4ISNA

Crystal structure of matriptase in complex with its inhibitor hai-1
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
241
structure length
241
Chain Sequence
VVGGTDADEGEWPWQVSLHALGQGHICGASLISPNWLVSAAHCYIDDRGFRYSDPTQWTAFLGLHDQSQRSAPGVQERRLKRIISHPFFNDFTFDYDIALLELEKPAEYSSMVRPICLPDASHVFPAGKAIWVTGWGHTQYGGTGALILQKGEIRVIQQTTCENLLPQQITPRMMCVGFLSGGVDSCQGDSGGPLSSVEADGRIFQAGVVSWGDGCAQRNKPGVYTRLPLFRDWIKENTGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Kunitz-type protease inhibitor 1
publication title Crystal structures of matriptase in complex with its inhibitor hepatocyte growth factor activator inhibitor-1.
pubmed doi rcsb
source organism Homo sapiens
total genus 54
structure length 241
sequence length 241
ec nomenclature ec 3.4.21.109: Matriptase.
pdb deposition date 2013-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4isnA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4isnA01
3VB4A 2ZTXA 3D23A 1FDPA 1SMFE 5C2ZA 2QXHA 1NY22 3RLYH 1UK4A 3GYMA 1C1VH 3UNSA 3PLPA 1GJAB 3C1KA 1QA0A 2FS9A 4MDSA 1TX7A 1BZXE 1F2SE 1DFPA 1GI9B 9ESTA 1GWAA 3EA8A 3TIUA 5C20A 1Y3YA 2VH0A 1IOEA 1P3CA 2QF3A 2PKSC 1WUNH 3A7VA 1SLWB 1TWXB 1C5YB 1OKXA 1J15A 4ZXXH 1NU7B 3F1SB 1ZMJA 1QJ7B 4I8GA 3A82A 1TPOA 3GCNA 2J95A 2W7UA 2ZPRA 3OY5U 2A7HA 5C1XA 3TVJB 1X7AC 4X0WU 4DIIH 1BHXF 1GMDF 2B7DH 3RXMA 1JWTA 2BX3A 3K6YA 3QGJA 1QB6A 4KGAA 1Y5BT 2QXIA 3ZZBA 5C5NA 3O8DA 2M5TA 3MH7A 1ZJKA 2ZHFH 1CBWC 3PYHA 4INLA 1A0LA 5FCRA 2EI8A 3SOSA 2XC5A 1BA8B 2XBVA 4WVPE 1BBRH 1QIXB 1NRQH 3U1JB 2GZ7A 3AVZA 4Y6DA 4AOQA 2JETC 4K69A 2FOCA 5BPEA 4CBOA 3UQVA 1L2EA 2FO9A 1VGCC 4X8UH 3RXCA 5AFZH 1NTPA 3ZZCA 2EA3A 1O2RA 2BY8X 3DFLA 2D8WA 4K1EA 3GY3A 1HJAB 3PB1E 4CH2B 1B7XB 1K1IA 2FEQH 3L3TA 2JH5D 1O3OA 3M7UA 4RKOB 1QB9A 4Y10E 3UIRA 2UUJB 2P16A 3GY6A 3NUMA 2PSXA 1O2TA 2YNBA 1A61H 2ZDKA 1G36A 1HIAA 1OP0A 1BHXB 3SNDA 2Q6FA 4CRAA 2ZGHA 1TNKA 4FUCA 3ZVEA 2G4TA 4NA9H 1OWIA 5A0CA 1IHTH 2G00A 1NT1A 3MH5A 4FVBA 3PMJA 1W0YH 5DP8A 1ZTJA 1SPJA 3W94A 4XBCA 4ABDA 3KQDA 1LVBA 2QXJA 3SN8A 1AY6H 1HXFH 5HYOA 2HALA 2Z9LA 1ACBE 2RA0A 1P57B 2VVCA 1C5MD 2GCTC 3H5CB 3JZ2B 3PWBA 1SOTA 2OC7A 3BIVH 1C1UH 2A45B 5FPYA 4HI3A 1DDJA 3ODFA 1HBTH 2XCFA 3T2NA 4AB9A 2G81E 2SGFE 2FOGA 1P0SH 2PHBA 3B9FH 2VIDA 4I31A 1O34A 3SV8A 2FP7B 3ATKA 4JZDH 4D76A 4ABBA 3M3VA 3SUGA 5F8ZA 3RMNH 3MO6A 4D7FA 2AERH 2ZZUH 2IJOB 1NPMA 4X6MA 1S0QA 1KXEA 1UVPA 1ESBA 5DP7A 1UMAH 5A2MH 3A8BA 1ZGVA 2BHGA 2ZDVH 4U30A 2P3FH 4FU7A 1BRAA 1DS2E 1CSOE 1DWBH 2A7JA 8LPRA 1EZSC 3ZZAA 1UVSH 4B2BA 4XDEA 4ABGA 1OYQA 1U6QA 4X1PU 1F7ZA 5FX6A 1FIWA 1GVLA 2NU4E 3Q00A 3SZNA 1QQ4A 4SGBE 3STIA 1QNJA 3OYPA 2QC2A 1RFNA 1UVUH 1YBWA 1BBRK 1DICA 5I25A 2AGIX 5C1UA 2R3YA 3F9GA 1HJ9A 4X2WA 4D9QA 1NFUA 1SC8U 3K9XB 1GJ6A 1NU9A 1LKBA 2ZI2H 2QGRA 3TJOA 5TCAA 2PLXA 3S7KB 1SQOA 3ZVCA 2WINI 2R2MB 4A1XA 1ZYOA 2ODYB 1AVGH 1LO6A 2FESH 1YM0A 3O8BA 3QTOH 3UNRA 5J4SA 1ESAA 4CR9A 1IAUA 1CA0C 2Z3EA 4THNH 4R8TB 3GCTF 3MOCA 1O3AA 3A7ZA 2BLQA 4CH8B 1KLTA 5GXPA 1H9HE 3SBKA 4YTAA 1G30B 2O8LA 5EPYA 2FZZA 2AH4X 5FHTA 3GY7A 2A32A 3RXLA 1Q3XA 2VIWA 1EOLA 4OS4A 1C1NA 2YNAA 3AW0A 1P2KA 1SFIA 3SNAA 2ZECA 4FVDA 2OC0A 2BD5A 1YLCA 1TLDA 4AORA 4H42U 1O2MA 4ZKRU 6CHAB 2A31A 1WCZA 5HGGA 1TBQH 1UO6A 1LKAA 2Z94A 1GG6B 3H7TA 1Z6JH 1W0ZU 3QUMP 1IQGA 1HAOH 3M3SA 3T25A 5E2PA 2BXTH 1AFEH 4TYDA 2A4RA 2Y5HA 2HOBA 3OU0A 1TRNA 1RIWB 1Y5UT 2ZP0H 2GV6A 3A7XA 5EOKA 2PV9B 1EJMA 3SO3A 1ELBA 1IQHA 3E8LA 2C93B 2FYQA 3SHAH 3S0NA 1O2KA 5AFYH 1PQAA 3GDVA 1FLEE 2FXRA 3E0NB 1QRWA 3MH4A 5DP4A 5DO4H 3SI4H 5F6MA 1K1OA 1NS3A 1SOZA 3PMBB 1LCYA 1FAKH 3E6PH 3LJOA 1Y59T 1GJ5H 1O2PA 1V2OT 3LGIA 1UHBB 1GL1A 2FPZA 1DPOA 2OLGA 2SGAA 3T5FH 3UWIA 3TNTA 4Q7XA 1Y5AT 3BTKE 2BYAX 2WUBA 1C2JA 3UQOA 1AUTC 2PGBB 1MMJN 2Y5FA 1O3KA 1DWDH 1EP6A 1O3NA 3RXPA 1VITH 4X8SH 1RJXB 1GCTC 4XBBA 3PO1B 1C9PA 2OC8A 1K1MA 1QL9A 1MTWA 7KMEH 1J16A 2GD4B 4Y76A 3KNXA 1E0FD 4NG9H 4AFQA 3SNCA 1EPTC 2AMDA 1MTSA 3QGNB 2R2WU 5HM2A 3DFJA 1ELCA 1Q2WA 3U8OH 2FOAA 2J94A 1O3JA 1ZRBA 4OGYA 2STBE 2ZFFH 1ABIH 2F9VA 2NU2E 5J4QA 2QYIA 1P2JA 1WBGB 3SU4A 2Z3DA 6ESTA 1GHBF 1XUHA 2OBOA 3LOXA 4YT6H 3P95A 1K22H 1P06A 2BOKA 3PLKA 1A4WH 2HWLB 2ALVA 1D4PB 3DA9B 4ISIH 3PTNA 1C1RA 4A1VA 3E16B 1RTLA 2BD3A 3LKWA 4XBDA 2A4OA 3URDA 1VR1H 2ASUB 1HAIH 1AD8H 1HCGA 4WH8A 1NRSH 2A5IA 1C5UA 1SI5H 5LH8A 4X1SU 3PROA 2JH0D 2VU8E 2DE9A 4DOQA 3RDZA 3BV9B 1SHHB 1SFQB 2GMTB 1AFQC 4GVUA 1W12U 1EX3A 2GDEH 3UFAA 1RTFB 3GY2A 1ZLRA 1QY6A 3BG4B 1TX8A 1MAYA 4XOJA 4B74A 4JZEH 4GUXA 2AIQA 3A80A 1G3CA 1EP5A 4KKDA 2R9PA 4ZUHA 4YM9A 3RMOH 3I78A 2QF0A 5JBBS 1P2QA 1BIOA 1F5RA 2NU0E 1HLTH 1XXFA 1ZJDA 1GVKB 1TAWA 4X1RU 1GHZA 1AWFH 5T3HA 1SB1H 3SJKA 5LPRA 1V2WT 4XSKU 4MPVA 1C1TA 2W5EA 4H6SB 1QTFA 3ZVDA 1W3CA 4CBNA 3V7TA 2GT7A 3FAOA 1EAUA 1T8LA 2SNWA 3CENA 4O3UA 1IQKA 5FX5A 4ZXYH 2RCEA 1MQ6A 2G8TA 4B2CA 1G9IE 5K7RA 1RTKA 1O2YA 2VIOA 1BB0B 6LPRA 4FUGA 1BTPA 1OWEA 1FMGA 1T8NA 1PFXC 1P3EA 1P8VC 4AFSA 1AB9C 1C5RA 4O9VA 5T6DA 1T8MA 3NPSA 3RXVA 1V2ST 1O2OA 1NC6A 3OY6U 1CGHA 2NU1E 1P03A 1S5SA 5A8YA 7GCHG 2EC9H 2A2XH 1ELDE 4WXIA 1MTNB 3A7TA 1KYNA 1HAZB 2ZHDA 3ENSB 1IQEA 1GI5A 1SLUB 3VGCB 2QN5T 5GIBA 1HIAB 2A5KA 2Y5GA 3GYLB 2VINA 1KIGH 4D8NA 4NGAH 5H4IB 4UFDH 5L2ZH 3ZZ5A 1O3CA 3ESTA 3RXBA 3ZZ3A 1QA7A 5A09A 2C90B 4WF8A 1OP2A 2F9NA 3VXFH 1YKTA 1K21H 1YLDA 2FOFA 2F9PA 2Y80A 5CHAC 1DX5M 4DURA 3LDXH 1O3LA 2TGPZ 2GKVE 1SG8B 4UDWH 5E0JA 4YLQH 1E37B 2O8MA 1PJPA 3VGCC 3Q76A 1EKBB 1MKWH 1L4ZA 1GI0A 3N7OA 5C67A 4JZFH 3I29A 3B23B 2ZGBH 4NIYA 1MD8A 4Y0ZE 4CHAB 3RXJA 4GAWA 3QTVH 3SJ9A 1GBDA 5TJXA 1W14U 1UK2A 1ZTLA 4WWYA 4Q80A 1C1OA 4CRCA 2BLVA 1EZUC 2ZPSA 2J34A 4BNRA 1QL7A 1GBBA 1ELEE 3M7TA 4BXWA 1FN6A 1HAHH 3ZYEA 1AE8H 1ZHPA 1A0HB 3HK3B 1RGQA 4WJG2 2XWAA 2P59A 1WTGH 1YPEH 4OS1A 2CF8H 1GJCB 3PV4A 4GLYA 1NFXA 3SU2A 1GJ4H 1ARCA 1S84A 4ZKOU 1DWCH 2VWLA 3S9AA 1TBZH 3QZRA 1YGCH 3TGIE 1GCDA 2XW9A 1TYNA 1DWEH 1P04A 1GHXH 1CVWH 3ELAH 1ZHRA 1ZPZA 1THRH 2HNTE 2HRVA 1DSUA 3MHWU 1BDAA 3R3GB 5FCKA 2VWNA 3TJNA 1T8OA 1N6XA 5ESBA 1V2PT 4HZHA 4A6LA 1DANH 4Y0YE 1S6HA 2VNTA 4BAHB 3G01A 2XWBI 2Z9JA 3A86A 5EU8A 2FOHA 1YPLH 1A3BH 3P17H 4Q7ZA 3MNXA 2VH6A 3SJIA 3MNCA 2SNVA 1E36B 2GGVB 3JZ1B 4K5ZA 4ZH8A 1SGEE 1ZRKA 1QFKH 4WXVA 1XUIA 2XCNA 2Y6TA 2A7CA 1LMWB 2OUAA 2HNTC 1NRPH 2VWOA 1Y3UA 2VGCB 4IBLH 1TONA 1MZAA 1O32A 4K8BA 1C1PA 3A88A 2O8WA 1EB1H 5EXNA 4IC5A 3RXGA 3LPRA 3MTYA 3QLPH 1C2EA 3BEFB 3UR6A 1UVOA 1L1JA 3VB6A 1ANEA 1QR3E 3PTBA 1UTJA 3F9FA 2OQUA 2FTLE 2Q6DA 1P2OA 1EJAA 1D6RA 1MKWK 1PPHE 1QRXA 1ABJH 1ETSH 1GHBG 1LDTT 3D65E 3M37A 1DY8A 2G5NA 3AAVA 4AZ2B 2ZFRH 1GJDB 1TGTA 1BTHH 1C5QA 1DOJA 1ELGA 4CRGA 3VB5A 1O30A 2F3CE 3EGKH 1VJAU 4AFUA 1GMCF 2PKAA 2Z9KA 3GDUA 5DP3A 4NIWA 3SJOA 4R0IA 4B1TA 2HGTH 1RXPA 3HKIB 4H4FA 3ZVAA 3RXKA 4NZLA 5BRRE 3FANA 3TU7H 1HFDA 2BDAA 2ZFQH 1C5SA 1C5NH 1S81A 3UWJH 1TRYA 3BTQE 4X1NU 3LGYA 3RXTA 4BTUB 3EA9A 2VIQA 3GDSA 1C2HA 2ZFSA 3SNEA 3GOVB 1Q31A 3P8FA 1O35A 1VCPA 1O3EA 5F8XA 1SHYA 4I8KA 4JZ1A 4DJZB 1GPZA 1O0DH 4ABEA 4MNVA 1O5GH 1XUJA 2H2ZA 2ZO3H 3T28A 2Q1JA 4CRBA 8ESTE 1QJ6B 3Q3KA 3K65B 2AGEX 3M5NA 2TGTA 1GBHA 3RC4A 3O8RA 2FWWA 1Z8JB 1LVYA 1YPGH 1LHEH 2GP9B 1UTOA 2ZU4A 5JDUB 2XBYA 3TH2H 1P10A 1THPB 3M61U 2EI6A 1F0SA 1F0UA 4IN1A 3BTDE 3T62A 1IQLA 3Q3YA 3BSQA 2ZEBA 2SGPE 1A2CH 3P92A 1HJAC 1V2MT 2UWOA 1MUEB 2BY6X 1XVOA 5IDKA 1GBKA 2QY0B 4NSYA 3Q3XA 2ZNKH 3LONA 1GDQA 3EQ0H 1Z71A 2D26C 1JIMA 4DCDA 1BTZA 1GI2A 3BTHE 4FUHA 1J17T 1MTUA 2C8YB 3NWUA 4WH6A 1OX1A 2F9BH 1BTUA 1KSNA 2VVUA 2VJ1A 3NXPA 1BTWA 1V2VT 2FDAA 1GJ9B 3NZIA 1XVMA 1K1PA 1PYTC 2BVXH 1A7SA 5DGJA 1VJ9U 3S9CA 1G37A 1CT0E 4MPWA 1ZZZA 1C2LA 2Q6GA 1BITA 1HDTH 2OINA 1KLJH 4A1TA 3V0XA 1ANDA 1C2IA 1C5TA 3ODDA 1L1NA 1V2NT 1GI6A 1OPHB 3A8DA 5F8TA 2A2QH 4Y7AA 2OP9A 1OSSA 1FUJA 1GBMA 3TITA 1MQ5A 1C2MA 5EG4A 4JK5A 5JBAS 7GCHF 1KTSB 1TGBA 1TBRH 1YPHE 1B0EA 5EODA 2BOHB 4AG1A 4B71A 2CGAA 2PSYA 5L2YH 3SORA 3VEQB 2PTCE 1FPCH 2DE8A 3ZZ9A 1D9IA 3GICB 4DVAU 2H9TH 2XC0A 1BT7A 1AZ8A 4A92A 1AUJA 1SGFA 2ZG0H 1ELVA 3VFEA 1SGFG 2AGGX 1TMUH 2G51A 3VB7A 1MCVA 3KF2A 2P93A 3TJVA 1CGIE 2PWXA 2F83A 1NFWA 1YPHC 1GHWH 1WV7H 4QT8C 3SW2B 1GJ8B 1WQSA 2UUKB 1TRMA 5HXFA 4ISHH 3TK6A 4ISOA 1ETTH 3BEUA 3V3MA 4UEHH 4MNYA 2A4GA 3LIWA 2SGEE 5T6FA 3OTJE 1BJVA 4UFGH 3UUZA 1SLXB 1AWHB 1DLKB 2O9QA 1HYLA 3QWCH 2WPIS 2GCHG 3GY8A 1CU1A 1XXDA 2C3SA 1OWJA 3PMAB 1GGDB 1EATA 1L4DA 1DUAA 1FN8A 4AX9H 1NZQH 1KY9A 1MBMA 1DUEA 5DP6A 5JB8S 1T32A 1O37A 4YT7H 2ZPQA 1AKSA 2OC1A 1NM6A 5F03A 1O5EH 6CHAC 2V0BA 1KXAA 3M3TA 1C4V2 2BDCA 3E0PB 4NCYA 1JIRA 3S9BA 4O97A 2D1JA 1S0RA 4DIHH 1GG6C 1P12E 2ZTYA 3GY5A 1JOUB 3LU9B 4Y8ZA 4DGJA 4GHTA 1LPZB 3EA7A 1SGCA 2AEIH 2GDDA 1AO5A 1C1MA 1RIWC 1E38B 1C5VA 1KXCA 4KTUA 1D3PB 2ZDAH 5I46H 1YYY1 3RMMH 1ORFA 1TNGA 1SQAA 4MVNA 3A81A 5EXMA 3ZV9A 1JBUH 3RXAA 4FUBA 3SU6A 1DVAH 3BTEE 1H4WA 4NSVA 4BOHA 5GDSH 1PPZA 1PQ8A 2WPKS 2P8OB 1AHTH 2J4IA 4UD9H 1ZGIA 4JCNA 1WYKA 1L1GA 2G5VA 2PFEA 7LPRA 3A85A 4MNXA 1C2GA 1QBNA 2B8OH 1GMCG 5LGOA 3A8AA 1A3EH 1O2NA 4ABFA 1HAVA 3RC6A 2C4FH 2BZAA 4Q2KA 5HMAA 1WU1A 2ZWLH 5ETXA 1D3QB 2H5DA 1O5BB 3Q77A 3SU1A 1FPHH 3V13A 3SV7A 2BMGB 3PO1C 4FUDA 2ZCKP 3ZZ4A 2P8OC 2BVSH 4MQAA 1K28D 1ZHMA 2BY7X 4UFEH 2Z9GA 1SLVB 1GMHG 4MPXA 1GI1A 1VITF 2H6MA 5E0GA 1W7GH 4BTIB 1LPGB 2BQ7B 3VXEH 3LGVA 4X8VH 1AU8A 2EI7A 4BAQB 1QURH 2GX4A 4FUFA 2F91A 1G32B 5A0AE 5EXLA 1C5LH 2CHAB 3MU0A 4Y71A 1ZMNA 1XX9A 2WPHS 1HB0B 2GTBA 4JZIA 4ZMAH 1AVWA 1CHOF 5CE1A 1YPMH 3WY8A 3VB3A 2WPJS 3URCA 5E8EH 3MO3A 2FX4A 3TJUA 2C8WB 3A7WA 4K8YA 3M5LA 1A1RA 1MH0A 2VB0A 1ELTA 1M9UA 1MU8B 1GBIA 1EASA 3CS0A 1S85A 1EQ9A 1TOCB 1DITH 1JRTA 2J92A 3U98H 1GBJA 1P01A 3LGWA 3SQEE 5EQQA 4X1QU 1O2LA 5DK1A 4UE7H 1GJ7B 2ZGXH 1PYTD 4A7IB 2ZU3A 3RU4D 3FVFB 1O2UA 1EAIA 4D7GA 2FS8A 4WY3A 2VIPA 2Y7XA 1AQ7A 3RC5A 2GMTC 3SV9A 1TPSA 1H8IH 4HTCH 1LVMA 3L33A 2VVVA 2RA3A 1H9LB 3BG4C 3KN2A 3KIDU 2PKAB 3BTGE 1W11U 4GCHF 2I6SA 1V2QT 4ZHAA 4CREA 3UOPA 2BDBA 1EXFA 1YP9A 3LC3A 5EW2H 3U8RH 2C8XB 3TGJE 2H9EH 3HGPA 2GT8A 2FOEA 1J14A 1ELFA 2UUFB 3E3TA 3SQHE 1FXYA 4MPUA 2XBWA 3RXHA 1YF4A 1B5GH 4WMFA 1W2KH 2B9LA 1NO9H 2K1QA 2OQ5A 1Z1JA 4I8HA 1FY3A 4ZHLU 2HPPH 1S83A 3KQBA 4INKA 5G4BA 3LT3A 2IPHA 1DM4B 4ASHA 3GCHB 1YPJH 4NA7A 4YOIA 4BANB 4F4OC 1O3HA 2XC4A 4O3TA 4ISNA 4ZKSU 1KDQA 1IHSH 1IQJA 3RMLH 2FMJA 2XYAA 3P8OA 3TH3H 1H1BA 1ETRH 1GBCA 4K1TA 1A5GH 3GY4A 1TMBH 1NN6A 2UUYA 4B73A 5K0HA 5GWZA 4IN2A 3NCLA 1QJ1B 3P8NA 3DT0H 2PUQH 1MTNC 1ANCA 1GHVH 2HLCA 3PM3A 1UTLM 3S7HB 1G3EA 3SGQE 1TGNA 1DE7H 4KELA 1KXBA 4DT7B 1EB2A 1ELAA 1QB1A 1TNIA 1V2JT 1A5IA 3KL6A 1O2GH 2ODQA 3ZVFA 1TGSZ 8KME2 1FIZA 1C9TA 1Y3XA 5JB9S 1GI8B 4Z6AH 3TGKE 3SU0A 3EYDA 4FU8A 5L30H 1AMHA 2ANWA 1J8AA 2ZGCA 4MNWA 1XKBC 1GHAG 3ZZDA 1UTQA 3QDZB 1P9UA 1SGRE 2P3UB 2WPMS 3UY9A 2CMYA 3C27B 1EPTA 4IC6A 2ZDNA 1TQ7B 1O2ZA 2WPLS 1LPKB 3MNBA 1FI8A 1D3TB 1O5AB 2KAIA 1ZSJA 5CMXH 1F0RA 1GBTA 4MG3A 2QA9E 3L6PA 1DXPA 1ZR0A 3MH6A 4CHAC 5DJ7A 3KQCA 4IS5A 2ANKH 4X6NA 2G52A 3A7YA 5L6NH 1LTOA 3ZVGA 2GCHF 3F9HA 1SR5C 1O2HA 3SU5A 5LPFA 1UK3A 5ESTE 4YESB 3BF6H 1HRTH 4TWWA 3LH3A 2XNIA 1N8OB 5A8ZA 4NFFA 2BD8A 1OP8A 4VGCB 5PTPA 1GDUA 2QXGA 1CT4E 3AW1A 4NFEA 4DW2U 1T7CA 4Y8YA 1TIOA 1YC0A 1XUGA 2Z9IA 4E7RG 3HGNA 1OWDA 1SGQE 3A8CA 1C5XB 4ZROA 2ZC9H 2A1DB 3SUFA 5SGAE 4GPGA 1O5FH 2FI5E 4I33A 3RXOA 1Y8TA 1NRRH 3SGBE 1AN1E 3SU3A 1O2IA 1SVPA 4AGJA 1BQYA 4DG4A 2Z3CA 1OXGA 2AFQB 1DT2A 2THFB 3RXDA 4IW4E 2PKSB 1TPPA 4NIVA 4B76A 5JYIA 1DSTA 1BRCE 3KHVA 2GZ8A 1MD7A 2CXVA 2DUCA 1HPGA 1RS0A 3MMGA 2CJIA 4RSPA 3UOUA 1QCPA 2ZFPH 1VCQA 2VGCC 3BN9A 1K1LA 1VITG 1ID5H 1OOKB 3LH1A 3QN7A 1UTMA 1B0FA 5JBCS 1CE5A 2O8UA 1QL8A 1O2WA 1AKSB 1IQNA 3HKJB 3MU4A 1RD3B 4AN7A 1LHGH 1O2XA 1PPCE 1CBWB 1XMNB 3BTWE 4E06H 1EZQA 2CN0H 3TK9A 3EE0B 5E0HA 1TA6A 1UCYE 4Y79A 4U01A 1CHOG 2JETB 1TABE 1A5HA 4TPYA 4TWYA 3V12A 5AVDA 1CT2E 4Y11E 2TPIZ 1VGCB 1O3IA 3A87A 1GMHF 2BDIA 1LQEA 1HAGE 1LQDB 1H8DH 4OGXA 3VPKA 1P05A 1MZDA 3W95A 3LGTA 5GPIB 2H1UA 5A0BA 2VIVA 3DD2H 1K1NA 3NKKA 1G2LA 2FOMB 5B6OA 2BVRH 1UTPA 3OSYA 4GSOA 2ANMH 1RRKA 2V35A 1GDNA 3LC5A 1TOMH 3UPEA 4JMYA 1BMAA 1XM1A 2RDLA 1UCYK 4X2YA 8GCHF 1INCA 4K3JA 4U2WA 4LXBH 1O3DA 4JYVH 1SL3A 3RXIA 4B75A 1JRSA 3E1XB 2CF9H 2G55A 4GCHG 1HAVB 1BRBE 3ZYDA 2SFAA 5FBIA 3RU4E 3RXSA 4BTTB 2BDYA 1A46H 3MNSA 2UWLA 5AHGH 2W3KA 3F68H 2FLRH 4K60A 1AGJA 2AS9A 5C5OA 2IOTA 2OXSA 1P11E 1C2FA 1OWKA 1SGPE 1UVTH 2GCTB 1O3FA 3FP7E 4J1YA 3SI3H 4M7GA 4IMQA 3FZZA 1AI8H 4YO9A 4TY7A 1P2NA 4I8LA 4AYYB 4ZHMU 4BAOB 4X6OA 1MU6B 1BRUP 2ZU2A 1QGFA 4ESTE 2ZHQH 1GBLA 4XE4A 4DY7B 5LPEA 3T29A 4TY6A 1T4UH 1E35B 3MWIU 5IYTA 1HAXB 1F92A 3MU8A 3SNBA 3PMHB 2ILNA 1C2DA 2IN2A 2XBXA 2SGQE 1ANBA 1AE5A 3MYWA 3EDXB 4IGDA 1BBRE 2BD9A 5GCHG 1L0ZA 1FZZA 1UTKA 1TNLA 3D49H 9LPRA 1WAYB 2FM2A 1BCUH 3R0FA 4X8TH 2BQWB 5EGMA 5FPTA 1ZPCA 1EAXA 3F6UH 2FIRH 1XKAC 4K1SA 1C2KA 3QZQA 2ZDLA 1MKXH 2VWMA 1SGIB 2R0KA 3SV2H 3TK5A 1UJ1A 5EW1H 1S6FA 4ABHA 5ABWA 2W3IA 2XXLA 1CA0B 1HAYB 5T6GA 4YOJA 4F49A 3RXUA 1CHGA 2ALPA 4A5TS 1THSH 1FONA 1S82A 3A84A 4FUIA 2ZCLP 1F0TA 4FXGH 1EOJA 4GHQA 4HGCA 1O2VA 1AVXA 4IMZA 4MLFB 1BTXA 1O39A 3QX5H 3K6ZA 1TX6A 3KEEA 5EQSA 2QIQA 4J2YB 5DKMA 1XUFA 2G4UA 4KP0A 1FNIA 1QBOA 1EAWA 4LZ4B 1QBVH 1V2KT 4BAKB 1WTHD 2FX6A 4JK6A 1V2UT 4NIXA 1QHRB 3ZZ6A 1V2RT 1FQ3A 4WMEA 2BB4A 1MBQA 1C1SA 1NRNH 1CA8B 4FUJA 3D62A 3A89A 2ZQ2A 6GCHF 1DLEA 1GHAF 3SJ8A 1KTTB 1UTNA 1SGTA 2HPQH 4OS2A 3HPTB 1GBAA 4JYTA 1H9IE 1AIXH 3SV6A 1GBFA 1KDQB 2WYJA 3SUDA 4I7YH 1ZOMA 2ZGJA 1GI7B 3TH4H 2EEKA 3O8CA 3CP7A 1SGNE 3FP8E 3M7QA 1BMLA 2XRCA 1GVZA 2OBQA 3ITIA 3GCOA 3H7OA 4Z0KA 3RUOA 3ZV8A 1O2SA 3UR9A 3CS7A 3RU4T 4Q7YA 2P94A 1FY1A 4MTBA 4AYVB 1J9CH 5C1YA 1CQQA 4KTCA 1GGDC 1MAXA 4FUEA 3RM0H 3M36A 4CRDA 1ESTA 1GI3A 3BG8A 2BD2A 1HGTH 1V2TT 2QCYA 1DY9A 4OS5A 1MKXK 2TGAA 1PPBH 1ARBA 1P02A 3E90B 1Y3WA 2W26A 2ZHWH 2FLBH 4H6TA 2Z6BD 1Z8GA 3IITA 1GHYH 4KTSA 1GCTB 1GJBB 2P3TB 2TGDA 5DPAA 1TA2A 2BTCE 2GV7A 1JXPA 1ZMLA 4I8JA 2R3UA 2V3HH 3T27A 1SSXA 3BTTE 2AYWA 2F9OA 1EPTB 1Z8RA 1K1JA 1VZQH 2BLOA 4O03A 2WUCA 3SGAE 4AB8A 3RXEA 4RKJB 3P8GA 2KAIB 2PUXB 3MU5A 2ZFTA 2ZIQH 3BEIB 2RG3A 2ODPA 2W7SA 1O2QA 4UONA 1SQTA 1YCPH 2LNCA 2OCVB 1Z8IB 2BZ6H 4B2AA 1WQVH 2TIOA 4LZ1H 3ATIA 1O3BA 1GMDG 2Z7FE 3I77A 1C5WB 3HK6B 2AMQA 2STAE 3S69A 1O3MA 3K2UA 2BD7A 2V3OH 1P09A 4LK4A 4YZUA 4YLUA 1G3BA 4INHA 1MTVA 3PLBA 1NESE 2H5CA 1LHDH 2PW8H 2H9HA 1AFQB 3QO6A 2QV1A 3BTME 3M5MA 4BAMB 5AF9H 2GVFA 1P2MA 7ESTE 2WV5A 1C4U2 3A83A 8GCHG 3U1IB 4ABIA 1F5KU 3OX7U 1E34B 2J9NA 4RN6A 5JPMH 1EUFA 3RLWH 2R0LA 1FY5A 4I32A 2BXUH 2ZA5A 3U9AH 1QRZA 5EQRA 1V2LT 1HXEH 4CR5A 4ISLA 2CHAC 3ATWA 1BOQA 4D9RA 3U69H 2WYGA 3PWCA 1HJ8A 4NZQA 4Y8XA 1BMMH 1N6YA 1W8BH 1O38A 2FYRA 3DUXH 1VCWA 1TPAE 2I6QA 2PTNA 5FXLA 1MCTA 2ULLA 3MO9A 2V6NA 1TNJA 1EJNA 2BDHA 1EZXC 2O8TA 1BJUA 4X2XA 1V3XA 4X2VA 5GJ4B 2YOLA 4NA8A 1Z1IA 1Y3VA 3RXQA 2TBSA 1TQ0B 3TPIZ 1GBEA 2D2DA 5C3NA 1AB9B 1WSSH 5FPSA 3P70B 1KLIH 3FP6E 1W7XH 3RXFA 1YCPK 5DG6A 2FI3E 3BTFE 3E91A 2QAAA 2ZU5A 2ZDMA 2F9UA 1PQ5A 3GISB 1O2JA 1TFXA 2BQ6B 2FOBA 1P2IA 1GL0E 3ZZ8A 4CRFA 2JKHA 3NK8A 1Z6EA 1ZSLA 1QQUA 4NWKA 1OWHA 2WV4A 4K2YA 1AZZA 1PPGE 2BY9X 3LGUA 3FFGA 3KQEA 1O5DH 2SGDE 3F9EA 3IWMA 1TE0A 5GCHF 1BUIA 1NROH 1O31A 1WOFA 1DXWA 2A0QB 2HVXA 4BXSA 2FTMA 3T26A 1IQFA 5CHAB 2OTVA 4YOGA 2PR3A 1FY4A 1KXFA 1YPKH 4Y7BA 2ZTZA 1C4Y2 1N1LA 3M35A 3DHKH 5FAHA 3KGPA 1CGJE 2B5TB 3GCHC 1TGCA 2LPRA 5A8XA 1C1QA 1BMNH 3TNSA 1SGDE 2ZU1A 4UFFH 1W13U 2A4QA 3GCTG 5DP9A 3STJA 2CV3A 1TNHA 1O5CB 4U32A 2J38A 1O33A 4JYUH 4ABJA 1K2I1 3QK1A 2FODA 1O3GA 1Z7KA 3AAUA 3ZVBA 1HAPH 2GZ9A 2JH6D 1C5OH 3HATH 6GCHG 4TPIZ 1HV7A 1UHBA 2ZCHP 2ESTE 1LHCH 2BY5X 2ZKSA 4ZKNU 1OYTH 5EPNA 3BIUH 1GI4A 1O3PB 2HNTF 2BX4A 1NFYA 1FY8E 1KXDA 1PPFE 2ANYA 3EAJA 1TALA 1BTYA 5TCCA 1SBWA 2XTTB 3B8JA 4X6PA 1ZTKA 1G3DA 1PPEE 2J2UA 3ATMA 2BM2A 3UTUH 3UNQA 2A5AA 1FAXA 4OS6A 1TMTH 3RXRA 5FBEA 3TLOA 5JBTA 2Y82A 1LVOA 1CO7E 4E7NA 2OD3B 2P95A 1IQMA 2B0FA 3P6ZB 2AIPA 3ZZ7A 3SHCH 1T4VH 1TB6H 1HNEE 4FU9A 4NWLA 1PQ7A 1D3DB 4SGAE 1HUTH 1SGYE 1IQIA 3MFJA 4ZAEA 3IG6B 1JMOH 1FV9A 5E2OA 1T31A 1UCYH 2BDGA 2BLWA 5DP5A 1YCPM 1A0JA 2ZF0H 3RM2H 1C5ZB 3MI4A 2C8ZB 1V6DA 4OS7A 2ZQ1A 3ATLA 1C5PA 1P9SA 4AFZA 3AASA 4AG2A 3FZDA 1ZPBA 3UREA 2AMPA 1FJSA 2Y81A 1W10U 3MU1A 1LHFH 2BD4A 5HM9A 4AGKA 1XUKA 2PGQB 3KCGH 4PROA 3U8TH 4E05H 4ABAA 1N8OC 2NU3E 4HFPB 4LOYH 1C1WH 1O36A 2TRMA 4VGCC 3LJJA 4WMDA 1F5LA 2NWNA 4XFQA 1G2MA 2ZHEH 1K9OE 2Y7ZA 2UWPA 1D6WA 1OS8A 3SUEA 3M5OA 1ZSKA 3RP2A 2FI4E
chains in the Genus database with same CATH superfamily
3VB4A 2ZTXA 3D23A 1FDPA 1SMFE 5C2ZA 2QXHA 1NY22 3RLYH 1UK4A 3GYMA 1C1VH 3UNSA 3PLPA 1GJAB 1SKYE 3C1KA 1QA0A 2FS9A 4MDSA 1TX7A 1BZXE 1F2SE 1DFPA 1GI9B 9ESTA 1GWAA 3EA8A 3TIUA 5C20A 2IJD1 1Y3YA 2VH0A 1IOEA 1P3CA 2QF3A 2PKSC 1WUNH 3A7VA 1SLWB 1TWXB 1C5YB 1OKXA 1J15A 4ZXXH 1NU7B 3F1SB 1ZMJA 1QJ7B 4I8GA 3A82A 1TPOA 3GCNA 2J95A 2W7UA 2ZPRA 3OY5U 2A7HA 5C1XA 3TVJB 1X7AC 4X0WU 4DIIH 1BHXF 1GMDF 2B7DH 3RXMA 1JWTA 2BX3A 3K6YA 3QGJA 1QB6A 4KGAA 1Y5BT 2QXIA 3ZZBA 5C5NA 3O8DA 2M5TA 2KZ4A 1ZJKA 3MH7A 1SQRA 2ZHFH 1CBWC 3PYHA 4INLA 1A0LA 5FCRA 2EI8A 3SOSA 2XC5A 1BA8B 2XBVA 4WVPE 1BBRH 1QIXB 1NRQH 3U1JB 5C0TA 2GZ7A 2KCOA 3AVZA 4Y6DA 4AOQA 2JETC 4K69A 2FOCA 5BPEA 4CBOA 3UQVA 1L2EA 2FO9A 1VGCC 4X8UH 3RXCA 5AFZH 1NTPA 3ZZCA 2EA3A 1O2RA 2BY8X 3DFLA 2D8WA 4K1EA 3GY3A 1HJAB 5B6LA 3PB1E 4CH2B 1B7XB 1K1IA 2FEQH 3L3TA 2JH5D 1O3OA 3M7UA 4RKOB 1QB9A 4Y10E 3UIRA 2UUJB 2P16A 3GY6A 3NUMA 2PSXA 1O2TA 2YNBA 1A61H 2ZDKA 1G36A 1HIAA 1OP0A 1BHXB 3SNDA 2Q6FA 4CRAA 2ZGHA 1TNKA 4FUCA 3ZVEA 2G4TA 4B6FA 4NA9H 1OWIA 5A0CA 2XNDD 1IHTH 2G00A 1NT1A 3MH5A 4FVBA 3PMJA 1W0YH 3OEHD 5DP8A 1ZTJA 1SPJA 3W94A 4XBCA 4ABDA 3KQDA 1LVBA 1NBMD 2QXJA 3SN8A 1AY6H 1HXFH 5HYOA 2HALA 2Z9LA 1ACBE 2RA0A 1P57B 2VVCA 1C5MD 2GCTC 3H5CB 3JZ2B 3PWBA 2IPQX 1SOTA 2OC7A 3BIVH 1C1UH 2A45B 5FPYA 4HI3A 1DDJA 3ODFA 1HBTH 2XCFA 3T2NA 4AB9A 2G81E 5CDFE 2SGFE 2FOGA 1P0SH 2PHBA 3B9FH 2VIDA 4I31A 1O34A 3SV8A 2FP7B 3ATKA 4JZDH 4D76A 4ABBA 5KGOA 3M3VA 3SUGA 5F8ZA 3RMNH 3MO6A 4RT0A 4D7FA 2AERH 2ZZUH 2IJOB 1NPMA 4X6MA 1S0QA 1KXEA 1UVPA 1ESBA 5DP7A 1UMAH 5A2MH 3A8BA 1ZGVA 2BHGA 2ZDVH 4U30A 2P3FH 4FU7A 1BRAA 1DS2E 1CSOE 1DWBH 2A7JA 8LPRA 1COWD 1EZSC 3ZZAA 1UVSH 4B2BA 4XDEA 4ABGA 1OYQA 1U6QA 4X1PU 1F7ZA 5FX6A 1FIWA 1GVLA 2NU4E 3Q00A 4ASUD 3SZNA 1QQ4A 4SGBE 3STIA 1QNJA 3OYPA 4M9FA 2QC2A 1RFNA 1UVUH 1YBWA 1BBRK 1DICA 5I25A 2AGIX 5C1UA 2PP6A 2R3YA 3F9GA 1HJ9A 4X2WA 4D9QA 1NFUA 1SC8U 3K9XB 1GJ6A 1NU9A 1LKBA 2ZI2H 2QGRA 3TJOA 4YXWD 5TCAA 2PLXA 3S7KB 1SQOA 3ZVCA 2WINI 2R2MB 4A1XA 1ZYOA 2ODYB 1AVGH 1LO6A 2FESH 1YM0A 3O8BA 3QTOH 3UNRA 5J4SA 1ESAA 4CR9A 1IAUA 1CA0C 2Z3EA 4THNH 4R8TB 3GCTF 3MOCA 1O3AA 3A7ZA 2BLQA 4Q63A 4CH8B 1KLTA 5GXPA 1H9HE 3SBKA 4YTAA 5EJ1A 1G30B 2O8LA 5EPYA 3WW7A 2FZZA 2AH4X 2RFKC 5FHTA 3GY7A 2A32A 3RXLA 1Q3XA 2VIWA 1EOLA 4OS4A 1C1NA 2YNAA 3AW0A 1P2KA 1SFIA 3SNAA 2ZECA 4FVDA 2OC0A 2BD5A 1YLCA 1TLDA 4AORA 4H42U 1O2MA 4ZKRU 6CHAB 2A31A 1WCZA 5HGGA 1TBQH 1UO6A 1LKAA 2Z94A 1GG6B 3H7TA 1Z6JH 1W0ZU 3QUMP 2HVYB 1IQGA 1HAOH 3M3SA 3T25A 5E2PA 2BXTH 1AFEH 4TYDA 2A4RA 2Y5HA 2HOBA 3OU0A 1TRNA 1RIWB 1Y5UT 2ZP0H 2GV6A 3A7XA 5EOKA 2PV9B 1EJMA 3SO3A 3DSPA 1ELBA 1IQHA 2WV9A 3E8LA 2C93B 2FYQA 3SHAH 3S0NA 2KCYA 1O2KA 5AFYH 1PQAA 3GDVA 1FLEE 2FXRA 3E0NB 1QRWA 3MH4A 5DP4A 5DO4H 3SI4H 5F6MA 1K1OA 1NS3A 1SOZA 3PMBB 1LCYA 1FAKH 3E6PH 3LJOA 5C94A 1Y59T 1GJ5H 1O2PA 1V2OT 3LGIA 1UHBB 3UAIC 1GL1A 2FPZA 1DPOA 2OLGA 2SGAA 3T5FH 3UWIA 3TNTA 1VKYA 4Q7XA 1Y5AT 3BTKE 3FO8D 2BYAX 2WUBA 1C2JA 3UQOA 1AUTC 2PGBB 1MMJN 2Y5FA 1O3KA 1DWDH 1EP6A 1O3NA 3RXPA 4Q4LA 1VITH 4X8SH 1RJXB 1GCTC 4XBBA 3PO1B 1C9PA 2OC8A 1K1MA 1QL9A 1MTWA 7KMEH 1J16A 2GD4B 4Y76A 3KNXA 1E0FD 4NG9H 4AFQA 3SNCA 1EPTC 2AMDA 1MTSA 1W0KD 3QGNB 2R2WU 5HM2A 3WWFA 3DFJA 1ELCA 1Q2WA 1S6LA 2FOAA 3U8OH 2J94A 1O3JA 1ZRBA 4OGYA 2STBE 2AHME 2ZFFH 1ABIH 2F9VA 2NU2E 1YY3A 5J4QA 2QYIA 1P2JA 4AC9A 1WBGB 3SU4A 2Z3DA 6ESTA 1GHBF 1XUHA 2OBOA 3LOXA 4YT6H 3P95A 1K22H 1P06A 2BOKA 3PLKA 1A4WH 2HWLB 2ALVA 1D4PB 3DA9B 4ISIH 3PTNA 1C1RA 4A1VA 3E16B 1RTLA 2BD3A 3LKWA 4XBDA 2A4OA 3URDA 1VR1H 2ASUB 1HAIH 1AD8H 1HCGA 4WH8A 1NRSH 2A5IA 1C5UA 1SI5H 5LH8A 4X1SU 3PROA 1BMFD 2JH0D 2VU8E 3F0OA 2DE9A 4DOQA 3RDZA 3BV9B 1SHHB 1SFQB 2GMTB 1AFQC 4GVUA 1W12U 1EX3A 3DSOA 2J97A 2GDEH 3UFAA 1RTFB 3GY2A 1ZLRA 1QY6A 3BG4B 1TX8A 1MAYA 4XOJA 4B74A 4JZEH 4GUXA 2AIQA 3A80A 1G3CA 1EP5A 4KKDA 4P02A 2R9PA 4ZUHA 4YM9A 3RMOH 2V7QD 2QF0A 3I78A 5JBBS 1P2QA 1BIOA 1F5RA 2NU0E 1HLTH 1XXFA 1ZJDA 1GVKB 1TAWA 4X1RU 1GHZA 1AWFH 5T3HA 1SB1H 3SJKA 5LPRA 1V2WT 4XSKU 4MPVA 1C1TA 2W5EA 4H6SB 1QTFA 3ZVDA 1W3CA 4CBNA 3V7TA 5KECA 2GT7A 5EJLA 3FAOA 1EAUA 1T8LA 2SNWA 3CENA 4O3UA 1IQKA 5FX5A 4ZXYH 2RCEA 1MQ6A 2G8TA 4B2CA 1G9IE 5K7RA 1RTKA 1O2YA 2VIOA 1BB0B 6LPRA 4FUGA 1BTPA 1OWEA 5GNDA 1FMGA 1T8NA 1PFXC 5C17A 1P3EA 1P8VC 4AFSA 1AB9C 1C5RA 4O9VA 5T6DA 1T8MA 3NPSA 3RXVA 1V2ST 1O2OA 1NC6A 3OY6U 1CGHA 2NU1E 1P03A 5EJZA 1S5SA 5A8YA 7GCHG 2EC9H 2A2XH 2OK5A 1ELDE 4WXIA 1MTNB 3A7TA 1KYNA 4FETA 2QE7D 1HAZB 2ZHDA 3ENSB 1IQEA 1GI5A 1SLUB 3VGCB 2QN5T 5GIBA 1HIAB 2A5KA 2Y5GA 3GYLB 2VINA 1KIGH 4D8NA 4NGAH 5H4IB 4UFDH 5L2ZH 3ZZ5A 1O3CA 3ESTA 3RXBA 3ZZ3A 1QA7A 5A09A 2C90B 4WF8A 1OP2A 2F9NA 3VXFH 1YKTA 1K21H 1YLDA 2FOFA 2F9PA 2Y80A 5CHAC 1DX5M 5FL7D 4DURA 3LDXH 2QF4A 1O3LA 2J98A 2TGPZ 2GKVE 1SG8B 4UDWH 5E0JA 4YLQH 1E37B 2O8MA 2EY4C 1PJPA 3VGCC 3Q76A 1EKBB 1MKWH 1L4ZA 1GI0A 3N7OA 5C67A 4JZFH 3I29A 3B23B 2ZGBH 4NIYA 1MD8A 4Y0ZE 4CHAB 3RXJA 4GAWA 3QTVH 4XD7D 3SJ9A 1GBDA 5TJXA 1W14U 1UK2A 1ZTLA 4WWYA 4Q80A 1C1OA 4CRCA 3KYGA 2BLVA 1EZUC 2ZPSA 2J34A 4BNRA 1QL7A 1GBBA 1ELEE 3M7TA 4BXWA 1FN6A 1HAHH 3ZYEA 1AE8H 1ZHPA 1A0HB 3PV2A 3HK3B 1RGQA 4WJG2 2XWAA 2P59A 1WTGH 1YPEH 2KCAA 4OS1A 2CF8H 1GJCB 3PV4A 4GLYA 1NFXA 3SU2A 1GJ4H 1ARCA 1S84A 4ZKOU 1DWCH 2VWLA 3F3BA 1TBZH 2F43B 3QZRA 3S9AA 1YGCH 2K0QA 3TGIE 1GCDA 2XW9A 5EIYA 1TYNA 1DWEH 1P04A 1GHXH 1CVWH 3ELAH 1ZHRA 2WSSD 1ZPZA 1THRH 2HNTE 2HRVA 1DSUA 3MHWU 1BDAA 3R3GB 5FCKA 2VWNA 3TJNA 3PRDA 1T8OA 1N6XA 5ESBA 1V2PT 4HZHA 4A6LA 1DANH 4Y0YE 1S6HA 2VNTA 4BAHB 3G01A 2XWBI 2Z9JA 3A86A 5EU8A 2FOHA 1YPLH 4RI0A 1A3BH 3P17H 4Q7ZA 3MNXA 2VH6A 3SJIA 3MNCA 2SNVA 1E36B 2GGVB 3JZ1B 4K5ZA 4ZH8A 1SGEE 1ZRKA 1QFKH 4WXVA 1XUIA 2XCNA 2Y6TA 2A7CA 1LMWB 2OUAA 3PV5A 2HNTC 1NRPH 2VWOA 1Y3UA 2VGCB 4IBLH 1TONA 1MZAA 1O32A 4K8BA 1C1PA 3A88A 2O8WA 1EB1H 5EXNA 4IC5A 3RXGA 3LPRA 3MTYA 3QLPH 1C2EA 3BEFB 3UR6A 1UVOA 1L1JA 3VB6A 1ANEA 1QR3E 3PTBA 1UTJA 3F9FA 2OQUA 2FTLE 2Q6DA 1P2OA 1EJAA 1D6RA 1MKWK 1PPHE 1QRXA 1ABJH 1ETSH 1GHBG 1LDTT 3D65E 3M37A 1DY8A 2G5NA 3AAVA 4AZ2B 2ZFRH 1GJDB 1TGTA 1BTHH 1C5QA 2LP6A 1DOJA 1ELGA 4CRGA 3VB5A 1O30A 2F3CE 3EGKH 1VJAU 4AFUA 1GMCF 2PKAA 2Z9KA 3GDUA 5DP3A 4NIWA 3SJOA 4R0IA 4B1TA 2HGTH 1RXPA 3HKIB 4H4FA 3ZVAA 3RXKA 4NZLA 5BRRE 3FANA 3TU7H 1HFDA 2BDAA 2ZFQH 1C5SA 1C5NH 3FOAA 1S81A 3UWJH 1TRYA 3BTQE 4X1NU 3LGYA 3RXTA 4BTUB 3EA9A 2VIQA 3GDSA 1C2HA 2ZFSA 3SNEA 1OHHD 3GOVB 1Q31A 3P8FA 1O35A 1VCPA 1O3EA 5F8XA 4FOUC 1SHYA 4I8KA 4JZ1A 4DJZB 1GPZA 1O0DH 4ABEA 4MNVA 2VBCA 1O5GH 1XUJA 2H2ZA 2ZO3H 3T28A 2Q1JA 4CRBA 8ESTE 1QJ6B 3Q3KA 3K65B 2AGEX 3M5NA 2TGTA 1GBHA 3RC4A 3O8RA 2FWWA 1Z8JB 1LVYA 1YPGH 1LHEH 2GP9B 1UTOA 2ZU4A 5JDUB 2XBYA 3TH2H 1P10A 1THPB 3M61U 2EI6A 1F0SA 1F0UA 4IN1A 3BTDE 3T62A 1IQLA 3Q3YA 3BSQA 2ZEBA 2SGPE 1A2CH 3P92A 1HJAC 1V2MT 2UWOA 1MUEB 2BY6X 1XVOA 5IDKA 1GBKA 2QY0B 4NSYA 3Q3XA 2ZNKH 3U28C 3LONA 1GDQA 3EQ0H 1Z71A 2D26C 1JIMA 4DCDA 1BTZA 1GI2A 1W0JD 3BTHE 4FUHA 1J17T 5IK2D 1MTUA 2C8YB 3NWUA 4WH6A 1OX1A 2F9BH 1BTUA 1KSNA 2VVUA 2VJ1A 3NXPA 1BTWA 1V2VT 2FDAA 1GJ9B 3NZIA 1XVMA 1K1PA 4RT1A 2KR7A 4B6EA 2CK3D 1PYTC 2BVXH 1A7SA 5DGJA 2LELA 1VJ9U 3S9CA 1G37A 1CT0E 1WDIA 4MPWA 1ZZZA 1C2LA 2Q6GA 1BITA 1HDTH 2OINA 1KLJH 4A1TA 3V0XA 1ANDA 1C2IA 1C5TA 3ODDA 1L1NA 1V2NT 1GI6A 1OPHB 3A8DA 5F8TA 2A2QH 4Y7AA 2OP9A 1OSSA 1FUJA 1GBMA 3TITA 1MQ5A 1C2MA 5EG4A 4JK5A 5JBAS 7GCHF 1KTSB 1TGBA 1TBRH 1YPHE 3OAAD 1B0EA 5EODA 2BOHB 4AG1A 4B71A 3H09A 2CGAA 2PSYA 5L2YH 3SORA 2KM0A 3VEQB 2PTCE 1FPCH 2DE8A 3ZZ9A 1D9IA 3GICB 4DVAU 2H9TH 2XC0A 2J5UA 1BT7A 2W6ID 1AZ8A 3W1EA 4A92A 1AUJA 1SGFA 4ZCNA 2ZG0H 1ELVA 3VFEA 1SGFG 2AGGX 1TMUH 2G51A 3VB7A 1MCVA 3KF2A 2P93A 3TJVA 1CGIE 4I86A 2PWXA 2F83A 1NFWA 1YPHC 1GHWH 1WV7H 4QT8C 3SW2B 1GJ8B 1WQSA 2UUKB 1TRMA 5HXFA 4ISHH 3TK6A 4ISOA 1ETTH 3BEUA 3V3MA 4UEHH 4MNYA 2A4GA 3LIWA 2SGEE 5T6FA 3OTJE 1BJVA 4UFGH 3UUZA 1SLXB 1AWHB 1DLKB 2O9QA 1HYLA 3QWCH 2WPIS 2GCHG 3GY8A 5HIZA 1CU1A 1H8ED 1XXDA 2C3SA 1OWJA 3PMAB 1GGDB 5HIYA 1EATA 1L4DA 1DUAA 1FN8A 4AX9H 1NZQH 1KY9A 1MBMA 1DUEA 5DP6A 5JB8S 1T32A 1O37A 4YT7H 2ZPQA 1AKSA 2OC1A 1NM6A 5F03A 3WWBA 1O5EH 6CHAC 2V0BA 1KXAA 3M3TA 1C4V2 2BDCA 3E0PB 4NCYA 1JIRA 3S9BA 4O97A 2D1JA 1S0RA 4DIHH 1GG6C 1P12E 2ZTYA 3GY5A 1JOUB 3LU9B 4Y8ZA 4DGJA 2KCPA 2J98B 4GHTA 1LPZB 3EA7A 1SGCA 2AEIH 2GDDA 1AO5A 1C1MA 1RIWC 1E38B 1C5VA 1KXCA 4KTUA 1D3PB 2ZDAH 5I46H 1YYY1 3RMMH 1ORFA 1TNGA 1SQAA 4MVNA 3A81A 5EXMA 3ZV9A 1JBUH 3RXAA 4FUBA 3SU6A 1DVAH 3BTEE 1H4WA 4NSVA 4BOHA 5GDSH 1PPZA 1PQ8A 2WPKS 2P8OB 1AHTH 2J4IA 4UD9H 1ZGIA 4JCNA 1WYKA 1L1GA 2G5VA 2PFEA 7LPRA 3A85A 4MNXA 1C2GA 1QBNA 1KMHB 1GMCG 2B8OH 5LGOA 3A8AA 1A3EH 1O2NA 4ABFA 1HAVA 3RC6A 4TT3D 2C4FH 2BZAA 4Q2KA 5HMAA 1WU1A 2ZWLH 5ETXA 1D3QB 2H5DA 1O5BB 2KX4A 3Q77A 3SU1A 1FPHH 3V13A 3SV7A 2BMGB 3PO1C 4FUDA 2ZCKP 3UB0A 3ZZ4A 2KFWA 2P8OC 2BVSH 4MQAA 1K28D 1MABB 1ZHMA 2BY7X 4UFEH 2Z9GA 1SLVB 1GMHG 4MPXA 1GI1A 1VITF 2H6MA 5E0GA 1W7GH 4BTIB 1LPGB 2BQ7B 3VXEH 3LGVA 4X8VH 1AU8A 2EI7A 4BAQB 1QURH 2GX4A 4FUFA 2F91A 1G32B 5A0AE 5EXLA 1C5LH 2CHAB 3MU0A 4Y71A 1ZMNA 1XX9A 2WPHS 1HB0B 2GTBA 4JZIA 4ZMAH 1AVWA 1CHOF 3KYFA 5CE1A 1YPMH 3WY8A 3VB3A 2WPJS 3URCA 5E8EH 3MO3A 2FX4A 3TJUA 2C8WB 2YMSB 3A7WA 4K8YA 2W6JD 3M5LA 1A1RA 1MH0A 2VB0A 1ELTA 1M9UA 1MU8B 1GBIA 1EASA 3CS0A 1S85A 1EQ9A 1TOCB 1DITH 1JRTA 2J92A 3U98H 1GBJA 1P01A 3LGWA 3SQEE 5EQQA 4X1QU 1O2LA 5DK1A 4UE7H 1GJ7B 2ZGXH 1PYTD 4A7IB 2ZU3A 3RU4D 3FVFB 1O2UA 1EAIA 4D7GA 2FS8A 4WY3A 2VIPA 2Y7XA 1AQ7A 3RC5A 2GMTC 3SV9A 3PRBA 1TPSA 1H8IH 4HTCH 1LVMA 2YMSC 3L33A 2VVVA 2RA3A 1H9LB 3BG4C 3KN2A 3KIDU 2PKAB 3BTGE 1W11U 4GCHF 2I6SA 1V2QT 4ZHAA 4CREA 1NBME 3UOPA 2BDBA 1EXFA 1YP9A 3LC3A 5EW2H 3U8RH 2C8XB 3TGJE 2H9EH 3HGPA 2GT8A 2FOEA 1J14A 1ELFA 2UUFB 3E3TA 3SQHE 1FXYA 4MPUA 2XBWA 3RXHA 1YF4A 1YWUA 1B5GH 4WMFA 1W2KH 2B9LA 2WPDD 1NO9H 2K1QA 2OQ5A 1Z1JA 4I8HA 1FY3A 4ZHLU 2HPPH 1S83A 3KQBA 4INKA 5G4BA 3LT3A 2IPHA 1DM4B 4ASHA 3GCHB 2L6OA 1YPJH 4NA7A 4YOIA 4BANB 4F4OC 1O3HA 2XC4A 4O3TA 4ISNA 4ZKSU 1KDQA 1IHSH 1IQJA 3RMLH 2FMJA 2XYAA 3P8OA 3TH3H 1H1BA 2JIZD 1ETRH 1GBCA 4K1TA 1A5GH 3F2HA 3GY4A 1TMBH 1NN6A 2UUYA 3DCLA 4B73A 3DSGA 5GWZA 5K0HA 4IN2A 3NCLA 1QJ1B 3P8NA 3DT0H 2PUQH 1MTNC 1ANCA 1GHVH 2HLCA 3PM3A 1UTLM 3S7HB 1G3EA 3SGQE 1TGNA 1DE7H 4KELA 1KXBA 4DT7B 1EB2A 1ELAA 1QB1A 1TNIA 1V2JT 2JJ2D 3N99A 1A5IA 3KL6A 1O2GH 2ODQA 3ZVFA 1TGSZ 8KME2 1FIZA 1C9TA 1Y3XA 5JB9S 1GI8B 4Z6AH 3TGKE 3SU0A 3EYDA 4FU8A 5L30H 1AMHA 2ANWA 1J8AA 2ZGCA 1E1RD 4MNWA 1XKBC 1GHAG 3ZZDA 1UTQA 3QDZB 1P9UA 1SGRE 2P3UB 2WPMS 3UY9A 2CMYA 3C27B 1EPTA 4IC6A 2ZDNA 1TQ7B 1O2ZA 2WPLS 1LPKB 3MNBA 1FI8A 1D3TB 1O5AB 2KAIA 1ZSJA 5CMXH 1F0RA 1GBTA 4MG3A 2QA9E 3L6PA 1DXPA 1ZR0A 3MH6A 4CHAC 5DJ7A 3KQCA 4IS5A 2ANKH 4X6NA 2G52A 3A7YA 5L6NH 1LTOA 5F53A 3ZVGA 2GCHF 3F9HA 1SR5C 1O2HA 3SU5A 5LPFA 1UK3A 3GS9A 5ESTE 3CNRA 4YESB 3BF6H 1HRTH 4TWWA 3LH3A 2XNIA 1N8OB 5A8ZA 4NFFA 2BD8A 1OP8A 4VGCB 5PTPA 1GDUA 2QXGA 1CT4E 3AW1A 4NFEA 4DW2U 1T7CA 4Y8YA 1TIOA 1YC0A 1XUGA 2Z9IA 4E7RG 3HGNA 1OWDA 4ACBA 1SGQE 3A8CA 1C5XB 4ZROA 2ZC9H 2A1DB 3SUFA 1UW7A 5SGAE 4GPGA 1O5FH 2FI5E 4I33A 3RXOA 3MQKC 1Y8TA 1NRRH 3SGBE 1AN1E 3SU3A 1O2IA 1SVPA 3KQ5A 1BQYA 4AGJA 4DG4A 2Z3CA 1OXGA 2AFQB 1DT2A 2THFB 3RXDA 4IW4E 2PKSB 1TPPA 4NIVA 4B76A 5JYIA 1DSTA 1BRCE 3KHVA 2GZ8A 2WZQA 1MD7A 2CXVA 2DUCA 1HPGA 1RS0A 3MMGA 2CJIA 4RSPA 3UOUA 2HLDD 1QCPA 3VG8A 2ZFPH 1VCQA 2VGCC 3BN9A 1K1LA 1VITG 1ID5H 1OOKB 3LH1A 3QN7A 1UTMA 1B0FA 5JBCS 1CE5A 2O8UA 1QL8A 1O2WA 1AKSB 1IQNA 3HKJB 3MU4A 1RD3B 4AN7A 1LHGH 1O2XA 1PPCE 1CBWB 1XMNB 2QF5A 3BTWE 4E06H 1EZQA 2CN0H 3TK9A 3EE0B 5E0HA 1TA6A 1UCYE 4Y79A 4U01A 1CHOG 2JETB 1TABE 1A5HA 4TPYA 4TWYA 3V12A 5AVDA 1CT2E 4Y11E 2TPIZ 1VGCB 1O3IA 3A87A 1GMHF 2BDIA 1LQEA 1HAGE 1LQDB 2YMSD 1H8DH 4OGXA 3VPKA 1P05A 1MZDA 3W95A 3LGTA 5GPIB 2H1UA 5A0BA 2VIVA 3DD2H 1K1NA 3NKKA 1G2LA 2FOMB 5B6OA 2BVRH 1UTPA 3OSYA 4GSOA 2ANMH 1RRKA 2V35A 1GDNA 3LC5A 1TOMH 3UPEA 4JMYA 1BMAA 1XM1A 2RDLA 1UCYK 4X2YA 8GCHF 1INCA 4K3JA 4U2WA 3EE7A 4LXBH 1O3DA 4JYVH 1SL3A 3RXIA 4B75A 1JRSA 3E1XB 2CF9H 2G55A 4GCHG 5CHBA 1HAVB 1BRBE 3ZYDA 2SFAA 5FBIA 3RU4E 3RXSA 4BTTB 2BDYA 1A46H 3MNSA 2UWLA 5AHGH 2W3KA 3F68H 4TSFD 2FLRH 4K60A 1AGJA 2AS9A 5C5OA 2IOTA 2OXSA 1P11E 1YLNA 1C2FA 1OWKA 1SGPE 1UVTH 2GCTB 1O3FA 3FP7E 4J1YA 3SI3H 4M7GA 4IMQA 3FZZA 1AI8H 4YO9A 4TY7A 1P2NA 4I8LA 4AYYB 4ZHMU 4BAOB 4X6OA 1MU6B 1BRUP 2ZU2A 1QGFA 4ESTE 2ZHQH 1GBLA 4XE4A 4DY7B 5LPEA 3T29A 4TY6A 1T4UH 1E35B 3MWIU 5IYTA 1HAXB 1F92A 3MU8A 3SNBA 3PMHB 2ILNA 3FKSD 1C2DA 2IN2A 3SYJA 2XBXA 2SGQE 1ANBA 1AE5A 3MYWA 3EDXB 4IGDA 1BBRE 2BD9A 4F55A 5GCHG 1L0ZA 1FZZA 1UTKA 1TNLA 3D49H 9LPRA 1WAYB 2FM2A 1BCUH 3R0FA 4X8TH 2BQWB 5DN6D 5EGMA 5FPTA 1ZPCA 1EAXA 3F6UH 2FIRH 1XKAC 4K1SA 1C2KA 3NRLA 3QZQA 3N7EA 3OEED 2ZDLA 1MKXH 2VWMA 2JDID 1SGIB 2R0KA 3SV2H 3TK5A 2L74A 1UJ1A 5EW1H 1S6FA 4ABHA 5ABWA 2W3IA 2XXLA 1CA0B 1HAYB 5T6GA 4YOJA 1WXRA 4F49A 3RXUA 1CHGA 2ALPA 4A5TS 1THSH 1FONA 1S82A 3A84A 4Z1MD 1K0HA 4FUIA 2ZCLP 1F0TA 2EQNA 4FXGH 1EOJA 4GHQA 2XOKD 4HGCA 1O2VA 1AVXA 4IMZA 4MLFB 1BTXA 1O39A 3QX5H 3K6ZA 1TX6A 3KEEA 5EQSA 1H8HD 2QIQA 4J2YB 5DKMA 1XUFA 2G4UA 4KP0A 1FNIA 1QBOA 1EAWA 4LZ4B 1QBVH 1V2KT 4BAKB 1WTHD 2FX6A 4JK6A 1V2UT 4NIXA 1QHRB 3ZZ6A 1V2RT 1FQ3A 4WMEA 2BB4A 1MBQA 1C1SA 1NRNH 1CA8B 4FUJA 3D62A 1EFRD 3A89A 2ZQ2A 6GCHF 1DLEA 1GHAF 2V3MA 3SJ8A 1KTTB 1UTNA 1SGTA 2HPQH 4OS2A 3HPTB 1GBAA 4JYTA 1H9IE 4OM9A 1AIXH 3SV6A 1GBFA 1KDQB 2WYJA 3SUDA 4I7YH 1ZOMA 2ZGJA 1GI7B 3TH4H 2EEKA 3O8CA 3CP7A 1SGNE 3FP8E 3M7QA 1BMLA 2XRCA 1GVZA 2OBQA 3ITIA 3GCOA 3H7OA 4Z0KA 3RUOA 3ZV8A 3ZIAD 1O2SA 3FN8A 3UR9A 3CS7A 3RU4T 4Q7YA 3F2FA 2P94A 1FY1A 4MTBA 4AYVB 1J9CH 5C1YA 1CQQA 4KTCA 1GGDC 1MAXA 4FUEA 3RM0H 3M36A 4CRDA 1ESTA 1GI3A 3BG8A 2BD2A 1HGTH 1V2TT 2QCYA 1DY9A 4OS5A 1MKXK 2TGAA 1PPBH 1ARBA 1P02A 3E90B 1Y3WA 2W26A 2ZHWH 2FLBH 4H6TA 2Z6BD 1Z8GA 3IITA 1GHYH 2RDEA 4P00A 4KTSA 1GCTB 1GJBB 2P3TB 2TGDA 5DPAA 1TA2A 3OE7D 2BTCE 2GV7A 1JXPA 1ZMLA 4I8JA 2R3UA 2V3HH 3T27A 1SSXA 3BTTE 2AYWA 2F9OA 1EPTB 1Z8RA 1K1JA 1VZQH 2BLOA 4O03A 2WUCA 3SGAE 4AB8A 3RXEA 4RKJB 3P8GA 2KAIB 2K8IA 2PUXB 3MU5A 2ZFTA 2ZIQH 3BEIB 2RG3A 2ODPA 2W7SA 1O2QA 4UONA 1SQTA 1YCPH 2LNCA 2OCVB 1Z8IB 2BZ6H 4B2AA 1WQVH 2TIOA 4LZ1H 3ATIA 1O3BA 1GMDG 2Z7FE 3I77A 1C5WB 3HK6B 2AMQA 2STAE 3S69A 1O3MA 3K2UA 3AK5A 3F0PA 2BD7A 2V3OH 1P09A 4LK4A 4YZUA 4YLUA 1G3BA 4INHA 1MTVA 3PLBA 1NESE 2H5CA 1LHDH 2PW8H 2H9HA 1AFQB 3QO6A 5DSFA 2QV1A 3BTME 3M5MA 4BAMB 5AF9H 2GVFA 1P2MA 7ESTE 2WV5A 1C4U2 3A83A 8GCHG 4ACAA 3U1IB 4ABIA 1F5KU 3OX7U 1E34B 2J9NA 4DT4A 4RN6A 5JPMH 1EUFA 3RLWH 2R0LA 1FY5A 4I32A 1E79D 2BXUH 2ZA5A 3U9AH 1QRZA 5EQRA 1V2LT 1HXEH 4CR5A 4ISLA 2CHAC 3ATWA 1BOQA 4D9RA 1FX0B 3U69H 2WHXA 2WYGA 3PWCA 1HJ8A 4NZQA 4Y8XA 1BMMH 1N6YA 5KEDA 1W8BH 1O38A 2FYRA 3DUXH 1VCWA 1TPAE 2I6QA 2PTNA 5FXLA 1MCTA 2ULLA 3MO9A 2V6NA 1TNJA 1EJNA 2BDHA 1EZXC 2O8TA 1BJUA 4X2XA 1V3XA 4X2VA 5GJ4B 2YOLA 4NA8A 1Z1IA 1Y3VA 3RXQA 1E1QD 2TBSA 1TQ0B 3F2GA 3TPIZ 1GBEA 2D2DA 5C3NA 1AB9B 1WSSH 5FPSA 3P70B 1KLIH 3FP6E 1W7XH 3RXFA 1YCPK 5DG6A 2FI3E 3BTFE 3E91A 2QAAA 2ZU5A 3OTPA 2ZDMA 2F9UA 1PQ5A 3GISB 1O2JA 1TFXA 2BQ6B 2FOBA 1P2IA 1GL0E 4XRNA 3ZZ8A 5T1VA 5C0UA 4CRFA 2JKHA 3NK8A 1Z6EA 1ZSLA 1QQUA 4NWKA 1OWHA 2WV4A 4K2YA 1AZZA 1PPGE 2BY9X 3LGUA 3FFGA 3KQEA 1O5DH 2SGDE 3F9EA 3IWMA 1TE0A 5GCHF 1BUIA 1NROH 1O31A 1WOFA 1DXWA 2A0QB 3SZEA 2HVXA 4BXSA 2FTMA 3T26A 1IQFA 5CHAB 2OTVA 4YOGA 2PR3A 1FY4A 1KXFA 1YPKH 4Y7BA 2ZTZA 1C4Y2 1N1LA 3M35A 3DHKH 5FAHA 3KGPA 1CGJE 2B5TB 2M2AA 3GCHC 1TGCA 2LPRA 5A8XA 1C1QA 1BMNH 3TNSA 1SGDE 2ZU1A 4UFFH 1W13U 2A4QA 3GCTG 5DP9A 3STJA 2CV3A 2JJ1D 1TNHA 1O5CB 2GJGA 4U32A 2J38A 1O33A 4JYUH 4ABJA 1K2I1 3QK1A 2FODA 1O3GA 1Z7KA 3AAUA 3ZVBA 1HAPH 2GZ9A 2JH6D 1C5OH 3HATH 6GCHG 4TPIZ 1HV7A 1UHBA 2ZCHP 2ESTE 1QZ8A 1LHCH 2BY5X 2ZKSA 4ZKNU 1OYTH 5EPNA 3BIUH 1GI4A 3OFND 1O3PB 2HNTF 2BX4A 1NFYA 1FY8E 1KXDA 1PPFE 2ANYA 3EAJA 1TALA 1BTYA 5TCCA 1SBWA 2XTTB 3B8JA 4X6PA 1ZTKA 1G3DA 1PPEE 2J2UA 3ATMA 2BM2A 3UTUH 3UNQA 5HKKD 2A5AA 1FAXA 4OS6A 1TMTH 3RXRA 5FBEA 3TLOA 5JBTA 2Y82A 1LVOA 1CO7E 4E7NA 2OD3B 2P95A 1IQMA 2B0FA 3N7DA 3P6ZB 2AIPA 3ZZ7A 3SHCH 2F4LA 1T4VH 1TB6H 1HNEE 4FU9A 4NWLA 1PQ7A 1D3DB 4SGAE 1HUTH 1SGYE 1IQIA 3MFJA 4ZAEA 3IG6B 1JMOH 1FV9A 5E2OA 1T31A 4F48B 1UCYH 2BDGA 2BLWA 5DP5A 1YCPM 1A0JA 2ZF0H 3RM2H 1C5ZB 3MI4A 2C8ZB 1V6DA 4OS7A 2ZQ1A 3ATLA 1C5PA 1P9SA 4HG6A 4AFZA 3AASA 4AG2A 3FZDA 1ZPBA 3UREA 2AMPA 1FJSA 2Y81A 1W10U 3MU1A 1LHFH 2BD4A 5HM9A 4AGKA 1XUKA 2PGQB 3KCGH 4PROA 3U8TH 4E05H 4ABAA 1N8OC 2NU3E 4HFPB 4LOYH 1C1WH 1O36A 2TRMA 4VGCC 3LJJA 4WMDA 1F5LA 2NWNA 4XFQA 1G2MA 2ZHEH 1K9OE 2Y7ZA 2UWPA 1D6WA 1OS8A 3SUEA 3M5OA 1ZSKA 3RP2A 2FI4E
chains in the Genus database with same CATH topology
3VB4A 2ZTXA 3D23A 1FDPA 1SMFE 5C2ZA 2QXHA 1NY22 3RLYH 1UK4A 3GYMA 1C1VH 3UNSA 3PLPA 1GJAB 3C1KA 1QA0A 2FS9A 4MDSA 1TX7A 1BZXE 1F2SE 1DFPA 1GI9B 9ESTA 1GWAA 3EA8A 3TIUA 5C20A 1Y3YA 2VH0A 1IOEA 1P3CA 2QF3A 2PKSC 1WUNH 3A7VA 1SLWB 1TWXB 1C5YB 1OKXA 1J15A 4ZXXH 1NU7B 3F1SB 1ZMJA 1QJ7B 4I8GA 3A82A 1TPOA 3GCNA 2J95A 2W7UA 2ZPRA 3OY5U 2A7HA 5C1XA 3TVJB 1X7AC 4X0WU 4DIIH 1BHXF 1GMDF 2B7DH 3RXMA 1JWTA 2BX3A 3K6YA 3QGJA 1QB6A 4KGAA 1Y5BT 2QXIA 3ZZBA 5C5NA 3O8DA 2M5TA 3MH7A 1ZJKA 2ZHFH 1CBWC 3PYHA 4INLA 1A0LA 5FCRA 2EI8A 3SOSA 2XC5A 1BA8B 2XBVA 4WVPE 1BBRH 1QIXB 1NRQH 3U1JB 2GZ7A 3AVZA 4Y6DA 4AOQA 2JETC 4K69A 2FOCA 5BPEA 4CBOA 3UQVA 1L2EA 2FO9A 1VGCC 4X8UH 3RXCA 5AFZH 1NTPA 3ZZCA 2EA3A 1O2RA 2BY8X 3DFLA 2D8WA 4K1EA 3GY3A 1HJAB 3PB1E 4CH2B 1B7XB 1K1IA 2FEQH 3L3TA 2JH5D 1O3OA 3M7UA 4RKOB 1QB9A 4Y10E 3UIRA 2UUJB 2P16A 3GY6A 3NUMA 2PSXA 1O2TA 2YNBA 1A61H 2ZDKA 1G36A 1HIAA 1OP0A 1BHXB 3SNDA 2Q6FA 4CRAA 2ZGHA 1TNKA 4FUCA 3ZVEA 2G4TA 4NA9H 1OWIA 5A0CA 1IHTH 2G00A 1NT1A 3MH5A 4FVBA 3PMJA 1W0YH 5DP8A 1ZTJA 1SPJA 3W94A 4XBCA 4ABDA 3KQDA 1LVBA 2QXJA 3SN8A 1AY6H 1HXFH 5HYOA 2HALA 2Z9LA 1ACBE 2RA0A 1P57B 2VVCA 1C5MD 2GCTC 3H5CB 3JZ2B 3PWBA 1SOTA 2OC7A 3BIVH 1C1UH 2A45B 5FPYA 4HI3A 1DDJA 3ODFA 1HBTH 2XCFA 3T2NA 4AB9A 2G81E 2SGFE 2FOGA 1P0SH 2PHBA 3B9FH 2VIDA 4I31A 1O34A 3SV8A 2FP7B 3ATKA 4JZDH 4D76A 4ABBA 3M3VA 3SUGA 5F8ZA 3RMNH 3MO6A 4D7FA 2AERH 2ZZUH 2IJOB 1NPMA 4X6MA 1S0QA 1KXEA 1UVPA 1ESBA 5DP7A 1UMAH 5A2MH 3A8BA 1ZGVA 2BHGA 2ZDVH 4U30A 2P3FH 4FU7A 1BRAA 1DS2E 1CSOE 1DWBH 2A7JA 8LPRA 1EZSC 3ZZAA 1UVSH 4B2BA 4XDEA 4ABGA 1OYQA 1U6QA 4X1PU 1F7ZA 5FX6A 1FIWA 1GVLA 2NU4E 3Q00A 3SZNA 1QQ4A 4SGBE 3STIA 1QNJA 3OYPA 2QC2A 1RFNA 1UVUH 1YBWA 1BBRK 1DICA 5I25A 2AGIX 5C1UA 2R3YA 3F9GA 1HJ9A 4X2WA 4D9QA 1NFUA 1SC8U 3K9XB 1GJ6A 1NU9A 1LKBA 2ZI2H 2QGRA 3TJOA 5TCAA 2PLXA 3S7KB 1SQOA 3ZVCA 2WINI 2R2MB 4A1XA 1ZYOA 2ODYB 1AVGH 1LO6A 2FESH 1YM0A 3O8BA 3QTOH 3UNRA 5J4SA 1ESAA 4CR9A 1IAUA 1CA0C 2Z3EA 4THNH 4R8TB 3GCTF 3MOCA 1O3AA 3A7ZA 2BLQA 4CH8B 1KLTA 5GXPA 1H9HE 3SBKA 4YTAA 1G30B 2O8LA 5EPYA 2FZZA 2AH4X 5FHTA 3GY7A 2A32A 3RXLA 1Q3XA 2VIWA 1EOLA 4OS4A 1C1NA 2YNAA 3AW0A 1P2KA 1SFIA 3SNAA 2ZECA 4FVDA 2OC0A 2BD5A 1YLCA 1TLDA 4AORA 4H42U 1O2MA 4ZKRU 6CHAB 2A31A 1WCZA 5HGGA 1TBQH 1UO6A 1LKAA 2Z94A 1GG6B 3H7TA 1Z6JH 1W0ZU 3QUMP 1IQGA 1HAOH 3M3SA 3T25A 5E2PA 2BXTH 1AFEH 4TYDA 2A4RA 2Y5HA 2HOBA 3OU0A 1TRNA 1RIWB 1Y5UT 2ZP0H 2GV6A 3A7XA 5EOKA 2PV9B 1EJMA 3SO3A 1ELBA 1IQHA 3E8LA 2C93B 2FYQA 3SHAH 3S0NA 1O2KA 5AFYH 1PQAA 3GDVA 1FLEE 2FXRA 3E0NB 1QRWA 3MH4A 5DP4A 5DO4H 3SI4H 5F6MA 1K1OA 1NS3A 1SOZA 3PMBB 1LCYA 1FAKH 3E6PH 3LJOA 1Y59T 1GJ5H 1O2PA 1V2OT 3LGIA 1UHBB 1GL1A 2FPZA 1DPOA 2OLGA 2SGAA 3T5FH 3UWIA 3TNTA 4Q7XA 1Y5AT 3BTKE 2BYAX 2WUBA 1C2JA 3UQOA 1AUTC 2PGBB 1MMJN 2Y5FA 1O3KA 1DWDH 1EP6A 1O3NA 3RXPA 1VITH 4X8SH 1RJXB 1GCTC 4XBBA 3PO1B 1C9PA 2OC8A 1K1MA 1QL9A 1MTWA 7KMEH 1J16A 2GD4B 4Y76A 3KNXA 1E0FD 4NG9H 4AFQA 3SNCA 1EPTC 2AMDA 1MTSA 3QGNB 2R2WU 5HM2A 3DFJA 1ELCA 1Q2WA 3U8OH 2FOAA 2J94A 1O3JA 1ZRBA 4OGYA 2STBE 2ZFFH 1ABIH 2F9VA 2NU2E 5J4QA 2QYIA 1P2JA 1WBGB 3SU4A 2Z3DA 6ESTA 1GHBF 1XUHA 2OBOA 3LOXA 4YT6H 3P95A 1K22H 1P06A 2BOKA 3PLKA 1A4WH 2HWLB 2ALVA 1D4PB 3DA9B 4ISIH 3PTNA 1C1RA 4A1VA 3E16B 1RTLA 2BD3A 3LKWA 4XBDA 2A4OA 3URDA 1VR1H 2ASUB 1HAIH 1AD8H 1HCGA 4WH8A 1NRSH 2A5IA 1C5UA 1SI5H 5LH8A 4X1SU 3PROA 2JH0D 2VU8E 2DE9A 4DOQA 3RDZA 3BV9B 1SHHB 1SFQB 2GMTB 1AFQC 4GVUA 1W12U 1EX3A 2GDEH 3UFAA 1RTFB 3GY2A 1ZLRA 1QY6A 3BG4B 1TX8A 1MAYA 4XOJA 4B74A 4JZEH 4GUXA 2AIQA 3A80A 1G3CA 1EP5A 4KKDA 2R9PA 4ZUHA 4YM9A 3RMOH 3I78A 2QF0A 5JBBS 1P2QA 1BIOA 1F5RA 2NU0E 1HLTH 1XXFA 1ZJDA 1GVKB 1TAWA 4X1RU 1GHZA 1AWFH 5T3HA 1SB1H 3SJKA 5LPRA 1V2WT 4XSKU 4MPVA 1C1TA 2W5EA 4H6SB 1QTFA 3ZVDA 1W3CA 4CBNA 3V7TA 2GT7A 3FAOA 1EAUA 1T8LA 2SNWA 3CENA 4O3UA 1IQKA 5FX5A 4ZXYH 2RCEA 1MQ6A 2G8TA 4B2CA 1G9IE 5K7RA 1RTKA 1O2YA 2VIOA 1BB0B 6LPRA 4FUGA 1BTPA 1OWEA 1FMGA 1T8NA 1PFXC 1P3EA 1P8VC 4AFSA 1AB9C 1C5RA 4O9VA 5T6DA 1T8MA 3NPSA 3RXVA 1V2ST 1O2OA 1NC6A 3OY6U 1CGHA 2NU1E 1P03A 1S5SA 5A8YA 7GCHG 2EC9H 2A2XH 1ELDE 4WXIA 1MTNB 3A7TA 1KYNA 1HAZB 2ZHDA 3ENSB 1IQEA 1GI5A 1SLUB 3VGCB 2QN5T 5GIBA 1HIAB 2A5KA 2Y5GA 3GYLB 2VINA 1KIGH 4D8NA 4NGAH 5H4IB 4UFDH 5L2ZH 3ZZ5A 1O3CA 3ESTA 3RXBA 3ZZ3A 1QA7A 5A09A 2C90B 4WF8A 1OP2A 2F9NA 3VXFH 1YKTA 1K21H 1YLDA 2FOFA 2F9PA 2Y80A 5CHAC 1DX5M 4DURA 3LDXH 1O3LA 2TGPZ 2GKVE 1SG8B 4UDWH 5E0JA 4YLQH 1E37B 2O8MA 1PJPA 3VGCC 3Q76A 1EKBB 1MKWH 1L4ZA 1GI0A 3N7OA 5C67A 4JZFH 3I29A 3B23B 2ZGBH 4NIYA 1MD8A 4Y0ZE 4CHAB 3RXJA 4GAWA 3QTVH 3SJ9A 1GBDA 5TJXA 1W14U 1UK2A 1ZTLA 4WWYA 4Q80A 1C1OA 4CRCA 2BLVA 1EZUC 2ZPSA 2J34A 4BNRA 1QL7A 1GBBA 1ELEE 3M7TA 4BXWA 1FN6A 1HAHH 3ZYEA 1AE8H 1ZHPA 1A0HB 3HK3B 1RGQA 4WJG2 2XWAA 2P59A 1WTGH 1YPEH 4OS1A 2CF8H 1GJCB 3PV4A 4GLYA 1NFXA 3SU2A 1GJ4H 1ARCA 1S84A 4ZKOU 1DWCH 2VWLA 3S9AA 1TBZH 3QZRA 1YGCH 3TGIE 1GCDA 2XW9A 1TYNA 1DWEH 1P04A 1GHXH 1CVWH 3ELAH 1ZHRA 1ZPZA 1THRH 2HNTE 2HRVA 1DSUA 3MHWU 1BDAA 3R3GB 5FCKA 2VWNA 3TJNA 1T8OA 1N6XA 5ESBA 1V2PT 4HZHA 4A6LA 1DANH 4Y0YE 1S6HA 2VNTA 4BAHB 3G01A 2XWBI 2Z9JA 3A86A 5EU8A 2FOHA 1YPLH 1A3BH 3P17H 4Q7ZA 3MNXA 2VH6A 3SJIA 3MNCA 2SNVA 1E36B 2GGVB 3JZ1B 4K5ZA 4ZH8A 1SGEE 1ZRKA 1QFKH 4WXVA 1XUIA 2XCNA 2Y6TA 2A7CA 1LMWB 2OUAA 2HNTC 1NRPH 2VWOA 1Y3UA 2VGCB 4IBLH 1TONA 1MZAA 1O32A 4K8BA 1C1PA 3A88A 2O8WA 1EB1H 5EXNA 4IC5A 3RXGA 3LPRA 3MTYA 3QLPH 1C2EA 3BEFB 3UR6A 1UVOA 1L1JA 3VB6A 1ANEA 1QR3E 3PTBA 1UTJA 3F9FA 2OQUA 2FTLE 2Q6DA 1P2OA 1EJAA 1D6RA 1MKWK 1PPHE 1QRXA 1ABJH 1ETSH 1GHBG 1LDTT 3D65E 3M37A 1DY8A 2G5NA 3AAVA 4AZ2B 2ZFRH 1GJDB 1TGTA 1BTHH 1C5QA 1DOJA 1ELGA 4CRGA 3VB5A 1O30A 2F3CE 3EGKH 1VJAU 4AFUA 1GMCF 2PKAA 2Z9KA 3GDUA 5DP3A 4NIWA 3SJOA 4R0IA 4B1TA 2HGTH 1RXPA 3HKIB 4H4FA 3ZVAA 3RXKA 4NZLA 5BRRE 3FANA 3TU7H 1HFDA 2BDAA 2ZFQH 1C5SA 1C5NH 1S81A 3UWJH 1TRYA 3BTQE 4X1NU 3LGYA 3RXTA 4BTUB 3EA9A 2VIQA 3GDSA 1C2HA 2ZFSA 3SNEA 3GOVB 1Q31A 3P8FA 1O35A 1VCPA 1O3EA 5F8XA 1SHYA 4I8KA 4JZ1A 4DJZB 1GPZA 1O0DH 4ABEA 4MNVA 1O5GH 1XUJA 2H2ZA 2ZO3H 3T28A 2Q1JA 4CRBA 8ESTE 1QJ6B 3Q3KA 3K65B 2AGEX 3M5NA 2TGTA 1GBHA 3RC4A 3O8RA 2FWWA 1Z8JB 1LVYA 1YPGH 1LHEH 2GP9B 1UTOA 2ZU4A 5JDUB 2XBYA 3TH2H 1P10A 1THPB 3M61U 2EI6A 1F0SA 1F0UA 4IN1A 3BTDE 3T62A 1IQLA 3Q3YA 3BSQA 2ZEBA 2SGPE 1A2CH 3P92A 1HJAC 1V2MT 2UWOA 1MUEB 2BY6X 1XVOA 5IDKA 1GBKA 2QY0B 4NSYA 3Q3XA 2ZNKH 3LONA 1GDQA 3EQ0H 1Z71A 2D26C 1JIMA 4DCDA 1BTZA 1GI2A 3BTHE 4FUHA 1J17T 1MTUA 2C8YB 3NWUA 4WH6A 1OX1A 2F9BH 1BTUA 1KSNA 2VVUA 2VJ1A 3NXPA 1BTWA 1V2VT 2FDAA 1GJ9B 3NZIA 1XVMA 1K1PA 1PYTC 2BVXH 1A7SA 5DGJA 1VJ9U 3S9CA 1G37A 1CT0E 4MPWA 1ZZZA 1C2LA 2Q6GA 1BITA 1HDTH 2OINA 1KLJH 4A1TA 3V0XA 1ANDA 1C2IA 1C5TA 3ODDA 1L1NA 1V2NT 1GI6A 1OPHB 3A8DA 5F8TA 2A2QH 4Y7AA 2OP9A 1OSSA 1FUJA 1GBMA 3TITA 1MQ5A 1C2MA 5EG4A 4JK5A 5JBAS 7GCHF 1KTSB 1TGBA 1TBRH 1YPHE 1B0EA 5EODA 2BOHB 4AG1A 4B71A 2CGAA 2PSYA 5L2YH 3SORA 3VEQB 2PTCE 1FPCH 2DE8A 3ZZ9A 1D9IA 3GICB 4DVAU 2H9TH 2XC0A 1BT7A 1AZ8A 4A92A 1AUJA 1SGFA 2ZG0H 1ELVA 3VFEA 1SGFG 2AGGX 1TMUH 2G51A 3VB7A 1MCVA 3KF2A 2P93A 3TJVA 1CGIE 2PWXA 2F83A 1NFWA 1YPHC 1GHWH 1WV7H 4QT8C 3SW2B 1GJ8B 1WQSA 2UUKB 1TRMA 5HXFA 4ISHH 3TK6A 4ISOA 1ETTH 3BEUA 3V3MA 4UEHH 4MNYA 2A4GA 3LIWA 2SGEE 5T6FA 3OTJE 1BJVA 4UFGH 3UUZA 1SLXB 1AWHB 1DLKB 2O9QA 1HYLA 3QWCH 2WPIS 2GCHG 3GY8A 1CU1A 1XXDA 2C3SA 1OWJA 3PMAB 1GGDB 1EATA 1L4DA 1DUAA 1FN8A 4AX9H 1NZQH 1KY9A 1MBMA 1DUEA 5DP6A 5JB8S 1T32A 1O37A 4YT7H 2ZPQA 1AKSA 2OC1A 1NM6A 5F03A 1O5EH 6CHAC 2V0BA 1KXAA 3M3TA 1C4V2 2BDCA 3E0PB 4NCYA 1JIRA 3S9BA 4O97A 2D1JA 1S0RA 4DIHH 1GG6C 1P12E 2ZTYA 3GY5A 1JOUB 3LU9B 4Y8ZA 4DGJA 4GHTA 1LPZB 3EA7A 1SGCA 2AEIH 2GDDA 1AO5A 1C1MA 1RIWC 1E38B 1C5VA 1KXCA 4KTUA 1D3PB 2ZDAH 5I46H 1YYY1 3RMMH 1ORFA 1TNGA 1SQAA 4MVNA 3A81A 5EXMA 3ZV9A 1JBUH 3RXAA 4FUBA 3SU6A 1DVAH 3BTEE 1H4WA 4NSVA 4BOHA 5GDSH 1PPZA 1PQ8A 2WPKS 2P8OB