4ISNA

Crystal structure of matriptase in complex with its inhibitor hai-1
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
241
structure length
241
Chain Sequence
VVGGTDADEGEWPWQVSLHALGQGHICGASLISPNWLVSAAHCYIDDRGFRYSDPTQWTAFLGLHDQSQRSAPGVQERRLKRIISHPFFNDFTFDYDIALLELEKPAEYSSMVRPICLPDASHVFPAGKAIWVTGWGHTQYGGTGALILQKGEIRVIQQTTCENLLPQQITPRMMCVGFLSGGVDSCQGDSGGPLSSVEADGRIFQAGVVSWGDGCAQRNKPGVYTRLPLFRDWIKENTGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of matriptase in complex with its inhibitor hepatocyte growth factor activator inhibitor-1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Kunitz-type protease inhibitor 1
total genus 54
structure length 241
sequence length 241
ec nomenclature ec 3.4.21.109: Matriptase.
pdb deposition date 2013-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4isnA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4isnA01
2Y5FA 1NT1A 2ANWA 3A7XA 1L4ZA 1O2SA 4YTAA 3OTJE 1A1RA 2ZFFH 3PM3A 3GYMA 1PQ7A 3KGPA 1AWHB 1KXFA 1SLVB 1TNLA 4ZXYH 1GMHG 2BQ7B 1Z1IA 2J94A 1A5HA 3QTVH 5EGMA 1EB1H 1THSH 5FPTA 1D6WA 3UWIA 3TGKE 1WSSH 2G00A 4FUFA 2GVFA 4ABEA 4A92A 1KTSB 2G8TA 1O39A 3BTKE 1DLEA 1NPMA 2G4UA 1O5GH 5CHAB 1HAGE 1P04A 1ZPZA 2ZGCA 4Y8XA 2AMQA 3GDVA 3SNDA 1RRKA 1PPZA 1A61H 5LPEA 3CS7A 2ZO3H 4FU9A 1DDJA 1QRWA 1HAVA 5EOKA 2OBOA 1GHAF 1V6DA 4WH6A 1PPBH 2P93A 1AGJA 3QZRA 1VGCB 5AF9H 3MU1A 2JETB 1AD8H 3P92A 2GT8A 4WH8A 2A32A 2Z94A 2ZQ1A 4ZROA 1ANBA 5FHTA 4YO9A 1DWEH 5HXFA 4DT7B 3SJKA 1C2MA 4K69A 3SQEE 3S9BA 3SUDA 1RIWC 5A0AE 1GJ4H 4ZHMU 1BMLA 2ZEBA 5DKMA 4IS5A 2FOBA 3ZVBA 4OS6A 1PPCE 1G3CA 1AIXH 1EKBB 1LQEA 1N8OB 2HWLB 3A7ZA 1BTZA 2W5EA 3U8RH 1O5FH 4MPUA 3A82A 1GJ7B 2QN5T 3ESTA 2XNIA 1OWIA 1P01A 3O8BA 5FBIA 1B5GH 2GP9B 1CA0C 3O8RA 4LZ4B 4FUJA 2FTMA 2CHAC 4MNWA 1QGFA 4F49A 1IQEA 4X8VH 1Z8JB 1D3QB 1OKXA 3L3TA 1KLIH 7LPRA 1YPEH 1WU1A 4UDWH 3SUEA 1AQ7A 2XCFA 2FWWA 4WMEA 3H7OA 3RXRA 2ZU4A 3RXBA 1O3FA 4SGAE 1MTNB 1BRAA 2A5IA 1AVWA 2BTCE 3GY4A 1P3CA 5FCKA 1VJ9U 4NA8A 1F92A 4FUIA 3SGAE 1Q3XA 3PWBA 3TGJE 2CGAA 1EQ9A 3SV6A 3LC5A 4BAHB 2GMTC 3ATLA 4MG3A 1ZMNA 1BBRE 3GCHB 4I8LA 3RXKA 2CJIA 1O3EA 5GDSH 1QRXA 2FS9A 3DUXH 1XXFA 2PGQB 1BOQA 2BD8A 4K3JA 1O34A 1ARCA 3BSQA 2V3OH 1P2OA 3GY5A 4CBOA 1W12U 1DXWA 1C5YB 1LHFH 2PUXB 2V0BA 1OWKA 1Q2WA 3LU9B 1DUAA 4JCNA 1BTWA 2AGGX 5EODA 1AMHA 1FY8E 1T32A 2AIQA 5LPRA 3KQDA 1EB2A 1S81A 3Q77A 2UUYA 2HNTC 4JYTA 1RD3B 3AW0A 5AHGH 2RA3A 1C4V2 4CREA 5CMXH 3LGVA 1L1JA 4GUXA 1ARBA 1NFUA 9ESTA 1SI5H 2BB4A 2C8XB 2V35A 2ZPSA 1CA8B 4K1EA 1CGJE 3UOUA 3MO3A 1AVXA 2NU3E 1BCUH 2FLBH 1Y3VA 2XYAA 1GI4A 3R3GB 3EQ0H 8LPRA 2EI8A 2PHBA 3MU0A 2WPLS 3LJJA 4X1NU 1ZRKA 1DY9A 1Y5AT 2R3UA 3RXOA 3RXSA 4CRFA 4MNVA 1GJ5H 1O35A 1ANCA 1WQSA 1Z6EA 1VCPA 2FLRH 2ZF0H 1HAVB 1GMDG 2FX6A 2WV5A 4BTTB 2HOBA 2R2WU 1GBLA 1C5ZB 5A09A 5LPFA 1SVPA 1TPPA 1C2EA 4MQAA 3G01A 1UTMA 2XC5A 4B71A 2ZP0H 1G3BA 5C1YA 3RXMA 1AN1E 1J17T 3P70B 2P3TB 2B0FA 5A8XA 3NCLA 3NWUA 6GCHF 5AFZH 4R0IA 2ZWLH 4WF8A 1GI2A 1A4WH 2BD7A 1L4DA 1S6HA 2WYJA 2A5KA 1LVOA 2JH0D 3SN8A 1B7XB 3RMOH 3RUOA 3SU6A 2QIQA 2OCVB 1KTTB 3A81A 4VGCC 3UR6A 1WYKA 2BY9X 3MNXA 4BXSA 1G3DA 5FAHA 2A7JA 1GCDA 3AASA 4ZKNU 5DP9A 2FS8A 4HTCH 2Z9GA 4E06H 2NWNA 2FOGA 2BDCA 1JMOH 1DE7H 1LCYA 1O2RA 3QUMP 2FIRH 4KTUA 4HZHA 2F9NA 1YCPM 4YOJA 4AN7A 3GYLB 1E34B 1ESTA 4PROA 1TGBA 5ESBA 1ZRBA 2A4QA 1OP0A 2ZCHP 1C2DA 1PYTD 4GCHF 1AHTH 1O3KA 1KXCA 3FVFB 3TH2H 3K65B 3VXFH 1DICA 2PKSB 4X0WU 1YGCH 3RXVA 5GCHG 2ZGHA 3V0XA 1FQ3A 5LGOA 2ZC9H 4BANB 2Y5GA 1FIWA 3K2UA 3P8FA 2BHGA 3MO6A 2ZGXH 1QL8A 2GD4B 3SBKA 6CHAB 4WMDA 1ZGIA 2PW8H 4RN6A 1D3PB 1C1MA 5FBEA 1P2KA 3VFEA 1P2JA 4I31A 3KQEA 5JYIA 4TPIZ 1OX1A 3F1SB 2B9LA 1OOKB 1JXPA 3M5NA 1RJXB 1YPHE 3GY7A 1DM4B 1BJUA 4NSYA 1V2QT 2FOHA 1C5RA 4ZHLU 1MTUA 3UREA 5EPNA 3EE0B 3MH6A 3M35A 1Y5UT 1CHOF 1BT7A 1QR3E 1H9IE 1VGCC 2XWAA 1YPMH 1GBBA 4OS7A 2DE8A 3L6PA 3BEFB 4X2VA 5EXLA 4DGJA 2CF8H 4JMYA 4DOQA 4K2YA 1MAYA 1TPSA 5DJ7A 3LGWA 2HLCA 1SHHB 3JZ2B 1JRTA 2J9NA 2ZDKA 1BBRK 4GAWA 2EI7A 2C3SA 1QBNA 2ODYB 3UWJH 4IGDA 4YT7H 5JPMH 3SW2B 3ZZ9A 4ABJA 1C1QA 1CT4E 2WUCA 1WV7H 2OTVA 3F9GA 3OU0A 5EW1H 3T62A 3FFGA 5CE1A 5HYOA 1CA0B 1QQ4A 1BTHH 3PMBB 1DLKB 1JBUH 4M7GA 5TJXA 4WXVA 3OY6U 1HYLA 2ZDNA 2OLGA 3ENSB 4D9QA 1O37A 1KLJH 1LQDB 3TJUA 4RKJB 1TNIA 3ATWA 3S9CA 4KTCA 5ETXA 2RA0A 4B76A 2H6MA 2VIQA 4CBNA 1EP6A 3E1XB 2R9PA 1TE0A 1TGNA 1KXBA 3Q3YA 2J4IA 2XXLA 3ZVCA 5DP6A 3PLBA 2ANYA 3RXAA 2BD3A 4X6MA 3V13A 5F8XA 2OQ5A 3B9FH 5C20A 1HXFH 2PR3A 1ELBA 1GHAG 4B2BA 1O2LA 3P6ZB 4B73A 2BLWA 3SJ9A 3LT3A 4UEHH 1FAXA 3CENA 4ISNA 3AW1A 1HIAA 1HAHH 3ATKA 2CN0H 2I6QA 3SGBE 1HXEH 3TJNA 3MH5A 1NFXA 1H9HE 3BTHE 3A7WA 2ANKH 2Z7FE 1INCA 3LJOA 1W10U 2SNWA 1O2HA 4INLA 1C2GA 3VGCB 6CHAC 4CRBA 2ZU2A 4NGAH 1CGIE 2TGTA 4B2CA 3A8CA 4FUEA 1NZQH 3F9HA 1V2WT 1X7AC 1YPHC 2IOTA 3GY6A 1N1LA 1K1NA 1L2EA 1CQQA 2ULLA 2J95A 3MU8A 2P94A 4U01A 1OYQA 4WXIA 1A0JA 4MLFB 1SGNE 1GHWH 5JBAS 1SB1H 1Y3XA 2H9EH 2V3HH 2G4TA 1AY6H 1C5VA 1LO6A 4BXWA 3P17H 1AKSB 1O2OA 5C2ZA 4Y0YE 1SGQE 3ZZ5A 2DUCA 1O38A 4YESB 2VH6A 3PTNA 2FOAA 3M3VA 1Q31A 3BTWE 4X6NA 1MKXK 2PSXA 2UUJB 3S9AA 1BIOA 8KME2 1GBIA 2G55A 1THRH 2GTBA 5ESTE 4LK4A 1HAPH 1G36A 4DIIH 1C5XB 1T4VH 3T25A 4Q7XA 1P3EA 2UUFB 3DFLA 1WCZA 1TX8A 1LHGH 1JIRA 1BMNH 3ITIA 3MO9A 1KDQA 1ZHPA 3M5OA 4ZMAH 2A31A 1TNJA 2BDYA 3P8GA 1GG6B 4NZQA 1C4U2 5GXPA 3KEEA 5B6OA 2BLQA 2GCTC 4X8SH 4WWYA 1EAIA 4HFPB 5JB9S 1ZZZA 2Y5HA 2ZHDA 2F9OA 3U8TH 4D9RA 3OSYA 2VNTA 4U30A 3FANA 3RXQA 1P05A 1KIGH 2Y82A 1ELAA 3BV9B 1ELVA 2BMGB 4BAQB 2GGVB 1A3BH 2AGEX 1GPZA 2ZDMA 1O2YA 2SGEE 4IMZA 3E0NB 3E6PH 3VXEH 1QFKH 3V3MA 1C1OA 1O2JA 2A7CA 2BVSH 3H7TA 3IWMA 3EYDA 1W8BH 4WJG2 5EXMA 2YOLA 3MNCA 2FESH 1SGEE 3LOXA 2JH6D 5EPYA 1NY22 1GHBF 2GCHG 1UHBB 3NPSA 5EU8A 1UHBA 3RXLA 4XOJA 2BVXH 5A2MH 1P9SA 2F9VA 2A4GA 1IQGA 4DJZB 1QJ6B 1MTNC 1O30A 1Z8IB 1XXDA 3URDA 4GLYA 2OUAA 3RXGA 2NU2E 3RC5A 1F0SA 3A85A 1CVWH 3SU0A 1K1JA 4E7NA 3EA7A 1HAIH 3SV7A 1TB6H 3U8OH 2BXUH 2VWNA 2SNVA 2Z9IA 3PROA 2W26A 1YCPK 3SU2A 3UIRA 4WMFA 2BD2A 3SU4A 3SJIA 4D76A 1IQFA 4I7YH 2W7UA 1O32A 3RU4T 5DO4H 1QQUA 1TGCA 1TNGA 2NU4E 4BNRA 2ZHEH 1A0LA 6GCHG 2NU1E 1GI1A 4BAOB 1SGPE 7ESTE 5E0JA 1O3HA 3SNBA 1J16A 2QXJA 4J2YB 4U2WA 2F9UA 3RXDA 1GVZA 4R8TB 1O2IA 2RDLA 1UTJA 1C5SA 4Q7ZA 5SGAE 4ZAEA 1NESE 4ABDA 3SNEA 1A3EH 3GCHC 4FVBA 1UK3A 1FIZA 1V2UT 1GHYH 2HPPH 4CHAB 4KP0A 2W3IA 1C5PA 1AZZA 1WOFA 1WTGH 1EOLA 1W0YH 3V7TA 2A5AA 2VGCC 3HATH 5BPEA 1BRCE 5FPSA 1ZTJA 4X6OA 3TU7H 4ABIA 2VVUA 4XSKU 1SGFA 1MQ6A 4ZUHA 4MDSA 2THFB 2ZTXA 1J8AA 1QA7A 5JBTA 4MTBA 3R0FA 3E90B 3SJOA 1EZQA 1NRNH 4INKA 1O31A 4AFUA 4I8HA 4GCHG 2ZFRH 1EUFA 1S0QA 3Q3XA 1EASA 2ODPA 4AFZA 4Z6AH 1TYNA 1K21H 4UFGH 3RXHA 2XWBI 2ZDAH 5AFYH 4H6SB 2ZA5A 1XMNB 2ZGBH 2FMJA 4UFEH 1Z7KA 2OBQA 5H4IB 1N6YA 1ZSJA 2BDAA 1FI8A 1BMAA 1UTLM 3UR9A 1MAXA 4ISIH 5BRRE 1AWFH 4A5TS 1L1GA 2BOKA 3ZZDA 5GIBA 1DVAH 1K1MA 1Z8RA 2F9PA 4B2AA 5JB8S 1T8LA 2HPQH 3M37A 1TRMA 1VCWA 3TIUA 5EW2H 2C8ZB 2BDHA 2B7DH 2FO9A 1UVTH 1EATA 3SJ8A 1GJAB 1GDQA 3MH7A 1ID5H 5HGGA 1C5WB 2ZFQH 3VEQB 1KLTA 1EJAA 2ZU1A 1ZGVA 4ZKRU 4B74A 1GWAA 2GV6A 3RMLH 1Z1JA 1D4PB 1QB9A 2A4RA 3I77A 1P09A 1T8NA 1MCVA 1XUKA 1O3BA 2F3CE 3ZYDA 1G30B 3UUZA 3EA9A 1HBTH 1GHBG 1SQAA 3LGTA 3BIUH 1HPGA 1O33A 3LH3A 4DCDA 1GBKA 5L2ZH 1O5AB 3SUFA 1C1NA 2D26C 1F5RA 3K6ZA 2Z9KA 1M9UA 1YF4A 2BD9A 1V2PT 3P8NA 2PV9B 2AMPA 3U1IB 1ELGA 5A0BA 4ABFA 1O3JA 1IQHA 4AOQA 1IQNA 1SR5C 2KAIA 3KIDU 2TBSA 5C3NA 4I8JA 3TITA 2H1UA 3MHWU 1OS8A 2ZIQH 1C1TA 2A2QH 3U1JB 3D49H 1LVMA 2O8UA 2ODQA 4GVUA 1O2KA 2ALPA 2ZCKP 1TX6A 3PV4A 1S85A 5LH8A 1DFPA 1W14U 3GCTG 1FV9A 4DURA 1UTPA 1QURH 1MU6B 4DIHH 1ANEA 3A80A 4Q7YA 1H9LB 2BZ6H 1AE8H 2GKVE 1EPTC 1A46H 2GZ9A 1CE5A 1OWHA 3S69A 4U32A 2GT7A 4XFQA 1HJ9A 2HGTH 4HI3A 1HRTH 4IC5A 3BTME 1JOUB 1GMCG 1ELFA 2LPRA 3RXTA 1KXAA 3CP7A 4YZUA 5F03A 2TGPZ 1IOEA 2W3KA 2ZFPH 4X2YA 1QIXB 2AYWA 1EP5A 1TABE 1AU8A 5F6MA 5TCAA 1FLEE 3BTDE 1ANDA 2D8WA 2XRCA 3WY8A 2VINA 5F8ZA 1HCGA 2PSYA 1J9CH 1GI3A 2PGBB 1ZMJA 1GBEA 3OY5U 2HRVA 1W0ZU 1TX7A 3ZVDA 1EZUC 1J14A 2FI3E 1C5OH 4CR9A 1E0FD 2WYGA 2ZFTA 1IQLA 4JZEH 1YYY1 1RTKA 1O2ZA 4ABGA 2D1JA 3DD2H 3KF2A 1BRUP 3F6UH 1UTKA 4KKDA 1NFYA 2AMDA 2ZU5A 3NK8A 3TH3H 1ZPCA 2BLVA 1TLDA 1YCPH 1DXPA 1FN8A 2IJOB 1C9PA 3FAOA 1EPTA 1IQIA 2BQWB 2PKAA 2JH5D 2DE9A 2FOMB 1ELTA 4NIYA 4A1VA 1EAUA 1DSUA 2VIWA 2QXHA 2FZZA 1NS3A 1NROH 2AFQB 2JKHA 2QAAA 4Y7BA 4CR5A 4CH2B 1FPCH 1BTPA 1SBWA 1SPJA 1TQ0B 4I33A 4TY7A 1GJBB 1UO6A 1F0RA 1CU1A 1YPLH 4MPXA 3ZZCA 3MTYA 4F4OC 1O5DH 1SGFG 5EQQA 1UK2A 1N8OC 4INHA 3DT0H 1C5MD 1SGIB 3QZQA 1GBHA 4DY7B 3ATMA 4FUDA 1J15A 2WPKS 2QXGA 1O0DH 2LNCA 1O2WA 2Q1JA 1LPZB 2O9QA 3B8JA 1RGQA 3LIWA 4JZ1A 2GV7A 2JETC 3SI4H 1GI0A 1OWJA 1TALA 4Q2KA 1PPHE 2GCHF 1FMGA 2SGFE 3Q3KA 4GSOA 1LPKB 4K8BA 3NZIA 1SLWB 4THNH 3BEIB 3UNSA 4XDEA 4VGCB 3ZZ4A 1A2CH 3PLKA 2ZHQH 4NFEA 1AZ8A 2A7HA 1S84A 2QYIA 4IN2A 1MBQA 4NG9H 2C8WB 4YLQH 2GDEH 3TK6A 1OXGA 1BZXE 2KAIB 1ABIH 1K1PA 1GI6A 3M7UA 2RCEA 2SGAA 2VJ1A 5DP3A 1UCYK 1GGDB 1D6RA 7GCHG 1DT2A 2P8OC 3EDXB 1HLTH 1CSOE 2QV1A 1O3MA 2K1QA 1P2NA 4DG4A 1C5QA 4ZHAA 2H5CA 1YPKH 2WV4A 4NIXA 1C4Y2 4Q80A 3ZZAA 5K0HA 4FU8A 1ELEE 1P8VC 1O2XA 4AG1A 2BM2A 1TNHA 2FOFA 1NO9H 1G2LA 4ASHA 4WY3A 3GISB 9LPRA 2HNTE 1HIAB 1BTYA 1SQTA 4XE4A 1SFIA 2VVCA 1DSTA 3MU4A 3V12A 2BY6X 4JK6A 3TVJB 1FPHH 3DFJA 4OS2A 1SG8B 1O3AA 4ZXXH 2FI5E 5DP7A 2Y81A 3ODDA 1BTXA 2BDBA 1HAXB 4O3TA 1NU9A 1PQAA 2G5NA 3KHVA 3RP2A 3SZNA 1V2KT 1TIOA 5FXLA 1BA8B 2G52A 3UOPA 1ZHMA 4BOHA 3SU1A 4AB9A 3GDSA 1GL1A 1WTHD 3A86A 4Y71A 3PMAB 1QJ1B 2CXVA 4IN1A 1LHDH 2XW9A 3MOCA 1SL3A 4YLUA 1ETSH 4H4FA 2XCNA 4NCYA 1TBQH 1GVKB 3P8OA 4ZKOU 1TFXA 4NFFA 3BG4B 4AYVB 3LPRA 3BG4C 4FUHA 4X2XA 2Y80A 2Y7ZA 1MZDA 3I78A 4JZIA 1K28D 1LVBA 1SGYE 2D2DA 3MU5A 4X1RU 1K1OA 4GPGA 1FY1A 2A1DB 3LGYA 1NFWA 3T2NA 1GI5A 1QL7A 1CGHA 4NWLA 3VPKA 1DY8A 4X8TH 3S7HB 1GJCB 1ZJKA 3RC4A 4ABHA 4LZ1H 3ZZ7A 1CO7E 3FP8E 1VITH 4D7FA 5G4BA 1KXEA 3BF6H 2GCTB 1FZZA 1C2HA 2QC2A 4GHTA 1NTPA 1TNKA 4FUGA 1G32B 1L1NA 3Q76A 3T26A 3SO3A 4CRAA 1P2QA 3LKWA 1UMAH 1XKAC 5C1UA 5JBBS 2CMYA 3KCGH 1PPFE 2P3FH 2VU8E 4J1YA 4NA7A 4D8NA 1OPHB 4B1TA 3F68H 6LPRA 4OGXA 4MNXA 1MCTA 5GJ4B 3FZZA 1H8DH 1AO5A 3ZZ6A 2ASUB 3A7YA 1MKXH 2OXSA 4Y8ZA 2A4OA 4ISHH 1K2I1 1E38B 1O5CB 3MI4A 3RM2H 3FZDA 2XBVA 3BTFE 3AAVA 2RG3A 3RXEA 3GOVB 3U98H 4KELA 3RXPA 3HKIB 4ISOA 1ZHRA 2QF3A 4IMQA 4TY6A 2CF9H 2FYRA 1QL9A 5C5NA 2QXIA 2OC7A 1HJAB 1AFQC 1O36A 1SC8U 3MFJA 1YBWA 3SI3H 1XUJA 1NRQH 1FN6A 1K1IA 1ZOMA 2EA3A 3ZV9A 2WPJS 2Q6GA 2GZ7A 1Y5BT 1GBMA 1RXPA 2QF0A 3PMHB 1C5TA 1SGDE 1NC6A 1SHYA 2ALVA 2UWLA 2ZPQA 4AG2A 4CRDA 3UY9A 2BOHB 3TNSA 1SQOA 4FUCA 3D65E 1O2QA 1V2MT 3F9EA 1QCPA 4D7GA 2IN2A 3OX7U 1XUFA 2VIOA 3I29A 2J2UA 3LONA 1MKWK 5E2PA 3BN9A 2A2XH 2VGCB 5L30H 1OWEA 3C27B 3SHCH 5AVDA 4A1TA 1UCYE 1TOCB 1V2ST 4CHAC 1C2KA 1MQ5A 3EAJA 2F9BH 3A88A 3QWCH 3LDXH 1AUTC 1BBRH 4YOGA 1SOZA 1XUHA 2R2MB 8GCHG 1RIWB 4YT6H 2G5VA 3ZZ8A 3PMJA 3TH4H 3GCNA 1HAZB 1Z6JH 5A8YA 3D62A 4JYVH 4NA9H 1HUTH 4A7IB 4UD9H 2OP9A 5HMAA 2TPIZ 5T6GA 2XBWA 3K6YA 1QA0A 2O8MA 3HGPA 3BTGE 1QTFA 1KSNA 2HNTF 1V2JT 1XKBC 4MNYA 3RXIA 1W11U 1O3DA 5E8EH 1O5EH 2UWPA 3SV8A 1C1RA 1O2MA 6ESTA 1S82A 2W7SA 3KL6A 1P02A 2M5TA 4ZH8A 2SFAA 4OGYA 1ZMLA 4AZ2B 1S6FA 4Y8YA 3RU4E 1ZLRA 5JBCS 3F9FA 3QO6A 5GWZA 2QGRA 4I32A 2R0KA 2FTLE 1QBVH 1T7CA 5I25A 1EJNA 2ZI2H 3ZZBA 1FY5A 2GZ8A 1LMWB 1O2UA 1O3GA 1G2MA 3M5LA 4XBBA 1GHVH 3N7OA 4RSPA 1IQKA 1Y3UA 2GX4A 4I8KA 1T4UH 5DP5A 1P03A 2ZPRA 1KYNA 1YLCA 2ZTZA 1MMJN 1BRBE 1PQ8A 4OS4A 3PO1B 2AERH 3HPTB 4MPWA 4XBDA 3W94A 1BITA 2PLXA 3M36A 4K5ZA 4O03A 1MTVA 3PLPA 1RTLA 1G37A 1O3PB 3RDZA 3RLWH 3M61U 1TWXB 2QY0B 3HGNA 4X1QU 3O8DA 1TGTA 5JDUB 1ZTLA 3GCOA 1G9IE 2ZZUH 1AKSA 2PKAB 2ZECA 5L6NH 1GJ6A 1TRYA 3UNQA 1C2IA 2WPMS 1OWDA 2FODA 2A0QB 3QGNB 1VJAU 1TBZH 4IW4E 1P11E 1NN6A 1GDUA 3AVZA 5FPYA 2ZHFH 3TNTA 2ZNKH 2EEKA 1AE5A 2C90B 3BIVH 1C5UA 1DWCH 1LTOA 1O3OA 3A8DA 1ZTKA 2ZCLP 4AFSA 2PTNA 1V2NT 1H4WA 1PPGE 3Q00A 1RTFB 2BVRH 1P57B 1NRPH 1GMDF 4MPVA 1QY6A 3ZVFA 1WUNH 1VITF 3MNSA 2ZG0H 1JRSA 3HK6B 2EC9H 1GGDC 1VCQA 5PTPA 4TWWA 1MUEB 1YKTA 1T8MA 2HALA 1Z8GA 3GDUA 3UPEA 1DPOA 1YPJH 1BHXF 3GCTF 1AFEH 2PUQH 2FOCA 5C5OA 3VB3A 4FU7A 5T3HA 3KNXA 4UONA 1AB9C 1UCYH 1EAXA 4FUBA 1UTQA 2B5TB 1TMUH 1S0RA 1MTSA 1BUIA 1C5NH 3LC3A 1UVPA 3BG8A 4CRGA 4TYDA 1GL0E 4X8UH 4UFDH 1GMCF 2FXRA 1TOMH 3QX5H 5K7RA 3K9XB 1GMHF 1MTWA 2ZGJA 1GBFA 4E7RG 3SNAA 2BDIA 3UQOA 1GHXH 1ZR0A 3TK5A 2Z9LA 1GI8B 1UVSH 1FJSA 3QK1A 4JYUH 3A8BA 5IDKA 3ZZ3A 2BX3A 2STBE 1TRNA 1EAWA 2VWMA 2J34A 3IITA 1SMFE 2GDDA 2AS9A 3A89A 3UNRA 5EXNA 2GMTB 5C67A 1OP8A 2FEQH 2QCYA 2TIOA 4X1PU 1H8IH 3M3TA 3ATIA 4Y11E 2TRMA 3HK3B 3KQBA 1GBTA 3U69H 1F5KU 1UVOA 1E35B 2C8YB 1H1BA 4ABAA 3T27A 1GJ9B 2Y7XA 2Z6BD 1IHSH 1GI9B 1QB1A 1IHTH 2VH0A 1B0FA 1A7SA 2FYQA 3E16B 1DANH 3M3SA 2QA9E 5HM2A 5C1XA 2VWLA 3SQHE 1O3NA 2ZDLA 3GY2A 3BTQE 2CV3A 1CHOG 2VWOA 4UE7H 5A8ZA 3PWCA 3PYHA 4WVPE 1MKWH 1RS0A 2O8WA 2ZQ2A 3MYWA 1W2KH 2ZKSA 3S7KB 1L0ZA 4OS5A 5FCRA 4DW2U 1BJVA 1P12E 3RMNH 1TAWA 2OINA 2BXTH 3GY8A 4Y79A 1D3TB 1WAYB 4Y7AA 4Z0KA 1SGCA 1LDTT 3E8LA 1SFQB 1AI8H 2ZFSA 4O3UA 2BX4A 5IYTA 4SGBE 3STIA 1C1WH 1WBGB 2OD3B 2AGIX 1B0EA 3UQVA 1O2VA 1A0HB 1WQVH 2Z3DA 5E2OA 3SU3A 2VVVA 1OP2A 1LPGB 1V2LT 3QDZB 4GHQA 1QRZA 1ELCA 1V3XA 2AIPA 3ZVGA 3VB4A 5J4QA 2OC0A 1HDTH 5CHAC 5I46H 1YLDA 2ZTYA 2I6SA 1O2TA 2P16A 5A0CA 3BTEE 3A7TA 1MZAA 3B23B 5EG4A 2O8TA 2SGPE 1MBMA 1PPEE 1DUEA 2H5DA 4JK5A 3SOSA 3A7VA 2VIDA 3TPIZ 1UTOA 1ZSKA 4NWKA 2FPZA 1ZJDA 3ODFA 1PJPA 3MWIU 3MNBA 1Y59T 4NZLA 1JIMA 1HV7A 1C1PA 3A8AA 1DWBH 1EX3A 2Z9JA 1ESBA 2P95A 4CH8B 1JWTA 4XBCA 3A87A 4YM9A 1S5SA 1ETTH 3FP7E 3IG6B 4O97A 1KY9A 3CS0A 2XC4A 1HJ8A 1IAUA 3HKJB 1DS2E 3NXPA 4ZKSU 1DWDH 1CHGA 1TGSZ 3OYPA 1N6XA 2Z3CA 3KN2A 2C93B 4UFFH 3SHAH 4JZDH 1SSXA 1D9IA 4IC6A 1GJDB 1HJAC 4JZFH 5E0HA 1U6QA 3W95A 1FNIA 1CT2E 2ANMH 2P59A 1FONA 3RXJA 2VIVA 3KQCA 3QLPH 2FM2A 1BQYA 2PTCE 1ACBE 1YC0A 3RXFA 2Z3EA 3SV9A 1C5LH 1A5IA 1W7GH 1UVUH 3T29A 4ABBA 1F2SE 3RXCA 4AGKA 1OSSA 1QBOA 7GCHF 2FX4A 1OYTH 3STJA 2ILNA 3QTOH 1FAKH 1E37B 1FDPA 3ZVAA 4Y10E 2H9TH 5FX6A 1CBWC 1ABJH 2EI6A 1QB6A 1ZYOA 3PTBA 1DX5M 3EGKH 4AYYB 1XX9A 4KTSA 4ISLA 1ELDE 3ELAH 5T6FA 4NIVA 2P3UB 5F8TA 2G51A 1D3DB 3U9AH 3DHKH 4KGAA 3VB7A 3UFAA 1UTNA 4BAKB 3E0PB 1MU8B 1P0SH 1O3LA 2Q6FA 4K1SA 1IQJA 2XBYA 3PO1C 1T8OA 2ESTE 3TGIE 1FUJA 1TPOA 1F0UA 2J92A 3MMGA 1PYTC 4AORA 2BD5A 2H9HA 1BHXB 1C9TA 1TBRH 5DP4A 3MH4A 1AUJA 1SGRE 1XUGA 3RU4D 1XUIA 1QNJA 3GY3A 3FP6E 2V6NA 3SORA 1O5BB 4LOYH 3AAUA 3M5MA 3URCA 5DK1A 1EJMA 3RLYH 3EA8A 1O3CA 3E3TA 4OS1A 2VIPA 2P8OB 1VZQH 1QJ7B 1XVMA 3BEUA 5E0GA 2PFEA 2B8OH 4Y76A 3QGJA 2J38A 1V2OT 1K1LA 2O8LA 8ESTE 1K9OE 1UJ1A 4K8YA 3H5CB 1C2LA 1SOTA 2UUKB 1TMBH 4BTIB 4K60A 2STAE 1LHEH 2FDAA 2CHAB 2BD4A 2ZU3A 2C4FH 1V2VT 2ZHWH 5DG6A 3VB6A 1ZSLA 1TA2A 3BTTE 3TJOA 2AEIH 1NM6A 1P9UA 1NRSH 1O2GH 1GBAA 2A45B 2Y6TA 1TMTH 3P95A 2TGDA 2BY5X 1F5LA 3ZYEA 5FX5A 1ZPBA 1AFQB 5DP8A 3SU5A 3O8CA 1A5GH 1C1UH 2XTTB 1GHZA 4DVAU 3UTUH 1C1VH 3T28A 1GBCA 1XM1A 1W3CA 1HNEE 4X1SU 1C2JA 5T6DA 3NUMA 4X6PA 1THPB 2BZAA 1ESAA 4Y0ZE 1S83A 5L2YH 1ORFA 4H42U 2FI4E 1TQ7B 1E36B 3LGIA 1GJ8B 3A84A 3S0NA 2PKSC 2G81E 4O9VA 4AFQA 1NU7B 5HM9A 2NU0E 2OQUA 3E91A 2AH4X 1W13U 4NIWA 1HAYB 2XC0A 3QN7A 2VB0A 4TWYA 3SUGA 2R3YA 3TJVA 2OC1A 1GDNA 1TONA 3RXUA 1MH0A 1V2TT 5GPIB 2ZDVH 4FVDA 1KXDA 1F0TA 3RC6A 1BMMH 4BTUB 2IPHA 1YPGH 4MVNA 3D23A 3RM0H 2HVXA 4AX9H 3JZ1B 2SGDE 3L33A 3RMMH 2Q6DA 1CT0E 1SLUB 1NRRH 1GI7B 4RKOB 2F83A 1MD8A 4ESTE 1Z71A 1GG6C 2PWXA 1P06A 1GCTB 1G3EA 1EOJA 2FOEA 2FP7B 1XVOA 2F91A 2WPIS 3SNCA 2UWOA 3PB1E 3VB5A 1Y3WA 1IQMA 1CBWB 5J4SA 1FXYA 1GBJA 1LKBA 1SGTA 1TPAE 2TGAA 1LHCH 1QHRB 4QT8C 1LKAA 2BY8X 1V2RT 2BY7X 1O2NA 2BYAX 5TCCA 1K22H 3C1KA 1W7XH 1RFNA 1HAOH 1ETRH 5DGJA 1C1SA 3LH1A 8GCHF 1PFXC 4AB8A 1EXFA 4FXGH 1P2MA 2WINI 3SV2H 4IBLH 4TPYA 4A6LA 1F7ZA 1YM0A 1VR1H 2WUBA 2BQ6B 4A1XA 4I8GA 1Y8TA 3A83A 1YP9A 1AVGH 3M7QA 4B75A 5GCHF 2R0LA 4LXBH 3ZV8A 1P2IA 1BB0B 5DPAA 1TA6A 1MD7A 3SGQE 1DOJA 4CRCA 1EPTB 1SLXB 1EZSC 1KDQB 4K1TA 1BTUA 1GVLA 2YNAA 1P10A 2H2ZA 3T5FH 4E05H 3VGCC 1DITH 2BLOA 5EQSA 2WPHS 3DA9B 2OC8A 1GBDA 2SGQE 1UK4A 3LGUA 1O3IA 3NKKA 4AGJA 1GCTC 4YOIA 4NSVA 3M7TA 3ZVEA 7KMEH 1C2FA 5ABWA 1EZXC 1Y3YA 2YNBA 4H6TA 1HB0B 4X2WA 5EQRA 4Y6DA 1VITG 1AB9B 1BDAA 4BAMB 2BDGA 3TLOA 1PQ5A 1FY4A 1FY3A 3GICB 3TK9A 1HGTH 4HGCA 1O2PA 1HFDA 2XBXA 1LVYA 1T31A
chains in the Genus database with same CATH superfamily
2Y5FA 1NT1A 2ANWA 3A7XA 1L4ZA 1O2SA 1H8ED 4YTAA 3OTJE 1A1RA 2ZFFH 3PM3A 3GYMA 1PQ7A 3KGPA 3GS9A 1AWHB 1KXFA 1SLVB 1TNLA 4ZXYH 1GMHG 2BQ7B 1Z1IA 2J94A 4Z1MD 1A5HA 3QTVH 5EGMA 1EB1H 1THSH 5FPTA 1D6WA 3UWIA 3TGKE 1WSSH 2G00A 4FUFA 2GVFA 4ABEA 4A92A 1KTSB 2G8TA 1O39A 3BTKE 1DLEA 1NPMA 2G4UA 1O5GH 5CHAB 1HAGE 1P04A 1ZPZA 2ZGCA 4Y8XA 2AMQA 3GDVA 3SNDA 1RRKA 1PPZA 1A61H 5LPEA 3CS7A 2ZO3H 4FU9A 1DDJA 1QRWA 1HAVA 5EOKA 2OBOA 1GHAF 5KEDA 1V6DA 1YLNA 4WH6A 1PPBH 2P93A 1AGJA 3QZRA 1VGCB 5AF9H 3MU1A 2JETB 1AD8H 3P92A 2GT8A 4WH8A 2A32A 2Z94A 2ZQ1A 4ZROA 1ANBA 5FHTA 4YO9A 1DWEH 5HXFA 4DT7B 3SJKA 1C2MA 4K69A 3SQEE 3S9BA 3SUDA 1RIWC 5A0AE 1GJ4H 4ZHMU 2HVYB 1BMLA 2ZEBA 5DKMA 4IS5A 2FOBA 3ZVBA 4OS6A 1PPCE 1G3CA 1AIXH 1EKBB 1LQEA 1N8OB 2HWLB 3A7ZA 1BTZA 2W5EA 3U8RH 1O5FH 4MPUA 3A82A 1YY3A 1GJ7B 2QN5T 3ESTA 2XNIA 1OWIA 1P01A 3O8BA 5FBIA 1B5GH 2GP9B 1CA0C 3O8RA 4LZ4B 2JJ1D 2J98B 4FUJA 2FTMA 2CHAC 4MNWA 1QGFA 4F49A 1IQEA 4X8VH 1Z8JB 1D3QB 1OKXA 3L3TA 1KLIH 7LPRA 1YPEH 1WU1A 2KFWA 4UDWH 1AQ7A 2XCFA 3SUEA 2FWWA 4WMEA 3H7OA 3RXRA 2ZU4A 3RXBA 2QF5A 1O3FA 4SGAE 1MTNB 1BRAA 2A5IA 1AVWA 2BTCE 3GY4A 1P3CA 5FCKA 1VJ9U 4NA8A 1F92A 4FUIA 3SGAE 1Q3XA 3PWBA 3TGJE 2CGAA 1EQ9A 3SV6A 3LC5A 4BAHB 2GMTC 3ATLA 4MG3A 1ZMNA 2W6JD 1BBRE 2EY4C 3GCHB 4I8LA 3RXKA 2CJIA 1O3EA 5GDSH 1QRXA 2FS9A 3DUXH 2KX4A 1XXFA 2PGQB 1SQRA 1BOQA 2BD8A 4K3JA 1O34A 1ARCA 3BSQA 2V3OH 1P2OA 3GY5A 4CBOA 1W12U 1DXWA 1C5YB 1LHFH 2PUXB 2V0BA 1OWKA 1Q2WA 3LU9B 1DUAA 4OM9A 4JCNA 1BTWA 2AGGX 5EODA 1AMHA 3F2HA 4Q4LA 3UAIC 1FY8E 1T32A 2AIQA 5LPRA 3KQDA 1EB2A 1S81A 3Q77A 2UUYA 2HNTC 3F0OA 4JYTA 1RD3B 3AW0A 5AHGH 2RA3A 1C4V2 4CREA 5CMXH 3LGVA 1L1JA 4GUXA 1ARBA 1NFUA 9ESTA 1SI5H 2BB4A 2C8XB 2V35A 2ZPSA 1CA8B 4K1EA 1CGJE 3UOUA 3MO3A 1AVXA 2NU3E 1BCUH 2FLBH 1Y3VA 2XYAA 1GI4A 3R3GB 3EQ0H 8LPRA 2EI8A 2PHBA 3MU0A 2WPLS 3LJJA 4X1NU 1ZRKA 5DSFA 1DY9A 1Y5AT 2R3UA 3RXOA 3RXSA 5HIYA 4CRFA 4MNVA 1GJ5H 1O35A 1MABB 1ANCA 1WQSA 1Z6EA 1VCPA 2FLRH 2ZF0H 1HAVB 1GMDG 2FX6A 2WV5A 2VBCA 2HOBA 4BTTB 2R2WU 1GBLA 1C5ZB 5A09A 3RP2A 5LPFA 1SVPA 1TPPA 1C2EA 4MQAA 3G01A 1UTMA 2XC5A 4B71A 2YMSB 2ZP0H 1G3BA 5C1YA 3RXMA 1AN1E 1J17T 3P70B 2P3TB 2B0FA 5A8XA 3NCLA 3NWUA 6GCHF 5AFZH 4R0IA 2ZWLH 4WF8A 1GI2A 1A4WH 2BD7A 1L4DA 1S6HA 3FOAA 2WYJA 2A5KA 1LVOA 2JH0D 3SN8A 5B6LA 1B7XB 3RMOH 3RUOA 3SU6A 2QIQA 2OCVB 1KTTB 3A81A 4VGCC 3UR6A 1WYKA 2BY9X 3MNXA 4BXSA 1G3DA 5FAHA 2A7JA 1GCDA 3AASA 4ZKNU 5DP9A 3AK5A 2FS8A 4HTCH 2Z9GA 4E06H 2NWNA 2FOGA 2BDCA 1JMOH 1DE7H 1LCYA 1O2RA 2LP6A 3QUMP 2FIRH 4KTUA 4HZHA 2F9NA 1YCPM 4YOJA 4AN7A 3GYLB 1E34B 1ESTA 4PROA 1TGBA 5ESBA 1ZRBA 2A4QA 1OP0A 2ZCHP 1C2DA 1PYTD 4GCHF 1AHTH 1O3KA 1KXCA 3FVFB 3TH2H 3K65B 3VXFH 1DICA 2PKSB 4X0WU 1YGCH 3RXVA 5GCHG 2ZGHA 3V0XA 1FQ3A 5LGOA 2ZC9H 4BANB 2Y5GA 1FIWA 3K2UA 3P8FA 2BHGA 3MO6A 2ZGXH 1QL8A 2GD4B 3SBKA 2JJ2D 4WMDA 6CHAB 1ZGIA 2PW8H 4RN6A 1D3PB 1C1MA 5FBEA 1P2KA 2J97A 3VFEA 1P2JA 4I31A 3KQEA 5JYIA 4TPIZ 1OX1A 3F1SB 2B9LA 1OOKB 1JXPA 3M5NA 1RJXB 2K8IA 1YPHE 3GY7A 1DM4B 1BJUA 4NSYA 1V2QT 3PRBA 2FOHA 1C5RA 4ZHLU 1MTUA 3UREA 2RFKC 5EPNA 3EE0B 3MH6A 3M35A 1Y5UT 1CHOF 1BT7A 1QR3E 1H9IE 1VGCC 2XWAA 1YPMH 1GBBA 4OS7A 2DE8A 3L6PA 3BEFB 4X2VA 2KM0A 5EXLA 4DGJA 2CF8H 4JMYA 4DOQA 1WXRA 4K2YA 1MAYA 1TPSA 5DJ7A 3LGWA 2HLCA 1SHHB 3JZ2B 1JRTA 2J9NA 2ZDKA 1BBRK 4GAWA 2EI7A 2C3SA 1QBNA 2ODYB 2WHXA 3UWJH 4IGDA 4YT7H 5JPMH 3SW2B 3ZZ9A 4ABJA 1C1QA 1CT4E 2WUCA 2J98A 1WV7H 2OTVA 3F9GA 3OU0A 2K0QA 5EW1H 3T62A 3FFGA 5CE1A 5HYOA 1SKYE 1CA0B 1QQ4A 1BTHH 3PMBB 1DLKB 1JBUH 4M7GA 5TJXA 4WXVA 3OY6U 1HYLA 2ZDNA 2OLGA 3ENSB 4D9QA 1O37A 1KLJH 1LQDB 3TJUA 4RKJB 1TNIA 3OAAD 3ATWA 3S9CA 4KTCA 5ETXA 2RA0A 4B76A 2H6MA 2VIQA 4CBNA 1EP6A 3E1XB 2R9PA 1TE0A 1TGNA 1KXBA 3Q3YA 2J4IA 2XXLA 3ZVCA 5DP6A 3PLBA 2ANYA 3RXAA 2BD3A 4X6MA 3V13A 5F8XA 2OQ5A 2KCOA 3B9FH 5C20A 1HXFH 2PR3A 1ELBA 1GHAG 4B2BA 1O2LA 3P6ZB 4B73A 2BLWA 3SJ9A 3LT3A 4UEHH 1K0HA 1FAXA 3CENA 4ISNA 3AW1A 1HIAA 1HAHH 2WZQA 3ATKA 2CN0H 2I6QA 3SGBE 1HXEH 3TJNA 3MH5A 1NFXA 3N7DA 1H9HE 3BTHE 3A7WA 2ANKH 2Z7FE 1INCA 3LJOA 2CK3D 1W10U 2SNWA 1O2HA 4INLA 1C2GA 3VGCB 6CHAC 4CRBA 2ZU2A 4NGAH 1CGIE 2TGTA 4B2CA 3A8CA 4FUEA 1NZQH 3F9HA 1V2WT 1X7AC 1YPHC 2IOTA 3GY6A 1N1LA 1K1NA 1L2EA 1CQQA 2ULLA 2J95A 2QF4A 3MU8A 2P94A 4U01A 1S6LA 1OYQA 4WXIA 1A0JA 4MLFB 1SGNE 1GHWH 5JBAS 1SB1H 1Y3XA 2H9EH 5KECA 2V3HH 2G4TA 1AY6H 1C5VA 1LO6A 4BXWA 3P17H 1AKSB 1O2OA 5C2ZA 4Y0YE 1SGQE 3ZZ5A 2DUCA 1O38A 4YESB 2VH6A 3PRDA 3PTNA 2FOAA 3M3VA 1Q31A 3BTWE 4X6NA 1MKXK 2PSXA 2UUJB 3S9AA 1BIOA 2F43B 1GBIA 8KME2 2G55A 1THRH 2GTBA 5ESTE 4LK4A 1HAPH 1G36A 4DIIH 1C5XB 1T4VH 3T25A 4Q7XA 4FETA 1P3EA 2UUFB 3DFLA 1WCZA 4B6EA 1TX8A 1LHGH 1JIRA 4P00A 1BMNH 3ITIA 3MO9A 1KDQA 1ZHPA 3M5OA 4ZMAH 2A31A 1TNJA 2BDYA 3P8GA 3PV5A 1GG6B 4NZQA 1C4U2 5GXPA 3KEEA 5B6OA 2BLQA 2GCTC 4X8SH 4WWYA 1EAIA 4HFPB 5JB9S 1ZZZA 2Y5HA 2ZHDA 2F9OA 3U8TH 4D9RA 3OSYA 2VNTA 4U30A 3FANA 3RXQA 1P05A 1KIGH 2Y82A 1ELAA 3BV9B 1ELVA 2BMGB 4BAQB 2GGVB 1A3BH 2AGEX 1GPZA 2ZDMA 1O2YA 2SGEE 1H8HD 4IMZA 3E0NB 3E6PH 3VXEH 1QFKH 3V3MA 1C1OA 1O2JA 2A7CA 4AC9A 2BVSH 3H7TA 3IWMA 3EYDA 1W8BH 4WJG2 5EXMA 2YOLA 2JIZD 2FESH 3MNCA 1SGEE 3LOXA 2JH6D 5EPYA 1NY22 1GHBF 2GCHG 1UHBB 3NPSA 5EU8A 1UHBA 3RXLA 4XOJA 2BVXH 5A2MH 1P9SA 2F9VA 2A4GA 1IQGA 4DJZB 1QJ6B 1MTNC 1O30A 1Z8IB 1XXDA 3URDA 4GLYA 2OUAA 3RXGA 2NU2E 3RC5A 1F0SA 3A85A 1CVWH 3SU0A 1K1JA 4E7NA 3EA7A 1HAIH 3SV7A 1TB6H 3U8OH 2BXUH 2VWNA 2SNVA 2Z9IA 3PROA 2W26A 1YCPK 3SU2A 3UIRA 4WMFA 2BD2A 3SU4A 3SJIA 4D76A 1IQFA 4I7YH 2W7UA 1O32A 3RU4T 5DO4H 1QQUA 1TGCA 1TNGA 2NU4E 4BNRA 2ZHEH 1A0LA 6GCHG 2NU1E 1GI1A 4BAOB 1SGPE 7ESTE 4ACBA 5E0JA 1O3HA 3SNBA 1J16A 2QXJA 4J2YB 4U2WA 2F9UA 3RXDA 1GVZA 4R8TB 1O2IA 2RDLA 1UTJA 1C5SA 1WDIA 4Q7ZA 5SGAE 4ZAEA 1NESE 4ABDA 3SNEA 1A3EH 3GCHC 4FVBA 1UK3A 1FIZA 1V2UT 1GHYH 2HPPH 4CHAB 5C0TA 4KP0A 2W3IA 1C5PA 1AZZA 1WOFA 1WTGH 1EOLA 1W0YH 3WWFA 3V7TA 2A5AA 2VGCC 3HATH 5BPEA 1BRCE 5FPSA 1ZTJA 4X6OA 3TU7H 4ABIA 2VVUA 4XSKU 1SGFA 1MQ6A 4ZUHA 4MDSA 5CDFE 2THFB 2ZTXA 1J8AA 1QA7A 5JBTA 4MTBA 3R0FA 3E90B 4XRNA 3SJOA 1EZQA 1NRNH 4INKA 1O31A 4AFUA 4I8HA 1QZ8A 4GCHG 2ZFRH 1EUFA 1S0QA 5EJZA 3Q3XA 2V7QD 1EASA 2ODPA 4AFZA 4Z6AH 1TYNA 1K21H 4UFGH 3RXHA 2XWBI 2ZDAH 5AFYH 4H6SB 2ZA5A 1XMNB 2ZGBH 2FMJA 4UFEH 1Z7KA 2OBQA 5H4IB 1N6YA 1ZSJA 2BDAA 1FI8A 1BMAA 1UTLM 3UR9A 1MAXA 4ISIH 5BRRE 1AWFH 4A5TS 1L1GA 2BOKA 3ZZDA 5GIBA 1DVAH 1K1MA 1Z8RA 2F9PA 4B2AA 5JB8S 1T8LA 2YMSC 2HPQH 3M37A 1TRMA 1VCWA 3TIUA 5EW2H 2C8ZB 2BDHA 2B7DH 2FO9A 1UVTH 1EATA 3SJ8A 1GJAB 1GDQA 3MH7A 1ID5H 5HGGA 1C5WB 2ZFQH 3VEQB 1KLTA 1EJAA 2ZU1A 1ZGVA 4ZKRU 4B74A 1GWAA 2GV6A 3RMLH 1Z1JA 1D4PB 1QB9A 2A4RA 3I77A 1P09A 1T8NA 1MCVA 1XUKA 1O3BA 2F3CE 3ZYDA 1G30B 3UUZA 3EA9A 1HBTH 1GHBG 1SQAA 3LGTA 3BIUH 1HPGA 1O33A 3LH3A 4DCDA 3OEHD 1GBKA 5L2ZH 1O5AB 3SUFA 1C1NA 2D26C 1F5RA 3K6ZA 2Z9KA 1M9UA 1VKYA 1YF4A 2BD9A 1V2PT 3P8NA 2PV9B 2AMPA 3U1IB 1ELGA 5A0BA 4ABFA 1O3JA 1IQHA 4AOQA 1IQNA 1SR5C 2KAIA 3KIDU 2TBSA 3N99A 5C3NA 4I8JA 3TITA 2H1UA 3MHWU 1OS8A 2ZIQH 1C1TA 2A2QH 3U1JB 3D49H 1LVMA 2O8UA 2ODQA 4GVUA 1O2KA 2ALPA 2ZCKP 1TX6A 3PV4A 3F2FA 1S85A 5LH8A 1DFPA 1W14U 3GCTG 1FV9A 4DURA 3W1EA 1UTPA 1QURH 1MU6B 4DIHH 1ANEA 3A80A 4Q7YA 1H9LB 2BZ6H 1AE8H 2GKVE 1EPTC 5KGOA 1A46H 2GZ9A 1CE5A 1OWHA 3S69A 4U32A 2GT7A 4XFQA 1HJ9A 2HGTH 4HI3A 1HRTH 4IC5A 3BTME 1JOUB 1GMCG 1ELFA 1UW7A 3FKSD 2LPRA 3RXTA 1KXAA 3CP7A 4YZUA 5F03A 2TGPZ 1IOEA 2W3KA 2ZFPH 4X2YA 1QIXB 2AYWA 1EP5A 4B6FA 1TABE 1AU8A 5F6MA 5TCAA 1FLEE 3BTDE 1ANDA 2D8WA 2XRCA 3WY8A 2VINA 5F8ZA 1HCGA 2PSYA 1J9CH 1GI3A 2PGBB 1ZMJA 1GBEA 3OY5U 2HRVA 1W0ZU 1TX7A 3ZVDA 1EZUC 1J14A 2FI3E 1C5OH 4CR9A 1E0FD 2WYGA 2ZFTA 1IQLA 4JZEH 1YYY1 1RTKA 1O2ZA 4ABGA 2D1JA 3DD2H 3DSOA 3KF2A 1BRUP 3F6UH 1UTKA 4KKDA 1NFYA 2AMDA 2ZU5A 3NK8A 3TH3H 1ZPCA 2BLVA 1TLDA 1YCPH 1DXPA 1FN8A 2IJOB 1C9PA 3FAOA 1EPTA 1IQIA 2BQWB 2PKAA 1COWD 2JH5D 2DE9A 2FOMB 1ELTA 4NIYA 4A1VA 1EAUA 1DSUA 2VIWA 2QXHA 2FZZA 1NS3A 1NROH 2AFQB 2JKHA 2QAAA 4Y7BA 4CR5A 4CH2B 1FPCH 1BTPA 1SBWA 1SPJA 1TQ0B 4I33A 4TY7A 1GJBB 1UO6A 1F0RA 1CU1A 1YPLH 5F53A 4RT0A 4MPXA 3ZZCA 3MTYA 4F4OC 3ZIAD 1O5DH 1SGFG 5EQQA 1UK2A 1N8OC 4INHA 3DT0H 1C5MD 1SGIB 3DCLA 3QZQA 3MQKC 1GBHA 4DY7B 3ATMA 4FUDA 1J15A 2WPKS 2QXGA 1O0DH 4DT4A 2LNCA 1O2WA 2Q1JA 3OEED 1E79D 2KCPA 1LPZB 2O9QA 3B8JA 1RGQA 3LIWA 4JZ1A 2GV7A 2JETC 3SI4H 1GI0A 1OWJA 1TALA 4Q2KA 1PPHE 2GCHF 1FMGA 2SGFE 3Q3KA 4GSOA 1LPKB 4K8BA 3NZIA 1SLWB 4THNH 3BEIB 3UNSA 4XDEA 4VGCB 3ZZ4A 1A2CH 2PP6A 3PLKA 2ZHQH 4NFEA 1AZ8A 2A7HA 1S84A 2QYIA 4IN2A 1MBQA 4NG9H 2C8WB 4YLQH 2GDEH 3TK6A 1OXGA 1GI6A 2KAIB 1ABIH 1K1PA 1BZXE 3M7UA 2RCEA 2KCYA 2SGAA 2VJ1A 5DP3A 1UCYK 1GGDB 1D6RA 7GCHG 1DT2A 2P8OC 3EDXB 1HLTH 1CSOE 2QV1A 1O3MA 2K1QA 1P2NA 4DG4A 1C5QA 4ZHAA 2H5CA 1YPKH 2WV4A 4NIXA 1C4Y2 4Q80A 3ZZAA 5K0HA 4FU8A 1ELEE 1P8VC 2QE7D 2KR7A 1O2XA 4AG1A 2BM2A 1TNHA 2FOFA 2LELA 1NO9H 1G2LA 4ASHA 4WY3A 3GISB 9LPRA 2HNTE 1HIAB 1BTYA 1SQTA 4XE4A 1SFIA 2VVCA 1DSTA 3MU4A 3V12A 2BY6X 4JK6A 3TVJB 1FPHH 3DFJA 4OS2A 1SG8B 1O3AA 4ZXXH 2FI5E 5DP7A 2Y81A 3ODDA 1BTXA 2BDBA 1HAXB 4HG6A 1NU9A 1PQAA 2G5NA 3KHVA 4O3TA 3SZNA 5C0UA 1V2KT 1TIOA 5FXLA 1BA8B 2G52A 3UOPA 1ZHMA 4BOHA 3SU1A 4AB9A 3GDSA 1GL1A 1WTHD 3A86A 4Y71A 3PMAB 1QJ1B 2CXVA 4IN1A 1LHDH 2XW9A 3MOCA 1SL3A 4YLUA 1ETSH 4H4FA 2XCNA 2IJD1 4NCYA 1TBQH 1GVKB 1OHHD 3P8OA 4ZKOU 1TFXA 4NFFA 3BG4B 4AYVB 3LPRA 3BG4C 4FUHA 4X2XA 2Y80A 2Y7ZA 1MZDA 3I78A 4JZIA 1K28D 1LVBA 1SGYE 2D2DA 3MU5A 4X1RU 1K1OA 4GPGA 1FY1A 2A1DB 3LGYA 1NFWA 3T2NA 1GI5A 2F4LA 1QL7A 1CGHA 4NWLA 3VPKA 4F48B 3SZEA 1DY8A 4X8TH 3S7HB 1GJCB 1ZJKA 3RC4A 4ABHA 4LZ1H 3ZZ7A 1CO7E 3FP8E 1VITH 3N7EA 4D7FA 5G4BA 2V3MA 1KXEA 3BF6H 2GCTB 1FZZA 1C2HA 2QC2A 4GHTA 1NTPA 1TNKA 4FUGA 1G32B 1L1NA 5EJLA 3Q76A 3T26A 3SO3A 4CRAA 1P2QA 3LKWA 1UMAH 1XKAC 5C1UA 5JBBS 2CMYA 3KCGH 1PPFE 2P3FH 2VU8E 4J1YA 4NA7A 4D8NA 1OPHB 2WV9A 4B1TA 3F68H 6LPRA 4OGXA 4MNXA 1MCTA 5GJ4B 3FZZA 1H8DH 1AO5A 3ZZ6A 2ASUB 3A7YA 1MKXH 2OXSA 4Y8ZA 2A4OA 4ISHH 1K2I1 1E38B 1O5CB 3MI4A 3RM2H 3FZDA 2XBVA 3BTFE 3AAVA 2RG3A 3RXEA 3GOVB 3U98H 4KELA 3RXPA 3HKIB 4ISOA 1ZHRA 2QF3A 4IMQA 4TY6A 2AHME 2CF9H 2FYRA 1QL9A 5C5NA 2QXIA 2OC7A 1HJAB 1AFQC 1O36A 1SC8U 3MFJA 1YBWA 3SI3H 3KQ5A 3F3BA 1XUJA 1NRQH 1FN6A 1K1IA 1ZOMA 2EA3A 3ZV9A 2WPJS 2Q6GA 2GZ7A 1Y5BT 4M9FA 1GBMA 1RXPA 2QF0A 3PMHB 1C5TA 1SGDE 1NC6A 1SHYA 2ALVA 2UWLA 2ZPQA 4AG2A 4CRDA 3UY9A 2BOHB 3TNSA 1SQOA 4FUCA 3D65E 1O2QA 1V2MT 2L74A 1W0KD 3F9EA 1QCPA 4D7GA 2IN2A 3OX7U 1XUFA 2VIOA 3I29A 2J2UA 3LONA 2GJGA 1MKWK 5E2PA 3BN9A 2A2XH 2VGCB 5L30H 1OWEA 3C27B 3SHCH 5AVDA 4A1TA 1UCYE 1BMFD 1TOCB 1V2ST 4CHAC 1C2KA 1MQ5A 3EAJA 2M2AA 2F9BH 3A88A 3QWCH 3LDXH 3KYFA 1AUTC 1BBRH 4YOGA 1SOZA 1XUHA 1NBMD 2R2MB 8GCHG 1RIWB 4YT6H 2G5VA 3ZZ8A 3PMJA 3TH4H 3GCNA 1HAZB 1Z6JH 5A8YA 3D62A 4JYVH 4NA9H 1HUTH 4A7IB 4UD9H 2OP9A 5HMAA 2TPIZ 5T6GA 2XBWA 3K6YA 1QA0A 4ACAA 2O8MA 3HGPA 3BTGE 1QTFA 1KSNA 2HNTF 1V2JT 1XKBC 4MNYA 3RXIA 1W11U 1O3DA 5E8EH 1O5EH 2UWPA 3SV8A 1C1RA 1O2MA 6ESTA 1S82A 2W7SA 3KL6A 1P02A 2YMSD 2M5TA 4ZH8A 1W0JD 2SFAA 1ZMLA 4OGYA 4AZ2B 1S6FA 4Y8YA 3RU4E 1ZLRA 5JBCS 3F9FA 3QO6A 5GWZA 2QGRA 4I32A 2R0KA 2FTLE 1QBVH 1T7CA 5I25A 1EJNA 2ZI2H 3ZZBA 1FY5A 2GZ8A 1LMWB 1O2UA 1O3GA 1G2MA 3M5LA 4XBBA 1GHVH 3N7OA 4RSPA 1IQKA 1Y3UA 2GX4A 4I8KA 1T4UH 5DP5A 1P03A 2ZPRA 1KYNA 1YLCA 2ZTZA 1MMJN 1BRBE 1PQ8A 4OS4A 3PO1B 3DSGA 2AERH 3HPTB 4MPWA 4XBDA 3W94A 2XOKD 1BITA 2PLXA 3M36A 4K5ZA 4O03A 1MTVA 3PLPA 1RTLA 1G37A 1O3PB 5EIYA 3RDZA 3RLWH 3M61U 1TWXB 2QY0B 3HGNA 4X1QU 3O8DA 1TGTA 5JDUB 1ZTLA 3GCOA 5EJ1A 1G9IE 2ZZUH 1AKSA 2PKAB 2ZECA 5L6NH 1GJ6A 1TRYA 3UNQA 1C2IA 2WPMS 4TT3D 1OWDA 2FODA 2A0QB 3QGNB 1VJAU 1TBZH 4IW4E 1P11E 1NN6A 1GDUA 3AVZA 5FPYA 2ZHFH 3TNTA 2ZNKH 2EEKA 1AE5A 2C90B 3BIVH 1C5UA 1DWCH 1LTOA 1O3OA 3A8DA 1ZTKA 2ZCLP 4AFSA 2PTNA 1V2NT 1H4WA 1PPGE 3Q00A 1RTFB 2BVRH 1P57B 1NRPH 1GMDF 5CHBA 1EFRD 4MPVA 1QY6A 3ZVFA 1WUNH 1VITF 3MNSA 4ZCNA 2ZG0H 1JRSA 3HK6B 2EC9H 1GGDC 1VCQA 5PTPA 4TWWA 1MUEB 1YKTA 1T8MA 2HALA 1Z8GA 3GDUA 3UPEA 1DPOA 1YPJH 2EQNA 1BHXF 3GCTF 1AFEH 2PUQH 2FOCA 5C5OA 3VB3A 4FU7A 5T3HA 3KNXA 4UONA 1AB9C 1UCYH 1EAXA 4FUBA 1UTQA 2B5TB 1TMUH 1S0RA 1MTSA 1BUIA 1C5NH 3LC3A 1UVPA 3BG8A 4CRGA 4TYDA 1GL0E 4X8UH 4UFDH 1GMCF 2FXRA 1TOMH 3QX5H 5K7RA 3K9XB 1GMHF 1MTWA 2ZGJA 1GBFA 5HKKD 4E7RG 3SNAA 2BDIA 3UQOA 1GHXH 1ZR0A 3TK5A 2Z9LA 1GI8B 1UVSH 1FJSA 3QK1A 4JYUH 3A8BA 5IDKA 3ZZ3A 2BX3A 2STBE 1KMHB 1EAWA 1TRNA 2VWMA 2J34A 3IITA 1SMFE 2GDDA 2AS9A 3A89A 3UNRA 5EXNA 2GMTB 5C67A 1OP8A 2FEQH 2QCYA 2TIOA 4X1PU 1H8IH 4I86A 3M3TA 3ATIA 4Y11E 2TRMA 3HK3B 3F2GA 3KQBA 1GBTA 3U69H 1F5KU 1UVOA 2WPDD 1E35B 2C8YB 2KCAA 1H1BA 4ABAA 3T27A 1GJ9B 2Y7XA 2Z6BD 1IHSH 1GI9B 1QB1A 1IHTH 1B0FA 2VH0A 1A7SA 2FYQA 3E16B 1DANH 3M3SA 2QA9E 5IK2D 5HM2A 5FL7D 5C1XA 2VWLA 3SQHE 1O3NA 2ZDLA 3GY2A 3BTQE 2CV3A 3H09A 2OK5A 1CHOG 2WSSD 2VWOA 4UE7H 5A8ZA 3PWCA 3PYHA 4WVPE 1MKWH 1RS0A 2O8WA 2ZQ2A 3MYWA 1W2KH 2ZKSA 3S7KB 1L0ZA 4OS5A 5FCRA 4DW2U 4YXWD 1BJVA 1P12E 2J5UA 3RMNH 1TAWA 2OINA 2BXTH 3GY8A 4Y79A 1D3TB 1WAYB 4RI0A 4Y7AA 1SGCA 4Z0KA 3UB0A 1LDTT 3E8LA 3PV2A 1SFQB 1AI8H 2ZFSA 4O3UA 2BX4A 5IYTA 4SGBE 3STIA 1C1WH 1WBGB 2OD3B 2AGIX 1B0EA 3UQVA 1O2VA 1A0HB 1WQVH 2Z3DA 5E2OA 3SU3A 2VVVA 1OP2A 1LPGB 1V2LT 3QDZB 4GHQA 1QRZA 1ELCA 1V3XA 4P02A 2AIPA 1FX0B 3ZVGA 5C17A 3VB4A 5J4QA 2OC0A 1HDTH 5CHAC 5I46H 1YLDA 2ZTYA 2I6SA 1O2TA 2P16A 5A0CA 3BTEE 3OE7D 3A7TA 1MZAA 3B23B 5EG4A 2O8TA 2SGPE 4XD7D 1MBMA 1PPEE 1DUEA 2H5DA 4JK5A 3SOSA 3A7VA 2VIDA 3TPIZ 5T1VA 1UTOA 3EE7A 1ZSKA 4NWKA 2FPZA 1ZJDA 3ODFA 1PJPA 3MWIU 3MNBA 1Y59T 4NZLA 1JIMA 1HV7A 1C1PA 3DSPA 3A8AA 1DWBH 1EX3A 2Z9JA 1ESBA 2P95A 4CH8B 1JWTA 4XBCA 3A87A 4YM9A 1S5SA 1ETTH 3FP7E 3IG6B 4O97A 1KY9A 3CS0A 2XC4A 1HJ8A 1IAUA 3HKJB 1DS2E 3NXPA 4ZKSU 1DWDH 1CHGA 1TGSZ 3OYPA 1N6XA 2Z3CA 3KN2A 2C93B 4UFFH 3SHAH 4JZDH 1SSXA 1D9IA 4IC6A 1GJDB 1HJAC 4JZFH 5E0HA 1U6QA 3W95A 1FNIA 1CT2E 2ANMH 2P59A 1FONA 3RXJA 2VIVA 3KQCA 3QLPH 2FM2A 1BQYA 2PTCE 1ACBE 1YC0A 3RXFA 2Z3EA 3SV9A 1C5LH 1A5IA 1W7GH 1UVUH 3T29A 4ABBA 1F2SE 3RXCA 4AGKA 1OSSA 1QBOA 7GCHF 2FX4A 1OYTH 3STJA 2ILNA 3QTOH 1FAKH 1E37B 1FDPA 3ZVAA 4Y10E 2H9TH 5FX6A 1CBWC 3OTPA 1ABJH 2HLDD 2EI6A 3NRLA 1QB6A 1ZYOA 3PTBA 1DX5M 3EGKH 4AYYB 1XX9A 4KTSA 4ISLA 1ELDE 3ELAH 5T6FA 4NIVA 2P3UB 5F8TA 2G51A 1D3DB 3U9AH 3DHKH 4KGAA 3VB7A 3UFAA 1UTNA 4BAKB 3E0PB 1MU8B 1P0SH 1O3LA 2Q6FA 4K1SA 1IQJA 2XBYA 3PO1C 1T8OA 2ESTE 3TGIE 1FUJA 1TPOA 1F0UA 2J92A 3MMGA 2L6OA 1PYTC 4AORA 2BD5A 2H9HA 1BHXB 4F55A 1C9TA 1TBRH 5DP4A 3MH4A 1AUJA 1SGRE 3SYJA 1XUGA 3RU4D 1XUIA 1QNJA 3GY3A 3FP6E 2V6NA 3SORA 1O5BB 4LOYH 3AAUA 3M5MA 3U28C 3URCA 5DK1A 1EJMA 3RLYH 3EA8A 1O3CA 3E3TA 4OS1A 2VIPA 4ASUD 2P8OB 1VZQH 1QJ7B 1XVMA 3BEUA 5E0GA 2PFEA 2B8OH 4Y76A 3QGJA 2J38A 1V2OT 1K1LA 2O8LA 8ESTE 1K9OE 1UJ1A 4K8YA 3H5CB 2IPQX 4FOUC 1C2LA 1SOTA 2UUKB 1TMBH 4BTIB 1YWUA 2JDID 4K60A 2STAE 1LHEH 2FDAA 3FO8D 2CHAB 2BD4A 2ZU3A 2C4FH 1V2VT 2ZHWH 5DG6A 3VB6A 3KYGA 1ZSLA 1TA2A 3BTTE 3TJOA 2AEIH 1NM6A 3CNRA 1P9UA 4TSFD 1NRSH 1O2GH 1GBAA 2A45B 2Y6TA 1TMTH 3P95A 2TGDA 2BY5X 1F5LA 3ZYEA 5FX5A 1ZPBA 1AFQB 5DP8A 3SU5A 3O8CA 1A5GH 1C1UH 2XTTB 1GHZA 4DVAU 3UTUH 1C1VH 3T28A 1GBCA 2RDEA 2XNDD 5GNDA 1XM1A 1W3CA 1HNEE 4X1SU 1C2JA 5T6DA 3NUMA 3FN8A 4X6PA 1E1QD 1THPB 2BZAA 1ESAA 4Y0ZE 1S83A 5L2YH 1ORFA 4H42U 2FI4E 1TQ7B 1E36B 3LGIA 1GJ8B 3A84A 3S0NA 2PKSC 2G81E 4O9VA 4AFQA 1NU7B 5HM9A 2NU0E 2OQUA 3E91A 2AH4X 1W13U 4NIWA 1HAYB 2XC0A 3QN7A 3VG8A 2VB0A 4TWYA 3SUGA 2R3YA 3TJVA 2OC1A 1GDNA 1TONA 3RXUA 3F0PA 1MH0A 1V2TT 5GPIB 2ZDVH 4FVDA 1KXDA 1F0TA 1E1RD 3RC6A 1BMMH 4BTUB 2IPHA 1YPGH 4MVNA 3D23A 3RM0H 2HVXA 4AX9H 3JZ1B 2SGDE 3L33A 3RMMH 2Q6DA 1CT0E 1SLUB 1NRRH 1GI7B 4RKOB 2F83A 1MD8A 4ESTE 1Z71A 1GG6C 2PWXA 1P06A 1GCTB 1G3EA 1EOJA 2FOEA 2FP7B 1XVOA 2F91A 2WPIS 3SNCA 2UWOA 3PB1E 3VB5A 1Y3WA 1IQMA 2KZ4A 1CBWB 5J4SA 1FXYA 1GBJA 1LKBA 1SGTA 1TPAE 2W6ID 2TGAA 1LHCH 1QHRB 4QT8C 1LKAA 2BY8X 1V2RT 2BY7X 4Q63A 1O2NA 2BYAX 5TCCA 1K22H 3C1KA 1W7XH 1RFNA 1HAOH 1ETRH 5DGJA 1C1SA 3OFND 3LH1A 8GCHF 1PFXC 4AB8A 1EXFA 4FXGH 1P2MA 2WINI 3SV2H 4IBLH 4TPYA 4A6LA 1F7ZA 1YM0A 1VR1H 2WUBA 2BQ6B 4A1XA 4I8GA 4RT1A 1Y8TA 3A83A 1YP9A 1AVGH 3M7QA 4B75A 5GCHF 2R0LA 4LXBH 3ZV8A 1P2IA 1BB0B 5DPAA 1TA6A 1MD7A 3SGQE 1DOJA 4CRCA 5DN6D 1EPTB 1SLXB 1EZSC 1KDQB 4K1TA 1BTUA 1GVLA 2YNAA 1P10A 2H2ZA 3T5FH 4E05H 3VGCC 1DITH 2BLOA 5EQSA 2WPHS 5C94A 3DA9B 2OC8A 1GBDA 2SGQE 1UK4A 3LGUA 1O3IA 3NKKA 4AGJA 1GCTC 4YOIA 4NSVA 3M7TA 3ZVEA 7KMEH 5HIZA 1C2FA 5ABWA 1EZXC 1Y3YA 2YNBA 4H6TA 1HB0B 4X2WA 5EQRA 4Y6DA 1VITG 1NBME 1AB9B 1BDAA 3WW7A 4BAMB 2BDGA 3TLOA 1PQ5A 1FY4A 1FY3A 3WWBA 3GICB 3TK9A 1HGTH 4HGCA 1O2PA 1HFDA 2XBXA 1LVYA 1T31A
chains in the Genus database with same CATH topology
2Y5FA 1NT1A 2ANWA 3A7XA 1L4ZA 1O2SA 4YTAA 3OTJE 1A1RA 2ZFFH 3PM3A 3GYMA 1PQ7A 3KGPA 1AWHB 1KXFA 1SLVB 1TNLA 4ZXYH 1GMHG 2BQ7B 1Z1IA 2J94A 1A5HA 3QTVH 5EGMA 1EB1H 1THSH 5FPTA 1D6WA 3UWIA 3TGKE 1WSSH 2G00A 4FUFA 2GVFA 4ABEA 4A92A 1KTSB 2G8TA 1O39A 3BTKE 1DLEA 1NPMA 2G4UA 1O5GH 5CHAB 1HAGE 1P04A 1ZPZA 2ZGCA 4Y8XA 2AMQA 3GDVA 3SNDA 1RRKA 1PPZA 1A61H 5LPEA 3CS7A 2ZO3H 4FU9A 1DDJA 1QRWA 1HAVA 5EOKA 2OBOA 1GHAF 1V6DA 4WH6A 1PPBH 2P93A 1AGJA 3QZRA 1VGCB 5AF9H 3MU1A 2JETB 1AD8H 3P92A 2GT8A 4WH8A 2A32A 2Z94A 2ZQ1A 4ZROA 1ANBA 5FHTA 4YO9A 1DWEH 5HXFA 4DT7B 3SJKA 1C2MA 4K69A 3SQEE 3S9BA 3SUDA 1RIWC 5A0AE 1GJ4H 4ZHMU 1BMLA 2ZEBA 5DKMA 4IS5A 2FOBA 3ZVBA 4OS6A 1PPCE 1G3CA 1AIXH 1EKBB 1LQEA 1N8OB 2HWLB 3A7ZA 1BTZA 2W5EA 3U8RH 1O5FH 4MPUA 3A82A 1GJ7B 2QN5T 3ESTA 2XNIA 1OWIA 1P01A 3O8BA 5FBIA 1B5GH 2GP9B 1CA0C 3O8RA 4LZ4B 4FUJA 2FTMA 2CHAC 4MNWA 1QGFA 4F49A 1IQEA 4X8VH 1Z8JB 1D3QB 1OKXA 3L3TA 1KLIH 7LPRA 1YPEH 1WU1A 4UDWH 3SUEA 1AQ7A 2XCFA 2FWWA 4WMEA 3H7OA 3RXRA 2ZU4A 3RXBA 1O3FA 4SGAE 1MTNB 1BRAA 2A5IA 1AVWA 2BTCE 3GY4A 1P3CA 5FCKA 1VJ9U 4NA8A 1F92A 4FUIA 3SGAE 1Q3XA 3PWBA 3TGJE 2CGAA 1EQ9A 3SV6A 3LC5A 4BAHB 2GMTC 3ATLA 4MG3A 1ZMNA 1BBRE 3GCHB 4I8LA 3RXKA 2CJIA 1O3EA 5GDSH 1QRXA 2FS9A 3DUXH 1XXFA 2PGQB 1BOQA 2BD8A 4K3JA 1O34A 1ARCA 3BSQA 2V3OH 1P2OA 3GY5A 4CBOA 1W12U 1DXWA 1C5YB 1LHFH 2PUXB 2V0BA 1OWKA 1Q2WA 3LU9B 1DUAA 4JCNA 1BTWA 2AGGX 5EODA 1AMHA 1FY8E 1T32A 2AIQA 5LPRA 3KQDA 1EB2A 1S81A 3Q77A 2UUYA 2HNTC 4JYTA 1RD3B 3AW0A 5AHGH 2RA3A 1C4V2 4CREA 5CMXH 3LGVA 1L1JA 4GUXA 1ARBA 1NFUA 9ESTA 1SI5H 2BB4A 2C8XB 2V35A 2ZPSA 1CA8B 4K1EA 1CGJE 3UOUA 3MO3A 1AVXA 2NU3E 1BCUH 2FLBH 1Y3VA 2XYAA 1GI4A 3R3GB 3EQ0H 8LPRA 2EI8A 2PHBA 3MU0A 2WPLS 3LJJA 4X1NU 1ZRKA 1DY9A 1Y5AT 2R3UA 3RXOA 3RXSA 4CRFA 4MNVA 1GJ5H 1O35A 1ANCA 1WQSA 1Z6EA 1VCPA 2FLRH 2ZF0H 1HAVB 1GMDG 2FX6A 2WV5A 4BTTB 2HOBA 2R2WU 1GBLA 1C5ZB 5A09A 5LPFA 1SVPA 1TPPA 1C2EA 4MQAA 3G01A 1UTMA 2XC5A 4B71A 2ZP0H 1G3BA 5C1YA 3RXMA 1AN1E 1J17T 3P70B 2P3TB 2B0FA 5A8XA 3NCLA 3NWUA 6GCHF 5AFZH 4R0IA 2ZWLH 4WF8A 1GI2A 1A4WH 2BD7A 1L4DA 1S6HA 2WYJA 2A5KA 1LVOA 2JH0D 3SN8A 1B7XB 3RMOH 3RUOA 3SU6A 2QIQA 2OCVB 1KTTB 3A81A 4VGCC 3UR6A 1WYKA 2BY9X 3MNXA 4BXSA 1G3DA 5FAHA 2A7JA 1GCDA 3AASA 4ZKNU 5DP9A 2FS8A 4HTCH 2Z9GA 4E06H 2NWNA 2FOGA 2BDCA 1JMOH 1DE7H 1LCYA 1O2RA 3QUMP 2FIRH 4KTUA 4HZHA 2F9NA 1YCPM 4YOJA 4AN7A 3GYLB 1E34B 1ESTA 4PROA 1TGBA 5ESBA 1ZRBA 2A4QA 1OP0A 2ZCHP 1C2DA 1PYTD 4GCHF 1AHTH 1O3KA 1KXCA 3FVFB 3TH2H 3K65B 3VXFH 1DICA 2PKSB 4X0WU 1YGCH 3RXVA 5GCHG 2ZGHA 3V0XA 1FQ3A 5LGOA 2ZC9H 4BANB 2Y5GA 1FIWA 3K2UA 3P8FA 2BHGA 3MO6A 2ZGXH 1QL8A 2GD4B 3SBKA 6CHAB 4WMDA 1ZGIA 2PW8H 4RN6A 1D3PB 1C1MA 5FBEA 1P2KA 3VFEA 1P2JA 4I31A 3KQEA 5JYIA 4TPIZ 1OX1A 3F1SB 2B9LA 1OOKB 1JXPA 3M5NA 1RJXB 1YPHE 3GY7A 1DM4B 1BJUA 4NSYA 1V2QT 2FOHA 1C5RA 4ZHLU 1MTUA 3UREA 5EPNA 3EE0B 3MH6A 3M35A 1Y5UT 1CHOF 1BT7A 1QR3E 1H9IE 1VGCC 2XWAA 1YPMH 1GBBA 4OS7A 2DE8A 3L6PA 3BEFB 4X2VA 5EXLA 4DGJA 2CF8H 4JMYA 4DOQA 4K2YA 1MAYA 1TPSA 5DJ7A 3LGWA 2HLCA 1SHHB 3JZ2B 1JRTA 2J9NA 2ZDKA 1BBRK 4GAWA 2EI7A 2C3SA 1QBNA 2ODYB 3UWJH 4IGDA 4YT7H 5JPMH 3SW2B 3ZZ9A 4ABJA 1C1QA 1CT4E 2WUCA 1WV7H 2OTVA 3F9GA 3OU0A 5EW1H 3T62A 3FFGA 5CE1A 5HYOA 1CA0B 1QQ4A 1BTHH 3PMBB 1DLKB 1JBUH 4M7GA 5TJXA 4WXVA 3OY6U 1HYLA 2ZDNA 2OLGA 3ENSB 4D9QA 1O37A 1KLJH 1LQDB 3TJUA 4RKJB 1TNIA 3ATWA 3S9CA 4KTCA 5ETXA 2RA0A 4B76A 2H6MA 2VIQA 4CBNA 1EP6A 3E1XB 2R9PA 1TE0A 1TGNA 1KXBA 3Q3YA 2J4IA 2XXLA 3ZVCA 5DP6A 3PLBA 2ANYA 3RXAA 2BD3A 4X6MA 3V13A 5F8XA 2OQ5A 3B9FH 5C20A 1HXFH 2PR3A 1ELBA 1GHAG 4B2BA 1O2LA 3P6ZB 4B73A 2BLWA 3SJ9A 3LT3A 4UEHH 1FAXA 3CENA 4ISNA 3AW1A 1HIAA 1HAHH 3ATKA 2CN0H 2I6QA 3SGBE 1HXEH 3TJNA 3MH5A 1NFXA 1H9HE 3BTHE 3A7WA 2ANKH 2Z7FE 1INCA 3LJOA 1W10U 2SNWA 1O2HA 4INLA 1C2GA 3VGCB 6CHAC 4CRBA 2ZU2A 4NGAH 1CGIE 2TGTA 4B2CA 3A8CA 4FUEA 1NZQH 3F9HA 1V2WT 1X7AC 1YPHC 2IOTA 3GY6A 1N1LA 1K1NA 1L2EA 1CQQA 2ULLA 2J95A 3MU8A 2P94A 4U01A 1OYQA 4WXIA 1A0JA 4MLFB 1SGNE 1GHWH 5JBAS 1SB1H 1Y3XA 2H9EH 2V3HH 2G4TA 1AY6H 1C5VA 1LO6A 4BXWA 3P17H 1AKSB 1O2OA 5C2ZA 4Y0YE 1SGQE 3ZZ5A 2DUCA 1O38A 4YESB 2VH6A 3PTNA 2FOAA 3M3VA 1Q31A 3BTWE 4X6NA 1MKXK 2PSXA 2UUJB 3S9AA 1BIOA 8KME2 1GBIA 2G55A 1THRH 2GTBA 5ESTE 4LK4A 1HAPH 1G36A 4DIIH 1C5XB 1T4VH 3T25A 4Q7XA 1P3EA 2UUFB 3DFLA 1WCZA 1TX8A 1LHGH 1JIRA 1BMNH 3ITIA 3MO9A 1KDQA 1ZHPA 3M5OA 4ZMAH 2A31A 1TNJA 2BDYA 3P8GA 1GG6B 4NZQA 1C4U2 5GXPA 3KEEA 5B6OA 2BLQA 2GCTC 4X8SH 4WWYA 1EAIA 4HFPB 5JB9S 1ZZZA 2Y5HA 2ZHDA 2F9OA 3U8TH 4D9RA 3OSYA 2VNTA 4U30A 3FANA 3RXQA 1P05A 1KIGH 2Y82A 1ELAA 3BV9B 1ELVA 2BMGB 4BAQB 2GGVB 1A3BH 2AGEX 1GPZA 2ZDMA 1O2YA 2SGEE 4IMZA 3E0NB 3E6PH 3VXEH 1QFKH 3V3MA 1C1OA 1O2JA 2A7CA 2BVSH 3H7TA 3IWMA 3EYDA 1W8BH 4WJG2 5EXMA 2YOLA 3MNCA 2FESH 1SGEE 3LOXA 2JH6D 5EPYA 1NY22 1GHBF 2GCHG 1UHBB 3NPSA 5EU8A 1UHBA 3RXLA 4XOJA 2BVXH 5A2MH 1P9SA 2F9VA 2A4GA 1IQGA 4DJZB 1QJ6B 1MTNC 1O30A 1Z8IB 1XXDA 3URDA 4GLYA 2OUAA 3RXGA 2NU2E 3RC5A 1F0SA 3A85A 1CVWH 3SU0A 1K1JA 4E7NA 3EA7A 1HAIH 3SV7A 1TB6H 3U8OH 2BXUH 2VWNA 2SNVA 2Z9IA 3PROA 2W26A 1YCPK 3SU2A 3UIRA 4WMFA 2BD2A 3SU4A 3SJIA 4D76A 1IQFA 4I7YH 2W7UA 1O32A 3RU4T 5DO4H 1QQUA 1TGCA 1TNGA 2NU4E 4BNRA 2ZHEH 1A0LA 6GCHG 2NU1E 1GI1A 4BAOB 1SGPE 7ESTE 5E0JA 1O3HA 3SNBA 1J16A 2QXJA 4J2YB 4U2WA 2F9UA 3RXDA 1GVZA 4R8TB 1O2IA 2RDLA 1UTJA 1C5SA 4Q7ZA 5SGAE 4ZAEA 1NESE 4ABDA 3SNEA 1A3EH 3GCHC 4FVBA 1UK3A 1FIZA 1V2UT 1GHYH 2HPPH 4CHAB 4KP0A 2W3IA 1C5PA 1AZZA 1WOFA 1WTGH 1EOLA 1W0YH 3V7TA 2A5AA 2VGCC 3HATH 5BPEA 1BRCE 5FPSA 1ZTJA 4X6OA 3TU7H 4ABIA 2VVUA 4XSKU 1SGFA 1MQ6A 4ZUHA 4MDSA 2THFB 2ZTXA 1J8AA 1QA7A 5JBTA 4MTBA 3R0FA 3E90B 3SJOA 1EZQA 1NRNH 4INKA 1O31A 4AFUA 4I8HA 4GCHG 2ZFRH 1EUFA 1S0QA 3Q3XA 1EASA 2ODPA 4AFZA 4Z6AH 1TYNA 1K21H 4UFGH 3RXHA 2XWBI 2ZDAH 5AFYH 4H6SB 2ZA5A 1XMNB 2ZGBH 2FMJA 4UFEH 1Z7KA 2OBQA 5H4IB 1N6YA 1ZSJA 2BDAA 1FI8A 1BMAA 1UTLM 3UR9A 1MAXA 4ISIH 5BRRE 1AWFH 4A5TS 1L1GA 2BOKA 3ZZDA 5GIBA 1DVAH 1K1MA 1Z8RA 2F9PA 4B2AA 5JB8S 1T8LA 2HPQH 3M37A 1TRMA 1VCWA 3TIUA 5EW2H 2C8ZB 2BDHA 2B7DH 2FO9A 1UVTH 1EATA 3SJ8A 1GJAB 1GDQA 3MH7A 1ID5H 5HGGA 1C5WB 2ZFQH 3VEQB 1KLTA 1EJAA 2ZU1A 1ZGVA 4ZKRU 4B74A 1GWAA 2GV6A 3RMLH 1Z1JA 1D4PB 1QB9A 2A4RA 3I77A 1P09A 1T8NA 1MCVA 1XUKA 1O3BA 2F3CE 3ZYDA 1G30B 3UUZA 3EA9A 1HBTH 1GHBG 1SQAA 3LGTA 3BIUH 1HPGA 1O33A 3LH3A 4DCDA 1GBKA 5L2ZH 1O5AB 3SUFA 1C1NA 2D26C 1F5RA 3K6ZA 2Z9KA 1M9UA 1YF4A 2BD9A 1V2PT 3P8NA 2PV9B 2AMPA 3U1IB 1ELGA 5A0BA 4ABFA 1O3JA 1IQHA 4AOQA 1IQNA 1SR5C 2KAIA 3KIDU 2TBSA 5C3NA 4I8JA 3TITA 2H1UA 3MHWU 1OS8A 2ZIQH 1C1TA 2A2QH 3U1JB 3D49H 1LVMA 2O8UA 2ODQA 4GVUA 1O2KA 2ALPA 2ZCKP 1TX6A 3PV4A 1S85A 5LH8A 1DFPA 1W14U 3GCTG 1FV9A 4DURA 1UTPA 1QURH 1MU6B 4DIHH 1ANEA 3A80A 4Q7YA 1H9LB 2BZ6H 1AE8H 2GKVE 1EPTC 1A46H 2GZ9A 1CE5A 1OWHA 3S69A 4U32A 2GT7A 4XFQA 1HJ9A 2HGTH 4HI3A 1HRTH 4IC5A 3BTME 1JOUB 1GMCG 1ELFA 2LPRA 3RXTA 1KXAA 3CP7A 4YZUA 5F03A 2TGPZ 1IOEA 2W3KA 2ZFPH 4X2YA 1QIXB 2AYWA 1EP5A 1TABE 1AU8A 5F6MA 5TCAA 1FLEE 3BTDE 1ANDA 2D8WA 2XRCA 3WY8A 2VINA 5F8ZA 1HCGA 2PSYA 1J9CH 1GI3A 2PGBB 1ZMJA 1GBEA 3OY5U 2HRVA 1W0ZU 1TX7A 3ZVDA 1EZUC 1J14A 2FI3E 1C5OH 4CR9A 1E0FD 2WYGA 2ZFTA 1IQLA 4JZEH 1YYY1 1RTKA 1O2ZA 4ABGA 2D1JA 3DD2H 3KF2A 1BRUP 3F6UH 1UTKA 4KKDA 1NFYA 2AMDA 2ZU5A 3NK8A 3TH3H 1ZPCA 2BLVA 1TLDA 1YCPH 1DXPA 1FN8A 2IJOB 1C9PA 3FAOA 1EPTA 1IQIA 2BQWB 2PKAA 2JH5D 2DE9A 2FOMB 1ELTA 4NIYA 4A1VA 1EAUA 1DSUA 2VIWA 2QXHA 2FZZA 1NS3A 1NROH 2AFQB 2JKHA 2QAAA 4Y7BA 4CR5A 4CH2B 1FPCH 1BTPA 1SBWA 1SPJA 1TQ0B 4I33A 4TY7A 1GJBB 1UO6A 1F0RA 1CU1A 1YPLH 4MPXA 3ZZCA 3MTYA 4F4OC 1O5DH 1SGFG 5EQQA 1UK2A 1N8OC 4INHA 3DT0H 1C5MD 1SGIB 3QZQA 1GBHA 4DY7B 3ATMA 4FUDA 1J15A 2WPKS 2QXGA 1O0DH 2LNCA 1O2WA 2Q1JA 1LPZB 2O9QA 3B8JA 1RGQA 3LIWA 4JZ1A 2GV7A 2JETC 3SI4H 1GI0A 1OWJA 1TALA 4Q2KA 1PPHE 2GCHF 1FMGA 2SGFE 3Q3KA 4GSOA 1LPKB 4K8BA 3NZIA 1SLWB 4THNH 3BEIB 3UNSA 4XDEA 4VGCB 3ZZ4A