1RIWB

Thrombin in complex with natural product inhibitor oscillarin
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
147
structure length
147
Chain Sequence
IVEGSDAEIGMSPWQVMLFRKSPQELLCGASLISDRWVLTAAHCLLYPPWDKNFTENDLLVRIGKHSRTRYERNIEKISMLEKIYIHPRYNWRENLDRDIALMKLKKPVAFSDYIHPVCLPDRETAASLLQAGYKGRVTGWGNLKET
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The N-acyloxyiminium ion aza-Prins route to octahydroindoles: total synthesis and structural confirmation of the antithrombotic marine natural product oscillarin
pubmed doi rcsb
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords thrombin light chain
total genus 28
structure length 147
sequence length 147
ec nomenclature ec 3.4.21.5: Thrombin.
pdb deposition date 2003-11-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1riwB00
1O5DH 2B7DH 3SNCA 2EEKA 2OD3B 3U8OH 5B6OA 1GMHG 2AIQA 1YF4A 3B9FH 4Q80A 1IOEA 1NRPH 5ETXA 1GHYH 5JDUB 2HNTC 1FN6A 2CHAC 2VJ1A 3I78A 1HAOH 2ZU2A 4MNVA 1EP6A 3HKIB 2FI3E 4ZMAH 1C2GA 4O97A 1AFQC 2VIDA 3FZZA 1NPMA 2G81E 3UOPA 1DS2E 4WY3A 3UWJH 3SUGA 5TCAA 1A0HB 2R2WU 2A7CA 3A8BA 1HB0B 3GDVA 3RXBA 2VVUA 1HIAB 3U9AH 1C1RA 2Z9KA 3LH1A 2HLCA 3OX7U 1GCTC 4O03A 2ZPSA 4Y8ZA 5IYTA 2QC2A 5L30H 3RXMA 1DY8A 4CHAB 5F6MA 1O2XA 2FS8A 4K1EA 2ZHQH 4XE4A 1O37A 3SU2A 4A7IB 2QA9E 1DX5M 3EDXB 1P06A 1Z1IA 4YTAA 1QNJA 1HRTH 5E2OA 3RXPA 1G37A 1MU6B 1VJAU 3FP7E 1GL1A 3EA7A 1BQYA 4ABAA 1A61H 1YCPH 3P6ZB 2VNTA 2XC5A 1PJPA 2F9OA 2V6NA 1EJNA 2PTCE 1C5YB 3M5MA 2OC0A 4FVBA 5EXNA 2XRCA 3O8BA 1ZSKA 3A85A 5CMXH 4LXBH 1HDTH 3ZVEA 4NFFA 1GI9B 3SV9A 1MCVA 4MTBA 3UQOA 4YOJA 1HAIH 4JZEH 3M5OA 1WQVH 1ANCA 2G4UA 5C20A 1EXFA 2BLWA 1QL9A 3TH2H 2BDYA 3KN2A 1QJ6B 5EOKA 4TPIZ 3RXUA 1GMCG 2XBXA 1G3EA 1BJUA 2BD7A 1QJ1B 2FLBH 1ARBA 4M7GA 4Z0KA 2CMYA 1ORFA 1TONA 1GJ8B 1EB2A 2XTTB 2PKAB 1OWJA 5T6FA 2ZGXH 5CHAC 2TGAA 1SHHB 1H1BA 1TGCA 4DY7B 4IW4E 4ZUHA 2G4TA 2JH0D 4O9VA 1MAXA 1BRCE 1P57B 4K8YA 4WXIA 4AYYB 1NZQH 1Y5AT 5FPTA 4GCHF 2UWPA 2Q1JA 3QO6A 3RMNH 5HXFA 1TRNA 1EOLA 1Z8IB 1YC0A 2QN5T 2ZHFH 2XCFA 1CBWB 2OCVB 4GPGA 4XBBA 1C2JA 1SI5H 2AEIH 1TFXA 7LPRA 2BD9A 4UFFH 1CBWC 1Y3YA 3ZVCA 2HOBA 1TYNA 3AAUA 3ZVAA 3BEUA 1C1PA 4HTCH 4H42U 1SHYA 3Q3KA 4MPXA 3E0NB 3PYHA 4AFZA 1OS8A 3PLPA 2P94A 1Y8TA 1SGQE 1WYKA 3GY2A 4IC5A 4O3TA 1AI8H 1AFEH 3KQEA 2XC0A 1SLXB 2W26A 1O3PB 2ZGJA 3AVZA 5GDSH 3RC4A 2BD4A 1ZGVA 3UPEA 1H8DH 1DWDH 5F8ZA 4DURA 2ZTYA 1A0JA 1DANH 1T4VH 1GHWH 2AMPA 1ETSH 1FY1A 2FOGA 3VFEA 1CU1A 4TWWA 4K8BA 3GOVB 1G32B 2IJOB 5DG6A 1SOTA 1SGYE 3U1JB 1VJ9U 3U1IB 3BG8A 1QURH 1EZUC 3URCA 2A4QA 4Q7ZA 1GI1A 1Q2WA 1UHBB 1ZTJA 1ELGA 2ZFPH 4YLQH 1FIWA 1Y3VA 1SSXA 4RSPA 4CRDA 1AFQB 1MTVA 1RFNA 3SUDA 1YPLH 3O8CA 2GDEH 2QF0A 3LIWA 2GX4A 3SU3A 1C1TA 1XUJA 1QRXA 2SNWA 2F9VA 3GCTF 2BVXH 1TA6A 4GAWA 2SGAA 2O9QA 3PV4A 3RXFA 3UR9A 4YOGA 3M5LA 3A7XA 2JETC 4KTSA 3RMLH 3VXEH 2J92A 5FBEA 6GCHG 1ESTA 3VEQB 2WPIS 1TQ0B 1EAUA 3RXGA 1C1SA 1XVOA 3SNAA 1G2MA 1BTYA 2Y5HA 1DVAH 2R0KA 3A81A 1L1NA 3QX5H 1GBCA 4BAQB 2Z3CA 1CGIE 4XSKU 2QGRA 1XUHA 1MH0A 3T28A 1TNGA 2VB0A 5HMAA 4BTTB 3V0XA 5GPIB 2FTLE 1Z8RA 2BD5A 1OWEA 4CRCA 3S7KB 3R3GB 1EJMA 1ELEE 3H7TA 4WJG2 3SU0A 4ZHLU 1OPHB 2AMDA 2ZECA 4FU9A 1GJAB 4OS5A 1TBZH 1C5LH 2GTBA 6ESTA 4F49A 1QTFA 1FMGA 4JZ1A 4MNWA 1V2QT 2ZHDA 4B2CA 3A89A 1O36A 4AYVB 1AU8A 2I6SA 4NZQA 1TAWA 2H9HA 1BBRH 1ABIH 1FY8E 4GHQA 3V3MA 3W94A 1BTXA 4Y0YE 1W13U 2A2XH 1SB1H 3NK8A 3ATMA 4X8SH 5IDKA 2R3YA 1V2MT 5HM9A 1TPAE 1KLJH 4I8HA 4OGYA 5JB8S 5DP5A 2D1JA 2AIPA 1L1GA 1C5QA 2P3UB 1KTTB 4D9QA 1F7ZA 1GHVH 3BEIB 1O2UA 5BRRE 3SNEA 1HXEH 1A1RA 1KY9A 1ZTLA 2RA3A 4NSYA 1O5AB 1RIWC 2J95A 1QIXB 4X8TH 1WTHD 2FO9A 3PO1C 1BMNH 1GMDG 1NTPA 5FPSA 1C5RA 1WCZA 1YBWA 4I32A 2UWOA 1BA8B 2BHGA 3LONA 2ZFSA 4E06H 5EW1H 7ESTE 4MPWA 1WSSH 1EASA 1V2ST 2ZNKH 1TNIA 1TPOA 1FPCH 1TPSA 1SOZA 5C3NA 1JIMA 3DD2H 3Q76A 3ESTA 1TWXB 1Z7KA 4JCNA 3D65E 1W8BH 1F5RA 1IQNA 3QTOH 1GJ9B 3SW2B 4IGDA 2FLRH 1GBDA 1ELDE 1CQQA 1XVMA 2I6QA 2P3FH 1P2JA 1UVUH 2Z3EA 3A84A 5FAHA 1O34A 4X2VA 1M9UA 1THPB 2VIQA 1NY22 1P01A 1EOJA 3R0FA 7KMEH 5A0AE 1RRKA 1C5SA 2ANWA 5EQRA 1DLKB 3L6PA 1TB6H 3RXLA 2ALPA 2FYRA 2J34A 5E0JA 2WV5A 4TY6A 1DWCH 3IG6B 1AE8H 4ZKOU 1DPOA 1QJ7B 1XKAC 2FDAA 7GCHF 1W7GH 3RM0H 3PLKA 5K0HA 5G4BA 1J15A 4MNYA 2F83A 2W7SA 3VB3A 1EZXC 1MTNB 5DP4A 5C1XA 3NXPA 1C5OH 3G01A 1BCUH 3EGKH 1GGDC 4KGAA 3SBKA 1W12U 3ZYDA 1PPBH 4X6OA 3GCTG 3UOUA 3BTWE 3CS7A 4MNXA 1EUFA 2FESH 1WOFA 1CT4E 2Y80A 4XBDA 3S69A 3P92A 4NIVA 1C1QA 1GHBG 3A8DA 5JBBS 1TPPA 1FN8A 3BIVH 3V13A 1B0FA 2FXRA 1LVBA 1ZMJA 1EZSC 1OOKB 1DWBH 1WQSA 3PWCA 2BVRH 2BDCA 1CA0C 1GL0E 2H9EH 4KTUA 1TE0A 1BMMH 4X6PA 3Q3XA 3VB5A 3UWIA 1GMHF 3O8RA 4Z6AH 4NFEA 4AORA 1AZ8A 4ISNA 3MO9A 5FBIA 3RXDA 2TRMA 1YKTA 4DCDA 1RGQA 2A4OA 3SI4H 4BAKB 9ESTA 1B5GH 1HBTH 1DDJA 3LGUA 1Z6EA 1LQDB 1CGJE 2P8OC 3KQCA 4GHTA 3FANA 1DM4B 1GHZA 2ANMH 1GGDB 1MCTA 1P2NA 2AGGX 4WF8A 4AFUA 2F9PA 3KEEA 1K9OE 2VU8E 3D49H 3IITA 6LPRA 4FUJA 5ESTE 1P2OA 4AX9H 3S0NA 1G2LA 1P9UA 2JH6D 4VGCC 4Y76A 4GCHG 3VB7A 2ZDMA 1K1MA 3RU4D 3F68H 1UVTH 3LT3A 1RTKA 4UFEH 1XXFA 2CXVA 1TALA 1A46H 2BQ7B 1LHGH 1KDQB 4UD9H 1IQEA 3M35A 1S81A 2VIOA 3TGKE 2OXSA 1L0ZA 2VWNA 1UTJA 2BXUH 3NPSA 2JKHA 5A8ZA 1WTGH 1HIAA 2OBQA 2H9TH 4WMDA 2ZWLH 2KAIB 3GY6A 3UIRA 2P59A 2ZDAH 1BITA 1QRZA 3GCHB 2UUKB 2GV7A 1BRUP 4K69A 2XBVA 2ZQ1A 2BD8A 1LPZB 1LTOA 2THFB 3I77A 4K2YA 5E0GA 1ZSLA 4ISHH 1GI2A 1BMAA 4TPYA 2ZPRA 1O2TA 1J14A 2BLQA 5A8XA 1PPCE 3BTFE 3VXFH 3A7WA 2BVSH 1V2JT 2UUFB 1GBMA 1S82A 3BSQA 1Y5UT 1BRAA 1SGTA 1G3BA 1ZYOA 2O8MA 4WXVA 4IN2A 1TX6A 4B2AA 4UFDH 1KIGH 1P09A 1YLDA 1WAYB 1C5WB 1NFXA 1CHGA 1UVOA 4XBCA 1HJ9A 1NRQH 6CHAC 5JBTA 4UE7H 3GCOA 4X2YA 4MVNA 1C9TA 1D9IA 1JIRA 2FIRH 3QN7A 2GCTB 1HLTH 4MG3A 1GHXH 4X2WA 1H9LB 4B74A 2YNBA 1S84A 4H6TA 1RS0A 5ESBA 3RXSA 2ALVA 1K1JA 3A82A 2R3UA 1AMHA 1FV9A 2TGTA 1W14U 4GSOA 4FUEA 4BTUB 2ZEBA 1G3DA 2FM2A 2G5VA 3S9AA 1SQTA 1OXGA 3FVFB 5T6GA 4Y10E 3KCGH 3T2NA 4ZAEA 1JMOH 1KDQA 4X1SU 1SLUB 3A7TA 1V2UT 1C2MA 1GCTB 1LCYA 1NO9H 1ZJDA 3DUXH 4IC6A 3S9BA 4U2WA 3F6UH 1HXFH 1O3BA 5A2MH 3GISB 2QAAA 1S0QA 1XX9A 3SV7A 4UFGH 2ZDLA 1UO6A 1LMWB 1ZPBA 1F92A 2B0FA 4JYTA 2GMTC 1FNIA 3SUFA 1SC8U 1HGTH 4NWLA 1WV7H 3ODFA 4AGKA 3LGYA 3UNQA 1ZOMA 2W7UA 1BZXE 2ZGHA 1UK2A 2FX4A 5A09A 4ABDA 2C8XB 3PM3A 4LZ4B 2G00A 3LU9B 2ZFTA 3SGBE 4INHA 3SU4A 1NFUA 1C2HA 4YZUA 1HPGA 4FU7A 1GPZA 2FOAA 1ANBA 3VPKA 3MOCA 4HGCA 4FUHA 3VGCC 1KLTA 1EAXA 1O0DH 2QY0B 3K6YA 4J1YA 3NZIA 1P3CA 1TLDA 1QB6A 1GBLA 3SHCH 4CBNA 1EZQA 1Y3UA 2RCEA 3GY5A 1KTSB 1DSTA 4MPUA 4SGAE 5C5OA 1ETTH 3AASA 1ZPZA 1UTKA 3TH4H 4BNRA 4IMQA 1CGHA 3P95A 1V2OT 2PUXB 1FAKH 4JK5A 2EI6A 2A0QB 2GD4B 1FLEE 1GMDF 4CBOA 2PSXA 3EE0B 2FS9A 1ZHRA 1TNHA 2BX3A 1O3DA 2FOHA 1OWHA 1KXDA 1P02A 2PLXA 4X8UH 1NU9A 1MBQA 1K1OA 4J2YB 4UONA 3KF2A 5A8YA 3LDXH 1BIOA 1NFYA 3P8GA 1WUNH 1O3MA 1UCYK 3TJUA 2TGDA 1IQMA 1O38A 2SGEE 1GBEA 2C90B 1LO6A 3GICB 2NU2E 4ISLA 3ATLA 1TGSZ 1VCPA 4YOIA 2PR3A 2Y81A 3MYWA 3ZZDA 1O3CA 2A31A 1O3FA 2ZA5A 3RXCA 4XOJA 2BY5X 2ZC9H 2C4FH 5H4IB 3KQBA 1QL7A 2HVXA 4IS5A 4Y11E 4BOHA 1MTUA 2H5DA 5AVDA 2PV9B 1GJ4H 3UUZA 1UTOA 1GVZA 3KIDU 4D7FA 2Z6BD 2K1QA 4ISIH 3MO6A 1DLEA 1JWTA 1OSSA 3TH3H 3U8RH 1LVMA 4Y71A 4I8LA 5L2YH 4I8KA 2VGCC 2GVFA 3STJA 1MZAA 2A32A 1GI8B 1E37B 5DK1A 5EW2H 2C8YB 2A7HA 4Y7BA 4A1XA 2GMTB 2O8UA 3NKKA 8GCHG 1V2TT 5LGOA 1INCA 2WUBA 5EXMA 1GBAA 4B76A 2F9NA 3BEFB 2QXJA 3ZZ5A 1C1UH 3BTTE 1UJ1A 1DFPA 1MU8B 2AH4X 1BRBE 1HJ8A 2ZG0H 1O2OA 4AN7A 1DT2A 4JZIA 1BB0B 4YLUA 1BOQA 1V2PT 1O39A 3TJNA 1LQEA 3TITA 1GBKA 5JBCS 4HZHA 3B23B 3A87A 3E90B 1SGPE 4DOQA 3SGQE 1PYTD 2JETB 1GI4A 1QFKH 3PMBB 2PW8H 3TVJB 2STBE 1T8OA 1W11U 1ELCA 4BANB 1SLVB 1EX3A 1C4U2 3ZZAA 3RXTA 4CHAC 4A5TS 2YOLA 1FIZA 2VWLA 4FUBA 3GY3A 1LPGB 1PYTC 4X1PU 4H4FA 1C4V2 2ODYB 1P2IA 2TGPZ 1TRMA 1YPGH 1Z71A 2XCNA 3QK1A 4JZFH 2SNVA 5GXPA 2QCYA 1GJBB 3BTKE 1B7XB 2F3CE 2DUCA 2GT8A 3MO3A 1IQHA 1C5XB 5DP6A 5A0BA 1NN6A 1AKSA 1C1NA 2STAE 1F5LA 1IHTH 2V3OH 4NCYA 3TJVA 2C93B 1C2LA 5L2ZH 5DP3A 2PGBB 3SJ8A 1A7SA 1EAWA 6GCHF 3RXKA 3RXAA 1S5SA 1A4WH 3SZNA 2BYAX 1DOJA 4NZLA 1GI5A 4XDEA 3P70B 1HYLA 3T62A 3W95A 1W2KH 2ZQ2A 1EPTB 2PTNA 3RDZA 2BMGB 1F2SE 2ZDNA 2SGPE 3ZZ3A 1L4DA 3ZVGA 2BM2A 2WPMS 3TIUA 5J4SA 3RXEA 4X0WU 1NT1A 1FONA 4AG2A 1O3KA 1QL8A 2H5CA 3SU6A 3RC6A 3E91A 2ZHEH 1OWIA 1K22H 1V2LT 1XUIA 2ZFFH 1YPKH 3MFJA 3BG4C 1O2HA 3A88A 1G30B 4R8TB 5DJ7A 3SHAH 3QZQA 1UTMA 5AFZH 1C2IA 2ZTXA 3HGNA 5EQSA 1TIOA 3A8CA 4DVAU 1W7XH 3Q3YA 2YNAA 1PPZA 5ABWA 2H1UA 3LGIA 1EJAA 4CRFA 1O32A 1MTNC 3EAJA 1AUTC 3M37A 1A3BH 3RXVA 3JZ1B 1FUJA 3M3VA 1S83A 1PPEE 1CT0E 2V3HH 1YP9A 2CN0H 2OC1A 3M61U 1DWEH 1YPJH 1GCDA 3UR6A 3ZZ8A 4SGBE 2HRVA 3A86A 2SGQE 2PUQH 1O31A 2VVCA 3PLBA 4CR5A 4INLA 3BTGE 2BDGA 2DE8A 1C2FA 1O30A 1RIWB 4I33A 4E7NA 1O2MA 1MZDA 4AB9A 2G55A 4MLFB 1C2EA 1ELVA 2IN2A 3RXIA 1K1NA 1ESBA 1SGFG 1TBQH 4ABGA 3LGWA 4JK6A 2F9BH 2ZGCA 1F0RA 3RUOA 2XWAA 4HI3A 1FDPA 1HNEE 1SBWA 4B2BA 2Z9IA 1F0UA 5I46H 1SGFA 2ZKSA 2ZI2H 4ABIA 3SV2H 1O3LA 1VGCC 3WY8A 1AQ7A 3M3SA 1SMFE 1GBHA 1RTLA 3UFAA 2PWXA 5K7RA 1FZZA 1ESAA 5FXLA 2J4IA 3P8NA 5DKMA 3SU5A 4Y8XA 4NA7A 1HAYB 1MKXK 4ZKSU 3TPIZ 1K1IA 1BHXF 3RU4E 1THSH 1F5KU 1ZLRA 4E05H 2BX4A 2GT7A 2J2UA 2J38A 1P05A 2ZFQH 1MKWK 2OTVA 1Y59T 3MU5A 1AB9C 1H9HE 2PGQB 4TY7A 4FXGH 2Y5FA 1C5VA 3FZDA 1GWAA 2HALA 2W3KA 1C5UA 1FY5A 1XUFA 2OUAA 4GLYA 2H2ZA 3VGCB 3RMMH 4BXSA 1C9PA 5F03A 4Q2KA 2GKVE 1OP8A 3URDA 2WYJA 2GP9B 1HJAB 4JYVH 1AVXA 2FOBA 3Q77A 4I7YH 1RXPA 1ACBE 2AGIX 1KXEA 4OS6A 5F8TA 2Z3DA 1C2DA 3SJKA 1Y5BT 4K1TA 1PFXC 2ZHWH 3LH3A 3NWUA 2AERH 1FI8A 1TOCB 3M36A 4ZKNU 3SUEA 1E0FD 5DO4H 3A7YA 2ZU1A 2EA3A 2FZZA 2O8TA 3E3TA 1NRNH 1O2GH 1GJ7B 1SFQB 1CA0B 2H6MA 1AY6H 5DP9A 2ZDVH 3BTHE 2VWOA 1ZRKA 1OWKA 3BTDE 2G52A 1AVWA 4OGXA 5JB9S 1SGEE 1S6HA 2BY7X 1GVLA 3DT0H 1IQIA 2VVVA 5I25A 1V6DA 1QQUA 1PQAA 2G8TA 1HFDA 3VB6A 1NS3A 1KXAA 3SGAE 4AOQA 1ZSJA 3PMJA 4X8VH 1HAHH 3A7ZA 3SV8A 1D3TB 3L33A 2HGTH 3PMHB 1MKXH 1O2QA 2A45B 1BTUA 4LK4A 4GVUA 3ATIA 3QWCH 1O3GA 4F4OC 3L3TA 2QYIA 1UVSH 4D76A 1LDTT 2D26C 4UDWH 5EPNA 2AMQA 4A92A 3EYDA 3ZZ7A 1O5EH 1YGCH 1O2IA 1TX8A 3GY4A 4JMYA 1O3HA 1ABJH 1Z8GA 3NUMA 2GDDA 1GHAG 1O2YA 1GJ5H 1QBVH 1QCPA 3GDUA 5EQQA 2D8WA 2PFEA 1CT2E 4AG1A 3OTJE 1XKBC 5DP8A 1B0EA 1J16A 3PB1E 1MUEB 4TWYA 1EQ9A 2BLVA 1VZQH 4CH8B 4ABFA 1IQJA 2ESTE 3T25A 3RXQA 3SQEE 5AF9H 3GYMA 3MH7A 2FPZA 5EXLA 4A1VA 4B75A 2BDHA 3SNBA 3RXJA 3U98H 2WYGA 2B5TB 4DW2U 5HYOA 1E34B 1V2KT 1RJXB 4CH2B 2PSYA 2ULLA 1C1WH 4FUIA 5GJ4B 2ZDKA 1MKWH 5C5NA 1GG6B 3QDZB 1LHDH 3RU4T 1QY6A 4GUXA 1NM6A 2ZCKP 1C5TA 1O2SA 5DP7A 3UQVA 1P10A 2G51A 2HPPH 2ZIQH 3SQHE 1KXCA 2XC4A 5GCHG 1SGDE 2J94A 2G5NA 1DITH 1G3CA 5PTPA 1D3QB 4MQAA 3A80A 1GI7B 1P2KA 2ZF0H 2P93A 4THNH 1LKAA 2Q6FA 1C1OA 4KELA 2Z9JA 2Z7FE 1P0SH 4HFPB 4I31A 2BZ6H 1THRH 2WPJS 3CS0A 4WH8A 4ISOA 4RN6A 1O3IA 1HV7A 2XBYA 4K60A 4DT7B 4D7GA 4FUGA 5SGAE 3H5CB 1PQ7A 1C5ZB 1AB9B 5LPRA 1DE7H 1WU1A 3QGJA 1AN1E 1O3NA 1W3CA 4BAMB 4ZROA 1P03A 2XNIA 2BDBA 1ETRH 5C67A 3C27B 1A5GH 4BAHB 3LKWA 1ELBA 1W0ZU 1KSNA 4DJZB 1QB9A 1YYY1 1LHEH 1QA7A 1BBRK 1J8AA 2BB4A 4MDSA 1N1LA 4UEHH 2BD2A 1J9CH 1ZPCA 4INKA 2WPKS 2NU1E 3OU0A 1BBRE 3RP2A 2Y7ZA 3ZVBA 8LPRA 1QRWA 3HGPA 2WPHS 1A0LA 1IQKA 1VITH 1ZHMA 2LPRA 1UVPA 5DPAA 3RC5A 5JPMH 2BY6X 1HAGE 2Y82A 1U6QA 3ELAH 4OS7A 1NROH 2NU3E 1O2RA 2FTMA 1V2RT 2GCTC 3RM2H 3DFJA 1V2WT 1VITG 2Z9LA 1HAXB 4DGJA 2BZAA 1AVGH 3KL6A 3E1XB 4WMEA 3UNRA 3MH4A 3FP8E 3VB4A 1MBMA 4I8JA 1O2WA 1T8NA 1HAVA 1AHTH 2QF3A 4OS4A 3LC3A 3V12A 2OQ5A 1ZMLA 1FY4A 5L6NH 3GCHC 3LOXA 1NU7B 1MQ6A 2A2QH 4K5ZA 2VIPA 2GGVB 1L1JA 3LGVA 1QHRB 3AAVA 3RXRA 3TK5A 3RLYH 3TGJE 2QIQA 2IOTA 1PQ5A 1RD3B 1SL3A 2FODA 1EKBB 4Y6DA 2UWLA 2VH0A 2BY8X 1UTLM 2BXTH 2VIWA 3O8DA 3TU7H 2TPIZ 1S6FA 1XUKA 3SN8A 3UY9A 1GG6C 1N8OC 2A4GA 5T6DA 3M5NA 1AIXH 3SU1A 5DGJA 1GHBF 1K2I1 2C8ZB 5AHGH 2QXHA 4ABHA 3LJOA 1Z8JB 4B71A 5E8EH 5GIBA 4Y7AA 1MAYA 1PPHE 2VIVA 2OINA 5LPEA 1Q31A 4Y0ZE 2Y6TA 4FU8A 1GJDB 3UNSA 4CRAA 5E2PA 1TBRH 2SFAA 4U32A 2OC8A 1AZZA 1GI6A 1GDUA 3F9FA 2AGEX 1AO5A 1AD8H 1BTZA 1A5HA 1LVOA 3HATH 5FX5A 5GWZA 2FEQH 2ZFRH 1UCYH 3SOSA 2ZU3A 4YO9A 3T5FH 1T32A 1BTWA 3F1SB 8KME2 9LPRA 2XYAA 3TK9A 2V35A 3FAOA 1A2CH 2FYQA 4U30A 1UMAH 2GCHF 1BDAA 4TYDA 4ZHMU 1V2VT 1BT7A 1LHFH 1C1VH 1EAIA 3MNBA 4I8GA 2PKAA 2ASUB 2OLGA 5F8XA 4YM9A 2IPHA 2LNCA 4XFQA 1C5MD 3A8AA 5EG4A 1OX1A 5FX6A 1ANDA 1P8VC 1QR3E 4ASHA 2BQ6B 3F9HA 3U8TH 2BY9X 3P8FA 5EODA 1CHOF 1TGBA 2Y7XA 1GDQA 2A7JA 3K65B 3PTBA 2ILNA 4NG9H 3TNSA 2OC7A 2RDLA 1YPHC 1T8LA 2O8WA 4DIHH 4WH6A 2JH5D 1GVKB 3MHWU 3HPTB 3MU8A 3HK6B 1AKSB 3QLPH 3OY6U 3ZV9A 2FX6A 3M3TA 3RMOH 1VCQA 2O8LA 1MMJN 4X2XA 3RXHA 4X6NA 1ZR0A 3GDSA 4ZXXH 4A1TA 2J9NA 3ATKA 5FPYA 4CRGA 1YCPM 1FPHH 2AYWA 1NRSH 1A5IA 1FY3A 2GV6A 1ZJKA 1TMUH 2BD3A 3C1KA 1IQGA 2D2DA 1ZZZA 1O2LA 3TNTA 1A3EH 1D4PB 3MNSA 3CENA 4FUDA 4ABJA 1J17T 3B8JA 2A5KA 1O35A 3BG4B 3H7OA 4KP0A 1GBBA 3AW1A 3V7TA 3EA9A 1TABE 3KQDA 2CV3A 3LGTA 3DFLA 3QZRA 2ZCLP 4IBLH 4RKOB 1JRSA 5E0HA 2WINI 1OP0A 3P17H 1O2PA 1ELFA 3MU1A 4QT8C 5CHAB 4KTCA 4IMZA 1HAZB 5FCRA 2WPLS 5FHTA 3ZVDA 4ABBA 2OBOA 4X1RU 4NIXA 2TBSA 1Q3XA 2A1DB 3SI3H 1BMLA 4Y8YA 2HPQH 1KYNA 2PHBA 1UTQA 5TCCA 4NIYA 2XBWA 1O3OA 3MU4A 1C2KA 2F9UA 4A6LA 1P12E 4NA8A 5JYIA 5LH8A 1OP2A 3SJ9A 3ZZ6A 1SVPA 1K1LA 1XM1A 1GJ6A 1SGRE 2UUYA 8GCHF 1S0RA 4CRBA 1D3DB 1DXPA 4D8NA 1GDNA 3KNXA 1TNLA 2OQUA 1FJSA 1D3PB 1JOUB 1ZMNA 3JZ2B 1UTPA 3ZYEA 2WV4A 3LC5A 3E0PB 1TMBH 1K1PA 3ZVFA 1VR1H 1BTHH 1L4ZA 1W0YH 3MU0A 5GCHF 3BF6H 1BUIA 2B9LA 2AFQB 1V3XA 2W3IA 5JBAS 3BTEE 5EPYA 1T31A 1LKBA 3ENSB 1VGCB 1CA8B 1ID5H 1V2NT 2ZGBH 1CVWH 1EB1H 4NWKA 2NWNA 1MTSA 4KKDA 4AGJA 4BXWA 2FOFA 4ZKRU 3P8OA 1O2VA 1HUTH 7GCHG 2BQWB 1P9SA 4Y79A 1AWFH 1QA0A 5HGGA 4ZH8A 3SORA 3SV6A 1QBOA 3K2UA 1O2NA 1SG8B 2AS9A 2P95A 2QXIA 2FOMB 4X1NU 4MPVA 2R0LA 1SLWB 1EPTC 1TRYA 1MQ5A 2FI4E 1IQFA 1O5BB 1KXFA 2XWBI 2ODQA 2ANKH 3K9XB 3BTME 1LVYA 3HK3B 4YT7H 1P2QA 1DXWA 1AUJA 1Z6JH 1GBIA 3LPRA 4WMFA 1CSOE 4K1SA 1ZHPA 3T26A 1G36A 1YPHE 2EC9H 2ZO3H 3STIA 3M7TA 3TJOA 2ZCHP 4DG4A 1BHXB 1OYQA 1HAVB 3K6ZA 1D6RA 1SGCA 1CO7E 1GI3A 2KAIA 3PO1B 1SR5C 4O3UA 1KLIH 1YLCA 2GZ7A 3MI4A 3MTYA 1C5NH 4OS2A 4LZ1H 3AW0A 4JYUH 2PKSC 3EQ0H 3PMAB 1K28D 3U69H 3GY8A 3A83A 2BOHB 1AWHB 1O3JA 2FWWA 1P2MA 2FMJA 4H6SB 1O5FH 3GYLB 3SNDA 1SFIA 2EI7A 1C5PA 3TLOA 2ODPA 1DUAA 1O2ZA 4CREA 2CGAA 1XUGA 1GMCF 1NRRH 3PWBA 5FCKA 3ZZ9A 5T3HA 1Z1JA 1MTWA 1P11E 2WUCA 1T8MA 1SGNE 2P8OB 2VWMA 1ELTA 4AB8A 1VCWA 2SGDE 4WWYA 3CP7A 4B73A 3E6PH 1E38B 2ZPQA 1EPTA 1LHCH 4FUCA 1YPMH 1FAXA 4OS1A 5TJXA 3RXOA 2C8WB 5LPFA 2QXGA 4AFQA 4VGCB 2VH6A 2SGFE 1QBNA 3S9CA 2B8OH 3Q00A 3S7HB 3OSYA 1O3AA 4U01A 3LJJA 2BOKA 4D9RA 3MWIU 2QV1A 1N6YA 3PROA 2FI5E 1H9IE 2OP9A 3ZZCA 1O3EA 1QB1A 1RTFB 1ELAA 3QTVH 2GZ8A 5AFYH 1JBUH 1H8IH 1ZRBA 4NA9H 1MD7A 2GZ9A 3T29A 2XXLA 1Y3WA 3MH6A 1KXBA 3BTQE 1P04A 2CF9H 3SJIA 3D62A 1F0TA 2CHAB 1UTNA 1L2EA 5J4QA 2A4RA 1XXDA 2F91A 2ZP0H 3D23A 2Z94A 2HWLB 1FQ3A 1TA2A 2CJIA 2P3TB 1F0SA 1ZTKA 5EGMA 1UK3A 3TGIE 2TIOA 2P16A 2V0BA 8ESTE 1CE5A 4PROA 2M5TA 3OYPA 1LPKB 1TQ7B 3PTNA 3NCLA 3M7UA 1TX7A 3MNXA 5C1YA 1ANEA 1TGNA 2GCHG 1GBFA 4ABEA 1Y3XA 4LOYH 1E35B 1QGFA 2ZTZA 3KHVA 2VINA 2A5AA 3DA9B 1O33A 4K3JA 4DIIH 3E16B 3DHKH 3KGPA 3ITIA 2Q6DA 3IWMA 4X1QU 1XMNB 4ZXYH 2FOEA 3T27A 3N7OA 5CE1A 2BDIA 3M7QA 1IAUA 1JXPA 1TNJA 3F9EA 4FUFA 1UHBA 4NSVA 1CHOG 2ZU5A 4R0IA 3SJOA 1S85A 2R9PA 3SO3A 1O5CB 1G9IE 1EP5A 2RA0A 4JZDH 1O5GH 4ZHAA 1NC6A 2NU4E 2ANYA 2R2MB 3E8LA 4Q7XA 2BLOA 1WBGB 3MH5A 2ZU4A 1YPEH 1UCYE 2PKSB 1AE5A 2BDAA 4B1TA 1JRTA 4BAOB 3TK6A 1SPJA 4IN1A 3ZV8A 4AZ2B 3A7VA 1GBTA 3MMGA 1T4UH 4RKJB 1C1MA 1PPFE 3UREA 3QUMP 4WVPE 1O2JA 2W5EA 1BJVA 2Z9GA 2RG3A 1W10U 5HM2A 1PPGE 5C2ZA 4CR9A 3RLWH 3GY7A 1HCGA 4Q7YA 5C1UA 1SQAA 1DICA 3ZZ4A 1BTPA 1P3EA 1HJAC 1IQLA 1E36B 1DSUA 1YCPK 1ZGIA 4X6MA 4BTIB 3BV9B 2Y5GA 3BIUH 3UTUH 4NGAH 1NFWA 4E7RG 3ZZBA 1IHSH 1VITF 5A0CA 1OWDA 2FOCA 1T7CA 4YT6H 4NIWA 2BTCE 3QGNB 6CHAB 5BPEA 1TMTH 1D6WA 1TOMH 2UUJB 2HNTE 5EU8A 4AFSA 2NU0E 2FP7B 1DUEA 1AGJA 1NESE 3ODDA 1DY9A 1H4WA 1GBJA 1OKXA 1EATA 4ESTE 1GHAF 1TGTA 2VGCB 1O2KA 3BN9A 1HAPH 2C3SA 1ARCA 1N8OB 1GI0A 3MNCA 1MD8A 3HKJB 1OYTH 2DE9A 3F9GA 1FXYA 4FVDA 2HNTF 2CF8H 1QQ4A 3OY5U 3I29A 1SQOA 2A5IA 2EI8A 3ATWA 1N6XA 2ZZUH 2Q6GA 1YM0A 2XW9A 3FP6E 1K21H 1X7AC 3GCNA 1C4Y2 4YESB 1SGIB 1PQ8A 3EA8A 3FFGA 1TNKA 1GJCB 1UK4A
chains in the Genus database with same CATH superfamily
1O5DH 2B7DH 3SNCA 2EEKA 2OD3B 3U8OH 5B6OA 1GMHG 2AIQA 1YF4A 3B9FH 4Q80A 1IOEA 1NRPH 5ETXA 1GHYH 5JDUB 2HNTC 1FN6A 2CHAC 2VJ1A 3I78A 1HAOH 2ZU2A 4MNVA 1EP6A 3HKIB 2FI3E 4ZMAH 1C2GA 4O97A 1AFQC 2VIDA 3F3BA 3FZZA 1NPMA 2G81E 3UOPA 1DS2E 4WY3A 3UWJH 1QZ8A 3SUGA 5TCAA 1A0HB 2R2WU 2A7CA 3A8BA 1HB0B 3GDVA 3RXBA 2VVUA 4DT4A 1HIAB 3U9AH 1C1RA 2Z9KA 3LH1A 2HLCA 3OX7U 1GCTC 4O03A 2ZPSA 4Y8ZA 5IYTA 2QC2A 5L30H 3RXMA 1DY8A 4CHAB 5F6MA 1O2XA 2XNDD 2FS8A 4K1EA 2ZHQH 4XE4A 1O37A 3SU2A 4A7IB 1KMHB 2QA9E 1FX0B 1DX5M 3EDXB 1P06A 1Z1IA 4FOUC 4YTAA 1QNJA 1HRTH 5E2OA 3RXPA 1G37A 1MU6B 1VJAU 3FP7E 3KYFA 1GL1A 3EA7A 1BQYA 4ABAA 5KEDA 1A61H 1YCPH 3P6ZB 2VNTA 2XC5A 1PJPA 2F9OA 2V6NA 1EJNA 2PTCE 1C5YB 3M5MA 2OC0A 4FVBA 5EXNA 2XRCA 3N99A 1ZSKA 3A85A 1WDIA 3O8BA 5CMXH 4LXBH 1HDTH 3ZVEA 2YMSC 4NFFA 1GI9B 2EQNA 3SV9A 1MCVA 2EY4C 4MTBA 3UQOA 4YOJA 1HAIH 4JZEH 3M5OA 2RDEA 1WQVH 1ANCA 2G4UA 5C20A 1EXFA 2BLWA 1QL9A 1COWD 3TH2H 2BDYA 3KN2A 1QJ6B 2RFKC 5EOKA 3WWBA 4TPIZ 3RXUA 1GMCG 4RT0A 2XBXA 1G3EA 1BJUA 2L74A 2BD7A 1QJ1B 2FLBH 1ARBA 4M7GA 4Z0KA 2CMYA 3AK5A 1ORFA 1TONA 1GJ8B 1EB2A 2XTTB 2PKAB 1OWJA 5T6FA 3SZEA 2ZGXH 5CHAC 2TGAA 1SHHB 1H1BA 1TGCA 4DY7B 4IW4E 4ZUHA 2G4TA 2JH0D 4O9VA 1MAXA 1BRCE 1P57B 2QE7D 4K8YA 4WXIA 4AYYB 1NZQH 1Y5AT 5FPTA 4GCHF 5EIYA 2UWPA 2Q1JA 3QO6A 3RMNH 5HXFA 5IK2D 1TRNA 1EOLA 1Z8IB 1YC0A 2QN5T 1NBME 2ZHFH 2XCFA 1CBWB 2OCVB 4GPGA 4XBBA 1C2JA 1SI5H 1EFRD 1TFXA 2AEIH 7LPRA 2BD9A 4UFFH 1CBWC 1Y3YA 3ZVCA 2HOBA 1TYNA 3AAUA 3ZVAA 3BEUA 1C1PA 4TSFD 4HTCH 4H42U 1SHYA 3Q3KA 4MPXA 3E0NB 3PYHA 4AFZA 1OS8A 3PLPA 2P94A 1Y8TA 1SGQE 1WYKA 3GY2A 4IC5A 4O3TA 1AI8H 1AFEH 3KQEA 2XC0A 1SLXB 2W26A 1O3PB 2ZGJA 3AVZA 5GDSH 3RC4A 2BD4A 1ZGVA 3UPEA 1H8DH 1DWDH 5F8ZA 2YMSD 4DURA 2ZTYA 1A0JA 1DANH 1T4VH 1GHWH 2AMPA 1ETSH 1FY1A 2FOGA 3VFEA 1CU1A 4TWWA 4K8BA 3GOVB 1G32B 2IJOB 5DG6A 1SOTA 1SGYE 3U1JB 1VJ9U 3U1IB 3BG8A 1QURH 1EZUC 3URCA 2A4QA 4Q7ZA 1GI1A 1Q2WA 1UHBB 1ZTJA 1ELGA 2ZFPH 4YLQH 1FIWA 1Y3VA 1SSXA 4RSPA 4CRDA 1AFQB 1MTVA 1RFNA 3SUDA 1YPLH 3O8CA 2GDEH 2QF0A 3LIWA 2GX4A 3SU3A 1C1TA 1XUJA 1QRXA 2SNWA 2F9VA 3GCTF 2BVXH 1TA6A 4GAWA 2SGAA 2O9QA 3PV4A 3RXFA 3UR9A 4YOGA 3M5LA 5C94A 3A7XA 2JETC 4KTSA 3RMLH 3VXEH 2J92A 5FBEA 6GCHG 1ESTA 2WHXA 3VEQB 2WPIS 1TQ0B 1EAUA 3RXGA 1C1SA 1XVOA 3SNAA 3VG8A 1G2MA 1BTYA 2Y5HA 1DVAH 2R0KA 3A81A 1L1NA 3QX5H 1GBCA 4BAQB 2Z3CA 1CGIE 4XSKU 2QGRA 1XUHA 1MH0A 3T28A 1TNGA 2VB0A 5HMAA 4BTTB 3V0XA 5GPIB 2FTLE 1Z8RA 2BD5A 1OWEA 4CRCA 3S7KB 3R3GB 1EJMA 1ELEE 3H7TA 4WJG2 3SU0A 4ZHLU 1OPHB 2AMDA 2ZECA 4FU9A 1GJAB 4OS5A 1TBZH 1C5LH 2GTBA 6ESTA 4F49A 1QTFA 2M2AA 1FMGA 4JZ1A 5HIZA 3SYJA 4MNWA 1V2QT 2ZHDA 4B2CA 3A89A 1O36A 4AYVB 1AU8A 2I6SA 4NZQA 1TAWA 2H9HA 1BBRH 1ABIH 1FY8E 4GHQA 5DSFA 3V3MA 3W94A 1BTXA 4Y0YE 1W13U 2A2XH 1SB1H 3NK8A 3ATMA 4X8SH 5IDKA 2R3YA 1V2MT 5HM9A 1TPAE 1KLJH 4I8HA 4OGYA 5JB8S 5DP5A 2D1JA 2AIPA 1L1GA 1C5QA 2P3UB 1KTTB 2HVYB 4D9QA 1F7ZA 1GHVH 3BEIB 1O2UA 5BRRE 3PRBA 3F0OA 3N7DA 3SNEA 1HXEH 1A1RA 3F2FA 1KY9A 1ZTLA 2RA3A 4NSYA 1O5AB 1RIWC 2J95A 1QIXB 4X8TH 1WTHD 2FO9A 3PO1C 1BMNH 2CK3D 1GMDG 1NTPA 5FPSA 1C5RA 1WCZA 1YBWA 4I32A 2UWOA 1BA8B 2BHGA 3LONA 2ZFSA 4E06H 5EW1H 7ESTE 2W6ID 1WSSH 4MPWA 1EASA 1V2ST 2J98A 2ZNKH 2QF5A 1TNIA 1TPOA 1FPCH 1TPSA 1SOZA 5C3NA 1JIMA 3DD2H 3Q76A 3ESTA 1TWXB 1Z7KA 4JCNA 3D65E 1W8BH 1F5RA 1IQNA 1YLNA 3QTOH 1GJ9B 3SW2B 4IGDA 2FLRH 2F4LA 1GBDA 1ELDE 1CQQA 1XVMA 2I6QA 2P3FH 1P2JA 1UVUH 2Z3EA 3A84A 5FAHA 1O34A 4X2VA 1M9UA 1THPB 2VIQA 1NY22 1P01A 1EOJA 3R0FA 7KMEH 5A0AE 1RRKA 1C5SA 2ANWA 5EQRA 2PP6A 1DLKB 3L6PA 1TB6H 3RXLA 2ALPA 2FYRA 2J34A 5E0JA 2WV5A 4TY6A 1DWCH 3IG6B 1AE8H 4ZKOU 1DPOA 1QJ7B 1XKAC 2FDAA 7GCHF 1W7GH 3RM0H 3PLKA 5K0HA 5G4BA 1J15A 4MNYA 2F83A 2W7SA 3VB3A 1EZXC 1MTNB 5DP4A 5C1XA 3NXPA 1C5OH 3G01A 1BCUH 3EGKH 3DSOA 2J5UA 1GGDC 4KGAA 3SBKA 1W12U 3ZYDA 3MQKC 1YWUA 1PPBH 4X6OA 3GCTG 3UOUA 3BTWE 3CS7A 4MNXA 1EUFA 2FESH 1WOFA 1CT4E 2Y80A 4XBDA 3S69A 3P92A 4NIVA 1C1QA 1GHBG 3A8DA 5JBBS 1TPPA 1FN8A 2KR7A 3BIVH 3V13A 1B0FA 2FXRA 1LVBA 1ZMJA 1EZSC 1OOKB 1DWBH 1WQSA 3PWCA 2BVRH 2BDCA 1CA0C 1GL0E 2H9EH 4KTUA 1TE0A 1BMMH 4X6PA 3Q3XA 3VB5A 3UWIA 1GMHF 3O8RA 4Z6AH 4NFEA 5HIYA 4AORA 1AZ8A 4ISNA 3MO9A 5FBIA 3RXDA 2TRMA 1YKTA 4DCDA 1RGQA 2A4OA 3SI4H 4BAKB 9ESTA 3CNRA 1B5GH 1HBTH 1DDJA 3LGUA 1Z6EA 1LQDB 1CGJE 2P8OC 3KQCA 4GHTA 3FANA 1DM4B 1GHZA 2ANMH 1GGDB 1MCTA 1P2NA 2AGGX 4WF8A 4AFUA 2F9PA 3KEEA 1K9OE 2VU8E 3D49H 3IITA 1W0JD 6LPRA 4FUJA 5ESTE 1P2OA 4AX9H 3S0NA 1G2LA 1P9UA 2JH6D 3OEHD 4VGCC 4Y76A 4GCHG 4Q4LA 3VB7A 2ZDMA 1K1MA 3RU4D 3F68H 1UVTH 3LT3A 1RTKA 4UFEH 1XXFA 2CXVA 1TALA 1A46H 2BQ7B 1LHGH 1KDQB 4UD9H 1IQEA 3M35A 1S81A 2VIOA 3TGKE 2OXSA 1L0ZA 2VWNA 1UTJA 2BXUH 3NPSA 2JKHA 5A8ZA 1WTGH 1HIAA 2OBQA 2H9TH 4WMDA 2ZWLH 2KAIB 3GY6A 1K0HA 3UIRA 2P59A 2ZDAH 3F2GA 1BITA 1QRZA 3GCHB 2UUKB 2GV7A 1BRUP 4K69A 2XBVA 2ZQ1A 2BD8A 1LPZB 1LTOA 2THFB 3I77A 4K2YA 5E0GA 1ZSLA 4ISHH 1GI2A 1BMAA 4TPYA 2ZPRA 1O2TA 3DCLA 1J14A 2BLQA 5A8XA 1PPCE 3BTFE 3VXFH 3A7WA 2BVSH 1V2JT 2UUFB 1GBMA 1S82A 3BSQA 1Y5UT 1BRAA 1SGTA 1G3BA 1ZYOA 2O8MA 4WXVA 4IN2A 1TX6A 4B2AA 4UFDH 1KIGH 1P09A 3NRLA 1YLDA 1WAYB 1C5WB 1NFXA 1CHGA 1UVOA 4XBCA 1HJ9A 1NRQH 6CHAC 5JBTA 1BMFD 4UE7H 3OTPA 3GCOA 4X2YA 4MVNA 1C9TA 1D9IA 1JIRA 2FIRH 3QN7A 2XOKD 2GCTB 1HLTH 4MG3A 1GHXH 4X2WA 1H9LB 4B74A 2YNBA 1S84A 2K8IA 4H6TA 1RS0A 5ESBA 3RXSA 2ALVA 1K1JA 3A82A 2R3UA 1AMHA 1FV9A 2TGTA 1W14U 4GSOA 4FUEA 4BTUB 2ZEBA 1G3DA 2FM2A 2G5VA 3S9AA 1SQTA 1OXGA 3FVFB 5T6GA 4Y10E 3KCGH 3T2NA 4ZAEA 1JMOH 1KDQA 4X1SU 1SLUB 3A7TA 1V2UT 3OAAD 1C2MA 1GCTB 1LCYA 1NO9H 1ZJDA 3DUXH 4IC6A 3S9BA 4U2WA 3F6UH 1HXFH 1O3BA 5A2MH 3GISB 2QAAA 1S0QA 1XX9A 3SV7A 4UFGH 2ZDLA 1UO6A 2KCYA 1LMWB 1ZPBA 1F92A 2B0FA 4JYTA 4XRNA 2GMTC 1FNIA 3SUFA 1SC8U 1HGTH 4NWLA 1WV7H 3ODFA 4AGKA 5C0UA 1MABB 3LGYA 3UNQA 1ZOMA 2W7UA 1BZXE 2ZGHA 1UK2A 2FX4A 5A09A 4ABDA 2C8XB 3PM3A 4LZ4B 2G00A 3LU9B 2ZFTA 3SGBE 4INHA 3SU4A 1NFUA 1C2HA 4YZUA 1HPGA 4FU7A 1GPZA 2FOAA 1ANBA 3VPKA 2KCPA 3MOCA 4FUHA 4HGCA 3VGCC 1KLTA 1EAXA 1O0DH 2QY0B 3K6YA 4J1YA 4P00A 3NZIA 1P3CA 1TLDA 1QB6A 5KECA 1GBLA 3SHCH 4CBNA 1EZQA 1Y3UA 2RCEA 1E1RD 4ACAA 3GY5A 1KTSB 1DSTA 4MPUA 4SGAE 5C5OA 1ETTH 3AASA 1ZPZA 1UTKA 3TH4H 4BNRA 4IMQA 1CGHA 3P95A 1V2OT 2PUXB 1FAKH 4JK5A 2EI6A 2A0QB 2GD4B 1FLEE 1GMDF 4CBOA 2PSXA 3EE0B 2FS9A 1ZHRA 1TNHA 2BX3A 1O3DA 2FOHA 1OWHA 1KXDA 1P02A 2PLXA 4X8UH 1NU9A 1MBQA 1K1OA 4J2YB 4UONA 3KF2A 5A8YA 3LDXH 1BIOA 1NFYA 3P8GA 1WUNH 1O3MA 1UCYK 3TJUA 2TGDA 1IQMA 1O38A 2SGEE 1GBEA 2C90B 1LO6A 3GICB 2NU2E 4ISLA 3ATLA 1TGSZ 1VCPA 4YOIA 2PR3A 2Y81A 3MYWA 3ZZDA 1O3CA 2A31A 1O3FA 2ZA5A 3RXCA 4XOJA 2BY5X 2ZC9H 2C4FH 5H4IB 3KQBA 1QL7A 2HVXA 4IS5A 4Y11E 4BOHA 1MTUA 2H5DA 5AVDA 2LELA 2PV9B 1GJ4H 3UUZA 1UTOA 1GVZA 3KIDU 4D7FA 2Z6BD 2K1QA 4ISIH 3MO6A 1DLEA 1JWTA 1OSSA 4B6EA 3TH3H 3U8RH 1LVMA 4Y71A 4I8LA 5L2YH 4I8KA 2VGCC 2GVFA 3STJA 1MZAA 2A32A 1GI8B 1E37B 4XD7D 5DK1A 5EW2H 2C8YB 2A7HA 4Y7BA 5EJLA 4A1XA 2GMTB 2O8UA 3NKKA 8GCHG 1V2TT 5LGOA 1INCA 2WUBA 5EXMA 1GBAA 4B76A 2F9NA 3BEFB 2QXJA 3ZZ5A 1C1UH 3BTTE 1UJ1A 1DFPA 1MU8B 1W0KD 2AH4X 1BRBE 1HJ8A 2ZG0H 1O2OA 4AN7A 1DT2A 4JZIA 1BB0B 4YLUA 1BOQA 1V2PT 1O39A 3TJNA 1LQEA 3TITA 1GBKA 5JBCS 4HZHA 3B23B 3A87A 3E90B 1SGPE 4DOQA 3SGQE 3DSGA 1PYTD 2JETB 1GI4A 1QFKH 3PMBB 2PW8H 3TVJB 3UB0A 2STBE 1T8OA 1W11U 3F2HA 2W6JD 1ELCA 4BANB 1SLVB 2KCOA 1EX3A 1C4U2 3ZZAA 3RXTA 4CHAC 4A5TS 2YOLA 1FIZA 2VWLA 4FUBA 3GY3A 1LPGB 1PYTC 4X1PU 4H4FA 1C4V2 2ODYB 1P2IA 2TGPZ 1TRMA 1YPGH 1Z71A 2XCNA 3QK1A 4JZFH 2SNVA 2OK5A 5GXPA 2QCYA 1GJBB 3BTKE 1B7XB 2F3CE 2DUCA 2GT8A 3MO3A 3OE7D 1IQHA 1C5XB 5DP6A 5A0BA 5F53A 1NN6A 1AKSA 1C1NA 2STAE 1F5LA 5EJZA 1IHTH 2V3OH 4NCYA 3TJVA 2C93B 1C2LA 5L2ZH 5DP3A 2PGBB 3SJ8A 1A7SA 1EAWA 6GCHF 3RXKA 3RXAA 1S5SA 1A4WH 3SZNA 2BYAX 1DOJA 4NZLA 1GI5A 4XDEA 3P70B 1HYLA 3T62A 3W95A 1W2KH 2ZQ2A 1EPTB 2PTNA 2V3MA 5EJ1A 3RDZA 3DSPA 2BMGB 1F2SE 2ZDNA 2SGPE 3ZZ3A 1L4DA 3ZVGA 2BM2A 2WPMS 3TIUA 5J4SA 4AC9A 4HG6A 3RXEA 4X0WU 5HKKD 1NT1A 1FONA 4AG2A 1O3KA 1QL8A 2H5CA 3SU6A 3RC6A 2K0QA 3E91A 2ZHEH 1OWIA 1K22H 1V2LT 1XUIA 2ZFFH 1YPKH 3MFJA 3BG4C 1O2HA 3A88A 1G30B 4R8TB 5DJ7A 3SHAH 3QZQA 1UTMA 5AFZH 1C2IA 2ZTXA 3HGNA 1E79D 5EQSA 1TIOA 3A8CA 4P02A 4DVAU 1W7XH 3Q3YA 2YNAA 1PPZA 5ABWA 2H1UA 3LGIA 1EJAA 4CRFA 1O32A 1MTNC 3EAJA 1AUTC 3M37A 1A3BH 3RXVA 3JZ1B 1WXRA 1FUJA 3M3VA 1S83A 2WPDD 1PPEE 1CT0E 2V3HH 1YP9A 2CN0H 2OC1A 3M61U 1DWEH 1YPJH 1GCDA 3UR6A 3ZZ8A 4SGBE 2HRVA 3A86A 2SGQE 2PUQH 1O31A 2VVCA 2L6OA 5FL7D 3PLBA 4CR5A 4INLA 3BTGE 2BDGA 2DE8A 1C2FA 1O30A 1RIWB 4I33A 4E7NA 1O2MA 1MZDA 4AB9A 2G55A 4MLFB 1C2EA 1ELVA 2IN2A 3RXIA 1K1NA 5GNDA 1ESBA 2JJ1D 1SGFG 1TBQH 4ABGA 2IJD1 3LGWA 5DN6D 5CDFE 4JK6A 2F9BH 2ZGCA 1F0RA 3RUOA 2LP6A 2XWAA 4HI3A 1FDPA 1HNEE 1SBWA 4B2BA 2Z9IA 1F0UA 5I46H 1SGFA 2ZKSA 2ZI2H 4ABIA 3SV2H 1O3LA 1VGCC 3WY8A 1AQ7A 3M3SA 1SMFE 1GBHA 1RTLA 2JIZD 3UFAA 2PWXA 4ASUD 5K7RA 1FZZA 1ESAA 5FXLA 2J4IA 3P8NA 5DKMA 2KCAA 3SU5A 4Y8XA 4NA7A 1HAYB 1MKXK 4ZKSU 3TPIZ 1K1IA 1BHXF 3RU4E 1THSH 1F5KU 1ZLRA 4E05H 2BX4A 2GT7A 2J2UA 2J38A 1P05A 2ZFQH 1MKWK 2OTVA 1Y59T 3MU5A 1AB9C 1H9HE 2PGQB 4TY7A 4FXGH 2Y5FA 1E1QD 1C5VA 3FZDA 1GWAA 2HALA 2W3KA 1C5UA 1FY5A 1XUFA 2OUAA 4GLYA 2H2ZA 3VGCB 3RMMH 4BXSA 1C9PA 5F03A 4Q2KA 2KFWA 2GKVE 1OP8A 3FOAA 3URDA 2WYJA 2GP9B 1HJAB 4JYVH 1AVXA 2FOBA 3Q77A 4I7YH 5C17A 1RXPA 1ACBE 2AGIX 1KXEA 4OS6A 5F8TA 2Z3DA 1C2DA 3SJKA 1Y5BT 4K1TA 1PFXC 2ZHWH 3LH3A 3NWUA 2AERH 1FI8A 1TOCB 3M36A 4ZKNU 3SUEA 1E0FD 5DO4H 3A7YA 2ZU1A 2EA3A 2FZZA 2O8TA 3E3TA 1NRNH 1O2GH 1GJ7B 1SFQB 1CA0B 2H6MA 1AY6H 2J98B 5C0TA 5DP9A 2ZDVH 3BTHE 2VWOA 1ZRKA 1OWKA 3BTDE 2G52A 1AVWA 4OGXA 5JB9S 1SGEE 1S6HA 2BY7X 1GVLA 2KX4A 3DT0H 1IQIA 2VVVA 5I25A 1V6DA 1QQUA 1PQAA 2G8TA 1HFDA 3VB6A 1NS3A 1KXAA 3SGAE 4AOQA 1ZSJA 3PMJA 4X8VH 1HAHH 3KYGA 3A7ZA 3SV8A 1D3TB 3L33A 2HGTH 3PMHB 1MKXH 1O2QA 2A45B 1BTUA 4LK4A 4GVUA 3ATIA 3QWCH 1O3GA 4F4OC 3L3TA 2QYIA 1UVSH 4D76A 1LDTT 2D26C 4UDWH 3KQ5A 5EPNA 2AMQA 4A92A 3EYDA 3ZZ7A 1O5EH 1YGCH 1O2IA 1TX8A 3GY4A 4JMYA 1O3HA 1ABJH 1Z8GA 3NUMA 2GDDA 1GHAG 1O2YA 1GJ5H 1QBVH 1QCPA 3GDUA 5EQQA 2D8WA 2PFEA 1CT2E 4AG1A 3OTJE 1XKBC 5DP8A 1B0EA 1J16A 3PB1E 1MUEB 4TWYA 1EQ9A 2BLVA 1VZQH 4CH8B 4ABFA 1IQJA 2ESTE 3T25A 3RXQA 3SQEE 5AF9H 3GYMA 3MH7A 2FPZA 5EXLA 4A1VA 4B75A 2BDHA 3SNBA 3RXJA 3U98H 2WYGA 2B5TB 4DW2U 5HYOA 1E34B 1V2KT 1RJXB 4CH2B 2PSYA 2ULLA 1C1WH 4FUIA 5GJ4B 2ZDKA 4B6FA 3H09A 1MKWH 5C5NA 1GG6B 4OM9A 3QDZB 1LHDH 3RU4T 1QY6A 4GUXA 1NM6A 2ZCKP 1C5TA 1O2SA 5DP7A 3UQVA 1P10A 2G51A 2HPPH 2ZIQH 5B6LA 3SQHE 1KXCA 2XC4A 5GCHG 1SGDE 2J94A 2G5NA 1DITH 1G3CA 5PTPA 1D3QB 4MQAA 3A80A 1GI7B 1P2KA 2ZF0H 2P93A 4THNH 1LKAA 2Q6FA 1C1OA 5CHBA 4KELA 2Z9JA 2Z7FE 1P0SH 4HFPB 4I31A 2BZ6H 1THRH 2WPJS 3CS0A 4WH8A 4ISOA 4RN6A 2YMSB 1O3IA 1HV7A 2XBYA 4K60A 4DT7B 4D7GA 4FUGA 5SGAE 3H5CB 1PQ7A 1C5ZB 1AB9B 5LPRA 1DE7H 1WU1A 3QGJA 2JJ2D 3WWFA 1AN1E 1O3NA 1W3CA 4TT3D 4BAMB 4ZROA 1P03A 2QF4A 2XNIA 2BDBA 1ETRH 5C67A 3C27B 1A5GH 4BAHB 3LKWA 1ELBA 1W0ZU 4I86A 1KSNA 4DJZB 1QB9A 1YYY1 1LHEH 1QA7A 3F0PA 1BBRK 1J8AA 2BB4A 4MDSA 1N1LA 4UEHH 2BD2A 1J9CH 1ZPCA 4INKA 2WPKS 2NU1E 3OU0A 1BBRE 3RP2A 2Y7ZA 3ZVBA 8LPRA 3OEED 1QRWA 3HGPA 2WPHS 1A0LA 1IQKA 1VITH 1ZHMA 2LPRA 1UVPA 5DPAA 3RC5A 4M9FA 5JPMH 2BY6X 1HAGE 1UW7A 2Y82A 1U6QA 3ELAH 4OS7A 1NROH 2NU3E 1O2RA 2FTMA 1V2RT 2GCTC 3RM2H 3DFJA 1V2WT 1VITG 2Z9LA 1HAXB 4DGJA 2BZAA 1AVGH 3KL6A 3E1XB 4WMEA 3UNRA 4Z1MD 3MH4A 3FP8E 3VB4A 1MBMA 4I8JA 1O2WA 1T8NA 1HAVA 1AHTH 2QF3A 4OS4A 3LC3A 3V12A 2OQ5A 3PRDA 4FETA 1ZMLA 1FY4A 5L6NH 3GCHC 3LOXA 1NU7B 1MQ6A 2A2QH 4RI0A 4K5ZA 2VIPA 2GGVB 1L1JA 3LGVA 1QHRB 3AAVA 3RXRA 3TK5A 3RLYH 3TGJE 2QIQA 2IOTA 1PQ5A 1RD3B 1SL3A 2FODA 1EKBB 4Y6DA 2UWLA 2VH0A 2BY8X 1UTLM 2BXTH 2VIWA 3O8DA 3TU7H 2TPIZ 1S6FA 1XUKA 3SN8A 3UY9A 1GG6C 1N8OC 2A4GA 5T6DA 3M5NA 1AIXH 3SU1A 5DGJA 1GHBF 1K2I1 2C8ZB 5AHGH 2QXHA 4F48B 4ABHA 3LJOA 1Z8JB 4B71A 5E8EH 5GIBA 4Y7AA 1MAYA 1PPHE 2VIVA 2OINA 5LPEA 1Q31A 4Y0ZE 3PV2A 2Y6TA 5KGOA 4FU8A 1GJDB 3UNSA 4CRAA 5E2PA 1TBRH 2SFAA 4U32A 2OC8A 2V7QD 1AZZA 1GI6A 1GDUA 3F9FA 2AGEX 2KZ4A 1AO5A 1AD8H 1BTZA 1SKYE 1A5HA 1LVOA 3HATH 5FX5A 5GWZA 2FEQH 2ZFRH 1UCYH 3SOSA 2ZU3A 4YO9A 3T5FH 4RT1A 1T32A 1BTWA 3F1SB 8KME2 9LPRA 2XYAA 3TK9A 2V35A 3FAOA 1A2CH 2FYQA 4U30A 1UMAH 2GCHF 3WW7A 1BDAA 4TYDA 4ZHMU 1V2VT 1BT7A 1LHFH 1C1VH 1EAIA 3MNBA 4I8GA 2PKAA 2ASUB 2OLGA 5F8XA 4YM9A 2IPHA 2LNCA 4XFQA 1C5MD 3A8AA 5EG4A 1OX1A 3FKSD 5FX6A 1ANDA 1P8VC 1QR3E 4ASHA 2BQ6B 3F9HA 3U8TH 2BY9X 3P8FA 5EODA 2KM0A 1CHOF 1TGBA 2Y7XA 3FN8A 1GDQA 2A7JA 3K65B 3PTBA 2ILNA 4NG9H 3TNSA 2OC7A 2RDLA 1YPHC 1T8LA 2O8WA 4DIHH 4WH6A 2JH5D 1GVKB 3MHWU 3HPTB 3MU8A 3HK6B 1AKSB 3QLPH 3OY6U 3ZV9A 2FX6A 3M3TA 3RMOH 1VCQA 2O8LA 1MMJN 4X2XA 3RXHA 4X6NA 1ZR0A 3GDSA 4ZXXH 4A1TA 2J9NA 3ATKA 5FPYA 4CRGA 1YCPM 1FPHH 2AYWA 1NRSH 1A5IA 1FY3A 2GV6A 1ZJKA 1TMUH 2BD3A 3C1KA 1IQGA 2D2DA 1ZZZA 1O2LA 3TNTA 1A3EH 1D4PB 3MNSA 3CENA 4FUDA 1S6LA 4ABJA 1J17T 3B8JA 2A5KA 1O35A 3BG4B 3H7OA 4KP0A 1GBBA 3AW1A 3V7TA 3EA9A 1TABE 3KQDA 2CV3A 3LGTA 3DFLA 3QZRA 2ZCLP 4IBLH 4RKOB 1JRSA 5E0HA 2WINI 1OP0A 3P17H 1O2PA 1ELFA 3MU1A 4QT8C 5CHAB 4KTCA 4IMZA 1HAZB 2HLDD 5FCRA 2WPLS 5FHTA 3ZVDA 4ABBA 2OBOA 4X1RU 4NIXA 2TBSA 1Q3XA 2A1DB 3SI3H 1BMLA 4Y8YA 2HPQH 1YY3A 1KYNA 2PHBA 1UTQA 5TCCA 4NIYA 2XBWA 1O3OA 3MU4A 1C2KA 2F9UA 4A6LA 1P12E 4NA8A 5JYIA 3W1EA 5LH8A 1OP2A 2VBCA 3SJ9A 1SVPA 3ZZ6A 1K1LA 1XM1A 1GJ6A 1SGRE 2UUYA 8GCHF 1S0RA 4CRBA 1D3DB 1DXPA 4D8NA 1GDNA 3KNXA 1SQRA 1TNLA 2OQUA 1FJSA 1D3PB 1JOUB 1ZMNA 3JZ2B 1UTPA 3ZYEA 2WV4A 3LC5A 1VKYA 3E0PB 1TMBH 1K1PA 3ZVFA 1VR1H 1BTHH 1L4ZA 1W0YH 3MU0A 5GCHF 3BF6H 1BUIA 2B9LA 2AFQB 1V3XA 2W3IA 5JBAS 3BTEE 5EPYA 1T31A 1LKBA 3ZIAD 3ENSB 1OHHD 1H8HD 1VGCB 1CA8B 1ID5H 1V2NT 2ZGBH 1CVWH 1EB1H 4NWKA 2NWNA 1MTSA 4KKDA 4AGJA 4BXWA 2FOFA 4ZKRU 3P8OA 1O2VA 1HUTH 7GCHG 2BQWB 1P9SA 4Y79A 1AWFH 1QA0A 5HGGA 4ZH8A 3SORA 3SV6A 1QBOA 3K2UA 1O2NA 1SG8B 2AS9A 2P95A 2QXIA 2FOMB 4X1NU 4MPVA 2R0LA 1SLWB 1EPTC 1TRYA 1MQ5A 2FI4E 1IQFA 1O5BB 1KXFA 2XWBI 2ODQA 2ANKH 3K9XB 3BTME 1LVYA 3HK3B 4YT7H 1P2QA 1DXWA 1AUJA 1Z6JH 1GBIA 3LPRA 4WMFA 1CSOE 3FO8D 4K1SA 1ZHPA 4ZCNA 3T26A 1G36A 1YPHE 2EC9H 2ZO3H 3STIA 3M7TA 3TJOA 2AHME 2ZCHP 4DG4A 1BHXB 1OYQA 1HAVB 3K6ZA 1D6RA 1SGCA 2WV9A 1CO7E 1GI3A 2KAIA 3PO1B 1SR5C 4O3UA 1KLIH 1YLCA 2GZ7A 4ACBA 3MI4A 3MTYA 1C5NH 4OS2A 4LZ1H 3AW0A 4JYUH 2PKSC 3EQ0H 3PMAB 1K28D 3U69H 3GY8A 2GJGA 3A83A 2BOHB 1AWHB 1O3JA 2FWWA 1P2MA 2FMJA 4H6SB 1O5FH 3GYLB 3SNDA 1SFIA 3GS9A 2EI7A 1C5PA 3TLOA 2ODPA 4F55A 1DUAA 1O2ZA 4CREA 2CGAA 1XUGA 1GMCF 1NRRH 3PWBA 5FCKA 3ZZ9A 5T1VA 5T3HA 3EE7A 1Z1JA 1MTWA 1P11E 2WUCA 1T8MA 1SGNE 2JDID 2P8OB 2VWMA 2WSSD 1ELTA 4AB8A 1VCWA 2SGDE 4WWYA 4Q63A 3CP7A 4B73A 3E6PH 1E38B 2ZPQA 1EPTA 1LHCH 4FUCA 1YPMH 1FAXA 4OS1A 5TJXA 3RXOA 2C8WB 5LPFA 2QXGA 4AFQA 4VGCB 2VH6A 2SGFE 1QBNA 3S9CA 2B8OH 3Q00A 3S7HB 1NBMD 3OSYA 1O3AA 4U01A 3LJJA 2BOKA 4D9RA 3MWIU 2QV1A 1N6YA 3PROA 2FI5E 1H9IE 2OP9A 3ZZCA 1O3EA 1QB1A 1RTFB 1ELAA 3QTVH 2GZ8A 5AFYH 1JBUH 1H8IH 1ZRBA 4NA9H 1MD7A 2GZ9A 3T29A 2XXLA 1Y3WA 3MH6A 1KXBA 3BTQE 1P04A 2CF9H 3SJIA 3D62A 1F0TA 2CHAB 1UTNA 1L2EA 3UAIC 5J4QA 2A4RA 1XXDA 2F91A 2ZP0H 3D23A 2Z94A 2HWLB 1FQ3A 1TA2A 2CJIA 2P3TB 1F0SA 1ZTKA 5EGMA 1UK3A 3TGIE 2TIOA 2P16A 2V0BA 8ESTE 1CE5A 4PROA 2M5TA 3OYPA 1LPKB 1TQ7B 3PTNA 3NCLA 3M7UA 1TX7A 3MNXA 5C1YA 1ANEA 1TGNA 2GCHG 1GBFA 4ABEA 1Y3XA 4LOYH 1E35B 1QGFA 2ZTZA 3KHVA 2VINA 2A5AA 3DA9B 1O33A 4K3JA 4DIIH 3E16B 3DHKH 3KGPA 3ITIA 2Q6DA 3IWMA 4X1QU 1XMNB 2J97A 4ZXYH 2FOEA 3T27A 3N7OA 5CE1A 2BDIA 3M7QA 1IAUA 1JXPA 1TNJA 3F9EA 4FUFA 1UHBA 4NSVA 1CHOG 2ZU5A 4R0IA 3SJOA 1S85A 2R9PA 3SO3A 1O5CB 1G9IE 1EP5A 2RA0A 3OFND 4JZDH 1O5GH 4ZHAA 1NC6A 2NU4E 2ANYA 2R2MB 3E8LA 4Q7XA 2BLOA 1WBGB 3MH5A 2ZU4A 1YPEH 1UCYE 2PKSB 1AE5A 2BDAA 4B1TA 1JRTA 4BAOB 2IPQX 3TK6A 1SPJA 4IN1A 3ZV8A 4AZ2B 3A7VA 1GBTA 3MMGA 1T4UH 2WZQA 1C1MA 4RKJB 1PPFE 3UREA 3QUMP 4WVPE 1O2JA 2W5EA 1BJVA 2Z9GA 2RG3A 1W10U 4YXWD 5HM2A 1PPGE 5C2ZA 4CR9A 3RLWH 3GY7A 1HCGA 4Q7YA 5C1UA 1SQAA 1DICA 3ZZ4A 1BTPA 1P3EA 1HJAC 1IQLA 1E36B 1DSUA 1YCPK 1ZGIA 4X6MA 4BTIB 3BV9B 2Y5GA 3BIUH 3UTUH 1H8ED 4NGAH 1NFWA 4E7RG 3ZZBA 1IHSH 1VITF 5A0CA 1OWDA 2FOCA 1T7CA 4YT6H 4NIWA 2BTCE 3QGNB 6CHAB 5BPEA 1TMTH 1D6WA 1TOMH 2UUJB 3N7EA 2HNTE 5EU8A 4AFSA 2NU0E 2FP7B 1DUEA 1AGJA 1NESE 3ODDA 1DY9A 1H4WA 1GBJA 1OKXA 3U28C 1EATA 4ESTE 1GHAF 1TGTA 2VGCB 1O2KA 3BN9A 2F43B 1HAPH 2C3SA 1ARCA 1N8OB 1GI0A 3MNCA 1MD8A 3HKJB 1OYTH 2DE9A 3F9GA 1FXYA 4FVDA 2HNTF 2CF8H 1QQ4A 3OY5U 3I29A 1SQOA 2A5IA 2EI8A 3ATWA 1N6XA 2ZZUH 2Q6GA 1YM0A 2XW9A 3FP6E 3PV5A 1K21H 1X7AC 3GCNA 1C4Y2 4YESB 1SGIB 1PQ8A 3EA8A 3FFGA 1TNKA 1GJCB 1UK4A
chains in the Genus database with same CATH topology
1O5DH 2B7DH 3SNCA 2EEKA 2OD3B 3U8OH 5B6OA 1GMHG 2AIQA 1YF4A 3B9FH 4Q80A 1IOEA 1NRPH 5ETXA 1GHYH 5JDUB 2HNTC 1FN6A 2CHAC 2VJ1A 3I78A 1HAOH 2ZU2A 4MNVA 1EP6A 3HKIB 2FI3E 4ZMAH 1C2GA 4O97A 1AFQC 2VIDA 3FZZA 1NPMA 2G81E 3UOPA 1DS2E 4WY3A 3UWJH 3SUGA 5TCAA 1A0HB 2R2WU 2A7CA 3A8BA 1HB0B 3GDVA 3RXBA 2VVUA 1HIAB 3U9AH 1C1RA 2Z9KA 3LH1A 2HLCA 3OX7U 1GCTC 4O03A 2ZPSA 4Y8ZA 5IYTA 2QC2A 5L30H 3RXMA 1DY8A 4CHAB 5F6MA 1O2XA 2FS8A 4K1EA 2ZHQH 4XE4A 1O37A 3SU2A 4A7IB 2QA9E 1DX5M 3EDXB 1P06A 1Z1IA 4YTAA 1QNJA 1HRTH 5E2OA 3RXPA 1G37A 1MU6B 1VJAU 3FP7E 1GL1A 3EA7A 1BQYA 4ABAA 1A61H 1YCPH 3P6ZB 2VNTA 2XC5A 1PJPA 2F9OA 2V6NA 1EJNA 2PTCE 1C5YB 3M5MA 2OC0A 4FVBA 5EXNA 2XRCA 3O8BA 1ZSKA 3A85A 5CMXH 4LXBH 1HDTH 3ZVEA 4NFFA 1GI9B 3SV9A 1MCVA 4MTBA 3UQOA 4YOJA 1HAIH 4JZEH 3M5OA 1WQVH 1ANCA 2G4UA 5C20A 1EXFA 2BLWA 1QL9A 3TH2H 2BDYA 3KN2A 1QJ6B 5EOKA 4TPIZ 3RXUA 1GMCG 2XBXA 1G3EA 1BJUA 2BD7A 1QJ1B 2FLBH 1ARBA 4M7GA 4Z0KA 2CMYA 1ORFA 1TONA 1GJ8B 1EB2A 2XTTB 2PKAB 1OWJA 5T6FA 2ZGXH 5CHAC 2TGAA 1SHHB 1H1BA 1TGCA 4DY7B 4IW4E 4ZUHA 2G4TA 2JH0D 4O9VA 1MAXA 1BRCE 1P57B 4K8YA 4WXIA 4AYYB 1NZQH 1Y5AT 5FPTA 4GCHF 2UWPA 2Q1JA 3QO6A 3RMNH 5HXFA 1TRNA 1EOLA 1Z8IB 1YC0A 2QN5T 2ZHFH 2XCFA 1CBWB 2OCVB 4GPGA 4XBBA 1C2JA 1SI5H 2AEIH 1TFXA 7LPRA 2BD9A 4UFFH 1CBWC 1Y3YA 3ZVCA 2HOBA 1TYNA 3AAUA 3ZVAA 3BEUA 1C1PA 4HTCH 4H42U 1SHYA 3Q3KA 4MPXA 3E0NB 3PYHA 4AFZA 1OS8A 3PLPA 2P94A 1Y8TA 1SGQE 1WYKA 3GY2A 4IC5A 4O3TA 1AI8H 1AFEH 3KQEA 2XC0A 1SLXB 2W26A 1O3PB 2ZGJA 3AVZA 5GDSH 3RC4A 2BD4A 1ZGVA 3UPEA 1H8DH 1DWDH 5F8ZA 4DURA 2ZTYA 1A0JA 1DANH 1T4VH 1GHWH 2AMPA 1ETSH 1FY1A 2FOGA 3VFEA 1CU1A 4TWWA 4K8BA 3GOVB 1G32B 2IJOB 5DG6A 1SOTA 1SGYE 3U1JB 1VJ9U 3U1IB 3BG8A 1QURH 1EZUC 3URCA 2A4QA 4Q7ZA 1GI1A 1Q2WA 1UHBB 1ZTJA 1ELGA 2ZFPH 4YLQH 1FIWA 1Y3VA 1SSXA 4RSPA 4CRDA 1AFQB 1MTVA 1RFNA 3SUDA 1YPLH 3O8CA 2GDEH 2QF0A 3LIWA 2GX4A 3SU3A 1C1TA 1XUJA 1QRXA 2SNWA 2F9VA 3GCTF 2BVXH 1TA6A 4GAWA 2SGAA 2O9QA 3PV4A 3RXFA 3UR9A 4YOGA 3M5LA 3A7XA 2JETC 4KTSA 3RMLH 3VXEH 2J92A 5FBEA 6GCHG 1ESTA 3VEQB 2WPIS 1TQ0B 1EAUA 3RXGA 1C1SA 1XVOA 3SNAA 1G2MA 1BTYA 2Y5HA 1DVAH 2R0KA 3A81A 1L1NA 3QX5H 1GBCA 4BAQB 2Z3CA 1CGIE 4XSKU 2QGRA 1XUHA 1MH0A 3T28A 1TNGA 2VB0A 5HMAA 4BTTB 3V0XA 5GPIB 2FTLE 1Z8RA 2BD5A 1OWEA 4CRCA 3S7KB 3R3GB 1EJMA 1ELEE 3H7TA 4WJG2 3SU0A 4ZHLU 1OPHB 2AMDA 2ZECA 4FU9A 1GJAB 4OS5A 1TBZH 1C5LH 2GTBA 6ESTA 4F49A 1QTFA 1FMGA 4JZ1A 4MNWA 1V2QT 2ZHDA 4B2CA 3A89A 1O36A 4AYVB 1AU8A 2I6SA 4NZQA 1TAWA 2H9HA 1BBRH 1ABIH 1FY8E 4GHQA 3V3MA 3W94A 1BTXA 4Y0YE 1W13U 2A2XH 1SB1H 3NK8A 3ATMA 4X8SH 5IDKA 2R3YA 1V2MT 5HM9A 1TPAE 1KLJH 4I8HA 4OGYA 5JB8S 5DP5A 2D1JA 2AIPA 1L1GA 1C5QA 2P3UB 1KTTB 4D9QA 1F7ZA 1GHVH 3BEIB 1O2UA 5BRRE 3SNEA 1HXEH 1A1RA 1KY9A 1ZTLA 2RA3A 4NSYA 1O5AB 1RIWC 2J95A 1QIXB 4X8TH 1WTHD 2FO9A 3PO1C 1BMNH 1GMDG 1NTPA 5FPSA 1C5RA 1WCZA 1YBWA 4I32A 2UWOA 1BA8B 2BHGA 3LONA 2ZFSA 4E06H 5EW1H 7ESTE 4MPWA 1WSSH 1EASA 1V2ST 2ZNKH 1TNIA 1TPOA 1FPCH 1TPSA 1SOZA 5C3NA 1JIMA 3DD2H 3Q76A 3ESTA 1TWXB 1Z7KA 4JCNA 3D65E 1W8BH 1F5RA 1IQNA 3QTOH 1GJ9B 3SW2B 4IGDA 2FLRH 1GBDA 1ELDE 1CQQA 1XVMA 2I6QA 2P3FH 1P2JA 1UVUH 2Z3EA 3A84A 5FAHA 1O34A 4X2VA 1M9UA 1THPB 2VIQA 1NY22 1P01A 1EOJA 3R0FA 7KMEH 5A0AE 1RRKA 1C5SA 2ANWA 5EQRA 1DLKB 3L6PA 1TB6H 3RXLA 2ALPA 2FYRA 2J34A 5E0JA 2WV5A 4TY6A 1DWCH 3IG6B 1AE8H 4ZKOU 1DPOA 1QJ7B 1XKAC 2FDAA 7GCHF 1W7GH 3RM0H 3PLKA 5K0HA 5G4BA 1J15A 4MNYA 2F83A 2W7SA 3VB3A 1EZXC 1MTNB 5DP4A 5C1XA 3NXPA 1C5OH 3G01A 1BCUH 3EGKH 1GGDC 4KGAA 3SBKA 1W12U 3ZYDA 1PPBH 4X6OA 3GCTG 3UOUA 3BTWE 3CS7A 4MNXA 1EUFA 2FESH 1WOFA 1CT4E 2Y80A 4XBDA 3S69A 3P92A 4NIVA 1C1QA 1GHBG 3A8DA 5JBBS 1TPPA 1FN8A 3BIVH 3V13A 1B0FA 2FXRA 1LVBA 1ZMJA 1EZSC 1OOKB 1DWBH 1WQSA 3PWCA 2BVRH 2BDCA 1CA0C 1GL0E 2H9EH 4KTUA 1TE0A 1BMMH 4X6PA 3Q3XA 3VB5A 3UWIA 1GMHF 3O8RA 4Z6AH 4NFEA 4AORA 1AZ8A 4ISNA 3MO9A 5FBIA 3RXDA 2TRMA 1YKTA 4DCDA 1RGQA 2A4OA 3SI4H 4BAKB 9ESTA 1B5GH 1HBTH 1DDJA 3LGUA 1Z6EA 1LQDB 1CGJE 2P8OC 3KQCA 4GHTA 3FANA 1DM4B 1GHZA 2ANMH 1GGDB 1MCTA 1P2NA 2AGGX 4WF8A 4AFUA 2F9PA 3KEEA 1K9OE 2VU8E 3D49H 3IITA 6LPRA 4FUJA 5ESTE 1P2OA 4AX9H 3S0NA 1G2LA 1P9UA 2JH6D 4VGCC 4Y76A 4GCHG 3VB7A 2ZDMA 1K1MA 3RU4D 3F68H 1UVTH 3LT3A 1RTKA 4UFEH 1XXFA 2CXVA 1TALA 1A46H 2BQ7B 1LHGH 1KDQB 4UD9H 1IQEA 3M35A 1S81A 2VIOA 3TGKE 2OXSA 1L0ZA 2VWNA 1UTJA 2BXUH 3NPSA 2JKHA 5A8ZA 1WTGH 1HIAA 2OBQA 2H9TH 4WMDA 2ZWLH 2KAIB 3GY6A 3UIRA 2P59A 2ZDAH 1BITA 1QRZA 3GCHB 2UUKB 2GV7A 1BRUP 4K69A 2XBVA 2ZQ1A 2BD8A 1LPZB 1LTOA 2THFB 3I77A 4K2YA 5E0GA 1ZSLA 4ISHH 1GI2A 1BMAA 4TPYA 2ZPRA 1O2TA 1J14A 2BLQA 5A8XA 1PPCE 3BTFE 3VXFH 3A7WA 2BVSH 1V2JT 2UUFB 1GBMA 1S82A 3BSQA 1Y5UT 1BRAA 1SGTA 1G3BA 1ZYOA 2O8MA 4WXVA 4IN2A 1TX6A 4B2AA 4UFDH 1KIGH 1P09A 1YLDA 1WAYB 1C5WB 1NFXA 1CHGA 1UVOA 4XBCA 1HJ9A 1NRQH 6CHAC 5JBTA 4UE7H 3GCOA 4X2YA 4MVNA 1C9TA 1D9IA 1JIRA 2FIRH 3QN7A 2GCTB 1HLTH 4MG3A 1GHXH 4X2WA 1H9LB 4B74A 2YNBA 1S84A 4H6TA 1RS0A 5ESBA 3RXSA 2ALVA 1K1JA 3A82A 2R3UA 1AMHA 1FV9A 2TGTA 1W14U 4GSOA 4FUEA 4BTUB 2ZEBA 1G3DA 2FM2A 2G5VA 3S9AA 1SQTA 1OXGA 3FVFB 5T6GA 4Y10E 3KCGH 3T2NA 4ZAEA 1JMOH 1KDQA 4X1SU 1SLUB 3A7TA 1V2UT 1C2MA 1GCTB 1LCYA 1NO9H 1ZJDA 3DUXH 4IC6A 3S9BA 4U2WA 3F6UH 1HXFH 1O3BA 5A2MH 3GISB 2QAAA 1S0QA 1XX9A 3SV7A 4UFGH 2ZDLA 1UO6A 1LMWB 1ZPBA 1F92A 2B0FA 4JYTA 2GMTC 1FNIA 3SUFA 1SC8U 1HGTH 4NWLA 1WV7H 3ODFA 4AGKA 3LGYA 3UNQA 1ZOMA 2W7UA 1BZXE 2ZGHA 1UK2A 2FX4A 5A09A 4ABDA 2C8XB 3PM3A 4LZ4B 2G00A 3LU9B 2ZFTA 3SGBE 4INHA 3SU4A 1NFUA 1C2HA 4YZUA 1HPGA 4FU7A 1GPZA 2FOAA 1ANBA 3VPKA 3MOCA 4HGCA 4FUHA 3VGCC 1KLTA 1EAXA 1O0DH 2QY0B 3K6YA 4J1YA 3NZIA 1P3CA 1TLDA 1QB6A 1GBLA 3SHCH 4CBNA 1EZQA 1Y3UA 2RCEA 3GY5A 1KTSB 1DSTA 4MPUA 4SGAE 5C5OA 1ETTH 3AASA 1ZPZA 1UTKA 3TH4H 4BNRA 4IMQA 1CGHA 3P95A 1V2OT 2PUXB 1FAKH 4JK5A 2EI6A 2A0QB 2GD4B 1FLEE 1GMDF 4CBOA 2PSXA 3EE0B 2FS9A 1ZHRA 1TNHA 2BX3A 1O3DA 2FOHA 1OWHA 1KXDA 1P02A 2PLXA 4X8UH 1NU9A 1MBQA 1K1OA 4J2YB 4UONA 3KF2A 5A8YA 3LDXH 1BIOA 1NFYA 3P8GA 1WUNH 1O3MA 1UCYK 3TJUA 2TGDA 1IQMA 1O38A 2SGEE 1GBEA 2C90B 1LO6A 3GICB 2NU2E 4ISLA 3ATLA 1TGSZ 1VCPA 4YOIA 2PR3A 2Y81A 3MYWA 3ZZDA 1O3CA 2A31A 1O3FA 2ZA5A 3RXCA 4XOJA 2BY5X 2ZC9H 2C4FH 5H4IB 3KQBA 1QL7A 2HVXA 4IS5A 4Y11E 4BOHA 1MTUA 2H5DA 5AVDA 2PV9B 1GJ4H 3UUZA 1UTOA 1GVZA 3KIDU 4D7FA 2Z6BD 2K1QA 4ISIH 3MO6A 1DLEA 1JWTA 1OSSA 3TH3H 3U8RH 1LVMA 4Y71A 4I8LA 5L2YH 4I8KA 2VGCC 2GVFA 3STJA 1MZAA 2A32A 1GI8B 1E37B 5DK1A 5EW2H 2C8YB 2A7HA 4Y7BA 4A1XA 2GMTB 2O8UA 3NKKA 8GCHG 1V2TT 5LGOA 1INCA 2WUBA 5EXMA 1GBAA 4B76A 2F9NA 3BEFB 2QXJA 3ZZ5A 1C1UH 3BTTE 1UJ1A 1DFPA 1MU8B 2AH4X 1BRBE 1HJ8A 2ZG0H 1O2OA 4AN7A 1DT2A 4JZIA 1BB0B 4YLUA 1BOQA 1V2PT 1O39A 3TJNA 1LQEA 3TITA 1GBKA 5JBCS 4HZHA 3B23B 3A87A 3E90B 1SGPE 4DOQA 3SGQE 1PYTD 2JETB 1GI4A 1QFKH 3PMBB 2PW8H 3TVJB 2STBE 1T8OA 1W11U 1ELCA 4BANB 1SLVB 1EX3A 1C4U2 3ZZAA 3RXTA 4CHAC 4A5TS 2YOLA 1FIZA 2VWLA 4FUBA 3GY3A 1LPGB 1PYTC 4X1PU 4H4FA 1C4V2 2ODYB 1P2IA 2TGPZ 1TRMA 1YPGH 1Z71A 2XCNA 3QK1A 4JZFH 2SNVA 5GXPA 2QCYA 1GJBB 3BTKE 1B7XB 2F3CE 2DUCA 2GT8A 3MO3A 1IQHA 1C5XB 5DP6A 5A0BA 1NN6A 1AKSA 1C1NA 2STAE 1F5LA 1IHTH 2V3OH 4NCYA 3TJVA 2C93B 1C2LA 5L2ZH 5DP3A 2PGBB 3SJ8A 1A7SA 1EAWA 6GCHF 3RXKA 3RXAA 1S5SA 1A4WH 3SZNA 2BYAX 1DOJA 4NZLA 1GI5A 4XDEA 3P70B 1HYLA 3T62A 3W95A 1W2KH 2ZQ2A 1EPTB 2PTNA 3RDZA 2BMGB 1F2SE 2ZDNA 2SGPE 3ZZ3A 1L4DA 3ZVGA 2BM2A 2WPMS 3TIUA 5J4SA 3RXEA 4X0WU 1NT1A 1FONA 4AG2A 1O3KA 1QL8A 2H5CA 3SU6A 3RC6A 3E91A 2ZHEH 1OWIA 1K22H 1V2LT 1XUIA 2ZFFH 1YPKH 3MFJA 3BG4C 1O2HA 3A88A 1G30B 4R8TB 5DJ7A 3SHAH 3QZQA 1UTMA 5AFZH 1C2IA 2ZTXA 3HGNA 5EQSA 1TIOA 3A8CA 4DVAU 1W7XH 3Q3YA 2YNAA 1PPZA 5ABWA 2H1UA 3LGIA 1EJAA 4CRFA 1O32A 1MTNC 3EAJA 1AUTC 3M37A 1A3BH 3RXVA 3JZ1B 1FUJA 3M3VA 1S83A 1PPEE 1CT0E 2V3HH 1YP9A 2CN0H 2OC1A 3M61U 1DWEH 1YPJH 1GCDA 3UR6A 3ZZ8A 4SGBE 2HRVA 3A86A 2SGQE 2PUQH 1O31A 2VVCA 3PLBA 4CR5A 4INLA 3BTGE 2BDGA 2DE8A 1C2FA 1O30A 1RIWB 4I33A 4E7NA 1O2MA 1MZDA 4AB9A 2G55A 4MLFB 1C2EA 1ELVA 2IN2A 3RXIA 1K1N