2OXSA

Crystal structure of the trypsin complex with benzamidine at high temperature (35 c)
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Cationic trypsin
publication title Crystal Structure of the trypsin complex with benzamidine at high temperature (35 C)
rcsb
total genus 52
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2007-02-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2oxsA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2oxsA02
3ZZ5A 3LIWA 1ZJDA 4WJG2 1BTPA 1BTUA 5A8XA 3BG4B 1P8VC 1G3EA 3BIUH 2GZ8A 3SU1A 2A5IA 2ZFTA 4HFPB 1CHOF 3MNSA 2NU0E 3LGWA 2ZPQA 3TPIZ 4ZHLU 4B71A 1P3EA 2O9QA 6GCHG 1YPJH 6CHAB 3M7UA 1J16A 1Y3VA 1TIOA 1FY3A 1TRYA 3F1SB 3U8TH 1OYQA 1ZPCA 3QZQA 4IN1A 5DP5A 1UCYH 4IBLH 1PQAA 4ABFA 1BMMH 4F49A 2YNAA 2ZC9H 2BY7X 4CBNA 1GCTC 3PLBA 1BBRE 2K1QA 3VB7A 2FTLE 3RU4D 4ABAA 4H6SB 4NIXA 2XXLA 4J1YA 5DK1A 1UHBA 3MNBA 1C4U2 1IOEA 1O3KA 2RDLA 2Y5FA 2G8TA 3G01A 2PW8H 1TONA 4NZLA 3SV8A 1C5VA 1F5LA 1H1BA 1UTLM 1L4DA 3VXFH 1C1QA 3GCOA 1K1NA 1E0FD 1UTQA 4CHAB 2ZDAH 1TQ0B 3LGYA 1GI2A 2UWLA 1ACBE 4YTAA 3ZZDA 1O3JA 3HK3B 1O3EA 2BB4A 2ZU1A 3T62A 2PKSB 4ZXXH 2Z9JA 1ZPZA 3LGUA 3DD2H 3MI4A 1LO6A 2TIOA 2QN5T 1C2GA 3V3MA 3TU7H 4FU9A 1MAXA 1P2JA 1C2MA 1ZTJA 3DHKH 3RMMH 8LPRA 2WUBA 5EPYA 2HWLB 5GDSH 3GDSA 2SGPE 1GBBA 3TH3H 3EE0B 3LPRA 2ALPA 1SGFG 2CGAA 5T6FA 1MZDA 2F3CE 5T6GA 1GJ9B 1XUIA 3M7QA 1LPKB 1ABJH 5HXFA 3FP7E 1E38B 4OS7A 3QTVH 2GCTC 1O5EH 3I78A 5EXNA 1Q3XA 2HVXA 4FUGA 1T32A 1Y3YA 3NXPA 1QBOA 1TBZH 4RSPA 1PJPA 1OP8A 2B7DH 2XC0A 1UVUH 2QA9E 3CS0A 1SOTA 1XXFA 1GWAA 1ORFA 2O8TA 1TPOA 1GI1A 2RA0A 3ZZBA 4NIVA 5FPTA 5L6NH 3FZZA 1EPTA 1P01A 2BD7A 2BY5X 3M35A 3OSYA 7LPRA 2A7JA 3MU4A 4AFSA 5LH8A 4X8VH 3RLWH 2SNVA 8GCHF 1EJMA 3P95A 2AFQB 4NIWA 3F68H 1GMDF 4X6MA 3EYDA 1AIXH 2FO9A 3UOUA 3RM0H 1XKAC 1C9PA 4ABEA 2V3OH 1KYNA 3SOSA 1HAOH 2ZCKP 1ESAA 3KQDA 4X6NA 2WPHS 1EATA 4DOQA 1GBMA 2XCNA 1TWXB 1HXEH 5E2PA 3AAVA 1LHCH 1ZRKA 2WUCA 1ZTKA 2QV1A 1KDQB 1PYTD 4D76A 5GCHG 4Y10E 5EW1H 2BD4A 1O2QA 2H9HA 3SU5A 1J8AA 2VJ1A 2ZHQH 1BA8B 1W14U 3A7YA 1SR5C 2PWXA 1AWFH 2ZDNA 4DVAU 5AFYH 4FUJA 3BTME 4FUBA 4K8BA 1DOJA 1YPEH 1VCQA 4FUHA 1V2RT 3W95A 1GL0E 2HALA 1XMNB 3LKWA 3L33A 2G81E 2AIQA 3ENSB 1FIWA 2C8ZB 3C27B 2ZFPH 2ZHDA 5FXLA 3VXEH 3M5NA 4OGYA 2GTBA 1GPZA 1SLWB 1O2TA 2NU3E 1WYKA 1P10A 3MH4A 4A1TA 1GJBB 3K2UA 4IMQA 1PFXC 2WYGA 1YBWA 3PO1B 1P2KA 4X8UH 2FOGA 1FXYA 3H7OA 1DVAH 4HI3A 1GHVH 3KN2A 1IQEA 2P94A 3A80A 1P12E 5CHAC 2GCHG 3A7XA 3FFGA 2Z6BD 1V2KT 5K0HA 1FZZA 4WVPE 2ZU5A 3GCHC 4INHA 2AYWA 3P8FA 2WPLS 1YPHC 3ZZAA 2IPHA 4MPVA 5GXPA 2Z9GA 4K69A 4WXIA 1WQSA 3JZ1B 1AFEH 2CHAC 3BEFB 1C4V2 1LVMA 1F0SA 3SV9A 1BT7A 1GI7B 4BAKB 1MU6B 3T5FH 3GY2A 3ZYEA 2OQ5A 1BMLA 3QZRA 1ELEE 2D8WA 4Q7ZA 1C5QA 4AZ2B 3D65E 2SGDE 3TITA 4WXVA 1C5YB 3ATIA 1ZMJA 2J2UA 3TJUA 2Z3EA 2BDAA 3PLKA 4TY6A 4JZEH 1VCWA 1N6XA 2FYRA 4M7GA 2BTCE 2R3UA 4AGJA 1Z8JB 1AU8A 1P2MA 4OS5A 1AI8H 3AW0A 1VITH 1TB6H 4WWYA 1AUJA 4DGJA 4O3TA 3RMLH 1ZYOA 1O3FA 1MTSA 1G37A 1C1PA 3MHWU 2VWNA 4YM9A 1GJ7B 2QIQA 1CQQA 2VIQA 4JK5A 1GI6A 1FY5A 1GHZA 1UTKA 3T27A 7KMEH 2W26A 1E34B 2HPQH 5C1UA 2BX4A 3GYLB 3MO6A 3RM2H 1SL3A 1VGCB 1ZSJA 1TALA 2ANYA 1JXPA 4B76A 4E7RG 5T6DA 1EASA 1P2NA 1PPZA 2ZDLA 1O3AA 2QXGA 2B0FA 1L2EA 1QY6A 3KIDU 1YCPK 5DJ7A 3ZV9A 4ABGA 1ELCA 1W12U 3RXAA 4XBBA 2GDEH 1Z8RA 1UK3A 1N1LA 2V0BA 1K1IA 2QXJA 4DURA 1A3BH 1ZGVA 2G00A 4CRCA 1O2KA 1EJNA 1C1NA 1EOJA 1IQLA 2HOBA 3A83A 2ZHFH 1FPHH 2B9LA 3A81A 1LHEH 1ZLRA 1V2QT 5E8EH 4GLYA 1FJSA 2PFEA 1W11U 2XBYA 1SMFE 2VINA 2AIPA 1C1SA 1TAWA 1UK4A 9LPRA 1G3DA 1HDTH 2ZDMA 1S6HA 1EQ9A 2FZZA 2EI6A 3UNRA 3QK1A 1V2ST 2A2XH 2CF9H 1O2HA 3QUMP 2BXTH 1BTHH 1V2VT 4JZIA 3RXGA 1V2PT 1GG6C 4ZKRU 1SGYE 1W8BH 1EB1H 5E2OA 5DO4H 1YPHE 3U8RH 4KTCA 1AVWA 3SO3A 2BM2A 1VITG 4X2VA 4FXGH 4X1QU 1GJ5H 1XX9A 2ZA5A 3RXKA 1MD8A 2XBXA 2ZIQH 1O32A 1GBDA 1THRH 5IYTA 1OSSA 3A86A 3Q00A 1MKWK 2AGEX 3SNCA 2NU1E 4MNXA 6GCHF 4MNWA 3TGKE 2WPKS 1TPPA 2AMDA 1B0FA 1T8LA 1GMHG 1SC8U 2DE9A 4K1EA 1BMAA 2PSYA 5TCCA 2BQ6B 3STIA 2SNWA 2NU4E 3SV7A 5DGJA 1C2KA 2ZNKH 5JBAS 5FAHA 3PMBB 4X1SU 3UY9A 1XUJA 6CHAC 1AUTC 3NK8A 1QB6A 1NFYA 4ZKSU 5T3HA 1O2SA 3CS7A 1O2LA 2HLCA 5ESBA 2ZF0H 1O3MA 2GZ9A 2VH0A 3IITA 1YGCH 2IN2A 2ZDKA 1GI9B 2GP9B 2WV4A 1BTWA 3ZV8A 1AWHB 2BMGB 1O3OA 2OBOA 2ANKH 1UVOA 2OTVA 2YOLA 3UPEA 3RXHA 4B73A 3PMAB 3MO9A 3R3GB 1CGHA 3EA9A 3MO3A 1HV7A 2ZGBH 1W13U 1UHBB 3LGIA 1DWBH 1D3PB 1G2LA 4UE7H 1P57B 1ARCA 1SBWA 2RCEA 3F9EA 1QB9A 1HCGA 1KXDA 1G3BA 2C90B 3MU8A 3SJIA 4NWKA 3UTUH 1S85A 1ELBA 2PKSC 1SHHB 1NFWA 1MUEB 2F9PA 3UR9A 1D3DB 3OYPA 1P9UA 3U1IB 1SB1H 1AE8H 3E3TA 5EU8A 4WH6A 5C1XA 2ZKSA 4WY3A 1GBHA 4FUDA 3A89A 1C5SA 4FU7A 3HK6B 4BTIB 1LHGH 1O5CB 5HM9A 4AYVB 1SQTA 2OC0A 1O2GH 2A7HA 1PPBH 2FPZA 1S81A 2FOCA 1EJAA 1ANCA 1MTNB 2ZHWH 1FY1A 2JH0D 3MTYA 4BNRA 1TRNA 4IN2A 2R3YA 1W3CA 1ZRBA 2ZO3H 2ULLA 2GKVE 3Q3XA 1GBKA 2LNCA 1AY6H 1GBCA 2BY9X 2OC7A 2Y6TA 1ANBA 4IC5A 5LPFA 5BRRE 3VGCB 2CXVA 1C1TA 1EAWA 4X6OA 1EZQA 4NA7A 2F9UA 2FI3E 1CA0C 2Z9KA 3GYMA 1INCA 1MD7A 1TE0A 3O8DA 1IQIA 1MBMA 2W3IA 4XE4A 1O3NA 5ETXA 4X0WU 5HYOA 2KAIA 1XKBC 1V6DA 1Z1JA 1EPTB 1F0UA 3ZVFA 1GGDB 3TH4H 3N7OA 6LPRA 1UVSH 3MYWA 4INKA 2FOEA 1P9SA 3RXOA 2VB0A 1GDNA 1P04A 1XXDA 1SGTA 2AGGX 1W7GH 1S82A 3ZZ8A 3QLPH 4JK6A 3C1KA 1HPGA 1ELAA 1O3BA 1C5RA 2HNTC 7ESTE 1WTHD 4OS2A 5EW2H 2R2MB 1OS8A 4BAQB 2P16A 2THFB 1C2IA 1NRRH 1O2XA 1EAUA 4AORA 2H1UA 4AFQA 2NU2E 2ZFRH 3UWIA 2Y5GA 4NA9H 3UIRA 2R0KA 3SGBE 3P92A 2BQ7B 5EQQA 3NKKA 3I77A 2XWBI 1HJAB 1GJ4H 1HAVA 3DT0H 2FOHA 1AE5A 2YNBA 1O38A 1RD3B 4YESB 3OY5U 2VIWA 1FPCH 2J34A 4CH2B 1HGTH 3A8DA 4ASHA 1PPHE 2UWOA 1TOCB 2ZGHA 5BPEA 4ABBA 2LPRA 1KXEA 1O3IA 2DE8A 2O8WA 3RXMA 5JDUB 1OWIA 4ZUHA 2TGDA 2BVRH 3PO1C 1GJDB 1AGJA 2TPIZ 2PUXB 2DUCA 1L0ZA 5H4IB 5J4SA 1C5WB 3JZ2B 2PHBA 1FDPA 4CRBA 1O0DH 3DUXH 3M3VA 1KLJH 3M3TA 1H9LB 1O2OA 4U01A 2BDGA 3RC5A 3KL6A 3SJKA 4AB9A 1IHTH 2WYJA 4CRFA 1G32B 1JWTA 1KXAA 1O2UA 3L6PA 1TABE 2WPIS 2ZGCA 5DP7A 1F2SE 2XTTB 1OWEA 2D26C 5GWZA 1A61H 4Y8XA 1F5KU 3CENA 3FP6E 4IW4E 1XUGA 1VJAU 2GVFA 1LCYA 1GCDA 1A5GH 5EQRA 1TX8A 1DS2E 1TMUH 1DICA 1SI5H 1VZQH 4AFZA 1LKAA 1GI5A 2STBE 4AYYB 1TNJA 1DM4B 1KXBA 1UCYE 1C5OH 4MLFB 4JYUH 3UWJH 1GHWH 4O9VA 1L4ZA 1HBTH 4JZDH 2SGFE 1V2MT 3GY4A 3V0XA 4ZHAA 1LDTT 2QF3A 3T26A 1QB1A 5DP6A 4UFGH 2A4OA 1EP5A 4NGAH 1RS0A 1DE7H 2ILNA 1C5MD 3KHVA 2BQWB 1IQFA 2ZDVH 3TK9A 3SGAE 2OXSA 2TGAA 3M5LA 2C4FH 2PSXA 2HNTE 3A7ZA 1CBWB 3LOXA 3GISB 4Z6AH 1Y8TA 4D9QA 4U30A 1G36A 1PQ5A 1O5AB 2FEQH 1D4PB 2VIDA 4CRDA 3EA7A 2FOMB 1F0TA 2D2DA 2P8OC 2FWWA 3KQBA 3A88A 1O5BB 2ZCHP 1VGCC 4XFQA 2G4TA 3PMJA 5F8TA 1EZUC 1ETRH 5L30H 3OX7U 4X1PU 4CREA 3F6UH 4KGAA 1ESTA 1E36B 1IQJA 3KEEA 1TRMA 4BAHB 3K6YA 1SGCA 4TYDA 4ZROA 1C1VH 1SPJA 3GCTG 1QQUA 2JKHA 1BITA 3ZVDA 4MNVA 5F8ZA 1BZXE 4R0IA 2Z3CA 3SUFA 2BDBA 4E7NA 2VVVA 4A5TS 1O3DA 1MU8B 4Y7AA 2FI5E 3TK6A 5FCRA 1G30B 1Z8IB 1NS3A 1OPHB 3SN8A 4B75A 5JBBS 4FVDA 1FMGA 3ZZ3A 1O2YA 1TGNA 3FAOA 1BMNH 1P06A 2HRVA 1UVTH 6ESTA 3FP8E 1KXCA 1DPOA 2R9PA 1DDJA 4CR5A 4ESTE 4FU8A 1AZZA 5E0JA 2PV9B 3VB3A 1T8MA 2BD5A 1IHSH 1Y5BT 4TY7A 5I25A 1KLIH 4Y0ZE 1K21H 1C5UA 3LU9B 1ABIH 3V12A 1BTZA 3S9BA 3M37A 2B5TB 3F9GA 1V2NT 1C5PA 1QA7A 2FOAA 1BHXF 2Z3DA 1QJ1B 1F0RA 1LHDH 1XVMA 5EXLA 1GMCG 1HAGE 7GCHF 3WY8A 3KCGH 3UNQA 1BRAA 4YLQH 2FX4A 4H42U 1FLEE 5EQSA 1GI0A 1OOKB 1MTVA 3SV2H 4NSYA 4B74A 3QTOH 1AFQC 3SV6A 1BUIA 2O8UA 4MPWA 2ZECA 1RRKA 5C5NA 3UNSA 2BZAA 2OP9A 3TNSA 2A31A 1Y59T 2FS8A 2SFAA 3PWCA 4JMYA 3U8OH 1SHYA 1QJ6B 4YOGA 3RXBA 2P95A 1A5IA 1ZHPA 4I8HA 5SGAE 1RTKA 2BDCA 2VVUA 1TBQH 3GY6A 1MQ6A 1ESBA 1GHBG 4D9RA 1MCTA 4UDWH 3UFAA 2O8LA 1TNKA 3EDXB 4K1SA 3BTHE 3QX5H 1C2EA 4GVUA 3A8CA 1WOFA 2G5VA 2XC4A 3UUZA 5DPAA 1K28D 3RXTA 2G5NA 3ATMA 3LGVA 1K22H 2OBQA 2ZQ2A 1C1MA 2ZCLP 1G9IE 1YPGH 3M3SA 1AMHA 5FBIA 3S9CA 5A09A 5AHGH 2ZGXH 3GY8A 5EXMA 2BD9A 1AB9C 3S7KB 3OY6U 4MDSA 1C1UH 3VB5A 1MTNC 3VB6A 5HGGA 1G2MA 2J94A 1FY8E 5FHTA 3SU6A 3SBKA 1O34A 1LVOA 1HIAA 1Z1IA 2EI8A 2AEIH 1CHOG 3FZDA 2FI4E 1FUJA 3QN7A 3MNCA 1DUAA 1O3LA 1NU9A 3QO6A 3URCA 2BX3A 4TWWA 3AW1A 2ZQ1A 4Q7XA 1SGDE 4NFEA 5EGMA 1H9HE 1H9IE 4A6LA 3RXEA 4PROA 1GHAF 3KF2A 1F5RA 1GGDC 2QYIA 1PPCE 5L2ZH 2UUFB 5I46H 1BTXA 1C5TA 1O35A 4LZ1H 3VEQB 3SHAH 2KAIB 1O3PB 5JB8S 4NSVA 1C5NH 2ZTYA 4K3JA 1GBJA 1CU1A 1WCZA 1HJ9A 5LGOA 1JOUB 1QHRB 4MQAA 4Y79A 3ZVBA 4RKJB 4BAOB 1BQYA 4GAWA 3UOPA 2PLXA 3RLYH 4HGCA 1JIRA 2F9NA 5F6MA 2PKAA 1NFUA 2PTCE 2GT8A 2ALVA 1MTUA 1EAIA 2ZPSA 3SQHE 4Y71A 1RTFB 1O5FH 1XM1A 2GDDA 1LQDB 2IOTA 4ZMAH 1S0RA 2FYQA 1QIXB 3OU0A 3SUDA 1W0ZU 2C93B 2Y81A 2TBSA 1HAVB 4GPGA 4JZFH 4UD9H 4DIHH 2C8XB 1CT4E 1HAHH 4OS4A 4ABJA 4GCHF 1EX3A 1C1WH 1A0HB 5TJXA 3T25A 5DP4A 2C3SA 1QL7A 4DW2U 4KTSA 2A4GA 4AG1A 3MH7A 3RXPA 1SLUB 2AGIX 2OD3B 4Y8YA 1H4WA 1Z7KA 2BDIA 1CT0E 4ISOA 1N8OC 1PQ7A 4D7GA 4ISHH 4BXSA 1QRZA 2OUAA 1GMDG 5PTPA 2Q1JA 2BLQA 4NA8A 1CE5A 3BG4C 1MKXK 1GHYH 1NTPA 4I8JA 1HFDA 2BOKA 3SU2A 2XYAA 1TX6A 4GHQA 3M5MA 1V2TT 1HB0B 2R0LA 1QRWA 1A7SA 3PLPA 1BBRK 3LC5A 1DWDH 1D6RA 1TGBA 1UCYK 4CH8B 2A2QH 1QBVH 1QR3E 3LGTA 5C5OA 2B8OH 1ZMNA 3PM3A 4ZKOU 2TGPZ 1YLCA 1CGJE 1ZSKA 1T4UH 1C2DA 3T29A 3B8JA 1W0YH 1BTYA 2QAAA 4MTBA 1O37A 1BHXB 3ODDA 3TIUA 4K8YA 4B2CA 1P03A 2Y82A 2ODQA 1EUFA 2JH6D 3P6ZB 1XUFA 5ABWA 1BIOA 5F8XA 1DWCH 2FOFA 3F9HA 1S84A 1TGSZ 2ZG0H 4X2WA 2A7CA 4MVNA 3SHCH 2Y7XA 4ABDA 1IQKA 1HAPH 4CHAC 4VGCB 1YKTA 3BEIB 1QTFA 1CBWC 1T8NA 1ELGA 3AASA 1NRPH 3KNXA 1CT2E 5CHAB 3P8NA 5FPYA 1TFXA 1GBLA 1HRTH 3RMOH 1J17T 4KKDA 3GCHB 4GUXA 1ID5H 2GZ7A 3UREA 1Z71A 1C9TA 2XWAA 1ANEA 5AVDA 2GGVB 1XUHA 1P0SH 2Z9IA 3ZYDA 1C2LA 1WV7H 2G4UA 1IAUA 3U1JB 2WV5A 3RC4A 1GI3A 3E8LA 4ISNA 3BIVH 1HAZB 1GI4A 4CBOA 4BXWA 2OQUA 1QL9A 1A1RA 1SGRE 2TGTA 1TNGA 5HM2A 1S6FA 4I8KA 1P05A 2FMJA 5DP9A 5DP8A 1IQMA 2XRCA 4D7FA 4X2XA 1LHFH 3HGNA 3PROA 1L1JA 4XOJA 8KME2 1O2NA 4JYVH 5DP3A 5JPMH 1NC6A 1QJ7B 4FUFA 3UQVA 2PGQB 1MQ5A 1YYY1 4LXBH 2H6MA 4X1NU 1DXWA 1C1RA 2P3FH 1NROH 5EG4A 3VFEA 1J9CH 1NM6A 1C5ZB 5GCHF 1SFIA 4NZQA 1O33A 2HNTF 2PUQH 2FX6A 4X2YA 1O36A 2GV7A 3S69A 2XW9A 5EODA 3UQOA 3SUEA 2XBWA 4ABHA 4WMFA 2GMTB 5HMAA 1JIMA 3DA9B 1QGFA 2XCFA 2PTNA 3LJOA 2JETB 3K65B 1MMJN 4E05H 2WINI 2P3UB 1DX5M 1FAXA 2P59A 1BJVA 1THPB 1OP2A 1UMAH 1WAYB 2ZFQH 3RMNH 1E35B 3ELAH 4IMZA 1DFPA 1DITH 1CVWH 3ATWA 1BJUA 1YM0A 2V3HH 1YCPH 1GBAA 1FONA 3ESTA 1YPKH 1FAKH 1O2IA 1TNIA 4K60A 3PWBA 1W7XH 1FNIA 4AG2A 1UTPA 1O2VA 3ZVCA 3SJ8A 1GVZA 1SGEE 4THNH 3E0NB 4H4FA 4Z0KA 1QRXA 3ZZ9A 3BTWE 3TGIE 1TMTH 1TPAE 3MOCA 1D3QB 2ASUB 1L1GA 3M61U 4XBCA 4JCNA 1PPFE 1NO9H 3MFJA 4FUCA 4MPXA 2GCHF 1MTWA 2VH6A 2C8WB 5TCAA 2UWPA 1ARBA 2XBVA 2UUJB 4Y7BA 2VGCB 3HKIB 1F92A 4Q80A 1C2HA 3MNXA 1LMWB 4D8NA 1W10U 2EEKA 3DFLA 4XSKU 1GI8B 1DWEH 1NT1A 1WQVH 1AQ7A 1JRTA 5DKMA 1SGNE 1C2JA 4WH8A 5FX6A 1TOMH 2M5TA 3AAUA 2CF8H 1HAXB 3SZNA 1C5LH 1MKWH 4TWYA 1OYTH 3BTGE 4AOQA 4K5ZA 2H2ZA 2GT7A 3MWIU 3A8BA 3Q3YA 1ZHRA 3TGJE 4MPUA 3KQCA 4B2BA 1B7XB 1UVPA 1HUTH 4X1RU 4U32A 4FVBA 4Y6DA 1MKXH 2FM2A 3E91A 2BLWA 3OTJE 1O3GA 4DJZB 2Z94A 1GBIA 1GBFA 1DSUA 5FBEA 3TLOA 1BBRH 2ZFFH 5FPSA 3TNTA 4OS6A 1C4Y2 4BANB 2P93A 4UFEH 1AD8H 1D3TB 1DLKB 3NWUA 1FY4A 1SGPE 1DT2A 1TMBH 3QWCH 2J38A 2J4IA 3SNBA 1HIAB 5F03A 4KELA 4YLUA 1V2WT 1NY22 1S83A 2ANWA 4MG3A 3FANA 2H5CA 4Q2KA 1SQAA 4IC6A 1TPSA 3BTEE 2W7UA 5A2MH 2ESTE 2XNIA 2ZU3A 3LC3A 5E0GA 1P2OA 3MU1A 2QC2A 3RXLA 1RIWB 1V2JT 1K1MA 1D6WA 4Y11E 2VWOA 1JMOH 3ZZ7A 1EKBB 3I29A 1ZJKA 3LJJA 2F9OA 4RN6A 2C8YB 3NUMA 2RG3A 5C3NA 1OWKA 3GY7A 1P2QA 2WPJS 4UFDH 3PTNA 3D23A 1YP9A 4A1XA 1ZOMA 1NESE 3UR6A 3SU4A 4YT7H 1EP6A 1EZSC 1BOQA 3RDZA 1C5XB 2OCVB 3LT3A 1ZZZA 2HPPH 2VIPA 3TK5A 4BTUB 1TA6A 1YCPM 3O8CA 3NPSA 4H6TA 2PKAB 3E16B 5E0HA 1VITF 4X6PA 1AKSA 1TBRH 1VR1H 1RXPA 1SLVB 1ELFA 4U2WA 1K1LA 1GBTA 2VVCA 3ATLA 4E06H 2F9VA 1ZR0A 1SFQB 4DT7B 4DY7B 1CA0B 2TRMA 3H5CB 5JBCS 5ESTE 3K6ZA 1BRCE 2Y7ZA 3STJA 4YZUA 1GMHF 2BD8A 1Y3XA 4ABIA 1X7AC 4AN7A 1HNEE 4FUIA 3E0PB 4GSOA 2F9BH 3ZVGA 3ITIA 1LVYA 2SGAA 2VIOA 2BD2A 2ZU2A 4Y76A 4DG4A 3BV9B 5LPRA 3MH6A 1RJXB 3HPTB 1UK2A 1TGCA 1UTJA 4SGAE 1YPMH 4CRAA 2J92A 2UUYA 1OWJA 4I31A 4WF8A 2J95A 1HAYB 3SGQE 1LKBA 1QCPA 3MU0A 5JBTA 1EOLA 1MAYA 1DSTA 5JYIA 3BTQE 3EQ0H 3SU0A 1A3EH 5GIBA 3RXRA 2Z7FE 2QXHA 5C67A 3GDVA 4XBDA 4F4OC 4CR9A 1VCPA 4K1TA 1G3CA 2BDHA 1FN8A 2FXRA 3A82A 3SI4H 2W7SA 4YT6H 2EI7A 1QURH 2ZWLH 2QGRA 2ZZUH 3E6PH 2AS9A 3ZZ4A 1EXFA 1SVPA 4KTUA 3SW2B 2ZFSA 2ZHEH 2ZU4A 1TNLA 1CHGA 2ANMH 1THSH 1WU1A 3NZIA 3TJVA 1PQ8A 4NG9H 2ZTZA 1O3HA 4VGCC 3ODFA 3SORA 1LPGB 3GY5A 3FVFB 3RXCA 1T4VH 2UUKB 3SJ9A 4WMDA 1GDQA 4O3UA 1O3CA 3PYHA 1HJ8A 2BLVA 1HXFH 3HATH 1YF4A 3RXUA 1TQ7B 4YO9A 1DY9A 5CE1A 1ANDA 4I7YH 2ZEBA 1O39A 1F7ZA 2CJIA 1A5HA 1MBQA 1DXPA 2A0QB 1EZXC 2VU8E 8ESTE 3O8RA 3TVJB 1GDUA 1B5GH 4NFFA 2BD3A 4I8LA 2FTMA 2W5EA 1NRNH 5GPIB 2A4RA 2R2WU 4Y8ZA 2FOBA 2OLGA 4GHTA 1D9IA 1GCTB 1T31A 3GCNA 1Q31A 1O2WA 1RGQA 3VGCC 2FDAA 1NPMA 4NWLA 1IQHA 2BOHB 1O2MA 1Q2WA 2OC1A 3PB1E 3RC6A 2FLRH 3P70B 1WSSH 3S0NA 1XVOA 3RXSA 3HGPA 1TGTA 1Y5UT 3R0FA 1ZTLA 4FUEA 3ZVAA 3Q77A 2BHGA 5A0AE 1NRSH 3ZVEA 1EPTC 1V3XA 2QCYA 1E37B 2A5AA 3T28A 4ZKNU 3F9FA 1Y3WA 5AF9H 1ZPBA 4TPYA 1IQNA 1O2RA 1FV9A 1ZHMA 3A87A 3W94A 2V35A 1NRQH 2BVSH 1H8IH 3SU3A 2AMPA 1LVBA 1AHTH 1SGFA 1SQOA 2A1DB 2GMTC 3H7TA 5C20A 1BB0B 2P8OB 2FIRH 1B0EA 1A0JA 2I6SA 4LZ4B 2JETC 1HAIH 3S7HB 3T2NA 3SNAA 1TX7A 1GL1A 2G52A 1KTSB 3P8GA 5AFZH 4KP0A 4HTCH 1MH0A 3GOVB 3BEUA 3GICB 2WPMS 4O03A 1NN6A 3EA8A 2F83A 2GCTB 4ISLA 2Y80A 2H5DA 1HJAC 3DFJA 3S9AA 1QA0A 3SI3H 1BDAA 3KGPA 1IQGA 1UTOA 3TJNA 4QT8C 1N6YA 2HGTH 1Z6EA 1U6QA 3SNEA 1QQ4A 3M5OA 3V7TA 3SNDA 1HYLA 4AB8A 1GBEA 3NCLA 2VWLA 1QNJA 1MZAA 3URDA 1MCVA 1V2LT 1QFKH 2OC8A 4NIYA 2PR3A 2F91A 4BOHA 3IWMA 2GX4A 4INLA 1A46H 4XDEA 3RXQA 1WBGB 3P17H 1TYNA 1S0QA 5IDKA 1ELTA 1C1OA 2VGCC 2ZGJA 1A4WH 1V2UT 1KDQA 4A7IB 2FESH 8GCHG 1SG8B 1YPLH 1J15A 3GY3A 2J9NA 1PPGE 1CA8B 3MMGA 1H8DH 3A7WA 4JYTA 3RUOA 2RA3A 1NFXA 1ZGIA 4TPIZ 5GJ4B 1KXFA 2D1JA 2ZPRA 1M9UA 1ZMLA 3U69H 1RFNA 1UO6A 1KY9A 3LH3A 1GJ6A 4IGDA 1LPZB 4MNYA 1BCUH 4BTTB 2V6NA 2BZ6H 3LDXH 3PV4A 2AMQA 4SGBE 2NWNA 4A92A 2BY6X 3LH1A 3ZZ6A 1AVXA 4DIIH 1GJ8B 3E90B 1FIZA 2STAE 1JBUH 2ODPA 3BF6H 3A84A 3GDUA 3D49H 1UTNA 4ZXYH 1P2IA 1ETTH 1VJ9U 2XC5A 4K2YA 3RXIA 3V13A 1K9OE 1V2OT 2VWMA 2EA3A 2SGEE 4I32A 4LK4A 5C1YA 2EC9H 4UFFH 4HZHA 2BLOA 5DG6A 4RKOB 2O8MA 1UJ1A 2G55A 4AGKA 1AFQB 3SUGA 7GCHG 1BRUP 2GD4B 1LTOA 1W2KH 1K1OA 3VB4A 1A2CH 3A8AA 1O31A 3BTTE 1P02A 2FP7B 2Y5HA 5EOKA 2G51A 2CN0H 4DCDA 1S5SA 1SLXB 3U98H 3QGNB 1ZSLA 5C2ZA 2P3TB 1RIWC 4AFUA 1O2PA 2VIVA 3GCTF 2ZP0H 5K7RA 1AZ8A 4B1TA 1NZQH 1T8OA 2BY8X 1FI8A 4B2AA 4UONA 1WTGH 2CHAB 3BG8A 1UTMA 3O8BA 2BVXH 1Y3UA 2AH4X 4WMEA 3IG6B 2Z9LA 4ZAEA 1P11E 3E1XB 4LOYH 9ESTA 1GJAB 5FCKA 1TNHA 2A5KA 3RU4T 3TH2H 4CRGA 3AVZA 1O5DH 5A0CA 2GV6A 1PPEE 3Q76A 1AB9B 3PTBA 1KLTA 2A45B 3BTDE 4BAMB 5L2YH 2Q6DA 1EAXA 1DY8A 3A7TA 1K2I1 1L1NA 3M36A 3MU5A 3CP7A 3U9AH 1SSXA 5J4QA 1AVGH 2ZI2H 3EGKH 4YOIA 1DUEA 1KSNA 1O30A 1Z8GA 2PGBB 1PYTC 1ETSH 1YLDA 1NU7B 3BN9A 2OINA 4UEHH 3B23B 1O2ZA 5A8YA 1FN6A 2A4QA 4A1VA 1WUNH 2BYAX 1CGIE 1JRSA 2CV3A 3RXDA 1K1JA 1AO5A 2A32A 3L3TA 4JZ1A 4IS5A 5JB9S 1GVLA 1XUKA 4J2YB 1AKSB 2AERH 2Q6GA 4NCYA 1ELVA 3RU4E 1Y5AT 3K9XB 3KQEA 3SJOA 1T7CA 3EAJA 4Q7YA 1SGQE 1LQEA 1OXGA 3LONA 3BTKE 3RXFA 5A0BA 1GMCF 1SOZA 1C2FA 4I33A 1FQ3A 2H9TH 4OGXA 1O2JA 5CMXH 1GHAG 3P8OA 1QBNA 1QL8A 2ODYB 1TLDA 2I6QA 1O5GH 5A8ZA 1YC0A 1TA2A 1GVKB 1ELDE 3PMHB 3QDZB 2W3KA 3A85A 1GHXH 2QF0A 2BXUH 3QGJA 3RP2A 4ISIH 2Q6FA 4ZH8A 1OWHA 1KTTB 2VNTA 1GJCB 2QY0B 2BDYA 5G4BA 5B6OA 4X8TH 3RXVA 1EB2A 1BRBE 2QXIA 1DANH 3BSQA 2IJOB 4I8GA 5EPNA 1J14A 2CMYA 2FS9A 1OKXA 3ATKA 4OS1A 3RXJA 5LPEA 2FODA 1GHBF 2SGQE 1AN1E 2JH5D 3A7VA 3SQEE 3MH5A 1SGIB 1RTLA 1GG6B 1HLTH 3ZZCA 1OWDA 2H9EH 1DLEA 1Z6JH 1CO7E 1A0LA 2FLBH 3M7TA 3Q3KA 1OP0A 1KIGH 1OX1A 3VPKA 3D62A 3TJOA 4Y0YE 1P09A 5FX5A 4O97A 4AX9H 1P3CA 3BTFE 3HKJB 4ZHMU 1CSOE 1N8OB 3B9FH 4YOJA 4R8TB 4X8SH 1K1PA 4GCHG 2ZTXA
chains in the Genus database with same CATH superfamily
3ZZ5A 3LIWA 1ZJDA 2V3MA 4WJG2 1BTPA 1BTUA 5A8XA 3BG4B 1P8VC 1G3EA 3BIUH 2GZ8A 4TT3D 3SU1A 2KR7A 3N7DA 2A5IA 2ZFTA 4HFPB 1CHOF 3MNSA 2NU0E 3LGWA 2ZPQA 3TPIZ 4ZHLU 4B71A 1P3EA 2O9QA 6GCHG 1YPJH 3KQ5A 3M7UA 6CHAB 1J16A 1Y3VA 1TIOA 1FY3A 1TRYA 3F1SB 3U8TH 1OYQA 1ZPCA 3QZQA 4IN1A 5DP5A 1UCYH 4IBLH 1PQAA 4ABFA 1BMMH 4F49A 2YNAA 2ZC9H 2BY7X 4CBNA 1GCTC 3PLBA 1BBRE 2K1QA 3VB7A 2FTLE 2WHXA 3RU4D 4ABAA 2RFKC 4H6SB 4NIXA 2XXLA 4J1YA 5DK1A 1UHBA 3MNBA 1C4U2 1IOEA 1O3KA 2RDLA 2Y5FA 2G8TA 3G01A 5CHBA 2PW8H 1TONA 4NZLA 3SV8A 1C5VA 1F5LA 1H1BA 1UTLM 1L4DA 3U28C 3VXFH 1C1QA 3GCOA 1K1NA 1E0FD 1UTQA 4CHAB 2ZDAH 1TQ0B 3LGYA 1GI2A 2UWLA 1ACBE 4YTAA 3ZZDA 1O3JA 3HK3B 1O3EA 2BB4A 2ZU1A 3T62A 2PKSB 4ZXXH 2Z9JA 1ZPZA 3LGUA 3DD2H 3MI4A 1LO6A 2TIOA 3UB0A 2QN5T 3PRBA 1C2GA 3V3MA 3TU7H 4FU9A 1MAXA 1P2JA 1C2MA 1ZTJA 3DHKH 3RMMH 8LPRA 2WUBA 5EPYA 2HWLB 5GDSH 3GDSA 2SGPE 1GBBA 3TH3H 3EE0B 3LPRA 4ACAA 2ALPA 1SGFG 2CGAA 5T6FA 1MZDA 2F3CE 5T6GA 1GJ9B 1XUIA 3M7QA 1LPKB 2JIZD 1ABJH 5HXFA 3FP7E 1E38B 4OS7A 3QTVH 2GCTC 1O5EH 3I78A 5EXNA 1Q3XA 2HVXA 4FUGA 4P02A 1T32A 1Y3YA 3NXPA 1QBOA 1TBZH 4RSPA 1PJPA 1OP8A 2B7DH 2XC0A 1UVUH 1E1QD 2QA9E 3CS0A 1SOTA 1XXFA 1GWAA 1ORFA 2O8TA 1H8ED 1TPOA 1GI1A 2RA0A 3ZZBA 4NIVA 5FPTA 5L6NH 3FZZA 1EPTA 1P01A 2BD7A 2BY5X 3M35A 3OSYA 7LPRA 5EIYA 2A7JA 3MU4A 4AFSA 5LH8A 4X8VH 3RLWH 2SNVA 8GCHF 1EJMA 3P95A 1YWUA 2AFQB 4NIWA 3F68H 1GMDF 4X6MA 3EYDA 1AIXH 2FO9A 4ASUD 3UOUA 3RM0H 1XKAC 1C9PA 4ABEA 2V3OH 1KYNA 3SOSA 1HAOH 2ZCKP 1ESAA 3UAIC 3KQDA 4X6NA 2WPHS 1EATA 4DOQA 1GBMA 2XCNA 1TWXB 1HXEH 5E2PA 3EE7A 3AAVA 1LHCH 1ZRKA 2WUCA 1ZTKA 2QV1A 1KDQB 1PYTD 4D76A 5GCHG 4Y10E 5EW1H 2XOKD 2BD4A 1O2QA 2H9HA 3SU5A 1J8AA 2VJ1A 3PV5A 2ZHQH 1BA8B 1W14U 3A7YA 1SR5C 2PWXA 1AWFH 2ZDNA 4DVAU 5AFYH 4FUJA 3BTME 4FUBA 4K8BA 1DOJA 3W1EA 1YPEH 1VCQA 4FUHA 1V2RT 3W95A 1GL0E 2HALA 1XMNB 3LKWA 3L33A 2G81E 2AIQA 3ENSB 1FIWA 2C8ZB 3C27B 2ZFPH 2ZHDA 2PP6A 5FXLA 3VXEH 3M5NA 5EJ1A 4OGYA 2GTBA 1GPZA 1SLWB 1O2TA 2NU3E 1WYKA 1P10A 3MH4A 4A1TA 1GJBB 3K2UA 4IMQA 1PFXC 2WYGA 1YBWA 3PO1B 1P2KA 4X8UH 2FOGA 1FXYA 3H7OA 1DVAH 2LELA 4HI3A 1GHVH 3KN2A 1IQEA 2P94A 3A80A 1P12E 2JJ2D 2GCHG 5CHAC 2KCPA 3A7XA 3FFGA 2Z6BD 1V2KT 5K0HA 1FZZA 3F2HA 4WVPE 2ZU5A 3GCHC 4INHA 2AYWA 3P8FA 2WPLS 1YPHC 3ZZAA 4B6EA 2WV9A 2IPHA 4MPVA 5GXPA 2Z9GA 4K69A 4WXIA 1WQSA 3JZ1B 1AFEH 2CHAC 3BEFB 1C4V2 1LVMA 1F0SA 3SV9A 1BT7A 1GI7B 4BAKB 1MU6B 3T5FH 3GY2A 3ZYEA 2OQ5A 1BMLA 3QZRA 1ELEE 2D8WA 4Q7ZA 1C5QA 4AZ2B 3D65E 2SGDE 3TITA 4WXVA 1C5YB 3ATIA 1ZMJA 2J2UA 3TJUA 2Z3EA 2BDAA 3PLKA 4TY6A 4JZEH 1VCWA 1N6XA 2FYRA 4M7GA 2BTCE 2R3UA 4AGJA 1Z8JB 1AU8A 1P2MA 4OS5A 1AI8H 3AW0A 1VITH 1TB6H 4WWYA 1AUJA 4DGJA 4O3TA 2WPDD 3RMLH 1ZYOA 1O3FA 1MTSA 1G37A 1C1PA 3MHWU 2VWNA 4YM9A 4I86A 5DN6D 1GJ7B 2QIQA 1CQQA 2VIQA 4JK5A 1GI6A 1FY5A 1GHZA 1UTKA 3T27A 7KMEH 2W26A 1E34B 2HPQH 5C1UA 2BX4A 2W6JD 3GYLB 3MO6A 3RM2H 1SL3A 1VGCB 1ZSJA 1TALA 2ANYA 1JXPA 4B76A 4E7RG 5T6DA 1EASA 1P2NA 1PPZA 2ZDLA 1O3AA 2QXGA 2B0FA 1L2EA 1QY6A 3KIDU 1YCPK 5DJ7A 3ZV9A 4ABGA 1ELCA 1W12U 3RXAA 4XBBA 2GDEH 1Z8RA 1UK3A 1N1LA 2V0BA 1K1IA 2QXJA 4DURA 1A3BH 1ZGVA 2G00A 4CRCA 1O2KA 1EJNA 1C1NA 1EOJA 1IQLA 2HOBA 3A83A 2KZ4A 2ZHFH 1FPHH 2B9LA 3A81A 1LHEH 1ZLRA 1V2QT 5E8EH 4GLYA 1FJSA 3FN8A 2PFEA 1W11U 2XBYA 1SMFE 2VINA 2AIPA 1C1SA 1TAWA 1UK4A 9LPRA 1G3DA 1HDTH 2ZDMA 1S6HA 1EQ9A 2YMSB 2FZZA 2EI6A 3UNRA 3QK1A 1V2ST 2A2XH 2CF9H 1WXRA 1O2HA 3QUMP 2BXTH 1BTHH 1V2VT 4JZIA 3RXGA 3F2FA 1V2PT 1GG6C 4ZKRU 1SGYE 1W8BH 1EB1H 3F0OA 5E2OA 5DO4H 1YPHE 4XRNA 3U8RH 4KTCA 1AVWA 3SO3A 2BM2A 3FO8D 1W0JD 1VITG 4X2VA 4FXGH 4X1QU 1GJ5H 1XX9A 2ZA5A 3RXKA 1MD8A 2XBXA 2ZIQH 1O32A 1GBDA 1THRH 5IYTA 5HKKD 1OSSA 3A86A 3Q00A 1MKWK 2AGEX 3SNCA 1W0KD 2NU1E 4MNXA 6GCHF 4MNWA 3TGKE 2WPKS 1TPPA 2AMDA 4YXWD 1B0FA 1T8LA 1GMHG 1SC8U 4XD7D 2DE9A 4K1EA 1BMAA 2PSYA 5TCCA 2BQ6B 3STIA 2SNWA 2NU4E 3SV7A 5DGJA 1C2KA 2ZNKH 5JBAS 5FAHA 3PMBB 4X1SU 3UY9A 1XUJA 6CHAC 1AUTC 3NK8A 1QB6A 1NFYA 4P00A 4ZKSU 5T3HA 1O2SA 3CS7A 1O2LA 2HLCA 5ESBA 2ZF0H 1O3MA 2GZ9A 2VH0A 3IITA 1YGCH 2IN2A 2ZDKA 1GI9B 2GP9B 2WV4A 1BTWA 3ZV8A 1AWHB 1COWD 2BMGB 1O3OA 2OBOA 2ANKH 1UVOA 2OTVA 2YOLA 3UPEA 3RXHA 4B73A 3PMAB 3MO9A 3R3GB 1CGHA 3EA9A 3MO3A 2KCAA 1HV7A 2ZGBH 1W13U 1UHBB 3LGIA 1DWBH 1D3PB 1G2LA 4UE7H 1P57B 1ARCA 1SBWA 2RCEA 3F9EA 4B6FA 1QB9A 1HCGA 1KXDA 1G3BA 4Q4LA 2C90B 3MU8A 3SJIA 3OTPA 4NWKA 3UTUH 1S85A 1ELBA 2PKSC 1SHHB 1NFWA 1MUEB 2F9PA 3UR9A 1D3DB 3OYPA 1P9UA 3U1IB 1SB1H 1AE8H 3E3TA 5EU8A 4WH6A 5C1XA 2ZKSA 4WY3A 1GBHA 4FUDA 3A89A 1C5SA 4FU7A 3HK6B 4BTIB 1LHGH 1O5CB 5HM9A 4AYVB 1SQTA 2OC0A 1O2GH 2A7HA 1PPBH 2FPZA 1S81A 2FOCA 1EJAA 1ANCA 1MTNB 2ZHWH 1FY1A 2JH0D 3MTYA 4BNRA 1TRNA 4IN2A 2R3YA 1W3CA 1ZRBA 2ZO3H 2ULLA 2GKVE 3Q3XA 1GBKA 2LNCA 1AY6H 1GBCA 2BY9X 2OC7A 2Y6TA 1ANBA 4IC5A 5LPFA 2KCOA 5BRRE 3VGCB 2CXVA 1C1TA 1EAWA 4X6OA 2QE7D 1EZQA 4NA7A 2F9UA 2FI3E 1CA0C 2Z9KA 3GYMA 1INCA 1MD7A 1TE0A 3O8DA 1IQIA 3FOAA 1MBMA 2W3IA 4XE4A 1O3NA 5ETXA 4X0WU 5HYOA 2KAIA 1XKBC 1V6DA 1Z1JA 1EPTB 1F0UA 3ZVFA 1GGDB 3TH4H 3N7OA 6LPRA 1UVSH 3MYWA 4INKA 2FOEA 1P9SA 3RXOA 2VB0A 1GDNA 1P04A 1XXDA 1E79D 1SGTA 2AGGX 1W7GH 1S82A 3ZZ8A 3QLPH 4JK6A 2EQNA 1HPGA 3C1KA 1ELAA 1O3BA 1C5RA 2HNTC 7ESTE 1WTHD 4OS2A 5EW2H 1NBME 2R2MB 1OS8A 3H09A 4BAQB 2P16A 5GNDA 2THFB 1C2IA 1NRRH 1O2XA 1EAUA 4AORA 2H1UA 4AFQA 2NU2E 2ZFRH 3UWIA 2Y5GA 4NA9H 3UIRA 2R0KA 3SGBE 3P92A 2BQ7B 5EQQA 3NKKA 3DSGA 3I77A 2JDID 1HJAB 1GJ4H 1HAVA 2XWBI 3DT0H 2FOHA 1AE5A 1K0HA 2YNBA 1O38A 1RD3B 4YESB 3OY5U 2VIWA 1FPCH 2J34A 4CH2B 1HGTH 3A8DA 4ASHA 1PPHE 2UWOA 1TOCB 2ZGHA 5BPEA 4ABBA 2LPRA 1KXEA 1O3IA 2DE8A 2O8WA 3RXMA 5JDUB 1OWIA 4ZUHA 2TGDA 2BVRH 3PO1C 1GJDB 1AGJA 2TPIZ 2PUXB 2DUCA 1L0ZA 5H4IB 5J4SA 1C5WB 3JZ2B 2AHME 2PHBA 1FDPA 4CRBA 1O0DH 3DUXH 3M3VA 3NRLA 1KLJH 3M3TA 1H9LB 1O2OA 4U01A 2BDGA 3RC5A 3KL6A 3SJKA 4AB9A 1IHTH 2WYJA 4CRFA 1G32B 1JWTA 1KXAA 1O2UA 3L6PA 1TABE 2WPIS 2ZGCA 5DP7A 1F2SE 2XTTB 1OWEA 2D26C 5GWZA 1A61H 4Y8XA 1F5KU 3CENA 3FP6E 4IW4E 1XUGA 4RI0A 1VJAU 2GVFA 1LCYA 1GCDA 1A5GH 5EQRA 1TX8A 1DS2E 1TMUH 1DICA 1SI5H 1VZQH 4AFZA 1LKAA 1GI5A 2STBE 4AYYB 1TNJA 1DM4B 1KXBA 1UCYE 1C5OH 4MLFB 4JYUH 3UWJH 1GHWH 4O9VA 1L4ZA 1HBTH 4JZDH 2SGFE 1V2MT 3GY4A 3V0XA 4ZHAA 1LDTT 2QF3A 3T26A 1QB1A 5DP6A 4UFGH 2A4OA 1EP5A 4NGAH 1RS0A 1DE7H 2ILNA 1C5MD 3KHVA 2BQWB 1IQFA 2ZDVH 3TK9A 3SGAE 2OXSA 2TGAA 2LP6A 2C4FH 2PSXA 3M5LA 2HNTE 2KCYA 3A7ZA 1CBWB 3LOXA 3GISB 4Z6AH 1Y8TA 1NBMD 2K8IA 4D9QA 4U30A 1G36A 1PQ5A 1O5AB 2FEQH 1D4PB 2VIDA 4CRDA 3EA7A 2FOMB 1F0TA 3VG8A 2D2DA 2P8OC 2FWWA 3KQBA 3A88A 1O5BB 2ZCHP 1VGCC 4XFQA 2G4TA 3PMJA 5F8TA 1EZUC 1ETRH 5L30H 3OX7U 4X1PU 4CREA 3F6UH 4KGAA 1ESTA 1E36B 1IQJA 3KEEA 3PRDA 1TRMA 4BAHB 3K6YA 1SGCA 4TYDA 4ZROA 1C1VH 1SPJA 3GCTG 1QQUA 3OEED 2J98A 2JKHA 1BITA 3ZVDA 4MNVA 5F8ZA 1BZXE 4R0IA 2Z3CA 3SUFA 2BDBA 3F2GA 4E7NA 2VVVA 3F0PA 4A5TS 1O3DA 1MU8B 4Y7AA 2FI5E 3TK6A 5FCRA 1G30B 1Z8IB 1NS3A 1OPHB 3SN8A 4B75A 5JBBS 4FVDA 1FMGA 3ZZ3A 2YMSC 1O2YA 1OHHD 1TGNA 3FAOA 1BMNH 1P06A 2HRVA 1UVTH 6ESTA 3FP8E 1KXCA 1DPOA 2R9PA 1DDJA 2KFWA 4CR5A 4ESTE 4FU8A 1AZZA 5E0JA 2PV9B 3VB3A 1T8MA 2BD5A 1IHSH 1Y5BT 4TY7A 5I25A 1KLIH 4Y0ZE 1K21H 1C5UA 3LU9B 1ABIH 3V12A 1BTZA 3S9BA 3M37A 2B5TB 3F9GA 1V2NT 1C5PA 1QA7A 3N7EA 2FOAA 1BHXF 2Z3DA 1QJ1B 1F0RA 1LHDH 1XVMA 2KM0A 5EXLA 1GMCG 1HAGE 7GCHF 3WY8A 3KCGH 3UNQA 1BRAA 4YLQH 2FX4A 4H42U 1FLEE 5EQSA 1GI0A 1UW7A 1OOKB 1MTVA 3SV2H 2RDEA 4NSYA 4B74A 3QTOH 4M9FA 1AFQC 3SV6A 1BUIA 2O8UA 4MPWA 2ZECA 1RRKA 5C5NA 3UNSA 2BZAA 2OP9A 3OFND 3TNSA 2A31A 1Y59T 4RT0A 2FS8A 2SFAA 3PWCA 4JMYA 3U8OH 1SHYA 1QJ6B 4YOGA 3RXBA 2P95A 1A5IA 1ZHPA 4I8HA 5SGAE 1RTKA 2BDCA 2QF4A 2VVUA 1TBQH 3GY6A 1MQ6A 1ESBA 1GHBG 3N99A 1MCTA 4D9RA 4UDWH 3UFAA 2O8LA 1TNKA 3EDXB 4K1SA 3BTHE 3QX5H 1C2EA 4GVUA 3A8CA 1WOFA 2G5VA 2XC4A 3UUZA 5DPAA 1K28D 3RXTA 2G5NA 5IK2D 3ATMA 3LGVA 1K22H 2OBQA 2ZQ2A 1C1MA 2ZCLP 1G9IE 1YPGH 3M3SA 1AMHA 5FBIA 3S9CA 5A09A 5AHGH 2ZGXH 3GY8A 3PV2A 5EXMA 2BD9A 1AB9C 3S7KB 5C94A 3OY6U 4MDSA 1C1UH 3VB5A 2JJ1D 2WZQA 1MTNC 3VB6A 5HGGA 1G2MA 2J94A 1FY8E 5FHTA 3SU6A 3SBKA 1O34A 1LVOA 1HIAA 1Z1IA 2EI8A 2AEIH 1CHOG 3FZDA 2FI4E 2IJD1 1FUJA 3QN7A 4TSFD 3MNCA 1DUAA 1O3LA 1NU9A 3QO6A 3URCA 2BX3A 4TWWA 3AW1A 2ZQ1A 4Q7XA 1SGDE 4NFEA 5EGMA 1H9HE 1H9IE 4A6LA 3RXEA 4PROA 1GHAF 3KF2A 1F5RA 1GGDC 2QYIA 1PPCE 5L2ZH 2UUFB 5I46H 1BTXA 1C5TA 1O35A 4LZ1H 3VEQB 3SHAH 2KAIB 1O3PB 5JB8S 4NSVA 1C5NH 2ZTYA 4K3JA 1GBJA 1CU1A 1WCZA 1HJ9A 5LGOA 1JOUB 1QHRB 4MQAA 4Y79A 3ZVBA 4RKJB 4BAOB 1BQYA 4GAWA 3UOPA 1E1RD 2PLXA 3RLYH 3ZIAD 4HGCA 1JIRA 2F9NA 5F6MA 2PKAA 1NFUA 2PTCE 2GT8A 2ALVA 1MTUA 1EAIA 2ZPSA 3SQHE 4Y71A 1RTFB 1O5FH 1XM1A 2GDDA 1LQDB 2IOTA 4ZMAH 1S0RA 2FYQA 1QIXB 3OU0A 3SUDA 1W0ZU 2C93B 2Y81A 2TBSA 1HAVB 4GPGA 4JZFH 4UD9H 4DIHH 2C8XB 1CT4E 1HAHH 4OS4A 4ABJA 4GCHF 1EX3A 1C1WH 1A0HB 5TJXA 3T25A 2F43B 5DP4A 2C3SA 1QL7A 4DW2U 4KTSA 2A4GA 4AG1A 3MH7A 3RXPA 1SLUB 2AGIX 2OD3B 4Y8YA 1H4WA 1Z7KA 2BDIA 1CT0E 4ISOA 1N8OC 1PQ7A 4D7GA 4ISHH 4BXSA 1QRZA 2OUAA 4FETA 1GMDG 5PTPA 2Q1JA 2BLQA 4NA8A 1CE5A 3BG4C 1MKXK 1GHYH 1NTPA 4I8JA 1HFDA 3MQKC 2BOKA 3SU2A 2XYAA 1TX6A 4GHQA 3M5MA 1V2TT 1HB0B 2R0LA 1QRWA 1A7SA 3PLPA 1BBRK 3LC5A 1DWDH 1D6RA 1TGBA 1UCYK 4CH8B 2A2QH 1QBVH 1QR3E 3LGTA 5C5OA 2B8OH 1ZMNA 3PM3A 4ZKOU 2VBCA 2TGPZ 1BMFD 1YLCA 1CGJE 1ZSKA 1T4UH 1C2DA 3T29A 3B8JA 1W0YH 1H8HD 1BTYA 4OM9A 2QAAA 4MTBA 1O37A 1BHXB 3ODDA 3TIUA 4K8YA 4B2CA 1P03A 2Y82A 2ODQA 1EUFA 2JH6D 3P6ZB 1XUFA 5ABWA 1BIOA 5F8XA 1DWCH 2FOFA 3F9HA 1S84A 1TGSZ 2ZG0H 4X2WA 2A7CA 4MVNA 3SHCH 2Y7XA 4ABDA 1IQKA 1HAPH 4CHAC 5C0TA 4VGCB 1YKTA 3BEIB 5B6LA 1QTFA 1CBWC 1T8NA 1ELGA 3SYJA 3AASA 1NRPH 3KNXA 2L74A 1CT2E 3OAAD 5CHAB 3P8NA 1VKYA 5F53A 5FPYA 3WWBA 1TFXA 1GBLA 1HRTH 3RMOH 1J17T 2J5UA 4KKDA 3GCHB 4GUXA 1ID5H 2GZ7A 3UREA 1Z71A 5FL7D 1C9TA 2XWAA 1ANEA 5AVDA 2GGVB 1XUHA 1P0SH 2Z9IA 3ZYDA 1C2LA 1WV7H 2G4UA 1IAUA 3U1JB 2WV5A 3WW7A 3RC4A 1GI3A 3E8LA 4ISNA 3BIVH 1HAZB 1GI4A 4CBOA 4BXWA 2OQUA 1QL9A 1A1RA 1SGRE 2TGTA 1TNGA 5HM2A 1S6FA 4I8KA 1P05A 2FMJA 2J98B 5DP9A 5DP8A 1IQMA 2XRCA 4D7FA 4X2XA 1LHFH 3HGNA 3PROA 1L1JA 4XOJA 8KME2 1O2NA 4JYVH 5DP3A 5JPMH 1NC6A 1QJ7B 4FUFA 3UQVA 1QZ8A 1MQ5A 2PGQB 1YYY1 3KYGA 4LXBH 2H6MA 4X1NU 1DXWA 1C1RA 2P3FH 1NROH 5EG4A 3VFEA 1J9CH 1NM6A 1C5ZB 5GCHF 1SFIA 4NZQA 1O33A 2HNTF 2PUQH 2FX6A 4X2YA 1O36A 2GV7A 3S69A 2XW9A 5EODA 3UQOA 3SUEA 2XBWA 4ABHA 4WMFA 2GMTB 5HMAA 1JIMA 3DA9B 1QGFA 2XCFA 2PTNA 3LJOA 2JETB 3K65B 2M2AA 1MMJN 4E05H 2WINI 2P3UB 1DX5M 1FAXA 2P59A 2F4LA 1BJVA 1THPB 1OP2A 1UMAH 1WAYB 2ZFQH 3RMNH 1E35B 3ELAH 4IMZA 1DFPA 1DITH 1CVWH 3ATWA 1BJUA 1YM0A 2V3HH 1YCPH 1GBAA 1FONA 2QF5A 3ESTA 1YPKH 1FAKH 1O2IA 1TNIA 4K60A 3PWBA 1YLNA 1W7XH 1FNIA 4AG2A 1UTPA 1O2VA 3ZVCA 3SJ8A 1GVZA 1SGEE 4THNH 3E0NB 4H4FA 4Z0KA 1QRXA 3ZZ9A 3BTWE 3TGIE 1TMTH 1TPAE 3MOCA 1D3QB 2ASUB 1L1GA 3M61U 4XBCA 4JCNA 1PPFE 1NO9H 3MFJA 4FUCA 4MPXA 2GCHF 1MTWA 2VH6A 2C8WB 5TCAA 2UWPA 1ARBA 2XBVA 2L6OA 2UUJB 4Y7BA 2VGCB 3HKIB 1F92A 4Q80A 1C2HA 3MNXA 1LMWB 4D8NA 1W10U 2EEKA 3DFLA 4XSKU 1GI8B 1DWEH 1NT1A 1WQVH 1AQ7A 1JRTA 5DKMA 1SGNE 1C2JA 4WH8A 5FX6A 1TOMH 2M5TA 3AAUA 5EJLA 2CF8H 1HAXB 3SZNA 1C5LH 1MKWH 4TWYA 1OYTH 3BTGE 4ZCNA 4AOQA 4K5ZA 2H2ZA 2GT7A 3MWIU 3A8BA 3Q3YA 1ZHRA 3TGJE 4MPUA 3KQCA 4B2BA 1B7XB 1UVPA 1HUTH 4X1RU 4U32A 4FVBA 4Y6DA 1MKXH 3AK5A 2FM2A 3E91A 2CK3D 2BLWA 3OTJE 3SZEA 1O3GA 4DJZB 2Z94A 1GBIA 1GBFA 1DSUA 5FBEA 3TLOA 1BBRH 2ZFFH 5FPSA 3TNTA 4OS6A 1C4Y2 4BANB 2P93A 4UFEH 1AD8H 1D3TB 1DLKB 3NWUA 1FY4A 1SGPE 1DT2A 1TMBH 3QWCH 2J38A 2J4IA 3DSPA 3OEHD 3SNBA 1HIAB 5F03A 2WSSD 4F48B 4KELA 4YLUA 1V2WT 1NY22 1S83A 2ANWA 4MG3A 3FANA 2H5CA 4Q2KA 1SQAA 4IC6A 1TPSA 3BTEE 2W7UA 5A2MH 2ESTE 2XNIA 2ZU3A 3F3BA 3LC3A 5E0GA 1P2OA 3MU1A 2QC2A 3RXLA 1RIWB 1V2JT 1K1MA 1D6WA 4Y11E 2VWOA 1JMOH 3ZZ7A 1EKBB 3I29A 1ZJKA 3LJJA 2F9OA 4RN6A 2C8YB 3NUMA 2RG3A 5C3NA 1OWKA 3GY7A 1P2QA 2WPJS 2XNDD 4UFDH 3DSOA 3PTNA 3D23A 1YP9A 4A1XA 1S6LA 1NESE 1ZOMA 3UR6A 3SU4A 4YT7H 1EP6A 5HIZA 1EZSC 1BOQA 3RDZA 1C5XB 2OCVB 3LT3A 1ZZZA 1KMHB 2HPPH 5KGOA 2VIPA 3TK5A 4BTUB 1TA6A 1YCPM 4RT1A 3O8CA 3NPSA 4H6TA 2PKAB 3E16B 5E0HA 1VITF 4X6PA 1AKSA 1TBRH 1VR1H 1RXPA 1SLVB 1ELFA 4U2WA 1K1LA 1GBTA 2VVCA 3ATLA 4E06H 2F9VA 1ZR0A 1SFQB 4DT7B 4DY7B 1CA0B 2TRMA 3H5CB 5JBCS 5ESTE 3K6ZA 4DT4A 1BRCE 2Y7ZA 1YY3A 4YZUA 3STJA 1GMHF 5CDFE 2BD8A 1Y3XA 4ABIA 1X7AC 4AN7A 1HNEE 4FUIA 2KX4A 3E0PB 4GSOA 2F9BH 3ZVGA 3ITIA 1LVYA 3FKSD 2SGAA 2VIOA 2BD2A 2ZU2A 4Y76A 4DG4A 3BV9B 5LPRA 3MH6A 1RJXB 3HPTB 1UK2A 1TGCA 1UTJA 4SGAE 1YPMH 4CRAA 2J92A 2UUYA 1OWJA 3GS9A 4I31A 4WF8A 2J95A 1HAYB 3SGQE 2W6ID 4FOUC 5KECA 1LKBA 1QCPA 3MU0A 5JBTA 1EOLA 1MAYA 1DSTA 5JYIA 3BTQE 3EQ0H 3SU0A 1A3EH 5GIBA 3RXRA 2Z7FE 2QXHA 5C67A 3GDVA 4XBDA 4F4OC 4CR9A 1VCPA 4K1TA 1G3CA 2BDHA 1FN8A 2FXRA 3OE7D 4Z1MD 4F55A 3A82A 3SI4H 2W7SA 1WDIA 2EI7A 1QURH 2ZWLH 2QGRA 2ZZUH 3E6PH 4YT6H 2AS9A 3ZZ4A 1EXFA 1SVPA 4KTUA 3SW2B 2ZFSA 2ZHEH 2ZU4A 1TNLA 1CHGA 2ANMH 1THSH 1WU1A 3NZIA 3TJVA 1PQ8A 4AC9A 4NG9H 2ZTZA 1O3HA 4VGCC 3ODFA 3SORA 1LPGB 3GY5A 3FVFB 3RXCA 1T4VH 2UUKB 3SJ9A 4WMDA 1GDQA 4O3UA 1O3CA 3PYHA 1HJ8A 2BLVA 1HXFH 2OK5A 3HATH 1YF4A 3RXUA 1TQ7B 4YO9A 1DY9A 5CE1A 1ANDA 5T1VA 4I7YH 2ZEBA 1O39A 1F7ZA 2CJIA 1A5HA 1MBQA 1DXPA 2A0QB 2GJGA 1EZXC 2VU8E 8ESTE 3O8RA 3TVJB 1GDUA 1B5GH 4NFFA 2BD3A 4I8LA 2FTMA 2W5EA 1NRNH 5GPIB 2A4RA 2R2WU 4Y8ZA 2FOBA 2OLGA 4GHTA 1D9IA 1GCTB 1T31A 3GCNA 1Q31A 1O2WA 1RGQA 3VGCC 2FDAA 1NPMA 4NWLA 1IQHA 2BOHB 1O2MA 4HG6A 1Q2WA 2OC1A 3PB1E 3RC6A 2FLRH 3P70B 1WSSH 3S0NA 1XVOA 3RXSA 3HGPA 1TGTA 1Y5UT 3R0FA 1ZTLA 4FUEA 1MABB 3ZVAA 3Q77A 2BHGA 5A0AE 1NRSH 2HVYB 3ZVEA 1EPTC 1V3XA 2QCYA 1E37B 2A5AA 3T28A 4ZKNU 3F9FA 1Y3WA 5AF9H 1ZPBA 4TPYA 1IQNA 1O2RA 1FV9A 1ZHMA 3A87A 3W94A 2V35A 1NRQH 2BVSH 1H8IH 3SU3A 2AMPA 1LVBA 1AHTH 1SGFA 1SQOA 2A1DB 2GMTC 3H7TA 2V7QD 5C20A 1BB0B 2P8OB 2FIRH 1B0EA 1A0JA 2I6SA 4LZ4B 2JETC 1HAIH 3S7HB 3T2NA 3SNAA 1TX7A 1GL1A 2G52A 1KTSB 3P8GA 5AFZH 4KP0A 4HTCH 1MH0A 3GOVB 3BEUA 3GICB 2WPMS 4O03A 1NN6A 3EA8A 2F83A 2GCTB 4ISLA 2Y80A 2H5DA 1HJAC 3DFJA 3S9AA 1QA0A 3SI3H 1BDAA 3KGPA 1IQGA 1UTOA 3TJNA 4QT8C 1N6YA 2HGTH 1Z6EA 1U6QA 3SNEA 1QQ4A 3M5OA 3V7TA 3SNDA 5HIYA 1HYLA 4AB8A 1GBEA 3NCLA 2VWLA 1QNJA 1MZAA 3URDA 1MCVA 1V2LT 1QFKH 2OC8A 4NIYA 2PR3A 2F91A 4BOHA 3IWMA 2GX4A 4INLA 1A46H 4XDEA 3RXQA 1WBGB 3P17H 1TYNA 1S0QA 5IDKA 1ELTA 1C1OA 2K0QA 2VGCC 2ZGJA 1A4WH 1V2UT 1KDQA 4A7IB 2FESH 8GCHG 1SG8B 1YPLH 1SQRA 5EJZA 1J15A 3KYFA 3GY3A 2J9NA 1PPGE 1CA8B 3MMGA 1H8DH 3A7WA 4JYTA 3RUOA 2RA3A 1NFXA 1ZGIA 4TPIZ 5GJ4B 1KXFA 2D1JA 2ZPRA 1M9UA 1ZMLA 2YMSD 3U69H 1RFNA 1UO6A 1KY9A 3LH3A 1GJ6A 4IGDA 1LPZB 4MNYA 1BCUH 4BTTB 2V6NA 2BZ6H 3LDXH 3PV4A 5C0UA 2AMQA 4SGBE 2NWNA 4A92A 2BY6X 3LH1A 3ZZ6A 1AVXA 4DIIH 1GJ8B 3E90B 1FIZA 2STAE 1JBUH 2ODPA 3BF6H 3A84A 3GDUA 3D49H 1UTNA 4ZXYH 1P2IA 1ETTH 1VJ9U 2XC5A 4K2YA 3RXIA 3V13A 1K9OE 1V2OT 2VWMA 2EA3A 2SGEE 4I32A 4LK4A 5C1YA 2EC9H 4UFFH 4HZHA 2BLOA 5DG6A 4RKOB 2O8MA 1UJ1A 2G55A 4AGKA 1AFQB 3SUGA 7GCHG 1BRUP 2GD4B 5C17A 1LTOA 2J97A 1W2KH 1K1OA 3VB4A 1A2CH 3A8AA 1O31A 3BTTE 1P02A 2FP7B 2Y5HA 5EOKA 2G51A 2CN0H 4DCDA 3WWFA 1S5SA 1SLXB 4ACBA 3U98H 3QGNB 1ZSLA 5C2ZA 2P3TB 1RIWC 4AFUA 1O2PA 2VIVA 3GCTF 2ZP0H 5K7RA 1AZ8A 4B1TA 1NZQH 1T8OA 2BY8X 1FI8A 1EFRD 4B2AA 4UONA 1WTGH 2CHAB 3BG8A 1UTMA 3O8BA 2BVXH 1Y3UA 2AH4X 4WMEA 3IG6B 2Z9LA 4ZAEA 1P11E 3E1XB 4LOYH 9ESTA 1GJAB 5FCKA 1TNHA 2A5KA 3RU4T 3TH2H 4Q63A 3AVZA 4CRGA 1O5DH 5A0CA 2GV6A 1PPEE 3Q76A 1AB9B 3PTBA 1KLTA 2A45B 3BTDE 4BAMB 5L2YH 2Q6DA 1EAXA 1DY8A 3A7TA 1K2I1 1L1NA 3M36A 3MU5A 3CP7A 3U9AH 1SSXA 2HLDD 5J4QA 1AVGH 2ZI2H 3EGKH 4YOIA 1DUEA 1KSNA 1O30A 1SKYE 1Z8GA 1PYTC 2PGBB 1ETSH 1YLDA 1NU7B 3BN9A 2OINA 4UEHH 3B23B 1O2ZA 5A8YA 1FN6A 2A4QA 4A1VA 1WUNH 2BYAX 1CGIE 1JRSA 2CV3A 3RXDA 1K1JA 1AO5A 2A32A 3L3TA 4JZ1A 4IS5A 3DCLA 5JB9S 1GVLA 1XUKA 4J2YB 1AKSB 2AERH 2IPQX 2Q6GA 4NCYA 1ELVA 3RU4E 1Y5AT 3K9XB 3KQEA 3SJOA 1T7CA 3EAJA 4Q7YA 1SGQE 1LQEA 1OXGA 3LONA 3BTKE 3RXFA 5A0BA 1GMCF 1SOZA 1C2FA 4I33A 1FQ3A 2H9TH 4OGXA 1O2JA 5CMXH 1GHAG 3P8OA 1QBNA 1QL8A 2ODYB 1TLDA 2I6QA 2EY4C 1O5GH 5A8ZA 1YC0A 1TA2A 1FX0B 1ELDE 1GVKB 3PMHB 3QDZB 2W3KA 3A85A 1GHXH 2QF0A 2BXUH 3QGJA 3RP2A 4ISIH 2Q6FA 4ZH8A 1OWHA 1KTTB 2VNTA 1GJCB 2QY0B 2BDYA 5G4BA 3CNRA 5B6OA 4X8TH 3RXVA 1EB2A 1BRBE 2QXIA 1DANH 3BSQA 2IJOB 4I8GA 5EPNA 1J14A 2CMYA 2FS9A 1OKXA 3ATKA 4OS1A 5DSFA 3RXJA 5KEDA 5LPEA 2FODA 1GHBF 2SGQE 1AN1E 2JH5D 3A7VA 3SQEE 3MH5A 1SGIB 1RTLA 1GG6B 1HLTH 3ZZCA 1OWDA 2H9EH 1DLEA 1Z6JH 1CO7E 1A0LA 2FLBH 3M7TA 3Q3KA 1OP0A 1KIGH 1OX1A 3VPKA 3D62A 3TJOA 4Y0YE 1P09A 5FX5A 4O97A 4AX9H 1P3CA 3BTFE 3HKJB 4ZHMU 1CSOE 1N8OB 3B9FH 4YOJA 4R8TB 4X8SH 1K1PA 4GCHG 2ZTXA
chains in the Genus database with same CATH topology
3ZZ5A 3LIWA 1ZJDA 4WJG2 1BTPA 1BTUA 5A8XA 3BG4B 1P8VC 1G3EA 3BIUH 2GZ8A 3SU1A 2A5IA 2ZFTA 4HFPB 1CHOF 3MNSA 2NU0E 3LGWA 2ZPQA 3TPIZ 4ZHLU 4B71A 1P3EA 2O9QA 6GCHG 1YPJH 6CHAB 3M7UA 1J16A 1Y3VA 1TIOA 1FY3A 1TRYA 3F1SB 3U8TH 1OYQA 1ZPCA 3QZQA 4IN1A 5DP5A 1UCYH 4IBLH 1PQAA 4ABFA 1BMMH 4F49A 2YNAA 2ZC9H 2BY7X 4CBNA 1GCTC 3PLBA 1BBRE 2K1QA 3VB7A 2FTLE 3RU4D 4ABAA 4H6SB 4NIXA 2XXLA 4J1YA 5DK1A 1UHBA 3MNBA 1C4U2 1IOEA 1O3KA 2RDLA 2Y5FA 2G8TA 3G01A 2PW8H 1TONA 4NZLA 3SV8A 1C5VA 1F5LA 1H1BA 1UTLM 1L4DA 3VXFH 1C1QA 3GCOA 1K1NA 1E0FD 1UTQA 4CHAB 2ZDAH 1TQ0B 3LGYA 1GI2A 2UWLA 1ACBE 4YTAA 3ZZDA 1O3JA 3HK3B 1O3EA 2BB4A 2ZU1A 3T62A 2PKSB 4ZXXH 2Z9JA 1ZPZA 3LGUA 3DD2H 3MI4A 1LO6A 2TIOA 2QN5T 1C2GA 3V3MA 3TU7H 4FU9A 1MAXA 1P2JA 1C2MA 1ZTJA 3DHKH 3RMMH 8LPRA 2WUBA 5EPYA 2HWLB 5GDSH 3GDSA 2SGPE 1GBBA 3TH3H 3EE0B 3LPRA 2ALPA 1SGFG 2CGAA 5T6FA 1MZDA 2F3CE 5T6GA 1GJ9B 1XUIA 3M7QA 1LPKB 1ABJH 5HXFA 3FP7E 1E38B 4OS7A 3QTVH 2GCTC 1O5EH 3I78A 5EXNA 1Q3XA 2HVXA 4FUGA 1T32A 1Y3YA 3NXPA 1QBOA 1TBZH 4RSPA 1PJPA 1OP8A 2B7DH 2XC0A 1UVUH 2QA9E 3CS0A 1SOTA 1XXFA 1GWAA 1ORFA 2O8TA 1TPOA 1GI1A 2RA0A 3ZZBA 4NIVA 5FPTA 5L6NH 3FZZA 1EPTA 1P01A 2BD7A 2BY5X 3M35A 3OSYA 7LPRA 2A7JA 3MU4A 4AFSA 5LH8A 4X8VH 3RLWH 2SNVA 8GCHF 1EJMA 3P95A 2AFQB 4NIWA 3F68H 1GMDF 4X6MA 3EYDA 1AIXH 2FO9A 3UOUA 3RM0H 1XKAC 1C9PA 4ABEA 2V3OH 1KYNA 3SOSA 1HAOH 2ZCKP 1ESAA 3KQDA 4X6NA 2WPHS 1EATA 4DOQA 1GBMA 2XCNA 1TWXB 1HXEH 5E2PA 3AAVA 1LHCH 1ZRKA 2WUCA 1ZTKA 2QV1A 1KDQB 1PYTD 4D76A 5GCHG 4Y10E 5EW1H 2BD4A 1O2QA 2H9HA 3SU5A 1J8AA 2VJ1A 2ZHQH 1BA8B 1W14U 3A7YA 1SR5C 2PWXA 1AWFH 2ZDNA 4DVAU 5AFYH 4FUJA 3BTME 4FUBA 4K8BA 1DOJA 1YPEH 1VCQA 4FUHA 1V2RT 3W95A 1GL0E 2HALA 1XMNB 3LKWA 3L33A 2G81E 2AIQA 3ENSB 1FIWA 2C8ZB 3C27B 2ZFPH 2ZHDA 5FXLA 3VXEH 3M5NA 4OGYA 2GTBA 1GPZA 1SLWB 1O2TA 2NU3E 1WYKA 1P10A 3MH4A 4A1TA 1GJBB 3K2UA 4IMQA 1PFXC 2WYGA 1YBWA 3PO1B 1P2KA 4X8UH 2FOGA 1FXYA 3H7OA 1DVAH 4HI3A 1GHVH 3KN2A 1IQEA 2P94A 3A80A 1P12E 5CHAC 2GCHG 3A7XA 3FFGA 2Z6BD 1V2KT 5K0HA 1FZZA 4WVPE 2ZU5A 3GCHC 4INHA 2AYWA 3P8FA 2WPLS 1YPHC 3ZZAA 2IPHA 4MPVA 5GXPA 2Z9GA 4K69A 4WXIA 1WQSA 3JZ1B 1AFEH 2CHAC 3BEFB 1C4V2 1LVMA 1F0SA 3SV9A 1BT7A 1GI7B 4BAKB 1MU6B 3T5FH 3GY2A 3ZYEA 2OQ5A 1BMLA 3QZRA 1ELEE 2D8WA 4Q7ZA 1C5QA 4AZ2B 3D65E 2SGDE 3TITA 4WXVA 1C5YB 3ATIA 1ZMJA 2J2UA 3TJUA 2Z3EA 2BDAA 3PLKA 4TY6A 4JZEH 1VCWA 1N6XA 2FYRA 4M7GA 2BTCE 2R3UA 4AGJA 1Z8JB 1AU8A 1P2MA 4OS5A 1AI8H 3AW0A 1VITH 1TB6H 4WWYA 1AUJA 4DGJA 4O3TA 3RMLH 1ZYOA 1O3FA 1MTSA 1G37A 1C1PA 3MHWU 2VWNA 4YM9A 1GJ7B 2QIQA 1CQQA 2VIQA 4JK5A 1GI6A 1FY5A 1GHZA 1UTKA 3T27A 7KMEH 2W26A 1E34B 2HPQH 5C1UA 2BX4A 3GYLB 3MO6A 3RM2H 1SL3A 1VGCB 1ZSJA 1TALA 2ANYA 1JXPA 4B76A 4E7RG 5T6DA 1EASA 1P2NA 1PPZA 2ZDLA 1O3AA 2QXGA 2B0FA 1L2EA 1QY6A 3KIDU 1YCPK 5DJ7A 3ZV9A 4ABGA 1ELCA 1W12U 3RXAA 4XBBA 2GDEH 1Z8RA 1UK3A 1N1LA 2V0BA 1K1IA 2QXJA 4DURA 1A3BH 1ZGVA 2G00A 4CRCA 1O2KA 1EJNA 1C1NA 1EOJA 1IQLA 2HOBA 3A83A 2ZHFH 1FPHH 2B9LA 3A81A 1LHEH 1ZLRA 1V2QT 5E8EH 4GLYA 1FJSA 2PFEA 1W11U 2XBYA 1SMFE 2VINA 2AIPA 1C1SA 1TAWA 1UK4A 9LPRA 1G3DA 1HDTH 2ZDMA 1S6HA 1EQ9A 2FZZA 2EI6A 3UNRA 3QK1A 1V2ST 2A2XH 2CF9H 1O2HA 3QUMP 2BXTH 1BTHH 1V2VT 4JZIA 3RXGA 1V2PT 1GG6C 4ZKRU 1SGYE 1W8BH 1EB1H 5E2OA 5DO4H 1YPHE 3U8RH 4KTCA 1AVWA 3SO3A 2BM2A 1VITG 4X2VA 4FXGH 4X1QU 1GJ5H 1XX9A 2ZA5A 3RXKA 1MD8A 2XBXA 2ZIQH 1O32A 1GBDA 1THRH 5IYTA 1OSSA 3A86A 3Q00A 1MKWK 2AGEX 3SNCA 2NU1E 4MNXA 6GCHF 4MNWA 3TGKE 2WPKS 1TPPA 2AMDA 1B0FA 1T8LA 1GMHG 1SC8U 2DE9A 4K1EA 1BMAA 2PSYA 5TCCA 2BQ6B 3STIA 2SNWA 2NU4E 3SV7A 5DGJA 1C2KA 2ZNKH 5JBAS 5FAHA 3PMBB 4X1SU 3UY9A 1XUJA 6CHAC 1AUTC 3NK8A 1QB6A 1NFYA 4ZKSU 5T3HA 1O2SA 3CS7A 1O2LA 2HLCA 5ESBA 2ZF0H 1O3MA 2GZ9A 2VH0A 3IITA 1YGCH 2IN2A 2ZDKA 1GI9B 2GP9B 2WV4A 1BTWA 3ZV8A 1AWHB 2BMGB 1O3OA 2OBOA 2ANKH 1UVOA 2OTVA 2YOLA 3UPEA 3RXHA 4B73A 3PMAB 3MO9A 3R3GB 1CGHA 3EA9A 3MO3A 1HV7A 2ZGBH 1W13U 1UHBB 3LGIA 1DWBH 1D3PB 1G2LA 4UE7H 1P57B 1ARCA 1SBWA 2RCEA 3F9EA 1QB9A 1HCGA 1KXDA 1G3BA 2C90B 3MU8A 3SJIA 4NWKA 3UTUH 1S85A 1ELBA 2PKSC 1SHHB 1NFWA 1MUEB 2F9PA 3UR9A 1D3DB 3OYPA 1P9UA 3U1IB 1SB1H 1AE8H 3E3TA 5EU8A 4WH6A 5C1XA 2ZKSA 4WY3A 1GBHA 4FUDA 3A89A 1C5SA 4FU7A 3HK6B 4BTIB 1LHGH 1O5CB 5HM9A 4AYVB 1SQTA 2OC0A 1O2GH 2A7HA 1PPBH 2FPZA 1S81A 2FOCA 1EJAA 1ANCA 1MTNB 2ZHWH 1FY1A 2JH0D 3MTYA 4BNRA 1TRNA 4IN2A 2R3YA 1W3CA 1ZRBA 2ZO3H 2ULLA 2GKVE 3Q3XA 1GBKA 2LNCA 1AY6H 1GBCA 2BY9X 2OC7A 2Y6TA 1ANBA 4IC5A 5LPFA 5BRRE 3VGCB 2CXVA 1C1TA 1EAWA 4X6OA 1EZQA 4NA7A 2F9UA 2FI3E 1CA0C 2Z9KA 3GYMA 1INCA 1MD7A 1TE0A 3O8DA 1IQIA 1MBMA 2W3IA 4XE4A 1O3NA 5ETXA 4X0WU 5HYOA 2KAIA 1XKBC 1V6DA 1Z1JA 1EPTB 1F0UA 3ZVFA 1GGDB 3TH4H 3N7OA 6LPRA 1UVSH 3MYWA 4INKA 2FOEA 1P9SA 3RXOA 2VB0A 1GDNA 1P04A 1XXDA 1SGTA 2AGGX 1W7GH 1S82A 3ZZ8A 3QLPH 4JK6A 3C1KA 1HPGA 1ELAA 1O3BA 1C5RA 2HNTC 7ESTE 1WTHD 4OS2A 5EW2H 2R2MB 1OS8A 4BAQB 2P16A 2THFB 1C2IA 1NRRH 1O2XA 1EAUA 4AORA 2H1UA 4AFQA 2NU2E 2ZFRH 3UWIA 2Y5GA 4NA9H 3UIRA 2R0KA 3SGBE 3P92A 2BQ7B 5EQQA 3NKKA 3I77A 2XWBI 1HJAB 1GJ4H 1HAVA 3DT0H 2FOHA 1AE5A 2YNBA 1O38A 1RD3B 4YESB 3OY5U 2VIWA 1FPCH 2J34A 4CH2B 1HGTH 3A8DA 4ASHA 1PPHE 2UWOA 1TOCB 2ZGHA 5BPEA 4ABBA 2LPRA 1KXEA 1O3IA 2DE8A 2O8WA 3RXMA 5JDUB 1OWIA 4ZUHA 2TGDA 2BVRH 3PO1C 1GJDB 1AGJA 2TPIZ 2PUXB 2DUCA 1L0ZA 5H4IB 5J4SA 1C5WB 3JZ2B 2PHBA 1FDPA 4CRBA 1O0DH 3DUXH 3M3VA 1KLJH 3M3TA 1H9LB 1O2OA 4U01A 2BDGA 3RC5A 3KL6A 3SJKA 4AB9A 1IHTH 2WYJA 4CRFA 1G32B 1JWTA 1KXAA 1O2UA 3L6PA 1TABE 2WPIS 2ZGCA 5DP7A 1F2SE 2XTTB 1OWEA 2D26C 5GWZA 1A61H 4Y8XA 1F5KU 3CENA 3FP6E 4IW4E 1XUGA 1VJAU 2GVFA 1LCYA 1GCDA 1A5GH 5EQRA 1TX8A 1DS2E 1TMUH 1DICA 1SI5H 1VZQH 4AFZA 1LKAA 1GI5A 2STBE 4AYYB 1TNJA 1DM4B 1KXBA 1UCYE 1C5OH 4MLFB 4JYUH 3UWJH 1GHWH 4O9VA 1L4ZA 1HBTH 4JZDH 2SGFE 1V2MT 3GY4A 3V0XA 4ZHAA 1LDTT 2QF3A 3T26A 1QB1A 5DP6A 4UFGH 2A4OA 1EP5A 4NGAH 1RS0A 1DE7H 2ILNA 1C5MD 3KHVA 2BQWB 1IQFA 2ZDVH 3TK9A 3SGAE 2OXSA 2TGAA 3M5LA 2C4FH 2PSXA 2HNTE 3A7ZA 1CBWB 3LOXA 3GISB 4Z6AH 1Y8TA 4D9QA 4U30A 1G36A 1PQ5A 1O5AB 2FEQH 1D4PB 2VIDA 4CRDA 3EA7A 2FOMB 1F0TA 2D2DA 2P8OC 2FWWA 3KQBA 3A88A 1O5BB 2ZCHP 1VGCC 4XFQA 2G4TA 3PMJA 5F8TA 1EZUC 1ETRH 5L30H 3OX7U 4X1PU 4CREA 3F6UH 4KGAA 1ESTA 1E36B 1IQJA 3KEEA 1TRMA 4BAHB 3K6YA 1SGCA 4TYDA 4ZROA 1C1VH 1SPJA 3GCTG 1QQUA 2JKHA 1BITA 3ZVDA 4MNVA 5F8ZA 1BZXE 4R0IA 2Z3CA 3SUFA 2BDBA 4E7NA 2VVVA 4A5TS 1O3DA 1MU8B 4Y7AA 2FI5E 3TK6A 5FCRA 1G30B 1Z8IB 1NS3A 1OPHB 3SN8A 4B75A 5JBBS 4FVDA 1FMGA 3ZZ3A 1O2YA 1TGNA 3FAOA 1BMNH 1P06A 2HRVA 1UVTH 6ESTA 3FP8E 1KXCA 1DPOA 2R9PA 1DDJA 4CR5A 4ESTE 4FU8A 1AZZA 5E0JA 2PV9B 3VB3A 1T8MA 2BD5A 1IHSH 1Y5BT 4TY7A 5I25A 1KLIH 4Y0ZE 1K21H 1C5UA 3LU9B 1ABIH 3V12A 1BTZA 3S9BA 3M37A 2B5TB 3F9GA 1V2NT 1C5PA 1QA7A 2FOAA 1BHXF 2Z3DA 1QJ1B 1F0RA 1LHDH 1XVMA 5EXLA 1GMCG 1HAGE 7GCHF 3WY8A 3KCGH 3UNQA 1BRAA 4YLQH 2FX4A 4H42U 1FLEE 5EQSA 1GI0A 1OOKB 1MTVA 3SV2H 4NSYA 4B74A 3QTOH 1AFQC 3SV6A 1BUIA 2O8UA 4MPWA 2ZECA 1RRKA 5C5NA 3UNSA 2BZAA 2OP9A 3TNSA 2A31A 1Y59T 2FS8A 2SFAA 3PWCA 4JMYA 3U8OH 1SHYA 1QJ6B 4YOGA 3RXBA 2P95A 1A5IA 1ZHPA 4I8HA 5SGAE 1RTKA 2BDCA 2VVUA 1TBQH 3GY6A 1MQ6A 1ESBA 1GHBG 4D9RA 1MCTA 4UDWH 3UFAA 2O8LA 1TNKA 3EDXB 4K1SA 3BTHE 3QX5H 1C2EA 4GVUA 3A8CA 1WOFA 2G5VA 2XC4A 3UUZA 5DPAA 1K28D 3RXTA 2G5NA 3ATMA 3LGVA 1K22H 2OBQA 2ZQ2A 1C1MA 2ZCLP 1G9IE 1YPGH 3M3SA 1AMHA 5FBIA 3S9CA 5A09A 5AHGH 2ZGXH 3GY8A 5EXMA 2BD9A 1AB9C 3S7KB 3OY6U 4MDSA 1C1UH 3VB5A 1MTNC 3VB6A 5HGGA 1G2MA 2J94A 1FY8E 5FHTA 3SU6A 3SBKA 1O34A 1LVOA 1HIAA 1Z1IA 2EI8A 2AEIH 1CHOG 3FZDA 2FI4E 1FUJA 3QN7A 3MNCA 1DUAA 1O3LA 1NU9A 3QO6A 3URCA 2BX3A 4TWWA 3AW1A 2ZQ1A 4Q7XA 1SGDE 4NFEA 5EGMA 1H9HE 1H9IE 4A6LA 3RXEA 4PROA 1GHAF 3KF2A 1F5RA 1GGDC 2QYIA 1PPCE 5L2ZH 2UUFB 5I46H 1BTXA 1C5TA 1O35A 4LZ1H 3VEQB 3SHAH 2KAIB 1O3PB 5JB8S 4NSVA 1C5NH 2ZTYA 4K3JA 1GBJA 1CU1A 1WCZA 1HJ9A 5LGOA 1JOUB 1QHRB 4MQAA 4Y79A 3ZVBA 4RKJB 4BAOB 1BQYA 4GAWA 3UOPA 2PLXA 3RLYH 4HGCA 1JIRA 2F9NA 5F6MA 2PKAA