1RIWB

Thrombin in complex with natural product inhibitor oscillarin
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
147
structure length
147
Chain Sequence
IVEGSDAEIGMSPWQVMLFRKSPQELLCGASLISDRWVLTAAHCLLYPPWDKNFTENDLLVRIGKHSRTRYERNIEKISMLEKIYIHPRYNWRENLDRDIALMKLKKPVAFSDYIHPVCLPDRETAASLLQAGYKGRVTGWGNLKET
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The N-acyloxyiminium ion aza-Prins route to octahydroindoles: total synthesis and structural confirmation of the antithrombotic marine natural product oscillarin
pubmed doi rcsb
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords thrombin light chain
total genus 28
structure length 147
sequence length 147
ec nomenclature ec 3.4.21.5: Thrombin.
pdb deposition date 2003-11-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1riwB00
2UWLA 2ANMH 1SMFE 4Q7YA 3ZZCA 4LXBH 3K9XB 1SB1H 1EPTB 3OTJE 1GI3A 5DP8A 5EG4A 1OP2A 5LH8A 1TGBA 1UVSH 4MDSA 3RXBA 4I33A 3PO1B 1MBQA 1O2PA 4JK5A 2HRVA 4KKDA 1PQAA 1GBTA 1AGJA 2BXTH 3RU4T 2WYGA 3LGIA 4NIWA 4CRGA 1SGFA 1O2QA 1TABE 1TE0A 5DP9A 3BG4C 4X2XA 2VVVA 1C1OA 5T6FA 5GWZA 3UIRA 6GCHG 1LPZB 1GMCF 1S84A 1VITH 4FUBA 5E0JA 1UJ1A 4BTIB 1G3EA 1ZMNA 2P8OC 1ZTLA 4XE4A 1J17T 2ZWLH 1EPTC 1E38B 1AU8A 4YZUA 1U6QA 2K1QA 4MQAA 3SI4H 4INKA 4CR5A 1ZSLA 2NU4E 5HGGA 1IQHA 5DP6A 1FXYA 2QA9E 3RXPA 1CE5A 3S9AA 3CENA 4MNYA 2FI4E 2R3UA 2F9NA 1SGYE 3SNBA 4X2YA 4CBOA 1S6FA 2BLOA 3TH4H 1SHYA 5FPSA 1JIMA 1QRZA 1HIAA 3AAUA 2IOTA 3MNSA 3HPTB 4ABBA 2FOHA 2ZG0H 4ISLA 1O3OA 1TRYA 2PHBA 1GHZA 3URDA 5GJ4B 5E0HA 4JYUH 1KTTB 2KAIB 1F5KU 1HAVA 2Z9LA 4AFQA 3BF6H 5JBCS 1MAYA 1HRTH 1O3FA 4FVBA 1O35A 2BX3A 4AB8A 1C5VA 1DITH 2AIQA 2HVXA 3UPEA 4CHAB 1HFDA 2BDAA 3PWCA 4O3TA 1QRXA 1KXAA 3RXVA 2HPQH 5CE1A 2Y5HA 1PPZA 4Y7AA 4MPUA 1P2QA 2BD8A 1YGCH 1ZTJA 3SI3H 1IQEA 2BD9A 5TCCA 2O8WA 4BOHA 3GY5A 4YM9A 1J9CH 3QLPH 4FU9A 2GDDA 3ZVCA 4AGKA 4OS6A 3SGQE 1KSNA 4Q80A 2Y6TA 1VITF 4ZKRU 2PGQB 3RXKA 1FY4A 4ZHLU 1IQFA 1DWDH 3U9AH 3MU4A 5FAHA 1SLXB 2VINA 1GL1A 1ELDE 1O2ZA 1ZJKA 1TIOA 3DHKH 1LHCH 2C90B 1EOLA 1SI5H 3RXAA 2FOMB 9LPRA 1PQ5A 2NU2E 1NO9H 5H4IB 3BEUA 1SLVB 1TNKA 3JZ1B 1WQVH 1G36A 2ZHWH 3RLYH 1P03A 2OC1A 1V2ST 4FUEA 2RA3A 4WXIA 4VGCB 3A86A 1UTLM 1AWFH 2TIOA 1AKSB 4GHTA 4X1NU 1DICA 3RMNH 4AN7A 4YLUA 4Z0KA 5IDKA 1GBIA 1O3IA 5FX5A 2O8TA 1CA8B 4DG4A 1SGTA 3RM2H 2VGCB 1NROH 2AH4X 2GP9B 3ZZAA 4BAKB 4KELA 5C1UA 4ISIH 1W2KH 4NGAH 4UFEH 2XBWA 1FY1A 2HWLB 3SJ8A 2NU3E 3TK5A 5I46H 1EPTA 3BTEE 4ZUHA 4JZIA 2LPRA 3M5OA 3E16B 2LNCA 3SU0A 1F2SE 1EJMA 2ZQ2A 2J9NA 3GCHC 2EI6A 1UTPA 3V0XA 2G81E 3RXFA 4KGAA 3V7TA 3ZZ6A 3QTOH 2ZDAH 4CREA 1MTUA 4H6TA 2GD4B 2Z94A 1JMOH 1V2LT 3U69H 3EAJA 2FI3E 1SC8U 1C1UH 1ESTA 1Y8TA 1TAWA 4X2VA 2F9UA 1P9UA 2QIQA 2SGPE 1INCA 1GI8B 1EAWA 3BG8A 2ZTZA 1H9IE 1LHDH 1Y5AT 4AOQA 4DY7B 3VXEH 1LKBA 5CHAC 1C1RA 1EXFA 1PJPA 1SGNE 2BOHB 3VB5A 5C3NA 2RCEA 3BTWE 3STJA 1Y5UT 2ZECA 2TGTA 2C8YB 1P2NA 1LQEA 1C2LA 4HGCA 1FY3A 3RUOA 3MU5A 3A85A 4X2WA 4Y79A 3ZYDA 1BB0B 1W8BH 2CGAA 3NKKA 5AFZH 1ZRKA 5DPAA 1GCTB 4E7RG 3GY2A 1F5RA 4NCYA 1DLKB 2H1UA 1GVZA 3VFEA 2BMGB 4INLA 1B7XB 4HTCH 4TPIZ 2G4TA 3ZZ9A 2FM2A 1CT0E 1MCTA 1ACBE 2OINA 2VU8E 4K8YA 1FNIA 1NRNH 1PFXC 2P95A 2XCFA 3UUZA 1Y3XA 1DT2A 3GY3A 3OY5U 1TRNA 1TBZH 2A5IA 2HNTF 1EZUC 4WH6A 4FU7A 1WSSH 3S69A 1LQDB 1ZYOA 2FOFA 3P8GA 3LT3A 1WBGB 2FI5E 2J92A 1NRSH 2G51A 1IQNA 2WPIS 5EGMA 1B0EA 3TGKE 4ISOA 1O39A 2Z9GA 4ZH8A 2Z3CA 3PM3A 2R0KA 1MKXH 2VWLA 3EA8A 4YT6H 1O3KA 1TA6A 2O8LA 1PPBH 1ABIH 1UTKA 2BQ7B 5A2MH 2R2MB 2XC5A 6CHAB 1BJVA 5A8XA 5I25A 3IG6B 1TOMH 2BTCE 2ZU2A 2J4IA 3D23A 4B73A 2H2ZA 1ZR0A 1QL8A 3A80A 1QR3E 2BD7A 3ESTA 3R0FA 3OY6U 3ZZ8A 1O2NA 3S9BA 4CRFA 1WQSA 3PV4A 3U8RH 4MTBA 4ESTE 2YNAA 3F6UH 1O33A 3LDXH 1QL7A 2AS9A 1FIZA 1TPAE 4K3JA 2ANYA 1YKTA 3TU7H 5GIBA 1V2WT 1QJ7B 2ZF0H 2C4FH 3P17H 2F9VA 1AVXA 3V13A 4DW2U 3TJNA 3RMOH 1DY9A 1GHXH 4AFZA 1S0RA 2C8ZB 1C5SA 4I8LA 2GDEH 1P2IA 1V2RT 1D3DB 2ZDVH 3UQOA 1XKBC 3GDVA 2ZDMA 3ATIA 1W13U 2QAAA 1V2MT 1C5TA 1VR1H 5FBEA 1VCQA 2ZHFH 4U2WA 4JZFH 1Q31A 4X1RU 1YCPM 3O8CA 3L3TA 2I6SA 4IN1A 4O3UA 4ASHA 3SNAA 1PPGE 2B5TB 1AVWA 3A83A 3SJIA 1QIXB 1RD3B 4WVPE 3SN8A 1HXFH 3DD2H 2FMJA 4ABAA 3MO3A 5HM2A 1TQ0B 1Y3UA 2W3IA 4Y7BA 3FAOA 4IN2A 5SGAE 3GY6A 2SGQE 1DXWA 4X1QU 1TBRH 3UFAA 2HPPH 1NFUA 1SGFG 4WJG2 1XM1A 4X0WU 4BANB 1C5WB 4UFDH 1LVOA 1DS2E 1TWXB 1O2WA 2QXGA 1IHTH 4NIXA 3SUEA 2FPZA 1IQGA 1QURH 2A0QB 1ELCA 3SHAH 5JPMH 2OTVA 4IBLH 1V2UT 3ENSB 2J95A 2BY5X 1W7XH 1AQ7A 2FXRA 8GCHF 2QV1A 4K2YA 1YLDA 1O36A 3VB4A 1EP6A 1QQUA 2FOAA 3PMAB 5HYOA 1P9SA 4K5ZA 4XSKU 1GI1A 3UREA 1FDPA 2FDAA 1XUJA 1T4VH 4YO9A 1HAVB 3RLWH 2FX6A 1SGRE 1C5RA 1ETRH 2GX4A 2ODPA 2ZA5A 2ODQA 1MTVA 4SGAE 3RC5A 1ZPBA 1UVTH 3E90B 3HGPA 1QRWA 1K2I1 1O2YA 3GYMA 1ELTA 2PUQH 4Q2KA 5LPFA 3DT0H 2Y7XA 5LPRA 4BNRA 2JKHA 3A7WA 1UHBA 2RG3A 1LPGB 2XBVA 3PB1E 1QCPA 4TYDA 3PTNA 1A7SA 1SOTA 4A6LA 1O3HA 3RXIA 2JETC 1WV7H 2ZC9H 5AHGH 4AYYB 5G4BA 5E0GA 3MH4A 4RKJB 1HDTH 1AFEH 3UNSA 1L4DA 1P2KA 3PLBA 1JBUH 1RIWC 2XYAA 3ODFA 5A8YA 1V2VT 1O38A 5EXLA 3BN9A 3K2UA 2ZU5A 1GBLA 2BD3A 4XOJA 1GDQA 4UFFH 2QXIA 3T29A 2DE8A 1YYY1 3H7OA 2JH6D 2C3SA 4B75A 1LO6A 1O2MA 2ZI2H 1HLTH 2V0BA 3RXDA 1ARBA 2HLCA 3FP7E 3SUDA 2GGVB 1UCYH 2PKSC 4ABHA 1BBRE 2THFB 4Y8ZA 3AW1A 1F92A 1LMWB 3MU8A 2GZ7A 2DUCA 3MYWA 1L1NA 1TPSA 4SGBE 5T6DA 1P09A 2FYQA 2QC2A 3P8FA 2VIPA 4O03A 5C67A 4E7NA 3MMGA 3TH3H 2CF8H 1HBTH 3RXGA 3PLPA 2SNVA 2FLRH 4FUCA 2BD4A 1O32A 2STAE 3GDSA 5F8ZA 4U01A 2ZFTA 5FXLA 3LJOA 2ASUB 2P94A 1GBFA 1TNLA 1XUFA 3SZNA 5IYTA 1THPB 3ZZBA 2O8MA 1ETTH 1L4ZA 1GMDF 4E06H 4WMEA 1Z8JB 2WV5A 3U8OH 3MNCA 3E3TA 2ZHEH 1O2RA 2OD3B 1GHBG 1BIOA 1TYNA 3GOVB 3I77A 3MNBA 5EW2H 2PKSB 3VEQB 4NA9H 2WUBA 3IWMA 5AF9H 2V35A 4R8TB 3QZRA 1QQ4A 4K60A 4D76A 5JDUB 2OC8A 4K1TA 2W7UA 1ABJH 1AZ8A 3ATLA 4BAMB 1C2EA 1M9UA 7LPRA 1LDTT 4KTCA 2HNTE 3SV8A 4X6PA 1GHAG 3U1IB 2ZFSA 4YLQH 1NT1A 2PUXB 2XCNA 4ZHAA 2D1JA 7ESTE 1O3BA 2VIDA 1EZSC 1C2DA 1SGEE 2FODA 3PMJA 2NU0E 1Z1IA 3ATWA 1EB2A 1UO6A 1C2MA 1JRTA 3K6YA 3PWBA 1H9LB 1UHBB 4DURA 2PGBB 1TNHA 4XFQA 1THSH 1IOEA 4UFGH 1Z8IB 2QXJA 4IGDA 1AHTH 3LH3A 1ZHMA 1VGCB 2A5AA 1SGCA 5J4QA 2AMDA 1DFPA 5L30H 1C1WH 3T5FH 1A5HA 1C1QA 3NPSA 4J2YB 4DT7B 4NZLA 5AVDA 1NRRH 2BQ6B 1MMJN 2TPIZ 5EODA 1C9PA 3RC4A 1T31A 2BDHA 4AG1A 1SFQB 1GI2A 2VVCA 3O8BA 3SV6A 3GY8A 3OYPA 3DUXH 1GBJA 3SW2B 1S0QA 1AVGH 4BAHB 1TX7A 1AFQB 1UTMA 2FIRH 3MU1A 1O2KA 1G3BA 1T8MA 2W5EA 3FVFB 4X6MA 1AZZA 4IC6A 3LIWA 4HZHA 1OXGA 1MU8B 7GCHG 1ID5H 3ZVEA 3EQ0H 1BTHH 5FPTA 1Q2WA 1QJ1B 1SPJA 4OS1A 2XWAA 4YT7H 2NU1E 3A8AA 3S9CA 2P3TB 1GBMA 1O2XA 1FV9A 1OP8A 2B9LA 1HXEH 3NUMA 1BRAA 4XBCA 1HB0B 1GI0A 1Z1JA 2IJOB 1O5AB 4X6OA 1TA2A 2BZ6H 1DX5M 3ZZDA 4FUIA 2RDLA 1OWKA 1ANDA 2SNWA 4NZQA 2BLQA 2GV7A 1O3MA 1XVMA 2C8WB 4ZXYH 1SLWB 3ZV9A 3ODDA 3EE0B 1QHRB 2GCTC 1EQ9A 1RXPA 1DDJA 1ELAA 3SNDA 2HGTH 5JYIA 4GPGA 2PKAB 2FYRA 1MD7A 2FOCA 1YPKH 2QGRA 1QY6A 3ZVFA 4I31A 5L2ZH 3NZIA 5EXMA 1PPHE 1XVOA 3UY9A 1C4U2 2TGDA 1BDAA 3QZQA 3RXCA 3M7TA 3DA9B 2VJ1A 4A1XA 1GI7B 4MPVA 3BTDE 1EB1H 1O3LA 1O5CB 3B8JA 1GBHA 2J38A 1G3CA 1C2GA 1TNIA 4A7IB 4NWKA 3SGAE 2FS9A 1O5FH 1YPHE 2P3UB 2A31A 2BDBA 4ABFA 1ZHRA 2FZZA 3UR6A 3O8RA 1P2JA 3TJUA 2VB0A 3M61U 1ESBA 3A81A 2BDCA 5EQQA 5DKMA 4Y8XA 1OWHA 4LK4A 3E6PH 4X8TH 2WPJS 3HATH 3FZZA 3KHVA 1CU1A 1DWEH 2A4OA 2F9PA 2VIQA 3GY7A 5DP3A 1QNJA 3P6ZB 3C1KA 4X6NA 1LPKB 3NXPA 1BQYA 4ZROA 1F0TA 4NA8A 2ZU3A 2AERH 3T27A 2AYWA 3TGIE 1RGQA 1YPLH 3GYLB 2A7JA 2STBE 1O2IA 1GBKA 1O3PB 1PPEE 1FPHH 1UTOA 5E2PA 3F9HA 1HAHH 4CH8B 2ZPSA 2UUKB 3E91A 2A4RA 1C1TA 1IQIA 1GHWH 3P70B 1YF4A 4MPXA 3RXHA 2ANKH 3Q3XA 4YESB 3HKIB 3RXOA 3KN2A 3ZZ3A 4DVAU 4D7GA 1AE5A 1ZMLA 1J15A 3BTGE 3D62A 3M5LA 1QFKH 3QO6A 2ZDNA 1O5GH 4TWWA 1O2VA 3MH7A 1LKAA 1NZQH 3P95A 1SR5C 5TCAA 4H6SB 4AZ2B 1AIXH 1GCDA 1ZTKA 4THNH 5E2OA 1K9OE 1CGHA 2BVSH 3ZVAA 4NSVA 1TX8A 1C2IA 3SUGA 1EAXA 1EKBB 3PLKA 2QF0A 1W3CA 1DSUA 1GWAA 1MTNB 2PWXA 2F83A 1YM0A 1QL9A 1DY8A 3AASA 5GPIB 3A7TA 1CVWH 2O8UA 3TK6A 3LU9B 2ZCKP 3SU5A 3R3GB 4U32A 3STIA 2D26C 2SGDE 1C2FA 1FZZA 5HXFA 2AMPA 4NG9H 3IITA 1HAYB 2B0FA 2BY8X 3F9FA 2Z9KA 4TY7A 1T8NA 3M3VA 4WWYA 2M5TA 3P8OA 5F8TA 3RP2A 1ZJDA 2SGEE 1OYQA 1BHXF 5F6MA 1NFYA 3LONA 1T7CA 1SSXA 1MTWA 5A0AE 4JZ1A 1T32A 3A7YA 3KQCA 2NWNA 4DIIH 1EUFA 1GI6A 2R2WU 1F5LA 4K1SA 3MO6A 4X1PU 1E34B 1C4Y2 1XXDA 1OWDA 1W0YH 4YOGA 1H4WA 1TOCB 1UVUH 3O8DA 4BAOB 4H4FA 2H9TH 4Y71A 1MBMA 1CHGA 4CH2B 1TRMA 2ZU4A 4AFSA 2XW9A 1NS3A 2ZPRA 2GZ8A 1UCYK 1A3BH 3FZDA 1QB1A 4A1TA 1P57B 2Z3DA 1N8OC 2F9OA 1FY5A 5GCHG 4KP0A 1HAXB 1WTHD 1UCYE 4TWYA 2Y81A 3A7XA 3M5MA 1NESE 4JZEH 1SLUB 1L1JA 1YPJH 1Q3XA 1O2SA 1UK2A 1WTGH 3GCNA 1NY22 1O5DH 2AGGX 1GPZA 4NA7A 1N8OB 5DP4A 1YPGH 1CA0B 1P2OA 1O2LA 2AGIX 2A7HA 3HK3B 5C5OA 1BTUA 1H8IH 4A5TS 4K8BA 4INHA 3SU2A 3LGWA 4O9VA 1G30B 1Z6EA 1P11E 5JBTA 2H5CA 3E8LA 4Y76A 4B2CA 4WF8A 3SO3A 1D3PB 3DFJA 5JB9S 1W7GH 3RXMA 4FUFA 2XC4A 3M7QA 3SV2H 1MU6B 1A0JA 4J1YA 4U30A 1VJ9U 1HIAB 3LGYA 1XXFA 1ETSH 3SGBE 1A46H 1UVOA 1XUIA 5ESBA 1V3XA 3KQBA 1C4V2 4UEHH 3H7TA 3U8TH 2PR3A 1DLEA 1NRPH 3QGNB 3T25A 1SQTA 3Q76A 2FESH 2BLVA 1O3EA 1SHHB 5L2YH 3E0NB 1EJNA 1GVKB 4GAWA 1GJ9B 2Z9IA 1KY9A 1S83A 2VIWA 3KL6A 5C2ZA 1C5OH 3PTBA 1V2QT 2ZGXH 1SOZA 1QBVH 3M35A 4F4OC 1RJXB 2TBSA 1DSTA 1O3NA 4CRDA 2Z7FE 1C5UA 2H6MA 3MH6A 3SHCH 4GCHF 5FCKA 3MO9A 4UONA 3ELAH 1WAYB 3RXLA 1BTYA 1GJ8B 2Y80A 1G2LA 3CP7A 1NPMA 1KLIH 4OS2A 4ZKOU 1N1LA 1GMHG 1OOKB 1HNEE 4Y0YE 1HAIH 2PSYA 4LOYH 3URCA 4AORA 1O37A 4BXWA 4Y8YA 1V2PT 2FTLE 4FU8A 2ALPA 4GCHG 1E0FD 1TONA 3TIUA 2AMQA 5CMXH 1K1OA 4NFEA 2BY9X 4IC5A 3TITA 3MU0A 1CT2E 1YBWA 2GZ9A 5BRRE 1CO7E 4CR9A 3LOXA 4TPYA 2P3FH 3K65B 1HGTH 1O5BB 3F9GA 1O0DH 1UTNA 1NTPA 4ZHMU 1ZSJA 2H9HA 1LTOA 3GCTG 4AB9A 4I8HA 1CBWC 1BITA 3SORA 2BLWA 2OBOA 3C27B 1C2KA 2F91A 1S85A 2O9QA 1YPMH 1BBRK 1BRCE 1GJ7B 1YPEH 2P59A 3UWJH 1B5GH 3LPRA 3ZZ5A 3KF2A 1AKSA 1BRUP 1TGTA 2AGEX 2XXLA 6LPRA 3PMHB 1NFXA 4OS4A 1MTNC 1BTXA 4OGYA 3TNSA 2PTNA 1CQQA 3M37A 3SU4A 1XKAC 1C1NA 3SU1A 1PYTC 3BTHE 1HAPH 3RDZA 1A0LA 2BDGA 1C2HA 4JMYA 1V2KT 2V3OH 4XBBA 2PLXA 3D49H 1XMNB 4WXVA 1Y59T 1K1LA 8KME2 2PW8H 1GBCA 2BY7X 1YPHC 1MTSA 2EA3A 2JETB 3UWIA 2FOBA 3D65E 3ZV8A 2AEIH 4AFUA 1TFXA 1O3CA 2GV6A 4IS5A 2H9EH 2Q6GA 1MKXK 1QA7A 2ZDLA 4HFPB 2GMTB 4XDEA 1VCWA 1ANEA 5DP5A 3JZ2B 2PV9B 1KXDA 2IN2A 1C5XB 3KEEA 2J94A 2Q6FA 1Y3YA 4VGCC 3RXUA 3BTKE 3VXFH 2HNTC 1FAXA 4FXGH 1NC6A 4HI3A 3VGCC 1ZZZA 3RC6A 1ARCA 4MPWA 3I29A 3MFJA 5C1YA 1DE7H 3LGVA 3SQHE 1HAGE 1MQ6A 4FUHA 3FANA 2BQWB 1HPGA 1GBEA 2ZGBH 3OSYA 1O2OA 5EXNA 1P04A 6GCHF 1ANBA 4B74A 2XRCA 4B1TA 2ZHQH 5A09A 1O2GH 3E0PB 1DPOA 4Z6AH 3Q3KA 1EJAA 1KXFA 1GJCB 5C20A 3W95A 1W10U 4Q7XA 5LGOA 1A1RA 2BXUH 1BMMH 1FPCH 2GVFA 1KLJH 1HJAB 1BOQA 1GHVH 3EDXB 1SGPE 4AYVB 1C1SA 3A89A 1K1PA 4ABDA 4IMQA 1O3AA 3SOSA 4DIHH 4LZ4B 1WOFA 2Z3EA 1S82A 4NIYA 2QN5T 3WY8A 1KYNA 1C5MD 1E36B 1HJAC 5FCRA 4AGJA 3BIUH 1QB6A 3M3TA 1UMAH 2ODYB 1BRBE 1TMBH 2JH5D 2B7DH 2ZIQH 1DM4B 4JK6A 4UE7H 4DCDA 5JBAS 1VGCC 1DUEA 1J8AA 1WUNH 1TGCA 3LJJA 1CSOE 5FHTA 4NWLA 4Y0ZE 1PPCE 4ISNA 1A0HB 1BJUA 1TMUH 4ZKSU 1D3QB 1K22H 2PTCE 3E1XB 1WCZA 4ISHH 3GICB 3S7HB 1ELBA 1QGFA 1H9HE 3P8NA 1EATA 3B23B 4MVNA 5JB8S 1BUIA 3KQDA 1ELFA 1UVPA 3T28A 5F03A 5LPEA 4X8SH 1FMGA 2SGAA 2PSXA 1JIRA 2OC0A 1YCPK 3TK9A 4CRBA 3TVJB 3SNEA 1O3GA 1L2EA 4WH8A 1CGJE 1DWBH 4E05H 2VH6A 1ZGIA 1N6YA 3UOUA 3RMLH 1LHFH 1ELEE 3QGJA 2VIVA 3SJOA 2BD5A 1MH0A 3F1SB 4GVUA 1C5ZB 1GHYH 1OX1A 4DOQA 1O2JA 2ZZUH 1P2MA 2OLGA 2BOKA 3HGNA 5A8ZA 3OU0A 4B76A 1GDUA 1TALA 1RRKA 1P3CA 2J2UA 4FUGA 1C1MA 3UR9A 4YOIA 3UQVA 1FQ3A 3RU4E 1TBQH 1ZSKA 3TH2H 1RTFB 2OXSA 1ZOMA 1NFWA 4KTSA 1FJSA 4Y11E 1V6DA 1D9IA 1GG6C 3SBKA 1W0ZU 1A5GH 1FUJA 1VCPA 2ZEBA 1W12U 2OBQA 1GI9B 2CXVA 2ULLA 2GT7A 1ZLRA 3VGCB 1BTZA 3LC5A 2Y82A 2VWOA 6CHAC 3T2NA 1EAUA 4RKOB 5FPYA 2G5NA 3VPKA 2CHAB 1A2CH 2EEKA 1IQLA 1FONA 5EQSA 5FBIA 2ZGCA 1BTWA 3V12A 3ATMA 1S81A 2TGAA 1AO5A 4ABEA 4CHAC 1P8VC 1HAOH 1OYTH 1XUGA 4B2BA 1IHSH 3NCLA 4GHQA 1GGDC 2W3KA 5TJXA 3SUFA 4X8VH 1Y3WA 4CBNA 3KCGH 4F49A 1GI4A 4FUJA 1PPFE 2CJIA 3Q00A 1J16A 1ESAA 2A2XH 2QXHA 1TLDA 2BY6X 1GJDB 3BIVH 1V2OT 4OS7A 1SGIB 3U1JB 1QBOA 5DJ7A 1F0SA 3SV7A 1Z71A 2RA0A 2ZPQA 1C5NH 3LGUA 1ELGA 1AB9C 1KLTA 1LVYA 4Q7ZA 2ALVA 2GKVE 4UDWH 1TNJA 3TGJE 1AUJA 1L0ZA 2ZFPH 3RXQA 1LVBA 1UK3A 2ZHDA 1KDQB 4IMZA 4Y6DA 1C2JA 1Y3VA 4AX9H 4H42U 3A8DA 4A92A 1GJ5H 1MAXA 3MH5A 2BD2A 5J4SA 1PQ8A 1AMHA 3LKWA 1WU1A 3PYHA 1FIWA 1ZGVA 1GJBB 1UTQA 1OWJA 4KTUA 2ANWA 1E37B 5BPEA 5C1XA 3MHWU 3ZVBA 2F9BH 2BVRH 4WMFA 3M36A 3OX7U 8LPRA 1DXPA 1SBWA 1C5PA 2FO9A 1SVPA 3SJ9A 1P01A 5ETXA 4I8JA 1KTSB 2OUAA 2BB4A 1O5EH 1PYTD 3BTFE 3A84A 1C5QA 3HK6B 1BCUH 2Y5GA 1KXCA 1OKXA 1B0FA 1UTJA 2ZU1A 5EU8A 1RFNA 2EI7A 3TNTA 4OGXA 2ZFFH 1CBWB 1C5YB 2XBXA 1FY8E 4BAQB 4I32A 2WV4A 2BDIA 1BA8B 3A7VA 3EA7A 3P92A 1RIWB 1GVLA 1DUAA 3KIDU 2G52A 2G00A 1OS8A 1F7ZA 3FP8E 1EP5A 3RMMH 1K1JA 1ORFA 1AN1E 2QF3A 1EZXC 5DK1A 2A1DB 3UTUH 4K69A 1SGDE 1DWCH 2A45B 2CF9H 2BZAA 4UD9H 2HALA 2UWOA 1GJ4H 4XBDA 3B9FH 2A32A 1AI8H 2C93B 7KMEH 1ANCA 1C5LH 2Z9JA 1P02A 2FEQH 1CA0C 1YLCA 1GDNA 1QBNA 4DJZB 2UUFB 4FUDA 2WPHS 5GDSH 5F8XA 1THRH 5GXPA 3G01A 5FX6A 1IQMA 2XTTB 1GL0E 3BV9B 3W94A 2PKAA 2QYIA 5HMAA 3BEIB 3RM0H 4RN6A 1HUTH 3GY4A 1G9IE 3TJVA 3NWUA 3BSQA 3QWCH 1K21H 3RU4D 1XUKA 2ZFRH 2WUCA 1XX9A 1PQ7A 4MG3A 2VWNA 2ZCLP 1O31A 2YOLA 2SFAA 2A4QA 2ZNKH 1LVMA 3SU3A 4ZMAH 3AAVA 3V3MA 4AG2A 4YTAA 1OP0A 1CGIE 2FX4A 3LH1A 5E8EH 1BT7A 2W7SA 1EX3A 1DANH 1QB9A 1P0SH 1VJAU 4OS5A 1LCYA 2G8TA 5C5NA 1S6HA 3S7KB 4CRCA 1T8OA 1C1PA 1KXBA 2ILNA 2A5KA 4O97A 2F3CE 1IQJA 1EZQA 1MZAA 3EA9A 2EC9H 2GT8A 4JZDH 2BVXH 1FN6A 4I8GA 2UUJB 4YOJA 2ZTXA 4JYTA 3I78A 4BTUB 1A5IA 4MNXA 1NM6A 2DE9A 2TRMA 3KGPA 3ZZ7A 2D2DA 1P3EA 2VWMA 3A82A 1TPPA 1T8LA 1OWEA 1C9TA 3T26A 1ZMJA 3BTQE 1X7AC 2VNTA 2Y7ZA 1TNGA 1JWTA 2BYAX 1P10A 1W11U 3CS0A 3M3SA 1SL3A 1Z6JH 1W14U 3N7OA 1O2TA 2ZGHA 2JH0D 4GSOA 3BTME 1NU7B 2UUYA 3BEFB 4D9RA 1SG8B 2WINI 3PROA 2IPHA 1L1GA 1D6RA 3RXEA 4MNWA 1S5SA 5DP7A 3SQEE 1TX6A 4Y10E 2FOEA 3ATKA 2OQ5A 9ESTA 3MOCA 1QA0A 1BTPA 1TQ7B 3SU6A 1ZRBA 4B2AA 4ZKNU 2KAIA 1GHBF 1QJ6B 3UNRA 2BM2A 3VB3A 3H5CB 4B71A 3A8CA 1OPHB 1Y5BT 3TLOA 3DFLA 5DG6A 5ESTE 1HYLA 2AFQB 1O3JA 3ZVDA 4MLFB 1VITG 2ZQ1A 3RXSA 6ESTA 2Y5FA 2QCYA 1AD8H 4I8KA 1GCTC 4GUXA 1Z8RA 1BMNH 3GCTF 1GJAB 3M5NA 1HAZB 3LGTA 1GG6B 5T6GA 2CMYA 2FS8A 1JOUB 1IQKA 4NIVA 3A87A 3F68H 5A0BA 3AVZA 2W26A 2HOBA 1NN6A 1EAIA 4RSPA 2GCTB 1YCPH 1SGQE 2YNBA 5EW1H 5CHAB 2CHAC 1G37A 4ABGA 2AIPA 1EASA 4K1EA 4JYVH 2CV3A 5A0CA 4ZXXH 1D4PB 1GMHF 4A1VA 1BBRH 2Z6BD 1CHOF 5ABWA 1A3EH 5EPNA 5K0HA 1MQ5A 2G4UA 4ABIA 1TGSZ 2ZTYA 2OQUA 2VH0A 1E35B 1Z7KA 2FWWA 1D6WA 2ZDKA 3SV9A 2G5VA 3LC3A 2R3YA 4BTTB 3GCHB 3QDZB 5B6OA 2OC7A 1DOJA 3F9EA 2ZCHP 2A4GA 1RS0A 3MWIU 1SQOA 1CT4E 3A8BA 1MKWK 5DGJA 5T3HA 3RXRA 1AY6H 3RXTA 1KIGH 1YC0A 1GGDB 4FVDA 4BXSA 1QTFA 2VGCC 1DVAH 1D3TB 1FAKH 1RTKA 2XNIA 1GMCG 1FI8A 3KNXA 1BMAA 1N6XA 1F0RA 2ZKSA 4TY6A 1O3DA 3MI4A 1HJ8A 2V3HH 2TGPZ 1G2MA 2ESTE 1O2HA 2WPLS 1BZXE 2ZGJA 1SFIA 1H1BA 2GTBA 2QY0B 1KXEA 2WYJA 5K7RA 4D7FA 2EI8A 1O2UA 1LHGH 1OWIA 7GCHF 3A7ZA 1ZPCA 1C1VH 1V2JT 3ZYEA 5EQRA 4X1SU 1AE8H 4PROA 1O30A 2FTMA 1VZQH 1A4WH 3Q3YA 5GCHF 2D8WA 4R0IA 5HM9A 5DO4H 1YP9A 3T62A 1MKWH 1P06A 3A88A 1MZDA 2J34A 4M7GA 4X8UH 1G3DA 1KDQA 4I7YH 2GCHF 3M7UA 3L6PA 1XUHA 1NRQH 3PMBB 1G32B 1IAUA 1NU9A 1K1IA 1V2NT 3FFGA 1GI5A 4D8NA 2FOGA 1AWHB 2H5DA 2VVUA 2XWBI 3ITIA 1GJ6A 2XBYA 4QT8C 3KQEA 4NSYA 3GISB 2R0LA 1EOJA 1BHXB 1AUTC 2A2QH 3MTYA 1P05A 3CS7A 1TPOA 1GBAA 3QTVH 4GLYA 3UNQA 1HV7A 1O34A 2A7CA 1MD8A 1K1NA 3TJOA 1UK4A 1K28D 3GCOA 2BHGA 5L6NH 3EYDA 2C8XB 2VIOA 3BTTE 3GDUA 1JRSA 1MUEB 2GMTC 2V6NA 3QX5H 8ESTE 1AFQC 3K6ZA 2FP7B 1Z8GA 3QN7A 3FP6E 1GBDA 1J14A 2R9PA 3UOPA 3NK8A 5PTPA 1HCGA 2ZFQH 1GHAF 1SQAA 2I6QA 1OSSA 1RTLA 3SJKA 1V2TT 2P16A 3VB7A 1FN8A 2Q6DA 3AW0A 4MNVA 1K1MA 3QUMP 2BX4A 1FLEE 1A61H 3QK1A 4DGJA 4NFFA 3TPIZ 1MCVA 1AB9B 2OP9A 2FLBH 3EGKH 4D9QA 1P12E 4ABJA 1H8DH 2XC0A 1BMLA 3ZVGA 1JXPA 1LHEH 2CN0H 2ZO3H 8GCHG 4LZ1H 2SGFE 1WYKA 4ZAEA 2P8OB 3HKJB 3PO1C 1TGNA 2B8OH 1HJ9A 4WY3A 1GMDG 3RXJA 1ELVA 2WPMS 2OCVB 1F0UA 4CRAA 1TB6H 2PFEA 5EPYA 2WPKS 1ZHPA 2P93A 2UWPA 3L33A 4IW4E 2Q1JA 3VB6A 1TMTH 1ZPZA 3S0NA 2ZP0H 5EOKA 2GCHG 3SNCA 1T4UH 2BDYA 3MNXA 2G55A 5AFYH 5JBBS 3BG4B 3ZZ4A 4WMDA 1CHOG 1GBBA 4JCNA 3Q77A 3U98H
chains in the Genus database with same CATH superfamily
1NBME 2UWLA 2ANMH 1SMFE 4Q7YA 3ZZCA 4LXBH 3K9XB 1SB1H 1EPTB 3OTJE 1GI3A 5DP8A 5EG4A 1OP2A 5LH8A 4ACAA 1TGBA 1UVSH 4MDSA 3RXBA 3FN8A 4I33A 3PO1B 1MBQA 1O2PA 4JK5A 2HRVA 4KKDA 4P02A 1PQAA 1GBTA 4FETA 1AGJA 2BXTH 3RU4T 2WYGA 3LGIA 4NIWA 4CRGA 1SGFA 1O2QA 1TABE 1TE0A 5DP9A 3BG4C 4RT1A 4X2XA 2VVVA 1C1OA 5T6FA 5GWZA 3UIRA 6GCHG 1LPZB 1GMCF 1S84A 2KZ4A 1VITH 4FUBA 5E0JA 1H8HD 1UJ1A 4BTIB 1G3EA 1ZMNA 2P8OC 1ZTLA 4XE4A 3AK5A 2CK3D 1J17T 2ZWLH 1EPTC 1E38B 1AU8A 4YZUA 1U6QA 2K1QA 4MQAA 3SI4H 4INKA 4CR5A 4Z1MD 1ZSLA 2NU4E 5HGGA 1IQHA 5DP6A 1FXYA 2QA9E 3RXPA 1CE5A 3S9AA 3CENA 4MNYA 2FI4E 2R3UA 2F9NA 1SGYE 3SNBA 4X2YA 4CBOA 1S6FA 2BLOA 3TH4H 1SHYA 5FPSA 1JIMA 1QRZA 1HIAA 3AAUA 2IOTA 3MNSA 3HPTB 4ABBA 2FOHA 2ZG0H 4ISLA 1O3OA 1TRYA 2PHBA 1GHZA 3URDA 5GJ4B 5E0HA 4JYUH 1KTTB 2KAIB 1F5KU 1HAVA 2Z9LA 3DSOA 4AFQA 3BF6H 5JBCS 1MAYA 1HRTH 1O3FA 4FVBA 1O35A 2BX3A 4AB8A 1C5VA 1DITH 2AIQA 2HVXA 3UPEA 4CHAB 1HFDA 2BDAA 3PWCA 4O3TA 1QRXA 1KXAA 3RXVA 2HPQH 5CE1A 2KCOA 2Y5HA 1PPZA 4Y7AA 4MPUA 1P2QA 2BD8A 1YGCH 1ZTJA 3SI3H 1IQEA 2BD9A 5TCCA 2O8WA 4BOHA 3GY5A 4YM9A 1J9CH 3QLPH 4FU9A 2GDDA 3ZVCA 4AGKA 4OS6A 3SGQE 1KSNA 2J98B 4Q80A 2Y6TA 1VITF 4ZKRU 2PGQB 3RXKA 1FY4A 4ZHLU 1IQFA 1DWDH 3U9AH 3MU4A 5FAHA 1SLXB 2VINA 1GL1A 1ELDE 1O2ZA 1ZJKA 1TIOA 3DHKH 1LHCH 2C90B 1EOLA 1SI5H 3RXAA 2FOMB 9LPRA 1PQ5A 1E1QD 2NU2E 1NO9H 5H4IB 3BEUA 1SLVB 1TNKA 3JZ1B 1W0KD 1WQVH 5EIYA 1G36A 2ZHWH 3RLYH 1P03A 2OC1A 1V2ST 4FUEA 2RA3A 4WXIA 4VGCB 3A86A 1UTLM 1AWFH 2TIOA 1AKSB 4GHTA 4X1NU 2LP6A 1DICA 3RMNH 4AN7A 4YLUA 4Z0KA 1YY3A 5IDKA 1GBIA 1O3IA 3DSGA 5FX5A 2O8TA 1CA8B 4DG4A 1SGTA 3RM2H 2VGCB 1NROH 2AH4X 2GP9B 3ZZAA 3OTPA 4BAKB 4KELA 5C1UA 5IK2D 4ISIH 1W2KH 4NGAH 4UFEH 2XBWA 1FY1A 2HWLB 3SJ8A 2NU3E 3TK5A 5I46H 1EPTA 3BTEE 4ZUHA 4JZIA 2LPRA 3M5OA 3E16B 2LNCA 3SU0A 1F2SE 1EJMA 2ZQ2A 2J9NA 3GCHC 2EI6A 1UTPA 3V0XA 2G81E 3RXFA 4KGAA 3V7TA 3ZZ6A 3QTOH 2ZDAH 4CREA 1MTUA 2WSSD 4H6TA 2GD4B 2Z94A 1JMOH 1V2LT 3U69H 3EAJA 2FI3E 1SC8U 1C1UH 1ESTA 1Y8TA 1TAWA 4X2VA 2F9UA 1P9UA 2QIQA 2SGPE 1INCA 1GI8B 1EAWA 3BG8A 2ZTZA 1H9IE 1LHDH 3N7EA 1Y5AT 4AOQA 4DY7B 3VXEH 1LKBA 5CHAC 1C1RA 1EXFA 1PJPA 1SGNE 2BOHB 3VB5A 5C3NA 2RCEA 3BTWE 3STJA 1Y5UT 2ZECA 2TGTA 2C8YB 1P2NA 1LQEA 1C2LA 4HGCA 1FY3A 3RUOA 3MU5A 3A85A 4X2WA 4Y79A 3ZYDA 1BB0B 1W8BH 2CGAA 3NKKA 5AFZH 1ZRKA 5DPAA 1GCTB 2IJD1 4E7RG 3GY2A 1F5RA 4NCYA 1DLKB 2H1UA 1GVZA 3VFEA 2BMGB 4INLA 1B7XB 4HTCH 4TPIZ 2G4TA 3ZZ9A 2FM2A 1CT0E 1MCTA 1ACBE 2OINA 2VU8E 4K8YA 1FNIA 1NRNH 1PFXC 2P95A 2XCFA 3UUZA 1Y3XA 1DT2A 3GY3A 3OY5U 1TRNA 1TBZH 2A5IA 2HNTF 1EZUC 4WH6A 4FU7A 1WSSH 3S69A 1LQDB 1ZYOA 2FOFA 3P8GA 3LT3A 3NRLA 1WBGB 2FI5E 2J92A 1NRSH 2G51A 1IQNA 1SQRA 2WPIS 5EGMA 1B0EA 3TGKE 4ISOA 1O39A 2Z9GA 4ZH8A 2Z3CA 3PM3A 2R0KA 1MKXH 2VWLA 3EA8A 4YT6H 1O3KA 1TA6A 2O8LA 1PPBH 1ABIH 1UTKA 2BQ7B 5A2MH 2R2MB 2XC5A 6CHAB 1BJVA 5A8XA 5I25A 3IG6B 1TOMH 2BTCE 2ZU2A 2J4IA 3D23A 4B73A 2H2ZA 1ZR0A 1QL8A 3A80A 1QR3E 2BD7A 2QF5A 4F48B 3ESTA 3R0FA 3OY6U 3ZZ8A 1O2NA 3S9BA 4CRFA 1WQSA 3PV4A 3U8RH 4MTBA 4ESTE 2YNAA 3F6UH 1O33A 3LDXH 1QL7A 2AS9A 1FIZA 1TPAE 4K3JA 2ANYA 1YKTA 3TU7H 5GIBA 1V2WT 1QJ7B 1MABB 2ZF0H 2C4FH 3P17H 2F9VA 5HIYA 1AVXA 3V13A 4DW2U 3TJNA 3RMOH 1DY9A 1GHXH 4AFZA 1S0RA 3KYGA 2C8ZB 1C5SA 4I8LA 2GDEH 1P2IA 1V2RT 1D3DB 2ZDVH 3UQOA 1XKBC 3GDVA 2ZDMA 3ATIA 1W13U 2QAAA 2QE7D 1V2MT 1C5TA 1VR1H 5FBEA 2W6JD 1VCQA 2ZHFH 4U2WA 4JZFH 1Q31A 4X1RU 1YCPM 2JJ2D 3O8CA 3L3TA 2I6SA 4IN1A 4O3UA 2KR7A 4ASHA 3SNAA 1PPGE 2B5TB 1AVWA 3A83A 3SJIA 1QIXB 1RD3B 4WVPE 3SN8A 1HXFH 3DD2H 2FMJA 4ABAA 3MO3A 5HM2A 1TQ0B 1Y3UA 2W3IA 4Y7BA 3FAOA 4IN2A 5SGAE 3GY6A 2SGQE 1DXWA 4X1QU 1TBRH 3UFAA 2HPPH 1NFUA 1SGFG 4WJG2 1XM1A 4X0WU 2F43B 4BANB 1C5WB 4UFDH 1LVOA 1DS2E 1TWXB 1O2WA 2QXGA 1IHTH 4NIXA 3SUEA 2FPZA 1IQGA 3UAIC 1QURH 2A0QB 1ELCA 3SHAH 5JPMH 2OTVA 4IBLH 1V2UT 3ENSB 2J95A 2BY5X 1W7XH 1AQ7A 2FXRA 8GCHF 2QV1A 4K2YA 1YLDA 1O36A 3VB4A 1EP6A 1QQUA 2FOAA 3PMAB 5HYOA 5B6LA 1P9SA 4K5ZA 4XSKU 1GI1A 3UREA 5CHBA 1FDPA 2FDAA 1XUJA 1T4VH 4YO9A 1HAVB 3RLWH 2FX6A 1SGRE 1C5RA 1ETRH 2L6OA 2GX4A 2ODPA 2ZA5A 2ODQA 1MTVA 4SGAE 3RC5A 5KGOA 1ZPBA 1UVTH 3E90B 3HGPA 1QRWA 1K2I1 1O2YA 3GYMA 1ELTA 2PUQH 5EJ1A 4Q2KA 5LPFA 3DT0H 2Y7XA 5LPRA 4BNRA 2JKHA 4ZCNA 3A7WA 5T1VA 1UHBA 2RG3A 1LPGB 2XBVA 3PB1E 1QCPA 4TYDA 3PTNA 1A7SA 1SOTA 4A6LA 1O3HA 3ZIAD 3RXIA 2JETC 1WV7H 2ZC9H 1E79D 5AHGH 4AYYB 5G4BA 5E0GA 3MH4A 4RKJB 1HDTH 1AFEH 3UNSA 4OM9A 1L4DA 1P2KA 3PLBA 1JBUH 2OK5A 1RIWC 2XYAA 3ODFA 5A8YA 5EJLA 1V2VT 1O38A 5EXLA 3BN9A 3K2UA 2ZU5A 1GBLA 2BD3A 4XOJA 1GDQA 4UFFH 2QXIA 3T29A 1BMFD 2DE8A 4AC9A 1YYY1 4ASUD 3H7OA 2JH6D 2C3SA 4B75A 1LO6A 1O2MA 2ZI2H 1HLTH 2V0BA 3RXDA 1ARBA 2HLCA 3FP7E 3SUDA 4B6EA 2GGVB 1UCYH 2PKSC 4ABHA 1BBRE 2THFB 4Y8ZA 3AW1A 1F92A 1LMWB 3MU8A 2GZ7A 3U28C 2K0QA 2DUCA 3MYWA 1L1NA 1TPSA 4SGBE 5T6DA 1P09A 2FYQA 2QC2A 3P8FA 2VIPA 4O03A 4RI0A 5C67A 4E7NA 3MMGA 3TH3H 2M2AA 2CF8H 1HBTH 3RXGA 3PLPA 2SNVA 2FLRH 4FUCA 2BD4A 1O32A 2STAE 3GDSA 5F8ZA 4U01A 2ZFTA 5FXLA 3LJOA 2ASUB 2P94A 1GBFA 1TNLA 1XUFA 3SZNA 5IYTA 1THPB 3ZZBA 2O8MA 2JJ1D 1ETTH 1L4ZA 1GMDF 2GJGA 4E06H 4WMEA 1Z8JB 2WV5A 3U8OH 3MNCA 3E3TA 2ZHEH 1O2RA 2OD3B 1GHBG 1BIOA 1TYNA 3GOVB 3I77A 3MNBA 5EW2H 2PKSB 3VEQB 2QF4A 4NA9H 2WUBA 3IWMA 5AF9H 2V35A 4R8TB 3QZRA 2JIZD 1QQ4A 4K60A 4D76A 5JDUB 2OC8A 4K1TA 2W7UA 1ABJH 1AZ8A 3ATLA 4BAMB 1C2EA 1M9UA 7LPRA 1LDTT 4KTCA 1VKYA 3PV2A 2HNTE 3SV8A 4X6PA 1GHAG 3U1IB 2ZFSA 4YLQH 1NT1A 2PUXB 2XCNA 4ZHAA 2D1JA 7ESTE 1O3BA 2VIDA 5FL7D 1EZSC 1C2DA 1SGEE 2FODA 3PMJA 2NU0E 1Z1IA 3FO8D 3ATWA 1EB2A 1UO6A 1C2MA 1JRTA 3K6YA 3PWBA 1H9LB 1UHBB 4DURA 2PGBB 1TNHA 4XFQA 1THSH 1IOEA 4UFGH 1Z8IB 2QXJA 4IGDA 1AHTH 3LH3A 1ZHMA 1VGCB 2A5AA 1SGCA 5J4QA 2AMDA 1DFPA 5L30H 1C1WH 3T5FH 1A5HA 1C1QA 3NPSA 5HIZA 4J2YB 4DT7B 4NZLA 5AVDA 5GNDA 1NRRH 2BQ6B 1MMJN 2TPIZ 5EODA 1C9PA 3RC4A 3DCLA 1T31A 2BDHA 3OFND 1SFQB 4AG1A 1GI2A 2VVCA 3O8BA 3SV6A 3GY8A 3OYPA 3DUXH 1GBJA 3SW2B 1S0QA 1AVGH 3FKSD 4BAHB 1TX7A 1AFQB 1UTMA 2FIRH 2AHME 3MU1A 1O2KA 1G3BA 1T8MA 2W5EA 3FVFB 4X6MA 1AZZA 5KEDA 4IC6A 3LIWA 4HZHA 1OXGA 1MU8B 7GCHG 1ID5H 3ZVEA 3EQ0H 1BTHH 5FPTA 1Q2WA 1QJ1B 1SPJA 4OS1A 2XWAA 4YT7H 2NU1E 5EJZA 3A8AA 3S9CA 2P3TB 1GBMA 1O2XA 1FV9A 1OP8A 2B9LA 1HXEH 3NUMA 1BRAA 4XBCA 1HB0B 1GI0A 1Z1JA 2IJOB 1O5AB 4X6OA 2J5UA 1TA2A 2BZ6H 1DX5M 3ZZDA 4FUIA 2RDLA 1OWKA 1ANDA 2SNWA 4NZQA 2BLQA 2GV7A 1O3MA 1XVMA 2C8WB 4ZXYH 1SLWB 2L74A 3ZV9A 3ODDA 3EE0B 1QHRB 2GCTC 1EQ9A 1RXPA 1DDJA 1ELAA 3SNDA 2HGTH 5JYIA 4GPGA 2PKAB 2FYRA 1MD7A 2FOCA 1YPKH 2QGRA 1QY6A 3ZVFA 4I31A 5L2ZH 3NZIA 5EXMA 1PPHE 1XVOA 3UY9A 1C4U2 2TGDA 1BDAA 3QZQA 3RXCA 3M7TA 3DA9B 2VJ1A 4A1XA 1GI7B 4MPVA 3BTDE 1EB1H 1O3LA 1O5CB 3B8JA 1GBHA 2J38A 1G3CA 1C2GA 1TNIA 4A7IB 4NWKA 3SGAE 2FS9A 1O5FH 1YPHE 2P3UB 2A31A 2BDBA 4ABFA 1ZHRA 2FZZA 3UR6A 3O8RA 1P2JA 3TJUA 2VB0A 3M61U 1ESBA 3A81A 2BDCA 5EQQA 5DKMA 4Y8XA 1OWHA 4LK4A 3E6PH 4X8TH 3VG8A 2LELA 2WPJS 3HATH 3FZZA 3KHVA 1CU1A 1DWEH 2A4OA 2F9PA 2VIQA 3GY7A 5DP3A 1QNJA 3P6ZB 3C1KA 4X6NA 1LPKB 3NXPA 1BQYA 4ZROA 1F0TA 4NA8A 2ZU3A 2AERH 3T27A 2AYWA 3TGIE 1RGQA 1YPLH 3GYLB 2A7JA 2STBE 1O2IA 1GBKA 1O3PB 2IPQX 1PPEE 1FPHH 1UTOA 5E2PA 3F9HA 1HAHH 4CH8B 2ZPSA 2UUKB 3E91A 2A4RA 1C1TA 1IQIA 1GHWH 3P70B 1YF4A 4MPXA 3RXHA 5DSFA 2ANKH 3Q3XA 4YESB 3PRBA 3HKIB 3RXOA 3KN2A 3ZZ3A 4DVAU 4D7GA 1AE5A 1ZMLA 1J15A 3BTGE 3D62A 3M5LA 1QFKH 3QO6A 2ZDNA 1O5GH 4TWWA 1O2VA 5KECA 3MH7A 1LKAA 1NZQH 3P95A 1SR5C 5TCAA 4H6SB 4AZ2B 1AIXH 1GCDA 1ZTKA 4THNH 5E2OA 1K9OE 1CGHA 2BVSH 2EQNA 3ZVAA 4NSVA 1TX8A 4TSFD 1C2IA 3SUGA 1EAXA 1EKBB 3PLKA 2QF0A 1W3CA 1DSUA 1GWAA 1MTNB 2PWXA 2F83A 1YM0A 1QL9A 1DY8A 3AASA 5GPIB 3A7TA 1CVWH 2O8UA 3N7DA 3TK6A 3LU9B 2ZCKP 3SU5A 3R3GB 4U32A 3STIA 2D26C 2SGDE 1C2FA 1FZZA 5HXFA 2AMPA 4NG9H 3IITA 1HAYB 2B0FA 2BY8X 3F9FA 2Z9KA 4TY7A 5F53A 1T8NA 3M3VA 4WWYA 2M5TA 3P8OA 5F8TA 3RP2A 1ZJDA 2V3MA 3MQKC 2SGEE 1OYQA 1BHXF 5F6MA 1NFYA 3LONA 5C0UA 3WWBA 1T7CA 1SSXA 1MTWA 5A0AE 4JZ1A 1T32A 4Q63A 3A7YA 3KQCA 3F2GA 2NWNA 4DIIH 1EUFA 1GI6A 2R2WU 1F5LA 4K1SA 3MO6A 4X1PU 1E34B 1C4Y2 1XXDA 1OWDA 1W0YH 4YOGA 1H4WA 1TOCB 1UVUH 2HLDD 3O8DA 4BAOB 2WHXA 4H4FA 2H9TH 4Y71A 1MBMA 1CHGA 4CH2B 1TRMA 2ZU4A 3DSPA 4AFSA 2XW9A 1NS3A 2ZPRA 2GZ8A 1UCYK 1A3BH 3FZDA 1QB1A 4A1TA 1P57B 2Z3DA 1N8OC 2F9OA 1FY5A 5GCHG 4KP0A 1HAXB 1WTHD 1UCYE 4TWYA 2EY4C 2Y81A 3A7XA 3M5MA 1NESE 4JZEH 1SLUB 1L1JA 1YPJH 1Q3XA 1O2SA 1UK2A 1WTGH 3GCNA 1NY22 1O5DH 2AGGX 1GPZA 2YMSB 4NA7A 1N8OB 3OEED 1YPGH 5DP4A 1CA0B 1P2OA 1O2LA 2AGIX 2A7HA 3HK3B 5C5OA 1BTUA 4XD7D 1H8IH 4M9FA 1EFRD 4A5TS 4K8BA 4INHA 3SU2A 3LGWA 4O9VA 1G30B 1Z6EA 1P11E 5JBTA 2H5CA 3E8LA 4Y76A 4B2CA 1W0JD 4WF8A 3SO3A 1D3PB 3DFJA 5JB9S 1W7GH 3RXMA 4FUFA 2XC4A 3M7QA 3SV2H 1MU6B 2K8IA 1A0JA 4J1YA 1COWD 4U30A 3H09A 1VJ9U 1HIAB 3LGYA 1XXFA 1ETSH 3SGBE 1A46H 1UVOA 1XUIA 2W6ID 1V3XA 5ESBA 3KQBA 1C4V2 4UEHH 3H7TA 3U8TH 2PR3A 1DLEA 1NRPH 3QGNB 3T25A 1SQTA 3Q76A 2FESH 2BLVA 1O3EA 1SHHB 2YMSC 5L2YH 3E0NB 1EJNA 1GVKB 4GAWA 1GJ9B 2Z9IA 1KY9A 1S83A 2VIWA 3KL6A 5C2ZA 1C5OH 3PTBA 1V2QT 2ZGXH 1SOZA 1QBVH 3M35A 4F4OC 1RJXB 2TBSA 1DSTA 1O3NA 4CRDA 2Z7FE 1C5UA 2H6MA 3MH6A 3SHCH 4GCHF 5FCKA 3MO9A 4UONA 3ELAH 1WAYB 1WDIA 3RXLA 1BTYA 1GJ8B 2Y80A 1G2LA 3CP7A 1NPMA 1KLIH 4OS2A 4ZKOU 1N1LA 1GMHG 1OOKB 1HNEE 4Y0YE 5DN6D 1HAIH 2PSYA 4LOYH 3URCA 4AORA 1O37A 2XOKD 4BXWA 4Y8YA 1V2PT 2FTLE 4FU8A 2ALPA 4GCHG 1E0FD 1TONA 3TIUA 2AMQA 5CMXH 1K1OA 4NFEA 2BY9X 4IC5A 3TITA 3MU0A 1CT2E 1YBWA 2GZ9A 5BRRE 1CO7E 4CR9A 3LOXA 4TPYA 2P3FH 4YXWD 3K65B 1HGTH 1O5BB 3F9GA 1O0DH 1UTNA 1NTPA 4ZHMU 1ZSJA 2H9HA 1LTOA 3GCTG 4AB9A 4I8HA 1CBWC 1BITA 3SORA 2BLWA 3KQ5A 2OBOA 3C27B 1C2KA 2F91A 1S85A 2O9QA 1YPMH 1BBRK 3KYFA 1BRCE 1GJ7B 1YPEH 2P59A 3UWJH 1B5GH 3LPRA 3ZZ5A 3KF2A 1AKSA 1BRUP 1YLNA 1TGTA 2AGEX 2XXLA 6LPRA 3PMHB 1NFXA 4OS4A 1MTNC 1BTXA 4OGYA 3TNSA 2PTNA 1CQQA 3M37A 3SU4A 1XKAC 1C1NA 3SU1A 1PYTC 3BTHE 1HAPH 3RDZA 1A0LA 5C94A 2BDGA 1C2HA 4DT4A 4JMYA 1V2KT 1NBMD 2V3OH 4XBBA 2PLXA 3D49H 1XMNB 4WXVA 1Y59T 1K1LA 8KME2 2PW8H 1GBCA 2BY7X 1YPHC 1MTSA 2EA3A 2JETB 3UWIA 2FOBA 3D65E 3ZV8A 2AEIH 4AFUA 1TFXA 4HG6A 1O3CA 2GV6A 4IS5A 2H9EH 2Q6GA 1MKXK 1QA7A 2ZDLA 1S6LA 2GMTB 4HFPB 4XDEA 1VCWA 1ANEA 5DP5A 3JZ2B 2PV9B 1KXDA 1H8ED 2IN2A 1C5XB 3KEEA 2J94A 2Q6FA 1Y3YA 4VGCC 3RXUA 3BTKE 3VXFH 2HNTC 1FAXA 3OEHD 4FXGH 1NC6A 4HI3A 3VGCC 1ZZZA 2KCYA 3RC6A 1ARCA 4MPWA 3I29A 3MFJA 5C1YA 1DE7H 3LGVA 3SQHE 1HAGE 1MQ6A 4FUHA 3FANA 5HKKD 2BQWB 1HPGA 1GBEA 2ZGBH 3OSYA 1O2OA 5EXNA 1P04A 6GCHF 1ANBA 4B74A 2XRCA 4B1TA 2ZHQH 5A09A 1O2GH 3E0PB 1DPOA 4Z6AH 3Q3KA 1EJAA 1KXFA 1GJCB 4I86A 5C20A 3W95A 1W10U 4Q7XA 5LGOA 1A1RA 2BXUH 1BMMH 1FPCH 2GVFA 1KLJH 1HJAB 1BOQA 1GHVH 5C0TA 3EDXB 1SGPE 4AYVB 1C1SA 3A89A 1K1PA 4ABDA 4IMQA 1O3AA 3SOSA 4DIHH 4LZ4B 1WOFA 2Z3EA 1S82A 4NIYA 3UB0A 2QN5T 3WY8A 1KYNA 1C5MD 1E36B 1HJAC 5FCRA 4AGJA 3BIUH 1QB6A 3M3TA 1UMAH 2ODYB 1BRBE 1TMBH 2JH5D 2B7DH 2ZIQH 1DM4B 4JK6A 4UE7H 4DCDA 5JBAS 1VGCC 1DUEA 1J8AA 1WUNH 1TGCA 3LJJA 1CSOE 5FHTA 4NWLA 4Y0ZE 1PPCE 4ISNA 1A0HB 1BJUA 1TMUH 4ZKSU 1D3QB 1K22H 2PTCE 3E1XB 1WCZA 4Q4LA 4ISHH 3GICB 3S7HB 1ELBA 1QGFA 1H9HE 3P8NA 1EATA 1UW7A 3B23B 4MVNA 5JB8S 1BUIA 2JDID 3KQDA 1ELFA 1UVPA 3T28A 5F03A 5LPEA 4X8SH 1FMGA 2KX4A 2SGAA 2PSXA 1JIRA 3EE7A 2OC0A 1YCPK 3TK9A 4CRBA 3TVJB 2KCPA 3SNEA 1O3GA 3F2FA 1L2EA 4WH8A 1CGJE 1DWBH 4E05H 2VH6A 1ZGIA 1N6YA 2VBCA 3SYJA 3RMLH 3UOUA 1LHFH 1ELEE 3QGJA 2VIVA 3SJOA 2BD5A 1MH0A 3F1SB 4GVUA 1C5ZB 1GHYH 1OX1A 4DOQA 1O2JA 2ZZUH 1P2MA 2OLGA 2BOKA 3HGNA 5A8ZA 3OU0A 4B76A 1GDUA 1KMHB 1TALA 1RRKA 2J2UA 1P3CA 4FUGA 1C1MA 3UR9A 4YOIA 3UQVA 1FQ3A 3RU4E 1TBQH 1ZSKA 3TH2H 1RTFB 2OXSA 1ZOMA 1NFWA 4KTSA 1FJSA 4Y11E 1V6DA 1D9IA 1GG6C 3SBKA 1W0ZU 1A5GH 1FUJA 1VCPA 2ZEBA 1QZ8A 1W12U 2OBQA 1GI9B 2CXVA 2ULLA 2GT7A 1ZLRA 3VGCB 1BTZA 3LC5A 2Y82A 2VWOA 6CHAC 3T2NA 1EAUA 4RKOB 5FPYA 2G5NA 3VPKA 2CHAB 1A2CH 2EEKA 1IQLA 1FONA 5EQSA 5FBIA 2ZGCA 1BTWA 3V12A 3ATMA 1S81A 2TGAA 1AO5A 1K0HA 4ABEA 5C17A 4CHAC 2KM0A 1P8VC 1HAOH 1OYTH 1XUGA 4B2BA 1IHSH 3NCLA 4GHQA 1YWUA 1GGDC 2WZQA 2W3KA 5TJXA 3SUFA 4X8VH 1Y3WA 4CBNA 3KCGH 4F49A 1GI4A 4FUJA 1E1RD 1PPFE 2CJIA 3Q00A 1J16A 1ESAA 2A2XH 2QXHA 1TLDA 2BY6X 1GJDB 3BIVH 1V2OT 4OS7A 1SGIB 3U1JB 1QBOA 5DJ7A 1F0SA 3SV7A 1Z71A 2RA0A 2ZPQA 1C5NH 3LGUA 1ELGA 1AB9C 1KLTA 1LVYA 4Q7ZA 2ALVA 2GKVE 4UDWH 1TNJA 3TGJE 1AUJA 1L0ZA 2ZFPH 3RXQA 1LVBA 1UK3A 2ZHDA 1KDQB 4IMZA 4Y6DA 1C2JA 1Y3VA 4AX9H 4H42U 3A8DA 4A92A 1GJ5H 1MAXA 3MH5A 2BD2A 5J4SA 1PQ8A 1AMHA 3LKWA 1WU1A 3PYHA 1FIWA 1ZGVA 1GJBB 1UTQA 1OWJA 4KTUA 2ANWA 1E37B 5BPEA 5C1XA 3MHWU 3ZVBA 2F9BH 2BVRH 4WMFA 3M36A 3OX7U 8LPRA 1DXPA 1SBWA 1C5PA 2FO9A 1SVPA 3SJ9A 1P01A 5ETXA 4I8JA 1KTSB 2OUAA 2BB4A 1O5EH 1PYTD 3BTFE 3A84A 1C5QA 3HK6B 1BCUH 2Y5GA 1KXCA 1OKXA 1B0FA 1UTJA 2ZU1A 5EU8A 1RFNA 2EI7A 3TNTA 4OGXA 2ZFFH 1CBWB 1C5YB 2XBXA 1FY8E 4BAQB 4I32A 2WV4A 2BDIA 1BA8B 3A7VA 2RFKC 3EA7A 3P92A 1RIWB 1GVLA 1DUAA 3KIDU 2G52A 2G00A 1OS8A 1F7ZA 3FP8E 1EP5A 3F0OA 3RMMH 1K1JA 1ORFA 1AN1E 2QF3A 1EZXC 5DK1A 2A1DB 3UTUH 4K69A 1SGDE 3F0PA 1DWCH 2A45B 2CF9H 2BZAA 4UD9H 2HALA 2UWOA 3OE7D 1GJ4H 4XBDA 3B9FH 2A32A 1AI8H 2C93B 7KMEH 1ANCA 1C5LH 2Z9JA 1P02A 2FEQH 1CA0C 1YLCA 1GDNA 1QBNA 4DJZB 2UUFB 4FUDA 2WPHS 5GDSH 2WPDD 5F8XA 1THRH 5GXPA 3G01A 5FX6A 1IQMA 2XTTB 1GL0E 3BV9B 3W94A 2PKAA 2QYIA 5HMAA 3BEIB 3RM0H 4RN6A 1HUTH 4RT0A 3GY4A 1G9IE 3TJVA 3PRDA 3NWUA 3BSQA 3QWCH 1K21H 3OAAD 3RU4D 1XUKA 2ZFRH 3F2HA 2WUCA 1XX9A 1PQ7A 3SZEA 4MG3A 2VWNA 2ZCLP 1O31A 2YOLA 2SFAA 2A4QA 2ZNKH 1LVMA 3SU3A 4ZMAH 3AAVA 3V3MA 4AG2A 4YTAA 1OP0A 1CGIE 2FX4A 3LH1A 5E8EH 1BT7A 2W7SA 1EX3A 1DANH 1QB9A 1P0SH 1VJAU 4OS5A 1LCYA 2G8TA 5C5NA 1S6HA 3S7KB 4CRCA 1T8OA 1C1PA 1KXBA 2ILNA 2A5KA 4O97A 2F3CE 1IQJA 1EZQA 2PP6A 1MZAA 3EA9A 3F3BA 2EC9H 2GT8A 4JZDH 2BVXH 2RDEA 1FN6A 4I8GA 2UUJB 4YOJA 2ZTXA 4JYTA 3I78A 4BTUB 3N99A 2KCAA 1A5IA 4MNXA 1NM6A 3WW7A 2DE9A 3PV5A 2TRMA 3KGPA 3ZZ7A 2D2DA 1P3EA 2VWMA 3A82A 1TPPA 1T8LA 1OWEA 1C9TA 3T26A 1ZMJA 3BTQE 1X7AC 4TT3D 2VNTA 2Y7ZA 1TNGA 1JWTA 2BYAX 1P10A 1W11U 3CS0A 3M3SA 1SL3A 1Z6JH 1W14U 3N7OA 1O2TA 2ZGHA 2JH0D 4GSOA 3BTME 1NU7B 2UUYA 3BEFB 4D9RA 1SG8B 2WINI 5CDFE 3PROA 2IPHA 1L1GA 2HVYB 1D6RA 2XNDD 4P00A 3RXEA 4MNWA 1S5SA 5DP7A 3SQEE 1TX6A 2J97A 4Y10E 2FOEA 3ATKA 2OQ5A 9ESTA 3MOCA 1QA0A 1BTPA 1TQ7B 3SU6A 1ZRBA 4B2AA 4ZKNU 2KAIA 1GHBF 1QJ6B 3UNRA 2BM2A 3VB3A 1SKYE 3H5CB 4B71A 3A8CA 1OPHB 1Y5BT 2J98A 3TLOA 3DFLA 5DG6A 5ESTE 1HYLA 2AFQB 1O3JA 3ZVDA 4MLFB 1VITG 2ZQ1A 3RXSA 6ESTA 2Y5FA 2QCYA 1AD8H 4I8KA 1GCTC 4GUXA 1Z8RA 1BMNH 3GCTF 1GJAB 2WV9A 3M5NA 4FOUC 1HAZB 3LGTA 1GG6B 5T6GA 2CMYA 2FS8A 1JOUB 1IQKA 4NIVA 3A87A 3F68H 5A0BA 3AVZA 4ACBA 2W26A 2HOBA 1NN6A 1EAIA 3CNRA 4XRNA 4RSPA 2GCTB 1YCPH 1SGQE 2YNBA 5EW1H 5CHAB 2CHAC 1FX0B 1G37A 2AIPA 4ABGA 1EASA 2KFWA 4K1EA 4JYVH 2CV3A 5A0CA 4ZXXH 1D4PB 1GMHF 4A1VA 1BBRH 2Z6BD 1CHOF 5ABWA 1A3EH 5EPNA 5K0HA 1MQ5A 2G4UA 4ABIA 1TGSZ 2ZTYA 2OQUA 1Z7KA 1E35B 2VH0A 2FWWA 1D6WA 2ZDKA 3SV9A 2G5VA 3LC3A 2R3YA 4BTTB 3GCHB 3QDZB 5B6OA 2OC7A 1DOJA 3F9EA 2ZCHP 4F55A 2A4GA 1RS0A 3MWIU 1SQOA 1CT4E 3A8BA 1MKWK 5DGJA 5T3HA 3RXRA 1AY6H 3RXTA 1KIGH 1YC0A 1GGDB 4FVDA 4BXSA 1QTFA 2VGCC 1DVAH 1D3TB 1FAKH 1RTKA 2XNIA 1GMCG 2V7QD 1FI8A 3KNXA 1BMAA 1N6XA 1F0RA 2ZKSA 4TY6A 3FOAA 1O3DA 3MI4A 1HJ8A 2V3HH 2TGPZ 1G2MA 2ESTE 1O2HA 2WPLS 1BZXE 2ZGJA 1SFIA 1H1BA 2GTBA 2QY0B 1KXEA 2WYJA 5K7RA 4D7FA 2EI8A 1O2UA 1LHGH 1OWIA 7GCHF 3A7ZA 1ZPCA 1C1VH 1V2JT 3ZYEA 2YMSD 5EQRA 4X1SU 1AE8H 4PROA 1O30A 2FTMA 1VZQH 1A4WH 3Q3YA 5GCHF 2D8WA 4R0IA 5HM9A 5DO4H 1YP9A 3T62A 1MKWH 1P06A 3A88A 1MZDA 2J34A 4M7GA 4X8UH 1G3DA 1KDQA 4I7YH 2GCHF 3M7UA 3L6PA 1XUHA 1NRQH 3PMBB 1G32B 1IAUA 1NU9A 1K1IA 1V2NT 3FFGA 1GI5A 4D8NA 2FOGA 1AWHB 2H5DA 2VVUA 2XWBI 3ITIA 1GJ6A 2XBYA 4QT8C 3KQEA 4NSYA 3GISB 2R0LA 1EOJA 1BHXB 1AUTC 2A2QH 3MTYA 1P05A 1OHHD 3CS7A 1TPOA 1GBAA 3QTVH 4GLYA 3UNQA 1HV7A 1O34A 2A7CA 1MD8A 1K1NA 3TJOA 1UK4A 1K28D 3GCOA 2BHGA 5L6NH 3EYDA 2C8XB 2VIOA 3BTTE 3GDUA 4B6FA 1JRSA 1MUEB 2F4LA 2GMTC 2V6NA 3QX5H 8ESTE 1AFQC 3K6ZA 2FP7B 1Z8GA 3QN7A 3FP6E 1GBDA 1J14A 2R9PA 3UOPA 3NK8A 5PTPA 1HCGA 2ZFQH 1GHAF 1SQAA 2I6QA 1OSSA 3GS9A 1RTLA 3W1EA 3SJKA 2P16A 1V2TT 3VB7A 1FN8A 2Q6DA 3AW0A 4MNVA 1K1MA 3QUMP 2BX4A 1FLEE 1A61H 3QK1A 4DGJA 4NFFA 3TPIZ 1MCVA 1AB9B 2OP9A 2FLBH 3EGKH 4D9QA 1P12E 4ABJA 1H8DH 2XC0A 1BMLA 3ZVGA 1JXPA 1LHEH 2CN0H 2ZO3H 8GCHG 4LZ1H 2SGFE 1WYKA 4ZAEA 3WWFA 2P8OB 3HKJB 3PO1C 1TGNA 2B8OH 1HJ9A 4WY3A 1GMDG 3RXJA 1ELVA 2WPMS 2OCVB 1F0UA 4CRAA 1TB6H 2PFEA 5EPYA 2WPKS 1ZHPA 2P93A 2UWPA 3L33A 4IW4E 2Q1JA 1WXRA 3VB6A 1TMTH 1ZPZA 3S0NA 2ZP0H 5EOKA 2GCHG 3SNCA 1T4UH 2BDYA 3MNXA 2G55A 5AFYH 5JBBS 3BG4B 3ZZ4A 4WMDA 1CHOG 1GBBA 4JCNA 3Q77A 3U98H
chains in the Genus database with same CATH topology
2UWLA 2ANMH 1SMFE 4Q7YA 3ZZCA 4LXBH 3K9XB 1SB1H 1EPTB 3OTJE 1GI3A 5DP8A 5EG4A 1OP2A 5LH8A 1TGBA 1UVSH 4MDSA 3RXBA 4I33A 3PO1B 1MBQA 1O2PA 4JK5A 2HRVA 4KKDA 1PQAA 1GBTA 1AGJA 2BXTH 3RU4T 2WYGA 3LGIA 4NIWA 4CRGA 1SGFA 1O2QA 1TABE 1TE0A 5DP9A 3BG4C 4X2XA 2VVVA 1C1OA 5T6FA 5GWZA 3UIRA 6GCHG 1LPZB 1GMCF 1S84A 1VITH 4FUBA 5E0JA 1UJ1A 4BTIB 1G3EA 1ZMNA 2P8OC 1ZTLA 4XE4A 1J17T 2ZWLH 1EPTC 1E38B 1AU8A 4YZUA 1U6QA 2K1QA 4MQAA 3SI4H 4INKA 4CR5A 1ZSLA 2NU4E 5HGGA 1IQHA 5DP6A 1FXYA 2QA9E 3RXPA 1CE5A 3S9AA 3CENA 4MNYA 2FI4E 2R3UA 2F9NA 1SGYE 3SNBA 4X2YA 4CBOA 1S6FA 2BLOA 3TH4H 1SHYA 5FPSA 1JIMA 1QRZA 1HIAA 3AAUA 2IOTA 3MNSA 3HPTB 4ABBA 2FOHA 2ZG0H 4ISLA 1O3OA 1TRYA 2PHBA 1GHZA 3URDA 5GJ4B 5E0HA 4JYUH 1KTTB 2KAIB 1F5KU 1HAVA 2Z9LA 4AFQA 3BF6H 5JBCS 1MAYA 1HRTH 1O3FA 4FVBA 1O35A 2BX3A 4AB8A 1C5VA 1DITH 2AIQA 2HVXA 3UPEA 4CHAB 1HFDA 2BDAA 3PWCA 4O3TA 1QRXA 1KXAA 3RXVA 2HPQH 5CE1A 2Y5HA 1PPZA 4Y7AA 4MPUA 1P2QA 2BD8A 1YGCH 1ZTJA 3SI3H 1IQEA 2BD9A 5TCCA 2O8WA 4BOHA 3GY5A 4YM9A 1J9CH 3QLPH 4FU9A 2GDDA 3ZVCA 4AGKA 4OS6A 3SGQE 1KSNA 4Q80A 2Y6TA 1VITF 4ZKRU 2PGQB 3RXKA 1FY4A 4ZHLU 1IQFA 1DWDH 3U9AH 3MU4A 5FAHA 1SLXB 2VINA 1GL1A 1ELDE 1O2ZA 1ZJKA 1TIOA 3DHKH 1LHCH 2C90B 1EOLA 1SI5H 3RXAA 2FOMB 9LPRA 1PQ5A 2NU2E 1NO9H 5H4IB 3BEUA 1SLVB 1TNKA 3JZ1B 1WQVH 1G36A 2ZHWH 3RLYH 1P03A 2OC1A 1V2ST 4FUEA 2RA3A 4WXIA 4VGCB 3A86A 1UTLM 1AWFH 2TIOA 1AKSB 4GHTA 4X1NU 1DICA 3RMNH 4AN7A 4YLUA 4Z0KA 5IDKA 1GBIA 1O3IA 5FX5A 2O8TA 1CA8B 4DG4A 1SGTA 3RM2H 2VGCB 1NROH 2AH4X 2GP9B 3ZZAA 4BAKB 4KELA 5C1UA 4ISIH 1W2KH 4NGAH 4UFEH 2XBWA 1FY1A 2HWLB 3SJ8A 2NU3E 3TK5A 5I46H 1EPTA 3BTEE 4ZUHA 4JZIA 2LPRA 3M5OA 3E16B 2LNCA 3SU0A 1F2SE 1EJMA 2ZQ2A 2J9NA 3GCHC 2EI6A 1UTPA 3V0XA 2G81E 3RXFA 4KGAA 3V7TA 3ZZ6A 3QTOH 2ZDAH 4CREA 1MTUA 4H6TA 2GD4B 2Z94A 1JMOH 1V2LT 3U69H 3EAJA 2FI3E 1SC8U 1C1UH 1ESTA 1Y8TA 1TAWA 4X2VA 2F9UA 1P9UA 2QIQA 2SGPE 1INCA 1GI8B 1EAWA 3BG8A 2ZTZA 1H9IE 1LHDH 1Y5AT 4AOQA 4DY7B 3VXEH 1LKBA 5CHAC 1C1RA 1EXFA 1PJPA 1SGNE 2BOHB 3VB5A 5C3NA 2RCEA 3BTWE 3STJA 1Y5UT 2ZECA 2TGTA 2C8YB 1P2NA 1LQEA 1C2LA 4HGCA 1FY3A 3RUOA 3MU5A 3A85A 4X2WA 4Y79A 3ZYDA 1BB0B 1W8BH 2CGAA 3NKKA 5AFZH 1ZRKA 5DPAA 1GCTB 4E7RG 3GY2A 1F5RA 4NCYA 1DLKB 2H1UA 1GVZA 3VFEA 2BMGB 4INLA 1B7XB 4HTCH 4TPIZ 2G4TA 3ZZ9A 2FM2A 1CT0E 1MCTA 1ACBE 2OINA 2VU8E 4K8YA 1FNIA 1NRNH 1PFXC 2P95A 2XCFA 3UUZA 1Y3XA 1DT2A 3GY3A 3OY5U 1TRNA 1TBZH 2A5IA 2HNTF 1EZUC 4WH6A 4FU7A 1WSSH 3S69A 1LQDB 1ZYOA 2FOFA 3P8GA 3LT3A 1WBGB 2FI5E 2J92A 1NRSH 2G51A 1IQNA 2WPIS 5EGMA 1B0EA 3TGKE 4ISOA 1O39A 2Z9GA 4ZH8A 2Z3CA 3PM3A 2R0KA 1MKXH 2VWLA 3EA8A 4YT6H 1O3KA 1TA6A 2O8LA 1PPBH 1ABIH 1UTKA 2BQ7B 5A2MH 2R2MB 2XC5A 6CHAB 1BJVA 5A8XA 5I25A 3IG6B 1TOMH 2BTCE 2ZU2A 2J4IA 3D23A 4B73A 2H2ZA 1ZR0A 1QL8A 3A80A 1QR3E 2BD7A 3ESTA 3R0FA 3OY6U 3ZZ8A 1O2NA 3S9BA 4CRFA 1WQSA 3PV4A 3U8RH 4MTBA 4ESTE 2YNAA 3F6UH 1O33A 3LDXH 1QL7A 2AS9A 1FIZA 1TPAE 4K3JA 2ANYA 1YKTA 3TU7H 5GIBA 1V2WT 1QJ7B 2ZF0H 2C4FH 3P17H 2F9VA 1AVXA 3V13A 4DW2U 3TJNA 3RMOH 1DY9A 1GHXH 4AFZA 1S0RA 2C8ZB 1C5SA 4I8LA 2GDEH 1P2IA 1V2RT 1D3DB 2ZDVH 3UQOA 1XKBC 3GDVA 2ZDMA 3ATIA 1W13U 2QAAA 1V2MT 1C5TA 1VR1H 5FBEA 1VCQA 2ZHFH 4U2WA 4JZFH 1Q31A 4X1RU 1YCPM 3O8CA 3L3TA 2I6SA 4IN1A 4O3UA 4ASHA 3SNAA 1PPGE 2B5TB 1AVWA 3A83A 3SJIA 1QIXB 1RD3B 4WVPE 3SN8A 1HXFH 3DD2H 2FMJA 4ABAA 3MO3A 5HM2A 1TQ0B 1Y3UA 2W3IA 4Y7BA 3FAOA 4IN2A 5SGAE 3GY6A 2SGQE 1DXWA 4X1QU 1TBRH 3UFAA 2HPPH 1NFUA 1SGFG 4WJG2 1XM1A 4X0WU 4BANB 1C5WB 4UFDH 1LVOA 1DS2E 1TWXB 1O2WA 2QXGA 1IHTH 4NIXA 3SUEA 2FPZA 1IQGA 1QURH 2A0QB 1ELCA 3SHAH 5JPMH 2OTVA 4IBLH 1V2UT 3ENSB 2J95A 2BY5X 1W7XH 1AQ7A 2FXRA 8GCHF 2QV1A 4K2YA 1YLDA 1O36A 3VB4A 1EP6A 1QQUA 2FOAA 3PMAB 5HYOA 1P9SA 4K5ZA 4XSKU 1GI1A 3UREA 1FDPA 2FDAA 1XUJA 1T4VH 4YO9A 1HAVB 3RLWH 2FX6A 1SGRE 1C5RA 1ETRH 2GX4A 2ODPA 2ZA5A 2ODQA 1MTVA 4SGAE 3RC5A 1ZPBA 1UVTH 3E90B 3HGPA 1QRWA 1K2I1 1O2YA 3GYMA 1ELTA 2PUQH 4Q2KA 5LPFA 3DT0H 2Y7XA 5LPRA 4BNRA 2JKHA 3A7WA 1UHBA 2RG3A 1LPGB 2XBVA 3PB1E 1QCPA 4TYDA 3PTNA 1A7SA 1SOTA 4A6LA 1O3HA 3RXIA 2JETC 1WV7H 2ZC9H 5AHGH 4AYYB 5G4BA 5E0GA 3MH4A 4RKJB 1HDTH 1AFEH 3UNSA 1L4DA 1P2KA 3PLBA 1JBUH 1RIWC 2XYAA 3ODFA 5A8YA 1V2VT 1O38A 5EXLA 3BN9A 3K2UA 2ZU5A 1GBLA 2BD3A 4XOJA 1GDQA 4UFFH 2QXIA 3T29A 2DE8A 1YYY1 3H7OA 2JH6D 2C3SA 4B75A 1LO6A 1O2MA 2ZI2H 1HLTH 2V0BA 3RXDA 1ARBA 2HLCA 3FP7E 3SUDA 2GGVB 1UCYH 2PKSC 4ABHA 1BBRE 2THFB 4Y8ZA 3AW1A 1F92A 1LMWB 3MU8A 2GZ7A 2DUCA 3MYWA 1L1NA 1TPSA 4SGBE 5T6DA 1P09A 2FYQA 2QC2A 3P8FA 2VIPA 4O03A 5C67A 4E7NA 3MMGA 3TH3H 2CF8H 1HBTH 3RXGA 3PLPA 2SNVA 2FLRH 4FUCA 2BD4A 1O32A 2STAE 3GDSA 5F8ZA 4U01A 2ZFTA 5FXLA 3LJOA 2ASUB 2P94A 1GBFA 1TNLA 1XUFA 3SZNA 5IYTA 1THPB 3ZZBA 2O8MA 1ETTH 1L4ZA 1GMDF 4E06H 4WMEA 1Z8JB 2WV5A 3U8OH 3MNCA 3E3TA 2ZHEH 1O2RA 2OD3B 1GHBG 1BIOA 1TYNA 3GOVB 3I77A 3MNBA 5EW2H 2PKSB 3VEQB 4NA9H 2WUBA 3IWMA 5AF9H 2V35A 4R8TB 3QZRA 1QQ4A 4K60A 4D76A 5JDUB 2OC8A 4K1TA 2W7UA 1ABJH 1AZ8A 3ATLA 4BAMB 1C2EA 1M9UA 7LPRA 1LDTT 4KTCA 2HNTE 3SV8A 4X6PA 1GHAG 3U1IB 2ZFSA 4YLQH 1NT1A 2PUXB 2XCNA 4ZHAA 2D1JA 7ESTE 1O3BA 2VIDA 1EZSC 1C2DA 1SGEE 2FODA 3PMJA 2NU0E 1Z1IA 3ATWA 1EB2A 1UO6A 1C2MA 1JRTA 3K6YA 3PWBA 1H9LB 1UHBB 4DURA 2PGBB 1TNHA 4XFQA 1THSH 1IOEA 4UFGH 1Z8IB 2QXJA 4IGDA 1AHTH 3LH3A 1ZHMA 1VGCB 2A5AA 1SGCA 5J4QA 2AMDA 1DFPA 5L30H 1C1WH 3T5FH 1A5HA 1C1QA 3NPSA 4J2YB 4DT7B 4NZLA 5AVDA 1NRRH 2BQ6B 1MMJN 2TPIZ 5EODA 1C9PA 3RC4A 1T31A 2BDHA 4AG1A 1SFQB 1GI2A 2VVCA 3O8BA 3SV6A 3GY8A 3OYPA 3DUXH 1GBJA 3SW2B 1S0QA 1AVGH 4BAHB 1TX7A 1AFQB 1UTMA 2FIRH 3MU1A 1O2KA 1G3BA 1T8MA 2W5EA 3FVFB 4X6MA 1AZZA 4IC6A 3LIWA 4HZHA 1OXGA 1MU8B 7GCHG 1ID5H 3ZVEA 3EQ0H 1BTHH 5FPTA 1Q2WA 1QJ1B 1SPJA 4OS1A 2XWAA 4YT7H 2NU1E 3A8AA 3S9CA 2P3TB 1GBMA 1O2XA 1FV9A 1OP8A 2B9LA 1HXEH 3NUMA 1BRAA 4XBCA 1HB0B 1GI0A 1Z1JA 2IJOB 1O5AB 4X6OA 1TA2A 2BZ6H 1DX5M 3ZZDA 4FUIA 2RDLA 1OWKA 1ANDA 2SNWA 4NZQA 2BLQA 2GV7A 1O3MA 1XVMA 2C8WB 4ZXYH 1SLWB 3ZV9A 3ODDA 3EE0B 1QHRB 2GCTC 1EQ9A 1RXPA 1DDJA 1ELAA 3SNDA 2HGTH 5JYIA 4GPGA 2PKAB 2FYRA 1MD7A 2FOCA 1YPKH 2QGRA 1QY6A 3ZVFA 4I31A 5L2ZH 3NZIA 5EXMA 1PPHE 1XVOA 3UY9A 1C4U2 2TGDA 1BDAA 3QZQA 3RXCA 3M7TA 3DA9B 2VJ1A 4A1XA 1GI7B 4MPVA 3BTDE 1EB1H 1O3LA 1O5CB 3B8JA 1GBHA 2J38A 1G3CA 1C2GA 1TNIA 4A7IB 4NWKA 3SGAE 2FS9A 1O5FH 1YPHE 2P3UB 2A31A 2BDBA 4ABFA 1ZHRA 2FZZA 3UR6A 3O8RA 1P2JA 3TJUA 2VB0A 3M61U 1ESBA 3A81A 2BDCA 5EQQA 5DKMA 4Y8XA 1OWHA 4LK4A 3E6PH 4X8TH 2WPJS 3HATH 3FZZA 3KHVA 1CU1A 1DWEH 2A4OA 2F9PA 2VIQA 3GY7A 5DP3A 1QNJA 3P6ZB 3C1KA 4X6NA 1LPKB 3NXPA 1BQYA 4ZROA 1F0TA 4NA8A 2ZU3A 2AERH 3T27A 2AYWA 3TGIE 1RGQA 1YPLH 3GYLB 2A7JA 2STBE 1O2IA 1GBKA 1O3PB 1PPEE 1FPHH 1UTOA 5E2PA 3F9HA 1HAHH 4CH8B 2ZPSA 2UUKB 3E91A 2A4RA 1C1TA 1IQIA 1GHWH 3P70B 1YF4A 4MPXA 3RXHA 2ANKH 3Q3XA 4YESB 3HKIB 3RXOA 3KN2A 3ZZ3A 4DVAU 4D7GA 1AE5A 1ZMLA 1J15A 3BTGE 3D62A 3M5LA 1QFKH 3QO6A 2ZDNA 1O5GH 4TWWA 1O2VA 3MH7A 1LKAA 1NZQH 3P95A 1SR5C 5TCAA 4H6SB 4AZ2B 1AIXH 1GCDA 1ZTKA 4THNH 5E2OA 1K9OE 1CGHA 2BVSH 3ZVAA 4NSVA 1TX8A 1C2IA 3SUGA 1EAXA 1EKBB 3PLKA 2QF0A 1W3CA 1DSUA 1GWAA 1MTNB 2PWXA 2F83A 1YM0A 1QL9A 1DY8A 3AASA 5GPIB 3A7TA 1CVWH 2O8UA 3TK6A 3LU9B 2ZCKP 3SU5A 3R3GB 4U32A 3STIA 2D26C 2SGDE 1C2FA 1FZZA 5HXFA 2AMPA 4NG9H 3IITA 1HAYB 2B0FA 2BY8X 3F9FA 2Z9KA 4TY7A 1T8NA 3M3VA 4WWYA 2M5TA 3P8OA 5F8TA 3RP2A 1ZJDA 2SGEE 1OYQA 1BHXF 5F6MA 1NFYA 3LONA 1T7CA 1SSXA 1MTWA 5A0AE 4JZ1A 1T32A 3A7YA 3KQCA 2NWNA 4DIIH 1EUFA 1GI6A 2R2WU 1F5LA 4K1SA 3MO6A 4X1PU 1E34B 1C4Y2 1XXDA 1OWDA 1W0YH 4YOGA 1H4WA 1TOCB 1UVUH 3O8DA 4BAOB 4H4FA 2H9TH 4Y71A 1MBMA 1CHGA 4CH2B 1TRMA 2ZU4A 4AFSA 2XW9A 1NS3A 2ZPRA 2GZ8A 1UCYK 1A3BH 3FZDA 1QB1A 4A1TA 1P57B 2Z3DA 1N8OC 2F9OA 1FY5A 5GCHG 4KP0A 1HAXB 1WTHD 1UCYE 4TWYA 2Y81A 3A7XA 3M5MA 1NESE 4JZEH 1SLUB 1L1JA 1YPJH 1Q3XA 1O2SA 1UK2A 1WTGH 3GCNA 1NY22 1O5DH 2AGGX 1GPZA 4NA7A 1N8OB 5DP4A 1YPGH 1CA0B 1P2OA 1O2LA 2AGIX 2A7HA 3HK3B 5C5OA 1BTUA 1H8IH 4A5TS 4K8BA 4INHA 3SU2A 3LGWA 4O9VA 1G30B 1Z6EA 1P11E 5JBTA 2H5CA 3E8L