3U98H 1P02A 1ESBA 3WW7A 1AB9B 1HJAB 1ELAA 2J98B 3D23A 1GBLA 1BUIA 5JB8S 1HIAA 3D65E 2XNDD 3SGBE 4I8LA 4ACAA 5A8YA 4MPWA 1GJ5H 4I7YH 5EIYA 5DGJA 1XKAC 5F03A 2GMTB 5GCHF 4AG2A 1ZRBA 3LGTA 1WV7H 1FAXA 1SQTA 5CE1A 3SU3A 9ESTA 1CBWC 2IJD1 4J1YA 3ZYDA 3TJVA 3T2NA 4ABJA 4BANB 1A5IA 1TX6A 2IN2A 3QUMP 1C5WB 1XM1A 2BDAA 5FX6A 3MNBA 1GBKA 5J4SA 1O3GA 1WTGH 3AK5A 1QR3E 2BQ7B 1DS2E 1FONA 3RXLA 3TH2H 1SQRA 3MU0A 4E7RG 5L2ZH 1GHVH 1CVWH 2F83A 2ZPRA 2FOCA 1LVOA 4LZ1H 4JMYA 2LELA 1SLWB 2JETC 3UY9A 3BTKE 2QYIA 3SNBA 1SFIA 4FUBA 1YKTA 2ZGHA 1VITH 2EQNA 2BLVA 4KELA 1P03A 2VINA 1P9SA 1SFQB 3Q00A 3ZYEA 5EG4A 1GI1A 2AIQA 1ELVA 1NRNH 1GBAA 3A87A 1P2JA 3BV9B 2UUJB 4JK5A 5C5OA 3RXMA 4ZHLU 2HVYB 1RXPA 2PP6A 1SGIB 5C94A 2FI3E 3BTGE 3RMNH 3F9HA 1VKYA 5HMAA 4HI3A 3R0FA 1T4UH 4ZHAA 2JH5D 2ASUB 3GCNA 4B73A 3RXFA 3FOAA 4YT6H 1T4VH 1UCYE 1W0YH 4Y8ZA 4ZCNA 3FP8E 1KXCA 4K1TA 1THSH 4X1RU 3PLPA 4YTAA 1O2ZA 4IC6A 1PQ7A 2QN5T 1S84A 2KM0A 3LC3A 5LH8A 4R8TB 2HLCA 2AFQB 2A7JA 5C0TA 2BZAA 1AE5A 2HALA 2W6ID 3F0OA 3DFLA 3MU8A 2JH6D 4DOQA 2J9NA 1AGJA 1AHTH 3KQEA 1GI4A 1C9TA 3P70B 3F2HA 2XOKD 4A5TS 1FY3A 1PPCE 3W94A 5EODA 1CO7E 1GGDB 3EE7A 1AFQB 2OUAA 3ODDA 1GDUA 2ALVA 4FU7A 3A7ZA 2ZGXH 3CNRA 3T28A 4BTUB 2SFAA 2BVRH 1QQ4A 2AGEX 4GPGA 1ELCA 1Z8JB 2ZIQH 1E34B 4Y0YE 1RJXB 4NGAH 1QB9A 2OBOA 3RXQA 3N7DA 1XVMA 3E0NB 1MKXK 4D8NA 1THRH 1BIOA 1BTUA 3SN8A 1H9IE 4IC5A 1GJ8B 4AYYB 1UTOA 5GPIB 3OY6U 1W13U 3N7OA 2W6JD 2VBCA 1NTPA 1XVOA 3M7TA 5DP3A 1K1JA 2BQ6B 4CBNA 1YF4A 2NU2E 1G3DA 1H8DH 1O2YA 1LQDB 1C5ZB 1ANDA 3LIWA 2VIPA 1J17T 5AVDA 4ABHA 2C90B 1DT2A 2FS8A 1TNJA 1TMUH 5EGMA 1HAVB 1VCWA 3PTBA 1KMHB 1K22H 2FOBA 1TGBA 2BY5X 3PTNA 1C1TA 4ABFA 2A5AA 2OBQA 1AO5A 1HAHH 1DY9A 5TCAA 2GCHG 4UEHH 1L4ZA 2ZDNA 2WPIS 1YPEH 2PW8H 2K1QA 5KGOA 1NBMD 1SG8B 1GI9B 1HIAB 1QQUA 1FZZA 1MKXH 1P0SH 2WINI 3BG8A 4TY6A 2BLQA 5E0JA 5DSFA 1S6LA 1B0FA 2V7QD 2ZI2H 3ZZ9A 4XDEA 3TK6A 5EJZA 8GCHG 1DLKB 1IQLA 2WV5A 4K69A 4Y0ZE 3MNSA 2XWBI 2XRCA 2FYRA 1T8OA 2BXTH 3WWFA 1NY22 3ZZ5A 2G00A 5F8TA 1N6XA 3UPEA 1K1PA 1UK2A 2WPLS 1O3NA 2OLGA 2PFEA 2GCHF 3D49H 1W3CA 2OP9A 3ZZDA 3QK1A 1SQAA 2CGAA 1YWUA 1W12U 1BDAA 3V0XA 2C8WB 4BAOB 1UK4A 5C1YA 5FAHA 1L0ZA 5C20A 5IYTA 3S9CA 1K1IA 4YO9A 2IOTA 3OEHD 2F91A 1YY3A 2CK3D 2QCYA 1V2LT 1C1VH 2B7DH 3IITA 1EFRD 1LHCH 3BEIB 3A7WA 2BY6X 5A0CA 1UW7A 3VXEH 2GDDA 4WMDA 6CHAC 1P12E 2Z94A 1C5PA 4NIYA 1KXAA 4Q2KA 5A0BA 5EPYA 1XUIA 3M7UA 1GBDA 3ZZ6A 4A1TA 1FQ3A 4FETA 1XXDA 4BAKB 5IK2D 2HNTF 1C5VA 1BTXA 3FO8D 2J4IA 3K9XB 2H9TH 3DD2H 1CQQA 4R0IA 1W8BH 3SV2H 2BMGB 3GDSA 2HPQH 4LXBH 1NT1A 4GVUA 2XC4A 6GCHF 3M3VA 4A6LA 2QE7D 1ZPZA 4X8SH 5CMXH 1UTPA 3KN2A 2G5NA 2GKVE 4X1SU 4Y10E 2JDID 1TNKA 5DKMA 5C1XA 1QA7A 4I8HA 3HGNA 4O03A 3RM0H 1G36A 3VGCB 3NZIA 2QY0B 2IPHA 1O3HA 5B6OA 4AGJA 2ULLA 1O5DH 4MNXA 2P93A 2XW9A 3A88A 1P8VC 1EAIA 1S6FA 1UCYK 2PUQH 1ZTLA 1RTFB 1GCTC 3CP7A 5DP4A 3A86A 1GG6C 5E0GA 3PWBA 1J15A 1TYNA 3M3TA 1SC8U 1RTKA 2ZCHP 3GY8A 2V3OH 1NU9A 1VCQA 5A09A 1S0RA 3RU4E 3U1IB 3S9BA 1XUJA 1OWJA 1O3IA 4WJG2 4X1QU 1LPKB 3STIA 4DW2U 4YT7H 3SJ9A 5DP8A 3RXRA 1V2JT 3UUZA 2WHXA 1PPHE 1O5AB 4KTUA 1N8OC 5HM9A 2BD2A 3QX5H 3F6UH 4ABAA 1QFKH 2Y81A 4OS7A 1O39A 1MUEB 4X2YA 2GV7A 2G55A 1J9CH 1ABIH 2Z3EA 2A4RA 2OCVB 4TT3D 3F2GA 4NA7A 4DJZB 1F5LA 1QRXA 3LH3A 1T8MA 2WPKS 1VJ9U 1GJ9B 1SPJA 2GT7A 1EZUC 1O2TA 1CHGA 1F5RA 1ELBA 3ZV9A 1EP5A 1UCYH 2A31A 2Q1JA 2Y7XA 3LH1A 1CHOG 1C1RA 4NWKA 3GCTF 3UOUA 1J14A 2B9LA 2PKSC 2ZDAH 3BG4C 1HCGA 1LVYA 4I32A 2I6QA 2P8OC 4XE4A 1PPGE 1P09A 2DUCA 3I78A 1EXFA 1G30B 2PR3A 2UUKB 2Y80A 1P2KA 2CHAC 5DK1A 1QURH 1CSOE 1PQAA 3DFJA 3MU1A 2ZF0H 1MTVA 1SLXB 1QJ6B 2WUCA 3RXPA 2BLWA 3E8LA 4UONA 1Y3WA 3K2UA 2BDIA 3QGJA 4I8KA 3SNAA 2Y82A 5CDFE 2ZU5A 2LP6A 2UWOA 4I33A 3VB3A 2ZHEH 1L2EA 2XXLA 4OS6A 1Y5BT 3KQ5A 2BD7A 3VB6A 3T62A 3DSPA 1BJVA 1L1GA 1DXPA 3LKWA 1EZXC 1LVMA 2XBVA 2FODA 2ZNKH 4ZMAH 1TALA 1PPBH 4NIVA 4E06H 1NZQH 1O2GH 2W3IA 3STJA 4K1EA 3SU1A 4THNH 1ZMLA 5FBIA 5EW2H 6LPRA 5HIYA 4FUIA 1QHRB 2AGIX 3M7QA 2TPIZ 3FANA 1CHOF 1O35A 5A0AE 1SMFE 2WPMS 3K6YA 2GT8A 3MH5A 3UWJH 2EA3A 1K0HA 1ZHPA 3ZZCA 1TOCB 1OP2A 4RKJB 1TA2A 2IJOB 2FX6A 1EAUA 1MZDA 2UUFB 3P8GA 2KZ4A 4J2YB 2WPDD 1T31A 4BXSA 2WYJA 3OE7D 2VGCB 1DXWA 2PSYA 4XSKU 4Y71A 5EW1H 1GMCF 5AHGH 3RXHA 3UWIA 1ZOMA 1KXEA 3EA7A 4X2WA 1MMJN 3B23B 5JB9S 3M5OA 1S85A 2ZCLP 3BEUA 5J4QA 1C2FA 4NIXA 1YGCH 2LNCA 3KHVA 4A1VA 1C9PA 1DLEA 2GDEH 1Y5UT 4VGCC 2ZHQH 1GDQA 3O8CA 1Z8IB 1E79D 3I29A 2RA3A 1CA0B 1HNEE 1LQEA 1IHSH 1AB9C 1HJAC 1OWKA 1Q31A 2F9OA 3FP6E 1TGTA 1GJ7B 3MWIU 3TK9A 3U28C 3ZVGA 3LPRA 1GBCA 1C2DA 4D9RA 1SGEE 3A89A 1K28D 2ZHFH 2BX4A 1O3AA 4JCNA 2Z9GA 4YESB 3TIUA 1YPHC 4RI0A 2VIQA 1O31A 2F9UA 1E1QD 2FX4A 1G3EA 3TGJE 1O5FH 4ZKNU 1PPEE 3A85A 2EI6A 1HB0B 3UIRA 4WXVA 1TB6H 1SOZA 3VXFH 2FXRA 1K1LA 3BTDE 3F1SB 3Q3KA 1V2OT 2AERH 1GJBB 2GD4B 4P02A 1GWAA 5BPEA 5C67A 1W10U 2QGRA 4NIWA 1V2WT 1KTTB 2TGTA 1ZPBA 2B0FA 4JZDH 1AU8A 1C1MA 3SO3A 2ZDVH 2SNVA 5JBCS 4DG4A 1RIWB 1XUHA 2B8OH 3P8OA 3T5FH 1ZMJA 3SV8A 3LT3A 1TPAE 1A4WH 2A45B 4K8YA 1ACBE 4AGKA 1Z8RA 1ZJKA 4GUXA 4OS1A 4DVAU 1DWCH 5DP7A 1HPGA 1HJ8A 2K8IA 1UTJA 1O5GH 4K8BA 1SKYE 4XOJA 5T6DA 3LGVA 1F0UA 3C27B 1O2KA 3ZV8A 1C2MA 1F0RA 1Y59T 1SLUB 1FXYA 2GP9B 1GBFA 2BDGA 3S9AA 1XUKA 1KLTA 1TX8A 1HXEH 1OP0A 5FPYA 2XWAA 2Q6FA 4B71A 4FUDA 1JRTA 3RMLH 3SGQE 1LHDH 1TFXA 1TPSA 2M5TA 3SQHE 4ZKSU 3TGIE 2AIPA 3HATH 1VITG 2G51A 5AF9H 5FCKA 2AGGX 2FDAA 1W7GH 1ORFA 4CHAB 3TK5A 3FFGA 9LPRA 1G3BA 1V6DA 1ZPCA 2NWNA 3GCHC 3ZVDA 2EI7A 1FY4A 1A0LA 3FN8A 5I46H 4BTTB 3ZVFA 1LPGB 1TPPA 1MD8A 3BTQE 2WUBA 3S7KB 3K65B 1GVKB 2A2QH 2A4GA 1TRMA 5C17A 4IMQA 4Y79A 4H6SB 1YPHE 3F68H 3GS9A 2PV9B 4ZHMU 5T6FA 2J34A 1C2LA 1SGQE 4X1NU 2HRVA 3TJNA 2PKAA 1AFQC 3OYPA 2YNAA 4H42U 1MTNB 1P2QA 1Y3UA 4NZQA 2FOMB 5EXNA 2VVVA 2FMJA 3PLBA 5T1VA 1Y3YA 2AMPA 1TAWA 3UFAA 1O3PB 3EGKH 3ZIAD 2RFKC 4FOUC 4ZAEA 5EQRA 2H9HA 2ZDMA 1EPTB 2GCTC 1DY8A 1YPMH 3HK6B 4MLFB 4WF8A 4UE7H 3M37A 1C5NH 4A7IB 4AC9A 1GVZA 1HXFH 4HFPB 4U32A 1Y5AT 1D3TB 1E0FD 3VG8A 1C5RA 2BVSH 1SGDE 3T27A 4TWWA 1H9LB 2ZU2A 2R0LA 1JIRA 2TIOA 4MVNA 2CMYA 2FLRH 2Z6BD 2Z9KA 4DY7B 4F55A 1M9UA 1AUJA 3SYJA 2K0QA 3TLOA 3RP2A 1K1MA 2JJ2D 2C3SA 1W0KD 2M2AA 2AMQA 4Q4LA 2EC9H 3DA9B 3PV5A 3E91A 2VWMA 2Y5HA 2XCFA 1Y3VA 1DOJA 4CR9A 1ZSJA 4D7GA 2QAAA 4ABBA 4NSVA 4M7GA 2OC8A 3TU7H 2SNWA 5JYIA 3BTTE 5GNDA 1ELFA 1KXFA 2GZ9A 4CRFA 2FS9A 1RGQA 2R0KA 1P2NA 1MABB 1S82A 3SU2A 2W7SA 5JPMH 3RXGA 1P06A 1CGJE 1D6WA 1KLIH 3SORA 5HM2A 4LZ4B 4B1TA 1EJMA 1C5UA 3URDA 3W1EA 4AN7A 3KF2A 1MBQA 2D2DA 2ZTYA 1E38B 1P2OA 4NFEA 1BBRK 1GL1A 3SNDA 3UQOA 1GI8B 3MH4A 4UFGH 4KP0A 1G3CA 4NCYA 2ZO3H 1SB1H 2F43B 2Y6TA 1QZ8A 1WDIA 1QY6A 1MBMA 1BRAA 1DVAH 4CBOA 1A0HB 1EQ9A 1YC0A 1W14U 3HKJB 1EP6A 4Z0KA 5L30H 2P16A 2NU4E 1BMLA 1F2SE 3V3MA 1BTPA 1TPOA 3LGYA 1HYLA 2W26A 4TPIZ 4ISNA 1IQIA 1MKWH 3RXUA 4DCDA 1TE0A 1O2XA 1CT2E 3LU9B 1N6YA 1OHHD 2SGDE 2VWNA 2ZQ2A 1GBMA 2HPPH 1WUNH 3RUOA 4K1SA 1SVPA 1CBWB 2HLDD 3SZNA 1YYY1 3T26A 2OTVA 2XYAA 2O8MA 1UTLM 5E8EH 3N99A 3KQBA 1AKSA 4X2VA 1KXBA 1BHXB 1BBRH 2A0QB 2YOLA 1QNJA 1NS3A 3SJOA 3DCLA 4PROA 1TGSZ 5EJLA 5ESTE 1W11U 1BMNH 1O38A 3P8FA 1GI3A 2GJGA 3DT0H 1C4U2 1SBWA 3H7TA 2JETB 1LKBA 2R9PA 1JBUH 4D76A 5GJ4B 2ZFPH 3QN7A 2R3UA 4SGBE 5HKKD 1BA8B 1EB2A 2JKHA 3VGCC 5C3NA 3O8BA 4YLQH 1P05A 1NFWA 1JMOH 3M35A 2P59A 2PKAB 1SL3A 1LHGH 2O8LA 3EA9A 3SNCA 1BT7A 1AIXH 1WQVH 1O2SA 1MQ5A 2O8TA 3F0PA 2A2XH 4RT0A 4RSPA 3DUXH 1C1WH 2QF0A 4GHQA 2FI5E 3ATWA 3MI4A 1CGHA 2QXGA 1ELTA 4IN1A 2G4TA 1ZYOA 2BD5A 2Q6DA 3FZDA 1UTKA 2C4FH 1UVUH 2C8ZB 4U2WA 3WWBA 4AB8A 2G4UA 2ZDLA 5FPTA 3SBKA 3VB7A 1CGIE 1SOTA 2OC0A 2GX4A 5DP5A 3SUFA 5DP6A 1HAPH 1OYQA 3I77A 2BDCA 2FLBH 3E6PH 3M36A 4NZLA 1MD7A 1A0JA 1EOJA 2OQ5A 5EU8A 3RM2H 3RXDA 4B2AA 2JJ1D 4CRBA 1C1UH 1RFNA 3NWUA 3UTUH 2GZ7A 3LGUA 3U8RH 1B0EA 1GHYH 4E7NA 3M5LA 4HZHA 2YMSC 1TRYA 8GCHF 5F53A 3S0NA 1QJ1B 3EE0B 1K1NA 3M5MA 2WV9A 1FUJA 1O2QA 2ZC9H 3RXKA 2QXHA 1NO9H 2B5TB 1GBTA 4MNVA 3UNQA 3GY7A 1ZTKA 5EQSA 5F8ZA 1O3DA 4INKA 1UTMA 1D3PB 4Y7BA 1LHEH 4K2YA 2XCNA 3MOCA 4KTSA 1JXPA 2V0BA 1HAGE 1VCPA 2ZQ1A 1O32A 3ATLA 4UFFH 3URCA 4MPVA 5DO4H 2ZP0H 1HDTH 3QO6A 1ETTH 2F9PA 3JZ2B 1PYTC 2QC2A 1H8IH 4ABEA 3SQEE 1O3LA 2TGAA 4ABDA 1F5KU 1DUEA 2VIOA 2ANWA 3QWCH 4IN2A 1A46H 2J95A 3OTPA 1HBTH 3NKKA 3HKIB 1KDQB 1BQYA 1ARCA 1DE7H 4U01A 3PO1B 4JYTA 1INCA 1GMHG 1P2MA 3AAVA 1YLDA 1BJUA 3KYGA 4MNWA 1O2VA 6ESTA 4Q63A 4KTCA 4X6PA 1BMFD 2WZQA 1UK3A 2XC5A 3MO9A 3LDXH 4AORA 4FUEA 1XXFA 2R2MB 2Z9LA 2RG3A 1QTFA 1JIMA 2CJIA 3PV2A 1GBHA 4BAQB 1EZSC 3KYFA 3PROA 4ISLA 2STBE 3MO3A 4Y6DA 1THPB 2VGCC 3U9AH 1AWFH 1Q2WA 1AD8H 2ODQA 1ZZZA 2KCYA 2HGTH 1TNIA 1O5BB 3VB5A 1BMMH 3VB4A 1RS0A 1D4PB 1AKSB 3TH3H 2A1DB 1W2KH 1T8NA 1AE8H 3ZVBA 3U1JB 1RTLA 3UB0A 1AZZA 2AHME 3AW0A 4Y76A 4Z6AH 1S83A 1CT0E 3Q76A 1K21H 2ZZUH 2ZFRH 2PUXB 4TSFD 4CR5A 3RXJA 1NU7B 5EJ1A 1GMHF 4I8JA 1GI7B 2BHGA 2BDBA 2FM2A 1A3EH 2Z3DA 1ZGVA 4TYDA 4WH8A 2VVUA 1QRWA 1VR1H 1IQGA
chains in the Genus database with same CATH topology
1A61H 1FY8E 2H6MA 2GVFA 3H5CB 1C2IA 2ZFQH 3LGIA 3QGNB 1SQOA 6CHAB 1ELGA 4KGAA 4WY3A 5SGAE 1GHBG 4JZEH 4D9QA 1BTZA 4OS2A 2Q6GA 2ZKSA 1WAYB 5G4BA 1G2LA 2BB4A 1SGRE 3SOSA 1KTSB 3CS7A 2J94A 1EJNA 1G9IE 1CA8B 1F0TA 1TQ7B 1GBBA 3SGAE 4AG1A 1MTUA 4MDSA 2THFB 4MTBA 2ZECA 3TGKE 4TY7A 1J8AA 3RXCA 4YM9A 4B75A 1GJDB 1NRSH 5EXLA 3RXIA 1O3EA 1RIWC 5K7RA 1FPCH 1D6RA 1HAXB 1O30A 2H1UA 1A3BH 3UR6A 3ITIA 1IQMA 1VGCB 4X6NA 1EPTA 3H7OA 4AFSA 1C5XB 3ENSB 4OS5A 3HPTB 1BB0B 1FPHH 1O3CA 3QLPH 1BITA 1XUFA 2XBWA 3PB1E 1P11E 2VWLA 4XBDA 4DURA 1OX1A 1AVGH 1GHWH 1C4Y2 1MAXA 1GCTB 1GG6B 1RD3B 1DWEH 2ZFTA 1GHBF 1V2PT 5BRRE 4YLUA 1HFDA 1S81A 3GY3A 1O2IA 1CT4E 3Q77A 3BN9A 3HGPA 2FOFA 4RKOB 1FV9A 2ODPA 5FXLA 1UMAH 4BTIB 1A7SA 3U8OH 2BDYA 3U8TH 4AFQA 4DIHH 1ZHRA 2FIRH 1MU6B 1N8OB 2OC1A 4UDWH 4GCHG 2FWWA 1U6QA 5CHAB 3BIVH 1TWXB 2CN0H 1QB6A 1L4DA 1C5MD 1O2RA 2G81E 3BEFB 1K2I1 2EEKA 2DE8A 3FZZA 3T25A 2BOHB 3MO6A 2ZU4A 5JBBS 3RMMH 3RU4T 1E35B 2ESTE 4Y7AA 1GHXH 2GMTC 2JH0D 1GI5A 1C4V2 1WBGB 5ETXA 1GBIA 3EA8A 3O8RA 2W7UA 1IQEA 3PMJA 1Z8GA 3ZVCA 1IQNA 5T3HA 3PLKA 1GJCB 3IG6B 1PPZA 3QZQA 2ZA5A 1C1OA 2A4QA 5FHTA 1P9UA 1FI8A 3AAUA 3HK3B 1IOEA 2PKSB 3BG4B 5TCCA 4TWYA 1UVTH 1TIOA 1ZTJA 3P8NA 2H9EH 2QXIA 3FAOA 4MG3A 2FO9A 1FLEE 3RU4D 4BAMB 3RLYH 2Z9JA 2FEQH 3MH6A 1TONA 2HNTC 1YPGH 2XC0A 1F92A 1C5TA 1PJPA 1SSXA 5FPSA 4MPXA 1P2IA 2F9VA 7ESTE 4ZXXH 5A8XA 1AVXA 3RC6A 1ZMNA 1OXGA 1GBEA 1HGTH 4I8GA 3A7TA 1C2EA 5L2YH 4FU9A 2ANKH 1MTSA 1ABJH 3A8CA 1MQ6A 3RXAA 2RCEA 2RDLA 4CRDA 1GJ4H 1Z1JA 1OKXA 2FYQA 3NXPA 5DJ7A 5C1UA 4RN6A 5AFZH 2V35A 3GISB 1TLDA 4X8UH 3C1KA 2UUYA 2P3TB 1FNIA 1ZGIA 1O33A 1FDPA 2PWXA 2TRMA 4WMEA 2TGDA 1XMNB 4AFZA 1NFYA 4FVDA 3V12A 1UTNA 4B74A 1FIZA 1S5SA 3F9EA 4NFFA 3IWMA 4ZKRU 4JZ1A 5GCHG 3ZZAA 1DSTA 2A7HA 1KSNA 4GLYA 2VWOA 1LHFH 2STAE 1V2KT 1YBWA 5C5NA 3GY6A 3KCGH 4MPUA 5JBTA 5H4IB 3GICB 4UFEH 4CRAA 1B7XB 2FI4E 1J16A 2QV1A 4SGAE 2NU0E 1JWTA 3EDXB 1LO6A 1D3QB 1HLTH 4Q7XA 1GGDC 1O3MA 4CREA 1FJSA 2BY9X 1JRSA 3OTJE 4VGCB 3JZ1B 1SHHB 1B5GH 1Y8TA 1C2GA 4AFUA 1GI6A 3SU0A 1Q3XA 3BIUH 3QZRA 5E2PA 1QGFA 3SU6A 4TPYA 1C5OH 2ZCKP 4KKDA 1VITF 1V2QT 3ZVEA 5L6NH 1TMTH 2P94A 1A5HA 3KEEA 3QDZB 7GCHG 1A5GH 1OSSA 1G37A 1LTOA 2A4OA 1HUTH 2ALPA 4JYUH 4AB9A 1S0QA 3A7YA 1EZQA 1NRPH 2HNTE 1WSSH 2OXSA 1MU8B 5AFYH 1AWHB 4CH2B 2PGBB 2V3HH 1ZRKA 3EYDA 1MCTA 4AOQA 3OSYA 5GWZA 4NA8A 4DT7B 1O3KA 2GV6A 3OU0A 3RXOA 2LPRA 4MNYA 4WMFA 3RXTA 4Y8XA 3SHAH 1T7CA 3GDUA 2VJ1A 2ZTXA 1H1BA 1TQ0B 1NN6A 2A5KA 1YM0A 3RMOH 3GCOA 2H2ZA 2ANYA 1AVWA 1FAKH 1LMWB 4FUJA 1VZQH 5I25A 2TGPZ 4Y8YA 3P95A 2ZGJA 3TJOA 1TA6A 1TX7A 1H9HE 5GXPA 4F4OC 1IQHA 3F9GA 1E37B 2F9BH 2QXJA 3G01A 1WYKA 4BOHA 1O2HA 1FN8A 1MKWK 2ZU3A 2XBYA 7GCHF 4FUCA 3ZZ7A 1DICA 5TJXA 4BNRA 3L3TA 4D7FA 4F49A 1TBQH 2A7CA 3UNSA 1T32A 1YPLH 5EOKA 3NUMA 3EAJA 3E90B 1DWBH 4O3TA 2G5VA 2ZFSA 1ZSKA 3SI4H 1LCYA 4X6MA 4ZROA 1T8LA 3L33A 1ANEA 1LVBA 1ID5H 4INHA 4A1XA 3V7TA 3UNRA 1BRUP 4Q7ZA 3A80A 1C2HA 2OINA 2O8UA 3WY8A 1FMGA 3GCHB 1BMAA 1OWDA 1KDQA 1WCZA 4OGYA 1OP8A 1ZJDA 4NWLA 2VIWA 3SJKA 4CH8B 2HOBA 1G32B 5E2OA 3P6ZB 1O5EH 1WTHD 2NU1E 4O97A 3SU4A 1MTWA 1TOMH 4X8TH 3U69H 1O3BA 3A8BA 4BAHB 1V2ST 5EQQA 3D62A 1TGCA 1AQ7A 5IDKA 2BD3A 1QBVH 2C8YB 2ZU1A 3KQCA 1JOUB 1W0ZU 4GSOA 2H5DA 1QL7A 2ZPSA 1WQSA 3SU5A 4Y11E 4FUGA 4HTCH 3B8JA 2R3YA 2ZPQA 3NK8A 2GCTB 2EI8A 2VNTA 5DG6A 1AFEH 2SGFE 1O36A 3GYLB 3E0PB 4B2CA 1ZR0A 2R2WU 1EKBB 2VVCA 3PM3A 3PMHB 4ASHA 5FCRA 4DIIH 1QL9A 2UWLA 1C1NA 4K5ZA 1O3OA 1UHBA 1KYNA 3QTVH 3ZZ4A 1OWHA 2ZWLH 1KLJH 1TBZH 1OS8A 3A81A 1BCUH 3LGWA 2ZGCA 3TPIZ 1O3FA 2Y7ZA 1QBNA 1YP9A 1SGYE 1GPZA 4ISHH 1SR5C 2VH0A 4ISOA 1TNHA 2PGQB 1CU1A 3RXVA 3UR9A 1V2RT 2VH6A 4JZIA 1QIXB 2FZZA 2GGVB 3MH7A 1ELEE 1O2PA 3PV4A 3ZZ3A 3OY5U 1C5YB 3PO1C 1NRRH 3AVZA 3RLWH 5JDUB 3MU4A 3T29A 4Q7YA 3SI3H 2WPHS 1KXDA 2P95A 1ZHMA 2QIQA 3UREA 5A2MH 4X1PU 1C2JA 1UJ1A 4YOGA 4DGJA 3SNEA 1QCPA 3ODFA 4YOJA 1V2TT 1PQ8A 3QTOH 1XX9A 3RC5A 2D26C 1P04A 1EATA 1HJ9A 5PTPA 2ZFFH 3A82A 3P17H 4I31A 3LJJA 3KGPA 4YZUA 1XUGA 1Z1IA 3SUDA 2J2UA 2O8WA 1HAZB 4IBLH 5ESBA 2W5EA 3PMAB 4H4FA 2SGPE 1AUTC 4AX9H 1ARBA 2C93B 3ATIA 3ZZ8A 3GY4A 6GCHG 8KME2 2FESH 5LPRA 4AYVB 2J38A 1EAXA 2BOKA 3Q3XA 1O2WA 3M3SA 1E36B 3O8DA 1VJAU 3EQ0H 3LOXA 1GCDA 1QRZA 3BTHE 5T6GA 1NPMA 1QJ7B 2ZEBA 3LC5A 1HRTH 4UD9H 5FX5A 3LJOA 1AY6H 2HWLB 1Z6JH 2PSXA 3CS0A 2F9NA 5LGOA 1MCVA 3M61U 1IQKA 4CRCA 3VPKA 4FVBA 1FIWA 1MH0A 2Z3CA 7KMEH 1EX3A 2VU8E 4FUHA 1L1NA 3P92A 2FTLE 1Z6EA 4WWYA 4ABGA 2O9QA 1SI5H 1TMBH 3MNCA 4GAWA 2Y5GA 2ZHWH 1ESAA 2ZDKA 1NM6A 1BTHH 1ELDE 1SGFG 2BTCE 8ESTE 3MU5A 5ABWA 7LPRA 2V6NA 4U30A 1YPKH 2RA0A 1DWDH 1P3EA 2GTBA 3PWCA 3NCLA 4K60A 1K9OE 5HGGA 1AI8H 4NSYA 3TH4H 2FOAA 1VGCC 4IW4E 4IGDA 1BZXE 3CENA 4OGXA 1IHTH 1GMDG 2UWPA 1SGTA 3E3TA 1L1JA 4UFDH 1YCPM 1GBJA 3BF6H 5HXFA 1EUFA 1V3XA 2ANMH 2YNBA 1O3JA 1C5QA 2G52A 2BD4A 1V2NT 1BRCE 1LKAA 1XKBC 1O34A 4WVPE 1GJ6A 3DHKH 3SUEA 3E16B 3GDVA 2G8TA 3ZVAA 4INLA 1W7XH 4HGCA 2KAIA 3GCTG 2BD9A 2ILNA 3MTYA 4BXWA 2ZTZA 3AASA 4XFQA 2ODYB 1LPZB 1MAYA 1O2OA 3BSQA 3FP7E 4X6OA 1C2KA 2WPJS 4Q80A 3RXEA 1P01A 2C8XB 1FY5A 1UHBB 5EPNA 3GYMA 3F9FA 2FTMA 1CA0C 4IS5A 2XTTB 1V2MT 5CHAC 2J92A 2BLOA 2FPZA 3GY2A 1IQFA 1NFXA 1O37A 1TNLA 1GMDF 4OS4A 1HAYB 1NROH 3KQDA 1OWIA 1WOFA 1GJAB 1OOKB 1DSUA 1UVPA 2AYWA 3SW2B 1C1QA 1S6HA 3TNSA 1SGNE 3SHCH 4MQAA 3UOPA 1BHXF 3UQVA 1O2NA 2AS9A 2FP7B 1NRQH 2CF8H 3BTME 3KNXA 5LPFA 3BTEE 3RDZA 2SGEE 4XBBA 1EAWA 1IQJA 1ANCA 3MHWU 4WH6A 3VEQB 1BOQA 3LONA 2XNIA 3Q3YA 4X2XA 3A8DA 3SV9A 1G2MA 1X7AC 1C1PA 2AH4X 2AMDA 1D9IA 1NC6A 2BVXH 2BYAX 1O2LA 1DANH 1ZLRA 2PTCE 1ETRH 2QA9E 1DUAA 3BTWE 2Y5FA 4B76A 4O3UA 2HVXA 1DITH 2OQUA 3MFJA 1GMCG 1D3DB 2BY7X 2Z9IA 1V2VT 2DE9A 2VB0A 5JBAS 1OPHB 3TITA 1ETSH 2OD3B 4LK4A 1TABE 4QT8C 3BTFE 1EJAA 1YLCA 4IMZA 3S7HB 1P57B 4ZH8A 4JK6A 3TNTA 3A7VA 2CXVA 1SGCA 1DFPA 2VIVA 3FVFB 2AEIH 1C1SA 4GHTA 3KL6A 1AZ8A 2A5IA 3SJ8A 3R3GB 4CHAC 3SUGA 1GVLA 1QB1A 4JZFH 1UTQA 1TGNA 1EB1H 2W3KA 1F7ZA 2GZ8A 2H5CA 1BTYA 3ATKA 1GHAG 3PYHA 3RC4A 1PFXC 2BY8X 2D8WA 4WXIA 4AZ2B 3SV7A 3B9FH 1HAOH 1YPJH 3A84A 2A32A 3MYWA 1OYTH 2FOGA 1AN1E 1O5CB 1YCPK 1GI2A 3M5NA 2CF9H 3TVJB 1ZSLA 3A7XA 3OX7U 4H6TA 2I6SA 3ELAH 1SLVB 1A1RA 3NPSA 1DPOA 5E0HA 1BTWA 1GHZA 4ABIA 4E05H 3GY5A 1O0DH 2BZ6H 1CE5A 1ESTA 1IAUA 5FBEA 1BBRE 1UVOA 3MMGA 3TJUA 1MTNC 3VFEA 1O2JA 5A8ZA 1RRKA 4A92A 1N1LA 1ANBA 2FOEA 1TNGA 3SJIA 2NU3E 1AMHA 4YOIA 1P3CA 1QBOA 1UO6A 1EPTC 5DP9A 1BRBE 2BD8A 1GL0E 1Z71A 2PLXA 2XBXA 2P8OB 4K3JA 2SGQE 5GDSH 5F8XA 1EASA 5K0HA 1DX5M 2P3UB 1GHAF 2CHAB 3A8AA 1GDNA 1HV7A 1P10A 3V13A 4NA9H 2ZHDA 1HAIH 1UVSH 4GCHF 1K1OA 1QA0A 1SGFA 1WU1A 3RXBA 3ATMA 4FU8A 1FY1A 2PTNA 2BQWB 3AW1A 1H4WA 2PHBA 5GIBA 2QF3A 1DM4B 1LDTT 4NG9H 3A83A 1YCPH 3RXSA 3K6ZA 1F0SA 2KAIB 1OWEA 2WV4A 1GI0A 3S69A 1SHYA 1O2MA 2ZGBH 4ZXYH 1O2UA 2FOHA 4FUFA 3ZZBA 3E1XB 5LPEA 4X0WU 1EOLA 2D1JA 3SV6A 2Z7FE 1V2UT 1PQ5A 2ZG0H 3MNXA 1NESE 4XBCA 4CRGA 2BXUH 4ESTE 4ISIH 4O9VA 2F3CE 8LPRA 5HYOA 4ZKOU 1MZAA 4X8VH 3GOVB 1FN6A 1KY9A 1Y3XA 2OC7A 3KIDU 1DDJA 1Z7KA 1NFUA 4JYVH 3L6PA 4B2BA 4LOYH 5C2ZA 2WYGA 1PYTD 4FXGH 1HAVA 2VIDA 2BM2A 1A2CH 2TBSA 1TRNA 1KIGH 1TBRH 5DPAA 1C5SA 2SGAA 1PPFE 2BX3A 3PMBB 5F6MA 2BDHA 1QL8A 2CV3A 5EXMA 3W95A 1C5LH 3ESTA 1SGPE 2P3FH 4ZUHA 3U98H 1P02A 1ESBA 1AB9B 1HJAB 1ELAA 3D23A 1GBLA 1BUIA 5JB8S 1HIAA 3D65E 3SGBE 4I8LA 5A8YA 4MPWA 1GJ5H 4I7YH 5DGJA 1XKAC 5F03A 2GMTB 5GCHF 4AG2A 1ZRBA 3LGTA 1WV7H 1FAXA 1SQTA 5CE1A 3SU3A 9ESTA 1CBWC 4J1YA 3ZYDA 3TJVA 3T2NA 4ABJA 4BANB 1A5IA 1TX6A 2IN2A 3QUMP 1C5WB 1XM1A 2BDAA 5FX6A 3MNBA 1GBKA 5J4SA 1O3GA 1WTGH 1QR3E 2BQ7B 1DS2E 1FONA 3RXLA 3TH2H 3MU0A 4E7RG 5L2ZH 1GHVH 1CVWH 2F83A 2ZPRA 2FOCA 1LVOA 4LZ1H 4JMYA 1SLWB 2JETC 3UY9A 3BTKE 2QYIA 3SNBA 1SFIA 4FUBA 1YKTA 2ZGHA 1VITH 2BLVA 4KELA 1P03A 2VINA 1P9SA 1SFQB 3Q00A 3ZYEA 5EG4A 1GI1A 2AIQA 1ELVA 1NRNH 1GBAA 3A87A 1P2JA 3BV9B 2UUJB 4JK5A 5C5OA 3RXMA 4ZHLU 1RXPA 1SGIB 2FI3E 3BTGE 3RMNH 3F9HA 5HMAA 4HI3A 3R0FA 1T4UH 4ZHAA 2JH5D