1F2SE

Crystal structure of the complex formed between bovine beta-trypsin and mcti-a, a trypsin inhibitor of squash family at 1.8 a resolution
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords TRYPSIN
publication title Crystal structure of the complex formed between bovine beta-trypsin and MCTI-A, a trypsin inhibitor of squash family, at 1.8-A resolution.
pubmed doi rcsb
total genus 53
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2000-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1f2sE01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1f2sE02
1Y5AT 1YF4A 2J34A 1MTWA 1XXFA 4CREA 1DXWA 1O2MA 5E8EH 5JB9S 3M5MA 1UVTH 1YPEH 4H4FA 1GBBA 1W7XH 2OLGA 1C1QA 1Z8JB 2VWLA 1O2LA 3C1KA 2GV6A 7ESTE 1TA6A 1T8MA 3BV9B 4OS7A 3E0NB 1VZQH 4OS4A 1YCPK 4E7RG 1ANBA 1C2FA 2P8OC 1JIRA 4AFQA 2ZP0H 3QGJA 1Y3UA 1QB1A 2Z3EA 1GMCG 3A82A 1NZQH 1V2ST 1O2KA 3QTOH 4UE7H 2ZPQA 2CHAB 2C8WB 1EJMA 1OXGA 1NM6A 3GY2A 2FPZA 2Z6BD 1C9TA 5K7RA 1KDQA 5DO4H 1JOUB 1OP0A 4TWWA 2WYJA 1NT1A 1G3DA 4IMQA 2VGCC 3BTFE 1MCVA 5FCRA 2UWPA 4Y0ZE 3FP8E 3U1IB 1Z71A 1TE0A 1HGTH 2HOBA 4MNYA 1V2JT 1XVMA 4OS2A 1PYTD 4FUEA 1QA7A 1FPHH 2PLXA 2ZGXH 2M5TA 3ITIA 5DKMA 3U8TH 1GMHG 4WVPE 4HZHA 2XRCA 1T4UH 1P05A 2PKAB 3FZZA 4AB9A 5DP5A 1DOJA 3A7WA 5LGOA 3S7KB 1GJ9B 3TH3H 3F6UH 1GJCB 1HIAB 1YCPH 2C90B 3RMOH 1MU6B 1XKAC 3KHVA 2ZDVH 2O9QA 1GVLA 4X2WA 3L33A 2BLWA 2GCTB 1FONA 1W14U 2P3TB 4ZROA 1DANH 2V3OH 2QXJA 1TNHA 1SFQB 2VB0A 4RSPA 2GTBA 1DWEH 1HAYB 1SB1H 3O8DA 3D65E 4WMDA 2BOHB 2A45B 5BPEA 3QN7A 3A7YA 5AFYH 2BX3A 1YKTA 3B9FH 4AYYB 4BAQB 2ZCKP 2RA0A 1C5VA 4NGAH 4ABHA 1UO6A 3ZZAA 1IOEA 1S0RA 3A86A 1DY9A 3OTJE 2A2QH 1TRMA 2BVSH 4AG1A 1LVMA 1T4VH 2JH6D 1TPOA 1RTFB 1L0ZA 4Y7BA 2FM2A 3QZRA 2QXHA 3PYHA 2A4OA 3ZVEA 3PV4A 1GJ7B 2BY5X 2JH5D 1AE5A 1FY4A 1HAHH 1AVWA 2OXSA 2P93A 1WBGB 3TNSA 1CA0C 3UR6A 4FUJA 1Y3YA 2GP9B 1O5BB 3T28A 4ZKNU 1ORFA 4UEHH 2NWNA 8LPRA 2ZU1A 2QN5T 5E0JA 1YPGH 3TH4H 1HYLA 1SG8B 1O2VA 1GWAA 2ZFFH 1ELVA 5DG6A 1UVOA 5L2YH 3RU4D 2GCHF 1WYKA 4K1TA 2BVXH 1HJAB 1EOJA 1ZYOA 1EXFA 1BMLA 4JZDH 1ZJKA 5GJ4B 5C3NA 5JBAS 1EZUC 2BZ6H 4HGCA 3TK5A 1GI5A 3A81A 3RXLA 3ZZDA 3FANA 1CHGA 3NZIA 4ABBA 1A61H 4DY7B 4YM9A 5FBEA 1TNIA 2VVVA 3GYMA 1DDJA 3K2UA 2P59A 1MMJN 1GI1A 4F49A 1ESAA 2WV5A 1OWKA 1C1PA 1L4DA 2LNCA 3PM3A 1S0QA 4KGAA 1TPPA 2F91A 3LGUA 4A1TA 1DPOA 1TGNA 2TBSA 5ETXA 3P8NA 2ZA5A 3AASA 3M3TA 1P3EA 5T6GA 3RXSA 1J17T 5C67A 2P3FH 1HFDA 3CS0A 1HAGE 1QBOA 1SOZA 3RDZA 2FTLE 2D8WA 3MH6A 1L1GA 3V3MA 2OQ5A 3F9EA 5LPFA 1THSH 1MTUA 2WPMS 2FMJA 1B0EA 1ABJH 1JWTA 1J15A 4B2AA 4CBOA 5EG4A 2ZDAH 1ELTA 2PKAA 3AVZA 4WMEA 1ARCA 1F0TA 1UCYK 7GCHF 3BEUA 4NZQA 1O2UA 2UUKB 2ZDNA 1HIAA 3GCOA 1BRAA 2D26C 1A3EH 4D9RA 1W2KH 2AMPA 3SQEE 2F9BH 3LC5A 3UPEA 2UUYA 4TYDA 2C93B 3S9AA 3T62A 2Y5HA 4IGDA 3RU4E 1AB9B 1DWDH 1DY8A 3T2NA 3P70B 1EZSC 1GHBF 1UVUH 2AGIX 1MKXH 2G51A 1QRWA 3SV8A 1HUTH 1BIOA 3T25A 3C27B 4Y11E 1KXCA 3GCHB 2AEIH 3TGIE 3SI4H 1GGDC 1TMBH 1DSTA 4Y79A 1HAPH 3SJIA 2J9NA 1AFEH 1GI6A 3RP2A 1ZOMA 3UIRA 1SHYA 2HNTE 5FPYA 4WWYA 3UTUH 4DT7B 2Y5GA 4OGYA 2B8OH 1G32B 1U6QA 1AU8A 2CJIA 1B7XB 2OINA 1EQ9A 3BF6H 1FAKH 3ZZ7A 1T8LA 2OC8A 5EQSA 1PPCE 3BIUH 2BY8X 1VITF 1O3FA 1D3DB 1O5AB 1ANDA 4R8TB 1V2MT 1V2QT 2VWOA 1S83A 3LGYA 1IQKA 3T27A 1DSUA 3PROA 2F9VA 4Q7YA 2BDCA 2ZWLH 1OYTH 3SOSA 2BXTH 1AVGH 1ZGIA 1SL3A 3HKIB 4I8KA 3PTBA 1SOTA 3KIDU 1BDAA 1GHAF 4HTCH 2BD8A 4ISOA 2OC1A 3UOPA 4D8NA 1E36B 1G9IE 3MU5A 3SU2A 1N6XA 5FCKA 3KGPA 1L1JA 4YOGA 4X1QU 1QJ1B 1A0HB 3HK6B 2PKSB 4GHTA 1FY5A 4OS5A 2FI3E 4MNVA 2ANWA 3PWCA 1S5SA 1XUIA 3SORA 1CE5A 1O3IA 1UTOA 5F6MA 1BOQA 2GKVE 1A3BH 1C5YB 4NIVA 4RKJB 2J4IA 1ZSKA 1YPMH 3AW1A 5A09A 1XXDA 1EPTB 2JKHA 2GCHG 1E0FD 1G30B 4IN1A 1SGTA 1H9IE 1NFUA 4I8HA 4K1SA 5E0GA 3D49H 1SQTA 2XW9A 2Y7ZA 4D7GA 1VCWA 4ZXXH 1EX3A 1P2KA 4ZKRU 3BTTE 4X2VA 2A0QB 1TNJA 1MD7A 4B2CA 4X6OA 3S0NA 1PJPA 5EQQA 4X0WU 1BCUH 2VGCB 1KXAA 4YT7H 3SO3A 1P9UA 2KAIB 1UK4A 4KTCA 3A7TA 1O2OA 5EW2H 7LPRA 1K21H 2PGQB 3RXFA 5TJXA 2YOLA 2WV4A 1SGEE 5C5OA 2AS9A 1QRZA 1F2SE 1XUGA 2XBVA 1WQSA 1LPGB 3ATWA 4INHA 4E05H 3AW0A 1W10U 3KNXA 2ZPSA 3P8GA 1FAXA 4J1YA 3SNEA 4ZMAH 3RXRA 2CV3A 1QQUA 1UTJA 2R3YA 4X1RU 2OUAA 2AMDA 1GG6C 1F5RA 1GMHF 2VNTA 1O2YA 1TIOA 1V2TT 4X1SU 1AY6H 1XUHA 5H4IB 5LH8A 1PPZA 5EXLA 3ZZ5A 1V2RT 3K6YA 1GJ8B 3ESTA 2BM2A 2A32A 1C5UA 1KDQB 1SGPE 1HV7A 1EOLA 1QA0A 3L6PA 4D7FA 2V6NA 4WMFA 7GCHG 3BTHE 3Q77A 4BANB 1TRYA 2WINI 1GCDA 1SR5C 4WY3A 1A7SA 1TMTH 1QY6A 4ZHAA 4XDEA 1OWEA 1O5GH 1IHSH 2JETC 3LC3A 1BTHH 4JZ1A 4X1PU 4UFEH 1MTNC 4WH8A 3UY9A 4U2WA 1GHBG 1GL1A 1XVOA 2YNAA 1RRKA 3TIUA 1XKBC 4WJG2 5CMXH 4UONA 3SUDA 3RMLH 1QL8A 2OP9A 4IC5A 4NFEA 5J4SA 1Q2WA 1D4PB 3KN2A 1QCPA 1DM4B 4I33A 2QV1A 1O3AA 3RC4A 3I78A 2VIWA 1GMDF 4JZEH 2GZ9A 3EE0B 1GDNA 5GDSH 3LH1A 3LU9B 3MWIU 3P92A 1CA0B 1CT2E 5CHAC 3O8BA 1SSXA 5DGJA 1ZRKA 2HLCA 2F9NA 1GJAB 2ZI2H 1V2NT 2Q6GA 4X2YA 1IQEA 3FP7E 3S69A 1DS2E 2C8XB 2ZDLA 1P04A 3SQHE 3FFGA 1Z6EA 2C8ZB 2ZFPH 2SGDE 3OSYA 1O32A 1FDPA 3SI3H 3TJOA 1ZTLA 4GSOA 1C5NH 1RTLA 5DPAA 3SGBE 1BMAA 1FJSA 1TOCB 1AZZA 3URDA 2ILNA 3OY5U 1BRBE 5F8ZA 1F7ZA 4TY7A 2PTNA 2TPIZ 2FOBA 1GHAG 1NTPA 3A7VA 5JBCS 1PPFE 1ACBE 3JZ2B 4IW4E 1ZSLA 1V2WT 4IMZA 1MKWH 3PLPA 3ELAH 1UVSH 5AFZH 2XWAA 1H4WA 1C1VH 3ZZ6A 1BTPA 4FUBA 4IC6A 2EI7A 1PPBH 1QHRB 5A2MH 1LVBA 2C4FH 4NWLA 1GCTC 1IQGA 1C5PA 3M61U 1C2GA 3JZ1B 4NA7A 4ABFA 1QBVH 4M7GA 1AZ8A 1TONA 1S6HA 4LZ1H 1J9CH 1TWXB 1ETRH 1VR1H 1RJXB 1SLVB 1S81A 4JK5A 4JK6A 1GI7B 1W12U 3SV7A 1LO6A 2TRMA 3UR9A 1SLWB 5JPMH 1HJ9A 1ZHRA 1C1SA 2A4GA 4U30A 1GDQA 1G3CA 2G5VA 1GI9B 1P57B 2BMGB 1FLEE 3RXGA 1KXEA 1N8OC 3MU8A 3VB6A 4Q80A 2EA3A 4DCDA 3RC5A 1C1OA 1NRPH 1CVWH 3MFJA 3MH7A 4PROA 1ESTA 1F0SA 3NCLA 1DE7H 2FESH 3FVFB 3MU1A 3A88A 3ZYEA 3A84A 2AYWA 3PMJA 3QK1A 2XYAA 1MD8A 1ZPZA 1KLTA 4BOHA 5L6NH 1AFQC 1AUTC 1OWIA 3R3GB 1QB9A 4DIIH 3RXOA 2VIPA 2FOMB 4XOJA 3BG4B 4K1EA 1BTWA 1MZAA 2BDBA 2ASUB 2FYQA 1G2LA 1P11E 2Y6TA 3LT3A 3N7OA 2QCYA 2BY6X 4I8LA 4YZUA 2RA3A 1FZZA 3GY3A 1KLIH 1O0DH 4MPUA 1FQ3A 2NU2E 2STAE 2B0FA 4NG9H 3NXPA 1NU9A 1P2NA 5K0HA 1HAOH 4YOIA 1C4U2 2BLQA 3T5FH 4CHAB 3LGVA 1SQOA 2BXUH 1YLDA 2G52A 1OWDA 1P2MA 1A2CH 4I8JA 1EASA 2ZGHA 3RU4T 1DLEA 1NN6A 5GCHF 5T6DA 1ZTJA 1ZRBA 3OY6U 1HNEE 3KL6A 4ISHH 1UTMA 1Z8GA 1E35B 4NA8A 5HMAA 3LKWA 1SGFG 1CSOE 1ELDE 5ESBA 1DT2A 4MPWA 4F4OC 3VGCC 2ANMH 2AH4X 3NKKA 2H9EH 3VB4A 1V2PT 3ODDA 1T7CA 1GMDG 1A4WH 2IN2A 5DP7A 4NSVA 1AVXA 1O3OA 1SHHB 1GPZA 5B6OA 3SNAA 4DURA 1J8AA 3TITA 2ODYB 3ODFA 4O97A 3VFEA 2O8LA 1Y3WA 3M36A 1K9OE 1T8OA 1KSNA 3MTYA 4YESB 2R2WU 1V2KT 1W0ZU 6ESTA 2D2DA 1A0LA 1BBRK 1SMFE 2EI6A 5I46H 3SGQE 2GDEH 2A4RA 1P2IA 1C2MA 2FOFA 2CF9H 3ZV9A 2F3CE 3SU1A 2EC9H 1IHTH 2WYGA 4YLQH 3PMBB 3KQDA 1EP6A 1XMNB 3P6ZB 2PWXA 3BTKE 2ALVA 3ATKA 1HAVB 1QURH 1D3QB 2BDYA 2SGQE 3T29A 2SFAA 2Z7FE 4AB8A 1AWFH 1VGCC 2VIVA 3F9FA 1NFWA 2FXRA 3TJUA 1DFPA 2NU4E 1FV9A 1C2IA 1NROH 1TMUH 1UK3A 3AAVA 1O3NA 2ZF0H 3M3VA 4OS1A 2AGEX 1ID5H 1HAIH 1O2PA 5EXMA 1MBQA 5L30H 1UTLM 2BDHA 2HVXA 2OC7A 2GVFA 2Q6DA 2W3KA 4E7NA 2FX4A 3A8DA 3BSQA 3DA9B 4FVDA 4MPVA 4CR9A 3Q3KA 1O2XA 4JZIA 5E0HA 1W8BH 2QIQA 2A31A 3SU3A 2QAAA 3DUXH 1AD8H 1EJAA 3PO1B 1P2QA 2FIRH 2W7UA 5ESTE 2ODPA 4MQAA 3UQVA 2Z3CA 1BJUA 3K9XB 1YGCH 1NRQH 1A46H 3LGIA 3SJ9A 2NU0E 3MI4A 1LHEH 2HNTF 2ULLA 1C5TA 3FP6E 3P8FA 3RMNH 1ZZZA 4GAWA 3RUOA 4K3JA 4K2YA 5C20A 3RM0H 1GG6B 4HFPB 2W26A 1HRTH 2FO9A 5PTPA 1D3PB 5TCCA 2F9PA 2Y82A 2R0KA 1Q31A 2XCNA 2GX4A 5DP3A 1YPHE 4BTUB 1GBIA 2CF8H 1PYTC 3RXVA 4A7IB 1MTSA 4ZH8A 1HB0B 1KTSB 4IS5A 5G4BA 3RXIA 3SV6A 5E2PA 4NWKA 1OSSA 1C5LH 1YBWA 1C2DA 1OPHB 2SGPE 3SUGA 1NRSH 3UWIA 3TK6A 1DWCH 3U69H 3UOUA 1O2RA 2G00A 2THFB 4D76A 1RIWC 2ZGJA 3EA8A 4K5ZA 2PTCE 2BOKA 3BTGE 1C5XB 3GDVA 1ZJDA 1MTNB 3MNSA 3HGNA 1TYNA 2G81E 3VB5A 1AKSB 4CBNA 3SNDA 1P03A 4NIYA 1MTVA 1BMNH 2CXVA 1XUJA 3GISB 5HM9A 1E38B 2VINA 1F5KU 1OP8A 5DJ7A 2GDDA 4CRFA 2G55A 3MH5A 1C5MD 4TPIZ 2P95A 1BTYA 1DICA 4FUFA 3RLYH 3A7ZA 1NRNH 1BHXB 4ABDA 1IQMA 1CBWB 1O36A 3HKJB 2CHAC 2ZIQH 1EB2A 1MCTA 2CN0H 1BTXA 3RXJA 1O2TA 1VJAU 2FI5E 1UCYH 1O3PB 3RXCA 4ABGA 3QUMP 1RTKA 1LHCH 1LHFH 2ANKH 4FXGH 1HAXB 1DXPA 4R0IA 1UK2A 5GCHG 8GCHF 4K8YA 1B5GH 2QY0B 2VVUA 1F0UA 3SU6A 1RFNA 1O3JA 3CS7A 2B9LA 2VH6A 1H8DH 4UFGH 3LONA 1GVKB 1QL9A 2HALA 3SJ8A 1BBRE 3NK8A 1GJDB 2ZTZA 1O5DH 2W3IA 3KEEA 3ZZ9A 1QB6A 1ZMJA 5GXPA 3F9HA 1HLTH 3GCTF 4GCHF 5JYIA 3RMMH 2TGPZ 1L2EA 2Z9JA 1LQDB 4H6TA 1Y3XA 2GCTC 1HAVA 3RXUA 3HK3B 1O3EA 2WPLS 4BAKB 1K1LA 5EODA 1QFKH 2WUBA 1YP9A 3D62A 1S6FA 3DFLA 4RKOB 2QYIA 1F0RA 1GCTB 5AHGH 3HGPA 1JIMA 4A92A 3ATIA 1OX1A 3A8CA 1B0FA 3ENSB 1CU1A 1O2HA 3M35A 1MUEB 2ZKSA 4MNXA 1GHVH 1LTOA 1ZHPA 2ZU2A 2FZZA 2HPPH 4X6MA 2HNTC 1P02A 1BQYA 2ZU3A 1LHGH 1WTGH 1NFYA 2XCFA 3K65B 3PLKA 3MO3A 4LK4A 1NRRH 4ABIA 1GJ6A 4CRDA 2FYRA 3I77A 4K69A 2G4TA 1Z1IA 2R2MB 1N8OB 5AVDA 2EI8A 1QRXA 3BEIB 4DW2U 2FWWA 1TB6H 5JB8S 1ZTKA 2XBWA 2ZG0H 3O8RA 1FY1A 1DLKB 2OTVA 2P8OB 1O3KA 2ZCHP 1UTQA 4B2BA 1TQ7B 4ISLA 1Y5UT 1SC8U 3RXQA 1WOFA 1D6RA 1LMWB 4FUHA 5FX5A 1BA8B 1FUJA 3LJOA 3BEFB 1KTTB 1C5ZB 2VIQA 3OX7U 4IN2A 2ZEBA 1BITA 2GV7A 3GDSA 4SGBE 4BNRA 5AF9H 3LDXH 1ETTH 2PR3A 1GBAA 4LXBH 4XE4A 1M9UA 2FTMA 1L4ZA 3PMHB 1Z8RA 1UCYE 4THNH 2XTTB 5T3HA 5LPRA 1PPEE 2P16A 2ZGBH 2H1UA 2ODQA 5HXFA 2ZNKH 1UJ1A 1TFXA 2BZAA 4ESTE 4H6SB 3M37A 2AMQA 2ALPA 1AKSA 4B1TA 1L1NA 1G3EA 1SLUB 3Q00A 1QTFA 1V3XA 4J2YB 2D1JA 2ZFSA 1NC6A 4NSYA 4B74A 3M7UA 4MLFB 1G37A 1YPKH 4ISIH 1YYY1 1IQLA 3TPIZ 5J4QA 1ELEE 1TGCA 1V2OT 2DUCA 3MMGA 4Z6AH 4LZ4B 1TBRH 1A0JA 4I31A 4AGKA 3DHKH 4NIWA 1GI3A 1GBHA 3SN8A 1YC0A 3QGNB 2ZQ1A 1O2QA 1EAUA 1O2WA 4GPGA 2YNBA 4B76A 4XBBA 3BTQE 5A0BA 1SBWA 3CENA 1OYQA 3KQCA 1OS8A 2FI4E 3GY7A 5FBIA 3Q76A 1EATA 1TGTA 1Y59T 3AAUA 4JYUH 5L2ZH 1D3TB 5EPNA 3H7TA 3SW2B 3M7QA 1N1LA 3EGKH 2CGAA 4MPXA 2F9OA 4WH6A 4MVNA 2FLBH 2NU1E 1HJ8A 3E16B 1QIXB 2G5NA 1TLDA 4UFFH 5GPIB 2A7JA 1EAIA 2GD4B 5A8XA 1GBCA 3VXFH 2HWLB 2P3UB 1UMAH 3M5NA 3LGTA 3A7XA 8GCHG 1XM1A 1EKBB 3D23A 4TPYA 1XX9A 2ZECA 1FNIA 3A85A 1KXBA 1A1RA 1JRTA 2G8TA 1TX8A 4FUCA 1O3DA 1TNGA 1TABE 1W13U 4MTBA 2FOHA 3MOCA 3GCTG 4GCHG 1O5CB 1JRSA 1NFXA 1UTNA 2XWBI 1HXEH 1O30A 2H5CA 3U9AH 1IQNA 1LDTT 5TCAA 4ISNA 2CMYA 1PQAA 3H5CB 4Y8XA 2ZU4A 3KQBA 1O2IA 4Y0YE 2BQWB 3GY4A 1YCPM 3LOXA 4X1NU 1C5QA 5HGGA 4I32A 3GOVB 4TY6A 3GICB 3P17H 4Y71A 4XBDA 2RDLA 4UDWH 2WPIS 2QGRA 2ZFQH 3BTEE 5CE1A 1AUJA 1GBMA 5FHTA 8KME2 1ZMNA 9ESTA 2TGTA 4BAOB 3WY8A 9LPRA 1O5FH 2Z9GA 4ABEA 2B7DH 2FOCA 2Z94A 4X6NA 2BYAX 2G4UA 5F8TA 2J94A 1TPAE 5DP8A 1X7AC 3RM2H 1BZXE 4O3TA 1C2JA 2UUJB 3STIA 2BHGA 3UNRA 1Y3VA 4YTAA 1TBQH 1OOKB 4AOQA 2A7HA 2SNWA 5C2ZA 1DITH 3BN9A 1VCQA 4Y6DA 2PKSC 3F9GA 1PQ8A 2Z9LA 1RIWB 3PMAB 4HI3A 3RXTA 1MZDA 3UNSA 3E1XB 4LOYH 3GYLB 1SPJA 3RC6A 2RCEA 1BRUP 1LPZB 1FN8A 2PUQH 1NU7B 4NIXA 5FPSA 4BTTB 1QR3E 5EXNA 1WV7H 5FPTA 5I25A 3VPKA 1EPTC 5T6FA 4ASHA 4DVAU 4FUDA 4CH8B 2J2UA 3K6ZA 1SQAA 1TPSA 4AFSA 6GCHF 1GHZA 1WSSH 2UWLA 1C5WB 2XC4A 1GBJA 2AERH 3LH3A 4X8VH 2BD4A 4CRGA 1ANCA 1LQEA 3DFJA 2ZPRA 5EW1H 3V13A 2EEKA 5HM2A 4CR5A 4JZFH 4D9QA 1GGDB 4K8BA 2H5DA 1FIWA 2XNIA 5E2OA 2HRVA 1K28D 3MU4A 3PWBA 1O33A 1LVOA 3MO9A 3TNTA 2Z3DA 1FMGA 1C1UH 2BD5A 3S9BA 3ZYDA 2ZCLP 5JBTA 3QZQA 3SNCA 2VJ1A 1HPGA 2IOTA 3UQOA 2FDAA 2OQUA 4I8GA 4JCNA 1YLCA 1FY8E 3ATLA 1O3LA 3QTVH 5C5NA 6CHAC 2BVRH 4X8TH 3RXKA 4Y76A 1O5EH 3MHWU 4BXSA 3ZZ3A 4X8SH 1S82A 1AO5A 3RXEA 1GBDA 4ABJA 2W5EA 1O37A 2FS9A 3QX5H 2C3SA 2FOEA 1KXFA 4O3UA 3P8OA 4XFQA 2BD7A 3MNBA 2PSXA 1OWHA 1INCA 3U8RH 1AGJA 6LPRA 2BLOA 1PQ5A 3RXHA 2P94A 4AN7A 3ZVBA 4YO9A 3SNBA 1ZPCA 1C4V2 5A0AE 2J92A 2GMTC 1C1NA 1PFXC 1T8NA 3A80A 1AN1E 1FI8A 4BTIB 1TX7A 2BD9A 3V7TA 3SV9A 3VEQB 1O3BA 4KTSA 1ARBA 1ZHMA 2QF0A 1XUKA 1GL0E 1GBKA 3ATMA 1Z7KA 3B8JA 1K1OA 2O8UA 3TK9A 5F03A 4KP0A 3OYPA 3F68H 1SFIA 2GGVB 3SJOA 1EP5A 5FAHA 1EZXC 2GZ8A 1GI4A 1C4Y2 3UWJH 1RS0A 3A87A 3QDZB 2OBOA 2ESTE 3VB3A 3F1SB 1C5OH 3CP7A 3ZZ4A 3ZVGA 4RN6A 3RXDA 1KIGH 1BTUA 2ZU5A 4CRBA 4B71A 1OKXA 1VJ9U 3BTDE 5EU8A 3TGJE 3I29A 1H9HE 4KKDA 1OWJA 2ZTXA 3ZVCA 1W11U 3SHCH 3EQ0H 1BBRH 3RXPA 3A8BA 1BT7A 2PW8H 2ZHQH 1BRCE 3LGWA 2VH0A 3MO6A 1G2MA 1DUEA 1LVYA 4DGJA 1KYNA 1RD3B 3IITA 4UFDH 3SV2H 2BD2A 2TGDA 1F92A 1MU8B 3ZZBA 4VGCC 1J14A 1C2EA 2IJOB 4X8UH 1MBMA 1UTPA 2R0LA 4FUGA 1TX6A 2OBQA 1WUNH 3DD2H 4U32A 1MQ5A 3UREA 1ELAA 3KF2A 5DP6A 1TAWA 4A1XA 1GI0A 1IQFA 3O8CA 1ELCA 2BQ7B 3M3SA 3SGAE 3TU7H 1AQ7A 1Z1JA 1O35A 1FIZA 2I6SA 1OP2A 2H9TH 3EA9A 3IG6B 4KELA 3V12A 2VWNA 1P12E 5DK1A 3ZVAA 3SU0A 4GUXA 2A5AA 1AI8H 4UD9H 1ABIH 2ZDMA 3U8OH 1KLJH 2IPHA 1GHXH 2C8YB 1G3BA 2ANYA 2ZFRH 1ESBA 2AIQA 1WU1A 2JETB 5FX6A 1P10A 1MKXK 6GCHG 3BIVH 1LCYA 1J16A 2XBXA 2BB4A 1JBUH 2ZTYA 2SGAA 1P2JA 2FODA 2FOAA 4AORA 1O2NA 2FLRH 3PLBA 2BDAA 2BQ6B 1XUFA 3EAJA 5DP4A 2NU3E 2J95A 1SVPA 1P2OA 4O9VA 2XC0A 1CHOF 1GJBB 1KXDA 2V35A 4AGJA 2O8TA 4GVUA 5A8YA 1A5GH 1CT0E 1SGIB 1V2LT 1C1WH 1O3HA 1V6DA 3SZNA 1H1BA 2K1QA 1P01A 2R9PA 5CHAB 2Z9IA 2ZGCA 2ZHDA 4YLUA 4CH2B 2BLVA 3R0FA 1S84A 1DVAH 2BY9X 1P06A 1ZLRA 1C5SA 4OS6A 3E8LA 1ZSJA 3SU4A 1DX5M 4ZKOU 1THRH 4AX9H 1THPB 4FU8A 1PPGE 1YPHC 2ZC9H 4NCYA 3QLPH 1PQ7A 1CA8B 1VITH 2VIOA 3SBKA 1LKBA 1JXPA 1AHTH 3MNCA 3BG4C 3U98H 1SGQE 1K1JA 1AWHB 1C9PA 1Q3XA 2BD3A 5IYTA 1MAYA 4AZ2B 4FVBA 2GT8A 1EAWA 1C1MA 1LHDH 3ZZ8A 4ZHMU 4XSKU 1LPKB 1AMHA 1PPHE 1A5IA 5HYOA 3MNXA 3IWMA 1ZMLA 2HPQH 4MNWA 1O3CA 1QJ6B 1W7GH 2BY7X 1DUAA 2J38A 4E06H 1GBTA 3RXMA 1IQJA 4XBCA 4YOJA 3SHAH 1QBNA 2BTCE 1O39A 4FU9A 4B75A 1G36A 3E6PH 1CT4E 4CHAC 3UFAA 2QC2A 5F8XA 4BAHB 2FP7B 1A5HA 1GJ5H 1WCZA 3SJKA 3EA7A 4AG2A 1YPLH 1C1TA 1TRNA 1ANEA 1GDUA 3HPTB 1O38A 2Y81A 2STBE 1TA2A 2ZQ2A 4NZLA 5A8ZA 1CGJE 3NPSA 1FPCH 2F9UA 4QT8C 4KTUA 1H9LB 5JDUB 1C5RA 1T32A 2WUCA 2UWOA 1QJ7B 1SGDE 2O8MA 2UUFB 2VU8E 1SGRE 1YPJH 1BJVA 3L3TA 5JBBS 1O34A 3LIWA 1NY22 3OU0A 3E90B 3BG8A 3TJNA 4ZHLU 1BUIA 2Y7XA 1FXYA 1BHXF 4JYTA 4Q7ZA 4U01A 1C2HA 3FZDA 4GHQA 1SI5H 5EPYA 3H7OA 1CGIE 1LKAA 2AGGX 4Y8YA 1TOMH 3UUZA 2VWMA 2DE8A 1ELGA 3PB1E 3QO6A 1K1NA 4ZXYH 1D9IA 2FX6A 4MG3A 4NA9H 2AIPA 4WF8A 2ZZUH 3SUFA 1UHBB 2Z9KA 5EGMA 1UTKA 2ZHFH 3GY5A 1AFQB 1SLXB 2OC0A 3W95A 3LPRA 4Y7AA 4A5TS 1HDTH 1O2ZA 1O2GH 1RXPA 1DWBH 2QXGA 3VB7A 4YT6H 3KQEA 1RGQA 1V2UT 1QQ4A 3S7HB 1H8IH 3QWCH 3S9CA 1TQ0B 2BDIA 1HJAC 2OCVB 1F5LA 5FXLA 1MH0A 3VXEH 1P3CA 4Z0KA 1TNLA 3TH2H 3TJVA 1SGCA 2QF3A 2Q1JA 1Y5BT 2VVCA 1FN6A 1AIXH 1V2VT 1NPMA 3BTME 1GVZA 4Y10E 5ABWA 1AE8H 2ZHEH 1BTZA 1O2SA 1ETSH 2F83A 4H42U 4ZUHA 1GMCF 3SU5A 1MAXA 1HXFH 3BTWE 3KCGH 2BX4A 1VCPA 4ZKSU 2A2XH 1NS3A 3PO1C 1T31A 1TGSZ 1O2JA 1W0YH 2H6MA 3STJA 3M5LA 6CHAB 4DJZB 4BXWA 1GBEA 2H9HA 2V0BA 1K2I1 2FEQH 2SGEE 4FUIA 3E3TA 3A8AA 1C2LA 4JMYA 4Y8ZA 3EDXB 1O3GA 2BDGA 1HCGA 3W94A 3TLOA 3ZV8A 2XXLA 1SGNE 2JH0D 1QGFA 3Q3XA 1YM0A 4GLYA 1P8VC 2A1DB 2O8WA 2ZDKA 3MU0A 3RXBA 1E37B 1O31A 2PV9B 3VGCB 1SGYE 2PFEA 2A5KA 1CHOG 3ZZCA 7KMEH 3SUEA 5GWZA 3Q3YA 1K1IA 2PGBB 2WPKS 3ZVFA 4NFFA 1IQHA 3DT0H 3RLWH 5DP9A 2SGFE 2A5IA 1P0SH 2I6QA 3E0PB 2GMTB 2LPRA 3GY6A 3LJJA 1QNJA 2AFQB 1P09A 1UVPA 1BMMH 2Y5FA 1TGBA 1Z8IB 1EB1H 4I7YH 1TBZH 1W3CA 3TVJB 2Y80A 4K60A 3ZVDA 3P95A 1GBFA 1ZGVA 2DE9A 1GHYH 4DIHH 1GI2A 4MDSA 3U1JB 5LPEA 8ESTE 2FS8A 3A83A 1AB9C 2PHBA 2A4QA 3E91A 1TNKA 1EZQA 1GBLA 4ZAEA 1CQQA 4FU7A 1QL7A 1D6WA 1VGCB 4SGAE 2PSYA 5C1YA 1ZPBA 3GCNA 4CRAA 1MKWK 3B23B 2PUXB 4IBLH 2RG3A 2ZO3H 4BAMB 3GCHC 2B5TB 1CBWC 2TIOA 2WPJS 4Q2KA 2GT7A 4CRCA 2W7SA 2XBYA 1HAZB 1GJ4H 2WPHS 2ZHWH 1C1RA 5A0CA 4ABAA 1S85A 1VITG 3URCA 3M5OA 2OD3B 1FY3A 3RXAA 3UNQA 1WQVH 1K1MA 4O03A 1K22H 1NO9H 2V3HH 4JYVH 2QXIA 3G01A 4INLA 2QA9E 2H2ZA 1IQIA 3MH4A 1EAXA 3PTNA 1ELFA 3MYWA 3GY8A 1P9SA 4Q7XA 4DOQA 5EQRA 4VGCB 1E34B 1K1PA 3V0XA 1ELBA 4WXVA 1HBTH 4X2XA 2VIDA 3NWUA 4AFZA 2HGTH 3T26A 5SGAE 2Q6FA 1EPTA 1UHBA 4DG4A 1ZR0A 2ZFTA 4AFUA 1WTHD 4A1VA 1WAYB 1MQ6A 3HATH 1GHWH 3FAOA 3TGKE 1KY9A 4WXIA 1N6YA 2TGAA 4B73A 5BRRE 1BB0B 4AYVB 1TALA 5C1UA 1IAUA 1CGHA 5C1XA 4TWYA 4X6PA 1SGFA 1GI8B 4A6LA 3GDUA 2A7CA 1JMOH 2XC5A 1CO7E 1EJNA 4OGXA 2R3UA 1Y8TA 3A89A 5GIBA 5IDKA 1Z6JH 2FOGA 5EOKA 2KAIA 1O3MA 1NESE 2GZ7A 1EUFA 3EYDA 2SNVA 1C2KA 3M7TA 3NUMA 4INKA
chains in the Genus database with same CATH superfamily
1Y5AT 1YF4A 4B6EA 2J34A 5HIYA 1MTWA 1XXFA 4CREA 1DXWA 1O2MA 5E8EH 5JB9S 3M5MA 1UVTH 1YPEH 4H4FA 1GBBA 1W7XH 2OLGA 1C1QA 1Z8JB 2VWLA 4Q4LA 1O2LA 3C1KA 2GV6A 7ESTE 1TA6A 1T8MA 3BV9B 4OS7A 3E0NB 1VZQH 4OS4A 1YCPK 4E7RG 1ANBA 1C2FA 2P8OC 1JIRA 3FOAA 5F53A 4AFQA 2ZP0H 3QGJA 1Y3UA 1QB1A 2Z3EA 1GMCG 3A82A 1NZQH 1V2ST 1O2KA 3QTOH 4UE7H 2ZPQA 2CHAB 2C8WB 1EJMA 1OXGA 1NM6A 3GY2A 2FPZA 2Z6BD 1C9TA 5K7RA 1KDQA 5DO4H 1JOUB 1OP0A 4TWWA 2WYJA 1NT1A 1G3DA 2V3MA 4IMQA 2VGCC 3BTFE 1WXRA 1MCVA 5FCRA 2UWPA 4Y0ZE 3FP8E 3U1IB 1Z71A 5EJLA 1TE0A 1HGTH 2HOBA 4MNYA 1V2JT 1XVMA 4OS2A 1PYTD 4FUEA 1QA7A 1FPHH 2PLXA 2ZGXH 2M5TA 3ITIA 5DKMA 3U8TH 1GMHG 4WVPE 5CHBA 4HZHA 2XRCA 1T4UH 1P05A 2PKAB 3FZZA 5T1VA 4AB9A 5DP5A 1DOJA 3A7WA 5LGOA 3S7KB 1GJ9B 3TH3H 3F6UH 1GJCB 1HIAB 1YCPH 2C90B 4P02A 3RMOH 1MU6B 1XKAC 3KHVA 2ZDVH 3F0OA 2O9QA 1GVLA 4X2WA 3L33A 2BLWA 2GCTB 1FONA 1W14U 5FL7D 2P3TB 4ZROA 1DANH 2V3OH 2QXJA 1TNHA 1SFQB 2VB0A 4RSPA 2GTBA 1DWEH 1HAYB 1SB1H 3O8DA 3D65E 4WMDA 2BOHB 2A45B 5BPEA 3QN7A 3A7YA 5AFYH 2BX3A 1YKTA 3B9FH 2KCPA 4AYYB 4BAQB 2ZCKP 2RA0A 1C5VA 4NGAH 4ABHA 1UO6A 3ZZAA 1IOEA 1S0RA 3A86A 1DY9A 3OTJE 2A2QH 1TRMA 2BVSH 4AG1A 1LVMA 1T4VH 2JH6D 1TPOA 1RTFB 1L0ZA 4Y7BA 2FM2A 3QZRA 2QXHA 3PYHA 2A4OA 3ZVEA 2HLDD 3PV4A 1GJ7B 2BY5X 2JH5D 1AE5A 1FY4A 1HAHH 1AVWA 2OXSA 2P93A 2KX4A 1WBGB 3TNSA 1CA0C 4P00A 3UR6A 4FUJA 1Y3YA 2GP9B 1O5BB 3T28A 4ZKNU 1ORFA 4UEHH 2NWNA 8LPRA 2ZU1A 2QN5T 5E0JA 1YPGH 3TH4H 1HYLA 1SG8B 5C0TA 1O2VA 1GWAA 2ZFFH 1ELVA 5DG6A 1UVOA 5L2YH 3RU4D 2GCHF 1NBMD 1WYKA 4K1TA 2BVXH 2K0QA 1HJAB 1EOJA 1ZYOA 1EXFA 1BMLA 4JZDH 1ZJKA 2JIZD 5GJ4B 5C3NA 5JBAS 1EZUC 2BZ6H 4HGCA 3TK5A 1GI5A 3A81A 3RXLA 3ZZDA 3FANA 1CHGA 3NZIA 4ABBA 1A61H 4DY7B 4YM9A 5FBEA 1TNIA 2VVVA 3GYMA 1DDJA 3K2UA 2P59A 1MMJN 1GI1A 4F49A 1ESAA 2WV5A 1OWKA 1C1PA 1L4DA 2LNCA 5C94A 3PM3A 1S0QA 4KGAA 2L6OA 1TPPA 2F91A 3LGUA 4A1TA 1DPOA 1TGNA 2TBSA 5ETXA 3P8NA 2ZA5A 3AASA 3M3TA 1P3EA 1WDIA 3KYFA 5T6GA 3RXSA 1J17T 5C67A 2P3FH 1HFDA 3CS0A 1HAGE 1QBOA 1SOZA 3RDZA 2FTLE 3ZIAD 2D8WA 3MH6A 1L1GA 3V3MA 2OQ5A 3F9EA 5LPFA 1THSH 1MTUA 2WPMS 2FMJA 1B0EA 1ABJH 1JWTA 1J15A 4B2AA 4CBOA 5EG4A 2ZDAH 3WW7A 1ELTA 2PKAA 3AVZA 4WMEA 1ARCA 1F0TA 1UCYK 7GCHF 3BEUA 4NZQA 1O2UA 2UUKB 2ZDNA 1HIAA 3GCOA 1BRAA 2D26C 1A3EH 3CNRA 4D9RA 1W2KH 2AMPA 4XD7D 3SQEE 2F9BH 3LC5A 3UPEA 2UUYA 4TYDA 2C93B 3S9AA 5KEDA 3T62A 2Y5HA 4IGDA 3RU4E 1AB9B 1DWDH 1NBME 1DY8A 3T2NA 3P70B 1EZSC 1GHBF 1UVUH 2AGIX 1MKXH 2G51A 1QRWA 3SV8A 1HUTH 1BIOA 3T25A 3C27B 5B6LA 4Y11E 1KXCA 3GCHB 3OAAD 2AEIH 3TGIE 3SI4H 1GGDC 1TMBH 1DSTA 2W6ID 4Y79A 1HAPH 3SJIA 2J9NA 1AFEH 1GI6A 3DSPA 1ZOMA 3RP2A 3UIRA 1SHYA 2HNTE 5FPYA 4WWYA 3UTUH 4DT7B 2Y5GA 4OGYA 2B8OH 1G32B 2WHXA 1U6QA 1AU8A 2CJIA 1B7XB 2OINA 1EQ9A 3BF6H 1FAKH 3ZZ7A 1T8LA 2OC8A 5EQSA 1PPCE 3BIUH 2L74A 2BY8X 1VITF 1O3FA 1D3DB 1O5AB 1ANDA 4I86A 4R8TB 1V2MT 1V2QT 2VWOA 1S83A 3LGYA 1IQKA 3T27A 1DSUA 3PROA 2F9VA 4Q7YA 2BDCA 2ZWLH 1OYTH 3SOSA 2BXTH 1AVGH 1ZGIA 1SL3A 3HKIB 4I8KA 3PTBA 1SOTA 3KIDU 1BDAA 1GHAF 4HTCH 2BD8A 4ISOA 4RT0A 2OC1A 3UOPA 4D8NA 1E36B 1G9IE 3MU5A 3SU2A 1N6XA 5FCKA 3KGPA 1L1JA 2K8IA 1K0HA 4YOGA 3F2HA 4X1QU 1QJ1B 1A0HB 3HK6B 2PKSB 4GHTA 1FY5A 4OS5A 2FI3E 4MNVA 2ANWA 3PWCA 1S5SA 1XUIA 3SORA 1CE5A 1O3IA 1UTOA 5F6MA 5CDFE 1BOQA 2GKVE 1A3BH 1C5YB 4NIVA 4RKJB 2J4IA 1ZSKA 1YPMH 3AW1A 5A09A 1XXDA 2GJGA 1EPTB 2JKHA 2GCHG 1E0FD 1G30B 4IN1A 1SGTA 3UB0A 1H9IE 1NFUA 4I8HA 4K1SA 5E0GA 3SYJA 3D49H 1SQTA 2XW9A 2Y7ZA 4D7GA 1VCWA 4ZXXH 1EX3A 1P2KA 4ZKRU 3BTTE 5EJZA 4X2VA 2A0QB 1TNJA 1MD7A 4B2CA 4X6OA 3S0NA 1PJPA 5EQQA 4X0WU 1BCUH 2VGCB 1KXAA 4YT7H 3SO3A 1P9UA 2KAIB 1UK4A 4KTCA 3A7TA 1O2OA 5EW2H 7LPRA 1K21H 3DCLA 2PGQB 3RXFA 5TJXA 2YOLA 2WV4A 1SGEE 5C5OA 2AS9A 1QRZA 1F2SE 1XUGA 2XBVA 1WQSA 1LPGB 3ATWA 4INHA 4E05H 3AW0A 1W10U 3KNXA 2ZPSA 3P8GA 1FAXA 4J1YA 3SNEA 4ZMAH 3RXRA 2CV3A 1QQUA 1UTJA 2R3YA 4X1RU 2OUAA 2AMDA 1GG6C 1F5RA 1GMHF 2VNTA 1O2YA 1TIOA 1V2TT 4X1SU 1AY6H 1XUHA 5H4IB 5LH8A 1PPZA 5EXLA 3ZZ5A 1V2RT 3K6YA 1GJ8B 3ESTA 2BM2A 2A32A 1C5UA 1KDQB 1SGPE 1HV7A 2PP6A 1EOLA 1QA0A 3L6PA 4D7FA 2V6NA 4WMFA 7GCHG 4OM9A 3GS9A 4TT3D 3BTHE 3Q77A 3W1EA 4BANB 1TRYA 2WINI 1GCDA 1SR5C 4WY3A 1A7SA 1TMTH 1QY6A 4ZHAA 4XDEA 1OWEA 1O5GH 1IHSH 2JETC 3LC3A 1BTHH 4JZ1A 4X1PU 4UFEH 1MTNC 4WH8A 3UY9A 4U2WA 1GHBG 1GL1A 1XVOA 2OK5A 2YNAA 1RRKA 3TIUA 1XKBC 2M2AA 4WJG2 5CMXH 4UONA 2RDEA 3SUDA 3RMLH 1QL8A 2OP9A 4IC5A 4NFEA 5J4SA 1Q2WA 1D4PB 3KN2A 1QCPA 1DM4B 4I33A 2WPDD 2QV1A 1O3AA 3RC4A 3I78A 2VIWA 1GMDF 4JZEH 2GZ9A 3EE0B 1GDNA 5GDSH 3LH1A 3LU9B 3MWIU 3P92A 1CA0B 1CT2E 5CHAC 3O8BA 1SSXA 5DGJA 3PRBA 1ZRKA 2HLCA 2F9NA 1GJAB 2ZI2H 1W0JD 3OE7D 1V2NT 2Q6GA 4X2YA 1IQEA 3FP7E 3S69A 1DS2E 2C8XB 2ZDLA 1P04A 3SQHE 3FFGA 1Z6EA 2C8ZB 2ZFPH 2SGDE 3OSYA 1O32A 1FDPA 3SI3H 3TJOA 1ZTLA 4GSOA 5KGOA 1C5NH 1RTLA 5DPAA 3SGBE 1BMAA 1FJSA 1TOCB 1AZZA 3URDA 2ILNA 1FX0B 3OY5U 2XOKD 1BRBE 5F8ZA 1F7ZA 4TY7A 2PTNA 2TPIZ 2FOBA 1GHAG 1NTPA 3A7VA 5JBCS 1PPFE 1ACBE 3JZ2B 4IW4E 1ZSLA 1V2WT 3PV2A 1MKWH 3PLPA 4IMZA 3ELAH 1UVSH 5AFZH 2XWAA 4AC9A 1H4WA 1C1VH 3ZZ6A 3N99A 1BTPA 4FUBA 4IC6A 2EI7A 1PPBH 3FKSD 1QHRB 5A2MH 1LVBA 2C4FH 3N7DA 4NWLA 1GCTC 1IQGA 1C5PA 3M61U 1C2GA 3JZ1B 4NA7A 4ABFA 1QBVH 4M7GA 1AZ8A 1TONA 1S6HA 4LZ1H 1J9CH 1TWXB 1ETRH 1VR1H 1RJXB 1SLVB 1S81A 4JK5A 4JK6A 1GI7B 1W12U 3SV7A 1LO6A 2TRMA 3OEHD 1SLWB 3UR9A 5JPMH 1HJ9A 1ZHRA 1C1SA 2A4GA 4U30A 1GDQA 1G3CA 2G5VA 1GI9B 1P57B 2BMGB 1FLEE 3RXGA 1KXEA 1N8OC 3MU8A 3VB6A 4Q80A 2EA3A 4DCDA 3RC5A 1C1OA 1NRPH 1CVWH 3MFJA 3MH7A 4PROA 1ESTA 2F4LA 1F0SA 3NCLA 1DE7H 2FESH 3FVFB 3MU1A 5HKKD 3A88A 3ZYEA 3A84A 2AYWA 3PMJA 3QK1A 2XYAA 1MD8A 1ZPZA 1KLTA 4BOHA 5L6NH 1AFQC 1AUTC 1OWIA 3R3GB 1QB9A 4DIIH 3RXOA 2VIPA 2FOMB 4XOJA 3BG4B 4K1EA 1BTWA 1MZAA 2J98A 2BDBA 2ASUB 2FYQA 1G2LA 1P11E 2Y6TA 3LT3A 3N7OA 2QCYA 2BY6X 4I8LA 4YZUA 2RA3A 1FZZA 3GY3A 1KLIH 1O0DH 4MPUA 1FQ3A 2NU2E 2STAE 2B0FA 4NG9H 3NXPA 1NU9A 1P2NA 5K0HA 1HAOH 4YOIA 1C4U2 2BLQA 3T5FH 4CHAB 3LGVA 1SQOA 2BXUH 1YLDA 2G52A 1OWDA 1P2MA 1A2CH 4I8JA 1EASA 2IPQX 2ZGHA 3RU4T 1DLEA 1NN6A 5GCHF 5T6DA 1ZTJA 1ZRBA 3OY6U 1HNEE 3KL6A 4ISHH 1UTMA 1Z8GA 1E35B 4NA8A 3F3BA 5HMAA 3LKWA 1SGFG 1CSOE 1ELDE 5ESBA 1DT2A 4MPWA 4F4OC 3VGCC 2ANMH 2AH4X 3NKKA 2H9EH 3VB4A 1V2PT 3ODDA 1T7CA 1GMDG 1A4WH 2IN2A 5DP7A 4NSVA 1AVXA 1O3OA 1SHHB 1GPZA 5B6OA 3SNAA 4DURA 1J8AA 3TITA 2ODYB 3ODFA 4O97A 3VFEA 2O8LA 1Y3WA 3M36A 1K9OE 1T8OA 1KSNA 1W0KD 3MTYA 4YESB 2R2WU 1V2KT 1W0ZU 6ESTA 2D2DA 1A0LA 1BBRK 1SMFE 2EI6A 5I46H 3SGQE 2GDEH 2A4RA 1P2IA 1C2MA 2FOFA 2CF9H 3ZV9A 2F3CE 3SU1A 2EC9H 1IHTH 2WYGA 4YLQH 3PMBB 3KQDA 1EP6A 1XMNB 3P6ZB 2PWXA 3BTKE 2ALVA 3ATKA 1HAVB 1QURH 1D3QB 2BDYA 2SGQE 2HVYB 1OHHD 3T29A 2SFAA 2Z7FE 4AB8A 1AWFH 1VGCC 2VIVA 2YMSB 3F9FA 1NFWA 2FXRA 3TJUA 1DFPA 2NU4E 1FV9A 1C2IA 1NROH 1TMUH 1UK3A 3AAVA 1O3NA 2ZF0H 3M3VA 4OS1A 2AGEX 1ID5H 1HAIH 1O2PA 5EXMA 1MBQA 5L30H 1UTLM 2BDHA 2HVXA 2OC7A 2GVFA 2Q6DA 2W3KA 4E7NA 2FX4A 3A8DA 3BSQA 3DA9B 4FVDA 4MPVA 4CR9A 3Q3KA 1O2XA 4JZIA 5E0HA 1W8BH 2QIQA 2A31A 3SU3A 2QAAA 3DUXH 1AD8H 1EJAA 3PO1B 1P2QA 2FIRH 2W7UA 5ESTE 2ODPA 4MQAA 3UQVA 2Z3CA 1BJUA 3K9XB 1YGCH 1NRQH 1A46H 3LGIA 3SJ9A 2NU0E 3MI4A 1LHEH 2HNTF 2ULLA 1C5TA 3FP6E 3P8FA 3RMNH 1ZZZA 4GAWA 3RUOA 4K3JA 4K2YA 5C20A 3RM0H 1GG6B 2QE7D 4HFPB 2W26A 1HRTH 2FO9A 5PTPA 1D3PB 5TCCA 2F9PA 2Y82A 2R0KA 1Q31A 2XCNA 2GX4A 5DP3A 1YPHE 4BTUB 1GBIA 2CF8H 1QZ8A 1PYTC 3RXVA 4A7IB 1MTSA 4ZH8A 1HB0B 1KTSB 4IS5A 5G4BA 3RXIA 3SV6A 5E2PA 4NWKA 1OSSA 1C5LH 1YBWA 1C2DA 1OPHB 2SGPE 3SUGA 1NRSH 3UWIA 3TK6A 2YMSD 1DWCH 5GNDA 3U69H 3UOUA 1O2RA 2G00A 1S6LA 2THFB 4D76A 1RIWC 2KCAA 2ZGJA 3EA8A 4K5ZA 2PTCE 2BOKA 3BTGE 1C5XB 3GDVA 1ZJDA 1MTNB 3MNSA 3HGNA 1TYNA 2G81E 2EQNA 2KCOA 3VB5A 1AKSB 4CBNA 3SNDA 1P03A 4NIYA 1MTVA 1H8HD 1BMNH 2CXVA 1XUJA 3GISB 5HM9A 1E38B 2VINA 1F5KU 1OP8A 5DJ7A 2GDDA 4CRFA 2G55A 3MH5A 1C5MD 4TPIZ 2P95A 1BTYA 1DICA 4FUFA 3RLYH 3A7ZA 1NRNH 1BHXB 4ABDA 1IQMA 1CBWB 3DSGA 1O36A 3HKJB 2CHAC 2ZIQH 1EB2A 1MCTA 3FN8A 2CN0H 1BTXA 2KCYA 3RXJA 1O2TA 1VJAU 2FI5E 1UCYH 1O3PB 4FETA 3RXCA 3QUMP 4ABGA 1RTKA 1COWD 1LHCH 1LHFH 2ANKH 4FXGH 1HAXB 1DXPA 4R0IA 1UK2A 5GCHG 8GCHF 4K8YA 1B5GH 4F48B 2QY0B 2VVUA 1F0UA 3SU6A 1RFNA 1O3JA 3CS7A 1H8ED 2B9LA 2VH6A 1H8DH 4UFGH 3LONA 1GVKB 1QL9A 2HALA 3SJ8A 1BBRE 3NK8A 1GJDB 2ZTZA 1O5DH 2W3IA 3KEEA 3ZZ9A 1QB6A 1ZMJA 5GXPA 3F9HA 1E79D 1HLTH 3GCTF 4GCHF 5JYIA 3RMMH 2TGPZ 1L2EA 3DSOA 2Z9JA 1LQDB 4H6TA 1Y3XA 2GCTC 1HAVA 3RXUA 3HK3B 1O3EA 2WPLS 2KFWA 4BAKB 1K1LA 5EODA 1QFKH 2J97A 2WUBA 1YP9A 3D62A 1S6FA 3DFLA 4RKOB 2QYIA 1F0RA 1GCTB 5AHGH 3HGPA 1JIMA 4A92A 3ATIA 1OX1A 3A8CA 1B0FA 3ENSB 1CU1A 1O2HA 3FO8D 1MUEB 3M35A 2QF5A 2ZKSA 4MNXA 1GHVH 1LTOA 1ZHPA 2ZU2A 2FZZA 2HPPH 4X6MA 2HNTC 1P02A 1BQYA 2ZU3A 1LHGH 1WTGH 1NFYA 2XCFA 3K65B 3PLKA 3MO3A 4LK4A 1NRRH 4ABIA 1GJ6A 4CRDA 2FYRA 3I77A 4K69A 2G4TA 1Z1IA 2R2MB 1N8OB 5AVDA 2EI8A 1QRXA 3BEIB 4DW2U 2FWWA 1TB6H 2JDID 5JB8S 1ZTKA 2XBWA 2ZG0H 3O8RA 1FY1A 1DLKB 2OTVA 2F43B 1O3KA 2P8OB 2ZCHP 1UTQA 4B2BA 1TQ7B 4ISLA 1Y5UT 1SC8U 3RXQA 4FOUC 1WOFA 1D6RA 1LMWB 4FUHA 5FX5A 1BA8B 1FUJA 3LJOA 3BEFB 1KTTB 1C5ZB 2VIQA 3OX7U 4IN2A 2ZEBA 1BITA 2GV7A 3GDSA 4SGBE 4BNRA 5AF9H 3LDXH 1ETTH 2PR3A 1GBAA 4LXBH 4XE4A 1M9UA 2FTMA 1L4ZA 3PMHB 3OTPA 1Z8RA 1UCYE 4THNH 2XTTB 5T3HA 5LPRA 1PPEE 2P16A 2ZGBH 2H1UA 2ODQA 5HXFA 2ZNKH 1UJ1A 1TFXA 2BZAA 4ESTE 4H6SB 3M37A 2AMQA 2ALPA 1AKSA 4B1TA 1L1NA 1G3EA 1SLUB 3Q00A 5IK2D 1QTFA 1V3XA 3WWBA 4J2YB 2D1JA 2ZFSA 4M9FA 1NC6A 4Z1MD 5C0UA 4NSYA 4B74A 3M7UA 4MLFB 1G37A 1YPKH 3PV5A 4ISIH 1YYY1 1IQLA 3TPIZ 5J4QA 1ELEE 1TGCA 1V2OT 2DUCA 3MMGA 4Z6AH 4LZ4B 1TBRH 1A0JA 2J98B 4I31A 4AGKA 3DHKH 4NIWA 1GI3A 1GBHA 3SN8A 1YC0A 3QGNB 2ZQ1A 1O2QA 1EAUA 1O2WA 4GPGA 2YNBA 4B76A 4XBBA 3BTQE 5A0BA 1SBWA 3CENA 1OYQA 1EFRD 3KQCA 1OS8A 2FI4E 2LELA 3GY7A 5FBIA 3Q76A 1EATA 1TGTA 1Y59T 3AAUA 4JYUH 5L2ZH 1D3TB 2KM0A 5EPNA 3H7TA 3SW2B 3M7QA 1N1LA 3EGKH 2CGAA 4MPXA 2F9OA 4WH6A 4MVNA 2FLBH 2NU1E 1HJ8A 3E16B 1QIXB 1YY3A 2G5NA 1TLDA 4UFFH 5GPIB 1SKYE 2A7JA 1EAIA 2GD4B 2KZ4A 5A8XA 4F55A 2J5UA 1GBCA 3VXFH 2HWLB 2P3UB 1UMAH 3M5NA 3LGTA 3OEED 3A7XA 8GCHG 1XM1A 1EKBB 3D23A 4TPYA 1XX9A 2ZECA 1FNIA 3A85A 1KXBA 3MQKC 1A1RA 1JRTA 2G8TA 1TX8A 4FUCA 1O3DA 1TNGA 1TABE 1W13U 4XRNA 4MTBA 2FOHA 3MOCA 3GCTG 4GCHG 4ASUD 1O5CB 1JRSA 1NFXA 1UTNA 2XWBI 1HXEH 1O30A 2H5CA 3U9AH 1IQNA 1LDTT 5TCAA 4ISNA 2CMYA 1PQAA 3H5CB 4Y8XA 2ZU4A 3KQBA 1O2IA 4Y0YE 2WV9A 2BQWB 3GY4A 3F2GA 1YCPM 1UW7A 3LOXA 4X1NU 1C5QA 5HGGA 4I32A 3GOVB 4TY6A 3GICB 3P17H 4Y71A 4XBDA 2RDLA 4UDWH 2WPIS 2QGRA 2ZFQH 3BTEE 5CE1A 1AUJA 1GBMA 5FHTA 8KME2 1ZMNA 9ESTA 2TGTA 4BAOB 3WY8A 9LPRA 1O5FH 2Z9GA 4ABEA 2B7DH 2FOCA 2Z94A 4X6NA 2BYAX 2G4UA 5F8TA 2J94A 1TPAE 5DP8A 1X7AC 3RM2H 1BZXE 4O3TA 1C2JA 2UUJB 3STIA 2BHGA 3UNRA 1Y3VA 4YTAA 1TBQH 1OOKB 4AOQA 2A7HA 2SNWA 5C2ZA 1DITH 3BN9A 1VCQA 4Y6DA 2PKSC 3F9GA 1PQ8A 2Z9LA 1RIWB 3PMAB 4HI3A 3RXTA 1MZDA 3UNSA 3E1XB 4LOYH 3GYLB 1SPJA 4YXWD 5EIYA 3RC6A 2RCEA 1BRUP 1LPZB 1FN8A 2PUQH 1NU7B 4NIXA 5FPSA 4BTTB 1QR3E 1KMHB 5EXNA 1WV7H 5FPTA 5I25A 3VPKA 1EPTC 5T6FA 4ASHA 4DVAU 4FUDA 4CH8B 2J2UA 3K6ZA 3PRDA 1SQAA 1TPSA 4AFSA 6GCHF 1GHZA 1WSSH 2UWLA 1C5WB 2XC4A 1GBJA 2AERH 3LH3A 4X8VH 2BD4A 4CRGA 1ANCA 2W6JD 1LQEA 3DFJA 2ZPRA 5EW1H 3V13A 2EEKA 5HM2A 4CR5A 4JZFH 4D9QA 4B6FA 1GGDB 4K8BA 2H5DA 1FIWA 2XNIA 5E2OA 2HRVA 1K28D 3MU4A 3PWBA 1O33A 1LVOA 3MO9A 3TNTA 2Z3DA 1FMGA 1C1UH 2BD5A 3S9BA 3SZEA 3ZYDA 2ZCLP 5JBTA 3QZQA 3SNCA 2VJ1A 1HPGA 2IOTA 3UQOA 2FDAA 2OQUA 4I8GA 4JCNA 1YLCA 1FY8E 3ATLA 5EJ1A 1O3LA 1E1RD 3QTVH 2RFKC 5C5NA 1YWUA 6CHAC 2BVRH 4X8TH 3RXKA 4Y76A 2VBCA 1O5EH 3MHWU 4BXSA 3ZZ3A 4X8SH 1S82A 1AO5A 3WWFA 3RXEA 1GBDA 4ABJA 2W5EA 1O37A 2FS9A 3QX5H 2C3SA 2FOEA 1KXFA 4O3UA 3P8OA 4XFQA 2BD7A 3MNBA 2PSXA 1OWHA 1INCA 3U8RH 1AGJA 6LPRA 3EE7A 2BLOA 1PQ5A 3RXHA 2P94A 4AN7A 3ZVBA 4YO9A 3SNBA 1ZPCA 1C4V2 5A0AE 2J92A 2GMTC 1C1NA 1PFXC 1T8NA 3A80A 5HIZA 1AN1E 1FI8A 4BTIB 1TX7A 2BD9A 3V7TA 3SV9A 3VEQB 1O3BA 4KTSA 1ARBA 1ZHMA 2QF0A 1XUKA 1GL0E 1GBKA 3ATMA 1Z7KA 3B8JA 1K1OA 2O8UA 3TK9A 5F03A 4KP0A 3OYPA 3F68H 1YLNA 1SFIA 2GGVB 3SJOA 1EP5A 5FAHA 1EZXC 2GZ8A 1GI4A 1C4Y2 3UWJH 1RS0A 3A87A 3QDZB 2OBOA 2ESTE 3VB3A 3F1SB 1C5OH 3CP7A 3ZZ4A 3ZVGA 4RN6A 3RXDA 1KIGH 1BTUA 2ZU5A 4CRBA 4B71A 1OKXA 1VJ9U 3BTDE 5EU8A 3TGJE 3I29A 1H9HE 4KKDA 1OWJA 2ZTXA 3ZVCA 1W11U 3SHCH 3EQ0H 3OFND 1BBRH 3RXPA 3A8BA 1BT7A 2PW8H 2ZHQH 1BRCE 3LGWA 2VH0A 3MO6A 1G2MA 1DUEA 1LVYA 4DGJA 1KYNA 3N7EA 1RD3B 3IITA 4UFDH 3SV2H 2BD2A 2TGDA 1F92A 5DSFA 1MU8B 3ZZBA 4VGCC 1J14A 1C2EA 2IJOB 4X8UH 1MBMA 1UTPA 2R0LA 4FUGA 1TX6A 2OBQA 1WUNH 3UAIC 3DD2H 4U32A 1MQ5A 3UREA 1ELAA 3KF2A 4RT1A 5DP6A 1TAWA 4A1XA 1GI0A 1IQFA 3O8CA 1ELCA 2BQ7B 3M3SA 3SGAE 3TU7H 1AQ7A 1Z1JA 1O35A 1VKYA 1FIZA 2I6SA 1OP2A 2H9TH 3EA9A 3IG6B 4KELA 3V12A 2VWNA 1P12E 5DK1A 3U28C 3ZVAA 3SU0A 4GUXA 2A5AA 1AI8H 4UD9H 1ABIH 2ZDMA 3U8OH 1KLJH 2IPHA 1GHXH 2C8YB 1G3BA 2ANYA 2ZFRH 1ESBA 2AIQA 1WU1A 2JETB 5FX6A 1P10A 1MKXK 6GCHG 3BIVH 1LCYA 1J16A 2XBXA 2BB4A 1JBUH 2ZTYA 2SGAA 2CK3D 1P2JA 2FODA 2FOAA 4AORA 1O2NA 2FLRH 3PLBA 2BDAA 2BQ6B 1XUFA 3EAJA 5DP4A 2NU3E 2J95A 1SVPA 1P2OA 4O9VA 2XC0A 1CHOF 1GJBB 1KXDA 2V35A 4AGJA 2O8TA 4GVUA 5A8YA 1A5GH 1CT0E 1SGIB 1V2LT 1C1WH 1O3HA 1V6DA 3SZNA 1H1BA 2K1QA 1P01A 2R9PA 5CHAB 2Z9IA 2ZGCA 2ZHDA 4YLUA 4CH2B 2BLVA 3R0FA 1S84A 1DVAH 2BY9X 1P06A 1ZLRA 1C5SA 4OS6A 3E8LA 1ZSJA 3SU4A 1DX5M 4ZKOU 1THRH 4AX9H 1THPB 4FU8A 1PPGE 1YPHC 2ZC9H 4NCYA 3QLPH 1PQ7A 1CA8B 1VITH 2VIOA 3SBKA 1E1QD 1LKBA 1SQRA 1JXPA 1AHTH 3MNCA 3BG4C 3U98H 1SGQE 2QF4A 1K1JA 1AWHB 1C9PA 1Q3XA 2BD3A 5IYTA 4TSFD 1MAYA 1BMFD 4AZ2B 4FVBA 2GT8A 1EAWA 1C1MA 1LHDH 3ZZ8A 4ZHMU 4XSKU 1LPKB 1AMHA 1PPHE 1A5IA 5HYOA 3MNXA 3IWMA 1ZMLA 2HPQH 4MNWA 1O3CA 1QJ6B 1W7GH 2BY7X 1DUAA 2J38A 4E06H 1GBTA 3RXMA 1IQJA 4XBCA 4YOJA 3SHAH 1QBNA 2BTCE 1O39A 4FU9A 4B75A 1G36A 3E6PH 1CT4E 4CHAC 3UFAA 2QC2A 5F8XA 4BAHB 2FP7B 1A5HA 1GJ5H 1WCZA 3SJKA 3EA7A 4AG2A 1YPLH 1C1TA 1TRNA 1ANEA 1GDUA 3HPTB 1O38A 2Y81A 2STBE 1TA2A 2ZQ2A 4NZLA 5A8ZA 2JJ1D 1CGJE 3NPSA 1FPCH 2F9UA 4QT8C 4KTUA 1H9LB 5JDUB 1C5RA 1T32A 2WUCA 4DT4A 2UWOA 1QJ7B 1SGDE 2O8MA 2UUFB 2VU8E 2WZQA 1SGRE 1YPJH 1BJVA 3L3TA 5JBBS 1O34A 3LIWA 1NY22 3OU0A 5C17A 3E90B 3BG8A 3TJNA 4ZHLU 1BUIA 2Y7XA 1FXYA 1BHXF 1MABB 4JYTA 4Q7ZA 4U01A 1C2HA 3FZDA 4GHQA 1SI5H 5EPYA 4ACBA 3H7OA 2KR7A 1CGIE 1LKAA 2AGGX 4Y8YA 1TOMH 3UUZA 2VWMA 2DE8A 1ELGA 3PB1E 3QO6A 1K1NA 2WSSD 4ZXYH 1D9IA 2FX6A 4MG3A 4NA9H 2AIPA 4WF8A 2ZZUH 3SUFA 5DN6D 1UHBB 2Z9KA 5EGMA 1UTKA 2ZHFH 3GY5A 1AFQB 1SLXB 2OC0A 3W95A 3LPRA 4Y7AA 4A5TS 1HDTH 1O2ZA 1O2GH 1RXPA 1DWBH 2QXGA 3VB7A 4YT6H 3KQEA 1RGQA 1V2UT 1QQ4A 4Q63A 3S7HB 1H8IH 5KECA 3QWCH 3S9CA 1TQ0B 2BDIA 2YMSC 1HJAC 2OCVB 1F5LA 5FXLA 1MH0A 3VXEH 1P3CA 4Z0KA 1TNLA 3TH2H 3TJVA 1SGCA 2QF3A 2Q1JA 1Y5BT 2VVCA 1FN6A 1AIXH 1V2VT 1NPMA 3BTME 1GVZA 4Y10E 5ABWA 1AE8H 2ZHEH 1BTZA 1O2SA 1ETSH 2F83A 4H42U 4ZUHA 1GMCF 3SU5A 1MAXA 1HXFH 3BTWE 3KCGH 2BX4A 1VCPA 4ZKSU 2A2XH 1NS3A 3PO1C 1T31A 1TGSZ 1O2JA 1W0YH 2H6MA 3STJA 3M5LA 6CHAB 4DJZB 4BXWA 1GBEA 2H9HA 2V0BA 1K2I1 2FEQH 2SGEE 4FUIA 3E3TA 3A8AA 1C2LA 4JMYA 4Y8ZA 3EDXB 1O3GA 2BDGA 1HCGA 3W94A 3TLOA 3ZV8A 2XXLA 1SGNE 2JH0D 1QGFA 3Q3XA 1YM0A 4GLYA 1P8VC 2A1DB 2LP6A 2O8WA 2ZDKA 3MU0A 3RXBA 1E37B 1O31A 2PV9B 3VGCB 1SGYE 2PFEA 2A5KA 1CHOG 3ZZCA 7KMEH 3SUEA 5GWZA 3Q3YA 1K1IA 2PGBB 3H09A 2WPKS 3ZVFA 2IJD1 4NFFA 1IQHA 3F2FA 3DT0H 3RLWH 5DP9A 2SGFE 2A5IA 1P0SH 2I6QA 3E0PB 2GMTB 2LPRA 3GY6A 3LJJA 2EY4C 1QNJA 2AFQB 1P09A 1UVPA 1BMMH 2Y5FA 1TGBA 1Z8IB 1EB1H 4I7YH 1TBZH 1W3CA 3TVJB 2XNDD 2Y80A 4K60A 3ZVDA 3P95A 1GBFA 1ZGVA 2DE9A 1GHYH 4DIHH 1GI2A 3KQ5A 4MDSA 3U1JB 5LPEA 8ESTE 2FS8A 3A83A 1AB9C 2PHBA 2A4QA 3E91A 1TNKA 1EZQA 1GBLA 4ZAEA 1CQQA 4FU7A 1QL7A 1D6WA 1VGCB 4SGAE 2PSYA 5C1YA 1ZPBA 3GCNA 4CRAA 1MKWK 3B23B 2PUXB 4IBLH 2RG3A 2ZO3H 4BAMB 3GCHC 2JJ2D 2B5TB 1CBWC 2TIOA 2WPJS 4Q2KA 2GT7A 4CRCA 2W7SA 2XBYA 1HAZB 1GJ4H 2WPHS 2ZHWH 1C1RA 5A0CA 3NRLA 4ABAA 1S85A 1VITG 3URCA 3M5OA 2OD3B 1FY3A 3RXAA 3UNQA 1WQVH 1K1MA 4O03A 1K22H 1NO9H 2V7QD 2V3HH 4JYVH 2QXIA 3G01A 4INLA 3F0PA 2QA9E 2AHME 2H2ZA 4HG6A 1IQIA 3MH4A 1EAXA 3PTNA 1ELFA 3MYWA 4ACAA 3GY8A 4RI0A 1P9SA 4Q7XA 4DOQA 5EQRA 4VGCB 1E34B 1K1PA 3V0XA 1ELBA 4WXVA 1HBTH 4X2XA 2VIDA 4ZCNA 3NWUA 4AFZA 2HGTH 3T26A 5SGAE 2Q6FA 1EPTA 1UHBA 4DG4A 1ZR0A 2ZFTA 4AFUA 1WTHD 4A1VA 1WAYB 1MQ6A 3HATH 1GHWH 3FAOA 3TGKE 1KY9A 4WXIA 1N6YA 2TGAA 4B73A 3AK5A 5BRRE 1BB0B 4AYVB 1TALA 5C1UA 1IAUA 1CGHA 5C1XA 4TWYA 4X6PA 3KYGA 1SGFA 1GI8B 4A6LA 3GDUA 2A7CA 1JMOH 2XC5A 1CO7E 1EJNA 4OGXA 2R3UA 1Y8TA 3A89A 5GIBA 5IDKA 1Z6JH 2FOGA 5EOKA 2KAIA 1O3MA 1NESE 2GZ7A 1EUFA 3EYDA 2SNVA 1C2KA 3VG8A 3M7TA 3NUMA 4INKA
chains in the Genus database with same CATH topology
1Y5AT 1YF4A 2J34A 1MTWA 1XXFA 4CREA 1DXWA 1O2MA 5E8EH 5JB9S 3M5MA 1UVTH 1YPEH 4H4FA 1GBBA 1W7XH 2OLGA 1C1QA 1Z8JB 2VWLA 1O2LA 3C1KA 2GV6A 7ESTE 1TA6A 1T8MA 3BV9B 4OS7A 3E0NB 1VZQH 4OS4A 1YCPK 4E7RG 1ANBA 1C2FA 2P8OC 1JIRA 4AFQA 2ZP0H 3QGJA 1Y3UA 1QB1A 2Z3EA 1GMCG 3A82A 1NZQH 1V2ST 1O2KA 3QTOH 4UE7H 2ZPQA 2CHAB 2C8WB 1EJMA 1OXGA 1NM6A 3GY2A 2FPZA 2Z6BD 1C9TA 5K7RA 1KDQA 5DO4H 1JOUB 1OP0A 4TWWA 2WYJA 1NT1A 1G3DA 4IMQA 2VGCC 3BTFE 1MCVA 5FCRA 2UWPA 4Y0ZE 3FP8E 3U1IB 1Z71A 1TE0A 1HGTH 2HOBA 4MNYA 1V2JT 1XVMA 4OS2A 1PYTD 4FUEA 1QA7A 1FPHH 2PLXA 2ZGXH 2M5TA 3ITIA 5DKMA 3U8TH 1GMHG 4WVPE 4HZHA 2XRCA 1T4UH 1P05A 2PKAB 3FZZA 4AB9A 5DP5A 1DOJA 3A7WA 5LGOA 3S7KB 1GJ9B 3TH3H 3F6UH 1GJCB 1HIAB 1YCPH 2C90B 3RMOH 1MU6B 1XKAC 3KHVA 2ZDVH 2O9QA 1GVLA 4X2WA 3L33A 2BLWA 2GCTB 1FONA 1W14U 2P3TB 4ZROA 1DANH 2V3OH 2QXJA 1TNHA 1SFQB 2VB0A 4RSPA 2GTBA 1DWEH 1HAYB 1SB1H 3O8DA 3D65E 4WMDA 2BOHB 2A45B 5BPEA 3QN7A 3A7YA 5AFYH 2BX3A 1YKTA 3B9FH 4AYYB 4BAQB 2ZCKP 2RA0A 1C5VA 4NGAH 4ABHA 1UO6A 3ZZAA 1IOEA 1S0RA 3A86A 1DY9A 3OTJE 2A2QH 1TRMA 2BVSH 4AG1A 1LVMA 1T4VH 2JH6D 1TPOA 1RTFB 1L0ZA 4Y7BA 2FM2A 3QZRA 2QXHA 3PYHA 2A4OA 3ZVEA 3PV4A 1GJ7B 2BY5X 2JH5D 1AE5A 1FY4A 1HAHH 1AVWA 2OXSA 2P93A 1WBGB 3TNSA 1CA0C 3UR6A 4FUJA 1Y3YA 2GP9B 1O5BB 3T28A 4ZKNU 1ORFA 4UEHH 2NWNA 8LPRA 2ZU1A 2QN5T 5E0JA 1YPGH 3TH4H 1HYLA 1SG8B 1O2VA 1GWAA 2ZFFH 1ELVA 5DG6A 1UVOA 5L2YH 3RU4D 2GCHF 1WYKA 4K1TA 2BVXH 1HJAB 1EOJA 1ZYOA 1EXFA 1BMLA 4JZDH 1ZJKA 5GJ4B 5C3NA 5JBAS 1EZUC 2BZ6H 4HGCA 3TK5A 1GI5A 3A81A 3RXLA 3ZZDA 3FANA 1CHGA 3NZIA 4ABBA 1A61H 4DY7B 4YM9A 5FBEA 1TNIA 2VVVA 3GYMA 1DDJA 3K2UA 2P59A 1MMJN 1GI1A 4F49A 1ESAA 2WV5A 1OWKA 1C1PA 1L4DA 2LNCA 3PM3A 1S0QA 4KGAA 1TPPA 2F91A 3LGUA 4A1TA 1DPOA 1TGNA 2TBSA 5ETXA 3P8NA 2ZA5A 3AASA 3M3TA 1P3EA 5T6GA 3RXSA 1J17T 5C67A 2P3FH 1HFDA 3CS0A 1HAGE 1QBOA 1SOZA 3RDZA 2FTLE 2D8WA 3MH6A 1L1GA 3V3MA 2OQ5A 3F9EA 5LPFA 1THSH 1MTUA 2WPMS 2FMJA 1B0EA 1ABJH 1JWTA 1J15A 4B2AA 4CBOA 5EG4A 2ZDAH 1ELTA 2PKAA 3AVZA 4WMEA 1ARCA 1F0TA 1UCYK 7GCHF 3BEUA 4NZQA 1O2UA 2UUKB 2ZDNA 1HIAA 3GCOA 1BRAA 2D26C 1A3EH 4D9RA 1W2KH 2AMPA 3SQEE 2F9BH 3LC5A 3UPEA 2UUYA 4TYDA 2C93B 3S9AA 3T62A 2Y5HA 4IGDA 3RU4E 1AB9B 1DWDH 1DY8A 3T2NA 3P70B 1EZSC 1GHBF 1UVUH 2AGIX 1MKXH 2G51A 1QRWA 3SV8A 1HUTH 1BIOA 3T25A 3C27B 4Y11E 1KXCA 3GCHB 2AEIH 3TGIE 3SI4H 1GGDC 1TMBH 1DSTA 4Y79A 1HAPH 3SJIA 2J9NA 1AFEH 1GI6A 3RP2A 1ZOMA 3UIRA 1SHYA 2HNTE 5FPYA 4WWYA 3UTUH 4DT7B 2Y5GA 4OGYA 2B8OH 1G32B 1U6QA 1AU8A 2CJIA 1B7XB 2OINA 1EQ9A 3BF6H 1FAKH 3ZZ7A 1T8LA 2OC8A 5EQSA 1PPCE 3BIUH 2BY8X 1VITF 1O3FA 1D3DB 1O5AB 1ANDA 4R8TB 1V2MT 1V2QT 2VWOA 1S83A 3LGYA 1IQKA 3T27A 1DSUA 3PROA 2F9VA 4Q7YA 2BDCA 2ZWLH 1OYTH 3SOSA 2BXTH 1AVGH 1ZGIA 1SL3A 3HKIB 4I8KA 3PTBA 1SOTA 3KIDU 1BDAA 1GHAF 4HTCH 2BD8A 4ISOA 2OC1A 3UOPA 4D8NA 1E36B 1G9IE 3MU5A 3SU2A 1N6XA 5FCKA 3KGPA 1L1JA 4YOGA 4X1QU 1QJ1B 1A0HB 3HK6B 2PKSB 4GHTA 1FY5A 4OS5A 2FI3E 4MNVA 2ANWA 3PWCA 1S5SA 1XUIA 3SORA 1CE5A 1O3IA 1UTOA 5F6MA 1BOQA 2GKVE 1A3BH 1C5YB 4NIVA 4RKJB 2J4IA 1ZSKA 1YPMH 3AW1A 5A09A 1XXDA 1EPTB 2JKHA 2GCHG 1E0FD 1G30B 4IN1A 1SGTA 1H9IE 1NFUA 4I8HA 4K1SA 5E0GA 3D49H 1SQTA 2XW9A 2Y7ZA 4D7GA 1VCWA 4ZXXH 1EX3A 1P2KA 4ZKRU 3BTTE 4X2VA 2A0QB 1TNJA 1MD7A 4B2CA 4X6OA 3S0NA 1PJPA 5EQQA 4X0WU 1BCUH 2VGCB 1KXAA 4YT7H 3SO3A 1P9UA 2KAIB 1UK4A 4KTCA 3A7TA 1O2OA 5EW2H 7LPRA 1K21H 2PGQB 3RXFA 5TJXA 2YOLA 2WV4A 1SGEE 5C5OA 2AS9A 1QRZA 1F2SE 1XUGA 2XBVA 1WQSA 1LPGB 3ATWA 4INHA 4E05H 3AW0A 1W10U 3KNXA 2ZPSA 3P8GA 1FAXA 4J1YA 3SNEA 4ZMAH 3RXRA 2CV3A 1QQUA 1UTJA 2R3YA 4X1RU 2OUAA 2AMDA 1GG6C 1F5RA 1GMHF 2VNTA 1O2YA 1TIOA 1V2TT 4X1SU 1AY6H 1XUHA 5H4IB 5LH8A 1PPZA 5EXLA 3ZZ5A 1V2RT 3K6YA 1GJ8B 3ESTA 2BM2A 2A32A 1C5UA 1KDQB 1SGPE 1HV7A 1EOLA 1QA0A 3L6PA 4D7FA 2V6NA 4WMFA 7GCHG 3BTHE 3Q77A 4BANB 1TRYA 2WINI 1GCDA 1SR5C 4WY3A 1A7SA 1TMTH 1QY6A 4ZHAA 4XDEA 1OWEA 1O5GH 1IHSH 2JETC 3LC3A 1BTHH 4JZ1A 4X1PU 4UFEH 1MTNC 4WH8A 3UY9A 4U2WA 1GHBG 1GL1A 1XVOA 2YNAA 1RRKA 3TIUA 1XKBC 4WJG2 5CMXH 4UONA 3SUDA 3RMLH 1QL8A 2OP9A 4IC5A 4NFEA 5J4SA 1Q2WA 1D4PB 3KN2A 1QCPA 1DM4B 4I33A 2QV1A 1O3AA 3RC4A 3I78A 2VIWA 1GMDF 4JZEH 2GZ9A 3EE0B 1GDNA 5GDSH 3LH1A 3LU9B 3MWIU 3P92A 1CA0B 1CT2E 5CHAC 3O8BA 1SSXA 5DGJA 1ZRKA 2HLCA 2F9NA 1GJAB 2ZI2H 1V2NT 2Q6GA 4X2YA 1IQEA 3FP7E 3S69A 1DS2E 2C8XB 2ZDLA 1P04A 3SQHE 3FFGA 1Z6EA 2C8ZB 2ZFPH 2SGDE 3OSYA 1O32A 1FDPA 3SI3H 3TJOA 1ZTLA 4GSOA 1C5NH 1RTLA 5DPAA 3SGBE 1BMAA 1FJSA 1TOCB 1AZZA 3URDA 2ILNA 3OY5U 1BRBE 5F8ZA 1F7ZA 4TY7A 2PTNA 2TPIZ 2FOBA 1GHAG 1NTPA 3A7VA 5JBCS 1PPFE 1ACBE 3JZ2B 4IW4E 1ZSLA 1V2WT 4IMZA 1MKWH 3PLPA 3ELAH 1UVSH 5AFZH 2XWAA 1H4WA 1C1VH 3ZZ6A 1BTPA 4FUBA 4IC6A 2EI7A 1PPBH 1QHRB 5A2MH 1LVBA 2C4FH 4NWLA 1GCTC 1IQGA 1C5PA 3M61U 1C2GA 3JZ1B 4NA7A 4ABFA 1QBVH 4M7GA 1AZ8A 1TONA 1S6HA 4LZ1H 1J9CH 1TWXB 1ETRH 1VR1H 1RJXB 1SLVB 1S81A 4JK5A 4JK6A 1GI7B 1W12U 3SV7A 1LO6A 2TRMA 3UR9A 1SLWB 5JPMH 1HJ9A 1ZHRA 1C1SA 2A4GA 4U30A 1GDQA 1G3CA 2G5VA 1GI9B 1P57B 2BMGB 1FLEE 3RXGA 1KXEA 1N8OC 3MU8A 3VB6A 4Q80A 2EA3A 4DCDA 3RC5A 1C1OA 1NRPH 1CVWH 3MFJA 3MH7A 4PROA 1ESTA 1F0SA 3NCLA 1DE7H 2FESH 3FVFB 3MU1A 3A88A 3ZYEA 3A84A 2AYWA 3PMJA 3QK1A 2XYAA 1MD8A 1ZPZA 1KLTA 4BOHA 5L6NH 1AFQC 1AUTC 1OWIA 3R3GB 1QB9A 4DIIH 3RXOA 2VIPA 2FOMB 4XOJA 3BG4B 4K1EA 1BTWA 1MZAA 2BDBA 2ASUB 2FYQA 1G2LA 1P11E 2Y6TA 3LT3A 3N7OA 2QCYA 2BY6X 4I8LA 4YZUA 2RA3A 1FZZA 3GY3A 1KLIH 1O0DH 4MPUA 1FQ3A 2NU2E 2STAE 2B0FA 4NG9H 3NXPA 1NU9A 1P2NA 5K0HA 1HAOH 4YOIA 1C4U2 2BLQA 3T5FH 4CHAB 3LGVA 1SQOA 2BXUH 1YLDA 2G52A 1OWDA 1P2MA 1A2CH 4I8JA 1EASA 2ZGHA 3RU4T 1DLEA 1NN6A 5GCHF 5T6DA 1ZTJA 1ZRBA 3OY6U 1HNEE 3KL6A 4ISHH 1UTMA 1Z8GA 1E35B 4NA8A 5HMAA 3LKWA 1SGFG 1CSOE 1ELDE 5ESBA 1DT2A 4MPWA 4F4OC 3VGCC 2ANMH 2AH4X 3NKKA 2H9EH 3VB4A 1V2PT 3ODDA 1T7CA 1GMDG 1A4WH 2IN2A 5DP7A 4NSVA 1AVXA 1O3OA 1SHHB 1GPZA 5B6OA 3SNAA 4DURA 1J8AA 3TITA 2ODYB 3ODFA 4O97A 3VFEA 2O8LA 1Y3WA 3M36A 1K9OE 1T8OA 1KSNA 3MTYA 4YESB 2R2WU 1V2KT 1W0ZU 6ESTA 2D2DA 1A0LA 1BBRK 1SMFE 2EI6A 5I46H 3SGQE 2GDEH 2A4RA 1P2IA 1C2MA 2FOFA 2CF9H 3ZV9A 2F3CE 3SU1A 2EC9H 1IHTH 2WYGA 4YLQH 3PMBB 3KQDA 1EP6A 1XMNB 3P6ZB 2PWXA 3BTKE 2ALVA 3ATKA 1HAVB 1QURH 1D3QB 2BDYA 2SGQE 3T29A 2SFAA 2Z7FE 4AB8A 1AWFH 1VGCC 2VIVA 3F9FA 1NFWA 2FXRA 3TJUA 1DFPA 2NU4E 1FV9A 1C2IA 1NROH 1TMUH 1UK3A 3AAVA 1O3NA 2ZF0H 3M3VA 4OS1A 2AGEX 1ID5H 1HAIH 1O2PA 5EXMA 1MBQA 5L30H 1UTLM 2BDHA 2HVXA 2OC7A 2GVFA 2Q6DA 2W3KA 4E7NA 2FX4A 3A8DA 3BSQA 3DA9B 4FVDA 4MPVA 4CR9A 3Q3KA 1O2XA 4JZIA 5E0HA 1W8BH 2QIQA 2A31A 3SU3A 2QAAA 3DUXH 1AD8H 1EJAA 3PO1B 1P2QA 2FIRH 2W7UA 5ESTE 2ODPA 4MQAA 3UQVA 2Z3CA 1BJUA 3K9XB 1YGCH 1NRQH 1A46H 3LGIA 3SJ9A 2NU0E 3MI4A 1LHEH 2HNTF 2ULLA 1C5TA 3FP6E 3P8FA 3RMNH 1ZZZA 4GAWA 3RUOA 4K3JA 4K2YA 5C20A 3RM0H 1GG6B 4HFPB 2W26A 1HRTH 2FO9A 5PTPA 1D3PB 5TCCA 2F9PA 2Y82A 2R0KA 1Q31A 2XCNA 2GX4A 5DP3A 1YPHE 4BTUB 1GBIA 2CF8H 1PYTC 3RXVA 4A7IB 1MTSA 4ZH8A 1HB0B 1KTSB 4IS5A 5G4BA 3RXIA 3SV6A 5E2PA 4NWKA 1OSSA 1C5LH 1YBWA 1C2DA 1OPHB 2SGPE 3SUGA 1NRSH 3UWIA 3TK6A 1DWCH 3U69H 3UOUA 1O2RA 2G00A 2THFB 4D76A 1RIWC 2ZGJA 3EA8A 4K5ZA 2PTCE 2BOKA 3BTGE 1C5XB 3GDVA 1ZJDA 1MTNB 3MNSA 3HGNA 1TYNA 2G81E 3VB5A 1AKSB 4CBNA 3SNDA 1P03A 4NIYA 1MTVA 1BMNH 2CXVA 1XUJA 3GISB 5HM9A 1E38B 2VINA 1F5KU 1OP8A 5DJ7A 2GDDA 4CRFA 2G55A 3MH5A 1C5MD 4TPIZ 2P95A 1BTYA 1DICA 4FUFA 3RLYH 3A7ZA 1NRNH 1BHXB 4ABDA 1IQMA 1CBWB 1O36A 3HKJB 2CHAC 2ZIQH 1EB2A 1MCTA 2CN0H 1BTXA 3RXJA 1O2TA 1VJAU 2FI5E 1UCYH 1O3PB 3RXCA 4ABGA 3QUMP 1RTKA 1LHCH 1LHFH 2ANKH 4FXGH 1HAXB 1DXPA 4R0IA 1UK2A 5GCHG 8GCHF 4K8YA 1B5GH 2QY0B 2VVUA 1F0UA 3SU6A 1RFNA 1O3JA 3CS7A 2B9LA 2VH6A 1H8DH 4UFGH 3LONA 1GVKB 1QL9A 2HALA 3SJ8A 1BBRE 3NK8A 1GJDB 2ZTZA 1O5DH 2W3IA 3KEEA 3ZZ9A 1QB6A 1ZMJA 5GXPA 3F9HA 1HLTH 3GCTF 4GCHF 5JYIA 3RMMH 2TGPZ 1L2EA 2Z9JA 1LQDB 4H6TA 1Y3XA 2GCTC 1HAVA 3RXUA 3HK3B 1O3EA 2WPLS 4BAKB 1K1LA 5EODA 1QFKH 2WUBA 1YP9A 3D62A 1S6FA 3DFLA