1RIWB

Thrombin in complex with natural product inhibitor oscillarin
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
147
structure length
147
Chain Sequence
IVEGSDAEIGMSPWQVMLFRKSPQELLCGASLISDRWVLTAAHCLLYPPWDKNFTENDLLVRIGKHSRTRYERNIEKISMLEKIYIHPRYNWRENLDRDIALMKLKKPVAFSDYIHPVCLPDRETAASLLQAGYKGRVTGWGNLKET
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords thrombin light chain
publication title The N-acyloxyiminium ion aza-Prins route to octahydroindoles: total synthesis and structural confirmation of the antithrombotic marine natural product oscillarin
pubmed doi rcsb
total genus 28
structure length 147
sequence length 147
ec nomenclature ec 3.4.21.5: Thrombin.
pdb deposition date 2003-11-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1riwB00
1A5GH 1C2MA 1XUFA 1HAVA 1P8VC 1NROH 1RFNA 3ZZDA 2XBYA 1AFQB 4YESB 1EPTA 1SGFA 2AIPA 4K69A 4PROA 1C5YB 1H8IH 1EJMA 1HAGE 3BEFB 1O2VA 1MTVA 3S0NA 4ESTE 2ZDNA 1SHHB 1VCWA 1SG8B 1WQSA 6LPRA 2ZHEH 3A84A 1JOUB 1QCPA 2H6MA 2PUQH 3T29A 1PQAA 1ELAA 2AIQA 3LU9B 1F7ZA 1EXFA 2FZZA 4GHTA 8KME2 1UCYE 2PGQB 1SLUB 1KLJH 1FIWA 2ZDAH 1THRH 2ZU4A 1GBBA 2FOCA 1P06A 1TX6A 6GCHF 3QTVH 4CBOA 1CBWB 3BIVH 4MVNA 4FU7A 1CHGA 1S6FA 1MUEB 1YPGH 1GI1A 1SBWA 2LPRA 1GBJA 3DA9B 1TBZH 1MZAA 3P17H 4WH6A 3RMOH 1GMHG 2D2DA 3OY5U 4AFZA 3T28A 2BLWA 4YT7H 2J38A 1QB9A 2P3TB 5DP4A 1GI7B 4A6LA 1ORFA 4ABEA 1KXFA 2YOLA 2WPHS 1YC0A 2ANWA 4TWYA 4CH8B 2UUFB 4A1TA 1TRMA 2WPMS 2XWAA 1DY8A 2F9PA 4NWKA 2XRCA 2VWNA 1MMJN 1P2JA 1ZMJA 3URCA 2BVXH 2H9HA 2R3YA 4THNH 2PSYA 1U6QA 1MTNC 2PKAB 4FVDA 1GJ9B 2HNTF 5F8ZA 1TPAE 4I8JA 1OWJA 1GBAA 1GJ5H 2FDAA 2I6QA 3ODFA 1O2TA 4UONA 3N7OA 1EKBB 1P2NA 1GI5A 1GBTA 3JZ2B 3E0PB 1G9IE 1K1JA 5CE1A 4X1NU 4FUGA 5DP8A 1NRNH 4XFQA 1RIWC 2GCHG 1IQKA 1GJ7B 1OP8A 2F9NA 3ZZ6A 1IHSH 1NFYA 1NFWA 3SQEE 2WPIS 2R2WU 5G4BA 3RXPA 3D23A 4K5ZA 1NRRH 2R0LA 1UTOA 4UE7H 1G2LA 5T6GA 1AQ7A 1GBKA 1HRTH 3LDXH 3SJ8A 1LKAA 1GBCA 1FAKH 4F49A 1S85A 5JBBS 5J4SA 4DIIH 1RJXB 1RS0A 1BTHH 2BTCE 3LJJA 3A8DA 1ARCA 1LQDB 2HLCA 1QURH 1Z8JB 1P2OA 1INCA 2OTVA 4YOIA 3BG4C 1DWDH 3LIWA 3MH5A 4NWLA 1HXEH 1C5LH 4ABFA 5A2MH 1GHWH 1HIAB 2QV1A 1L1NA 4Z6AH 5JB9S 4GCHG 3MH4A 4X2WA 5AFZH 2PHBA 2HWLB 1F92A 1H9LB 1KYNA 2A4RA 2AFQB 2G52A 5EG4A 2ZHWH 3MU8A 3NWUA 3BF6H 1K1OA 1O5FH 1HV7A 1QL8A 2DE9A 5CMXH 1C5MD 1VITG 1O39A 4BAQB 3V12A 2Z9KA 5DG6A 1O2SA 4Y8XA 2VIVA 2Y5FA 4K60A 3FZZA 2OP9A 1N8OC 1SMFE 2BLQA 1SB1H 2ZI2H 2RG3A 3PMHB 1C1RA 3FP8E 3TGIE 4ASHA 4DCDA 2BY5X 1UK3A 3TJVA 3W95A 2C8YB 4CREA 3KQCA 4OS1A 1BOQA 3MOCA 1UHBB 2GMTC 1NY22 3PWBA 2XW9A 1V2MT 2ANYA 1W14U 1FPCH 3SBKA 3EDXB 1V2JT 1D3QB 2JETC 5HM9A 4ZUHA 2XBVA 4O97A 1MTNB 3QLPH 4B76A 3U98H 1GHBG 3QZQA 2ZECA 2C8XB 1TQ0B 3VEQB 4WMDA 1GI4A 3PLKA 1MKXH 4ISNA 3ODDA 4NCYA 3BEIB 4NA9H 1P3CA 3UQOA 8GCHF 1C4Y2 4Y11E 1DSTA 1NC6A 2TGPZ 1ARBA 1QBVH 1ANCA 3UR6A 2VIPA 1RIWB 4CR9A 2AYWA 2BD8A 3ATLA 4GSOA 1O2XA 1SGIB 2G4UA 2JKHA 2VB0A 2BM2A 5E2OA 2ZDKA 1TMBH 1WV7H 3SQHE 1K1MA 1P05A 2BLOA 4MNVA 4Y8ZA 2THFB 1ZPBA 3GDUA 3SU1A 1ABIH 4IC5A 3GCOA 1GVZA 1SSXA 2BDBA 1F5LA 1O5BB 1KLTA 1BBRH 2G5VA 3Q76A 4HFPB 2QXGA 4J1YA 2OUAA 5EQRA 2FP7B 1FY3A 4ZAEA 2A7JA 1MAXA 1EASA 7GCHF 1C2LA 5DK1A 1QRXA 3BG4B 1QHRB 3ZV8A 3V3MA 2P16A 1GHAF 2VINA 3DUXH 4D8NA 4NA7A 5JBTA 1IOEA 3A81A 2HGTH 3QDZB 1Y5AT 1ZTKA 1Z6EA 2D1JA 3HPTB 1CGHA 1DE7H 3BTME 1GHZA 4ABIA 2ZU1A 2B5TB 4LZ1H 4JYUH 1A5IA 1P03A 4CBNA 1SI5H 2ZWLH 1P12E 4CH2B 5FCRA 1NT1A 2EA3A 2J95A 2WPLS 1EP5A 4QT8C 5GCHF 2P3FH 1FIZA 2FI4E 1N8OB 5JB8S 3VB5A 2O8LA 4DG4A 1C2EA 1FXYA 1GMDF 5F03A 2H5DA 3RXFA 3S7KB 2M5TA 2BY6X 4CRCA 1S6HA 2GMTB 1C1NA 4JK6A 1XX9A 1KXEA 2PLXA 1X7AC 2VU8E 4YLUA 3ZVAA 1S0QA 1AVXA 1GVKB 1C2KA 5ESBA 1AKSB 1C5ZB 1ELBA 1CT2E 2H5CA 5C1XA 2GKVE 1AO5A 3FANA 4WVPE 3T2NA 1PQ5A 1SGEE 2TRMA 1THPB 5L2YH 1BHXF 2CGAA 2BZAA 2ZC9H 3U8OH 1MU6B 4BNRA 3GY4A 4AB9A 1VZQH 2GDDA 4AYVB 2UWOA 3PB1E 1ELEE 3SU2A 1FY5A 3RXQA 1F5RA 4ZHMU 1OWEA 5GWZA 3RXUA 1KXAA 2SGPE 1O35A 2ILNA 3SNEA 1W13U 1H8DH 2BD7A 5DGJA 3UNQA 4BAHB 4LZ4B 1TMTH 3QGNB 2Y7XA 2ZGJA 2ZEBA 4K8YA 3UIRA 1ZLRA 2SGEE 1LHFH 3SI3H 3E16B 2A5KA 1QA0A 1GMCG 4UFFH 1O2OA 1GJ4H 4LOYH 1WYKA 1T32A 4YOGA 4I8KA 2QYIA 1TA2A 2TGTA 4H6TA 3AW0A 2BD5A 1J14A 1TABE 2ZNKH 3M3SA 4HTCH 5BPEA 1C9PA 1BJVA 1QB6A 3VB6A 1HAVB 3VB3A 3L6PA 4MQAA 5C67A 3KNXA 1VCPA 2F83A 3P95A 4KTUA 1ZHPA 2GGVB 2VJ1A 1GGDC 1MAYA 1P0SH 4JZ1A 3A7YA 4MNYA 2BXTH 1NZQH 3EAJA 1DUAA 1W3CA 1G3EA 3GY8A 5T6DA 3FVFB 2ZCHP 1TGNA 2GP9B 2OXSA 1ANBA 3M5OA 4DOQA 3U1JB 1Z8RA 1P57B 2BZ6H 1CT0E 3AVZA 3NXPA 2NU3E 2XCFA 3A83A 4D9RA 3SGAE 3TIUA 2W26A 3ZZCA 3LGYA 1IQMA 1HNEE 3KEEA 1PPCE 4D7GA 2OQ5A 1HAIH 5EW2H 2GZ8A 1CA0B 1Y8TA 1TGTA 2JH6D 1BTPA 2BD4A 1AWFH 3JZ1B 3IITA 3S7HB 2G4TA 1F0TA 3Q77A 1TOMH 2FOGA 2BXUH 1C1MA 1K1IA 1O5DH 1TONA 2FWWA 2ZPSA 2PW8H 2QIQA 2PWXA 1K9OE 3I29A 1O2ZA 1QQUA 1GI2A 4ZH8A 1UTQA 2GT8A 3UUZA 2HVXA 4AN7A 5EPNA 5ABWA 2B8OH 2OQUA 1EX3A 2C4FH 1K2I1 3SI4H 3UTUH 4BAOB 3FAOA 3SU0A 1FDPA 2VWMA 3NUMA 2QA9E 2Y81A 1O5GH 1SLXB 4TPYA 5HMAA 1C5TA 1BTXA 1ID5H 2BQ7B 4DURA 1XUGA 5A8ZA 3SU4A 2XWBI 1MTWA 5F8TA 1LPZB 4Q7YA 2ZGCA 2BX4A 1VJ9U 1ZHMA 3U69H 3P8GA 1HGTH 3SV8A 2WYJA 3ZZAA 2QXHA 5EPYA 1RTLA 2BOHB 4MTBA 1ZRKA 4FUDA 1CHOG 2A32A 4Y0ZE 3UPEA 1L0ZA 2ALPA 1THSH 4NZLA 5H4IB 5DP9A 5EW1H 3SUFA 5C3NA 1DANH 2ZFPH 5DP5A 3UOUA 1LVYA 5FPTA 2J9NA 1XKAC 1GBEA 1SC8U 4ABHA 2EEKA 3A7TA 2HPPH 2P8OC 1UCYK 2ZCKP 1PFXC 2TBSA 1C2DA 3RXRA 3MH7A 1S82A 4AZ2B 2ZF0H 1ZSLA 5EXLA 3A88A 4Y6DA 3MO6A 1TNGA 3SU6A 1KSNA 1T8MA 4X6MA 3ZVEA 1YKTA 2VIDA 3ENSB 2W7UA 3RXIA 2RA3A 3Q3YA 3RLYH 1O3HA 3SJKA 1YPEH 4CRGA 1UVOA 2GX4A 3RM0H 1OP0A 3PTBA 4MPVA 5FPSA 2FODA 3LONA 4E7NA 1DPOA 3KL6A 4IGDA 4O03A 1EB2A 4GVUA 1O2HA 1L4DA 1HJ8A 2F9BH 4AFSA 1WCZA 2ZCLP 4D7FA 1C1QA 2XC0A 3SO3A 1CA8B 1AGJA 1KIGH 1BJUA 5EQSA 5FCKA 2Z3CA 1GHYH 4U30A 1QIXB 1SL3A 1NRPH 1UTKA 1WSSH 1A3BH 1HB0B 3PTNA 1BMAA 1UK2A 4MPUA 1PPEE 1C9TA 1IQGA 1O5AB 1LCYA 3NPSA 3TK9A 1DDJA 1OP2A 1AUJA 1O33A 1Z8GA 2A7HA 3RM2H 1GVLA 1YP9A 2QC2A 2BB4A 1Z1IA 3NCLA 5FHTA 3U1IB 3TLOA 1N6XA 1UVUH 2WINI 2BD2A 3STJA 1LHCH 3BG8A 2H1UA 5ESTE 3CS7A 4B2BA 4ISLA 1GJBB 1TIOA 1DUEA 1LPGB 1GJDB 1PQ7A 3ZYEA 4F4OC 1QJ1B 1ETRH 1DVAH 1TPOA 4R8TB 4WJG2 4ABDA 4NZQA 1VGCC 1C5PA 1PPBH 5GIBA 1W12U 3RXVA 1MKXK 1HCGA 2BMGB 1MU8B 1CU1A 1O3EA 1B0FA 1UTPA 4AFUA 3QGJA 4O3TA 3KN2A 1O3NA 1UVTH 1SGCA 1FZZA 4X2YA 2ZDLA 1A0LA 1JMOH 1GMHF 1P2QA 3L33A 3E0NB 2A4OA 1AY6H 1C4U2 2ESTE 3RXDA 3VFEA 2QGRA 1AD8H 2P8OB 2ZTXA 5L2ZH 1EAUA 2FX4A 4IW4E 1TGBA 1S83A 3E91A 1AB9C 4YZUA 4HI3A 1LTOA 2ZKSA 1YPHE 1BBRK 3RDZA 9ESTA 3KQBA 4E7RG 1EUFA 4I33A 1ESTA 2XYAA 4UFDH 4D76A 6GCHG 1WAYB 5EGMA 3PM3A 5HM2A 1GI0A 3HATH 2ZHDA 1V2ST 3AASA 1O2KA 4X6PA 1H1BA 1FMGA 1C2IA 1K1NA 1V2TT 2FO9A 3D49H 3VXEH 4FVBA 1P09A 1Y5BT 2VNTA 5JDUB 2ZHFH 3ESTA 2GCHF 3ZZ7A 1YPKH 3S69A 2J4IA 1O2UA 1ZMLA 2PTCE 2A2XH 1ELFA 2H9EH 2OLGA 3UR9A 1P10A 1JBUH 3G01A 1XUJA 1O3DA 4ZROA 1DXWA 2BY7X 2WPKS 4ISIH 1ELCA 1C5OH 1E37B 3QX5H 1UCYH 3EA9A 3OTJE 1DT2A 1O5CB 1SQAA 1TBQH 2A1DB 2G55A 4J2YB 2Z3DA 3BTHE 3SV7A 1CO7E 3P8FA 4ISHH 3SV6A 2D26C 3FP7E 2OBQA 3RC4A 3KF2A 1W7XH 1YPLH 2BDAA 2R3UA 1GJAB 4TYDA 3STIA 4FUIA 1FY4A 4INLA 4WH8A 1GI8B 2W3IA 1YM0A 4VGCC 1WTGH 2Z94A 1VGCB 4GCHF 1C1UH 3UWJH 3LOXA 6ESTA 4AGKA 3GDSA 1IAUA 2J92A 3LGTA 1DSUA 1V2UT 3BIUH 2FS8A 3RMLH 5K7RA 3MO3A 2B0FA 3RC5A 1XXFA 2FTMA 4XSKU 2ODYB 3T27A 2XBXA 1SQTA 3RU4T 2AERH 1TPPA 3PYHA 5E2PA 4I8HA 4X6OA 2HNTE 2KAIB 4IMQA 1XUHA 1Y3XA 3MHWU 1A4WH 3WY8A 1P04A 5LPRA 1E36B 3LH1A 3BSQA 1GI3A 2G51A 1AB9B 2ZIQH 1KDQA 3HGPA 4A1VA 4KELA 3M35A 1RD3B 2PV9B 1GJ6A 2O8UA 3B8JA 2FOBA 3TVJB 2FESH 2CXVA 2A45B 1A0JA 1QL9A 2QXIA 2GTBA 2V3OH 1GHBF 1WU1A 3TH2H 3RUOA 3T26A 3ATWA 4JK5A 3TITA 3MFJA 3TH4H 1DS2E 2FX6A 2F9OA 3HK3B 4ZHLU 1SHYA 1WOFA 1VJAU 1C5SA 2UWPA 2V0BA 2FOMB 5E0GA 3QZRA 2XXLA 2PTNA 1W2KH 1SGQE 3BN9A 1HAZB 1O37A 2AS9A 1V6DA 1XUIA 1A3EH 3RXBA 1G30B 1TALA 2QAAA 2GD4B 1AMHA 2W7SA 1AVGH 1A2CH 1TX7A 2SGFE 1IQFA 2K1QA 1GHVH 4WF8A 2FM2A 1LVMA 1OYQA 4Q80A 1SOTA 1T4VH 2FYQA 5A0CA 3P8NA 2NU0E 3T62A 2RDLA 4FUJA 1OYTH 1O0DH 1TGSZ 4ZKOU 3DFLA 2BD3A 2ZU5A 3SOSA 4XBCA 1FV9A 1T31A 3SGBE 5EU8A 1VCQA 5E0HA 5SGAE 1BZXE 2CN0H 4M7GA 4Y79A 3C27B 2GDEH 1SPJA 2PSXA 1TPSA 1PJPA 5ETXA 3P6ZB 1MTSA 3RXSA 4FUEA 1GBDA 1FN8A 4SGAE 3A8BA 2NU2E 3RXAA 4VGCB 4Y76A 3GOVB 4NA8A 4HGCA 4RSPA 4X8SH 1S5SA 3UWIA 1HJAC 4ZKRU 1BIOA 3RXHA 1LHGH 2ZGXH 1CQQA 1WUNH 3M7QA 1EZSC 1ELVA 5FBIA 1O2QA 2FIRH 1J9CH 1F0UA 1EPTC 5FPYA 1EP6A 1BUIA 3DFJA 4ABJA 1NFXA 1ELTA 1RGQA 1D4PB 1K1PA 2NU4E 1UMAH 2RA0A 4X8VH 1SGNE 1XM1A 1FAXA 4HZHA 2PKAA 1KTTB 1SQOA 4JYVH 7GCHG 2FOFA 5A8XA 3H5CB 3F9EA 1Q3XA 3UOPA 1VITH 3M3VA 2SGQE 5HGGA 4IBLH 1QA7A 5EQQA 3H7TA 2FEQH 1NESE 1MQ6A 2A2QH 1GCTC 2NU1E 2O8MA 2ZU3A 4R0IA 1HAOH 1UTJA 1C5QA 1L2EA 1M9UA 4GAWA 1PPGE 1AU8A 2BDHA 3PV4A 4NFFA 1LO6A 1NRSH 1QR3E 2VVVA 1NS3A 3TNSA 1CA0C 1ZPZA 1TLDA 3EYDA 3SNDA 2J34A 3EA8A 4NSVA 1BT7A 3MI4A 4CHAC 4GUXA 3LGVA 5LPEA 4WWYA 1HYLA 1CGIE 3ZYDA 2BVRH 3RXKA 1AFEH 1MKWK 1ZMNA 2VVUA 1K1LA 3GCTG 1QFKH 2BDCA 2CF9H 2FPZA 1G37A 1O3IA 4CR5A 1GMDG 4Y7AA 4NIWA 5TCCA 3S9CA 2WV4A 1Z71A 3E1XB 1UVSH 2STAE 1BMMH 1CGJE 4FUCA 4D9QA 2WPJS 1P11E 1DM4B 4X6NA 4H4FA 5I25A 5JBCS 1YCPK 4AX9H 3MO9A 1HIAA 1O3FA 1ABJH 1AI8H 3VGCC 1GBHA 4CRAA 2NWNA 1GMCF 1IHTH 5C2ZA 3OY6U 4B2CA 1MZDA 1ZRBA 2Q6DA 2WYGA 1GJ8B 1NRQH 1IQHA 1SOZA 2AMPA 4Y71A 1HAHH 2Z9IA 1HJAB 3KIDU 1O2YA 3F6UH 4I31A 1MH0A 1O38A 2PFEA 5BRRE 5T3HA 3SNBA 1A0HB 2ZDVH 1ZHRA 3BTDE 4UD9H 2P59A 1A1RA 1EPTB 1LPKB 3UREA 4Y7BA 1C1VH 3ZVFA 1BTUA 2QN5T 3AW1A 5DP7A 2SFAA 5C20A 1CE5A 3VPKA 3RLWH 3MNCA 4AG1A 3HGNA 5FAHA 1TRNA 3VXFH 2ZA5A 4DVAU 3QUMP 3NKKA 3TU7H 5I46H 4X1SU 4YT6H 1B7XB 1C5NH 2P95A 3IWMA 2BQWB 5A8YA 1KXDA 1K21H 1SGFG 2AMQA 1WBGB 2GV7A 1P9UA 3LGWA 3LC3A 4Y10E 1BRAA 3FFGA 3HKIB 1TOCB 2QXJA 1GCTB 2OCVB 2Y80A 4YTAA 3KHVA 4JZEH 2ASUB 2ZTYA 4X1QU 5B6OA 3UNSA 2ZQ1A 2FLBH 1EOLA 3A8CA 1B0EA 1KY9A 3MU0A 4CRDA 1EJAA 4ABGA 4CHAB 4BTUB 1ZPCA 1IQEA 1AE5A 2G8TA 1OPHB 3A80A 1W7GH 1J8AA 1W10U 1TGCA 3PLBA 3PO1C 2OBOA 5T6FA 1TFXA 1QJ7B 4OGXA 5FX6A 4NIXA 1YPHC 1ZSKA 4JZDH 3UY9A 4INHA 2B9LA 1O3KA 3GYMA 4X1RU 3ZZ5A 3TNTA 3CENA 2BQ6B 5DP3A 1GI9B 1HAXB 1C2HA 2BDGA 4ZXXH 5AF9H 2QF3A 2W5EA 3MNXA 1ESAA 4K3JA 3ZVGA 1ETTH 1Y3VA 3V0XA 4BANB 1GBLA 1YCPM 4ZKSU 1C5UA 3TK6A 1DLKB 1EATA 3VGCB 2VWLA 2ZGHA 3FZDA 1CHOF 2Q6FA 3M36A 2V3HH 2VIWA 1O3OA 2AGIX 1C4V2 3RMNH 2PUXB 1W11U 3D62A 3SHCH 2WV5A 7ESTE 1F0SA 1V2RT 2Z9LA 3SGQE 3NZIA 1O2MA 4XBDA 2UUYA 1ELGA 1Z7KA 3RU4E 3SW2B 3BV9B 4B75A 1ESBA 2BLVA 1SGYE 3AAVA 1TWXB 3P8OA 3C1KA 4AGJA 7KMEH 1RTKA 2V6NA 1TBRH 4MDSA 5JBAS 8LPRA 2TPIZ 4FU8A 1O31A 4XBBA 1MKWH 3ZZ4A 2A5IA 1TAWA 1GDNA 3EA7A 4KKDA 4K1SA 3ATIA 1SLWB 4BTTB 1PYTC 1A5HA 1P9SA 1AN1E 1YPJH 1PPZA 1TQ7B 1L1GA 2VH0A 1LVBA 1S0RA 2UUKB 4RN6A 4WXIA 3A82A 3EQ0H 3ATMA 4RKOB 1YCPH 4JYTA 4AORA 1NFUA 1QBOA 1DX5M 2XCNA 4E05H 1K22H 2FYRA 3PWCA 3E8LA 1V2NT 4NIVA 2HNTC 5IYTA 1EOJA 1QBNA 4IN2A 3MNSA 1Z1JA 3M3TA 4IMZA 3TPIZ 2ALVA 1D6RA 5FX5A 1TNKA 1G3BA 1GWAA 4U32A 2AH4X 4JZFH 4MNWA 5CHAC 3GDVA 1AUTC 1OSSA 1HLTH 3QO6A 1FONA 3PO1B 2EC9H 3TK5A 2HPQH 1H9HE 1O2LA 1W0ZU 4U01A 1G3DA 1UO6A 2FOEA 5LH8A 3URDA 6CHAC 4KTCA 2ZFFH 4TPIZ 5L30H 1GG6C 3GCNA 1YBWA 3SV9A 1KTSB 1C1TA 1ZSJA 1L4ZA 4K1EA 4YOJA 2F91A 4BAKB 4FUHA 3GYLB 3GCHC 3I77A 4AYYB 1TRYA 1BRCE 3TJOA 4DT7B 4NSYA 1ZZZA 5FBEA 1V2KT 2PR3A 2R9PA 4MLFB 2VWOA 3Q00A 2VH6A 1LVOA 2ZPQA 1P3EA 1ZTLA 2JH0D 3A7ZA 3BTTE 3E90B 5F8XA 1NM6A 3B9FH 1WQVH 1GBMA 1D3DB 4H6SB 5LGOA 1TMUH 2I6SA 1FY1A 1D9IA 2F9VA 3P92A 1UJ1A 1AVWA 1QRWA 4TWWA 1YPMH 1FQ3A 4GHQA 4JMYA 3ZZ3A 5HYOA 3QTOH 3RXGA 2Z9JA 2ODPA 1T8NA 2FOHA 1O3BA 3LKWA 1E38B 2OD3B 3K2UA 3QN7A 2EI8A 1TB6H 2A31A 1MQ5A 1BTYA 4OS2A 3HKJB 1EZUC 5AHGH 1IQIA 3P70B 1O2WA 3F1SB 1FNIA 3BTEE 2ZO3H 3S9BA 2IN2A 2ZHQH 3TGJE 1TX8A 2ZFTA 1HPGA 1BA8B 1JXPA 1TNIA 1O5EH 1PYTD 4TY6A 1C5XB 3LGIA 1Y3UA 1FLEE 1YF4A 1EAIA 2W3KA 5GJ4B 2XTTB 4INKA 1W0YH 3KGPA 1KLIH 1HXFH 1O3PB 1SGTA 4DY7B 2ZFSA 2ZGBH 3SV2H 4Q7XA 2WUCA 1G2MA 2VVCA 1H4WA 2VGCB 4JZIA 4ZXYH 2VIQA 3K6YA 2AMDA 5AFYH 4LXBH 2P3UB 1SGDE 4K2YA 4GLYA 2V35A 3ZZ9A 2C8WB 5CHAB 3EE0B 1NPMA 2R2MB 3RXLA 2AEIH 3W94A 2QF0A 2Z9GA 3LH3A 1FJSA 4JCNA 3LT3A 4YLQH 6CHAB 1GBFA 3GICB 1GG6B 1NN6A 2OC1A 4FXGH 3M5MA 1ANDA 2FS9A 1GPZA 1MCVA 3ZVCA 1Y5UT 1RRKA 4MPWA 1ZOMA 3T25A 2O8TA 3IG6B 1QB1A 3GCHB 1P02A 2H9TH 3L3TA 1DOJA 1G3CA 2STBE 1A46H 5DO4H 1LKBA 1O3GA 1XVOA 1C1OA 2Y6TA 4UDWH 1YGCH 2FI3E 2HOBA 1HAPH 3BTGE 1O2NA 3RXEA 1LQEA 2IPHA 3TH3H 4Z0KA 2SNVA 2XNIA 1UTNA 1VITF 1BCUH 2YNBA 1GDQA 3BTQE 1O2IA 1S81A 2O8WA 5E0JA 1UTMA 1DWCH 1MBQA 1C5RA 3UNRA 3O8RA 2XC4A 3SUEA 1TA6A 2H2ZA 1HBTH 3A7WA 2Y82A 3Q3KA 4ABAA 1TE0A 1F5KU 3DT0H 2Y7ZA 1K28D 3SZNA 2A4QA 1O36A 2YNAA 3K65B 1UK4A 8ESTE 2Q6GA 1ZR0A 3LPRA 2TGDA 1BBRE 1O2GH 1V2WT 1XVMA 1DXPA 2ULLA 5DJ7A 3I78A 1OKXA 2Y5HA 1BMNH 4RKJB 1O3JA 2FXRA 1KXCA 4YM9A 1AZ8A 1EQ9A 1LDTT 4AFQA 1QL7A 1O2PA 1V2QT 1H9IE 3MYWA 3QK1A 4MNXA 3U9AH 1O3AA 2PKSC 4ABBA 4U2WA 1RXPA 1MBMA 3KCGH 1IQJA 1QY6A 1AHTH 5PTPA 1Z6JH 3S9AA 2XBWA 3EGKH 1QGFA 2BD9A 1NTPA 3M5NA 3PMJA 1SR5C 4YO9A 1FI8A 3SU5A 3PMAB 1ANEA 1CVWH 4O3UA 4B71A 4BXSA 1DWBH 3BTFE 1F2SE 3MNBA 5L6NH 5IDKA 1EZQA 4ZKNU 1BMLA 3A85A 3K6ZA 2CV3A 1ZJDA 5C1YA 4OGYA 3SU3A 1V2PT 4IN1A 1JWTA 5DKMA 2AGEX 2A0QB 1T7CA 1O3CA 2ZTZA 4MG3A 1O32A 5A0BA 1CSOE 4K1TA 3O8CA 1DICA 5GXPA 1P2MA 4AOQA 4XE4A 8GCHG 3U8RH 4X2VA 3RXMA 4Q2KA 1O3MA 3VB4A 3RC6A 3SUDA 3A86A 1PQ8A 3LGUA 1C2GA 3ATKA 5LPFA 4UEHH 2Z7FE 3B23B 1DY9A 2GVFA 1BITA 1SFIA 3NK8A 1YLDA 3SJOA 2FI5E 1TNHA 3GY5A 4X8UH 1FUJA 2BDIA 2CHAC 1NO9H 2ZU2A 4Y8YA 4FUFA 1ZYOA 1OOKB 1C5VA 4KGAA 1AE8H 1XKBC 3TJNA 1W8BH 4ZHAA 2TIOA 4FUBA 2HALA 1E0FD 1C2JA 2ZZUH 2SNWA 1N6YA 1Y3YA 2FLRH 3M5LA 4LK4A 5TJXA 1UVPA 2F3CE 2P93A 1OWDA 3ZVBA 4B74A 3VB7A 1J15A 3MMGA 3RXCA 4FU9A 4A1XA 2PGBB 3LJOA 1GHAG 1EAWA 1T8OA 2DUCA 4AB8A 2OC7A 3A7VA 4I8GA 5A09A 1P01A 1JIRA 2RCEA 2R0KA 4UFEH 1FY8E 1DFPA 2J2UA 2ZFQH 1CT4E 3A89A 3GISB 1OXGA 2Z3EA 3CS0A 5EODA 1OWIA 4IS5A 3KQEA 2ZG0H 1OWKA 2PKSB 3CP7A 3GCTF 5EXNA 3MU5A 2BY9X 5K0HA 4DJZB 1IQLA 2GZ7A 4OS5A 1C5WB 5GCHG 1BTZA 3MWIU 2ZP0H 4DW2U 2GZ9A 3QWCH 5C5NA 3A7XA 2OC8A 2JETB 5DPAA 3ZZ8A 1D3PB 4Q7ZA 1G36A 3M61U 3PMBB 1HJ9A 3M37A 5JPMH 3SNAA 1BHXB 2HRVA 3F9FA 4WXVA 2BHGA 2QY0B 1BB0B 2C3SA 4TY7A 2Z6BD 1TNJA 2UUJB 3R0FA 1C1SA 5FXLA 1BDAA 5GPIB 4X0WU 2IJOB 2QCYA 1GHXH 1O30A 1TYNA 2ZDMA 3E3TA 2A7CA 4MPXA 4A92A 1S84A 2ZPRA 1DLEA 2B7DH 2KAIA 3PROA 1LMWB 3M7TA 1GJCB 2OC0A 2ANKH 1YYY1 3RMMH 4BOHA 4WY3A 3D65E 4DIHH 1FN6A 2UWLA 1BRUP 1ACBE 3O8BA 1OX1A 3TGKE 4NG9H 1BTWA 2VIOA 2CHAB 1OWHA 2ZFRH 1TNLA 1SFQB 2WUBA 1UHBA 1XXDA 1SGPE 1Y59T 3SJ9A 3BTKE 3KQDA 9LPRA 3AAUA 4NIYA 2CJIA 4GPGA 2SGAA 2GCTC 2ZQ2A 1MCTA 5J4QA 3RP2A 5AVDA 2J94A 2A5AA 5EXMA 1UTLM 1EAXA 1LHEH 1Z8IB 4A7IB 1ZGVA 5DP6A 4CRBA 1D6WA 1FPHH 1V2OT 3ITIA 1O34A 1J17T 3M7UA 3MU1A 1JIMA 3DD2H 3BEUA 4O9VA 2FOAA 4NFEA 2O9QA 3U8TH 2BDYA 2A4GA 4WMEA 1C2FA 2TGAA 3RU4D 1O2JA 1L1JA 3SN8A 2FMJA 5C5OA 1AWHB 1J16A 1VR1H 3V7TA 2IOTA 2EI7A 3GY3A 3SORA 1GL0E 1BRBE 1P2IA 1HUTH 1B5GH 1V2LT 2XC5A 4A5TS 1DITH 1O2RA 2BY8X 2F9UA 4B73A 2BOKA 2Q1JA 1N1LA 5F6MA 1AZZA 1NU9A 1BQYA 4ISOA 3OU0A 3O8DA 1GI6A 1Y3WA 1C1PA 1MTUA 1GBIA 1IQNA 5HXFA 2ODQA 3GY6A 3UFAA 4NGAH 2C93B 1V2VT 1QTFA 1AFQC 1E34B 1EB1H 3F9HA 4X1PU 2CF8H 3SHAH 4XDEA 2P94A 5TCAA 4I7YH 1QNJA 1V3XA 4I32A 3MU4A 1XUKA 4X8TH 3E6PH 4BTIB 4BAMB 1ZJKA 2ANMH 3HK6B 4B2AA 1T4UH 1QRZA 1SVPA 4OS6A 1YLCA 4OS4A 1AIXH 1SLVB 1ZGIA 2CMYA 4H42U 5EOKA 3ZZBA 3ELAH 3DHKH 3Q3XA 4CRFA 5E8EH 2EI6A 3A87A 1P2KA 2OINA 1GDUA 3H7OA 1CBWC 3V13A 1NU7B 1Q2WA 2C90B 4Y0YE 4KP0A 3RXTA 1JRSA 1GL1A 3BTWE 1A7SA 4XOJA 1F0RA 3OX7U 2GCTB 2C8ZB 3F9GA 1AKSA 3UQVA 1XMNB 2BX3A 3F68H 4UFGH 1ZTJA 1JRTA 1HAYB 3LC5A 4DGJA 4I8LA 1KXBA 5JYIA 1E35B 1EJNA 4AG2A 3SJIA 1A61H 1QQ4A 4IC6A 1PPHE 4E06H 1G32B 3RXJA 7LPRA 1GGDB 3TJUA 2G5NA 1RTFB 1PPFE 3OSYA 4K8BA 1WTHD 3FP6E 1EZXC 3SUGA 1GCDA 1OS8A 1MD8A 4WMFA 4SGBE 2G00A 2VGCC 2JH5D 2SGDE 1QJ6B 2FTLE 3ZV9A 2GV6A 1ETSH 1T8LA 3SNCA 4B1TA 5GDSH 1LHDH 4X2XA 1HFDA 2BYAX 2LNCA 3A8AA 3K9XB 1KDQB 3GY7A 5A0AE 3RXOA 1O3LA 4OS7A 2BVSH 1SGRE 3R3GB 5C1UA 1MD7A 1DWEH 2D8WA 3MH6A 1HDTH 1D3TB 2DE8A 2Y5GA 2G81E 3OYPA 3MTYA 4KTSA 3ZVDA 4ZMAH 1ELDE 3PLPA 4BXWA 2AGGX 3T5FH 1C1WH 3GY2A 2GT7A 1Q31A
chains in the Genus database with same CATH superfamily
1A5GH 1C2MA 1XUFA 1HAVA 1P8VC 1NROH 1RFNA 3ZZDA 2XBYA 1AFQB 4YESB 1EPTA 1SGFA 2AIPA 4K69A 4PROA 1C5YB 1H8IH 1EJMA 1HAGE 3BEFB 1O2VA 1MTVA 4FETA 3S0NA 4ESTE 2ZDNA 1SHHB 1VCWA 1SG8B 1WQSA 6LPRA 2ZHEH 3A84A 1JOUB 1QCPA 2H6MA 2PUQH 3T29A 1PQAA 1ELAA 2AIQA 3LU9B 1F7ZA 1EXFA 2FZZA 4GHTA 8KME2 1UCYE 2PGQB 1SLUB 1KLJH 1FIWA 2ZDAH 1THRH 2ZU4A 1GBBA 1H8HD 1P06A 1TX6A 2FOCA 6GCHF 3QTVH 4CBOA 1CBWB 3BIVH 4MVNA 4FU7A 1CHGA 1S6FA 1MUEB 1YPGH 2L6OA 1GI1A 3F0OA 1SBWA 2LPRA 1GBJA 3DA9B 1TBZH 1MZAA 3P17H 4WH6A 3RMOH 1GMHG 2D2DA 4HG6A 3OY5U 4AFZA 3T28A 2BLWA 4YT7H 2J38A 1QB9A 2P3TB 5DP4A 1GI7B 4A6LA 1ORFA 4ABEA 1KXFA 2YOLA 2WPHS 1YC0A 2ANWA 4TWYA 4CH8B 2UUFB 4A1TA 1TRMA 2WPMS 2XWAA 1DY8A 2F9PA 4NWKA 2XRCA 2VWNA 1MMJN 1P2JA 1ZMJA 3URCA 2BVXH 2H9HA 2R3YA 4THNH 2PSYA 1U6QA 1MTNC 2PKAB 4FVDA 1GJ9B 2HNTF 5F8ZA 1TPAE 4I8JA 1OWJA 1GBAA 1GJ5H 2FDAA 2I6QA 3ODFA 1O2TA 4UONA 5HKKD 3N7OA 1EKBB 1P2NA 1GI5A 1GBTA 3JZ2B 3E0PB 1G9IE 1K1JA 5CE1A 4X1NU 4FUGA 5DP8A 1NRNH 4XFQA 1RIWC 2GCHG 1IQKA 1GJ7B 1OP8A 2F9NA 3ZZ6A 1IHSH 1NFYA 1NFWA 5GNDA 3SQEE 2WPIS 2XOKD 2R2WU 5G4BA 3RXPA 3D23A 4K5ZA 1NRRH 2R0LA 1UTOA 4UE7H 1W0KD 1G2LA 5T6GA 1AQ7A 1GBKA 1HRTH 3LDXH 3SJ8A 1LKAA 1GBCA 1FAKH 4F49A 1S85A 2F43B 5JBBS 5J4SA 4DIIH 1RJXB 1RS0A 1BTHH 2JJ1D 2BTCE 4ASUD 3LJJA 3A8DA 1ARCA 1LQDB 2HLCA 1QURH 1Z8JB 1P2OA 1INCA 2OTVA 4YOIA 3BG4C 1DWDH 3LIWA 2KCYA 3MH5A 4NWLA 1HXEH 3KYFA 1C5LH 4ABFA 5A2MH 1GHWH 1HIAB 2QV1A 1L1NA 4Z6AH 5JB9S 4GCHG 3MH4A 1KMHB 4X2WA 5AFZH 2PHBA 2HWLB 1F92A 1H9LB 1KYNA 2A4RA 2AFQB 2G52A 1BMFD 5EG4A 2ZHWH 3MU8A 3NWUA 3FKSD 3BF6H 1K1OA 1O5FH 1HV7A 2HLDD 1QL8A 2DE9A 5CMXH 1C5MD 1VITG 1O39A 4BAQB 3V12A 2Z9KA 5DG6A 1O2SA 4Y8XA 2VIVA 2Y5FA 4K60A 3FZZA 2OP9A 1N8OC 1SMFE 2BLQA 1SB1H 2ZI2H 2RG3A 3PMHB 1C1RA 3FP8E 3TGIE 4ASHA 4DCDA 2EQNA 2BY5X 1UK3A 3TJVA 3W95A 2C8YB 4CREA 3KQCA 4OS1A 1BOQA 3MOCA 1UHBB 1NBME 2GMTC 1NY22 3PWBA 2XW9A 1V2MT 2ANYA 1W14U 1FPCH 3SBKA 3EDXB 1V2JT 1D3QB 2JETC 5HM9A 4ZUHA 2XBVA 4O97A 1MTNB 3QLPH 4B76A 3U98H 1GHBG 3QZQA 2ZECA 2C8XB 1TQ0B 3VEQB 4WMDA 1GI4A 3PLKA 1MKXH 1QZ8A 4ISNA 3ODDA 3SZEA 4NCYA 3BEIB 4NA9H 1P3CA 3UQOA 8GCHF 1C4Y2 4Y11E 1DSTA 1NC6A 2TGPZ 1ARBA 1QBVH 1ANCA 3UR6A 2VIPA 2W6JD 1RIWB 4CR9A 2AYWA 2BD8A 3ATLA 4GSOA 4TT3D 1O2XA 1SGIB 2G4UA 2JKHA 2VB0A 2BM2A 5E2OA 2ZDKA 1TMBH 1WV7H 4I86A 3SQHE 1K1MA 1P05A 2BLOA 4MNVA 4Y8ZA 2THFB 1ZPBA 3GDUA 3SU1A 1ABIH 4IC5A 3GCOA 1GVZA 1SSXA 2BDBA 1F5LA 1O5BB 1KLTA 1BBRH 2G5VA 3Q76A 4HFPB 2QXGA 4J1YA 2OUAA 5EQRA 2FP7B 1FY3A 5B6LA 3F2GA 4ZAEA 2A7JA 1YWUA 1MAXA 2KCPA 1EASA 7GCHF 1C2LA 5DK1A 1QRXA 3BG4B 3U28C 1QHRB 3ZV8A 3V3MA 2P16A 1GHAF 2VINA 3DUXH 4D8NA 4NA7A 5JBTA 1IOEA 3A81A 2HGTH 3QDZB 1Y5AT 1ZTKA 1Z6EA 2D1JA 3HPTB 1CGHA 1DE7H 3BTME 1GHZA 4ABIA 2ZU1A 2B5TB 3KQ5A 4LZ1H 4JYUH 1A5IA 1P03A 4CBNA 1SI5H 2ZWLH 1P12E 4CH2B 5FCRA 1NT1A 2EA3A 2J95A 2WPLS 1EP5A 4QT8C 5GCHF 2P3FH 1FIZA 2FI4E 1N8OB 5JB8S 3AK5A 3VB5A 2O8LA 4DG4A 1C2EA 2KZ4A 1FXYA 1GMDF 5F03A 2H5DA 3RXFA 3S7KB 2M5TA 2BY6X 4CRCA 1S6HA 2GMTB 1C1NA 4JK6A 1XX9A 1KXEA 2PLXA 1X7AC 2VU8E 4YLUA 3ZVAA 1S0QA 1AVXA 1GVKB 1C2KA 5ESBA 1AKSB 1C5ZB 1ELBA 1CT2E 2H5CA 5C1XA 2GKVE 1AO5A 3FANA 4WVPE 2WZQA 3T2NA 1PQ5A 1SGEE 2TRMA 1THPB 5L2YH 1BHXF 2CGAA 2BZAA 2ZC9H 3U8OH 1MU6B 4BNRA 3FO8D 3GY4A 4AB9A 1VZQH 2GDDA 4AYVB 2K0QA 2UWOA 1OHHD 3NRLA 3PB1E 2J5UA 1ELEE 3SU2A 1FY5A 3RXQA 4ACBA 1F5RA 4ZHMU 1OWEA 5GWZA 3RXUA 1KXAA 2SGPE 1O35A 3FOAA 2ILNA 3SNEA 1W13U 1H8DH 2BD7A 5DGJA 3UNQA 4BAHB 4LZ4B 1TMTH 3QGNB 3F0PA 3F2HA 2Y7XA 2ZGJA 2ZEBA 4K8YA 3UIRA 1ZLRA 2SGEE 1LHFH 3SI3H 3E16B 2A5KA 1QA0A 1GMCG 4UFFH 1O2OA 1GJ4H 4LOYH 1WYKA 1T32A 4YOGA 4I8KA 2QYIA 3H09A 1TA2A 2TGTA 4H6TA 3AW0A 2BD5A 1J14A 1TABE 2ZNKH 3M3SA 4HTCH 5BPEA 1C9PA 1BJVA 1QB6A 3VB6A 1HAVB 3VB3A 3L6PA 4MQAA 4XRNA 5C67A 3KNXA 1VCPA 2F83A 3P95A 4KTUA 1ZHPA 2GGVB 2VJ1A 1GGDC 1MAYA 3W1EA 1P0SH 4JZ1A 3A7YA 4MNYA 2BXTH 1NZQH 3EAJA 1DUAA 1W3CA 1G3EA 3GY8A 5T6DA 3FVFB 2ZCHP 1TGNA 2GP9B 2RDEA 2OXSA 1ANBA 3M5OA 3VG8A 4DOQA 3U1JB 1Z8RA 1P57B 2BZ6H 1CT0E 3AVZA 3NXPA 2NU3E 2XCFA 3A83A 4D9RA 2CK3D 5EJ1A 3SGAE 3TIUA 2W26A 3ZZCA 3LGYA 1SKYE 1IQMA 1HNEE 3KEEA 1PPCE 4D7GA 2OQ5A 1HAIH 5EW2H 2GZ8A 1CA0B 1Y8TA 1TGTA 2JH6D 1BTPA 2BD4A 1AWFH 3JZ1B 3IITA 3S7HB 2G4TA 1F0TA 3Q77A 5C17A 1TOMH 2FOGA 2BXUH 1C1MA 1K1IA 1O5DH 1TONA 2FWWA 2ZPSA 2PW8H 2QIQA 2PWXA 1K9OE 3I29A 1O2ZA 1QQUA 1GI2A 4ZH8A 1UTQA 2GT8A 3UUZA 2HVXA 4AN7A 5EPNA 5ABWA 2B8OH 2OQUA 1EX3A 2C4FH 1K2I1 3SI4H 3UTUH 4OM9A 4BAOB 3FAOA 3SU0A 1FDPA 2VWMA 3NUMA 2QA9E 2Y81A 1O5GH 1SLXB 4TPYA 4RI0A 3WWFA 5HMAA 1C5TA 1BTXA 1ID5H 2BQ7B 4DURA 1XUGA 5A8ZA 3SU4A 2XWBI 1E79D 1MTWA 5F8TA 1LPZB 4Q7YA 2ZGCA 2BX4A 1VJ9U 1ZHMA 3U69H 3P8GA 3N7DA 1HGTH 3SV8A 2WYJA 3ZZAA 2QXHA 5EPYA 1RTLA 2BOHB 4MTBA 1ZRKA 4FUDA 1CHOG 2A32A 4Y0ZE 3UPEA 1L0ZA 2ALPA 1THSH 4NZLA 5H4IB 5DP9A 5EW1H 3SUFA 5C3NA 1DANH 2ZFPH 5DP5A 5EJLA 3UOUA 1LVYA 5FPTA 2J9NA 1XKAC 1GBEA 1SC8U 4ABHA 2EEKA 3A7TA 2HPPH 2P8OC 1UCYK 2ZCKP 1PFXC 2TBSA 1C2DA 3RXRA 3MH7A 1S82A 4AZ2B 2ZF0H 1ZSLA 5EXLA 3A88A 4Y6DA 3MO6A 1TNGA 3SU6A 5C94A 1KSNA 1T8MA 4X6MA 3ZVEA 3PV2A 1YKTA 2VIDA 3ENSB 2W7UA 3RXIA 2RA3A 3Q3YA 3RLYH 1O3HA 3SJKA 1YPEH 4CRGA 1UVOA 2GX4A 3RM0H 1OP0A 3PTBA 4MPVA 5FPSA 2FODA 3LONA 4E7NA 1DPOA 3KL6A 4IGDA 4O03A 1EB2A 4GVUA 1O2HA 1L4DA 1HJ8A 2F9BH 4AFSA 1S6LA 1WCZA 2ZCLP 4D7FA 1C1QA 2XC0A 3SO3A 1CA8B 1AGJA 1KIGH 1BJUA 5EQSA 5FCKA 2Z3CA 1GHYH 4U30A 1QIXB 1SL3A 1NRPH 1UTKA 1WSSH 1A3BH 1HB0B 3PTNA 1BMAA 1UK2A 2KCAA 4MPUA 1WXRA 1PPEE 1C9TA 1IQGA 1O5AB 1LCYA 3NPSA 3TK9A 1DDJA 1OP2A 1AUJA 1O33A 1Z8GA 2A7HA 3RM2H 1GVLA 1YP9A 2QC2A 2BB4A 1Z1IA 3NCLA 5FHTA 3U1IB 3TLOA 1N6XA 3WW7A 1UVUH 2WINI 2BD2A 3STJA 1LHCH 3BG8A 2H1UA 5ESTE 3CS7A 4B2BA 4ISLA 1GJBB 1TIOA 1DUEA 1LPGB 1GJDB 1PQ7A 3ZYEA 4F4OC 1QJ1B 1ETRH 1DVAH 1TPOA 4R8TB 4WJG2 4ABDA 4NZQA 3SYJA 1VGCC 1C5PA 1PPBH 5GIBA 1W12U 3RXVA 1MKXK 1HCGA 1VKYA 2BMGB 1MU8B 1CU1A 1O3EA 1B0FA 1UTPA 4AFUA 3QGJA 4O3TA 3KN2A 1O3NA 1UVTH 1SGCA 1FZZA 4X2YA 2ZDLA 1A0LA 1JMOH 1GMHF 1P2QA 3L33A 2IJD1 3E0NB 2A4OA 4Z1MD 5T1VA 1AY6H 1C4U2 2ESTE 3RXDA 3VFEA 2QGRA 1AD8H 2P8OB 2ZTXA 5L2ZH 1EAUA 2FX4A 4IW4E 1TGBA 1S83A 3E91A 1AB9C 4YZUA 4HI3A 1E1QD 1LTOA 3OE7D 2ZKSA 1YPHE 1BBRK 3RDZA 9ESTA 3KQBA 4E7RG 1EUFA 4I33A 3WWBA 1ESTA 2XYAA 4UFDH 4D76A 6GCHG 2WV9A 4Q63A 1WAYB 5EGMA 3PM3A 5HM2A 1GI0A 3HATH 2ZHDA 1V2ST 3AASA 1O2KA 4X6PA 2KFWA 1H1BA 1FMGA 1C2IA 1K1NA 1V2TT 2FO9A 3D49H 5KGOA 3VXEH 4FVBA 1P09A 1Y5BT 2VNTA 5JDUB 2ZHFH 3ESTA 2GCHF 3ZZ7A 1YPKH 3S69A 2J4IA 1O2UA 1ZMLA 2PTCE 2A2XH 1ELFA 2H9EH 2OLGA 3UR9A 1P10A 1JBUH 3G01A 1XUJA 1O3DA 4ZROA 1DXWA 2BY7X 2WPKS 4ISIH 1ELCA 1C5OH 1E37B 3QX5H 1UCYH 3EA9A 3OTJE 1DT2A 1O5CB 1SQAA 1TBQH 2A1DB 2G55A 4J2YB 2Z3DA 3BTHE 3SV7A 1CO7E 3P8FA 4ISHH 3SV6A 2D26C 3FP7E 2OBQA 3RC4A 3KF2A 1W7XH 1YPLH 2BDAA 2R3UA 1GJAB 4TYDA 3STIA 4FUIA 1FY4A 4INLA 4WH8A 1GI8B 2W3IA 1YM0A 4VGCC 1WTGH 2Z94A 1VGCB 4GCHF 1C1UH 3UWJH 3LOXA 6ESTA 1EFRD 4RT0A 4AGKA 3GDSA 1IAUA 2J92A 3LGTA 1DSUA 1V2UT 3BIUH 2FS8A 2WSSD 3RMLH 5K7RA 3N99A 3MO3A 2B0FA 3RC5A 1XXFA 2FTMA 4XSKU 2ODYB 3T27A 2XBXA 1SQTA 3RU4T 2AERH 1TPPA 3PYHA 5E2PA 4I8HA 4X6OA 2HNTE 4FOUC 2KAIB 4IMQA 1XUHA 2KX4A 1Y3XA 3MHWU 1A4WH 4YXWD 3WY8A 1P04A 5LPRA 1E36B 3LH1A 3BSQA 1GI3A 2G51A 1AB9B 2JIZD 2ZIQH 1KDQA 3HGPA 4A1VA 4KELA 3M35A 3FN8A 1RD3B 2PV9B 1GJ6A 2O8UA 3B8JA 2FOBA 3TVJB 2FESH 2CXVA 2A45B 1A0JA 1QL9A 2QXIA 2GTBA 2V3OH 1GHBF 1WU1A 3TH2H 3RUOA 3T26A 3ATWA 4JK5A 3TITA 3MFJA 3TH4H 1DS2E 2FX6A 2F9OA 3HK3B 4ZHLU 1SHYA 1WOFA 1VJAU 1C5SA 2UWPA 2V0BA 4ACAA 2FOMB 5E0GA 3QZRA 2XXLA 2PTNA 1W2KH 1SGQE 3BN9A 1HAZB 1O37A 2AS9A 1V6DA 1XUIA 1A3EH 3RXBA 1G30B 1TALA 2QAAA 2KM0A 2GD4B 1AMHA 2W7SA 1AVGH 1A2CH 1TX7A 2SGFE 1IQFA 2K1QA 1GHVH 4WF8A 2FM2A 1LVMA 1OYQA 3DSPA 4Q80A 1SOTA 1T4VH 2FYQA 5A0CA 3P8NA 2NU0E 3T62A 2RDLA 4FUJA 1OYTH 1O0DH 2RFKC 1TGSZ 4ZKOU 3DFLA 2BD3A 2ZU5A 3SOSA 5KEDA 4XBCA 1FV9A 1T31A 3MQKC 3SGBE 5EU8A 1VCQA 5E0HA 5SGAE 1BZXE 2CN0H 4M7GA 4Y79A 3C27B 2GDEH 1SPJA 2PSXA 1TPSA 1PJPA 5ETXA 3P6ZB 1MTSA 3RXSA 4FUEA 1GBDA 1FN8A 4SGAE 3A8BA 2NU2E 3RXAA 4VGCB 4Y76A 3OAAD 3GOVB 3GS9A 4NA8A 4HGCA 5HIYA 4RSPA 4X8SH 1S5SA 3UWIA 1HJAC 4ZKRU 1BIOA 3RXHA 1LHGH 2ZGXH 1CQQA 1WUNH 3M7QA 1EZSC 1ELVA 5FBIA 1O2QA 2FIRH 1J9CH 1F0UA 1EPTC 5FPYA 1EP6A 1BUIA 3DFJA 4ABJA 1NFXA 1ELTA 1RGQA 1D4PB 2VBCA 1K1PA 2NU4E 1UMAH 2RA0A 1W0JD 4X8VH 1SGNE 1XM1A 1FAXA 4HZHA 2PKAA 2YMSC 1KTTB 1SQOA 4JYVH 7GCHG 2FOFA 5A8XA 3H5CB 3F9EA 1Q3XA 3UOPA 1VITH 3M3VA 2SGQE 5HGGA 4IBLH 1QA7A 5EQQA 3H7TA 2FEQH 1NESE 1MQ6A 2A2QH 1GCTC 2NU1E 2O8MA 2ZU3A 4R0IA 1HAOH 1UTJA 1C5QA 1L2EA 1M9UA 4GAWA 1PPGE 1AU8A 2BDHA 2J98B 3PV4A 4NFFA 1LO6A 1NRSH 1QR3E 2QE7D 2VVVA 1NS3A 3TNSA 1CA0C 1ZPZA 1TLDA 3EYDA 3SNDA 2J34A 3EA8A 4NSVA 1BT7A 3MI4A 4CHAC 4GUXA 3LGVA 5LPEA 4WWYA 1HYLA 1CGIE 3ZYDA 2BVRH 3RXKA 1AFEH 1MKWK 1ZMNA 2VVUA 1K1LA 3GCTG 1QFKH 2BDCA 4P00A 2CF9H 2FPZA 1G37A 1O3IA 4CR5A 1GMDG 4Y7AA 4NIWA 5TCCA 3S9CA 2WV4A 1Z71A 3E1XB 1UVSH 2STAE 1BMMH 1CGJE 4FUCA 4D9QA 2WPJS 1P11E 1DM4B 4X6NA 4H4FA 5I25A 5JBCS 1E1RD 1YCPK 4AX9H 3MO9A 1HIAA 1O3FA 1ABJH 1AI8H 3VGCC 1GBHA 4CRAA 2NWNA 1GMCF 5F53A 1IHTH 5C2ZA 3OY6U 4B2CA 1MZDA 1ZRBA 2Q6DA 2WYGA 1GJ8B 1NRQH 1IQHA 1SOZA 2AMPA 4Y71A 1HAHH 2Z9IA 1HJAB 3PRDA 3KIDU 1O2YA 3F6UH 4I31A 1MH0A 1O38A 2PFEA 5BRRE 5T3HA 3SNBA 2M2AA 1A0HB 2ZDVH 1ZHRA 3BTDE 4UD9H 1SQRA 2P59A 1A1RA 1EPTB 1LPKB 3UREA 4Y7BA 1C1VH 3ZVFA 1BTUA 2QN5T 3AW1A 5DP7A 2SFAA 5C20A 1CE5A 3VPKA 3RLWH 3MNCA 4AG1A 2LP6A 3HGNA 5FAHA 1TRNA 3VXFH 2ZA5A 4DVAU 3QUMP 3NKKA 3TU7H 5I46H 4X1SU 4YT6H 1B7XB 1C5NH 2P95A 2YMSB 3IWMA 4DT4A 2BQWB 3UB0A 5A8YA 1KXDA 1K21H 2YMSD 1SGFG 2AMQA 1WBGB 2GV7A 1P9UA 3LGWA 3LC3A 4Y10E 1BRAA 3FFGA 3HKIB 1TOCB 2QXJA 1GCTB 2OCVB 2Y80A 4YTAA 3KHVA 4JZEH 2ASUB 2ZTYA 4X1QU 5B6OA 3UNSA 2ZQ1A 2FLBH 1EOLA 3PRBA 2OK5A 3A8CA 1B0EA 1KY9A 3MU0A 4CRDA 1EJAA 4ABGA 4CHAB 4BTUB 1ZPCA 1IQEA 1AE5A 2G8TA 1OPHB 3A80A 1W7GH 1J8AA 1W10U 1TGCA 3PLBA 3PO1C 2OBOA 5T6FA 1TFXA 3PV5A 1QJ7B 4OGXA 5FX6A 4NIXA 1YPHC 2L74A 1ZSKA 1H8ED 4JZDH 3UY9A 4INHA 2B9LA 1O3KA 3N7EA 3GYMA 1UW7A 4X1RU 3ZZ5A 3TNTA 3CENA 2BQ6B 5DP3A 1GI9B 1HAXB 1C2HA 2BDGA 4ZXXH 5AF9H 2QF3A 2W5EA 3MNXA 4Q4LA 1ESAA 4K3JA 3ZVGA 1ETTH 1Y3VA 3V0XA 4BANB 1GBLA 1YCPM 4ZKSU 1C5UA 3TK6A 1DLKB 1EATA 3VGCB 3KYGA 2VWLA 2ZGHA 3FZDA 1CHOF 2Q6FA 2HVYB 3M36A 2V3HH 2VIWA 1O3OA 2AGIX 1C4V2 3RMNH 2PUXB 1W11U 3D62A 3SHCH 2WV5A 7ESTE 1F0SA 1V2RT 2Z9LA 3SGQE 3NZIA 1O2MA 4XBDA 4B6FA 2UUYA 1ELGA 1Z7KA 3RU4E 3SW2B 3BV9B 4B75A 1ESBA 2BLVA 1SGYE 3AAVA 1TWXB 3P8OA 3C1KA 4AGJA 7KMEH 1RTKA 2V6NA 1TBRH 4MDSA 5JBAS 8LPRA 2TPIZ 4FU8A 1O31A 4XBBA 1MKWH 3ZZ4A 2A5IA 1TAWA 1GDNA 3EA7A 4KKDA 4K1SA 3ATIA 1SLWB 4BTTB 1PYTC 1A5HA 1P9SA 1AN1E 1YPJH 1PPZA 1TQ7B 1L1GA 2VH0A 1LVBA 1S0RA 2UUKB 4RN6A 4WXIA 3A82A 3EQ0H 2XNDD 3ATMA 4RKOB 1YCPH 4JYTA 4AORA 1NFUA 1QBOA 1DX5M 2XCNA 4E05H 1K22H 2FYRA 3PWCA 3E8LA 1V2NT 4NIVA 2HNTC 4AC9A 5IYTA 1EOJA 1QBNA 4IN2A 3MNSA 1FX0B 1Z1JA 3M3TA 4IMZA 3TPIZ 2ALVA 1D6RA 5FX5A 1TNKA 1G3BA 1GWAA 4U32A 2AH4X 4JZFH 4MNWA 5CHAC 3GDVA 1AUTC 1OSSA 1HLTH 3QO6A 1FONA 3PO1B 4P02A 2EC9H 3TK5A 2HPQH 1H9HE 1O2LA 1W0ZU 4U01A 1G3DA 1UO6A 2FOEA 5LH8A 3URDA 6CHAC 4KTCA 2ZFFH 4TPIZ 5L30H 1GG6C 2W6ID 3GCNA 1YBWA 3SV9A 1KTSB 1C1TA 1ZSJA 1L4ZA 4K1EA 4YOJA 2F91A 4BAKB 4FUHA 3GYLB 3GCHC 3I77A 4AYYB 1TRYA 5C0TA 1BRCE 3TJOA 4DT7B 4NSYA 1ZZZA 5FBEA 1V2KT 2PR3A 2R9PA 4MLFB 2VWOA 3Q00A 2VH6A 1LVOA 5DN6D 2ZPQA 1P3EA 1ZTLA 2JH0D 2KCOA 3A7ZA 3BTTE 3E90B 5F8XA 1NM6A 3B9FH 1WQVH 1GBMA 1D3DB 4H6SB 5LGOA 1TMUH 2I6SA 1FY1A 1D9IA 2F9VA 3P92A 1UJ1A 1AVWA 1QRWA 4TWWA 1YPMH 1FQ3A 4GHQA 4JMYA 3ZZ3A 5HYOA 3QTOH 3RXGA 2Z9JA 2ODPA 1T8NA 2FOHA 1O3BA 3LKWA 1E38B 2OD3B 3K2UA 3QN7A 2EI8A 1TB6H 2A31A 1MQ5A 1BTYA 4OS2A 3HKJB 1EZUC 5AHGH 1IQIA 3P70B 1O2WA 3F1SB 1FNIA 5KECA 5HIZA 3BTEE 2ZO3H 3F2FA 3S9BA 2IN2A 2ZHQH 2WPDD 3TGJE 1TX8A 2ZFTA 1HPGA 1BA8B 1JXPA 1TNIA 1O5EH 1PYTD 1MABB 4TY6A 1C5XB 3LGIA 1Y3UA 1FLEE 1YF4A 1EAIA 2W3KA 5GJ4B 2XTTB 4INKA 1W0YH 3KGPA 1KLIH 1HXFH 1O3PB 1SGTA 4DY7B 2ZFSA 2ZGBH 3SV2H 4Q7XA 2WUCA 1G2MA 2VVCA 1H4WA 2VGCB 4JZIA 4ZXYH 2VIQA 3CNRA 3K6YA 2AMDA 5AFYH 5CDFE 4LXBH 2P3UB 1SGDE 4K2YA 4GLYA 2V35A 3ZZ9A 2C8WB 5CHAB 3EE0B 1NPMA 2R2MB 3RXLA 2AEIH 3W94A 2QF0A 2Z9GA 3LH3A 1FJSA 4JCNA 3LT3A 4YLQH 6CHAB 1GBFA 3GICB 1GG6B 1NN6A 2OC1A 4FXGH 3M5MA 1ANDA 2FS9A 1GPZA 1MCVA 3ZVCA 1Y5UT 1RRKA 4MPWA 1NBMD 1ZOMA 3DSOA 2O8TA 3T25A 3IG6B 1QB1A 3GCHB 1P02A 2H9TH 3L3TA 1DOJA 1G3CA 1COWD 1A46H 2STBE 5DO4H 1LKBA 1O3GA 1XVOA 1C1OA 2Y6TA 4UDWH 1YGCH 2FI3E 2HOBA 1HAPH 3BTGE 1O2NA 3RXEA 1LQEA 2IPHA 3TH3H 4Z0KA 2SNVA 2XNIA 1UTNA 1VITF 1BCUH 2YNBA 1GDQA 3BTQE 1O2IA 2LELA 1S81A 2O8WA 5E0JA 1UTMA 1DWCH 1MBQA 1C5RA 3UNRA 3O8RA 2XC4A 3SUEA 1TA6A 2H2ZA 1HBTH 3A7WA 2Y82A 3Q3KA 4TSFD 4ABAA 1TE0A 1F5KU 3DT0H 2Y7ZA 1K28D 3SZNA 2A4QA 1O36A 2YNAA 3K65B 1UK4A 8ESTE 2Q6GA 1ZR0A 3LPRA 2TGDA 1BBRE 1O2GH 1V2WT 1XVMA 1DXPA 2ULLA 5DJ7A 3I78A 1OKXA 2Y5HA 1BMNH 4RKJB 1O3JA 2FXRA 1KXCA 4YM9A 1AZ8A 1EQ9A 1LDTT 4AFQA 1QL7A 1O2PA 1V2QT 1H9IE 3MYWA 3QK1A 4MNXA 3U9AH 1O3AA 2PKSC 4ABBA 4U2WA 1RXPA 1MBMA 1WDIA 3KCGH 1IQJA 1QY6A 4B6EA 1AHTH 5PTPA 1Z6JH 3S9AA 2XBWA 4RT1A 3EGKH 1QGFA 2BD9A 4F55A 1NTPA 3M5NA 3PMJA 1SR5C 4YO9A 1FI8A 3SU5A 3PMAB 1ANEA 1CVWH 4O3UA 4B71A 4BXSA 1DWBH 3BTFE 1F2SE 3MNBA 5L6NH 5IDKA 1EZQA 4ZKNU 1BMLA 3A85A 3K6ZA 2CV3A 1ZJDA 2V3MA 5C1YA 4OGYA 3SU3A 1V2PT 4IN1A 1JWTA 3OTPA 5DKMA 2AGEX 2A0QB 1T7CA 1O3CA 2ZTZA 4MG3A 3OFND 1O32A 5A0BA 1CSOE 4K1TA 3O8CA 1DICA 5GXPA 1P2MA 4AOQA 4XE4A 8GCHG 3U8RH 4X2VA 3RXMA 4Q2KA 1O3MA 3VB4A 3RC6A 3SUDA 3A86A 1PQ8A 5CHBA 3LGUA 2EY4C 1C2GA 3ATKA 5LPFA 4UEHH 4XD7D 2Z7FE 3B23B 1DY9A 2GVFA 1BITA 1SFIA 3NK8A 1YLDA 3SJOA 2FI5E 1TNHA 3GY5A 4X8UH 1FUJA 2BDIA 2CHAC 2KR7A 1NO9H 2ZU2A 4Y8YA 4FUFA 1ZYOA 1OOKB 1C5VA 4KGAA 1AE8H 1XKBC 3TJNA 1W8BH 1YY3A 4ZHAA 2TIOA 4FUBA 2HALA 1E0FD 1C2JA 2ZZUH 2SNWA 1N6YA 1Y3YA 2FLRH 3M5LA 4LK4A 5TJXA 1UVPA 2F3CE 2P93A 1OWDA 4ZCNA 3ZVBA 4B74A 3VB7A 2QF5A 1J15A 3MMGA 3RXCA 4FU9A 2J97A 2JJ2D 4A1XA 2PGBB 3LJOA 1GHAG 1EAWA 1T8OA 2DUCA 4AB8A 2OC7A 3A7VA 4I8GA 5A09A 1P01A 1JIRA 2RCEA 2R0KA 4UFEH 1FY8E 1DFPA 2J2UA 2ZFQH 1CT4E 3A89A 3GISB 1OXGA 2WHXA 2Z3EA 3CS0A 5EODA 3EE7A 1OWIA 4IS5A 3KQEA 2ZG0H 1OWKA 2PKSB 3CP7A 3GCTF 5EXNA 3MU5A 2BY9X 5K0HA 4DJZB 1IQLA 2GZ7A 4OS5A 1C5WB 5GCHG 1BTZA 3MWIU 5C0UA 2ZP0H 4DW2U 2GZ9A 3QWCH 5C5NA 3A7XA 2OC8A 2JETB 5DPAA 3ZZ8A 2GJGA 1D3PB 4Q7ZA 1G36A 3M61U 3PMBB 1HJ9A 3M37A 5JPMH 3SNAA 1BHXB 2HRVA 3F9FA 4WXVA 2BHGA 2QY0B 1BB0B 2C3SA 4TY7A 2Z6BD 1TNJA 2UUJB 3R0FA 1C1SA 5FXLA 1BDAA 5GPIB 4X0WU 2IJOB 2QCYA 1GHXH 1O30A 1TYNA 2ZDMA 3E3TA 2A7CA 4MPXA 4A92A 5IK2D 1S84A 2ZPRA 1DLEA 2B7DH 2KAIA 3PROA 1LMWB 3M7TA 1GJCB 2OC0A 2ANKH 1YYY1 3RMMH 4BOHA 4WY3A 3D65E 4DIHH 1FN6A 2UWLA 1BRUP 1ACBE 3O8BA 1OX1A 3TGKE 4NG9H 1BTWA 2VIOA 2CHAB 1OWHA 2ZFRH 1TNLA 1SFQB 2WUBA 1UHBA 3OEED 3OEHD 1XXDA 1SGPE 1Y59T 3SJ9A 3BTKE 3KQDA 9LPRA 3AAUA 4NIYA 2CJIA 4GPGA 2SGAA 2GCTC 2ZQ2A 1MCTA 5J4QA 3RP2A 2QF4A 5AVDA 2J94A 2A5AA 2PP6A 5EXMA 1UTLM 1EAXA 1LHEH 1Z8IB 4A7IB 1ZGVA 5DP6A 4CRBA 1D6WA 1FPHH 4F48B 1V2OT 3ITIA 1O34A 1J17T 3M7UA 3UAIC 3MU1A 1JIMA 3DD2H 3BEUA 4O9VA 5FL7D 2FOAA 4NFEA 2O9QA 2F4LA 5DSFA 3U8TH 2BDYA 2A4GA 4WMEA 2V7QD 1C2FA 2TGAA 3RU4D 1O2JA 1L1JA 3SN8A 2FMJA 3F3BA 1AWHB 5C5OA 1J16A 1VR1H 3V7TA 2IOTA 2EI7A 3GY3A 3SORA 1GL0E 1BRBE 1P2IA 1HUTH 1B5GH 1V2LT 2XC5A 4A5TS 1DITH 1O2RA 2BY8X 2F9UA 4B73A 2BOKA 2Q1JA 1N1LA 5F6MA 1AZZA 1NU9A 1BQYA 4ISOA 3OU0A 3O8DA 1GI6A 1Y3WA 1C1PA 1MTUA 1GBIA 1IQNA 5HXFA 2ODQA 3GY6A 3UFAA 4NGAH 2C93B 1V2VT 4M9FA 1QTFA 1AFQC 1E34B 1EB1H 3F9HA 4X1PU 2CF8H 3SHAH 4XDEA 2P94A 5TCAA 4I7YH 1QNJA 1V3XA 4I32A 3MU4A 1XUKA 4X8TH 3E6PH 4BTIB 4BAMB 1ZJKA 2ANMH 3HK6B 4B2AA 1T4UH 1QRZA 1SVPA 4OS6A 1YLCA 4OS4A 5EJZA 1AIXH 1SLVB 1ZGIA 2CMYA 4H42U 5EOKA 3ZZBA 3ELAH 3DHKH 3Q3XA 4CRFA 1K0HA 3ZIAD 5E8EH 2EI6A 3A87A 3DCLA 1P2KA 1GDUA 2OINA 3H7OA 1CBWC 3V13A 5EIYA 1NU7B 1Q2WA 2C90B 2J98A 4Y0YE 4KP0A 3RXTA 1JRSA 1GL1A 3BTWE 1A7SA 4XOJA 1F0RA 3OX7U 2GCTB 2C8ZB 3F9GA 1AKSA 3UQVA 1XMNB 2BX3A 3F68H 4UFGH 1ZTJA 1JRTA 1HAYB 3LC5A 4DGJA 4I8LA 1KXBA 5JYIA 1E35B 1EJNA 4AG2A 3SJIA 1A61H 1QQ4A 4IC6A 1PPHE 4E06H 1G32B 3RXJA 7LPRA 1GGDB 3TJUA 2K8IA 2G5NA 1RTFB 1PPFE 3OSYA 4K8BA 1WTHD 3FP6E 1EZXC 3SUGA 1GCDA 1OS8A 1MD8A 2IPQX 4WMFA 4SGBE 2G00A 2VGCC 3DSGA 2JH5D 2SGDE 1QJ6B 2FTLE 3ZV9A 2GV6A 1ETSH 1T8LA 3SNCA 4B1TA 5GDSH 1LHDH 4X2XA 1HFDA 2BYAX 2LNCA 3A8AA 3K9XB 1KDQB 3GY7A 5A0AE 3RXOA 1O3LA 4OS7A 1YLNA 2BVSH 1SGRE 2JDID 3R3GB 5C1UA 1MD7A 1DWEH 2AHME 2D8WA 3MH6A 1HDTH 1D3TB 2DE8A 2Y5GA 2G81E 3OYPA 3MTYA 4KTSA 3ZVDA 4ZMAH 1ELDE 3PLPA 4BXWA 2AGGX 3T5FH 1C1WH 3GY2A 2GT7A 1Q31A
chains in the Genus database with same CATH topology
1A5GH 1C2MA 1XUFA 1HAVA 1P8VC 1NROH 1RFNA 3ZZDA 2XBYA 1AFQB 4YESB 1EPTA 1SGFA 2AIPA 4K69A 4PROA 1C5YB 1H8IH 1EJMA 1HAGE 3BEFB 1O2VA 1MTVA 3S0NA 4ESTE 2ZDNA 1SHHB 1VCWA 1SG8B 1WQSA 6LPRA 2ZHEH 3A84A 1JOUB 1QCPA 2H6MA 2PUQH 3T29A 1PQAA 1ELAA 2AIQA 3LU9B 1F7ZA 1EXFA 2FZZA 4GHTA 8KME2 1UCYE 2PGQB 1SLUB 1KLJH 1FIWA 2ZDAH 1THRH 2ZU4A 1GBBA 2FOCA 1P06A 1TX6A 6GCHF 3QTVH 4CBOA 1CBWB 3BIVH 4MVNA 4FU7A 1CHGA 1S6FA 1MUEB 1YPGH 1GI1A 1SBWA 2LPRA 1GBJA 3DA9B 1TBZH 1MZAA 3P17H 4WH6A 3RMOH 1GMHG 2D2DA 3OY5U 4AFZA 3T28A 2BLWA 4YT7H 2J38A 1QB9A 2P3TB 5DP4A 1GI7B 4A6LA 1ORFA 4ABEA 1KXFA 2YOLA 2WPHS 1YC0A 2ANWA 4TWYA 4CH8B 2UUFB 4A1TA 1TRMA 2WPMS 2XWAA 1DY8A 2F9PA 4NWKA 2XRCA 2VWNA 1MMJN 1P2JA 1ZMJA 3URCA 2BVXH 2H9HA 2R3YA 4THNH 2PSYA 1U6QA 1MTNC 2PKAB 4FVDA 1GJ9B 2HNTF 5F8ZA 1TPAE 4I8JA 1OWJA 1GBAA 1GJ5H 2FDAA 2I6QA 3ODFA 1O2TA 4UONA 3N7OA 1EKBB 1P2NA 1GI5A 1GBTA 3JZ2B 3E0PB 1G9IE 1K1JA 5CE1A 4X1NU 4FUGA 5DP8A 1NRNH 4XFQA 1RIWC 2GCHG 1IQKA 1GJ7B 1OP8A 2F9NA 3ZZ6A 1IHSH 1NFYA 1NFWA 3SQEE 2WPIS 2R2WU 5G4BA 3RXPA 3D23A 4K5ZA 1NRRH 2R0LA 1UTOA 4UE7H 1G2LA 5T6GA 1AQ7A 1GBKA 1HRTH 3LDXH 3SJ8A 1LKAA 1GBCA 1FAKH 4F49A 1S85A 5JBBS 5J4SA 4DIIH 1RJXB 1RS0A 1BTHH 2BTCE 3LJJA 3A8DA 1ARCA 1LQDB 2HLCA 1QURH 1Z8JB 1P2OA 1INCA 2OTVA 4YOIA 3BG4C 1DWDH 3LIWA 3MH5A 4NWLA 1HXEH 1C5LH 4ABFA 5A2MH 1GHWH 1HIAB 2QV1A 1L1NA 4Z6AH 5JB9S 4GCHG 3MH4A 4X2WA 5AFZH 2PHBA 2HWLB 1F92A 1H9LB 1KYNA 2A4RA 2AFQB 2G52A 5EG4A 2ZHWH 3MU8A 3NWUA 3BF6H 1K1OA 1O5FH 1HV7A 1QL8A 2DE9A 5CMXH 1C5MD 1VITG 1O39A 4BAQB 3V12A 2Z9KA 5DG6A 1O2SA 4Y8XA 2VIVA 2Y5FA 4K60A 3FZZA 2OP9A 1N8OC 1SMFE 2BLQA 1SB1H 2ZI2H 2RG3A 3PMHB 1C1RA 3FP8E 3TGIE 4ASHA 4DCDA 2BY5X 1UK3A 3TJVA 3W95A 2C8YB 4CREA 3KQCA 4OS1A 1BOQA 3MOCA 1UHBB 2GMTC 1NY22 3PWBA 2XW9A 1V2MT 2ANYA 1W14U 1FPCH 3SBKA 3EDXB 1V2JT 1D3QB 2JETC 5HM9A 4ZUHA 2XBVA 4O97A 1MTNB 3QLPH 4B76A 3U98H 1GHBG 3QZQA 2ZECA 2C8XB 1TQ0B 3VEQB 4WMDA 1GI4A 3PLKA 1MKXH 4ISNA 3ODDA 4NCYA 3BEIB 4NA9H 1P3CA 3UQOA 8GCHF 1C4Y2 4Y11E 1DSTA 1NC6A 2TGPZ 1ARBA 1QBVH 1ANCA 3UR6A 2VIPA 1RIWB 4CR9A 2AYWA 2BD8A 3ATLA 4GSOA 1O2XA 1SGIB 2G4UA 2JKHA 2VB0A 2BM2A 5E2OA 2ZDKA 1TMBH 1WV7H 3SQHE 1K1MA 1P05A 2BLOA 4MNVA 4Y8ZA 2THFB 1ZPBA 3GDUA 3SU1A 1ABIH 4IC5A 3GCOA 1GVZA 1SSXA 2BDBA 1F5LA 1O5BB 1KLTA 1BBRH 2G5VA 3Q76A 4HFPB 2QXGA 4J1YA 2OUAA 5EQRA 2FP7B 1FY3A 4ZAEA 2A7JA 1MAXA 1EASA 7GCHF 1C2LA 5DK1A 1QRXA 3BG4B 1QHRB 3ZV8A 3V3MA 2P16A 1GHAF 2VINA 3DUXH 4D8NA 4NA7A 5JBTA 1IOEA 3A81A 2HGTH 3QDZB 1Y5AT 1ZTKA 1Z6EA 2D1JA 3HPTB 1CGHA 1DE7H 3BTME 1GHZA 4ABIA 2ZU1A 2B5TB 4LZ1H 4JYUH 1A5IA 1P03A 4CBNA 1SI5H 2ZWLH 1P12E 4CH2B 5FCRA 1NT1A 2EA3A 2J95A 2WPLS 1EP5A 4QT8C 5GCHF 2P3FH 1FIZA 2FI4E 1N8OB 5JB8S 3VB5A 2O8LA 4DG4A 1C2EA 1FXYA 1GMDF 5F03A 2H5DA 3RXFA 3S7KB 2M5TA 2BY6X 4CRCA 1S6HA 2GMTB 1C1NA 4JK6A 1XX9A 1KXEA 2PLXA 1X7AC 2VU8E 4YLUA 3ZVAA 1S0QA 1AVXA 1GVKB 1C2KA 5ESBA 1AKSB 1C5ZB 1ELBA 1CT2E 2H5CA 5C1XA 2GKVE 1AO5A 3FANA 4WVPE 3T2NA 1PQ5A 1SGEE 2TRMA 1THPB 5L2YH 1BHXF 2CGAA 2BZAA 2ZC9H 3U8OH 1MU6B 4BNRA 3GY4A 4AB9A 1VZQH 2GDDA 4AYVB 2UWOA 3PB1E 1ELEE 3SU2A 1FY5A 3RXQA 1F5RA 4ZHMU 1OWEA 5GWZA 3RXUA 1KXAA 2SGPE 1O35A 2ILNA 3SNEA 1W13U 1H8DH 2BD7A 5DGJA 3UNQA 4BAHB 4LZ4B 1TMTH 3QGNB 2Y7XA 2ZGJA 2ZEBA 4K8YA 3UIRA 1ZLRA 2SGEE 1LHFH 3SI3H 3E16B 2A5KA 1QA0A 1GMCG 4UFFH 1O2OA 1GJ4H 4LOYH 1WYKA 1T32A 4YOGA 4I8KA 2QYIA 1TA2A 2TGTA 4H6TA 3AW0A 2BD5A 1J14A 1TABE 2ZNKH 3M3SA 4HTCH 5BPEA 1C9PA 1BJVA 1QB6A 3VB6A 1HAVB 3VB3A 3L6PA 4MQAA 5C67A 3KNXA 1VCPA 2F83A 3P95A 4KTUA 1ZHPA 2GGVB 2VJ1A 1GGDC 1MAYA 1P0SH 4JZ1A 3A7YA 4MNYA 2BXTH 1NZQH 3EAJA 1DUAA 1W3CA 1G3EA 3GY8A 5T6DA 3FVFB 2ZCHP 1TGNA 2GP9B 2OXSA 1ANBA 3M5OA 4DOQA 3U1JB 1Z8RA 1P57B 2BZ6H 1CT0E 3AVZA 3NXPA 2NU3E 2XCFA 3A83A 4D9RA 3SGAE 3TIUA 2W26A 3ZZCA 3LGYA 1IQMA 1HNEE 3KEEA 1PPCE 4D7GA 2OQ5A 1HAIH 5EW2H 2GZ8A 1CA0B 1Y8TA 1TGTA 2JH6D 1BTPA 2BD4A 1AWFH 3JZ1B 3IITA 3S7HB 2G4TA 1F0TA 3Q77A 1TOMH 2FOGA 2BXUH 1C1MA 1K1IA 1O5DH 1TONA 2FWWA 2ZPSA 2PW8H 2QIQA 2PWXA 1K9OE 3I29A 1O2ZA 1QQUA 1GI2A 4ZH8A 1UTQA 2GT8A 3UUZA 2HVXA 4AN7A 5EPNA 5ABWA 2B8OH 2OQUA 1EX3A 2C4FH 1K2I1 3SI4H 3UTUH 4BAOB 3FAOA 3SU0A 1FDPA 2VWMA 3NUMA 2QA9E 2Y81A 1O5GH 1SLXB 4TPYA 5HMAA 1C5TA 1BTXA 1ID5H 2BQ7B 4DURA 1XUGA 5A8ZA 3SU4A 2XWBI 1MTWA 5F8TA 1LPZB 4Q7YA 2ZGCA 2BX4A 1VJ9U 1ZHMA 3U69H 3P8GA 1HGTH 3SV8A 2WYJA 3ZZAA 2QXHA 5EPYA 1RTLA 2BOHB 4MTBA 1ZRKA 4FUDA 1CHOG 2A32A 4Y0ZE 3UPEA 1L0ZA 2ALPA 1THSH 4NZLA 5H4IB 5DP9A 5EW1H 3SUFA 5C3NA 1DANH 2ZFPH 5DP5A 3UOUA 1LVYA 5FPTA 2J9NA 1XKAC 1GBEA 1SC8U 4ABHA 2EEKA 3A7TA 2HPPH 2P8OC 1UCYK 2ZCKP 1PFXC 2TBSA 1C2DA 3RXRA 3MH7A 1S82A 4AZ2B 2ZF0H 1ZSLA 5EXLA 3A88A 4Y6DA 3MO6A 1TNGA 3SU6A 1KSNA 1T8MA 4X6MA 3ZVEA 1YKTA 2VIDA 3ENSB 2W7UA 3RXIA 2RA3A 3Q3YA 3RLYH 1O3HA 3SJKA 1YPEH 4CRGA 1UVOA 2GX4A 3RM0H 1OP0A 3PTBA 4MPVA 5FPSA 2FODA 3LONA 4E7NA 1DPOA 3KL6A 4IGDA 4O03A 1EB2A 4GVUA 1O2HA 1L4DA 1HJ8A 2F9BH 4AFSA 1WCZA 2ZCLP 4D7FA 1C1QA 2XC0A 3SO3A 1CA8B 1AGJA 1KIGH 1BJUA 5EQSA 5FCKA 2Z3CA 1GHYH 4U30A 1QIXB 1SL3A 1NRPH 1UTKA 1WSSH 1A3BH 1HB0B 3PTNA 1BMAA 1UK2A 4MPUA 1PPEE 1C9TA 1IQGA 1O5AB 1LCYA 3NPSA 3TK9A 1DDJA 1OP2A 1AUJA 1O33A 1Z8GA 2A7HA 3RM2H 1GVLA 1YP9A 2QC2A 2BB4A 1Z1IA 3NCLA 5FHTA 3U1IB 3TLOA 1N6XA 1UVUH 2WINI 2BD2A 3STJA 1LHCH 3BG8A 2H1UA 5ESTE 3CS7A 4B2BA 4ISLA 1GJBB 1TIOA 1DUEA 1LPGB 1GJDB 1PQ7A 3ZYEA 4F4OC 1QJ1B 1ETRH 1DVAH 1TPOA 4R8TB 4WJG2 4ABDA 4NZQA 1VGCC 1C5PA 1PPBH 5GIBA 1W12U 3RXVA 1MKXK 1HCGA 2BMGB 1MU8B 1CU1A 1O3EA 1B0FA 1UTPA 4AFUA 3QGJA 4O3TA 3KN2A 1O3NA 1UVTH 1SGCA 1FZZA 4X2YA 2ZDLA 1A0LA 1JMOH 1GMHF 1P2QA 3L33A 3E0NB 2A4OA 1AY6H 1C4U2 2ESTE 3RXDA 3VFEA 2QGRA 1AD8H 2P8OB 2ZTXA 5L2ZH 1EAUA 2FX4A 4IW4E 1TGBA 1S83A 3E91A 1AB9C 4YZUA 4HI3A 1LTOA 2ZKSA 1YPHE 1BBRK 3RDZA 9ESTA 3KQBA 4E7RG 1EUFA 4I33A 1ESTA 2XYAA 4UFDH 4D76A 6GCHG 1WAYB 5EGMA 3PM3A 5HM2A 1GI0A 3HATH 2ZHDA 1V2ST 3AASA 1O2KA 4X6PA 1H1BA 1FMGA 1C2IA 1K1NA 1V2TT 2FO9A 3D49H 3VXEH 4FVBA 1P09A 1Y5BT 2VNTA 5JDUB 2ZHFH 3ESTA 2GCHF 3ZZ7A 1YPKH 3S69A 2J4IA 1O2UA 1ZMLA 2PTCE 2A2XH 1ELFA 2H9EH 2OLGA 3UR9A 1P10A 1JBUH 3G01A 1XUJA 1O3DA 4ZROA 1DXWA 2BY7X 2WPKS 4ISIH 1ELCA 1C5OH 1E37B 3QX5H 1UCYH 3EA9A 3OTJE 1DT2A 1O5CB 1SQAA 1TBQH 2A1DB 2G55A 4J2YB 2Z3DA 3BTHE 3SV7A 1CO7E 3P8FA 4ISHH 3SV6A 2D26C 3FP7E 2OBQA 3RC4A 3KF2A 1W7XH 1YPLH 2BDAA 2R3UA 1GJAB 4TYDA 3STIA 4FUIA 1FY4A 4INLA 4WH8A 1GI8B 2W3IA 1YM0A 4VGCC 1WTGH 2Z94A 1VGCB 4GCHF 1C1UH 3UWJH 3LOXA 6ESTA 4AGKA 3GDSA 1IAUA 2J92A 3LGTA 1DSUA 1V2UT 3BIUH 2FS8A 3RMLH 5K7RA 3MO3A 2B0FA 3RC5A 1XXFA 2FTMA 4XSKU 2ODYB 3T27A 2XBXA 1SQTA 3RU4T 2AERH 1TPPA 3PYHA 5E2PA 4I8HA 4X6OA 2HNTE 2KAIB 4IMQA 1XUHA 1Y3XA 3MHWU 1A4WH 3WY8A 1P04A 5LPRA 1E36B 3LH1A 3BSQA 1GI3A 2G51A 1AB9B 2ZIQH 1KDQA 3HGPA 4A1VA 4KELA 3M35A 1RD3B 2PV9B 1GJ6A 2O8UA 3B8JA 2FOBA 3TVJB 2FESH 2CXVA 2A45B 1A0JA 1QL9A 2QXIA 2GTBA 2V3OH 1GHBF 1WU1A 3TH2H 3RUOA 3T26A 3ATWA 4JK5A 3TITA 3MFJA 3TH4H 1DS2E 2FX6A 2F9OA 3HK3B 4ZHLU 1SHYA 1WOFA 1VJAU 1C5SA 2UWPA 2V0BA 2FOMB 5E0GA 3QZRA 2XXLA 2PTNA 1W2KH 1SGQE 3BN9A 1HAZB 1O37A 2AS9A 1V6DA 1XUIA 1A3EH 3RXBA 1G30B 1TALA 2QAAA 2GD4B 1AMHA 2W7SA 1AVGH 1A2CH 1TX7A 2SGFE 1IQFA 2K1QA 1GHVH 4WF8A 2FM2A 1LVMA 1OYQA 4Q80A 1SOTA 1T4VH 2FYQA 5A0CA 3P8NA 2NU0E 3T62A 2RDLA 4FUJA 1OYTH 1O0DH 1TGSZ 4ZKOU 3DFLA 2BD3A 2ZU5A 3SOSA 4XBCA 1FV9A 1T31A 3SGBE 5EU8A 1VCQA 5E0HA 5SGAE 1BZXE 2CN0H 4M7GA 4Y79A 3C27B 2GDEH 1SPJA 2PSXA 1TPSA 1PJPA 5ETXA 3P6ZB 1MTSA 3RXSA 4FUEA 1GBDA 1FN8A 4SGAE 3A8BA 2NU2E 3RXAA 4VGCB 4Y76A 3GOVB 4NA8A 4HGCA 4RSPA 4X8SH 1S5SA 3UWIA 1HJAC 4ZKRU 1BIOA 3RXHA 1LHGH 2ZGXH 1CQQA 1WUNH 3M7QA 1EZSC 1ELVA 5FBIA 1O2QA 2FIRH 1J9CH 1F0UA 1EPTC 5FPYA 1EP6A 1BUIA 3DFJA 4ABJA 1NFXA 1ELTA 1RGQA 1D4PB 1K1PA 2NU4E 1UMAH 2RA0A 4X8VH 1SGNE 1XM1A 1FAXA 4HZHA 2PKAA 1KTTB 1SQOA 4JYVH 7GCHG 2FOFA 5A8XA 3H5CB 3F9EA 1Q3XA 3UOPA 1VITH 3M3VA 2SGQE 5HGGA 4IBLH 1QA7A 5EQQA 3H7TA 2FEQH 1NESE 1MQ6A 2A2QH 1GCTC 2NU1E 2O8MA 2ZU3A 4R0IA 1HAOH 1UTJA 1C5QA 1L2EA