4ISNA

Crystal structure of matriptase in complex with its inhibitor hai-1
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
241
structure length
241
Chain Sequence
b'VVGGTDADEGEWPWQVSLHALGQGHICGASLISPNWLVSAAHCYIDDRGFRYSDPTQWTAFLGLHDQSQRSAPGVQERRLKRIISHPFFNDFTFDYDIALLELEKPAEYSSMVRPICLPDASHVFPAGKAIWVTGWGHTQYGGTGALILQKGEIRVIQQTTCENLLPQQITPRMMCVGFLSGGVDSCQGDSGGPLSSVEADGRIFQAGVVSWGDGCAQRNKPGVYTRLPLFRDWIKENTGV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Kunitz-type protease inhibitor 1
publication title Crystal structures of matriptase in complex with its inhibitor hepatocyte growth factor activator inhibitor-1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 54
structure length 241
sequence length 241
ec nomenclature ec 3.4.21.109: Matriptase.
pdb deposition date 2013-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4isnA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4isnA01
5ESBA 2GCTB 1FV9A 1LPZB 1XXDA 2P93A 1HAVB 4F49A 3R3GB 4DW2U 5EPYA 1UVOA 1LKBA 4ZH8A 5EPNA 1O2KA 2ZG0H 1GBAA 1W10U 3SGQE 2ASUB 2VIDA 3GDUA 1K1OA 2Q1JA 2FOAA 3MH4A 5E0GA 2ZFPH 1IQLA 1QIXB 2ESTE 4GSOA 1GI9B 4AYVB 3TNSA 3FZZA 1VGCC 2CJIA 1TOCB 1XMNB 1QBVH 4ZAEA 1ELCA 1G3CA 4MDSA 1KXFA 5DP8A 5F8TA 4TY6A 1A0LA 2Y5GA 4JZFH 2HNTC 1GHAF 2FPZA 4INLA 3GDVA 3CENA 4MNYA 1W8BH 1CA8B 4MPXA 2A45B 1THPB 1P2NA 4XBBA 3ZZAA 1ELDE 3DFJA 1O2HA 4X2YA 3L6PA 3UFAA 2OC8A 3URCA 4CRBA 1BRCE 2XC0A 4MTBA 5LPEA 1RTFB 2WPLS 3P8OA 2VWOA 1MU8B 3STIA 2ANMH 1BT7A 1QR3E 1NRRH 3RXAA 2C4FH 1NT1A 2PHBA 4YM9A 1AD8H 1FY4A 2ZCKP 2Z9KA 3TK5A 4J2YB 2SGPE 2PWXA 1UVTH 3BTFE 2Y7ZA 1QTFA 1N1LA 2A31A 2BXUH 3GCTG 1A46H 3AW1A 3TIUA 1LPGB 4WY3A 5CHAB 1SGEE 1GHXH 3KGPA 3D62A 1HXEH 3TH3H 5EXLA 2Z6BD 3SJOA 3F6UH 2Y82A 1PFXC 3LGVA 4BOHA 2HALA 1QRXA 1UTKA 3TVJB 1EP6A 4YESB 3SI3H 1O3HA 3E90B 3E0PB 4DJZB 1DWEH 4K1EA 1GI6A 4IGDA 3GCNA 1GBFA 2ODYB 1SBWA 4D9QA 2GT7A 3BTKE 2ZHEH 5FBIA 1IHSH 2XTTB 4ISNA 1O2SA 2XC4A 3NKKA 1N6YA 3LOXA 1O35A 4ISOA 5FX5A 1RFNA 5A8XA 4D76A 4DCDA 4HGCA 4FUEA 2PFEA 1SG8B 2ZCLP 2WPJS 5E0HA 4X1QU 1QQUA 1ZTKA 3ESTA 3VEQB 2GDEH 1DITH 2FP7B 4I8KA 3RXIA 1GI2A 2EC9H 4HI3A 1BJUA 1XM1A 3M5NA 1H8DH 1T31A 4Y0ZE 1QQ4A 1V2UT 3LU9B 4PROA 2AMPA 1O5FH 4X2WA 3A7YA 2BXTH 3L3TA 4K1TA 2OUAA 2STAE 5GXPA 1EAWA 1TX7A 2ZGBH 1EAIA 1O34A 1O2TA 1V2OT 1MZDA 2BOKA 4UONA 5J4QA 2WUCA 2ZTXA 4AX9H 1OX1A 3E8LA 3ZVEA 1TNLA 1QA7A 1EJNA 3EA7A 5L6NH 4ZHMU 1C5QA 1HJ8A 1SB1H 3G01A 1QCPA 2QY0B 5EXMA 4GUXA 5AFZH 4YT6H 3NXPA 2O8LA 2A2XH 3SUGA 7ESTE 3GCHC 1YPMH 5DG6A 3GICB 1CGJE 2JKHA 1EX3A 2VH6A 1UTNA 3EE0B 1XUFA 3RXBA 1C5LH 5E2OA 2OD3B 1ESAA 2FIRH 3A7XA 2P95A 1O2IA 4ASHA 3P70B 1EP5A 2FI3E 3M37A 4NIYA 5F03A 4OS1A 4MNXA 1ANDA 2ZHWH 4AYYB 2CV3A 1P8VC 3HK6B 1BDAA 4DIIH 1MKWK 1T7CA 2A7JA 2Z9LA 1HIAA 3A7VA 4ABHA 1TPSA 1GMHG 3VPKA 3F9GA 2A4QA 4I8GA 8KME2 1AY6H 4X8SH 1AB9B 4ABDA 1MQ6A 3W94A 2PLXA 2EI6A 3VB4A 2RA0A 1DVAH 2FOBA 1BZXE 2PW8H 2ZU1A 2VIWA 1QB6A 1MAYA 9ESTA 1CGHA 5DP7A 4MQAA 2D26C 1GBEA 1QHRB 1YGCH 2OQUA 4CH2B 4X1RU 1UK4A 4GHQA 1ARBA 3ENSB 3FANA 1SGYE 1SLVB 1A5GH 1TE0A 3SHAH 1PQ8A 2FI4E 1XKBC 1TBZH 1C2MA 2ZO3H 3BIUH 4UEHH 3UOPA 2PKSB 2G4UA 1C5UA 4WF8A 3SJ8A 4IMQA 3SJKA 1GG6B 3RC6A 3A86A 4YOJA 3T25A 4WH6A 5SGAE 5LGOA 1HCGA 2G55A 3SJIA 1TMUH 4XOJA 4R0IA 2A5KA 1TONA 3RMLH 3MU4A 2K1QA 4DIHH 1OP2A 3GCOA 2QAAA 4FUFA 1LVYA 3QDZB 3SUDA 1AUTC 1K28D 5DP4A 3TGKE 1DLEA 2PSYA 1GVLA 4F4OC 1T8LA 3RXPA 1UTLM 4CREA 4E06H 1MH0A 2XBXA 8LPRA 1O30A 2W3KA 5JBAS 1LVMA 1DM4B 1A3EH 3VXEH 6GCHG 1GHVH 2FXRA 1OWJA 3TITA 4JYTA 1EOJA 6CHAC 4B1TA 1L0ZA 2AMQA 2BZAA 1F0SA 1YLCA 1FXYA 5L2YH 2RCEA 1O2XA 1VCPA 1H8IH 3M5MA 4E7RG 3UQOA 1UHBB 2BD9A 2AIPA 4AFZA 5F8ZA 2FOCA 1NROH 3EAJA 1DXPA 4B71A 1XUIA 4VGCB 1SL3A 1HAHH 1IAUA 5A2MH 1ZGIA 3E16B 4CRGA 2ZP0H 2PV9B 2KAIB 3MMGA 2ALPA 4TPYA 5A0AE 2OP9A 1DE7H 1XXFA 2DE9A 4K2YA 2TGAA 1TFXA 4E05H 3MTYA 1SGNE 1UCYK 1V2KT 1C4V2 4NZQA 2AEIH 1AFQC 1O3NA 1GJ5H 3KCGH 1HXFH 2ZQ2A 1F92A 4NIWA 1VJ9U 2BDHA 3A84A 1GVZA 9LPRA 1Y3WA 1FUJA 4IN2A 1WU1A 1T8MA 2UUYA 4BAMB 1TX8A 4FUDA 1V2ST 1P03A 3PO1C 1C2LA 1LTOA 4K60A 3VGCB 1OWIA 1ZHPA 3ZZBA 4ABIA 4ABJA 3ZV9A 1OS8A 3A83A 4MNWA 1F0UA 3RXFA 3FP7E 3O8DA 2ZPSA 2CF9H 1CBWC 4ZHAA 1TPOA 1JBUH 3MH6A 1CA0C 4NCYA 2BDCA 3FP8E 2WYJA 1XUKA 5J4SA 2HWLB 2H9EH 3TNTA 5T6FA 1GBMA 1ANBA 1MCTA 3RUOA 5TJXA 4D9RA 3ZZ7A 2BQWB 2ZFTA 2BD7A 1C5VA 4A1VA 1OPHB 1P2MA 1YCPH 1P3CA 1C9TA 3SOSA 1BCUH 1TALA 3KIDU 1HJAC 4YOGA 2GV6A 2BVXH 1QBNA 1XVMA 3HGPA 1TMBH 3RXRA 3S69A 1QY6A 2TRMA 3GY4A 4AG1A 1GHAG 4RKOB 3FAOA 3RXQA 4KKDA 1AKSA 2F9VA 1K21H 1WAYB 5GCHG 4GCHG 3LIWA 3V3MA 1M9UA 1NM6A 1RTKA 2A5IA 1MTNB 1KXBA 1O2PA 4IC5A 3V13A 1RIWB 3SU1A 3FZDA 1F5LA 3QGJA 1IQGA 4WWYA 2ZDAH 1MTSA 1ACBE 2FODA 2F9UA 3P92A 3MHWU 3KHVA 1TBQH 3F1SB 3BG4C 2BLQA 2OBQA 1GCDA 5AFYH 1AE8H 1O3GA 1ABJH 3RC4A 5CHAC 3MU8A 3Q76A 4WMDA 4D7FA 4WMFA 1K1NA 1P9SA 2Z9JA 1D3QB 1GJDB 3TJUA 3RMNH 1C5YB 4XBDA 3ZVGA 1TPPA 1TAWA 1Y8TA 4DVAU 5C67A 3SGBE 3LGTA 1FPCH 2Y81A 1K1MA 2B7DH 2SGFE 1F2SE 3M35A 4O9VA 1ZR0A 4IN1A 1WYKA 1PPGE 1V2LT 4AGKA 1O37A 4CBNA 1PYTD 3DFLA 2HPPH 3NWUA 1PPHE 4YT7H 2OC1A 2D2DA 1AZZA 1PPCE 3FP6E 1J17T 1BHXB 1RJXB 3CP7A 1DSUA 3T28A 2BDGA 3STJA 1LO6A 3SV2H 3VXFH 2QF0A 1BMLA 5T6GA 2CXVA 1FY3A 1GJ4H 4NA8A 2AERH 3T5FH 3NUMA 1QGFA 4LOYH 1UVPA 2I6QA 4BXSA 1K1IA 1Y3VA 2QXGA 2PUXB 1L1GA 2V6NA 2J4IA 3SN8A 2FOFA 2VVUA 2C8XB 5DP9A 4H6SB 2OTVA 2VGCC 1J14A 2GT8A 1ZMNA 1GBCA 3P8NA 2TPIZ 2ZHQH 2P94A 1XUHA 1AU8A 1VR1H 2FLRH 2ZFQH 3A81A 1CT2E 1HIAB 5G4BA 4ABFA 1L4DA 4AFUA 1TRNA 4H4FA 1C5XB 1GBIA 1Z1JA 1MD7A 4K69A 3RU4T 3LGUA 1BRAA 3MH7A 1O2VA 4JCNA 1V3XA 1O39A 3SU4A 1T4UH 5A0CA 1OYTH 3OTJE 1ZLRA 4B73A 2YNAA 1D6WA 1P3EA 1C2GA 1V2TT 2XWAA 3ATIA 3SGAE 1ZTLA 1QJ6B 1SQTA 2A32A 2GMTB 3VB6A 1GJBB 2STBE 2OCVB 1NU9A 2BY5X 2A4GA 1C1MA 1NC6A 2KAIA 4NA7A 3PB1E 1ANCA 3RU4D 1P05A 2FOEA 2CHAB 3LPRA 3M5LA 3M5OA 1AB9C 4OS6A 1N8OB 2FX6A 4X6PA 3HK3B 5JBBS 1P02A 1J15A 2GD4B 1E34B 1MU6B 4X8TH 3UPEA 1VITH 5B6OA 1INCA 3A88A 3BF6H 1GMDG 1GBLA 1Y59T 1GBDA 1OP8A 3BEUA 2ZGCA 5EG4A 2AGGX 3UUZA 1TNKA 1S5SA 1F5RA 5H4IB 2Q6DA 3PLBA 4KELA 1O3BA 2G51A 2PGQB 3A8AA 3Q3YA 2BQ6B 5T3HA 4Y6DA 2XCNA 2AYWA 2PGBB 1D3PB 3SU6A 5GCHF 4GCHF 5HM2A 4OGXA 1GG6C 1VITG 3S7KB 5FPTA 1L2EA 3EGKH 4SGAE 3IG6B 5FHTA 3SZNA 1V2QT 1C1OA 1O3CA 3UNRA 4A92A 1ARCA 1ZSKA 1Y5BT 4Y0YE 1AUJA 1KY9A 1O2NA 1NS3A 1V2VT 2JH6D 1TX6A 2AH4X 4WVPE 4I32A 1WUNH 2ZF0H 2ZEBA 3RXUA 4FUGA 2Y5FA 1MAXA 1AFEH 1VCWA 4AB8A 1Z8JB 1EASA 1O3KA 4X8UH 1V2WT 2BZ6H 2VIPA 2XW9A 2UWOA 4MPUA 1GI0A 2ZGJA 1FPHH 4HZHA 1ESBA 1WQSA 1FNIA 2OC0A 1O2OA 1ETTH 4FUJA 3QLPH 1ELVA 4AZ2B 1O3LA 2BY8X 2GZ9A 2ZI2H 1T32A 1RD3B 2HPQH 4MVNA 3QWCH 4ABBA 4KGAA 1SGPE 1HNEE 3CS0A 1W7XH 2Y6TA 3L33A 1A1RA 3D65E 4U32A 2BLVA 3E6PH 4K5ZA 2IJOB 1A0HB 3NK8A 2CMYA 3RMMH 1CHGA 4YZUA 2OXSA 1C1SA 1TYNA 3PWCA 2Y80A 2BM2A 1RS0A 2GZ7A 3W95A 1ZHRA 2NWNA 1Q31A 4YO9A 1LMWB 4ZKSU 2QCYA 2C93B 1O5DH 5AHGH 1GGDC 1P06A 3LKWA 1MKXK 5LPRA 3B8JA 2OC7A 3OU0A 1GMCG 1HV7A 1SFIA 1TRMA 1D6RA 2SNVA 2VIOA 5BPEA 1H9HE 4UFFH 1NFXA 1EATA 1YP9A 2ZZUH 4Q7XA 4K1SA 4LZ1H 3BG8A 2XBWA 1FQ3A 3BTQE 5TCCA 1BMAA 1LQEA 2RDLA 2SGEE 5T6DA 1YPKH 4NWKA 2XBVA 1BMMH 2FMJA 1G30B 3GY2A 2TGTA 2GGVB 1O36A 2QXIA 4HTCH 3T27A 1HYLA 1DANH 1BOQA 1KSNA 3ATWA 1C2KA 1V6DA 1EQ9A 4X1NU 3D23A 5ABWA 3SU5A 4DY7B 4ZROA 3Q3XA 1S83A 2BDBA 1SGRE 1AKSB 2HRVA 3KL6A 1O31A 3ZYEA 2XNIA 1PPBH 1SOZA 3BSQA 1EZQA 1FZZA 1SLXB 1GCTC 2ZTYA 3ZZDA 5FPSA 2J94A 5DP5A 2Y5HA 3SU2A 2JETB 4X6OA 3N7OA 2BY7X 1UO6A 1BA8B 1SVPA 3A87A 2R2MB 1S6HA 4B2CA 2WV4A 4O03A 3TGJE 3U8TH 3A8CA 1L4ZA 1FIZA 2G5VA 1CHOG 4I8HA 2CF8H 3DUXH 1V2JT 1O2RA 2VJ1A 2CGAA 2BD5A 4ZKNU 5DGJA 2ZCHP 3HPTB 3A89A 4XBCA 5LH8A 1FN8A 2ANKH 5JDUB 1IQIA 1GMDF 1PJPA 3ZZ8A 2GZ8A 1SR5C 1W2KH 1D4PB 2G00A 4Y11E 1LVOA 1MTNC 3OYPA 5ESTE 3SQHE 1RIWC 1NPMA 2O8WA 3HATH 1ID5H 1MQ5A 1ZRKA 1GJCB 1O3JA 1E38B 2SFAA 1G3EA 2FYRA 4ZMAH 1GL1A 1A5HA 1O2LA 1YM0A 3MFJA 2BX4A 1VITF 2I6SA 1EJAA 1A2CH 2O8TA 1SGFA 1O2GH 1TIOA 1TLDA 2BD4A 1AMHA 1UK2A 3K65B 3RU4E 3BTME 1G9IE 1AWHB 2P3TB 4Y7AA 4MLFB 3RXTA 1QB1A 4NFEA 5C3NA 3A7ZA 3QTOH 5GIBA 6ESTA 4BAOB 2G5NA 1EZXC 4X2VA 5HXFA 1VGCB 8ESTE 5EODA 1OWHA 1G3BA 3U69H 1EAXA 3FFGA 1BITA 3U1JB 3MO6A 5JB9S 1XVOA 5A8ZA 1SQOA 2BX3A 2VVCA 5DK1A 4ABGA 2G81E 1EPTC 1TQ0B 5L30H 1Z6JH 3ELAH 4ZUHA 1TABE 3LJOA 2WV5A 3SV9A 4UFDH 5E2PA 2UWLA 3DD2H 1FMGA 1LDTT 1B7XB 1PYTC 3BTGE 4BANB 3TJNA 5LPFA 3RLWH 3ZVBA 1J8AA 1BHXF 3BTWE 1MKWH 1O5AB 3AAVA 3O8BA 3Q3KA 1P2KA 1H1BA 1Z6EA 1DWCH 2R0LA 3QN7A 2ZPRA 3TU7H 3U8OH 1IQFA 5C20A 2ILNA 1BTUA 4I8JA 5C5NA 3K9XB 2GV7A 3KEEA 3V12A 3U8RH 1MTWA 2BVRH 3ZVDA 2W5EA 1ELBA 3TLOA 1AQ7A 3KQEA 2ZU2A 3MH5A 1EKBB 1TB6H 2P8OB 1FAKH 2RA3A 4Q7ZA 1EZUC 3SNBA 1F5KU 3RXLA 1WTGH 3TJVA 1P11E 1V2RT 5C5OA 1ZYOA 3PTBA 1GI4A 1GMCF 1CE5A 1GHZA 3MU5A 3PROA 1BTXA 3BEFB 1LKAA 1SPJA 3ZZ6A 1YBWA 1PQ7A 3RXJA 1Q3XA 3SUFA 1S0QA 1LVBA 1UVUH 3GDSA 7GCHG 2BYAX 4XSKU 1GHBG 1P09A 1AVGH 3F9HA 4IC6A 1ZHMA 1YCPK 2C8ZB 2NU0E 1BUIA 1SQAA 5FCKA 1ZJDA 4X8VH 2PKAA 1IHTH 3RXMA 1WV7H 2J38A 2QN5T 1F0TA 4Y8YA 4IS5A 1O2QA 1DUAA 2R2WU 1C2IA 2AS9A 2XC5A 1C5RA 1RTLA 1JOUB 2GCTC 4D8NA 1S0RA 1WQVH 3ATLA 4RN6A 1KTSB 1TGNA 1TGTA 2F91A 2FOGA 1ELGA 1QB9A 1AVWA 1HDTH 2EI8A 3RC5A 4DGJA 2CHAC 1S6FA 1SHYA 1XKAC 1KXDA 1Z8RA 2F3CE 3KQBA 1NRPH 2OINA 1ABIH 1P04A 3M3VA 2WINI 5EGMA 1GWAA 1W12U 1FI8A 1CHOF 2VWMA 3SJ9A 1CU1A 1ZSJA 5HMAA 1Z8IB 4CRAA 1T8NA 5FPYA 3UR6A 2OLGA 1C2FA 4E7NA 2B0FA 1GDQA 2TBSA 3SORA 1BQYA 1YPLH 2A1DB 1ZGVA 1O32A 3CS7A 5EOKA 2BLOA 3B23B 1TWXB 1ETSH 2VU8E 5AVDA 2VIVA 2ANWA 3GCHB 2GVFA 2QA9E 1LHEH 4UDWH 1EJMA 1RXPA 1DSTA 3RXSA 3ZV8A 3M36A 1HAGE 2V3HH 3M7TA 4ZKOU 4ZXYH 7LPRA 1IQEA 1YYY1 1TA2A 4B76A 3S9AA 1ZMJA 4DG4A 1W3CA 2H5CA 1GDNA 2VWNA 2ZFRH 2Z7FE 4UFEH 5JYIA 2GP9B 1BTWA 2BD8A 1LHDH 2FYQA 1TOMH 2EA3A 1C1PA 2GX4A 5FXLA 3HKIB 1GBHA 4O3TA 1QBOA 4X1SU 3BIVH 1FY8E 2GTBA 2Q6GA 3A85A 1SI5H 3P8FA 3LH3A 1MTUA 5DPAA 1LHFH 1MBMA 3EA8A 3ZVAA 1JIMA 3QZRA 4UE7H 2AIQA 1MCVA 2UUKB 3A8BA 4Q80A 5E0JA 1K2I1 2J34A 4YLUA 1IQKA 2AFQB 2FLBH 8GCHG 4IMZA 1NFWA 2P3FH 3RP2A 4MNVA 2BDYA 1GI8B 2PTNA 3MYWA 2QV1A 5L2ZH 3SV6A 5K0HA 3GISB 1O3OA 4GPGA 3VFEA 1O5EH 3UWIA 1ETRH 1UTMA 2O8MA 5BRRE 1GBKA 2ZNKH 4A1TA 2IOTA 2UUFB 2XBYA 1IQMA 5F8XA 1O33A 1UTOA 1DY8A 5FAHA 3T2NA 1XUGA 1TA6A 2M5TA 4KTSA 1GI3A 1Y3YA 2ZHDA 1VJAU 1P12E 2R3UA 1DXWA 1ZTJA 1LHGH 3KQDA 1IQJA 4BTTB 3ODFA 4U01A 1Y3UA 1HFDA 2FESH 1KTTB 5FX6A 1J9CH 1T4VH 2TGDA 3B9FH 1G32B 3JZ2B 3ZVCA 3A7TA 1BBRH 1P0SH 1YPHE 1AN1E 1C1WH 1Y3XA 2H6MA 4K8BA 4ABAA 1NESE 3IITA 2Z3CA 3UOUA 1MTVA 1AO5A 3MNCA 2XYAA 2AGIX 1GDUA 1X7AC 3GOVB 2A7HA 1CSOE 2J2UA 4GAWA 3GY8A 2ZFSA 7GCHF 1PPFE 2FS9A 2H1UA 6CHAB 1GHBF 1KDQA 5EQQA 4ISLA 4RKJB 5CMXH 3ZZ4A 2NU2E 2ZDMA 1TGSZ 3LONA 3RM0H 2A4RA 3MNXA 1D3DB 2FOHA 4TY7A 3SNCA 2ZU3A 2D8WA 3BN9A 3K6YA 1WOFA 1AZ8A 3GY5A 2CN0H 3TK9A 1C9PA 3BTHE 1MMJN 1P2OA 2F9PA 2Z3DA 2SGAA 3MU0A 2ULLA 5I25A 3KF2A 3ZVFA 2ZDVH 4Y7BA 1S82A 4B75A 1JRSA 3DHKH 2QXJA 3T62A 1VCQA 3BV9B 1YPGH 2SGQE 5TCAA 2BVSH 4ZXXH 3P6ZB 2WUBA 1AHTH 1TGCA 1JRTA 2PSXA 4BTIB 1AFQB 1B0EA 3M7QA 1AE5A 2QC2A 4BAQB 1L1JA 1GJ6A 4AG2A 1SGIB 4JZEH 3ATMA 4A5TS 5IDKA 1EZSC 1ORFA 1K22H 1EXFA 3RXEA 1MD8A 1G2MA 1NFUA 2ZWLH 3R0FA 4H6TA 2ALVA 3PO1B 3MO3A 1ZPBA 4KTUA 3TK6A 1H9LB 1EUFA 4B2AA 2WPKS 1NRNH 1DX5M 2A4OA 1W0ZU 4CRCA 3QZQA 5C1XA 1SGCA 1CBWB 2BY9X 2ZKSA 1O3PB 2V35A 1K1PA 4XE4A 2BB4A 3A80A 1BRUP 1CA0B 5EXNA 2B8OH 4WJG2 1KIGH 4X1PU 3KN2A 2JH0D 2PKSC 2GCHF 5JPMH 4FVBA 3PLPA 1GBJA 2FOMB 1KLJH 1O2MA 5AF9H 1O2WA 3FVFB 4NGAH 3E91A 2R3YA 4Y8XA 4Y76A 1TNJA 1C5TA 1O2UA 1O5CB 3M3TA 1OWDA 3ZYDA 3O8CA 1QL8A 2FI5E 1MUEB 3ATKA 4X6MA 1OKXA 1QJ7B 2Q6FA 1BTPA 1DY9A 1BMNH 1AGJA 1O3DA 3HGNA 2J92A 2QGRA 1WSSH 1HJAB 1GBTA 3SU3A 4ISIH 1PPEE 2P3UB 2HNTF 4H42U 4MPWA 2FM2A 2ZHFH 3EYDA 4AORA 1KLTA 1HJ9A 2HOBA 4IW4E 5ETXA 1YPHC 1Z8GA 4Q7YA 1C1UH 2W7SA 2BQ7B 1DWDH 1C4Y2 1HLTH 3TJOA 8GCHF 4Q2KA 3NPSA 3LGYA 4FU7A 3SV7A 3LC3A 4I8LA 2GKVE 4NZLA 1GHWH 1MBQA 3E3TA 3ZZ5A 2ZDNA 4B2BA 1D3TB 3UNQA 3V0XA 4CR9A 2PKAB 5C1YA 5EW1H 2ODQA 2ZDLA 3PV4A 1WBGB 1A4WH 2ZGHA 2UUJB 3I29A 2P8OC 4AGJA 6LPRA 1GHYH 3BG4B 3EA9A 4VGCC 2F9OA 1Y5AT 1FN6A 1DICA 1NN6A 5IYTA 1LCYA 2FWWA 1OOKB 1V2MT 3PMJA 2EEKA 1E35B 2AGEX 4AFQA 1EB1H 4JZ1A 1GJ7B 2C90B 1N6XA 3C27B 2XCFA 4D7GA 2ZFFH 3F68H 4Y71A 5FCRA 4I31A 1TQ7B 2XRCA 4CHAB 1O38A 4JYVH 1O0DH 2Z9GA 2PTCE 3AW0A 3TH4H 4I33A 4WXIA 4UD9H 1TNGA 3PM3A 1GI5A 4J1YA 4UFGH 3MNBA 1Y5UT 5GWZA 1BTZA 4NWLA 5C1UA 2QYIA 2G8TA 1E0FD 1MZAA 1FLEE 1BTYA 1YC0A 2F83A 4FUBA 4NFFA 1CT4E 3MNSA 1OYQA 2UWPA 3RXKA 3VGCC 4X0WU 4NIVA 1YCPM 3JZ1B 2F9NA 1FY1A 1NRQH 1ELTA 3I78A 1HAZB 1Q2WA 3ZZCA 1V2NT 1DT2A 4K8YA 3SW2B 3TPIZ 4BAHB 1EOLA 1W13U 4B74A 5DKMA 1DFPA 5C2ZA 3M61U 1BJVA 2ZU5A 3BTEE 3PMAB 3U98H 3PTNA 4SGBE 3RLYH 1SGFG 1C5PA 1FY5A 2G4TA 2B5TB 1F0RA 1EPTA 2TGPZ 2ZQ1A 1YF4A 2VGCB 5F6MA 4DOQA 4BTUB 2W7UA 2P16A 4K3JA 1A7SA 1UTJA 2C8YB 2QF3A 3D49H 3LGIA 4NSVA 2FTMA 4O3UA 3URDA 2C8WB 4ZKRU 2H5DA 4Z6AH 1UVSH 4BAKB 3S7HB 1UK3A 3GY3A 1P2JA 5HGGA 3UREA 1ZSLA 3UQVA 2BHGA 1C1VH 4LXBH 4AN7A 2C3SA 3U9AH 3AASA 3RXGA 3WY8A 1LHCH 1ZPCA 4AFSA 4DT7B 3VB3A 4ISHH 3PMHB 2VH0A 3I77A 1MKXH 3AAUA 2BTCE 2HVXA 3SNAA 4NA9H 3H7OA 2ZIQH 2OBOA 1KXAA 3MO9A 5A0BA 1YKTA 1U6QA 1JWTA 1EB2A 1DDJA 3P95A 3RMOH 1ELFA 2ZU4A 1F7ZA 1W14U 3SUEA 4RSPA 1HB0B 2ZDKA 5JBCS 5DP6A 3RDZA 1UJ1A 1GI1A 3K2UA 1C1NA 3NZIA 2WYGA 2ZGXH 1GVKB 4A7IB 3SQEE 3ODDA 1TNIA 3EDXB 1OP0A 1QURH 5A09A 4Y8ZA 1NRSH 4ABEA 2XXLA 4GLYA 3LJJA 4INHA 3U1IB 7KMEH 5DJ7A 3P17H 4TWYA 2VWLA 3UR9A 3LDXH 3UWJH 2HLCA 2B9LA 5DO4H 2FX4A 1CVWH 1QL9A 1FAXA 3RXOA 1P2QA 3T26A 3M7UA 1IQHA 1HAVA 1P57B 2G52A 1O3EA 4Y79A 4XDEA 1TNHA 1TPAE 1JXPA 1ZRBA 2ZECA 1FJSA 4JYUH 1W11U 5FBEA 4BNRA 1UMAH 4AOQA 1THSH 1HAYB 1KDQB 1V2PT 5JB8S 1KXEA 1WTHD 1PQ5A 4CH8B 3ZZ3A 2BLWA 4DURA 3S0NA 1C5WB 1QJ1B 2WPMS 1G36A 3OY5U 5E8EH 4FVDA 3TGIE 1BIOA 1KYNA 3GCTF 3A82A 2LNCA 4TPIZ 2J9NA 3LGWA 1OWEA 4WMEA 1DOJA 1L1NA 1DPOA 4Z0KA 2V0BA 2F9BH 1NY22 3PMBB 3QUMP 5EQRA 2DE8A 2VNTA 1C5NH 2WPHS 1ZMLA 1J16A 3NCLA 1FIWA 3SNDA 2R0KA 1Z7KA 5HYOA 3SNEA 1TGBA 4THNH 3SBKA 1A61H 1C2EA 2Z9IA 5EU8A 3S9BA 2H9TH 4XFQA 4U2WA 2A7CA 4JK6A 1HGTH 3MWIU 1GL0E 4I7YH 3RXCA 3SI4H 1G3DA 4ESTE 4TYDA 1SMFE 1C1RA 5GDSH 1O3AA 1OWKA 2YNBA 4X2XA 3DT0H 1ZPZA 4M7GA 2W26A 3PYHA 4FU8A 2A2QH 2IN2A 2R9PA 2BOHB 3RXVA 3QO6A 1GJ8B 4WH8A 3UIRA 2BMGB 4FUCA 4FUIA 5DP3A 1SLWB 4NIXA 2DUCA 1H9IE 1W0YH 3AVZA 1UTPA 1O3FA 4LZ4B 1ELEE 2BD2A 2GMTC 3BEIB 1GGDB 3EQ0H 1O5BB 4CBOA 1AIXH 1O3MA 2YOLA 1C5MD 2HGTH 3IWMA 1QFKH 2O8UA 1N8OC 5EW2H 3GY6A 2BDAA 2WPIS 1SGDE 4TWWA 2ZC9H 3OY6U 2ANYA 1B0FA 2FTLE 2H9HA 1LQDB 4GHTA 1VZQH 2OQ5A 2QIQA 1ANEA 1P2IA 1ELAA 1SGTA 4CRDA 2ZPQA 2W3IA 3RXHA 5GPIB 4KTCA 1UTQA 1HAOH 1PQAA 1T8OA 1K1JA 1FDPA 2FEQH 1RGQA 1SFQB 4LK4A 1QA0A 2QXHA 1B5GH 1K9OE 4INKA 3QK1A 1IQNA 4YOIA 5PTPA 2XWBI 3LH1A 5K7RA 2VB0A 1GCTB 3QTVH 2RG3A 2ZTZA 3K6ZA 3M3SA 4NSYA 1HUTH 1C1QA 1CGIE 2LPRA 2NU4E 3UNSA 1D9IA 1YLDA 1QRZA 1UCYH 1GI7B 2VVVA 1QRWA 2GCHG 4OS5A 2THFB 4ZHLU 2FS8A 1G2LA 1C2JA 1GMHF 4FXGH 1THRH 1JMOH 1SLUB 3DA9B 3HKJB 3E0NB 1QNJA 1O2YA 3KNXA 1PPZA 1AWFH 1C5OH 1C5SA 1NO9H 4JZDH 2Z3EA 3Q00A 3E1XB 1ESTA 2FDAA 1CQQA 3ITIA 3QX5H 3S9CA 5EQSA 3LC5A 4A1XA 4A6LA 1BBRK 4HFPB 4WXVA 1HBTH 1A0JA 3F9FA 1AI8H 1C2HA 5I46H 1XUJA 1NU7B 3MOCA 1LPKB 2AMDA 3OX7U 1O2ZA 3P8GA 3O8RA 3SO3A 3BTDE 4YLQH 3GYMA 1O3IA 3Q77A 1TMTH 4JK5A 1O5GH 3T29A 5GJ4B 4AB9A 1DS2E 3H7TA 3SU0A 2A0QB 1GPZA 1OXGA 1SOTA 3TH2H 1ZOMA 4NG9H 1C1TA 1W7GH 2PUQH 1DLKB 1GJ9B 4R8TB 4U30A 1S85A 2SNWA 3ZZ9A 4CHAC 2H2ZA 1UCYE 2HNTE 2O9QA 3BTTE 1GBBA 3SHCH 1HAXB 1H4WA 1AVXA 2BY6X 5HM9A 1YPEH 1SGQE 1NTPA 3SV8A 1EPTB 3MI4A 4JZIA 3PLKA 1BTHH 1CO7E 3RM2H 1CT0E 1Z1IA 6GCHF 1HAIH 1O2JA 2FZZA 3MU1A 1P10A 3A8DA 2FO9A 4CR5A 4FUHA 4OS7A 3UTUH 1SHHB 1HAPH 3VB5A 1K1LA 1G37A 1EAUA 5JBTA 2EI7A 1S81A 3PWBA 1QL7A 1WCZA 1E36B 2ODPA 2VINA 2IPHA 1E37B 1RRKA 4KP0A 4MG3A 1SSXA 1TRYA 1KLIH 3KQCA 5A8YA 2Z94A 4MPVA 1FONA 1GJAB 2P59A 1NFYA 2V3OH 3UY9A 1Z71A 2VIQA 2JETC 3GY7A 4IBLH 3VB7A 4QT8C 1P9UA 2J95A 1ZJKA 3V7TA 2SGDE 1IOEA 2BD3A 4GVUA 1P01A 1XX9A 3GYLB 2A5AA 4JMYA 4YTAA 3C1KA 1A3BH 2JH5D 2Y7XA 2GDDA 5CE1A 1ZZZA 3A7WA 1C2DA 1NZQH 4FU9A 2BDIA 3RXDA 1HPGA 1YPJH 2PR3A 4Y10E 1S84A 3OSYA 4O97A 2ZA5A 3F9EA 3QGNB 3LT3A 1BB0B 1DUEA 3H5CB 1KXCA 2NU3E 1JIRA 1A5IA 4CRFA 1OSSA 2TIOA 1TBRH 1SC8U 4OS2A 1C5ZB 1DWBH 1UHBA 4X6NA 4BXWA 1C4U2 2D1JA 4OGYA 1BRBE 2NU1E 1HRTH 4OS4A 1BBRE
chains in the Genus database with same CATH superfamily
5ESBA 2GCTB 1FV9A 1LPZB 1XXDA 2P93A 1HAVB 4F49A 3R3GB 4DW2U 5EPYA 1UVOA 1LKBA 4ZH8A 5EPNA 1O2KA 2ZG0H 1GBAA 1W10U 3SGQE 2ASUB 2VIDA 3GDUA 1K1OA 2Q1JA 3F2GA 2FOAA 3MH4A 5E0GA 2ZFPH 1IQLA 1QIXB 2ESTE 4GSOA 1GI9B 4AYVB 3TNSA 3FZZA 1VGCC 2CJIA 1TOCB 1XMNB 1QBVH 2F43B 4ZAEA 1OHHD 2V3MA 1ELCA 1G3CA 4MDSA 2K0QA 1KXFA 4XRNA 5DP8A 5F8TA 4TY6A 1A0LA 2Y5GA 4JZFH 2HNTC 1GHAF 2FPZA 4INLA 3GDVA 3CENA 4MNYA 1W8BH 1CA8B 4MPXA 2A45B 1THPB 1P2NA 4XBBA 3ZZAA 1ELDE 3DFJA 1O2HA 4X2YA 3L6PA 3UFAA 2OC8A 3URCA 4CRBA 1BRCE 2XC0A 3F2HA 4MTBA 5LPEA 1RTFB 2WPLS 3P8OA 2VWOA 1MU8B 3STIA 2ANMH 1BT7A 1QR3E 1NRRH 3RXAA 2C4FH 1NT1A 2PHBA 4YM9A 3VG8A 1AD8H 1FY4A 2ZCKP 2Z9KA 3TK5A 4J2YB 2SGPE 2PWXA 1UVTH 3BTFE 2Y7ZA 1QTFA 1N1LA 2A31A 2BXUH 3GCTG 1A46H 1S6LA 3AW1A 3TIUA 4HG6A 1LPGB 4WY3A 5CHAB 1SGEE 1GHXH 3KGPA 3D62A 1HXEH 3TH3H 5EXLA 2Z6BD 3SJOA 3F6UH 2Y82A 2OK5A 1PFXC 3LGVA 4BOHA 2HALA 1QRXA 3FOAA 1UTKA 3TVJB 1EP6A 4YESB 3SI3H 1O3HA 3E90B 3E0PB 2L6OA 4DJZB 1DWEH 4K1EA 1GI6A 4IGDA 3GCNA 1GBFA 2ODYB 1SBWA 4D9QA 2GT7A 3BTKE 2ZHEH 5FBIA 1IHSH 2XTTB 4ISNA 1O2SA 2XC4A 3NKKA 1N6YA 3LOXA 1O35A 4ISOA 5FX5A 1RFNA 5A8XA 4D76A 4DCDA 4HGCA 4FUEA 2PFEA 3FKSD 1SG8B 2ZCLP 2WPJS 3OE7D 5E0HA 4X1QU 1QQUA 1W0KD 1ZTKA 3ESTA 5EJLA 3VEQB 2GDEH 3U28C 1DITH 2FP7B 4I8KA 3RXIA 1GI2A 2EC9H 4HI3A 2GJGA 1BJUA 1XM1A 3M5NA 1H8DH 1T31A 4Y0ZE 1QQ4A 1V2UT 1YWUA 3LU9B 4PROA 2AMPA 1O5FH 4X2WA 3A7YA 2BXTH 3L3TA 4K1TA 4ZCNA 2OUAA 2STAE 5GXPA 1EAWA 1TX7A 2ZGBH 1EAIA 1O34A 1O2TA 1V2OT 1MZDA 2BOKA 4UONA 5J4QA 2WUCA 2ZTXA 4AX9H 1OX1A 3E8LA 3ZVEA 1TNLA 1QA7A 1EJNA 3EA7A 5L6NH 4ZHMU 1C5QA 1HJ8A 1SB1H 3G01A 1QCPA 2QY0B 5EXMA 4GUXA 5AFZH 4YT6H 3NXPA 2O8LA 2A2XH 3SUGA 7ESTE 3GCHC 1YPMH 5DG6A 3GICB 1CGJE 2JKHA 1EX3A 2VH6A 1UTNA 2J98A 3EE0B 3AK5A 1XUFA 3RXBA 1C5LH 5E2OA 2OD3B 1ESAA 2FIRH 3A7XA 2P95A 1O2IA 4ASHA 3P70B 1EP5A 2FI3E 3M37A 4NIYA 5F03A 1K0HA 4OS1A 4MNXA 3DCLA 1ANDA 2ZHWH 4AYYB 3OFND 2CV3A 1P8VC 3HK6B 1BDAA 4DT4A 2QF4A 2VBCA 4DIIH 1MKWK 1T7CA 2A7JA 2Z9LA 3NRLA 1HIAA 3A7VA 4ABHA 1TPSA 1GMHG 3VPKA 3F9GA 5EIYA 2A4QA 4I8GA 3GS9A 8KME2 1AY6H 4X8SH 1AB9B 4ABDA 1MQ6A 3W94A 2PLXA 2EI6A 3VB4A 1WXRA 2RA0A 1DVAH 2FOBA 1BZXE 2PW8H 2ZU1A 2VIWA 1QB6A 1MAYA 2YMSB 9ESTA 1CGHA 5DP7A 4MQAA 2D26C 1GBEA 1QHRB 4OM9A 1YGCH 2OQUA 4CH2B 4X1RU 1UK4A 4GHQA 1ARBA 3ENSB 3FANA 1SGYE 1SLVB 1A5GH 1TE0A 3SHAH 1PQ8A 2FI4E 1XKBC 1TBZH 1C2MA 2ZO3H 3BIUH 4UEHH 3UOPA 2PKSB 2G4UA 1C5UA 4WF8A 3SJ8A 4IMQA 3SJKA 1E1QD 1GG6B 3RC6A 3A86A 4YOJA 3T25A 4WH6A 5SGAE 5LGOA 1HCGA 2G55A 2QE7D 3SJIA 1TMUH 4XOJA 4R0IA 2A5KA 1TONA 3RMLH 3MU4A 2K1QA 4DIHH 1OP2A 3GCOA 2AHME 2QAAA 4FUFA 1LVYA 3QDZB 3SUDA 1AUTC 1K28D 5DP4A 3PRDA 2WSSD 3TGKE 1DLEA 2PSYA 1GVLA 4F4OC 1T8LA 3RXPA 1UTLM 5GNDA 4CREA 4E06H 1MH0A 2XBXA 8LPRA 1O30A 2W3KA 5JBAS 1LVMA 1DM4B 3N7EA 1A3EH 3VXEH 6GCHG 1GHVH 2FXRA 1OWJA 3TITA 4JYTA 1EOJA 6CHAC 4B1TA 1L0ZA 2AMQA 2BZAA 1F0SA 1YLCA 1FXYA 5L2YH 2RCEA 1O2XA 1VCPA 1H8IH 1UW7A 3M5MA 5KGOA 4E7RG 3UQOA 1UHBB 2BD9A 2AIPA 4AFZA 5F8ZA 2FOCA 1NROH 2W6ID 1DXPA 3EAJA 4B71A 1XUIA 4VGCB 1SL3A 1HAHH 1IAUA 5A2MH 1ZGIA 3E16B 4CRGA 2ZP0H 2PV9B 2KAIB 3MMGA 2ALPA 4TPYA 5A0AE 2OP9A 1DE7H 1XXFA 2DE9A 4K2YA 2TGAA 1TFXA 4E05H 3MTYA 1SGNE 1UCYK 1V2KT 1C4V2 4NZQA 2AEIH 1AFQC 1O3NA 1GJ5H 3KCGH 1HXFH 2ZQ2A 5EJZA 1F92A 4NIWA 3F3BA 1VJ9U 2BDHA 3A84A 1GVZA 9LPRA 1Y3WA 1FUJA 4IN2A 1WU1A 1T8MA 2UUYA 4BAMB 1TX8A 4FUDA 1V2ST 1P03A 3PO1C 1C2LA 1LTOA 4K60A 3VGCB 1OWIA 1ZHPA 3ZZBA 4ABIA 4ABJA 3ZV9A 1OS8A 3A83A 4MNWA 1F0UA 3RXFA 3FP7E 3O8DA 2ZPSA 2CF9H 1CBWC 4ZHAA 1TPOA 1JBUH 3MH6A 1CA0C 4NCYA 2BDCA 3FP8E 2WYJA 1XUKA 5J4SA 2HWLB 2H9EH 4Q63A 3TNTA 5T6FA 1GBMA 1ANBA 1MCTA 3RUOA 5FL7D 5TJXA 4D9RA 3ZZ7A 2BQWB 2ZFTA 2BD7A 1C5VA 4A1VA 1OPHB 1P2MA 4FOUC 1YCPH 1P3CA 1C9TA 3SOSA 1BCUH 1TALA 3KIDU 1HJAC 4YOGA 2GV6A 2LELA 2BVXH 1QBNA 1XVMA 3HGPA 1TMBH 3RXRA 3S69A 1QY6A 2TRMA 3GY4A 4AG1A 1GHAG 4RKOB 3FAOA 3RXQA 4KKDA 1AKSA 2F9VA 1K21H 1WAYB 5GCHG 4GCHG 3LIWA 3V3MA 1M9UA 1NM6A 1RTKA 2A5IA 1MTNB 1KXBA 1O2PA 4IC5A 3V13A 1RIWB 3SU1A 3FZDA 1F5LA 3QGJA 1IQGA 4WWYA 2ZDAH 1MTSA 1ACBE 2FODA 2F9UA 3P92A 3MHWU 5F53A 3KHVA 1TBQH 3F1SB 3BG4C 2BLQA 2OBQA 1GCDA 3KQ5A 3KYFA 5AFYH 1AE8H 1O3GA 1ABJH 3RC4A 5CHAC 3MU8A 3Q76A 4WMDA 4D7FA 4WMFA 1K1NA 1P9SA 2Z9JA 1D3QB 1GJDB 3TJUA 3RMNH 1C5YB 4XBDA 3ZVGA 1TPPA 1TAWA 1Y8TA 4DVAU 5C67A 3SGBE 3LGTA 1FPCH 2Y81A 1K1MA 2B7DH 2SGFE 1F2SE 3M35A 4O9VA 1ZR0A 4IN1A 1WYKA 1PPGE 1V2LT 4AGKA 1O37A 4CBNA 1PYTD 3DFLA 1E79D 2HPPH 3NWUA 1PPHE 4YT7H 2OC1A 2D2DA 1AZZA 1PPCE 3FP6E 1J17T 1BHXB 1RJXB 3CP7A 1DSUA 3T28A 2BDGA 2CK3D 3STJA 1LO6A 3SV2H 3VXFH 2QF0A 1BMLA 5T6GA 2CXVA 1FY3A 2KCAA 1GJ4H 4NA8A 2AERH 3T5FH 3NUMA 1QGFA 4LOYH 2IJD1 2J98B 1UVPA 2I6QA 4BXSA 1K1IA 1Y3VA 2QXGA 2PUXB 3OTPA 1L1GA 2V6NA 2J4IA 3SN8A 2FOFA 2VVUA 2C8XB 5DP9A 4H6SB 2OTVA 2VGCC 1J14A 2GT8A 1ZMNA 1GBCA 3P8NA 2TPIZ 2ZHQH 2P94A 1XUHA 1AU8A 1VR1H 2FLRH 2ZFQH 3A81A 1CT2E 1HIAB 5G4BA 4ABFA 1L4DA 4AFUA 1TRNA 4H4FA 1C5XB 1GBIA 3DSGA 1Z1JA 1MD7A 4K69A 3RU4T 3LGUA 1BRAA 3MH7A 1O2VA 4JCNA 1V3XA 1O39A 3SU4A 1T4UH 2PP6A 5A0CA 1OYTH 3OTJE 1ZLRA 4B73A 2YNAA 1D6WA 1P3EA 1C2GA 1V2TT 2XWAA 3ATIA 3SGAE 1ZTLA 1QJ6B 1SQTA 2A32A 2GMTB 3VB6A 1GJBB 2STBE 2OCVB 1NU9A 2BY5X 3WW7A 2A4GA 1C1MA 1NC6A 2KAIA 4NA7A 3PB1E 1ANCA 3RU4D 1P05A 2FOEA 2CHAB 3LPRA 3M5LA 3M5OA 1AB9C 4OS6A 1N8OB 2FX6A 4X6PA 3HK3B 5JBBS 1P02A 1J15A 2GD4B 1E34B 1MU6B 4X8TH 3UPEA 1VITH 5B6OA 1INCA 3A88A 3BF6H 1GMDG 1GBLA 1Y59T 1GBDA 1OP8A 3BEUA 2ZGCA 5EG4A 2AGGX 3UUZA 1TNKA 1S5SA 1F5RA 5H4IB 2Q6DA 3PLBA 2IPQX 4KELA 1O3BA 2G51A 2PGQB 3A8AA 3Q3YA 2BQ6B 4ACAA 5T3HA 4Y6DA 2XCNA 2AYWA 2PGBB 1D3PB 3SU6A 5GCHF 4GCHF 5HM2A 4OGXA 1GG6C 1VITG 3S7KB 5FPTA 1L2EA 3EGKH 4SGAE 3IG6B 5FHTA 3SZNA 1V2QT 1C1OA 1O3CA 3UNRA 4A92A 1ARCA 1ZSKA 1Y5BT 4Y0YE 1AUJA 1KY9A 1O2NA 1NS3A 1V2VT 2JH6D 1TX6A 2AH4X 4WVPE 4I32A 1WUNH 2ZF0H 2ZEBA 3RXUA 3FO8D 4FUGA 2Y5FA 1MAXA 1AFEH 1VCWA 4AB8A 1Z8JB 1EASA 1O3KA 4X8UH 1V2WT 2BZ6H 2VIPA 2XW9A 2UWOA 4MPUA 1GI0A 2ZGJA 1FPHH 4HZHA 1ESBA 1WQSA 1FNIA 2OC0A 3UB0A 1O2OA 1ETTH 4FUJA 3QLPH 1ELVA 4AZ2B 1O3LA 2BY8X 2GZ9A 2ZI2H 1T32A 1RD3B 2HPQH 4MVNA 3QWCH 4ABBA 2WPDD 4RI0A 4KGAA 1SGPE 1HNEE 3CS0A 2EQNA 1W7XH 2Y6TA 3L33A 1A1RA 3D65E 4U32A 2BLVA 3E6PH 4K5ZA 2IJOB 1A0HB 3NK8A 2CMYA 3RMMH 1CHGA 4YZUA 2OXSA 1C1SA 3PWCA 2Y80A 1VKYA 2BM2A 1RS0A 2GZ7A 3W95A 1ZHRA 2NWNA 1Q31A 4YO9A 1LMWB 4ZKSU 2M2AA 2QCYA 2C93B 1O5DH 5AHGH 1GGDC 1P06A 3LKWA 1MKXK 5LPRA 3B8JA 2OC7A 5HIYA 3OU0A 1GMCG 1HV7A 1SFIA 1TRMA 1D6RA 2SNVA 2VIOA 5BPEA 1H9HE 4UFFH 1NFXA 1EATA 1YP9A 2ZZUH 4Q7XA 4K1SA 4LZ1H 3BG8A 2XBWA 1FQ3A 3BTQE 5TCCA 1BMAA 1LQEA 2RDLA 2SGEE 5T6DA 1YPKH 4NWKA 2XBVA 1BMMH 2FMJA 1G30B 3GY2A 2TGTA 2GGVB 2EY4C 1O36A 2QXIA 4HTCH 3T27A 1HYLA 1DANH 1BOQA 1KSNA 3ATWA 1C2KA 1V6DA 1EQ9A 2KCOA 4X1NU 3D23A 5ABWA 3SU5A 4DY7B 4ZROA 3Q3XA 1S83A 2BDBA 2NU1E 1SGRE 1AKSB 2HRVA 3KL6A 1O31A 3ZYEA 2XNIA 1PPBH 1SOZA 3BSQA 1EZQA 1FZZA 1SLXB 1GCTC 2ZTYA 3ZZDA 5FPSA 2J94A 5DP5A 2Y5HA 3SU2A 2JETB 4X6OA 3N7OA 2BY7X 1UO6A 1BA8B 1SVPA 3A87A 2R2MB 1S6HA 4B2CA 2WV4A 4O03A 3TGJE 3U8TH 3A8CA 1L4ZA 1FIZA 2G5VA 1CHOG 4I8HA 2CF8H 3DUXH 1V2JT 1O2RA 2VJ1A 2CGAA 2BD5A 3H09A 4ZKNU 5DGJA 2ZCHP 3HPTB 3A89A 4XBCA 5LH8A 1FN8A 2ANKH 5JDUB 3PV5A 1IQIA 1GMDF 1PJPA 3ZZ8A 2GZ8A 2QF5A 4F55A 1SR5C 1W2KH 1D4PB 2YMSD 2G00A 4Y11E 1LVOA 1MTNC 3OYPA 5ESTE 3SQHE 1RIWC 1NPMA 2O8WA 3HATH 1ID5H 1MQ5A 1ZRKA 1GJCB 1O3JA 2WHXA 1E38B 2SFAA 1G3EA 2FYRA 4ZMAH 1GL1A 2KR7A 1A5HA 1O2LA 1YM0A 5DSFA 3MFJA 2BX4A 1VITF 2I6SA 1EJAA 1A2CH 2O8TA 1SGFA 1O2GH 1TIOA 1TLDA 2BD4A 1AMHA 1UK2A 3K65B 5CDFE 3RU4E 3BTME 1G9IE 1AWHB 2P3TB 4Y7AA 4MLFB 3RXTA 1QB1A 4NFEA 5C3NA 3A7ZA 3QTOH 5GIBA 6ESTA 4BAOB 2G5NA 1EZXC 4X2VA 5HXFA 1VGCB 8ESTE 5DN6D 1QZ8A 5EODA 1OWHA 1G3BA 3SZEA 3U69H 1EAXA 3FFGA 1BITA 3U1JB 4TT3D 3MO6A 5JB9S 1XVOA 5A8ZA 1SQOA 2BX3A 2VVCA 5DK1A 4ABGA 2G81E 1EPTC 1TQ0B 5L30H 1Z6JH 3ELAH 4ZUHA 1TABE 3LJOA 2WV5A 3SV9A 4UFDH 5E2PA 2UWLA 3DD2H 3MQKC 1H8ED 1FMGA 1LDTT 1B7XB 1PYTC 3BTGE 4BANB 3TJNA 5LPFA 3RLWH 3ZVBA 1J8AA 1BHXF 3BTWE 1MKWH 1O5AB 3AAVA 3O8BA 3Q3KA 1P2KA 1H1BA 1Z6EA 1DWCH 2R0LA 3QN7A 2ZPRA 3TU7H 4I86A 1IQFA 3U8OH 5C20A 2ILNA 1BTUA 4I8JA 5C5NA 3K9XB 2GV7A 3KEEA 3V12A 3U8RH 1MTWA 2BVRH 3ZVDA 2W5EA 1ELBA 3TLOA 1AQ7A 3KQEA 2ZU2A 3MH5A 1EKBB 1TB6H 4XD7D 5C0TA 2P8OB 1FAKH 2RA3A 4Q7ZA 1EZUC 3SNBA 1F5KU 3RXLA 1WTGH 3TJVA 1P11E 1V2RT 5C5OA 1ZYOA 3PTBA 1GI4A 1GMCF 1CE5A 1GHZA 3MU5A 3PROA 1BTXA 3BEFB 1LKAA 1SPJA 3ZZ6A 1YBWA 1PQ7A 3RXJA 1Q3XA 3SUFA 1S0QA 1LVBA 1UVUH 3GDSA 7GCHG 2BYAX 4XSKU 1GHBG 1P09A 1AVGH 3F9HA 4IC6A 1ZHMA 1YCPK 2C8ZB 2NU0E 1BUIA 1SQAA 5FCKA 1ZJDA 4X8VH 2PKAA 1IHTH 3RXMA 1WV7H 2J38A 2QN5T 1F0TA 4Y8YA 4IS5A 1O2QA 1DUAA 2R2WU 1C2IA 2AS9A 5KECA 2XC5A 1C5RA 1RTLA 1JOUB 2GCTC 4D8NA 1S0RA 1WQVH 3ATLA 4RN6A 1KTSB 1TGNA 1TGTA 2F91A 2FOGA 1ELGA 1QB9A 1AVWA 1HDTH 2EI8A 3RC5A 4DGJA 2CHAC 1S6FA 1SHYA 1XKAC 1KXDA 1Z8RA 2F3CE 3KQBA 1NRPH 2OINA 1ABIH 1P04A 3M3VA 2WINI 5EGMA 1GWAA 1W12U 1FI8A 1CHOF 2VWMA 3SJ9A 1CU1A 1ZSJA 5HMAA 3SYJA 4ASUD 1Z8IB 4CRAA 1T8NA 5FPYA 3UR6A 2OLGA 1C2FA 4E7NA 2B0FA 1GDQA 2TBSA 3SORA 1BQYA 1YPLH 2A1DB 1ZGVA 1O32A 3CS7A 5EOKA 2BLOA 3B23B 1TWXB 1ETSH 2VU8E 5AVDA 2VIVA 2ANWA 3GCHB 4AC9A 2GVFA 2QA9E 1LHEH 4UDWH 1EJMA 1RXPA 3ZIAD 1DSTA 3RXSA 2XNDD 3ZV8A 1EFRD 1HAGE 2V3HH 3M36A 3M7TA 4ZKOU 4ZXYH 7LPRA 1IQEA 1YYY1 1TA2A 5B6LA 4B76A 3S9AA 1ZMJA 4DG4A 1W3CA 2H5CA 1GDNA 2VWNA 2ZFRH 2Z7FE 4UFEH 5JYIA 2GP9B 1BTWA 2BD8A 1LHDH 2FYQA 1TOMH 2EA3A 1C1PA 2GX4A 5FXLA 3HKIB 1GBHA 4O3TA 1QBOA 4X1SU 3BIVH 1FY8E 2GTBA 2Q6GA 3A85A 1SI5H 3WWBA 3P8FA 3LH3A 1FX0B 1MTUA 5DPAA 3W1EA 1LHFH 1MBMA 3EA8A 3ZVAA 4B6FA 1JIMA 3QZRA 3F0OA 4UE7H 2AIQA 1MCVA 2UUKB 3A8BA 4Q80A 1MABB 1K2I1 2J5UA 5E0JA 2J34A 1KMHB 2JJ1D 3FN8A 4YLUA 1IQKA 2AFQB 2FLBH 8GCHG 4IMZA 1NFWA 2KZ4A 2P3FH 3RP2A 4MNVA 2BDYA 1GI8B 2PTNA 3MYWA 2QV1A 5L2ZH 3SV6A 5K0HA 3GISB 1O3OA 4GPGA 3PRBA 3VFEA 3CNRA 1O5EH 1E1RD 3UWIA 1ETRH 1UTMA 2O8MA 5BRRE 1GBKA 2ZNKH 4A1TA 2IOTA 2UUFB 2XBYA 1IQMA 5F8XA 1O33A 1UTOA 1DY8A 5FAHA 3T2NA 1XUGA 1TA6A 2M5TA 4KTSA 1GI3A 1Y3YA 2ZHDA 1VJAU 1P12E 2R3UA 1DXWA 1ZTJA 1LHGH 3KQDA 1IQJA 4BTTB 3ODFA 4U01A 1Y3UA 1HFDA 2FESH 1KTTB 5FX6A 1J9CH 1T4VH 2TGDA 3B9FH 1G32B 3JZ2B 3ZVCA 3A7TA 1BBRH 1P0SH 1YPHE 1AN1E 1C1WH 1Y3XA 2H6MA 4K8BA 4ABAA 1NESE 3IITA 2Z3CA 3UOUA 1MTVA 1AO5A 3MNCA 2XYAA 2AGIX 1GDUA 1X7AC 3GOVB 2A7HA 1CSOE 2J2UA 4GAWA 3GY8A 2ZFSA 7GCHF 1PPFE 2FS9A 2H1UA 6CHAB 1GHBF 1KDQA 5EQQA 4ISLA 4RKJB 5CMXH 3ZZ4A 2NU2E 2ZDMA 1TGSZ 3LONA 3RM0H 2A4RA 3MNXA 1D3DB 2FOHA 4TY7A 3SNCA 2ZU3A 2D8WA 2KCYA 3BN9A 3K6YA 1WOFA 1AZ8A 3GY5A 2CN0H 3TK9A 1C9PA 3BTHE 1MMJN 1P2OA 2F9PA 2Z3DA 2SGAA 3MU0A 2ULLA 5I25A 3KF2A 3ZVFA 2ZDVH 4Y7BA 1S82A 4B75A 1JRSA 5IK2D 3DHKH 2QXJA 3T62A 1VCQA 2J97A 3BV9B 4FETA 1YPGH 2SGQE 5TCAA 2BVSH 4ZXXH 3P6ZB 2WUBA 1AHTH 1TGCA 4YXWD 1JRTA 2PSXA 4BTIB 1AFQB 1B0EA 3M7QA 1AE5A 2QC2A 4BAQB 1L1JA 1GJ6A 4AG2A 1SGIB 4JZEH 3ATMA 4A5TS 5IDKA 1EZSC 1ORFA 1K22H 1EXFA 3RXEA 1MD8A 1G2MA 1NFUA 2ZWLH 3R0FA 4H6TA 2ALVA 3PO1B 2YMSC 3MO3A 1ZPBA 4KTUA 3TK6A 1H9LB 3UAIC 1EUFA 4B2AA 2WPKS 2L74A 1NRNH 1DX5M 2A4OA 1W0ZU 4CRCA 3QZQA 5C1XA 1SGCA 1CBWB 2BY9X 2ZKSA 1O3PB 2V35A 1K1PA 4XE4A 2BB4A 3A80A 1BRUP 1CA0B 5EXNA 2B8OH 4WJG2 1KIGH 4X1PU 3KN2A 2JH0D 2PKSC 2GCHF 5JPMH 4FVBA 3PLPA 1GBJA 2FOMB 1KLJH 1O2MA 5AF9H 1O2WA 3FVFB 4NGAH 3E91A 2R3YA 4Y8XA 4Y76A 1TNJA 1C5TA 1O2UA 1O5CB 3M3TA 1OWDA 3ZYDA 2JIZD 1QL8A 3O8CA 2FI5E 1MUEB 2RDEA 3ATKA 4X6MA 1OKXA 1QJ7B 2Q6FA 2RFKC 1BTPA 1DY9A 1BMNH 1AGJA 1O3DA 2JJ2D 3HGNA 2J92A 2QGRA 1WSSH 1HJAB 1GBTA 3SU3A 4ISIH 1PPEE 2P3UB 2HNTF 4H42U 4MPWA 2FM2A 2ZHFH 3EYDA 4AORA 1KLTA 1HJ9A 2HOBA 4IW4E 5ETXA 1YPHC 1Z8GA 4Q7YA 1C1UH 2W7SA 2BQ7B 1DWDH 1C4Y2 1HLTH 3TJOA 5CHBA 2K8IA 8GCHF 4Q2KA 3NPSA 3LGYA 4FU7A 3SV7A 2W6JD 4RT0A 3LC3A 4I8LA 2GKVE 4NZLA 1GHWH 2HLDD 5EJ1A 1MBQA 3E3TA 3ZZ5A 2ZDNA 4B2BA 1D3TB 3UNQA 3V0XA 4CR9A 2PKAB 5C1YA 5EW1H 2ODQA 2ZDLA 3PV4A 1WBGB 1A4WH 2ZGHA 2UUJB 3I29A 2P8OC 4AGJA 6LPRA 1GHYH 3BG4B 3EA9A 4VGCC 2F9OA 1Y5AT 1FN6A 3OAAD 1DICA 1NN6A 5IYTA 1LCYA 2FWWA 1OOKB 1V2MT 3PMJA 2EEKA 1E35B 2AGEX 4AFQA 1EB1H 4JZ1A 1GJ7B 2C90B 1N6XA 3C27B 2XCFA 1YY3A 4D7GA 2ZFFH 3F68H 3OEHD 4Y71A 5FCRA 4I31A 1TQ7B 2XRCA 4CHAB 1O38A 4JYVH 1O0DH 2Z9GA 2PTCE 3AW0A 3TH4H 4I33A 4WXIA 4UD9H 1TNGA 1WDIA 3PM3A 1GI5A 4J1YA 4UFGH 3MNBA 1Y5UT 5GWZA 1BTZA 4NWLA 5C1UA 2QYIA 2G8TA 1E0FD 1MZAA 1FLEE 1BTYA 3KYGA 1YC0A 2F83A 4FUBA 4NFFA 1CT4E 3MNSA 1OYQA 2UWPA 3RXKA 3VGCC 4X0WU 4NIVA 1YCPM 3JZ1B 2F9NA 1FY1A 1NRQH 1ELTA 3I78A 1HAZB 1Q2WA 4M9FA 3ZZCA 1V2NT 1DT2A 3OEED 4K8YA 3SW2B 3TPIZ 4BAHB 1EOLA 1W13U 4B74A 5DKMA 1DFPA 5C2ZA 3M61U 1BJVA 2ZU5A 3BTEE 3PMAB 3U98H 3PTNA 4SGBE 3RLYH 1SGFG 1C5PA 1FY5A 2G4TA 2B5TB 1F0RA 1EPTA 2TGPZ 2ZQ1A 1YF4A 2VGCB 5F6MA 4DOQA 4BTUB 2W7UA 2P16A 4K3JA 1A7SA 1UTJA 2C8YB 2QF3A 3D49H 3LGIA 4NSVA 2FTMA 4O3UA 3URDA 2C8WB 4ZKRU 2H5DA 4Z6AH 1UVSH 4BAKB 3S7HB 1UK3A 3GY3A 1P2JA 5HGGA 3UREA 1ZSLA 3UQVA 2BHGA 1C1VH 4LXBH 4AN7A 2C3SA 3U9AH 3AASA 3RXGA 3WY8A 1LHCH 1ZPCA 4AFSA 4DT7B 5C94A 3VB3A 4ISHH 3PMHB 2VH0A 3I77A 1H8HD 1MKXH 2F4LA 2BTCE 3AAUA 2HVXA 3SNAA 4NA9H 3H7OA 2ZIQH 2OBOA 1KXAA 3MO9A 5A0BA 1YKTA 1U6QA 1JWTA 3DSOA 1EB2A 1DDJA 3P95A 3RMOH 1ELFA 2ZU4A 1F7ZA 1W14U 3SUEA 4RSPA 1HB0B 2ZDKA 5JBCS 5DP6A 3RDZA 1UJ1A 1GI1A 3K2UA 1C1NA 3NZIA 2WYGA 2ZGXH 1GVKB 4A7IB 3SQEE 3ODDA 5HIZA 1TNIA 3EDXB 1OP0A 3DSPA 1QURH 5A09A 4Y8ZA 1NRSH 4ABEA 2XXLA 4GLYA 3LJJA 4INHA 3U1IB 7KMEH 5DJ7A 3P17H 1YLNA 4TWYA 2VWLA 3UR9A 3LDXH 3UWJH 2HLCA 2B9LA 5DO4H 2FX4A 3WWFA 1CVWH 1QL9A 1FAXA 3RXOA 1P2QA 3T26A 3M7UA 1IQHA 2XOKD 1HAVA 1P57B 2G52A 1O3EA 4Y79A 4XDEA 1TNHA 1TPAE 2V7QD 1JXPA 1ZRBA 2ZECA 1FJSA 4JYUH 1W11U 5FBEA 4BNRA 1UMAH 3PV2A 4AOQA 1THSH 1HAYB 1KDQB 1V2PT 5JB8S 1KXEA 1WTHD 1PQ5A 4CH8B 3ZZ3A 2BLWA 4DURA 3S0NA 1C5WB 1QJ1B 1SKYE 2WPMS 1G36A 3OY5U 5E8EH 4FVDA 3TGIE 1BIOA 1KYNA 3GCTF 3A82A 2LNCA 4TPIZ 2J9NA 3LGWA 1OWEA 4WMEA 1DOJA 1L1NA 1DPOA 2LP6A 4Z0KA 2V0BA 2F9BH 1NY22 3PMBB 3QUMP 5EQRA 2DE8A 2VNTA 1C5NH 2JDID 1W0JD 2WPHS 1ZMLA 1J16A 3NCLA 1FIWA 3SNDA 2R0KA 3F2FA 1Z7KA 5HYOA 3SNEA 3N99A 1TGBA 4THNH 3SBKA 1A61H 1C2EA 2Z9IA 5EU8A 3S9BA 2H9TH 4XFQA 4U2WA 2A7CA 4JK6A 1HGTH 3MWIU 1GL0E 4I7YH 3RXCA 3SI4H 1NBMD 1G3DA 4ESTE 4TYDA 1SMFE 1C1RA 5GDSH 1COWD 1O3AA 1OWKA 2YNBA 4X2XA 3DT0H 1ZPZA 4M7GA 2W26A 3PYHA 4FU8A 2A2QH 2IN2A 4P00A 2R9PA 2BOHB 3RXVA 3QO6A 1GJ8B 4WH8A 3UIRA 2BMGB 4FUCA 4FUIA 5DP3A 1SLWB 4NIXA 2DUCA 1H9IE 1W0YH 3AVZA 1UTPA 1O3FA 4LZ4B 1ELEE 2BD2A 2GMTC 3BEIB 1GGDB 3EQ0H 4B6EA 1O5BB 4CBOA 1AIXH 1O3MA 2YOLA 1C5MD 2HGTH 3IWMA 1BMFD 1QFKH 2O8UA 1N8OC 5EW2H 3GY6A 2BDAA 2WPIS 1SGDE 4TWWA 2ZC9H 3OY6U 2KX4A 2ANYA 1B0FA 2FTLE 2H9HA 1LQDB 4GHTA 1VZQH 2OQ5A 2QIQA 1ANEA 1P2IA 1ELAA 1SGTA 3EE7A 4CRDA 2ZPQA 2W3IA 3RXHA 5GPIB 4KTCA 1UTQA 1HAOH 1PQAA 1T8OA 1K1JA 1FDPA 2FEQH 1RGQA 1SFQB 4LK4A 1QA0A 2QXHA 1B5GH 1K9OE 4INKA 3QK1A 1IQNA 4YOIA 5PTPA 2XWBI 3LH1A 5K7RA 2VB0A 1GCTB 3QTVH 2RG3A 2ZTZA 3K6ZA 2WV9A 3M3SA 4NSYA 1HUTH 1C1QA 1CGIE 2LPRA 2NU4E 3UNSA 1D9IA 1YLDA 1QRZA 1UCYH 1GI7B 2VVVA 5C17A 1QRWA 2GCHG 4OS5A 2THFB 4ZHLU 2FS8A 1G2LA 4P02A 1C2JA 1GMHF 4FXGH 1THRH 1JMOH 1SLUB 3DA9B 3HKJB 3E0NB 1QNJA 1O2YA 3KNXA 1PPZA 1AWFH 1C5OH 1C5SA 1NO9H 4JZDH 2Z3EA 3Q00A 3E1XB 1ESTA 2FDAA 1CQQA 3ITIA 3QX5H 3S9CA 5EQSA 3LC5A 4A1XA 4A6LA 1BBRK 4HFPB 4WXVA 1HBTH 1A0JA 3F9FA 1AI8H 2KCPA 1C2HA 5I46H 1XUJA 1NU7B 3MOCA 1LPKB 2AMDA 3OX7U 1O2ZA 3P8GA 3O8RA 3SO3A 3BTDE 4YLQH 3GYMA 1O3IA 3Q77A 1TMTH 4JK5A 1O5GH 3T29A 5GJ4B 4AB9A 1DS2E 3H7TA 3SU0A 2A0QB 1GPZA 1OXGA 5C0UA 1SOTA 3TH2H 1ZOMA 4NG9H 1C1TA 1W7GH 2PUQH 1DLKB 1GJ9B 4R8TB 4U30A 1S85A 2SNWA 3ZZ9A 4CHAC 2H2ZA 1UCYE 2HNTE 2O9QA 3BTTE 1GBBA 3SHCH 1HAXB 1H4WA 1AVXA 2BY6X 5HM9A 4TSFD 1YPEH 1SGQE 1NTPA 3SV8A 1EPTB 3MI4A 4JZIA 3PLKA 1BTHH 1CO7E 3RM2H 1CT0E 1Z1IA 6GCHF 1HAIH 1O2JA 4ACBA 2FZZA 3MU1A 1P10A 3A8DA 2FO9A 4CR5A 4F48B 5KEDA 4FUHA 3F0PA 4OS7A 1SQRA 3UTUH 2WZQA 1SHHB 1HAPH 3VB5A 1K1LA 1G37A 1EAUA 2HVYB 5JBTA 2EI7A 4Z1MD 1S81A 3PWBA 1QL7A 1WCZA 1E36B 2ODPA 2VINA 2IPHA 3N7DA 1E37B 1RRKA 4KP0A 4MG3A 1SSXA 1TRYA 1KLIH 3KQCA 5A8YA 2KM0A 2Z94A 4MPVA 1FONA 1GJAB 2P59A 1NFYA 2V3OH 3UY9A 1Z71A 2VIQA 2JETC 3GY7A 4IBLH 4RT1A 3VB7A 4QT8C 1P9UA 2J95A 1ZJKA 3V7TA 2SGDE 1IOEA 2BD3A 4GVUA 4Q4LA 5HKKD 1P01A 1XX9A 3GYLB 2A5AA 4JMYA 4YTAA 3C1KA 1A3BH 2JH5D 2Y7XA 2GDDA 5CE1A 1ZZZA 3A7WA 1C2DA 1NZQH 4FU9A 2BDIA 3RXDA 1HPGA 1YPJH 2PR3A 4Y10E 1S84A 3OSYA 4O97A 2ZA5A 3F9EA 3QGNB 2KFWA 3LT3A 1BB0B 1DUEA 1NBME 3H5CB 1KXCA 2NU3E 1JIRA 1A5IA 4CRFA 1OSSA 2TIOA 1TBRH 1SC8U 4OS2A 1C5ZB 1DWBH 1UHBA 4X6NA 4BXWA 1C4U2 2D1JA 4OGYA 1BRBE 1TYNA 1HRTH 5T1VA 4OS4A 1BBRE
chains in the Genus database with same CATH topology
5ESBA 2GCTB 1FV9A 1LPZB 1XXDA 2P93A 1HAVB 4F49A 3R3GB 4DW2U 5EPYA 1UVOA 1LKBA 4ZH8A 5EPNA 1O2KA 2ZG0H 1GBAA 1W10U 3SGQE 2ASUB 2VIDA 3GDUA 1K1OA 2Q1JA 2FOAA 3MH4A 5E0GA 2ZFPH 1IQLA 1QIXB 2ESTE 4GSOA 1GI9B 4AYVB 3TNSA 3FZZA 1VGCC 2CJIA 1TOCB 1XMNB 1QBVH 4ZAEA 1ELCA 1G3CA 4MDSA 1KXFA 5DP8A 5F8TA 4TY6A 1A0LA 2Y5GA 4JZFH 2HNTC 1GHAF 2FPZA 4INLA 3GDVA 3CENA 4MNYA 1W8BH 1CA8B 4MPXA 2A45B 1THPB 1P2NA 4XBBA 3ZZAA 1ELDE 3DFJA 1O2HA 4X2YA 3L6PA 3UFAA 2OC8A 3URCA 4CRBA 1BRCE 2XC0A 4MTBA 5LPEA 1RTFB 2WPLS 3P8OA 2VWOA 1MU8B 3STIA 2ANMH 1BT7A 1QR3E 1NRRH 3RXAA 2C4FH 1NT1A 2PHBA 4YM9A 1AD8H 1FY4A 2ZCKP 2Z9KA 3TK5A 4J2YB 2SGPE 2PWXA 1UVTH 3BTFE 2Y7ZA 1QTFA 1N1LA 2A31A 2BXUH 3GCTG 1A46H 3AW1A 3TIUA 1LPGB 4WY3A 5CHAB 1SGEE 1GHXH 3KGPA 3D62A 1HXEH 3TH3H 5EXLA 2Z6BD 3SJOA 3F6UH 2Y82A 1PFXC 3LGVA 4BOHA 2HALA 1QRXA 1UTKA 3TVJB 1EP6A 4YESB 3SI3H 1O3HA 3E90B 3E0PB 4DJZB 1DWEH 4K1EA 1GI6A 4IGDA 3GCNA 1GBFA 2ODYB 1SBWA 4D9QA 2GT7A 3BTKE 2ZHEH 5FBIA 1IHSH 2XTTB 4ISNA 1O2SA 2XC4A 3NKKA 1N6YA 3LOXA 1O35A 4ISOA 5FX5A 1RFNA 5A8XA 4D76A 4DCDA 4HGCA 4FUEA 2PFEA 1SG8B 2ZCLP 2WPJS 5E0HA 4X1QU 1QQUA 1ZTKA 3ESTA 3VEQB 2GDEH 1DITH 2FP7B 4I8KA 3RXIA 1GI2A 2EC9H 4HI3A 1BJUA 1XM1A 3M5NA 1H8DH 1T31A 4Y0ZE 1QQ4A 1V2UT 3LU9B 4PROA 2AMPA 1O5FH 4X2WA 3A7YA 2BXTH 3L3TA 4K1TA 2OUAA 2STAE 5GXPA 1EAWA 1TX7A 2ZGBH 1EAIA 1O34A 1O2TA 1V2OT 1MZDA 2BOKA 4UONA 5J4QA 2WUCA 2ZTXA 4AX9H 1OX1A 3E8LA 3ZVEA 1TNLA 1QA7A 1EJNA 3EA7A 5L6NH 4ZHMU 1C5QA 1HJ8A 1SB1H 3G01A 1QCPA 2QY0B 5EXMA 4GUXA 5AFZH 4YT6H 3NXPA 2O8LA 2A2XH 3SUGA 7ESTE 3GCHC 1YPMH 5DG6A 3GICB 1CGJE 2JKHA 1EX3A 2VH6A 1UTNA 3EE0B 1XUFA 3RXBA 1C5LH 5E2OA 2OD3B 1ESAA 2FIRH 3A7XA 2P95A 1O2IA 4ASHA 3P70B 1EP5A 2FI3E 3M37A 4NIYA 5F03A 4OS1A 4MNXA 1ANDA 2ZHWH 4AYYB 2CV3A 1P8VC 3HK6B 1BDAA 4DIIH 1MKWK 1T7CA 2A7JA 2Z9LA 1HIAA 3A7VA 4ABHA 1TPSA 1GMHG 3VPKA 3F9GA 2A4QA 4I8GA 8KME2 1AY6H 4X8SH 1AB9B 4ABDA 1MQ6A 3W94A 2PLXA 2EI6A 3VB4A 2RA0A 1DVAH 2FOBA 1BZXE 2PW8H 2ZU1A 2VIWA 1QB6A 1MAYA 9ESTA 1CGHA 5DP7A 4MQAA 2D26C 1GBEA 1QHRB 1YGCH 2OQUA 4CH2B 4X1RU 1UK4A 4GHQA 1ARBA 3ENSB 3FANA 1SGYE 1SLVB 1A5GH 1TE0A 3SHAH 1PQ8A 2FI4E 1XKBC 1TBZH 1C2MA 2ZO3H 3BIUH 4UEHH 3UOPA 2PKSB 2G4UA 1C5UA 4WF8A 3SJ8A 4IMQA 3SJKA 1GG6B 3RC6A 3A86A 4YOJA 3T25A 4WH6A 5SGAE 5LGOA 1HCGA 2G55A 3SJIA 1TMUH 4XOJA 4R0IA 2A5KA 1TONA 3RMLH 3MU4A 2K1QA 4DIHH 1OP2A 3GCOA 2QAAA 4FUFA 1LVYA 3QDZB 3SUDA 1AUTC 1K28D 5DP4A 3TGKE 1DLEA 2PSYA 1GVLA 4F4OC 1T8LA 3RXPA 1UTLM 4CREA 4E06H 1MH0A 2XBXA 8LPRA 1O30A 2W3KA 5JBAS 1LVMA 1DM4B 1A3EH 3VXEH 6GCHG 1GHVH 2FXRA 1OWJA 3TITA 4JYTA 1EOJA 6CHAC 4B1TA 1L0ZA 2AMQA 2BZAA 1F0SA 1YLCA 1FXYA 5L2YH 2RCEA 1O2XA 1VCPA 1H8IH 3M5MA 4E7RG 3UQOA 1UHBB 2BD9A 2AIPA 4AFZA 5F8ZA 2FOCA 1NROH 3EAJA 1DXPA 4B71A 1XUIA 4VGCB 1SL3A 1HAHH 1IAUA 5A2MH 1ZGIA 3E16B 4CRGA 2ZP0H 2PV9B 2KAIB 3MMGA 2ALPA 4TPYA 5A0AE 2OP9A 1DE7H 1XXFA 2DE9A 4K2YA 2TGAA 1TFXA 4E05H 3MTYA 1SGNE 1UCYK 1V2KT 1C4V2 4NZQA 2AEIH 1AFQC 1O3NA 1GJ5H 3KCGH 1HXFH 2ZQ2A 1F92A 4NIWA 1VJ9U 2BDHA 3A84A 1GVZA 9LPRA 1Y3WA 1FUJA 4IN2A 1WU1A 1T8MA 2UUYA 4BAMB 1TX8A 4FUDA 1V2ST 1P03A 3PO1C 1C2LA 1LTOA 4K60A 3VGCB 1OWIA 1ZHPA 3ZZBA 4ABIA 4ABJA 3ZV9A 1OS8A 3A83A 4MNWA 1F0UA 3RXFA 3FP7E 3O8DA 2ZPSA 2CF9H 1CBWC 4ZHAA 1TPOA 1JBUH 3MH6A 1CA0C 4NCYA 2BDCA 3FP8E 2WYJA 1XUKA 5J4SA 2HWLB 2H9EH 3TNTA 5T6FA 1GBMA 1ANBA 1MCTA 3RUOA 5TJXA 4D9RA 3ZZ7A 2BQWB 2ZFTA 2BD7A 1C5VA 4A1VA 1OPHB 1P2MA 1YCPH 1P3CA 1C9TA 3SOSA 1BCUH 1TALA 3KIDU 1HJAC 4YOGA 2GV6A 2BVXH 1QBNA 1XVMA 3HGPA 1TMBH 3RXRA 3S69A 1QY6A 2TRMA 3GY4A 4AG1A 1GHAG 4RKOB 3FAOA 3RXQA 4KKDA 1AKSA 2F9VA 1K21H 1WAYB 5GCHG 4GCHG 3LIWA 3V3MA 1M9UA 1NM6A 1RTKA 2A5IA 1MTNB 1KXBA 1O2PA 4IC5A 3V13A 1RIWB 3SU1A 3FZDA 1F5LA 3QGJA 1IQGA 4WWYA 2ZDAH 1MTSA 1ACBE 2FODA 2F9UA 3P92A 3MHWU 3KHVA 1TBQH 3F1SB 3BG4C 2BLQA 2OBQA 1GCDA 5AFYH 1AE8H 1O3GA 1ABJH 3RC4A 5CHAC 3MU8A 3Q76A 4WMDA 4D7FA 4WMFA 1K1NA 1P9SA 2Z9JA 1D3QB 1GJDB 3TJUA 3RMNH 1C5YB 4XBDA 3ZVGA 1TPPA 1TAWA 1Y8TA 4DVAU 5C67A 3SGBE 3LGTA 1FPCH 2Y81A 1K1MA 2B7DH 2SGFE 1F2SE 3M35A 4O9VA 1ZR0A 4IN1A 1WYKA 1PPGE 1V2LT 4AGKA 1O37A 4CBNA 1PYTD 3DFLA 2HPPH 3NWUA 1PPHE 4YT7H 2OC1A 2D2DA 1AZZA 1PPCE 3FP6E 1J17T 1BHXB 1RJXB 3CP7A 1DSUA 3T28A 2BDGA 3STJA 1LO6A 3SV2H 3VXFH 2QF0A 1BMLA 5T6GA 2CXVA 1FY3A 1GJ4H 4NA8A 2AERH 3T5FH 3NUMA 1QGFA 4LOYH 1UVPA 2I6QA 4BXSA 1K1IA 1Y3VA 2QXGA 2PUXB 1L1GA 2V6NA 2J4IA 3SN8A 2FOFA 2VVUA 2C8XB 5DP9A 4H6SB 2OTVA 2VGCC 1J14A 2GT8A 1ZMNA 1GBCA 3P8NA 2TPIZ 2ZHQH 2P94A 1XUHA 1AU8A 1VR1H 2FLRH 2ZFQH 3A81A 1CT2E 1HIAB 5G4BA 4ABFA 1L4DA 4AFUA 1TRNA 4H4FA 1C5XB 1GBIA 1Z1JA 1MD7A 4K69A 3RU4T 3LGUA 1BRAA 3MH7A 1O2VA 4JCNA 1V3XA 1O39A 3SU4A 1T4UH 5A0CA 1OYTH 3OTJE 1ZLRA 4B73A 2YNAA 1D6WA 1P3EA 1C2GA 1V2TT 2XWAA 3ATIA 3SGAE 1ZTLA 1QJ6B 1SQTA 2A32A 2GMTB 3VB6A 1GJBB 2STBE 2OCVB 1NU9A 2BY5X 2A4GA 1C1MA 1NC6A 2KAIA 4NA7A 3PB1E 1ANCA 3RU4D 1P05A 2FOEA 2CHAB 3LPRA 3M5LA 3M5OA 1AB9C 4OS6A 1N8OB 2FX6A 4X6PA 3HK3B 5JBBS 1P02A 1J15A 2GD4B 1E34B 1MU6B 4X8TH 3UPEA 1VITH 5B6OA 1INCA 3A88A 3BF6H 1GMDG 1GBLA 1Y59T 1GBDA 1OP8A 3BEUA 2ZGCA 5EG4A 2AGGX 3UUZA 1TNKA 1S5SA 1F5RA 5H4IB 2Q6DA 3PLBA 4KELA 1O3BA 2G51A 2PGQB 3A8AA 3Q3YA 2BQ6B 5T3HA 4Y6DA 2XCNA 2AYWA 2PGBB 1D3PB 3SU6A 5GCHF 4GCHF 5HM2A 4OGXA 1GG6C 1VITG 3S7KB 5FPTA 1L2EA 3EGKH 4SGAE 3IG6B 5FHTA 3SZNA 1V2QT 1C1OA 1O3CA 3UNRA 4A92A 1ARCA 1ZSKA 1Y5BT 4Y0YE 1AUJA 1KY9A 1O2NA 1NS3A 1V2VT 2JH6D 1TX6A 2AH4X 4WVPE 4I32A 1WUNH 2ZF0H 2ZEBA 3RXUA 4FUGA 2Y5FA 1MAXA 1AFEH 1VCWA 4AB8A 1Z8JB 1EASA 1O3KA 4X8UH 1V2WT 2BZ6H 2VIPA 2XW9A 2UWOA 4MPUA 1GI0A 2ZGJA 1FPHH 4HZHA 1ESBA 1WQSA 1FNIA 2OC0A 1O2OA 1ETTH 4FUJA 3QLPH 1ELVA 4AZ2B 1O3LA 2BY8X 2GZ9A 2ZI2H 1T32A 1RD3B 2HPQH 4MVNA 3QWCH 4ABBA 4KGAA 1SGPE 1HNEE 3CS0A 1W7XH 2Y6TA 3L33A 1A1RA 3D65E 4U32A 2BLVA 3E6PH 4K5ZA 2IJOB 1A0HB 3NK8A 2CMYA 3RMMH 1CHGA 4YZUA 2OXSA 1C1SA 1TYNA 3PWCA 2Y80A 2BM2A 1RS0A 2GZ7A 3W95A 1ZHRA 2NWNA 1Q31A 4YO9A 1LMWB 4ZKSU 2QCYA 2C93B 1O5DH 5AHGH 1GGDC 1P06A 3LKWA 1MKXK 5LPRA 3B8JA 2OC7A 3OU0A 1GMCG 1HV7A 1SFIA 1TRMA 1D6RA 2SNVA 2VIOA 5BPEA 1H9HE 4UFFH 1NFXA 1EATA 1YP9A 2ZZUH 4Q7XA 4K1SA 4LZ1H 3BG8A 2XBWA 1FQ3A 3BTQE 5TCCA 1BMAA 1LQEA 2RDLA 2SGEE 5T6DA 1YPKH 4NWKA 2XBVA 1BMMH 2FMJA 1G30B 3GY2A 2TGTA 2GGVB 1O36A 2QXIA 4HTCH 3T27A 1HYLA 1DANH 1BOQA 1KSNA 3ATWA 1C2KA 1V6DA 1EQ9A 4X1NU 3D23A 5ABWA 3SU5A 4DY7B 4ZROA 3Q3XA 1S83A 2BDBA 1SGRE 1AKSB 2HRVA 3KL6A 1O31A 3ZYEA 2XNIA 1PPBH 1SOZA 3BSQA 1EZQA 1FZZA 1SLXB 1GCTC 2ZTYA 3ZZDA 5FPSA 2J94A 5DP5A 2Y5HA 3SU2A 2JETB 4X6OA 3N7OA 2BY7X 1UO6A 1BA8B 1SVPA 3A87A 2R2MB 1S6HA 4B2CA 2WV4A 4O03A 3TGJE 3U8TH 3A8CA 1L4ZA 1FIZA 2G5VA 1CHOG 4I8HA 2CF8H 3DUXH 1V2JT 1O2RA 2VJ1A 2CGAA 2BD5A 4ZKNU 5DGJA 2ZCHP 3HPTB 3A89A 4XBCA 5LH8A 1FN8A 2ANKH 5JDUB 1IQIA 1GMDF 1PJPA 3ZZ8A 2GZ8A 1SR5C 1W2KH 1D4PB 2G00A 4Y11E 1LVOA 1MTNC 3OYPA 5ESTE 3SQHE 1RIWC 1NPMA 2O8WA 3HATH 1ID5H 1MQ5A 1ZRKA 1GJCB 1O3JA 1E38B 2SFAA 1G3EA 2FYRA 4ZMAH 1GL1A 1A5HA 1O2LA 1YM0A 3MFJA 2BX4A 1VITF 2I6SA 1EJAA 1A2CH 2O8TA 1SGFA 1O2GH 1TIOA 1TLDA 2BD4A 1AMHA 1UK2A 3K65B 3RU4E 3BTME 1G9IE 1AWHB 2P3TB 4Y7AA 4MLFB 3RXTA 1QB1A 4NFEA 5C3NA 3A7ZA 3QTOH 5GIBA 6ESTA 4BAOB 2G5NA 1EZXC 4X2VA 5HXFA 1VGCB 8ESTE 5EODA 1OWHA 1G3BA 3U69H 1EAXA 3FFGA 1BITA 3U1JB 3MO6A 5JB9S 1XVOA 5A8ZA 1SQOA 2BX3A 2VVCA 5DK1A 4ABGA 2G81E 1EPTC 1TQ0B 5L30H 1Z6JH 3ELAH 4ZUHA 1TABE 3LJOA 2WV5A 3SV9A 4UFDH 5E2PA 2UWLA 3DD2H 1FMGA 1LDTT 1B7XB 1PYTC 3BTGE 4BANB 3TJNA 5LPFA 3RLWH 3ZVBA 1J8AA 1BHXF 3BTWE 1MKWH 1O5AB 3AAVA 3O8BA 3Q3KA 1P2KA 1H1BA 1Z6EA 1DWCH 2R0LA 3QN7A 2ZPRA 3TU7H 3U8OH 1IQFA 5C20A 2ILNA 1BTUA 4I8JA 5C5NA 3K9XB 2GV7A 3KEEA 3V12A 3U8RH 1MTWA 2BVRH 3ZVDA 2W5EA 1ELBA 3TLOA 1AQ7A 3KQEA 2ZU2A 3MH5A 1EKBB 1TB6H 2P8OB 1FAKH 2RA3A 4Q7ZA 1EZUC 3SNBA 1F5KU 3RXLA 1WTGH 3TJVA 1P11E 1V2RT 5C5OA 1ZYOA 3PTBA 1GI4A 1GMCF 1CE5A 1GHZA 3MU5A 3PROA 1BTXA 3BEFB 1LKAA 1SPJA 3ZZ6A 1YBWA 1PQ7A 3RXJA