2Z9LA

Complex structure of sars-cov 3c-like protease with jmf1586
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
305
structure length
300
Chain Sequence
SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICLNPNYEDLLIRKSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKFYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQCSGVTF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords 3C-like proteinase
publication title Structural basis of mercury- and zinc-conjugated complexes as SARS-CoV 3C-like protease inhibitors.
pubmed doi rcsb
source organism Sars coronavirus
total genus 82
structure length 300
sequence length 305
chains with identical sequence B
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2007-09-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1840.10 Mainly Alpha Orthogonal Bundle main proteinase (3clpro) structure, domain 3 main proteinase (3clpro) structure, domain 3 2z9lA03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2z9lA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2z9lA02
5C1UA 1KSNA 3LGVA 3OY6U 3QO6A 1AHTH 3TJNA 1QL8A 3UWIA 5JBBS 4NWLA 1RGQA 3SUDA 1VITF 2XTTB 3M7TA 1D3TB 2HNTF 3MO6A 1CT4E 2ANWA 4AYYB 4WH6A 4AN7A 4HI3A 2O9QA 3F1SB 3MO9A 3F9FA 2PKSC 1EOLA 3SGAE 1T8MA 3GY3A 3T27A 1OP2A 3K6ZA 2SGDE 1O3JA 3TITA 1WBGB 1CT2E 1MCTA 1S5SA 3TH2H 2ZU2A 1QBNA 3ZZ6A 1QL9A 1VGCC 4BAKB 1MKWK 1UTOA 1WCZA 2ZA5A 3T25A 4IGDA 1THSH 4JYTA 3LONA 2ZTZA 1FDPA 1SC8U 2TGTA 2A5KA 1SR5C 1CGIE 2A4QA 2W3KA 4ISOA 4ABGA 1E34B 1SGFA 1ANCA 3OTJE 4ZHAA 3MH7A 3ZZ7A 1RIWC 6LPRA 2ZEBA 1HLTH 4UFFH 3SI4H 1INCA 1GBJA 4RN6A 3WY8A 1C2JA 1LO6A 3GDSA 1VGCB 1KIGH 3GY6A 4MNXA 1LVBA 3GY2A 3KQEA 3ZVEA 1L4ZA 2AGIX 1C2LA 7LPRA 3RXQA 3EDXB 4WXIA 4MVNA 2XC5A 4JMYA 2O8TA 2Q6FA 1C5UA 5IYTA 1GMHG 5LGOA 1GL0E 1MU6B 5F03A 1MZAA 4AZ2B 5C67A 2HOBA 4YT6H 1RIWB 1KXDA 1XUGA 4X0WU 1C1WH 1W7GH 1HCGA 3PV4A 4K8BA 1A2CH 1ZTLA 1C5SA 2FI4E 4YOGA 5GXPA 1ELEE 1SQTA 2BM2A 3QTVH 4JZFH 4F49A 2P16A 3MNCA 1LHFH 3E3TA 4I31A 1A61H 1PPHE 4X6OA 1QRXA 5FPTA 4FUEA 1F5RA 3S9AA 4INHA 1T7CA 2P3FH 4FUFA 2CJIA 1O2KA 1T4VH 1CO7E 1GL1A 4WMDA 2GVFA 3LH1A 2NWNA 3MFJA 1FPCH 2NU3E 2LIZA 1T8LA 2R0KA 1BB0B 1DY9A 1OWDA 1LPGB 1SGCA 2AS9A 4D7FA 5A09A 2ULLA 4NZQA 3U98H 3K2UA 2A0QB 1E35B 1O2NA 2CV3A 1ESAA 3GCTF 4H6TA 3SV8A 3E90B 2DE8A 4AYVB 3C1KA 3AASA 2BVXH 5G4BA 1AUTC 2HWLB 2ZF0H 4FUJA 4YTAA 1P2JA 1QQUA 5A0AE 2OD3B 2ZDLA 5LPEA 1SHHB 4WH8A 1NO9H 5DK1A 4IN1A 2GT8A 4TWYA 2FO9A 3QTOH 3QX5H 1KYNA 1UTKA 3M5OA 2C3SA 3H7OA 3MWIU 2Y81A 2ESTE 3URDA 1C5OH 5A8YA 3ZVAA 3O8BA 4AORA 1ELCA 1O2JA 1AKSB 1O34A 2GZ7A 3RXJA 1O37A 5TCCA 1BTHH 1FNIA 1C5QA 1TALA 5C20A 1G3EA 3SORA 1HXEH 2A4OA 3A7XA 1HAIH 5AF9H 3ZZAA 1WQSA 3SOSA 1G9IE 3RXAA 1LCYA 2A32A 1ELAA 5T3HA 4ZXYH 1AE8H 1Q3XA 2PTNA 2QF3A 3Q3YA 4HFPB 1SI5H 4Y0YE 2FS9A 2XBXA 1QCPA 8GCHF 2PLXA 1JRTA 2WPMS 5AFZH 5T6DA 5GPIB 3SZNA 1HIAB 3M37A 2AGEX 3ODFA 3EBNA 1MTNC 4YESB 4WY3A 1TPOA 4JYUH 4X6MA 3UQOA 4NIXA 1O3MA 2A5AA 2BY9X 2ZHEH 6CHAC 2PR3A 1C1MA 1XVMA 7GCHF 3T2NA 3LH3A 3AW0A 2FOCA 1O2WA 2RA0A 2NU2E 5L30H 1H4WA 3UFAA 1LQDB 1YC0A 2V3HH 1V2NT 5EQSA 1AFQC 1QRZA 2Z94A 2ZQ2A 3GDUA 1S84A 4X1NU 5LPRA 3MI4A 2Z6BD 1ORFA 4FUCA 2FM2A 1MD8A 4I8JA 3RXBA 1ZSKA 1MTNB 1RJXB 1YF4A 3TGKE 3LJJA 2BDCA 2ODYB 2ZFRH 3SUEA 1UVPA 5LH8A 2UUFB 6CHAB 5EG4A 5T6GA 3RP2A 1C2HA 2AGGX 4IS5A 4X8VH 5A2MH 4BXSA 5LPFA 4AG1A 3LGIA 1GJ8B 2CF8H 1O3KA 2ZO3H 1AFQB 3OX7U 1SVPA 1J14A 3FZZA 3KQDA 4BXWA 1OP8A 2TGAA 1GJBB 3U8OH 1D9IA 1PQ5A 1C5RA 1YKTA 1FAKH 1LHCH 2ZDAH 3E6PH 5HMAA 3NXPA 1Y8TA 3BTDE 3A7YA 1HDTH 1NY22 4JYVH 2C4FH 5FX6A 9ESTA 1MTVA 3ZZ3A 1YCPM 2OUAA 3T62A 2FX4A 1FV9A 1GHVH 2ZI2H 2FXRA 1ANBA 1DVAH 1AZZA 2GT7A 2OXSA 1O2MA 2BDBA 1PQ7A 1NRPH 1P11E 4I7YH 1TMBH 3MH5A 3P8FA 1SGPE 1K1MA 3BSQA 3ZVCA 5E2PA 1A5GH 1GPZA 1UTMA 3RXHA 1V2OT 4X1SU 3RC4A 3NCLA 1GJCB 1IQMA 1OPHB 2G5VA 1Y5UT 4KTCA 2UUYA 2UWOA 2WYGA 3SO3A 4AGKA 1P57B 3TJUA 1C4V2 3OSYA 1GI5A 6GCHF 2P94A 1XMNB 2FPZA 1QJ6B 3TVJB 1C2FA 1O5GH 1J15A 1OYTH 3KF2A 1P05A 3OU0A 3QUMP 4I33A 5ABWA 1O32A 3GCHB 1C5LH 1KTTB 2FLBH 1QB9A 3ZVFA 1EKBB 1TA2A 5H4IB 3U69H 3EQ0H 1TNKA 4DOQA 1SGTA 1K28D 3ZZ4A 1MTWA 4XBBA 3VXEH 1DICA 2SGAA 2QGRA 2VVVA 1TB6H 5EQRA 1AIXH 2ANMH 2G55A 4MPUA 3ZZCA 3K65B 1JOUB 4MNWA 3HKJB 4Y8XA 1F0UA 4GCHG 4KTUA 1ELDE 3PM3A 3HGNA 4XFQA 1E36B 1UCYH 2R2WU 3EA7A 7KMEH 4DJZB 1IQEA 4IN2A 3RMOH 2SGPE 4K1SA 2O8LA 2BD3A 1GBCA 1BITA 2ZECA 1C1PA 2BLVA 3U9AH 1ETSH 1L4DA 2B9LA 2FOBA 1TQ0B 1LTOA 4IW4E 1QQ4A 1TX6A 2WPLS 1YPEH 2H1UA 1ZZZA 2KAIA 2PW8H 1BBRH 1TMUH 1ANDA 2XCNA 2O8UA 1CU1A 3V12A 3P8OA 1AB9C 1MD7A 2XYAA 1GMHF 3ZZBA 4ASHA 3RMNH 2A7JA 3Q3KA 5FPSA 2AIPA 1CGJE 5DP8A 1CHGA 2EA3A 2WUBA 1P03A 1NROH 5EQQA 5EPNA 4CRDA 3RXCA 4UFDH 2VIWA 3RU4T 1OYQA 1AFEH 1TX8A 2BDYA 1FIWA 4NG9H 1BOQA 2F9OA 1GI0A 3PB1E 4FXGH 3MH4A 1G37A 1AB9B 5ESTE 3LGTA 1PFXC 4DVAU 3MU8A 2GGVB 4ZKNU 1IHTH 2BHGA 3FZDA 4FUDA 1EZUC 5DP4A 3ZVGA 4X2WA 3AVZA 4H6SB 2FS8A 1SLXB 2J4IA 1HAVA 3S7KB 1ZYOA 1H9IE 1TONA 1UHBA 2BDHA 1O5DH 2GV6A 2ZGXH 2XNIA 2YNBA 2BX3A 1GJAB 2CXVA 3SNDA 2PHBA 1GI7B 2Y82A 3RC5A 3F68H 2UUJB 1NS3A 4ISHH 2BXUH 3F9HA 4CH2B 1TOMH 4GSOA 4A6LA 2EI8A 4B2CA 1LDTT 1P12E 1MBMA 3O8DA 2G00A 4KGAA 1E38B 2PFEA 2C8YB 1A46H 1JIRA 4IC5A 4JCNA 1DWCH 1DFPA 2BQ6B 4UFEH 1P3CA 1FN6A 2SNWA 1GHWH 1SHYA 1NRQH 3SNAA 1W11U 1UK3A 3A7TA 1O2LA 5JYIA 1HAYB 4BAQB 4R0IA 1EQ9A 1C1RA 1ZMJA 1O5AB 3ZZDA 4OGXA 1P10A 1N1LA 2GP9B 3KIDU 1GBDA 4SGBE 2ZGBH 4TPIZ 2VH0A 2GMTC 1ZJKA 1EB2A 1EAIA 1KLIH 1RRKA 1T8NA 2TRMA 2ZHWH 1Y3VA 1J16A 2ZGCA 2JH5D 4CHAB 4YO9A 1Y3XA 4J2YB 3JZ1B 1ZLRA 2GCHG 1N6YA 4MPXA 3LGUA 2FLRH 3FAOA 3TH3H 1ETRH 2BD9A 1SGRE 2GD4B 3GY5A 3M36A 2AFQB 2I6SA 1DDJA 3LDXH 4ABJA 1UTQA 2GMTB 1O2IA 4ABHA 1DSUA 5DP3A 3SBKA 1FI8A 2R3UA 3LIWA 4ZHLU 2R9PA 1Z8IB 1KDQA 3GYMA 4CRFA 1PPBH 2SFAA 1UMAH 4UFGH 1O3FA 2JETC 4WMEA 4BTUB 5BRRE 1O2ZA 3LC5A 1A5IA 1C1VH 1QTFA 4INKA 2Z3CA 5BPEA 5F8TA 1BMMH 3PWCA 4HZHA 5FPYA 1C2KA 1YLCA 5DGJA 1F7ZA 3GY7A 2OCVB 2NU1E 3SQEE 2C8ZB 1VZQH 1AD8H 1X7AC 2BQWB 3RM2H 2ZCHP 1NZQH 2BVSH 2Z7FE 5E0HA 1FQ3A 2P95A 3A80A 2A4RA 3BTHE 3RXGA 4AGJA 2JETB 1TPAE 2LNCA 1GCTC 1T31A 1HJAC 1W7XH 3QGNB 2ZPSA 5A0BA 3PO1C 1DWBH 1XUHA 1WSSH 1PPEE 3CENA 4AB8A 1HV7A 1HAVB 1WYKA 3B8JA 3UREA 3RXDA 2A2XH 3DD2H 4X8TH 4I8KA 1GMDG 1TA6A 4IMZA 2R0LA 1NN6A 1O3CA 1SGFG 1P9UA 2RA3A 4O97A 2ANYA 1GCTB 4K1TA 1HJAB 1GBIA 3M3VA 1G2MA 2B5TB 4Q2KA 4ZMAH 2PTCE 5FBEA 2BY6X 1FPHH 1VITH 2PUXB 3PO1B 3SU6A 4BAMB 2Y5FA 1GMCG 1TABE 4X1QU 1HAHH 4ZH8A 2BQ7B 3VEQB 3FP7E 1DM4B 1O31A 5CMXH 2WPIS 1JMOH 1HRTH 1GDQA 3MNSA 3RXMA 4Y7BA 4DIHH 1S0QA 2HVXA 1RTKA 3UWJH 3E16B 1GHZA 4LOYH 1GJ5H 3C27B 4K3JA 2ALVA 5F8XA 5EGMA 4I8GA 1F5KU 2GV7A 1DT2A 3CP7A 4CH8B 1A7SA 1EOJA 3BTGE 3SJIA 1O2GH 3EE0B 3UQVA 1EPTA 4XE4A 3HGPA 4NA8A 3SUGA 3B9FH 2V35A 1IQGA 2A1DB 4ZHMU 5C1YA 1O38A 2QA9E 1HJ8A 1E0FD 4ZKRU 1V6DA 2K1QA 2EC9H 5ETXA 1S82A 2Y7ZA 4WVPE 1BTZA 1CE5A 3MTYA 3U8TH 2A5IA 2OBQA 3E0NB 3RC6A 3SW2B 4NSVA 1O36A 4FU7A 1T32A 3QGJA 5ESBA 1C2EA 2A7HA 5FHTA 3H7TA 3BG4C 3KL6A 1O3LA 2O8WA 2Y6TA 2A4GA 1CHOG 3PWBA 3KN2A 1H1BA 5FCKA 3L6PA 1IAUA 1NESE 4NCYA 2OC7A 2R3YA 2VU8E 3I77A 1KDQB 1GBLA 3RXSA 1UK4A 1AWHB 4K1EA 5E0GA 1BT7A 2LPRA 2VWOA 5A8ZA 1NM6A 4GLYA 2P3UB 2J92A 4FU9A 2WV5A 4Y11E 1GDNA 4ISLA 1F0TA 2BYAX 1T8OA 5TJXA 1BMNH 1BTPA 1GBAA 1G2LA 2ZTYA 3ATIA 3BG4B 3RXUA 1YP9A 3AW1A 1ZTJA 3VXFH 3S9CA 1SPJA 4NGAH 3V13A 1ZHRA 3UIRA 4KTSA 1CGHA 3BIUH 3SNBA 3A8BA 1JBUH 4FVDA 1YPHE 1C5YB 1L1NA 1UVOA 2YNAA 1PYTC 3CS0A 1M9UA 1WUNH 2GKVE 2VJ1A 2PUQH 2AEIH 4KKDA 4INLA 3M35A 1THPB 1ZJDA 3RXOA 2XBYA 1A0HB 1GHAG 1LMWB 3P92A 3A82A 4NZLA 1YCPK 4UE7H 3A83A 4FVBA 4JZ1A 3F6UH 1TBQH 1AO5A 4Y0ZE 1W13U 3GCOA 1MTUA 1HAPH 1C2DA 1BIOA 4B75A 1GDUA 1TAWA 1TGSZ 4DIIH 1GHBG 3A7ZA 2FYRA 5PTPA 1DX5M 2J9NA 3M61U 4H4FA 4DW2U 5L2YH 1F2SE 4K8YA 4B76A 4ZKOU 2ALPA 3S9BA 1DOJA 4Q7XA 2ODQA 1L2EA 1C2IA 2C90B 1UTPA 1QB6A 1Z6EA 5EPYA 1ABIH 1ANEA 1F92A 2FOGA 1TWXB 1SQOA 3QN7A 2H5DA 1BMLA 5CHAC 1P04A 4X8SH 2ZGHA 2BDAA 3BTQE 2ZCLP 4JK6A 3FFGA 5T6FA 1FJSA 3KCGH 1RFNA 2ZTXA 1TOCB 2VIDA 3ZYDA 1MKWH 5EU8A 2ZCKP 1O33A 1O39A 3SNEA 1XKAC 1V2WT 2C8WB 2FX6A 3NPSA 3D62A 1XUKA 4E7NA 1FUJA 1THRH 1Z1IA 1QBOA 1HAXB 4Q7YA 4ABDA 3DT0H 9LPRA 1OP0A 1OWJA 2Z9JA 4RSPA 3OY5U 1QGFA 5CHAB 3A89A 1MQ6A 4I32A 4ESTE 2IPHA 4K5ZA 3LT3A 4UD9H 4HTCH 1V3XA 2EI6A 2ZU5A 2QXIA 2STBE 3A7VA 1AZ8A 4WF8A 3PMAB 4LXBH 1TGNA 2Q6DA 2GZ9A 5E0JA 1O2OA 1J8AA 1BJVA 1UO6A 2ZU1A 2VNTA 5JDUB 1NU9A 2PWXA 1B5GH 4CRAA 1HXFH 2J38A 3A86A 4RKOB 3EGKH 3TK5A 3SU3A 1G30B 1C5PA 2XBWA 3RDZA 3VB3A 2G4UA 3Q3XA 1FLEE 4MTBA 2OC1A 4CR9A 2Y5HA 2BMGB 1SFIA 3BN9A 4GVUA 3UR9A 2VGCC 3Q77A 2O8MA 2Y5GA 3A7WA 3BTKE 1K1NA 2AYWA 3Q00A 1GHYH 4Y8YA 1V2ST 4BANB 1SL3A 2GCHF 2PGQB 3PMHB 3ZV9A 1B0EA 1ELGA 1YM0A 2XWAA 5EXLA 3URCA 3T29A 1KXCA 1UCYE 3B23B 1WQVH 1LHEH 3U1JB 4OS7A 3UUZA 1CSOE 3AAUA 4D9QA 1QIXB 3PMJA 3GCHC 5TCAA 2AERH 2Z3EA 1QA0A 1DS2E 2W5EA 1A5HA 2M5TA 2YOLA 3SHCH 2VGCB 2R2MB 4UONA 1Z71A 3TH4H 5L6NH 1V2VT 3A87A 1OWKA 1O2SA 2WPJS 4CR5A 1D3PB 2QV1A 2Y80A 3HATH 1BBRE 3BEFB 4Y7AA 3ATKA 3RXRA 1O3IA 3SU5A 3KGPA 2PSYA 1S6HA 2ILNA 1Y5AT 1NFYA 1SOTA 1CVWH 1UVTH 3A8AA 3NUMA 1PPGE 2GZ8A 3VB5A 3HPTB 1D4PB 1FAXA 2J34A 1XX9A 1P2KA 4ZROA 2BXTH 1DXPA 5K7RA 4DT7B 2HGTH 4YLQH 2BD2A 2A45B 2RCEA 2ZPQA 1CA8B 4IMQA 1IQNA 1KLTA 2A2QH 2ZGJA 4UDWH 3QK1A 5A8XA 1V2RT 1EP5A 2I6QA 1U6QA 3S0NA 1BRAA 2VWLA 4IC6A 4HGCA 1IQHA 2BDIA 1PPCE 3SJ8A 1GMDF 2TIOA 1TPSA 2XC0A 1XM1A 4WXVA 3VFEA 4AFUA 1HUTH 1ARCA 3FANA 1LKAA 1ZRKA 1BZXE 3BTME 1GI3A 1GI1A 3PLPA 1O0DH 3GCTG 2WPKS 2F9BH 1UVSH 1QR3E 5EW1H 1EJNA 1GMCF 2J95A 3LJOA 3LU9B 1O2HA 1Z8JB 4Q7ZA 4YLUA 2AIQA 1WTGH 3TK9A 4Q80A 5DP7A 2G4TA 3MO3A 2OLGA 1UTLM 1GBKA 2F91A 1D6WA 1HJ9A 3PTBA 4TYDA 2H6MA 2G52A 1LKBA 2PKAA 2B7DH 4D9RA 4Z6AH 1AVXA 2BZAA 3KEEA 2H2ZA 2TGDA 4U30A 1DE7H 4ABEA 3OYPA 1AVWA 1OWHA 2ZDMA 4MNYA 1H8DH 3MNXA 3SN8A 2UWPA 4THNH 1AWFH 4A1VA 2HPPH 2WUCA 5AVDA 3D23A 3IWMA 4OS5A 1ZTKA 3M3TA 3VB4A 1QHRB 2ZIQH 3PROA 1TBZH 5SGAE 1MBQA 4Y6DA 2H9HA 3PYHA 5C3NA 1C2MA 3MU1A 3NZIA 4K69A 1W0YH 4B2BA 3SV2H 2CN0H 1HNEE 2F83A 1TIOA 3A84A 4D76A 1PJPA 5DP9A 2QF0A 3F9GA 1BRBE 3N7OA 3TPIZ 1G32B 1YPLH 1QFKH 2CHAB 1YPKH 1S0RA 5EXMA 2FTLE 1CHOF 2Z3DA 1L1GA 2OINA 1PQ8A 1CA0C 2V3OH 4ZXXH 1OWEA 4IBLH 3UOUA 1O2XA 3I78A 1K1IA 3RXKA 1O2RA 4MDSA 5FAHA 2HRVA 1UTNA 3TJOA 3GY4A 1MH0A 3LGWA 3RLYH 1O5EH 2XC4A 1FY4A 2FEQH 3GISB 3MYWA 1P9SA 2GX4A 2FP7B 5AHGH 2FWWA 3R0FA 4DG4A 3D49H 5E2OA 2ZU4A 1K1LA 1GJ7B 1AMHA 2QAAA 1ZRBA 3T28A 4CHAC 5GCHG 4ZKSU 4X2VA 1Z8RA 3D65E 2FIRH 1CA0B 1D3QB 1EB1H 1V2TT 2D1JA 1TBRH 1FY8E 3A8DA 1MU8B 3SI3H 1IQIA 1LPZB 2ZC9H 5DP5A 3LC3A 2F9UA 2UUKB 1O2TA 3SJOA 1IQFA 2ZZUH 3MH6A 3SGBE 1MTSA 1GHAF 3A81A 3VGCC 1ABJH 2P8OB 4X8UH 1P0SH 1CQQA 1NRRH 2IJOB 1EZXC 1ELBA 2G5NA 3M3SA 2GDEH 4AFSA 1GHBF 1YPJH 5HGGA 2ZFPH 3DFLA 4DGJA 4NFEA 1FIZA 1H8IH 3FP8E 2BZ6H 4A5TS 2AMDA 1QB1A 3QZRA 1J9CH 3VGCB 3TIUA 2ZDNA 1BRCE 4YOJA 2KAIB 1SMFE 2WINI 3PTNA 4ABBA 1S83A 1ESBA 1D6RA 2HNTE 2Q1JA 5CE1A 2F3CE 1JWTA 3E8LA 4TWWA 1XXFA 2TBSA 1BTWA 2VIQA 4BAHB 4I8LA 1CT0E 3ZZ5A 3ZZ9A 1TNGA 4SGAE 1GCDA 1CBWC 3GICB 1GVKB 1YPHC 2QXHA 1DWDH 1O3PB 3DHKH 2SGQE 5C2ZA 1WU1A 2FESH 5J4SA 1S81A 3L33A 1EUFA 4GAWA 4ABIA 4CBNA 2Q6GA 1NFUA 2RG3A 1OWIA 1W0ZU 2ASUB 1Y59T 4WWYA 4XSKU 4MG3A 1QY6A 2FZZA 2W7SA 3BTTE 1CBWB 3P17H 3M5LA 5I46H 3DFJA 1ZSLA 1F0SA 3P70B 1EXFA 4Y8ZA 5JBTA 1TLDA 2QN5T 2F9VA 3RXTA 1ELTA 2OTVA 2FOEA 1EZQA 3IG6B 1O5BB 1SGQE 3MOCA 2PV9B 1UHBB 3SV7A 1PPZA 3ZV8A 2F9PA 3M5NA 1AKSA 5HM9A 3S69A 3UNQA 1EP6A 1NFWA 3TJVA 1AU8A 1GBFA 4ISIH 4OS2A 1TRMA 4JZEH 2UWLA 1MCVA 2Y7XA 4ISNA 2OC8A 2BX4A 1O3GA 1Q31A 4E06H 4X6PA 1TQ7B 2PKSB 3BTWE 4XDEA 3L3TA 4BTIB 1QJ7B 1DWEH 1W3CA 1XXDA 1QJ1B 2BLQA 1HIAA 2F9NA 2NU4E 1NTPA 2OQUA 2P59A 2THFB 3O8RA 1FN8A 1LVYA 3RXLA 1C1NA 3FVFB 1K1JA 5DP6A 1O3OA 1LQEA 5A0CA 2ZFSA 1GBMA 1DXWA 1FY3A 3P95A 4JK5A 5JB8S 4E7RG 4WJG2 4A92A 5EOKA 1XUFA 1MKXH 2CMYA 4DURA 3SNCA 4Y79A 1GJDB 3BEUA 4YT7H 3MMGA 1XVOA 2BLWA 2A7CA 2BOHB 3BV9B 4NFFA 1Y3UA 5AFYH 3EA9A 1P09A 1GJ6A 3GCNA 1SGIB 1GI6A 1L1JA 3K9XB 1RS0A 3QLPH 2FOMB 4GHQA 4X6NA 1S6FA 1HBTH 2C93B 1C1QA 4CRBA 1DUAA 2ZNKH 2OBOA 3RMMH 1IOEA 2BB4A 3SV9A 1C9PA 4U32A 3LKWA 3SV6A 3STJA 3ZVBA 1FMGA 3LGYA 1G3BA 2G81E 1O3AA 1P2OA 3GOVB 2SNVA 2OP9A 1SB1H 3BTFE 4R8TB 1BTUA 2FTMA 4NIVA 1AQ7A 2STAE 1WAYB 1KTSB 1H9LB 1SSXA 3SGQE 1AGJA 4DCDA 1SGDE 3TK6A 1KXBA 1V2UT 2V6NA 4GCHF 4ZAEA 1VCWA 1SBWA 2VWMA 2BD7A 2AMPA 1FXYA 1QNJA 2RDLA 4MNVA 4O03A 1ZPBA 1O3DA 1NT1A 1O30A 4CBOA 1Q2WA 1AN1E 1QURH 3SU1A 2BVRH 1K1OA 2ZQ1A 1GJ4H 1EAXA 1ZGVA 1B7XB 1UK2A 1WOFA 3V7TA 2BD8A 1HAGE 2VIOA 5DO4H 3SUFA 1TRNA 1ELFA 1MMJN 2BDGA 3ATWA 1ZHPA 1UJ1A 4VGCC 2ZWLH 4LK4A 5EW2H 2VH6A 5EODA 7ESTE 4Y10E 1BCUH 1C5MD 1OX1A 2D26C 3UOPA 2VVUA 4FUBA 4NIWA 4OS6A 3HKIB 1GVZA 2QIQA 5C5NA 4X1PU 1WTHD 3SJKA 3MU0A 1AI8H 1UVUH 1FY1A 2BLOA 4BTTB 1K2I1 4AB9A 4MPWA 4AFQA 1UCYK 4B1TA 4DY7B 4LZ1H 3QZQA 1P02A 5C5OA 1SLUB 1OOKB 3GY8A 4VGCB 4AFZA 2SGEE 1KXFA 4J1YA 1EASA 3RLWH 1N6XA 2B8OH 3HK3B 1QBVH 4H42U 1YLDA 3GYLB 3BF6H 1EATA 4NWKA 1EAUA 1EJMA 1P06A 3M5MA 1O2PA 1LVMA 1BBRK 1FY5A 1EPTC 1MAXA 1P3EA 5B6OA 1C5NH 1D3DB 3P8GA 2GCTC 3O8CA 1EZSC 4YOIA 1YBWA 4ABAA 4X1RU 3TGJE 3QDZB 1OSSA 4A1XA 3KQBA 3P6ZB 5IDKA 1DITH 1C5TA 2NU0E 1G36A 2ZPRA 4F4OC 3ZYEA 3G01A 1SQAA 4Z0KA 1J17T 1V2KT 2XBVA 3E1XB 4NIYA 4BOHA 1GHXH 1HGTH 2BD5A 1V2JT 1EPTB 5K0HA 1OXGA 1W8BH 1C9TA 1TNLA 5GDSH 1FZZA 3EYDA 1C5ZB 2GCTB 1VJ9U 3V3MA 4OS1A 1HB0B 1C4Y2 2BOKA 1E37B 1C5XB 1VITG 2W3IA 2C8XB 4MQAA 2DE9A 1P2NA 4B2AA 2ANKH 3ENSB 3ITIA 1DY8A 2FODA 3SQHE 2ZKSA 1GI4A 4GUXA 5GCHF 1SOZA 1Z8GA 1NPMA 3RXIA 1F0RA 3E91A 1C1TA 2WV4A 5L2ZH 4U2WA 1NU7B 4M7GA 3MU5A 1GI2A 3SHAH 4Y76A 1V2PT 5HYOA 2QY0B 1W14U 5I25A 5JPMH 2BD4A 3E0PB 1W10U 4MPVA 4ABFA 3TNTA 2J2UA 4CRCA 1FONA 1O2YA 1HFDA 4TPYA 3KQCA 2VIPA 1SFQB 2P3TB 3K6YA 2EI7A 2QC2A 4FUHA 1SLWB 1GWAA 5DPAA 4O9VA 1KLJH 1VCQA 2VWNA 1TFXA 8LPRA 3JZ2B 3NWUA 1GI8B 1YGCH 2Z9KA 4JZIA 3KHVA 1O5CB 1BUIA 1HAOH 2ZFFH 4NSYA 3M7UA 1A0LA 4I8HA 4U01A 3ODDA 2TPIZ 1SGYE 3T5FH 1H9HE 2W7UA 1NFXA 1O2UA 3ZZ8A 1O2QA 4B74A 4A1TA 1C4U2 1UTJA 2ZFTA 1YPGH 2QCYA 1ETTH 2HALA 5GIBA 1TPPA 4GPGA 3QWCH 1A4WH 1MQ5A 4ZUHA 3V0XA 2EEKA 3RM0H 1HAZB 2ODPA 4BNRA 1PPFE 1BRUP 4WMFA 1SGNE 1DPOA 2HPQH 1K21H 2QXGA 1SG8B 3RU4E 2W26A 3MHWU 1VJAU 3MU4A 5FBIA 2IOTA 1O3BA 1O3HA 1O35A 3I29A 1QL7A 1DLEA 2G8TA 1Z7KA 3Q76A 2DUCA 2H9TH 1VR1H 2WYJA 1JRSA 5DKMA 1GBBA 3F9EA 1BHXB 1JIMA 3BEIB 1KY9A 1SLVB 1Z6JH 3PLBA 1O5FH 3CS7A 1RTFB 1G3DA 1GGDC 1S85A 2VB0A 3RXFA 1C5VA 1V2QT 3RMLH 1F5LA 3S7HB 1TNHA 4YM9A 2D2DA 1KXEA 2ZU3A 4AX9H 1TGTA 5HM2A 1WV7H 3KNXA 1ELVA 1AVGH 4X2YA 1QA7A 3UY9A 1ESTA 2FOFA 3W94A 5HXFA 2B0FA 3ELAH 1P2MA 2AH4X 4NA9H 1YCPH 2HNTC 1Y3YA 2XCFA 3BG8A 1W12U 1RXPA 5F8ZA 2XXLA 4XOJA 5E8EH 4BAOB 2P93A 1ZSJA 3RUOA 1RD3B 3U8RH 1DANH 1ZMLA 3LPRA 2TGPZ 4JZDH 4OGYA 1GGDB 1DLKB 1GJ9B 1AUJA 2K7XA 2OC0A 1Y5BT 1HYLA 4AG2A 1GBTA 1Y3WA 4K2YA 1V2MT 1B0FA 2PSXA 4QT8C 1A3BH 1OS8A 3PMBB 3R3GB 4B73A 4K60A 2A31A 2XW9A 3SU2A 3ATMA 4Y71A 4KP0A 4UEHH 3RXPA 1C1OA 1TNIA 2ZFQH 4AOQA 4CREA 1K1PA 2VIVA 1Z1JA 1BA8B 3LOXA 2CGAA 1O2VA 4YZUA 3SU4A 3HK6B 4MLFB 1DSTA 3AAVA 1A0JA 1BJUA 2BY5X 5C1XA 2SGFE 1TMTH 1EAWA 1GI9B 2CHAC 1BTXA 5J4QA 1RTLA 1V2LT 1IHSH 1LHGH 5F6MA 5JBCS 4NA7A 3NK8A 3RXEA 3TGIE 1HPGA 3ESTA 2IN2A 2D8WA 1O3EA 2FYQA 4XBCA 5FXLA 5DJ7A 1P2QA 1ARBA 3RXVA 1G3CA 1A1RA 1NRNH 1C5WB 1LPKB 3TU7H 8GCHG 3U1IB 1OKXA 5FCRA 1GVLA 4X2XA 1YYY1 2PGBB 1K9OE 1TE0A 6ESTA 5JB9S 1NC6A 2XRCA 2ZG0H 1ACBE 2GDDA 2GTBA 1P2IA 1ZGIA 4FUIA 7GCHG 2JH0D 3A85A 1TRYA 4FUGA 1N8OC 4TY6A 2BY7X 2H9EH 4GHTA 2J94A 3DA9B 1MKXK 3VB7A 1C1UH 3H5CB 2Z9GA 5JBAS 3FP6E 1TGBA 2CF9H 2VVCA 1C2GA 1BDAA 2FMJA 4KELA 3VB6A 1TYNA 1ZR0A 1XKBC 1EX3A 4TY7A 4E05H 1C1SA 4LZ4B 3T26A 2P8OC 1TNJA 3GDVA 2QXJA 5FX5A 2FOHA 2WPHS 3EAJA 1GBEA 2H5CA 1ZOMA 1YPMH 5GWZA 1TX7A 1VCPA 4A7IB 1N8OB 2ZP0H 4PROA 3M7QA 2BY8X 1L0ZA 1P8VC 4D8NA 3VPKA 1GBHA 5DG6A 1ZHMA 3PLKA 4OS4A 1NRSH 1KXAA 2JKHA 3A8CA 8KME2 4FU8A 1ID5H 3MNBA 3BTEE 1XUIA 5EXNA 4O3UA 2XWBI 3ZVDA 1GG6C 3NKKA 3ATLA 1DUEA 1ZPCA 2ZHFH 2FOAA 3DUXH 2VINA 2ZDVH 3A88A 3RU4D 1LVOA 2AMQA 3TLOA 4CRGA 1W2KH 1LHDH 3UPEA 1PQAA 2Z9IA 1P01A 1IQKA 1MZDA 1MAYA 5GJ4B 1BHXF 1SGEE 2ZHDA 1K22H 3W95A 1O3NA 2G51A 2QYIA 3P8NA 1QRWA 1PYTD 8ESTE 1IQLA 3UNSA 3UNRA 1A3EH 4RKJB 2HLCA 3STIA 1GG6B 2V0BA 4B71A 1AY6H 1EJAA 1ZPZA 3TNSA 1ZMNA 1T4UH 2FI5E 1BQYA 1TGCA 3BIVH 3EA8A 1XUJA 2ZHQH 1MUEB 3SU0A 1IQJA 2BTCE 2OQ5A 2FDAA 2ZDKA 4O3TA 1BMAA 1AE5A 2FI3E 2PKAB 3UR6A 1BTYA 1JXPA 4D7GA 6GCHG 2JH6D 2Z9LA 3IITA 3SJ9A 4XBDA 3UTUH
chains in the Genus database with same CATH superfamily
5C1UA 1KSNA 3LGVA 3OY6U 3QO6A 1AHTH 3TJNA 1QL8A 3UWIA 5JBBS 4NWLA 1RGQA 3SUDA 1VITF 2XTTB 3M7TA 1D3TB 2HNTF 3MO6A 1CT4E 2ANWA 4AYYB 4WH6A 4AN7A 4HI3A 2O9QA 3F1SB 3MO9A 3F9FA 2PKSC 1EOLA 3SGAE 1T8MA 3GY3A 3T27A 4M9FA 1OP2A 3K6ZA 2SGDE 1O3JA 3TITA 1WBGB 1CT2E 1MCTA 1S5SA 3TH2H 2ZU2A 1QBNA 3ZZ6A 1QL9A 1VGCC 4BAKB 1MKWK 1UTOA 1WCZA 2ZA5A 3T25A 4IGDA 1THSH 4JYTA 3LONA 2ZTZA 1FDPA 1SC8U 2TGTA 2A5KA 1SR5C 1CGIE 2A4QA 2W3KA 4ISOA 4ABGA 1E34B 1SGFA 1ANCA 3OTJE 4ZHAA 3MH7A 3ZZ7A 1RIWC 6LPRA 2ZEBA 1HLTH 4UFFH 3SI4H 1INCA 1GBJA 4RN6A 3WY8A 1C2JA 1LO6A 3GDSA 1VGCB 1KIGH 3GY6A 3NRLA 4MNXA 1LVBA 3GY2A 3KQEA 3ZVEA 1L4ZA 2K0QA 2AGIX 1C2LA 3N7EA 7LPRA 3RXQA 3EDXB 4WXIA 4MVNA 2XC5A 4JMYA 2O8TA 2Q6FA 1C5UA 5DSFA 1GMHG 5IYTA 5LGOA 1GL0E 1MU6B 5F03A 1MZAA 4AZ2B 5C67A 2HOBA 4YT6H 1RIWB 1KXDA 1XUGA 4X0WU 1C1WH 1W7GH 1HCGA 3PV4A 4K8BA 1A2CH 1ZTLA 1C5SA 2FI4E 4YOGA 5GXPA 1ELEE 1SQTA 2BM2A 3QTVH 4JZFH 4F49A 2P16A 3MNCA 1LHFH 3E3TA 4I31A 1A61H 1PPHE 4X6OA 1QRXA 1VKYA 5FPTA 4FUEA 1F5RA 3S9AA 4INHA 1T7CA 2P3FH 4FUFA 2CJIA 1O2KA 1T4VH 1CO7E 1GL1A 4WMDA 2GVFA 3LH1A 2NWNA 3MFJA 1FPCH 2NU3E 2LIZA 1T8LA 2R0KA 1BB0B 1DY9A 1OWDA 1LPGB 1SGCA 2AS9A 4D7FA 4Q4LA 5A09A 2ULLA 4NZQA 3U98H 3K2UA 4P02A 2A0QB 2CK3D 1E35B 1O2NA 2CV3A 1ESAA 3GCTF 4H6TA 3SV8A 3E90B 1OHHD 2DE8A 4AYVB 3C1KA 2OK5A 3AASA 2BVXH 5G4BA 1AUTC 2HWLB 5B6LA 2ZF0H 4FUJA 4YTAA 1P2JA 1QQUA 5A0AE 2OD3B 2ZDLA 5LPEA 1SHHB 4WH8A 1NO9H 5DK1A 4IN1A 2GT8A 1FX0B 4TWYA 2FO9A 3QTOH 3QX5H 1KYNA 1UTKA 2J98A 3M5OA 2C3SA 2HLDD 3H7OA 3MWIU 2Y81A 2ESTE 3URDA 1C5OH 3PRDA 5A8YA 3ZVAA 3O8BA 4AORA 1ELCA 1O2JA 1AKSB 1O34A 2GZ7A 3RXJA 1O37A 5TCCA 1BTHH 1FNIA 1C5QA 1TALA 5C20A 1G3EA 3SORA 1HXEH 3PV5A 2A4OA 3A7XA 1HAIH 5AF9H 3ZZAA 3OE7D 1WQSA 3SOSA 1G9IE 3RXAA 1K0HA 1LCYA 2A32A 1ELAA 5EJLA 4ZXYH 5T3HA 2IPQX 2W6JD 1AE8H 1Q3XA 2PTNA 2QF3A 3Q3YA 4HFPB 1SI5H 4Y0YE 2FS9A 2XBXA 1QCPA 8GCHF 2PLXA 1JRTA 2XNDD 2WPMS 5AFZH 5T6DA 5GPIB 1YY3A 3SZNA 1HIAB 3WW7A 3M37A 2AGEX 3ODFA 3EBNA 3F3BA 1MTNC 4YESB 4WY3A 1TPOA 4JYUH 4X6MA 3UQOA 4NIXA 1O3MA 2A5AA 2BY9X 2ZHEH 6CHAC 2PR3A 3DCLA 1C1MA 1XVMA 2WV9A 7GCHF 3T2NA 2WHXA 3LH3A 3AW0A 2FOCA 1O2WA 2RA0A 2NU2E 5L30H 1H4WA 3UFAA 1LQDB 1YC0A 2V3HH 1V2NT 5EQSA 1AFQC 4RT1A 1QRZA 2Z94A 2ZQ2A 3GDUA 1S84A 4X1NU 5LPRA 3MI4A 2Z6BD 1ORFA 4FUCA 2FM2A 1MD8A 4I8JA 3RXBA 1ZSKA 1MTNB 1RJXB 1YF4A 3TGKE 3LJJA 2BDCA 2ODYB 2ZFRH 3SUEA 1UVPA 5LH8A 2UUFB 6CHAB 5EG4A 5T6GA 3RP2A 1C2HA 2AGGX 4IS5A 4X8VH 5A2MH 4BXSA 5LPFA 4AG1A 3LGIA 1GJ8B 2CF8H 1O3KA 2ZO3H 1AFQB 3OX7U 1SVPA 1J14A 3FZZA 3F2GA 3KQDA 4BXWA 1OP8A 2TGAA 1GJBB 3U8OH 1D9IA 1PQ5A 1C5RA 1YKTA 2KM0A 1FAKH 1LHCH 2ZDAH 3E6PH 3OEHD 5HMAA 3NXPA 1Y8TA 3BTDE 3A7YA 1HDTH 1NY22 4JYVH 5F53A 2C4FH 5FX6A 9ESTA 1MTVA 3UAIC 3ZZ3A 1YCPM 2OUAA 3T62A 2FX4A 1FV9A 1GHVH 2ZI2H 4XRNA 2FXRA 1ANBA 5CDFE 1DVAH 1AZZA 2GT7A 1W0KD 2OXSA 1O2MA 2BDBA 1PQ7A 1NRPH 1P11E 4I7YH 1TMBH 3MH5A 3P8FA 1SGPE 1K1MA 3BSQA 3ZVCA 5E2PA 1A5GH 2L74A 1GPZA 1UTMA 3RXHA 1V2OT 4X1SU 3RC4A 2KFWA 3NCLA 1GJCB 1IQMA 1OPHB 2G5VA 1Y5UT 4KTCA 2UUYA 2UWOA 2WYGA 3SO3A 4AGKA 1P57B 3TJUA 1C4V2 3OSYA 1GI5A 6GCHF 2P94A 1QZ8A 1XMNB 2FPZA 1QJ6B 3TVJB 1C2FA 1O5GH 1J15A 1OYTH 3KF2A 1P05A 3OU0A 3QUMP 4I33A 5ABWA 1O32A 3GCHB 1C5LH 1KTTB 2FLBH 1QB9A 3ZVFA 1EKBB 1TA2A 5H4IB 3U69H 3EQ0H 1TNKA 4DOQA 1SGTA 1K28D 3ZZ4A 1MTWA 4XBBA 3VXEH 1DICA 2SGAA 4I86A 2QGRA 2VVVA 1TB6H 5EQRA 1AIXH 2ANMH 2G55A 4MPUA 3ZZCA 3K65B 1JOUB 4MNWA 3HKJB 4Y8XA 1F0UA 4GCHG 4KTUA 1ELDE 3PM3A 2VBCA 3HGNA 4XFQA 1E36B 1UCYH 2R2WU 3FN8A 3EA7A 7KMEH 4DJZB 1IQEA 1H8ED 4IN2A 3RMOH 2SGPE 4K1SA 3MQKC 2O8LA 2BD3A 1GBCA 1BITA 2ZECA 1C1PA 2BLVA 3U9AH 4OM9A 1ETSH 1L4DA 2B9LA 2FOBA 1TQ0B 1LTOA 4IW4E 1QQ4A 1TX6A 3F0PA 2WPLS 1YPEH 1BMFD 2H1UA 1ZZZA 2KAIA 2PW8H 1BBRH 1TMUH 1ANDA 2XCNA 5FL7D 2O8UA 1CU1A 5C94A 3V12A 3P8OA 1AB9C 1MD7A 2XYAA 1GMHF 3ZZBA 4ASHA 3RMNH 2A7JA 3Q3KA 5FPSA 2AIPA 1CGJE 5DP8A 1CHGA 2EA3A 2WUBA 1P03A 5C0TA 1NROH 5EQQA 5EPNA 4CRDA 3RXCA 4UFDH 2VIWA 3RU4T 1OYQA 1AFEH 1TX8A 2BDYA 1FIWA 4YXWD 4NG9H 1BOQA 2F9OA 1GI0A 3PB1E 4FXGH 3MH4A 1G37A 1AB9B 5ESTE 3LGTA 1PFXC 4DVAU 3MU8A 2GGVB 4ZKNU 1IHTH 2BHGA 3FZDA 4FUDA 1EZUC 5DP4A 3ZVGA 4X2WA 3AVZA 4H6SB 2FS8A 1SLXB 2J4IA 1HAVA 1E79D 3S7KB 1ZYOA 1H9IE 1TONA 1UHBA 2BDHA 1O5DH 2GV6A 3GS9A 3PRBA 3FO8D 2ZGXH 2XNIA 2YNBA 2BX3A 1GJAB 2CXVA 3SNDA 2PHBA 1GI7B 2Y82A 3RC5A 3F68H 2UUJB 1NS3A 4ISHH 2BXUH 3F9HA 4CH2B 1TOMH 2PP6A 4GSOA 4A6LA 2EI8A 4B2CA 1LDTT 1P12E 1MBMA 3O8DA 2G00A 4KGAA 1E38B 2PFEA 2C8YB 1A46H 1JIRA 4IC5A 4JCNA 1DWCH 1DFPA 2F43B 2BQ6B 4UFEH 1P3CA 1FN6A 2SNWA 1GHWH 1SHYA 1NRQH 3SNAA 1W11U 1UK3A 3A7TA 1O2LA 5JYIA 1HAYB 4BAQB 4R0IA 1EQ9A 1C1RA 1ZMJA 1O5AB 3ZZDA 4OGXA 1P10A 1N1LA 2GP9B 3KIDU 2GJGA 1GBDA 4SGBE 2ZGBH 4TPIZ 2VH0A 2GMTC 1ZJKA 1EB2A 1EAIA 1KLIH 1RRKA 1T8NA 2TRMA 5KEDA 2ZHWH 1Y3VA 1J16A 2ZGCA 1COWD 2JH5D 4CHAB 4YO9A 1Y3XA 3W1EA 4J2YB 3JZ1B 4P00A 1ZLRA 2GCHG 1N6YA 4MPXA 3F2HA 3LGUA 2FLRH 3FAOA 3TH3H 1ETRH 2BD9A 1SGRE 2GD4B 3GY5A 3M36A 2AFQB 2I6SA 1DDJA 3LDXH 4ABJA 1UTQA 2GMTB 1O2IA 4ABHA 1DSUA 5DP3A 3SBKA 1FI8A 2R3UA 3LIWA 4ZHLU 2R9PA 1Z8IB 1KDQA 3GYMA 4CRFA 1PPBH 2SFAA 1UMAH 4UFGH 1O3FA 2JETC 4WMEA 4BTUB 5BRRE 1O2ZA 3LC5A 1A5IA 1C1VH 1QTFA 4INKA 2Z3CA 5BPEA 5F8TA 1BMMH 3PWCA 4HZHA 5FPYA 1C2KA 1YLCA 5DGJA 1F7ZA 3GY7A 2OCVB 2NU1E 3SQEE 2C8ZB 1VZQH 1AD8H 1X7AC 2BQWB 3RM2H 2ZCHP 1NZQH 2BVSH 2Z7FE 5E0HA 1FQ3A 2P95A 3A80A 3DSOA 2A4RA 3BTHE 3RXGA 4AGJA 2JETB 1TPAE 2LNCA 1GCTC 1T31A 1HJAC 1W7XH 3QGNB 2ZPSA 5A0BA 3PO1C 1DWBH 1XUHA 1WSSH 1PPEE 3CENA 4AB8A 1HV7A 1HAVB 1WYKA 3B8JA 3UREA 3RXDA 2A2XH 3DD2H 2F4LA 4X8TH 4I8KA 1GMDG 1TA6A 4IMZA 2R0LA 1NN6A 4B6FA 1O3CA 1SGFG 1P9UA 2RA3A 4O97A 2ANYA 3FOAA 1GCTB 4K1TA 1HJAB 1GBIA 3M3VA 1G2MA 2B5TB 4Q2KA 4ZMAH 2PTCE 5FBEA 2BY6X 1FPHH 1VITH 2PUXB 3PO1B 2EY4C 3SU6A 4BAMB 2Y5FA 2QF5A 1GMCG 1TABE 4X1QU 1HAHH 4ZH8A 2BQ7B 3VEQB 3FP7E 1DM4B 1O31A 5CMXH 2WPIS 1JMOH 1HRTH 1GDQA 3MNSA 3RXMA 4Y7BA 4DIHH 1S0QA 2HVXA 1RTKA 3UWJH 3E16B 1GHZA 4LOYH 4B6EA 1GJ5H 1WDIA 3C27B 3F0OA 4K3JA 2ALVA 5F8XA 5EGMA 4I8GA 1F5KU 2GV7A 1DT2A 3CP7A 4CH8B 1A7SA 1EOJA 3BTGE 3SJIA 1O2GH 3EE0B 3UQVA 2KR7A 1EPTA 4XE4A 3HGPA 4NA8A 3SUGA 3B9FH 2V35A 1IQGA 2A1DB 4ZHMU 5C1YA 1O38A 2QA9E 1HJ8A 1E0FD 4ZKRU 1V6DA 3OFND 2K1QA 2EC9H 5ETXA 1S82A 2Y7ZA 4WVPE 1BTZA 1CE5A 3MTYA 3U8TH 2A5IA 2OBQA 2HVYB 3E0NB 2V3MA 3RC6A 3SW2B 4NSVA 1O36A 4FU7A 1T32A 3QGJA 5ESBA 1C2EA 2A7HA 5FHTA 3H7TA 3BG4C 3KL6A 1O3LA 2O8WA 2Y6TA 4FETA 2A4GA 1CHOG 3PWBA 3KN2A 1H1BA 5FCKA 3L6PA 1IAUA 1NESE 4NCYA 2OC7A 2R3YA 2VU8E 3I77A 1KDQB 1GBLA 3RXSA 1KMHB 1UK4A 1AWHB 4K1EA 5E0GA 1BT7A 2LPRA 2VWOA 5A8ZA 1NM6A 4GLYA 2P3UB 2J92A 4FU9A 2WV5A 4Y11E 1GDNA 4ISLA 1F0TA 4AC9A 2BYAX 1T8OA 5TJXA 1BMNH 1BTPA 1GBAA 1G2LA 2ZTYA 5HKKD 3ATIA 3BG4B 3RXUA 1YP9A 3AW1A 1ZTJA 3VXFH 3S9CA 1SPJA 4NGAH 3V13A 1ZHRA 3UIRA 4KTSA 1CGHA 3BIUH 3SNBA 3A8BA 3F2FA 1JBUH 4FVDA 5EJ1A 1YPHE 1C5YB 1W0JD 1L1NA 1UVOA 2YNAA 1PYTC 3CS0A 1M9UA 1WUNH 2GKVE 2VJ1A 2PUQH 2AEIH 4KKDA 4INLA 3M35A 1THPB 1ZJDA 3RXOA 2XBYA 1A0HB 1GHAG 1LMWB 3P92A 3A82A 4NZLA 1YCPK 4UE7H 3A83A 4FVBA 4JZ1A 3F6UH 1TBQH 1AO5A 4Y0ZE 1W13U 3GCOA 1MTUA 1HAPH 1C2DA 1BIOA 4B75A 1GDUA 5C0UA 3N99A 1TAWA 1TGSZ 4DIIH 1GHBG 2JJ1D 2FYRA 3A7ZA 5PTPA 1DX5M 2J9NA 3M61U 4H4FA 4DW2U 5L2YH 5HIYA 1F2SE 3PV2A 4K8YA 4B76A 4ZKOU 2ALPA 3S9BA 1DOJA 4Q7XA 2ODQA 1L2EA 2YMSD 1C2IA 2C90B 1UTPA 2KX4A 1QB6A 1Z6EA 5EPYA 1ABIH 1ANEA 1F92A 2FOGA 1TWXB 1SQOA 3QN7A 2H5DA 1BMLA 5CHAC 1P04A 4X8SH 1E1RD 2ZGHA 4ACBA 2BDAA 3BTQE 2ZCLP 4JK6A 3FFGA 5T6FA 1FJSA 3KCGH 1RFNA 2ZTXA 1TOCB 2VIDA 3ZYDA 1MKWH 5EU8A 2ZCKP 1O33A 1O39A 3SNEA 1XKAC 1V2WT 2C8WB 2FX6A 3NPSA 3D62A 2L6OA 1XUKA 4E7NA 1THRH 1FUJA 1Z1IA 1QBOA 1HAXB 4Q7YA 4ABDA 3DT0H 9LPRA 1OP0A 1OWJA 2Z9JA 4RSPA 3OY5U 1QGFA 4RT0A 3A89A 1MQ6A 4I32A 5CHAB 4ESTE 2IPHA 3U28C 4K5ZA 3LT3A 4UD9H 4HTCH 2EI6A 1V3XA 2ZU5A 2QXIA 2STBE 3A7VA 1AZ8A 4WF8A 3PMAB 4LXBH 1TGNA 2Q6DA 3OAAD 2GZ9A 5E0JA 1O2OA 1J8AA 1BJVA 1UO6A 2ZU1A 2VNTA 5JDUB 1NU9A 2PWXA 1B5GH 4CRAA 1HXFH 2J38A 3A86A 4RKOB 3EGKH 3TK5A 3SU3A 1G30B 1C5PA 2XBWA 3RDZA 3VB3A 2G4UA 3Q3XA 2EQNA 1FLEE 4MTBA 2OC1A 4CR9A 2Y5HA 2BMGB 1SFIA 3BN9A 3AK5A 4GVUA 3UR9A 2VGCC 2KCOA 3Q77A 2O8MA 2Y5GA 3A7WA 3BTKE 1K1NA 2AYWA 3Q00A 1GHYH 4Y8YA 1V2ST 4BANB 1SL3A 2GCHF 2PGQB 3PMHB 3ZV9A 1B0EA 1ELGA 1EFRD 1YM0A 2XWAA 5EXLA 3T29A 3URCA 1KXCA 1UCYE 3B23B 1WQVH 1LHEH 3U1JB 4OS7A 4F48B 3UUZA 1CSOE 3AAUA 4D9QA 1QIXB 3PMJA 3GCHC 5TCAA 2AERH 2J98B 5EJZA 2Z3EA 1QA0A 1DS2E 2W5EA 1A5HA 2M5TA 2YOLA 3SHCH 2VGCB 2R2MB 4UONA 3UB0A 1Z71A 3TH4H 5L6NH 1V2VT 3A87A 1OWKA 1O2SA 2WPJS 4CR5A 1D3PB 2QV1A 2Y80A 3HATH 1BBRE 3BEFB 4Y7AA 2WPDD 3ATKA 3RXRA 1O3IA 3SU5A 3KGPA 2PSYA 1S6HA 2ILNA 1Y5AT 1NFYA 1SOTA 1CVWH 1UVTH 3A8AA 3NUMA 1PPGE 2GZ8A 3VB5A 3HPTB 1D4PB 2KCPA 1FAXA 2J34A 1XX9A 5CHBA 3OEED 1P2KA 4ZROA 4HG6A 2BXTH 1DXPA 5K7RA 4DT7B 2HGTH 4YLQH 2BD2A 2A45B 2RCEA 2ZPQA 1CA8B 4IMQA 1IQNA 1KLTA 2A2QH 2ZGJA 4UDWH 3QK1A 5A8XA 1V2RT 1EP5A 2I6QA 5KECA 1U6QA 3S0NA 1BRAA 2VWLA 4IC6A 4HGCA 1IQHA 2BDIA 1PPCE 3SJ8A 1GMDF 2TIOA 1TPSA 2XC0A 1XM1A 4WXVA 3VFEA 4AFUA 1HUTH 1ARCA 3FANA 1LKAA 1ZRKA 1BZXE 3BTME 1GI3A 1GI1A 3PLPA 1O0DH 3GCTG 2WPKS 2F9BH 1UVSH 1QR3E 5EW1H 1EJNA 1GMCF 2J95A 3LJOA 3LU9B 1O2HA 1Z8JB 4Q7ZA 4YLUA 2AIQA 1WTGH 3TK9A 4Q80A 5DP7A 2G4TA 3MO3A 2OLGA 1UTLM 1GBKA 2F91A 1D6WA 1HJ9A 3PTBA 4TYDA 2H6MA 2G52A 1LKBA 2PKAA 2B7DH 4XD7D 4D9RA 4Z6AH 1AVXA 2BZAA 3KEEA 2H2ZA 2TGDA 4U30A 1DE7H 4ABEA 3OYPA 1AVWA 1OWHA 2ZDMA 4MNYA 2YMSC 1H8DH 3MNXA 3SN8A 2UWPA 4THNH 1AWFH 4A1VA 2HPPH 2QE7D 2WUCA 5AVDA 3D23A 3IWMA 4OS5A 1ZTKA 3M3TA 3VB4A 1QHRB 2ZIQH 3PROA 1TBZH 5SGAE 1MBQA 4Y6DA 3KYGA 2H9HA 3PYHA 5C3NA 3KQ5A 1C2MA 3MU1A 3NZIA 4K69A 1W0YH 4B2BA 3SV2H 2CN0H 1HNEE 2F83A 1TIOA 3A84A 4D76A 1PJPA 2YMSB 5DP9A 3VG8A 2QF0A 3F9GA 1BRBE 3N7OA 3TPIZ 1G32B 1YPLH 1QFKH 2CHAB 1YPKH 2KZ4A 1S0RA 5EXMA 2FTLE 1CHOF 2Z3DA 1L1GA 2OINA 1PQ8A 4ASUD 1CA0C 2V3OH 4ZXXH 1OWEA 4IBLH 3UOUA 1O2XA 3I78A 1K1IA 2J97A 3RXKA 1O2RA 4MDSA 5FAHA 2HRVA 1UTNA 3TJOA 3GY4A 1MH0A 3LGWA 3RLYH 1O5EH 2XC4A 1FY4A 2FEQH 3GISB 3MYWA 1P9SA 2GX4A 2FP7B 5AHGH 2FWWA 3R0FA 4DG4A 3D49H 5E2OA 2ZU4A 1K1LA 1GJ7B 1AMHA 2QAAA 1ZRBA 3T28A 4CHAC 5GCHG 4ZKSU 4X2VA 3SZEA 1Z8RA 3D65E 2FIRH 1CA0B 1D3QB 1EB1H 1V2TT 2D1JA 1TBRH 1FY8E 3A8DA 1MU8B 3SI3H 1IQIA 1LPZB 2ZC9H 5DP5A 3LC3A 2F9UA 2UUKB 1O2TA 3SJOA 1IQFA 2ZZUH 3MH6A 3SGBE 1MTSA 1GHAF 3A81A 3VGCC 1ABJH 2P8OB 4X8UH 1P0SH 1CQQA 1NRRH 2IJOB 1EZXC 1ELBA 2G5NA 3M3SA 2GDEH 1SQRA 4AFSA 1GHBF 2J5UA 1YPJH 5HGGA 2ZFPH 3DFLA 4DGJA 4NFEA 1FIZA 1H8IH 3FP8E 2BZ6H 4A5TS 2AMDA 1QB1A 3QZRA 1J9CH 3VGCB 3TIUA 3FKSD 2ZDNA 5EIYA 1BRCE 4YOJA 2KAIB 1SMFE 2WINI 3PTNA 4ABBA 1S83A 1ESBA 1D6RA 2HNTE 2Q1JA 5CE1A 2F3CE 1JWTA 3E8LA 4TWWA 1XXFA 2TBSA 1BTWA 2VIQA 4BAHB 4I8LA 1CT0E 3ZZ5A 3ZZ9A 1TNGA 4SGAE 1GCDA 1CBWC 3GICB 1GVKB 1YPHC 2QXHA 1DWDH 1O3PB 3DHKH 2SGQE 3KYFA 5C2ZA 1WU1A 2FESH 5J4SA 2AHME 1S81A 3L33A 1EUFA 4GAWA 4ABIA 4CBNA 2Q6GA 1NFUA 2RG3A 1OWIA 1W0ZU 2ASUB 1Y59T 4WWYA 4XSKU 4MG3A 1QY6A 2FZZA 2W7SA 3BTTE 1CBWB 3P17H 3M5LA 5I46H 3DFJA 1ZSLA 1F0SA 3P70B 1EXFA 4Y8ZA 5JBTA 1TLDA 5HIZA 2QN5T 2F9VA 3RXTA 1ELTA 2OTVA 2FOEA 1EZQA 3IG6B 1O5BB 1SGQE 3MOCA 2PV9B 1UHBB 3SV7A 1PPZA 3ZV8A 2F9PA 3M5NA 1AKSA 5HM9A 3S69A 3UNQA 1EP6A 1NFWA 3TJVA 1AU8A 1GBFA 4ISIH 4OS2A 1TRMA 4JZEH 2UWLA 1MCVA 2Y7XA 4ISNA 2OC8A 2BX4A 1O3GA 1Q31A 4E06H 4X6PA 1TQ7B 2PKSB 3BTWE 4XDEA 2RDEA 3L3TA 4ACAA 4BTIB 1QJ7B 1DWEH 1W3CA 1XXDA 1QJ1B 2BLQA 1HIAA 2F9NA 2NU4E 1NTPA 2OQUA 2P59A 2THFB 3O8RA 1FN8A 1LVYA 3RXLA 1C1NA 3FVFB 1K1JA 5DP6A 1O3OA 1LQEA 5A0CA 2ZFSA 1GBMA 1DXWA 1FY3A 3P95A 4JK5A 5JB8S 4E7RG 4WJG2 4A92A 5EOKA 1XUFA 1MKXH 2CMYA 4DURA 3SNCA 4Y79A 1S6LA 1GJDB 3BEUA 4YT7H 3MMGA 1XVOA 2BLWA 2A7CA 2BOHB 3BV9B 4NFFA 1Y3UA 5AFYH 3EA9A 1P09A 1GJ6A 3GCNA 1SGIB 1GI6A 1L1JA 3K9XB 1RS0A 3QLPH 2FOMB 4GHQA 4X6NA 4TT3D 1S6FA 1HBTH 2C93B 1C1QA 4CRBA 1YWUA 2IJD1 1DUAA 2ZNKH 2OBOA 3RMMH 1IOEA 2BB4A 3SV9A 1C9PA 4U32A 3LKWA 4Z1MD 3SV6A 3STJA 3ZVBA 1FMGA 3LGYA 2XOKD 1G3BA 2G81E 1O3AA 1P2OA 3GOVB 2SNVA 2OP9A 1SB1H 3BTFE 4R8TB 1BTUA 2FTMA 4NIVA 1AQ7A 2STAE 1WAYB 1KTSB 1H9LB 1SSXA 3SGQE 1AGJA 4DCDA 1SGDE 3TK6A 1KXBA 1V2UT 2V6NA 4GCHF 4ZAEA 1VCWA 1SBWA 3DSPA 2VWMA 2BD7A 2AMPA 1FXYA 1QNJA 2RDLA 4MNVA 4O03A 1ZPBA 1O3DA 1NT1A 1O30A 4CBOA 1Q2WA 1AN1E 1QURH 3SU1A 3SYJA 2BVRH 1K1OA 2ZQ1A 1GJ4H 2K8IA 1EAXA 1ZGVA 1B7XB 1UK2A 1WOFA 3V7TA 2BD8A 1HAGE 2VIOA 5DO4H 3SUFA 1TRNA 1ELFA 1MMJN 2BDGA 3ATWA 1ZHPA 1UJ1A 4VGCC 2ZWLH 4LK4A 5EW2H 2VH6A 5EODA 7ESTE 4Y10E 1BCUH 1C5MD 1OX1A 2D26C 3UOPA 2VVUA 4FUBA 2W6ID 2KCAA 4NIWA 4OS6A 3HKIB 1GVZA 2QIQA 5C5NA 4X1PU 1WTHD 3SJKA 1YLNA 3MU0A 1AI8H 1UVUH 1FY1A 2BLOA 2QF4A 4BTTB 1K2I1 4AB9A 4MPWA 4AFQA 1UCYK 4B1TA 4DY7B 4LZ1H 3QZQA 1P02A 5C5OA 4RI0A 1SLUB 1OOKB 3GY8A 4VGCB 4AFZA 2SGEE 1KXFA 4J1YA 1EASA 3RLWH 1N6XA 2B8OH 3HK3B 1QBVH 4H42U 1YLDA 3GYLB 3BF6H 1EATA 4NWKA 1EAUA 1EJMA 1P06A 3M5MA 1O2PA 1LVMA 1BBRK 1FY5A 1EPTC 1MAXA 1P3EA 5B6OA 1C5NH 1D3DB 3P8GA 2GCTC 3O8CA 1EZSC 4YOIA 1YBWA 4ABAA 4X1RU 3TGJE 3QDZB 1OSSA 4A1XA 3KQBA 3P6ZB 5IDKA 1DITH 1C5TA 2NU0E 1G36A 2ZPRA 4F4OC 3ZYEA 3G01A 1SQAA 3OTPA 4Z0KA 1J17T 1V2KT 2XBVA 3E1XB 4NIYA 4BOHA 1GHXH 1HGTH 2BD5A 1V2JT 1EPTB 5K0HA 1OXGA 1W8BH 1C9TA 1TNLA 5GDSH 1FZZA 3EYDA 1C5ZB 2GCTB 1VJ9U 3V3MA 4OS1A 1HB0B 1UW7A 5C17A 1C4Y2 2BOKA 1E37B 1C5XB 1VITG 2W3IA 2C8XB 4MQAA 2DE9A 1P2NA 4B2AA 2ANKH 3ENSB 3ITIA 1DY8A 2FODA 3SQHE 2ZKSA 1GI4A 4GUXA 1NBME 5GCHF 1SOZA 1Z8GA 1NPMA 3N7DA 1F0RA 3RXIA 3E91A 1C1TA 2WV4A 5L2ZH 3H09A 4U2WA 1NU7B 4M7GA 3MU5A 1GI2A 3SHAH 4Y76A 1V2PT 5HYOA 2QY0B 1W14U 5I25A 5JPMH 2BD4A 3E0PB 1W10U 4MPVA 4ABFA 3TNTA 2J2UA 4CRCA 1FONA 1O2YA 1HFDA 4TPYA 3KQCA 2VIPA 1SFQB 2P3TB 3K6YA 2EI7A 2QC2A 4FUHA 1SLWB 1GWAA 5DPAA 4O9VA 1KLJH 1VCQA 2VWNA 5GNDA 1TFXA 8LPRA 3JZ2B 3NWUA 1GI8B 1YGCH 2Z9KA 4JZIA 3KHVA 1O5CB 1BUIA 1HAOH 2ZFFH 4NSYA 3M7UA 1A0LA 4I8HA 4U01A 4DT4A 3ODDA 2TPIZ 1SGYE 3T5FH 1H9HE 2W7UA 1NFXA 1O2UA 3ZZ8A 1O2QA 4B74A 4A1TA 1C4U2 1UTJA 2ZFTA 1YPGH 2QCYA 1ETTH 2HALA 5GIBA 1TPPA 4GPGA 3QWCH 1A4WH 1MQ5A 4ZUHA 4Q63A 3V0XA 2EEKA 3RM0H 1HAZB 2ODPA 4BNRA 1PPFE 1BRUP 4FOUC 5IK2D 4WMFA 1SGNE 1DPOA 2HPQH 1K21H 5DN6D 2QXGA 1SG8B 3RU4E 2W26A 3MHWU 1VJAU 3MU4A 5FBIA 2IOTA 1O3BA 1O3HA 2WZQA 1O35A 3I29A 1QL7A 1DLEA 2G8TA 1Z7KA 3Q76A 2DUCA 2H9TH 1VR1H 2WYJA 1JRSA 5DKMA 1GBBA 3F9EA 1BHXB 1JIMA 3BEIB 1KY9A 1SLVB 1Z6JH 3PLBA 1O5FH 3CS7A 1RTFB 1G3DA 2V7QD 1GGDC 1S85A 2VB0A 3RXFA 1C5VA 1V2QT 3RMLH 1F5LA 3WWFA 3S7HB 1TNHA 4YM9A 2D2DA 1KXEA 2ZU3A 4AX9H 1TGTA 5HM2A 1WV7H 3KNXA 1ELVA 1AVGH 4X2YA 1QA7A 3UY9A 1ESTA 2FOFA 3W94A 5HXFA 1MABB 2B0FA 2RFKC 3ELAH 1P2MA 4TSFD 2AH4X 4NA9H 1YCPH 2HNTC 1Y3YA 2XCFA 3BG8A 1W12U 1RXPA 5F8ZA 2XXLA 4XOJA 5E8EH 4BAOB 2P93A 1ZSJA 3RUOA 1RD3B 3U8RH 1DANH 1ZMLA 3LPRA 2TGPZ 4JZDH 4OGYA 2LELA 2JIZD 1GGDB 1DLKB 1GJ9B 1AUJA 2K7XA 2OC0A 1Y5BT 1HYLA 2JDID 4AG2A 1GBTA 1SKYE 1Y3WA 4K2YA 1V2MT 1B0FA 2PSXA 4QT8C 1A3BH 1OS8A 3PMBB 3R3GB 4B73A 4K60A 2A31A 2XW9A 3SU2A 3ATMA 4Y71A 4KP0A 4UEHH 3RXPA 1C1OA 1TNIA 2ZFQH 2JJ2D 4AOQA 4CREA 1K1PA 2VIVA 1Z1JA 1BA8B 3LOXA 3WWBA 3ZIAD 2CGAA 1O2VA 4YZUA 3SU4A 3HK6B 4MLFB 1DSTA 3AAVA 1A0JA 1BJUA 2BY5X 5C1XA 2SGFE 1TMTH 1EAWA 1GI9B 2CHAC 1BTXA 5J4QA 1RTLA 1V2LT 1IHSH 1LHGH 5F6MA 5JBCS 4NA7A 3NK8A 3RXEA 3TGIE 1HPGA 3ESTA 2IN2A 2D8WA 1O3EA 1WXRA 2FYQA 4XBCA 5FXLA 5DJ7A 4ZCNA 1P2QA 1ARBA 3RXVA 1G3CA 1A1RA 1NRNH 1C5WB 1NBMD 3CNRA 3EE7A 1LPKB 3TU7H 8GCHG 3U1IB 1OKXA 5FCRA 1GVLA 4X2XA 1YYY1 2PGBB 1K9OE 1TE0A 6ESTA 5JB9S 1NC6A 2XRCA 2ZG0H 1ACBE 2GDDA 2GTBA 1P2IA 1ZGIA 4FUIA 7GCHG 2JH0D 3A85A 2M2AA 1TRYA 4FUGA 3DSGA 1N8OC 4TY6A 2BY7X 2H9EH 4GHTA 2J94A 3DA9B 1MKXK 3VB7A 1C1UH 3H5CB 2Z9GA 5JBAS 3FP6E 1TGBA 2CF9H 2VVCA 1C2GA 1BDAA 2FMJA 4KELA 3VB6A 1TYNA 1ZR0A 1XKBC 1EX3A 4TY7A 4E05H 1C1SA 4LZ4B 3T26A 2P8OC 1TNJA 3GDVA 2QXJA 5FX5A 2FOHA 2WPHS 3EAJA 1GBEA 2H5CA 1ZOMA 1YPMH 5GWZA 1TX7A 1VCPA 4A7IB 1N8OB 2ZP0H 4PROA 3M7QA 2BY8X 1L0ZA 1P8VC 4D8NA 3VPKA 1GBHA 5DG6A 1ZHMA 2KCYA 3PLKA 4OS4A 1NRSH 1KXAA 2JKHA 3A8CA 8KME2 4FU8A 1ID5H 3MNBA 3BTEE 1XUIA 5EXNA 4O3UA 5T1VA 2XWBI 3ZVDA 1GG6C 3NKKA 3ATLA 1DUEA 1ZPCA 2ZHFH 2FOAA 3DUXH 2VINA 2ZDVH 3A88A 3RU4D 1H8HD 1LVOA 2AMQA 3TLOA 4CRGA 1W2KH 1LHDH 4F55A 3UPEA 1PQAA 2Z9IA 1P01A 2LP6A 1IQKA 1MZDA 1MAYA 5GJ4B 1BHXF 1SGEE 2ZHDA 1K22H 3W95A 1O3NA 2G51A 2QYIA 3P8NA 1QRWA 1PYTD 8ESTE 1IQLA 3UNSA 3UNRA 1A3EH 4RKJB 2HLCA 3STIA 1GG6B 2V0BA 4B71A 1AY6H 1EJAA 1ZPZA 3TNSA 5KGOA 1ZMNA 1T4UH 2FI5E 1BQYA 1TGCA 3BIVH 3EA8A 1XUJA 2ZHQH 1MUEB 3SU0A 1IQJA 2BTCE 2OQ5A 2FDAA 2ZDKA 4O3TA 1BMAA 1AE5A 2FI3E 2PKAB 3UR6A 1BTYA 1JXPA 4D7GA 6GCHG 2JH6D 2Z9LA 1E1QD 3IITA 3SJ9A 4XBDA 3UTUH 2WSSD
chains in the Genus database with same CATH topology
5C1UA 1KSNA 3LGVA 3OY6U 3QO6A 1AHTH 3TJNA 1QL8A 3UWIA 5JBBS 4NWLA 1RGQA 3SUDA 1VITF 2XTTB 3M7TA 1D3TB 2HNTF 3MO6A 1CT4E 2ANWA 4AYYB 4WH6A 4AN7A 4HI3A 2O9QA 3F1SB 3MO9A 3F9FA 2PKSC 1EOLA 3SGAE 1T8MA 3GY3A 3T27A 1OP2A 3K6ZA 2SGDE 1O3JA 3TITA 1WBGB 1CT2E 1MCTA 1S5SA 3TH2H 2ZU2A 1QBNA 3ZZ6A 1QL9A 1VGCC 4BAKB 1MKWK 1UTOA 1WCZA 2ZA5A 3T25A 4IGDA 1THSH 4JYTA 3LONA 2ZTZA 1FDPA 1SC8U 2TGTA 2A5KA 1SR5C 1CGIE 2A4QA 2W3KA 4ISOA 4ABGA 1E34B 1SGFA 1ANCA 3OTJE 4ZHAA 3MH7A 3ZZ7A 1RIWC 6LPRA 2ZEBA 1HLTH 4UFFH 3SI4H 1INCA 1GBJA 4RN6A 3WY8A 1C2JA 1LO6A 3GDSA 1VGCB 1KIGH 3GY6A 4MNXA 1LVBA 3GY2A 3KQEA 3ZVEA 1L4ZA 2AGIX 1C2LA 7LPRA 3RXQA 3EDXB 4WXIA 4MVNA 2XC5A 4JMYA 2O8TA 2Q6FA 1C5UA 5IYTA 1GMHG 5LGOA 1GL0E 1MU6B 5F03A 1MZAA 4AZ2B 5C67A 2HOBA 4YT6H 1RIWB 1KXDA 1XUGA 4X0WU 1C1WH 1W7GH 1HCGA 3PV4A 4K8BA 1A2CH 1ZTLA 1C5SA 2FI4E 4YOGA 5GXPA 1ELEE 1SQTA 2BM2A 3QTVH 4JZFH 4F49A 2P16A 3MNCA 1LHFH 3E3TA 4I31A 1A61H 1PPHE 4X6OA 1QRXA 5FPTA 4FUEA 1F5RA 3S9AA 4INHA 1T7CA 2P3FH 4FUFA 2CJIA 1O2KA 1T4VH 1CO7E 1GL1A 4WMDA 2GVFA 3LH1A 2NWNA 3MFJA 1FPCH 2NU3E 2LIZA 1T8LA 2R0KA 1BB0B 1DY9A 1OWDA 1LPGB 1SGCA 2AS9A 4D7FA 5A09A 2ULLA 4NZQA 3U98H 3K2UA 2A0QB 1E35B 1O2NA 2CV3A 1ESAA 3GCTF 4H6TA 3SV8A 3E90B 2DE8A 4AYVB 3C1KA 3AASA 2BVXH 5G4BA 1AUTC 2HWLB 2ZF0H 4FUJA 4YTAA 1P2JA 1QQUA 5A0AE 2OD3B 2ZDLA 5LPEA 1SHHB 4WH8A 1NO9H 5DK1A 4IN1A 2GT8A 4TWYA 2FO9A 3QTOH 3QX5H 1KYNA 1UTKA 3M5OA 2C3SA 3H7OA 3MWIU 2Y81A 2ESTE 3URDA 1C5OH 5A8YA 3ZVAA 3O8BA 4AORA 1ELCA 1O2JA 1AKSB 1O34A 2GZ7A 3RXJA 1O37A 5TCCA 1BTHH 1FNIA 1C5QA 1TALA 5C20A 1G3EA 3SORA 1HXEH 2A4OA 3A7XA 1HAIH 5AF9H 3ZZAA 1WQSA 3SOSA 1G9IE 3RXAA 1LCYA 2A32A 1ELAA 5T3HA 4ZXYH 1AE8H 1Q3XA 2PTNA 2QF3A 3Q3YA 4HFPB 1SI5H 4Y0YE 2FS9A 2XBXA 1QCPA 8GCHF 2PLXA 1JRTA 2WPMS 5AFZH 5T6DA 5GPIB 3SZNA 1HIAB 3M37A 2AGEX 3ODFA 3EBNA 1MTNC 4YESB 4WY3A 1TPOA 4JYUH 4X6MA 3UQOA 4NIXA 1O3MA 2A5AA 2BY9X 2ZHEH 6CHAC 2PR3A 1C1MA 1XVMA 7GCHF 3T2NA 3LH3A 3AW0A 2FOCA 1O2WA 2RA0A 2NU2E 5L30H 1H4WA 3UFAA 1LQDB 1YC0A 2V3HH 1V2NT 5EQSA 1AFQC 1QRZA 2Z94A 2ZQ2A 3GDUA 1S84A 4X1NU 5LPRA 3MI4A 2Z6BD 1ORFA 4FUCA 2FM2A 1MD8A 4I8JA 3RXBA 1ZSKA 1MTNB 1RJXB 1YF4A 3TGKE 3LJJA 2BDCA 2ODYB 2ZFRH 3SUEA 1UVPA 5LH8A 2UUFB 6CHAB 5EG4A 5T6GA 3RP2A 1C2HA 2AGGX 4IS5A 4X8VH 5A2MH 4BXSA 5LPFA 4AG1A 3LGIA 1GJ8B 2CF8H 1O3KA 2ZO3H 1AFQB 3OX7U 1SVPA 1J14A 3FZZA 3KQDA 4BXWA 1OP8A 2TGAA 1GJBB 3U8OH 1D9IA 1PQ5A 1C5RA 1YKTA 1FAKH 1LHCH 2ZDAH 3E6PH 5HMAA 3NXPA 1Y8TA 3BTDE 3A7YA 1HDTH 1NY22 4JYVH 2C4FH 5FX6A 9ESTA 1MTVA 3ZZ3A 1YCPM 2OUAA 3T62A 2FX4A 1FV9A 1GHVH 2ZI2H 2FXRA 1ANBA 1DVAH 1AZZA 2GT7A 2OXSA 1O2MA 2BDBA 1PQ7A 1NRPH 1P11E 4I7YH 1TMBH 3MH5A 3P8FA 1SGPE 1K1MA 3BSQA 3ZVCA 5E2PA 1A5GH 1GPZA 1UTMA 3RXHA 1V2OT 4X1SU 3RC4A 3NCLA 1GJCB 1IQMA 1OPHB 2G5VA 1Y5UT 4KTCA 2UUYA 2UWOA 2WYGA 3SO3A 4AGKA 1P57B 3TJUA 1C4V2 3OSYA 1GI5A 6GCHF 2P94A 1XMNB 2FPZA 1QJ6B 3TVJB 1C2FA 1O5GH 1J15A 1OYTH 3KF2A 1P05A 3OU0A 3QUMP 4I33A 5ABWA 1O32A 3GCHB 1C5LH 1KTTB 2FLBH 1QB9A 3ZVFA 1EKBB 1TA2A 5H4IB 3U69H 3EQ0H 1TNKA 4DOQA 1SGTA 1K28D 3ZZ4A 1MTWA 4XBBA 3VXEH 1DICA 2SGAA 2QGRA 2VVVA 1TB6H 5EQRA 1AIXH 2ANMH 2G55A 4MPUA 3ZZCA 3K65B 1JOUB 4MNWA 3HKJB 4Y8XA 1F0UA 4GCHG 4KTUA 1ELDE 3PM3A 3HGNA 4XFQA 1E36B 1UCYH 2R2WU 3EA7A 7KMEH 4DJZB 1IQEA 4IN2A 3RMOH 2SGPE 4K1SA 2O8LA 2BD3A 1GBCA 1BITA 2ZECA 1C1PA 2BLVA 3U9AH 1ETSH 1L4DA 2B9LA 2FOBA 1TQ0B 1LTOA 4IW4E 1QQ4A 1TX6A 2WPLS 1YPEH 2H1UA 1ZZZA 2KAIA 2PW8H 1BBRH 1TMUH 1ANDA 2XCNA 2O8UA 1CU1A 3V12A 3P8OA 1AB9C 1MD7A 2XYAA 1GMHF 3ZZBA 4ASHA 3RMNH 2A7JA 3Q3KA 5FPSA 2AIPA 1CGJE 5DP8A 1CHGA 2EA3A 2WUBA 1P03A 1NROH 5EQQA 5EPNA 4CRDA 3RXCA 4UFDH 2VIWA 3RU4T 1OYQA 1AFEH 1TX8A 2BDYA 1FIWA 4NG9H 1BOQA 2F9OA 1GI0A 3PB1E 4FXGH 3MH4A 1G37A 1AB9B 5ESTE 3LGTA 1PFXC 4DVAU 3MU8A 2GGVB 4ZKNU 1IHTH 2BHGA 3FZDA 4FUDA 1EZUC 5DP4A 3ZVGA 4X2WA 3AVZA 4H6SB 2FS8A 1SLXB 2J4IA 1HAVA 3S7KB 1ZYOA 1H9IE 1TONA 1UHBA 2BDHA 1O5DH 2GV6A 2ZGXH 2XNIA 2YNBA 2BX3A 1GJAB 2CXVA 3SNDA 2PHBA 1GI7B 2Y82A 3RC5A 3F68H 2UUJB 1NS3A 4ISHH 2BXUH 3F9HA 4CH2B 1TOMH 4GSOA 4A6LA 2EI8A 4B2CA 1LDTT 1P12E 1MBMA 3O8DA 2G00A 4KGAA 1E38B 2PFEA 2C8YB 1A46H 1JIRA 4IC5A 4JCNA 1DWCH 1DFPA 2BQ6B 4UFEH 1P3CA 1FN6A 2SNWA 1GHWH 1SHYA 1NRQH 3SNAA 1W11U 1UK3A 3A7TA 1O2LA 5JYIA 1HAYB 4BAQB 4R0IA 1EQ9A 1C1RA 1ZMJA 1O5AB 3ZZDA 4OGXA 1P10A 1N1LA 2GP9B 3KIDU 1GBDA 4SGBE 2ZGBH 4TPIZ 2VH0A 2GMTC 1ZJKA 1EB2A 1EAIA 1KLIH 1RRKA 1T8NA 2TRMA 2ZHWH 1Y3VA 1J16A 2ZGCA 2JH5D 4CHAB 4YO9A 1Y3XA 4J2YB 3JZ1B 1ZLRA 2GCHG 1N6YA 4MPXA 3LGUA 2FLRH 3FAOA 3TH3H 1ETRH 2BD9A 1SGRE 2GD4B 3GY5A 3M36A 2AFQB 2I6SA 1DDJA 3LDXH 4ABJA 1UTQA 2GMTB 1O2IA 4ABHA 1DSUA 5DP3A 3SBKA 1FI8A 2R3UA 3LIWA 4ZHLU 2R9PA 1Z8IB 1KDQA 3GYMA 4CRFA 1PPBH 2SFAA 1UMAH 4UFGH 1O3FA 2JETC 4WMEA 4BTUB 5BRRE 1O2ZA 3LC5A 1A5IA 1C1VH 1QTFA 4INKA 2Z3CA 5BPEA 5F8TA 1BMMH 3PWCA 4HZHA 5FPYA 1C2KA 1YLCA 5DGJA 1F7ZA 3GY7A 2OCVB 2NU1E 3SQEE 2C8ZB 1VZQH 1AD8H 1X7AC 2BQWB 3RM2H 2ZCHP 1NZQH 2BVSH 2Z7FE 5E0HA 1FQ3A 2P95A 3A80A 2A4RA 3BTHE 3RXGA 4AGJA 2JETB 1TPAE 2LNCA 1GCTC 1T31A 1HJAC 1W7XH 3QGNB 2ZPSA 5A0BA 3PO1C 1DWBH 1XUHA 1WSSH 1PPEE 3CENA 4AB8A 1HV7A 1HAVB 1WYKA 3B8JA 3UREA 3RXDA 2A2XH 3DD2H 4X8TH 4I8KA 1GMDG 1TA6A 4IMZA 2R0LA 1NN6A 1O3CA 1SGFG 1P9UA 2RA3A 4O97A 2ANYA 1GCTB 4K1TA 1HJAB 1GBIA 3M3VA 1G2MA 2B5TB 4Q2KA 4ZMAH 2PTCE 5FBEA 2BY6X 1FPHH 1VITH 2PUXB 3PO1B 3SU6A 4BAMB 2Y5FA 1GMCG 1TABE 4X1QU 1HAHH 4ZH8A 2BQ7B 3VEQB 3FP7E 1DM4B 1O31A 5CMXH 2WPIS 1JMOH 1HRTH 1GDQA 3MNSA 3RXMA 4Y7BA 4DIHH 1S0QA 2HVXA 1RTKA 3UWJH 3E16B 1GHZA 4LOYH 1GJ5H 3C27B 4K3JA 2ALVA 5F8XA 5EGMA 4I8GA 1F5KU 2GV7A 1DT2A 3CP7A 4CH8B 1A7SA 1EOJA 3BTGE 3SJIA 1O2GH 3EE0B 3UQVA 1EPTA 4XE4A 3HGPA 4NA8A 3SUGA 3B9FH 2V35A 1IQGA 2A1DB 4ZHMU 5C1YA 1O38A 2QA9E 1HJ8A 1E0FD 4ZKRU 1V6DA 2K1QA 2EC9H 5ETXA 1S82A 2Y7ZA 4WVPE 1BTZA 1CE5A 3MTYA 3U8TH 2A5IA 2OBQA 3E0NB 3RC6A 3SW2B 4NSVA 1O36A 4FU7A 1T32A 3QGJA 5ESBA 1C2EA 2A7HA 5FHTA 3H7TA 3BG4C 3KL6A 1O3LA 2O8WA 2Y6TA 2A4GA 1CHOG 3PWBA 3KN2A 1H1BA 5FCKA 3L6PA 1IAUA 1NESE 4NCYA 2OC7A 2R3YA 2VU8E 3I77A 1KDQB 1GBLA 3RXSA 1UK4A 1AWHB 4K1EA 5E0GA 1BT7A 2LPRA 2VWOA 5A8ZA 1NM6A 4GLYA 2P3UB 2J92A 4FU9A 2WV5A 4Y11E 1GDNA 4ISLA 1F0TA 2BYAX 1T8OA 5TJXA 1BMNH 1BTPA 1GBAA 1G2LA 2ZTYA 3ATIA 3BG4B 3RXUA 1YP9A 3AW1A 1ZTJA 3VXFH 3S9CA 1SPJA 4NGAH 3V13A 1ZHRA 3UIRA 4KTSA 1CGHA 3BIUH 3SNBA 3A8BA 1JBUH 4FVDA 1YPHE 1C5YB 1L1NA 1UVOA 2YNAA 1PYTC 3CS0A 1M9UA 1WUNH 2GKVE 2VJ1A 2PUQH 2AEIH 4KKDA 4INLA 3M35A 1THPB 1ZJDA 3RXOA 2XBYA 1A0HB 1GHAG 1LMWB 3P92A 3A82A 4NZLA 1YCPK 4UE7H 3A83A 4FVBA 4JZ1A 3F6UH 1TBQH 1AO5A 4Y0ZE 1W13U 3GCOA 1MTUA 1HAPH 1C2DA 1BIOA 4B75A 1GDUA 1TAWA 1TGSZ 4DIIH 1GHBG 3A7ZA 2FYRA 5PTPA 1DX5M 2J9NA 3M61U 4H4FA 4DW2U 5L2YH 1F2SE 4K8YA 4B76A 4ZKOU 2ALPA 3S9BA 1DOJA 4Q7XA 2ODQA 1L2EA 1C2IA 2C90B 1UTPA 1QB6A 1Z6EA 5EPYA 1ABIH 1ANEA 1F92A 2FOGA 1TWXB 1SQOA 3QN7A 2H5DA 1BMLA 5CHAC 1P04A 4X8SH 2ZGHA 2BDAA 3BTQE 2ZCLP 4JK6A 3FFGA 5T6FA 1FJSA 3KCGH 1RFNA 2ZTXA 1TOCB 2VIDA 3ZYDA 1MKWH 5EU8A 2ZCKP 1O33A 1O39A 3SNEA 1XKAC 1V2WT 2C8WB 2FX6A 3NPSA 3D62A 1XUKA 4E7NA 1FUJA 1THRH 1Z1IA 1QBOA 1HAXB 4Q7YA 4ABDA 3DT0H 9LPRA 1OP0A 1OWJA 2Z9JA 4RSPA 3OY5U 1QGFA 5CHAB 3A89A 1MQ6A 4I32A 4ESTE 2IPHA 4K5ZA 3LT3A 4UD9H 4HTCH 1V3XA 2EI6A 2ZU5A 2QXIA 2STBE 3A7VA 1AZ8A 4WF8A 3PMAB 4LXBH 1TGNA 2Q6DA 2GZ9A 5E0JA 1O2OA 1J8AA 1BJVA 1UO6A 2ZU1A 2VNTA 5JDUB 1NU9A 2PWXA 1B5GH 4CRAA 1HXFH 2J38A 3A86A 4RKOB 3EGKH 3TK5A 3SU3A 1G30B 1C5PA 2XBWA 3RDZA 3VB3A 2G4UA 3Q3XA 1FLEE 4MTBA 2OC1A 4CR9A 2Y5HA 2BMGB 1SFIA 3BN9A 4GVUA 3UR9A 2VGCC 3Q77A 2O8MA 2Y5GA 3A7WA 3BTKE 1K1NA 2AYWA 3Q00A 1GHYH 4Y8YA 1V2ST 4BANB 1SL3A 2GCHF 2PGQB 3PMHB 3ZV9A 1B0EA 1ELGA 1YM0A 2XWAA 5EXLA 3URCA 3T29A 1KXCA 1UCYE 3B23B 1WQVH 1LHEH 3U1JB 4OS7A 3UUZA 1CSOE 3AAUA 4D9QA 1QIXB 3PMJA 3GCHC 5TCAA 2AERH 2Z3EA 1QA0A 1DS2E 2W5EA 1A5HA 2M5TA 2YOLA 3SHCH