4ABDA

Fragments bound to bovine trypsin for the sampl challenge
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CATIONIC TRYPSIN
publication title The Dingo Dataset: A Comprehensive Set of Data for the Sampl Challenge.
pubmed doi rcsb
molecule tags Hydrolase
total genus 58
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2011-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4abdA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4abdA02
2HGTH 3RXVA 1GVLA 5DP6A 3RXAA 1P8VC 3ZZDA 1KXCA 3MU0A 1KIGH 1BJVA 1MBMA 1TNGA 1NU9A 1E34B 3PROA 1YKTA 3C1KA 2O8WA 1UCYK 1O2HA 3N7OA 5FBIA 4WY3A 3LC5A 2ALVA 1GHVH 5K0HA 2XW9A 4CRGA 3B8JA 1ZLRA 2QF3A 4O03A 1ETSH 1AUTC 3SU2A 1T32A 3M7UA 1ANEA 4ESTE 2QV1A 3SU1A 2HNTE 1LHFH 1PPCE 1UVUH 1E38B 4I8GA 1KLJH 2UUKB 1EOLA 2O8MA 1P2QA 1K22H 1ZHRA 1JIMA 2A4GA 2AFQB 1UVSH 1GJ9B 2WPKS 4IBLH 4X2WA 1NFXA 1O2QA 4BAQB 2HPQH 4NFFA 5EW1H 4LK4A 1GVZA 1EB2A 3UREA 5FPYA 1IQMA 1AIXH 1O5CB 1AUJA 4ZHMU 2A32A 1W2KH 1MTNB 1NZQH 4A1XA 3M7TA 3KHVA 1ZSLA 1RTLA 1BTUA 3GCTG 7KMEH 2B7DH 5AFYH 3LH3A 3T29A 4AYVB 2AYWA 4VGCB 3KEEA 1RGQA 1AKSA 5C3NA 2ZG0H 1UHBA 1ZMJA 1Y5UT 2Y80A 1FJSA 4FUIA 4JCNA 4MDSA 2ZHWH 1ANBA 4GUXA 2TRMA 4X2VA 1GDUA 3BTFE 1XMNB 2C90B 1LHDH 4TWWA 4XE4A 1TNKA 4WWYA 2V0BA 4TY7A 4ABBA 9ESTA 1S5SA 5LPRA 5FAHA 1BMAA 1WTGH 3K65B 2FI3E 3LGTA 1G36A 3TK6A 1MZAA 5C1UA 3M36A 1KDQA 1KTTB 2WPHS 1GBMA 3TK5A 1GCTC 2ODPA 3MNBA 3UNSA 2WPJS 1YPHC 1C2IA 2EC9H 4CHAC 3RMOH 1LO6A 5HMAA 1OP2A 1AE5A 2SGFE 4X8UH 3STJA 4JK5A 1EPTB 1SSXA 3U8OH 1C2JA 2FIRH 2ZGBH 2RDLA 3FZDA 1GHYH 5DP5A 1AN1E 1CA0C 1T31A 2W7UA 4CR9A 1QJ1B 1AGJA 1F5RA 3R0FA 1OPHB 3RXLA 3A88A 1XXFA 1WBGB 1ESTA 4U01A 4JZEH 3S9AA 4E7RG 4HZHA 3A80A 2BDIA 5EGMA 2BD9A 5EQRA 3TPIZ 1SOZA 1FLEE 3ZVGA 3ZZCA 2VWOA 1TX8A 1FPCH 4NA8A 1MQ5A 2BZAA 3BTDE 1WQSA 4HGCA 2BXTH 3MNSA 1BTXA 1HAHH 3MNCA 2XC4A 1KLIH 2FOGA 4MQAA 1SQOA 1EQ9A 2O9QA 3BTME 2AGEX 2F83A 1AY6H 3TLOA 3M7QA 1QURH 1NESE 2BY5X 3R3GB 3ZVCA 1LHEH 3F6UH 2J2UA 1F5LA 4B2AA 1TGCA 5LPEA 3RXKA 1MUEB 1VZQH 2C93B 2CXVA 3HATH 1WV7H 4DCDA 1NRNH 2D1JA 3ODDA 1G9IE 2XXLA 1DDJA 2ZC9H 3M5LA 1C1QA 5EODA 4AGKA 1TMTH 1AI8H 1Y8TA 1NS3A 1TE0A 5A0CA 3ZZ9A 2G4UA 4FU7A 1YPJH 1D4PB 3V7TA 5CHAB 3VXFH 2DE9A 3W94A 1GJ4H 2W3KA 1BRUP 2J95A 2RA3A 1LKAA 1TOMH 2VIDA 4YT6H 2PKSB 2Z3CA 1PJPA 4XDEA 1GMCF 1MAXA 5F03A 5A0AE 1CO7E 4ZUHA 1AVWA 4GHTA 1C5YB 1CT0E 1GJ5H 5A8ZA 4GHQA 3TVJB 1P05A 1QB6A 1TQ7B 2G5NA 1FUJA 3P6ZB 1XVMA 1SLUB 1S81A 1DXPA 3UUZA 2CV3A 4Y6DA 1AKSB 9LPRA 1GCDA 1GL1A 4OS5A 1LQDB 3ESTA 4LOYH 1P02A 2FOAA 2NWNA 2W26A 1PPFE 1DS2E 3ZV9A 2A2QH 2AGGX 5GJ4B 3T62A 2A1DB 1EATA 1T8LA 3LGUA 2BVRH 6CHAC 1ANDA 2BMGB 1S0RA 2HLCA 2WINI 2BXUH 3P17H 3G01A 3O8CA 2R9PA 1QGFA 3RMNH 1SGIB 1KDQB 2TIOA 2ZHFH 4YM9A 1SQTA 3PMJA 3L33A 3BSQA 1O3CA 1KXEA 3I29A 5JBAS 1VITH 3BIVH 1DY9A 2NU3E 2WPIS 1OXGA 1SOTA 3E90B 1MKWH 3S7KB 5IDKA 1TFXA 2IOTA 1B5GH 1WSSH 4F4OC 1GVKB 1XXDA 2P8OC 3RXDA 1Z8RA 2XBWA 3VPKA 4OS2A 3EE0B 3U9AH 1ARCA 1O2IA 1P2KA 3IWMA 1C5OH 2VIVA 1A7SA 2H2ZA 1SMFE 2Z3EA 3RM0H 3SBKA 5A09A 3A8BA 1BTYA 1VGCB 3SJIA 1T8OA 1AB9B 4OGYA 1O5EH 1ZRKA 1HFDA 5FBEA 4Y8YA 2EI8A 2J4IA 1SC8U 1LTOA 1DLEA 2G4TA 3EDXB 1TMBH 2A45B 2CHAC 3M37A 4FUDA 3A85A 4JZ1A 3KF2A 3AW1A 2GCTB 1LHGH 1NRPH 1GBKA 2R2WU 1HBTH 1YCPK 2A2XH 1F0TA 4RSPA 1D6RA 2NU1E 3GCHC 1L4DA 3UOUA 1YGCH 4BOHA 1EX3A 1P0SH 1UO6A 3GDVA 2BX3A 1O3LA 1TAWA 1HRTH 2A0QB 3LGIA 1D3DB 3GDUA 1G3EA 4YO9A 4CBNA 2BDAA 1OX1A 1W14U 5TCCA 1WOFA 4X1RU 4D7GA 2Z9GA 3M5MA 3TJOA 3KQDA 4UFGH 2R3UA 4MPUA 4CH2B 5BRRE 1SLVB 1FIZA 2R0KA 1GDNA 1RJXB 3TK9A 1EZUC 1IQKA 1C2DA 1DXWA 1PQ7A 1ELTA 4M7GA 1HJAC 1TQ0B 4D9QA 1YYY1 2FYRA 3UOPA 2VIWA 1G2LA 1GI5A 4DJZB 2O8UA 1A3EH 4CRAA 1GBJA 1RRKA 2ZFQH 3SOSA 4MNWA 2YOLA 1K2I1 1CHGA 1P9UA 4D9RA 1UTNA 2BQWB 4KP0A 1EAXA 2P16A 3ATLA 3OY5U 1FZZA 2VWLA 5A8XA 1LDTT 3ZZ6A 4SGBE 2BD5A 2P59A 1HLTH 4ZROA 3SZNA 2GDDA 3V13A 3ZVBA 4DOQA 1V2JT 2P94A 4LXBH 5FX5A 1UCYH 1UVOA 3DD2H 5ABWA 1V2MT 3GY4A 2ZCLP 4FUEA 1TX7A 4WMEA 3QUMP 4Y7BA 3M5OA 2EI6A 3RMMH 1AFQB 1PPGE 2TGDA 3RXEA 2GGVB 2ZPSA 1SGEE 3QLPH 2A7JA 1C2EA 3M3SA 1FY5A 4TY6A 3EA9A 3M35A 3NXPA 2Y7XA 5AF9H 3TU7H 3GCOA 1AFEH 4DG4A 3ITIA 4CH8B 1C2GA 2EI7A 4Y11E 1GGDB 1TALA 4ZH8A 3Q00A 1TYNA 3Q3YA 3TJNA 2ZGCA 1V2PT 4AGJA 2Z9JA 4IMZA 1IQIA 1EAWA 4I8JA 1XUFA 3T2NA 1S84A 3ZZ8A 2XC5A 1BMNH 2J92A 4GCHF 3SGAE 1O2XA 1J16A 1C1WH 1C5QA 5L2ZH 1ELDE 1SLXB 2XC0A 1WYKA 4LZ4B 1NROH 1N6YA 2IN2A 4FUCA 1DWCH 1HNEE 4KKDA 1IQGA 3LJOA 1GMHF 3FVFB 1F0SA 1LVOA 1WAYB 1P12E 1Z6JH 2FMJA 2G52A 2OUAA 3S7HB 4FXGH 2ZHEH 1C5WB 1NC6A 1D3QB 4NWKA 2RCEA 3U8TH 1CVWH 4AG2A 1QIXB 3BEIB 3ZZAA 3FZZA 1RXPA 2ZI2H 4KTUA 1L1JA 1Z7KA 2ZP0H 2QXJA 2TBSA 1H9LB 1YM0A 5DKMA 1C1NA 1ZHMA 1PPBH 1K1IA 1HAYB 2H9HA 4A92A 1C4V2 4IN1A 1AWFH 1DICA 1UK3A 2PKAB 4ZKOU 2KAIB 1CQQA 2WUBA 1GHXH 1FAXA 2ZTXA 2C8YB 1K21H 2SGEE 2ZDLA 2ZCKP 1UK4A 4DT7B 2Z3DA 2ZFSA 1A4WH 1OOKB 2P3UB 1UJ1A 1FONA 1V2OT 5L30H 4KGAA 6ESTA 2ZHQH 2EEKA 1H9IE 1JRSA 4TPYA 3MU1A 4IN2A 2PHBA 4YT7H 1O2NA 1PQAA 1J9CH 1CBWB 4JZFH 1O3JA 4NFEA 4TYDA 2HNTF 2V6NA 1TNHA 5TCAA 2ZWLH 2AMDA 5LPFA 4FUJA 4K60A 1KYNA 1QRZA 1C1OA 4DURA 3TH3H 1C5TA 1B0FA 5DP3A 4ASHA 4CREA 1FV9A 3SJOA 4Y71A 2RG3A 4JZIA 5BPEA 1ESBA 1GI1A 1SQAA 1J17T 1HJ9A 2ZU1A 1DSUA 1XM1A 3ZZBA 2GZ8A 4XBDA 4NIYA 4INHA 3TJUA 3MI4A 1QTFA 1TGBA 1A0JA 2JKHA 1QQ4A 4ABEA 3LH1A 3RLYH 1EPTA 5H4IB 1O2LA 3CP7A 2OQUA 2FLBH 2FOCA 5AHGH 5EU8A 1Z8GA 2IPHA 5C2ZA 2G51A 5GCHF 3AW0A 3DFJA 4B2CA 2VWNA 3VGCB 4MPWA 4ABHA 2BD8A 1BBRH 1AO5A 2Y5HA 1BRAA 1CGHA 2I6QA 1DWEH 1ABIH 1K1JA 3TH2H 3UIRA 5L6NH 5EPNA 5F8TA 1GG6B 1GI6A 4NSVA 5JBCS 1T7CA 3RXIA 1UTMA 5JB9S 1GJCB 1G2MA 1F92A 3DUXH 1O3HA 1HXEH 2WV5A 2GD4B 4ZMAH 1ZPZA 3A7WA 1ZJKA 1GWAA 3BG4B 2Y6TA 7LPRA 1O37A 1WQVH 1O39A 3D65E 1SBWA 2GP9B 1GHBF 1GI2A 2I6SA 2VIOA 1SGFG 1O2OA 1THSH 2WPMS 1MQ6A 4UDWH 3PMHB 2FOHA 2ZTZA 1MZDA 1PQ5A 1ZGIA 1HPGA 2Y81A 1O5BB 1ORFA 2ANWA 1GBDA 4B1TA 1UCYE 1FY1A 3NWUA 1MTNC 8GCHF 2GV7A 4O97A 1XX9A 1IHTH 2YNBA 3Q77A 1QA7A 3FP8E 3SNBA 1NFYA 2GT7A 2HPPH 4UFEH 5HGGA 3ZVAA 4VGCC 1MMJN 2Y7ZA 2XWBI 2FS9A 3MH5A 1CE5A 4ABFA 2W5EA 3RXFA 2FPZA 2F3CE 1DLKB 1Y3UA 4FU8A 2GDEH 1NTPA 3M3TA 4YOJA 2BLVA 3TGIE 1XKAC 4X8VH 1G32B 3H5CB 4IW4E 2ULLA 3MYWA 4F49A 5GDSH 3GYMA 4U2WA 2CF9H 4I8LA 1C2KA 4A5TS 1DANH 3P92A 1EZXC 4CBOA 5TJXA 2GZ7A 2LNCA 4JYVH 3RU4D 3LOXA 3E1XB 2SGQE 4AB9A 1O3KA 1ZHPA 4AFQA 2B0FA 3LDXH 1MU6B 2A5IA 1A3BH 4OS7A 4GAWA 1EAUA 4A7IB 2XBVA 3FP7E 4X6MA 2R0LA 1GJAB 5EXMA 1A5HA 1XUHA 2PLXA 4JMYA 4CRCA 1GMCG 3QZQA 1TRNA 1Y3XA 2BVXH 2H9EH 2P3TB 2UWLA 3GDSA 1LVMA 4KELA 1ESAA 3VEQB 1HAGE 1GBTA 1NRSH 5EOKA 2V35A 2UUJB 3QGNB 1DPOA 1W8BH 3UFAA 1A1RA 3V3MA 3Q3KA 4UE7H 1QFKH 1S0QA 2GT8A 1QB1A 2QXGA 1TWXB 1G3BA 4WJG2 1SGTA 1C1VH 5ETXA 5GWZA 3A82A 1A5GH 1BHXB 2NU0E 5C1XA 3VXEH 3HKIB 1EASA 4O9VA 3PM3A 4B73A 2JETB 3A86A 1SGDE 5FCRA 3M61U 3UR9A 4KTSA 1GI3A 4Q7ZA 2J9NA 4BXSA 2BDHA 1GDQA 1IQNA 1OYQA 4IC5A 2PV9B 1TPOA 1P2NA 4MNVA 2FWWA 4UFFH 2PW8H 1TA6A 2ZPRA 3URDA 1C2FA 1KY9A 3SV7A 3U8RH 5I25A 1V2UT 1YLDA 4Y79A 1AD8H 5K7RA 1P01A 1BJUA 2F9UA 4UD9H 3RXPA 1QBNA 2CJIA 4JYUH 3F1SB 6LPRA 3SI4H 3BIUH 1EAIA 5EQQA 3MU8A 2Z9LA 1SL3A 2OC7A 1LHCH 3JZ2B 3U1IB 1DITH 2OC0A 2DE8A 1B7XB 2PKSC 3OYPA 3PLKA 1OWKA 3EQ0H 5I46H 3SU3A 1MKXK 3MU5A 1C1SA 2GX4A 4FUHA 4I31A 1ELAA 4AYYB 5T6DA 1GBIA 4NA9H 2XCNA 1SR5C 1O5DH 2B9LA 4DGJA 3GYLB 4Q80A 1W3CA 3P8OA 1KSNA 1V2VT 5E0GA 3RXJA 2GKVE 2BDGA 3SNAA 1O2KA 2OC1A 1O3FA 4D7FA 3GY7A 1O2VA 3NZIA 4OGXA 1H9HE 1SGCA 3CENA 1O2PA 1C2LA 1ZMLA 1BBRE 2FYQA 4ABAA 4E7NA 1V6DA 4I8KA 1O38A 2BB4A 1L0ZA 4MVNA 1TGSZ 2PWXA 3URCA 1PPZA 3BEFB 1GBAA 4MTBA 4I7YH 2TGTA 4ZHAA 2AH4X 3ZZ3A 5LGOA 1UMAH 2BLQA 3HKJB 4AX9H 1TBQH 2ZDVH 3SNEA 2ZFTA 8KME2 1TRMA 4X6OA 1GJ8B 1GJ6A 3ZYDA 3ELAH 1ZTKA 1YBWA 1F2SE 2VVUA 3UTUH 1NT1A 1P11E 4Y0ZE 1GBCA 1BOQA 2ODQA 2WV4A 1D3PB 2SNVA 2CF8H 1W13U 3NPSA 3LONA 4UEHH 2FEQH 1AWHB 4X2YA 5T3HA 1VGCC 3P8NA 1TX6A 4MPVA 4WF8A 1P06A 1GBLA 1AB9C 2Y5FA 1O2TA 2A5AA 1P2JA 2ZF0H 4INKA 5DGJA 2QC2A 3E16B 4MNXA 2HNTC 3AAUA 1O2UA 1O31A 3T5FH 2GCTC 3BN9A 3CS0A 4DIIH 3RXBA 5E2PA 3E6PH 1MTWA 1GI4A 2LPRA 1Z71A 5E0HA 3A8DA 3MH7A 3UY9A 1MTUA 2UUYA 3K6ZA 2C4FH 4B75A 2FTMA 2AIQA 4ABGA 4KTCA 5GXPA 1K1OA 2ZPQA 1C1RA 1BTWA 3GY8A 3MHWU 5A0BA 2GMTB 1Z1IA 1QJ7B 2PGQB 4Y10E 3SQHE 1D3TB 4RN6A 4BXWA 1LMWB 1ZOMA 3RDZA 1PFXC 2OBOA 4GCHG 1W0ZU 3SV6A 1WTHD 1HXFH 2VU8E 1E36B 1LPZB 1C2HA 7GCHF 1GI9B 1ZTJA 2PKAA 2V3OH 2KAIA 2GCHF 2QY0B 3GY5A 1J15A 2J38A 3PWCA 1AQ7A 1LPGB 4XFQA 2OP9A 3PYHA 4ISIH 4AORA 1O3NA 1GMHG 1TMUH 2VJ1A 1C5MD 1ETTH 1BA8B 4X8SH 3F9EA 3O8BA 2FOEA 4WXIA 2XCFA 4ZHLU 1DWDH 1O3EA 2PUQH 1BHXF 4NIWA 1V2LT 1P57B 2BTCE 1HAVA 3K6YA 3RXHA 2FX4A 2QGRA 2R2MB 1DSTA 2ZA5A 4UFDH 3ATMA 3U1JB 3A81A 1AFQC 1C9PA 3ZZ7A 3MMGA 1TGTA 1O3GA 2PUXB 1RTFB 3C27B 4Y8XA 1NM6A 4ISLA 3I78A 2QN5T 1G3CA 1C5NH 1TGNA 5CE1A 5E0JA 1GHZA 1E37B 3FAOA 1WUNH 3UNQA 1VITF 1THRH 1SHYA 3UQVA 1O3PB 2O8LA 1GGDC 1EJMA 1HYLA 2AGIX 2ZNKH 3UR6A 2FTLE 1EP5A 4WH8A 3GCNA 4HFPB 3PO1B 4O3UA 3ZZ4A 3KGPA 2UWPA 3SNDA 3TGKE 4AN7A 1O3AA 1XUJA 2A7HA 5SGAE 1QL9A 1FY4A 3SNCA 3MNXA 1QQUA 2BQ7B 2CGAA 2BD3A 2WYJA 3UWIA 3BTGE 2AMQA 1RS0A 1O2ZA 1YPGH 3A7ZA 1QY6A 2ZFFH 2WYGA 3ODFA 1KTSB 1O3IA 4INLA 3UQOA 3ATIA 4OS4A 2VGCB 1QNJA 5FXLA 3LGVA 1O2SA 1TIOA 2V3HH 2AMPA 1JBUH 2Z7FE 3ZYEA 5DG6A 2BHGA 1HV7A 1W12U 1ELCA 3PMAB 1LPKB 2SGAA 4GVUA 1QCPA 5GCHG 4QT8C 1OWIA 2NU2E 2CN0H 3V0XA 3RXRA 2FX6A 1V2RT 1AHTH 1S85A 4YLUA 1Y3VA 1K9OE 1Y5AT 1EKBB 2XRCA 1XUGA 1HUTH 2ZGJA 1GPZA 3QO6A 4X1PU 1TNJA 1FY8E 2QA9E 1H8IH 3EAJA 1JXPA 3RMLH 1DUEA 4GSOA 1O3BA 1O33A 1BTZA 3MWIU 1NFUA 1CBWC 1O2MA 2OCVB 3VB7A 1MAYA 5C67A 2NU4E 1GI7B 2YNAA 4DY7B 4CRBA 1FMGA 1TBZH 1GHBG 2C8XB 1YPHE 2PGBB 3A83A 1N6XA 2PFEA 1S6HA 3HPTB 2A4RA 4SGAE 1HAVB 3VB5A 1XVOA 3MO6A 4FUGA 2GTBA 4U32A 1KXDA 1LKBA 8GCHG 2DUCA 3K2UA 3MOCA 3D49H 1VCQA 1W0YH 1MKWK 3SGQE 1C9TA 4MLFB 3LPRA 3LT3A 1VJAU 4E06H 2F9PA 1A61H 1OP0A 1BRCE 3RC5A 3JZ1B 4O3TA 4TPIZ 3PLBA 3T25A 1CHOF 1N8OB 1PPHE 3SJ8A 1N1LA 4XBBA 1NN6A 3RC6A 4BAHB 1O5AB 2BOHB 1SB1H 1ACBE 4ZXXH 3BTWE 2XTTB 1V2ST 3QZRA 2FOFA 1XUIA 3TJVA 1T8MA 5JB8S 3RXGA 3E0NB 1ZMNA 3RXCA 2FS8A 1JRTA 4R0IA 4CRDA 2H6MA 3Q76A 1CU1A 1NRRH 1VJ9U 2BDBA 4RKJB 1GG6C 1S82A 1TPSA 1P2MA 5E2OA 3U69H 1TPPA 1GBBA 1SG8B 3GY2A 1O32A 5B6OA 1G3DA 3LIWA 1JIRA 1FQ3A 2BY9X 1GJDB 2BVSH 2Q1JA 3SUGA 4FVDA 2ZTYA 1O5GH 4Z0KA 3A7YA 4LZ1H 3BG4C 2JH6D 2BY7X 2F9BH 1TBRH 4A1VA 3DFLA 3MO3A 1TLDA 1GBFA 3ATWA 2BD7A 2ZDAH 3BTTE 5AVDA 3PB1E 1RIWB 1P10A 5L2YH 2VWMA 4J1YA 5C5NA 4UONA 1PQ8A 3T26A 2QIQA 5EXLA 1Y3WA 1IQHA 1AVGH 2GV6A 2WUCA 3BF6H 1GMDF 3KQCA 3KCGH 1DVAH 5DP8A 2PTCE 2FO9A 4YOIA 4K1TA 2BD4A 4ZAEA 2K1QA 2OC8A 1ZSKA 4WMFA 1CGJE 2Z6BD 1Z6EA 2ZEBA 4YOGA 1AE8H 1L2EA 2FLRH 1SHHB 2OD3B 4I8HA 2QYIA 3A87A 5EPYA 2ILNA 2VIPA 2Z94A 3IITA 3QN7A 4AFZA 3RC4A 1UVPA 4JK6A 1W7XH 3SV8A 4XBCA 2ZGHA 4GPGA 1W11U 2A4QA 1P2OA 1OP8A 1O0DH 2F91A 5F8ZA 1NRQH 1ZZZA 1OWHA 1W10U 1ARBA 1Q31A 1D9IA 1TPAE 4AFSA 2Y82A 2PSYA 4AOQA 3BV9B 2BM2A 1NPMA 1UVTH 2B8OH 3ZVDA 1SGNE 3TNSA 3VB4A 4FUFA 5C20A 2ZQ2A 4NSYA 1O2WA 1OYTH 2XYAA 2Z9IA 3DA9B 1P09A 1V2NT 2VB0A 1NY22 1SGRE 4YESB 3TGJE 1E0FD 2TGAA 5DJ7A 4X8TH 1MCTA 1OS8A 1IQFA 2BLWA 2UWOA 4PROA 1C1UH 1ANCA 1BTHH 1ELFA 1SVPA 1BRBE 3O8DA 4K1EA 3P70B 2XNIA 1XKBC 1YCPH 1MH0A 1TNIA 3UPEA 1GHAF 3AASA 3Q3XA 1IQJA 4NWLA 4THNH 1H1BA 3S0NA 1HGTH 2FI5E 1EJAA 2J34A 1EPTC 1BB0B 4ZKSU 1NFWA 1PPEE 3AVZA 1ELBA 4Y7AA 3RXUA 1QB9A 3H7OA 3GY6A 2GZ9A 3KL6A 4BAMB 2B5TB 4K3JA 3L3TA 3RU4E 1SFQB 2JETC 2SFAA 1O5FH 3M3VA 3A8CA 3SORA 1SGQE 3O8RA 3NK8A 2AS9A 1HJ8A 1MD7A 1CSOE 3PWBA 3P8GA 6GCHF 4OS6A 1KXBA 4R8TB 1T4UH 1EZQA 2ZCHP 1HIAB 2QXHA 1IHSH 3I77A 1C5SA 3UNRA 1MTSA 2Q6GA 1ABJH 2C8ZB 5DP4A 1DE7H 1L1GA 1PYTC 4B71A 1Y59T 1LQEA 1J14A 1FAKH 2G55A 1P04A 2FXRA 1GI8B 3RUOA 3TIUA 1EZSC 4NIXA 4IMQA 1ELEE 2ZU3A 1GCTB 1O2JA 4BANB 1ZSJA 1A0HB 2W3IA 3SJ9A 1GI0A 4CHAB 1HAIH 2Z9KA 4X1SU 3SU5A 5HM2A 2VH0A 2ALPA 2BLOA 2ZFPH 4FU9A 1A46H 3U98H 4H6TA 3PMBB 5CHAC 1VR1H 2ZQ1A 1CA0B 1ZJDA 4BNRA 4Q2KA 2F9VA 1FDPA 3FANA 1IAUA 4B74A 1HB0B 4BTTB 1BITA 5FPTA 4H6SB 4Z6AH 3QTOH 1S83A 4B76A 1O34A 3SU4A 1FN8A 1P3EA 2A5KA 2P3FH 2AEIH 3KNXA 4CRFA 1P9SA 4FVBA 4WVPE 1UTOA 1O3MA 1FY3A 3ZV8A 4DIHH 1H4WA 1DM4B 1LVBA 1YLCA 2HRVA 3BTEE 2BX4A 3GCTF 1K1PA 4IGDA 1OWDA 1YF4A 3SUEA 4NZQA 2FP7B 5C1YA 2G81E 7GCHG 3MTYA 1V2QT 2GCHG 8LPRA 1JMOH 1C5UA 2H5CA 1O35A 4Y76A 3SU6A 3HK6B 1QA0A 1EOJA 1NU7B 3NKKA 1BQYA 3F9FA 3MH4A 1MCVA 2P95A 1AVXA 1OWJA 1FIWA 1W7GH 1TNLA 4NGAH 4E05H 1SFIA 3AAVA 3GICB 1AMHA 3SO3A 3RLWH 1LVYA 1BUIA 1BBRK 3B9FH 1G37A 4NCYA 3LGYA 1G30B 1D6WA 4NIVA 3BTQE 2D8WA 4ABJA 5DO4H 3LC3A 1KLTA 1O2RA 1UTLM 2THFB 3W95A 2FOMB 5LH8A 1QBVH 1O3DA 3VB3A 5EW2H 1DUAA 3MU4A 1UHBB 1OSSA 1P03A 3SI3H 2BY6X 5HM9A 1IQEA 4JYTA 5PTPA 1O2YA 4YLQH 1T4VH 2D2DA 1UTKA 3L6PA 4NZLA 1QBOA 1HAXB 4HTCH 1X7AC 2STAE 3B23B 4BAOB 1FNIA 1VITG 2ZFRH 4Q7XA 3KIDU 1DT2A 3A7XA 2GMTC 2TGPZ 5GPIB 3MFJA 1THPB 1GJ7B 1AZZA 2WPLS 1QRWA 2H5DA 2QCYA 3RU4T 2D26C 2RA0A 4H4FA 4AZ2B 1TABE 3ATKA 6CHAB 4ISHH 5JDUB 1UTJA 2OQ5A 2ZU2A 3LU9B 1CT4E 2HWLB 1Y5BT 1YC0A 3PTBA 2FOBA 1AU8A 3SV2H 1S6FA 2OXSA 1KXAA 3A84A 2QXIA 5FHTA 2VH6A 4ABDA 3BEUA 1ZTLA 1BZXE 3H7TA 5GIBA 1TA2A 3QDZB 1C5VA 1C5LH 4B2BA 2OINA 2ZHDA 1AZ8A 3EA8A 2G00A 3K9XB 2P8OB 1SLWB 2HVXA 1GL0E 1EJNA 1HDTH 1YP9A 1LCYA 2AERH 2H1UA 3FP6E 4Y8ZA 3SU0A 2ZZUH 3OY6U 3EGKH 1WCZA 5A8YA 1RFNA 3GOVB 3FFGA 4D8NA 4I33A 5JBTA 2R3YA 1O3OA 3OTJE 1HAZB 2FDAA 1QRXA 5FPSA 3DHKH 1YPEH 1MU8B 2BD2A 3T27A 1QL7A 3V12A 2QAAA 3ENSB 2CHAB 4WXVA 4YTAA 1EP6A 3VFEA 1YPKH 3E3TA 2ESTE 2A7CA 1J8AA 1C4Y2 1GBHA 4IS5A 1NO9H 2VINA 3MH6A 1F0RA 1QL8A 1T8NA 3GCHB 3RM2H 1INCA 1Y3YA 4K1SA 5EG4A 1Q3XA 1FN6A 3P8FA 1M9UA 3F9HA 3PO1C 2ASUB 3QK1A 1SGFA 3ZZ5A 4RKOB 3RXTA 1A2CH 7ESTE 2PTNA 3A7TA 3E8LA 5JBBS 1FPHH 2BZ6H 2FZZA 1Q2WA 4XSKU 2JH5D 1ELGA 3BTHE 4FUBA 1O2GH 5HYOA 1KXFA 4ZXYH 1F7ZA 2F9OA 1U6QA 3NUMA 2ANYA 1O30A 2SNWA 1HJAB 1TRYA 1K1NA 1V2TT 1ZR0A 1IOEA 5C5OA 3RXMA 2ODYB 1BMMH 4AFUA 1SPJA 1JOUB 3QTVH 1O36A 3S69A 4JZDH 3MO9A 1ZPBA 4A6LA 5ESBA 4AG1A 3EYDA 1MTVA 2Q6DA 3GISB 3SHCH 1XUKA 1YCPM 3QWCH 3RXOA 3ZVFA 1UK2A 2VGCC 3QX5H 1E35B 3KQEA 3NCLA 2FM2A 1ZGVA 2O8TA 2XWAA 5DK1A 1EUFA 1FI8A 1CHOG 3S9CA 2C3SA 2ZKSA 2ZDNA 2FESH 3F68H 1C1PA 4NA7A 2JH0D 3TITA 1DOJA 4BAKB 2BQ6B 1BMLA 3P95A 1HCGA 5G4BA 3SN8A 1UTPA 5JYIA 2ANKH 3S9BA 1MBQA 2BYAX 4D76A 5FCKA 1SGPE 2UUFB 3TH4H 3T28A 1C5ZB 1DX5M 1L1NA 2J94A 1GHWH 2BDYA 1K28D 1C5RA 2FI4E 1P3CA 1HAOH 3PLPA 2W7SA 1OKXA 1Z1JA 4YZUA 2TPIZ 2OTVA 1UTQA 1BIOA 3RXQA 5T6GA 1VCWA 2ANMH 5F6MA 2EA3A 2VVVA 1JWTA 3KQBA 1DY8A 8ESTE 2IJOB 5E8EH 2QF0A 5IYTA 3TNTA 1C1MA 2ZIQH 4Q7YA 1C5XB 3D62A 4X1NU 1K1LA 3SV9A 4DW2U 3SGBE 1QJ6B 1BDAA 1RTKA 1ETRH 4X6NA 1HAPH 4CR5A 2G8TA 1ID5H 4MPXA 5DP7A 1GMDG 1L4ZA 1ZRBA 1QHRB 2OLGA 4MNYA 4NG9H 2PR3A 3STIA 4K5ZA 5JPMH 4K2YA 2P93A 2Y5GA 1Z8IB 3RP2A 2BDCA 5CMXH 1EB1H 2M5TA 2ZGXH 4WH6A 1PYTD 2A4OA 1C1TA 1N8OC 4WMDA 1TOCB 3HGNA 5DPAA 4DVAU 4ZKRU 1V2KT 1V3XA 3SQEE 2VIQA 4H42U 4X0WU 4BTIB 1CGIE 1P2IA 1CT2E 1BCUH 2STBE 2VVCA 2Q6FA 4I32A 4MG3A 1EXFA 3LGWA 4AB8A 3OU0A 1BTPA 4K8YA 1A5IA 4A1TA 3A89A 3CS7A 5F8XA 1ZYOA 4HI3A 1CA8B 4OS1A 3HGPA 1FXYA 2ZU5A 1Z8JB 4ABIA 3A8AA 2ZU4A 3A7VA 5T6FA 3PTNA 1YPMH 1F0UA 5A2MH 2HOBA 3VGCC 3SHAH 1BT7A 5DP9A 3PV4A 5EQSA 2SGDE 4X6PA 5J4SA 1RD3B 3HK3B 3BTKE 4IC6A 3SUFA 1YPLH 1TONA 1MKXH 1OWEA 2OBQA 2AIPA 3BG8A 2XBXA 2CMYA 1DWBH 2BOKA 1GBEA 1B0EA 1RIWC 4ISOA 4ISNA 4J2YB 1QR3E 1GJBB 5ESTE 4Y0YE 1GHAG 3VB6A 2ZO3H 4BTUB 1IQLA 2G5VA 1HIAA 5AFZH 3EA7A 3SJKA 3SW2B 5EXNA 2HALA 1A0LA 4X2XA 3IG6B 3OX7U 3WY8A 2ZECA 3E91A 4GLYA 1C2MA 4K8BA 1C5PA 2A31A 3KN2A 1ELVA 3SUDA 1SI5H 3D23A 1SGYE 5J4QA 2ZDMA 1F5KU 1VCPA 2C8WB 3LJJA 3OSYA 2FODA 4U30A 1DFPA 5FX6A 3LKWA 1ZPCA 4X1QU 3M5NA 1WU1A 4XOJA 2PSXA 1C4U2 3ZVEA 6GCHG 5HXFA 2VNTA 3GY3A 3RXSA 1TB6H 3F9GA 3E0PB 3QGJA 4TWYA 4ZKNU 1K1MA 2GVFA 1V2WT 2SGPE 2XBYA 3UWJH 2H9TH 4K69A 2BY8X 2ZDKA 1H8DH 2F9NA 1MD8A 3DT0H
chains in the Genus database with same CATH superfamily
2HGTH 3RXVA 1GVLA 5DP6A 3RXAA 1P8VC 1E1RD 3ZZDA 1KXCA 3MU0A 1KIGH 1BJVA 1VKYA 1MBMA 1TNGA 1NU9A 1E34B 3PROA 1YKTA 3C1KA 2O8WA 1UCYK 1O2HA 3N7OA 5FBIA 4WY3A 3LC5A 2ALVA 1NBME 1GHVH 5K0HA 2XW9A 4CRGA 3B8JA 1ZLRA 2QF3A 4O03A 1ETSH 1AUTC 3SU2A 1T32A 3M7UA 1ANEA 4ESTE 2QV1A 3SU1A 2HNTE 1LHFH 1PPCE 1UVUH 1E38B 4I8GA 1KLJH 2UUKB 1EOLA 2O8MA 1P2QA 1K22H 1ZHRA 1JIMA 2A4GA 2AFQB 1UVSH 1GJ9B 2WPKS 4IBLH 4X2WA 1NFXA 1O2QA 4BAQB 2HPQH 4NFFA 5EW1H 4LK4A 1GVZA 1EB2A 3UREA 5FPYA 1IQMA 1AIXH 1O5CB 1AUJA 4ZHMU 2A32A 1W2KH 1MTNB 1NZQH 4A1XA 3M7TA 3KHVA 1ZSLA 1RTLA 1BTUA 3GCTG 7KMEH 2B7DH 1WDIA 5AFYH 3LH3A 3T29A 4AYVB 2AYWA 4VGCB 3KEEA 1RGQA 1AKSA 5C3NA 2ZG0H 1UHBA 5B6LA 1ZMJA 1Y5UT 2Y80A 1FJSA 4FUIA 4JCNA 4MDSA 2ZHWH 1ANBA 4GUXA 2TRMA 4X2VA 1GDUA 3BTFE 1XMNB 2C90B 1LHDH 4TWWA 4XE4A 1TNKA 4WWYA 2V0BA 4TY7A 4ABBA 9ESTA 1S5SA 5T1VA 5LPRA 5FAHA 1BMAA 1SKYE 1WTGH 3K65B 2FI3E 3LGTA 1G36A 3TK6A 1MZAA 5C1UA 3M36A 1KDQA 1KTTB 2WSSD 2WV9A 2EY4C 2WPHS 1GBMA 3TK5A 1GCTC 2ODPA 3MNBA 3UNSA 2WPJS 1YPHC 1C2IA 2EC9H 4CHAC 3RMOH 1LO6A 5HMAA 1OP2A 1AE5A 2SGFE 4X8UH 3STJA 4JK5A 1EPTB 1SSXA 3U8OH 1C2JA 2FIRH 2ZGBH 2RDLA 3FZDA 1GHYH 5DP5A 1AN1E 1CA0C 1T31A 2W7UA 4CR9A 1QJ1B 1AGJA 1F5RA 3R0FA 1OPHB 3RXLA 3A88A 1XXFA 1WBGB 1ESTA 4U01A 2IPQX 4JZEH 3S9AA 4E7RG 4HZHA 3A80A 2BDIA 5EGMA 2BD9A 5EQRA 3TPIZ 1SOZA 1FLEE 3ZVGA 3ZZCA 2VWOA 1TX8A 1FPCH 4NA8A 1MQ5A 2BZAA 3BTDE 1WQSA 4HGCA 2BXTH 3MNSA 1BTXA 1HAHH 3MNCA 2XC4A 1KLIH 2FOGA 4MQAA 1SQOA 1EQ9A 2O9QA 3BTME 2AGEX 2F83A 1AY6H 3TLOA 3M7QA 1QURH 1NESE 2BY5X 3R3GB 3ZVCA 1LHEH 3F6UH 2J2UA 1F5LA 4Q63A 4B2AA 1TGCA 5LPEA 3RXKA 1MUEB 2YMSB 1VZQH 2C93B 2CXVA 2IJD1 3HATH 1WV7H 4DCDA 5C0UA 1NRNH 2D1JA 3ODDA 1G9IE 2XXLA 1DDJA 2ZC9H 3M5LA 1C1QA 5EODA 3KYFA 4AGKA 1TMTH 2KX4A 1AI8H 1Y8TA 1NS3A 1TE0A 5A0CA 3ZZ9A 2G4UA 4FU7A 1YPJH 1D4PB 3V7TA 5CHAB 5HIYA 3VXFH 2DE9A 3W94A 1GJ4H 2JJ2D 2W3KA 1BRUP 2J95A 2RA3A 1LKAA 1TOMH 2VIDA 4YT6H 2PKSB 2Z3CA 1PJPA 4XDEA 1GMCF 1MAXA 5F03A 5A0AE 1CO7E 4ZUHA 1AVWA 4GHTA 1C5YB 1CT0E 1GJ5H 5KGOA 5A8ZA 4GHQA 3TVJB 1P05A 1QB6A 1TQ7B 2G5NA 1FUJA 3P6ZB 1XVMA 1SLUB 1S81A 3OFND 1DXPA 2QF4A 3UUZA 2CV3A 4Y6DA 1AKSB 3FO8D 1GCDA 9LPRA 1GL1A 4OS5A 1LQDB 3ESTA 4LOYH 1P02A 2FOAA 2NWNA 2W26A 1PPFE 1DS2E 3ZV9A 2A2QH 2AGGX 5GJ4B 3T62A 2A1DB 1EATA 1T8LA 3LGUA 2BVRH 6CHAC 1ANDA 2BMGB 1S0RA 2HLCA 2WINI 2BXUH 2WZQA 3P17H 3G01A 3UAIC 3O8CA 2R9PA 1QGFA 3RMNH 1SGIB 1KDQB 2TIOA 2ZHFH 4YM9A 3KQ5A 1SQTA 3PMJA 3L33A 4XD7D 1KMHB 3BSQA 2J97A 1O3CA 1KXEA 3I29A 5JBAS 1VITH 3BIVH 1DY9A 2NU3E 2WPIS 1OXGA 1SOTA 3E90B 1MKWH 3S7KB 5IDKA 1TFXA 2IOTA 1B5GH 1WSSH 4F4OC 1GVKB 1XXDA 2P8OC 3RXDA 1Z8RA 2XBWA 3VPKA 4OS2A 3EE0B 3U9AH 1ARCA 1O2IA 1P2KA 2VBCA 3IWMA 1C5OH 2VIVA 1A7SA 2H2ZA 1SMFE 2Z3EA 3RM0H 3SBKA 5A09A 3A8BA 1BTYA 1VGCB 3SJIA 1T8OA 1AB9B 4OGYA 1O5EH 1ZRKA 1HFDA 5FBEA 4Y8YA 2EI8A 2J4IA 1SC8U 5CDFE 1LTOA 1DLEA 2G4TA 3EDXB 1TMBH 2A45B 2CHAC 3M37A 4FUDA 3A85A 4JZ1A 3KF2A 3AW1A 2GCTB 4ACBA 1LHGH 1NRPH 1GBKA 2R2WU 1HBTH 1YCPK 2A2XH 1F0TA 4RSPA 4YXWD 1D6RA 2NU1E 3GCHC 1L4DA 3UOUA 1YGCH 4BOHA 1EX3A 2KCPA 3EE7A 1P0SH 1UO6A 3GDVA 2BX3A 1O3LA 1TAWA 2XNDD 1HRTH 2A0QB 1H8HD 3LGIA 1D3DB 3GDUA 1G3EA 4YO9A 4CBNA 2BDAA 1OX1A 1W14U 5TCCA 1WOFA 4X1RU 4D7GA 2Z9GA 3M5MA 3TJOA 2AHME 3KQDA 4UFGH 2R3UA 4MPUA 4CH2B 5BRRE 1SLVB 1FIZA 2R0KA 1GDNA 1RJXB 3TK9A 1EZUC 1IQKA 1C2DA 2HVYB 1DXWA 1PQ7A 2KCAA 1ELTA 4M7GA 1HJAC 1TQ0B 4D9QA 1YYY1 2FYRA 2QE7D 3UOPA 2VIWA 1G2LA 1GI5A 4DJZB 2O8UA 1A3EH 4ZCNA 4CRAA 1GBJA 1RRKA 2ZFQH 3SOSA 4MNWA 3WW7A 2YOLA 1K2I1 1CHGA 1P9UA 4D9RA 1UTNA 2BQWB 4KP0A 3W1EA 1EAXA 5C17A 2P16A 3ATLA 3OY5U 1FZZA 2VWLA 5A8XA 1LDTT 2JJ1D 3ZZ6A 4SGBE 2BD5A 2P59A 4M9FA 1HLTH 4ZROA 3SZNA 2GDDA 3V13A 3ZVBA 4DOQA 1V2JT 2P94A 4LXBH 5FX5A 1UCYH 1UVOA 3DD2H 5ABWA 1V2MT 3GY4A 2ZCLP 4FUEA 1TX7A 4WMEA 3QUMP 4Y7BA 3M5OA 2EI6A 3RMMH 1AFQB 1BMFD 5EJLA 1PPGE 2TGDA 3RXEA 2GGVB 2ZPSA 1SGEE 3QLPH 2A7JA 1C2EA 3M3SA 1FY5A 4TY6A 3EA9A 3M35A 3NXPA 2Y7XA 5AF9H 4F55A 3TU7H 3GCOA 3PV5A 1AFEH 4DG4A 3ITIA 4CH8B 1C2GA 2EI7A 4Y11E 1GGDB 1TALA 4ZH8A 3Q00A 1TYNA 3Q3YA 3TJNA 2ZGCA 1V2PT 4AGJA 2Z9JA 4IMZA 1IQIA 1EAWA 4I8JA 1XUFA 3T2NA 1S84A 3ZZ8A 2XC5A 1BMNH 2J92A 2XOKD 4GCHF 3SGAE 1O2XA 1J16A 1C1WH 1C5QA 5L2ZH 1ELDE 1SLXB 2XC0A 1WYKA 4LZ4B 1NROH 1N6YA 2IN2A 4FUCA 1DWCH 1HNEE 4KKDA 1IQGA 3LJOA 1GMHF 3FVFB 1F0SA 1LVOA 1WAYB 1P12E 1Z6JH 2FMJA 2G52A 2OUAA 3S7HB 4FXGH 2ZHEH 1C5WB 1NC6A 1D3QB 4NWKA 2RCEA 3U8TH 1CVWH 4AG2A 1QIXB 3BEIB 3ZZAA 3FZZA 1RXPA 2ZI2H 4KTUA 1L1JA 5EJ1A 1Z7KA 2ZP0H 2QXJA 2TBSA 1H9LB 1YM0A 5DKMA 1C1NA 1ZHMA 1PPBH 1K1IA 1HAYB 2H9HA 4A92A 1C4V2 4IN1A 1AWFH 1DICA 1UK3A 2PKAB 4ZKOU 2KAIB 1CQQA 2WUBA 1GHXH 1FAXA 2ZTXA 2C8YB 1K21H 2SGEE 2ZDLA 2ZCKP 1UK4A 4DT7B 2Z3DA 2ZFSA 1A4WH 2F43B 1OOKB 2P3UB 4AC9A 1UJ1A 1FONA 1V2OT 5L30H 4KGAA 6ESTA 2ZHQH 2EEKA 3F0PA 1H9IE 1H8ED 1JRSA 4TPYA 3MU1A 4IN2A 4FETA 2PHBA 4YT7H 1O2NA 1PQAA 1J9CH 1CBWB 4JZFH 1O3JA 4NFEA 4TYDA 2HNTF 2V6NA 1TNHA 5TCAA 2ZWLH 2AMDA 5LPFA 4FUJA 4K60A 1KYNA 1QRZA 1C1OA 4DURA 3TH3H 1C5TA 1B0FA 5DP3A 4ASHA 4CREA 1FV9A 3SJOA 4Y71A 2RG3A 5HKKD 4JZIA 5BPEA 1ESBA 1GI1A 1SQAA 1J17T 1HJ9A 2ZU1A 1DSUA 1XM1A 3ZZBA 2GZ8A 4XBDA 4NIYA 4INHA 3FKSD 3TJUA 4B6EA 3MI4A 3AK5A 1QTFA 1TGBA 3PRBA 1A0JA 2JKHA 1QQ4A 4ABEA 3LH1A 3RLYH 1EPTA 5H4IB 1O2LA 3CP7A 2OQUA 2FLBH 2FOCA 5AHGH 5EU8A 1Z8GA 2IPHA 5C2ZA 2G51A 5GCHF 3AW0A 3DFJA 4B2CA 2VWNA 3VGCB 4MPWA 4ABHA 2BD8A 1BBRH 1AO5A 2Y5HA 1BRAA 1CGHA 2I6QA 1DWEH 1ABIH 1K1JA 3TH2H 3UIRA 5L6NH 5EPNA 5F8TA 1GG6B 1GI6A 4NSVA 5JBCS 1T7CA 3RXIA 1UTMA 5JB9S 1GJCB 1G2MA 1F92A 3DUXH 1O3HA 1HXEH 2WV5A 2GD4B 4ZMAH 1ZPZA 3A7WA 1ZJKA 1GWAA 3BG4B 2Y6TA 7LPRA 1O37A 1WQVH 2KCOA 1O39A 3D65E 1SBWA 2GP9B 1GHBF 1GI2A 2I6SA 2VIOA 1SGFG 1O2OA 1THSH 2WPMS 5HIZA 1MQ6A 4UDWH 3PMHB 2FOHA 3SYJA 2ZTZA 1MZDA 1PQ5A 1ZGIA 1HPGA 2Y81A 1O5BB 1ORFA 2ANWA 1GBDA 4B1TA 2KCYA 1UCYE 1FY1A 3NWUA 1MTNC 8GCHF 2GV7A 4O97A 1XX9A 1IHTH 2YNBA 3Q77A 1QA7A 3FP8E 3SNBA 1NFYA 2GT7A 2HPPH 4UFEH 5HGGA 3ZVAA 4VGCC 1MMJN 2Y7ZA 2XWBI 2FS9A 3MH5A 1CE5A 4ABFA 2W5EA 3RXFA 2FPZA 2F3CE 5EJZA 1DLKB 1Y3UA 1YY3A 4FU8A 2GDEH 1NTPA 3M3TA 4HG6A 4YOJA 2BLVA 3TGIE 1XKAC 2LP6A 4X8VH 1G32B 3H5CB 4IW4E 2ULLA 3MYWA 4F49A 5GDSH 3GYMA 4U2WA 2CF9H 2M2AA 4I8LA 1C2KA 4A5TS 1DANH 3P92A 4P02A 1EZXC 4CBOA 5TJXA 2GZ7A 2LNCA 4JYVH 3RU4D 3LOXA 3E1XB 2SGQE 4AB9A 1O3KA 1ZHPA 4AFQA 2B0FA 3LDXH 1MU6B 2A5IA 1A3BH 4OS7A 4GAWA 1EAUA 4A7IB 2XBVA 3FP7E 4X6MA 2R0LA 1GJAB 5EXMA 1A5HA 1XUHA 2PLXA 4JMYA 4CRCA 1GMCG 3QZQA 1TRNA 1Y3XA 2BVXH 2H9EH 2P3TB 2UWLA 3GDSA 1LVMA 4KELA 1ESAA 3VEQB 1HAGE 2V7QD 1GBTA 1NRSH 5EOKA 2V35A 2UUJB 3QGNB 1DPOA 1W8BH 3UFAA 1A1RA 3V3MA 3Q3KA 3CNRA 4UE7H 1QFKH 4ACAA 1S0QA 2GT8A 1QB1A 2QXGA 1TWXB 1G3BA 4WJG2 1SGTA 1C1VH 5ETXA 5GWZA 3A82A 1A5GH 5CHBA 1BHXB 2NU0E 5C1XA 3VXEH 3HKIB 1EASA 4O9VA 3PM3A 4B73A 2JETB 3A86A 1SGDE 5FCRA 3M61U 3UR9A 4KTSA 1GI3A 4Q7ZA 2J9NA 4BXSA 2BDHA 1GDQA 1IQNA 1OYQA 4IC5A 2RDEA 2PV9B 1TPOA 1P2NA 4MNVA 2FWWA 4UFFH 2PW8H 1TA6A 2ZPRA 3URDA 1C2FA 2YMSC 1KY9A 3SV7A 3U8RH 5I25A 1V2UT 1YLDA 5DN6D 4Y79A 1AD8H 5K7RA 2J5UA 1P01A 1BJUA 2F9UA 4UD9H 3RXPA 1QBNA 2CJIA 4JYUH 3F1SB 6LPRA 3SI4H 3PRDA 2KZ4A 3BIUH 1EAIA 5EQQA 3FOAA 3MU8A 2Z9LA 1QZ8A 1SL3A 2OC7A 1LHCH 3JZ2B 3WWFA 3U1IB 1DITH 2OC0A 2DE8A 1B7XB 2PKSC 3OYPA 3PLKA 1OWKA 3EQ0H 5I46H 4XRNA 3SU3A 1MKXK 3MU5A 1C1SA 2GX4A 4FUHA 4I31A 1ELAA 4AYYB 5T6DA 1GBIA 4NA9H 2XCNA 1SR5C 1YLNA 1O5DH 2B9LA 4DGJA 3GYLB 4Q80A 1W3CA 3P8OA 1KSNA 1V2VT 5E0GA 3RXJA 3SZEA 2OK5A 2GKVE 2BDGA 3SNAA 1O2KA 2OC1A 1O3FA 4D7FA 3GY7A 1O2VA 3NZIA 4OGXA 1H9HE 1SGCA 3CENA 2K8IA 1O2PA 1C2LA 1ZMLA 1BBRE 2FYQA 4ABAA 4E7NA 1V6DA 4I8KA 1O38A 2BB4A 1L0ZA 4MVNA 1TGSZ 2PWXA 3URCA 1PPZA 3BEFB 1GBAA 4MTBA 4I7YH 2TGTA 4ZHAA 2AH4X 3ZZ3A 5LGOA 1UMAH 2BLQA 3HKJB 4AX9H 1TBQH 2ZDVH 3SNEA 5EIYA 2ZFTA 8KME2 1TRMA 4X6OA 1GJ8B 1GJ6A 3ZYDA 3ELAH 1ZTKA 1YBWA 1F2SE 2VVUA 3UTUH 1NT1A 1P11E 4Y0ZE 1GBCA 1BOQA 2ODQA 2WV4A 1D3PB 2SNVA 2CF8H 1W13U 3NPSA 3LONA 4UEHH 2FEQH 1AWHB 4X2YA 3DSOA 5T3HA 1VGCC 3P8NA 1TX6A 4MPVA 3OE7D 4WF8A 1P06A 1GBLA 1AB9C 2Y5FA 1O2TA 2A5AA 1P2JA 2ZF0H 2WHXA 4INKA 5DGJA 2QC2A 3E16B 4MNXA 2HNTC 3AAUA 1O2UA 1O31A 2W6ID 3T5FH 2GCTC 3BN9A 3CS0A 4DIIH 3RXBA 5E2PA 3E6PH 1MTWA 1GI4A 2LPRA 1Z71A 5E0HA 3A8DA 3MH7A 3UY9A 1MTUA 2UUYA 4RI0A 3K6ZA 2C4FH 4B75A 2FTMA 2AIQA 4ABGA 4KTCA 5GXPA 1K1OA 2ZPQA 1C1RA 4Z1MD 1BTWA 3GY8A 3MHWU 5A0BA 2GMTB 1Z1IA 1QJ7B 2PGQB 4Y10E 3SQHE 1D3TB 4RN6A 4BXWA 1LMWB 1ZOMA 3RDZA 1PFXC 4B6FA 2OBOA 4GCHG 1W0ZU 3SV6A 1WTHD 1HXFH 2VU8E 1E36B 1LPZB 1C2HA 7GCHF 1GI9B 1ZTJA 2PKAA 2V3OH 2KAIA 2GCHF 2QY0B 3GY5A 1J15A 3U28C 2J38A 3PWCA 1AQ7A 1LPGB 4XFQA 2OP9A 3PYHA 4ISIH 4AORA 1O3NA 1GMHG 1TMUH 2VJ1A 1C5MD 1ETTH 1BA8B 4X8SH 3F9EA 3O8BA 2FOEA 4WXIA 2XCFA 4ZHLU 1DWDH 1O3EA 4Q4LA 2PUQH 1BHXF 3ZIAD 4NIWA 1V2LT 1P57B 2BTCE 1HAVA 3K6YA 3RXHA 2FX4A 2QGRA 2R2MB 1DSTA 2KM0A 2ZA5A 4UFDH 3ATMA 3U1JB 3A81A 1AFQC 1C9PA 3ZZ7A 3MMGA 1TGTA 1O3GA 2PUXB 1RTFB 3C27B 4Y8XA 1NM6A 4ISLA 3I78A 2QN5T 1G3CA 1C5NH 1TGNA 5CE1A 5E0JA 2J98A 1GHZA 1E37B 3FAOA 1WUNH 3UNQA 1VITF 1THRH 1SHYA 3UQVA 1O3PB 2O8LA 1GGDC 1EJMA 1HYLA 2AGIX 2ZNKH 3UR6A 2FTLE 1EP5A 4WH8A 3GCNA 4HFPB 3PO1B 1W0KD 4O3UA 3ZZ4A 3KGPA 2UWPA 3SNDA 3TGKE 4AN7A 1O3AA 1XUJA 2A7HA 5SGAE 1QL9A 1FY4A 3F3BA 3SNCA 1MABB 3MNXA 1QQUA 2BQ7B 2CGAA 2BD3A 2WYJA 3UWIA 3BTGE 2AMQA 5KEDA 1RS0A 1O2ZA 1YPGH 3A7ZA 1QY6A 2ZFFH 2WYGA 3ODFA 1KTSB 1O3IA 5C0TA 2L6OA 4INLA 3UQOA 3ATIA 4OS4A 2VGCB 1QNJA 5FXLA 3LGVA 1O2SA 1TIOA 2V3HH 2AMPA 1JBUH 2Z7FE 3ZYEA 5DG6A 2BHGA 1HV7A 1W12U 1ELCA 3PMAB 1LPKB 2SGAA 4GVUA 1QCPA 1OHHD 5GCHG 1E79D 4QT8C 1OWIA 2NU2E 2CN0H 3V0XA 3RXRA 3MQKC 2FX6A 1V2RT 1AHTH 1S85A 4YLUA 1Y3VA 1Y5AT 1K9OE 1EKBB 2XRCA 1E1QD 1XUGA 1HUTH 2ZGJA 1GPZA 3QO6A 4TSFD 4X1PU 1TNJA 1FY8E 2QA9E 1H8IH 3EAJA 1JXPA 3RMLH 1DUEA 4GSOA 1O3BA 1O33A 1BTZA 3MWIU 1NFUA 2JDID 1CBWC 1O2MA 2OCVB 3VB7A 1MAYA 5C67A 2NU4E 1GI7B 2YNAA 4DY7B 4CRBA 1FMGA 1TBZH 1GHBG 2C8XB 1YPHE 2PGBB 3A83A 1N6XA 2PFEA 1S6HA 3HPTB 2A4RA 4SGAE 1HAVB 3VB5A 1XVOA 3MO6A 4FUGA 2GTBA 2YMSD 4U32A 1KXDA 1LKBA 8GCHG 2DUCA 3K2UA 3MOCA 4P00A 3D49H 1VCQA 1W0YH 1MKWK 3NRLA 3SGQE 1C9TA 4MLFB 3LPRA 3LT3A 1VJAU 4E06H 2F9PA 1A61H 1OP0A 1BRCE 3RC5A 3JZ1B 4O3TA 4TPIZ 3PLBA 3T25A 1CHOF 1N8OB 1PPHE 3SJ8A 1N1LA 1UW7A 4XBBA 1NN6A 3RC6A 4BAHB 2J98B 1O5AB 2BOHB 1SB1H 1ACBE 4ZXXH 3BTWE 2XTTB 1V2ST 3QZRA 2FOFA 1XUIA 3TJVA 1T8MA 5JB8S 3RXGA 3E0NB 1ZMNA 3RXCA 2FS8A 1JRTA 4R0IA 4CRDA 2H6MA 3Q76A 1WXRA 1CU1A 1NRRH 1VJ9U 2BDBA 3H09A 4RKJB 1GG6C 1S82A 1TPSA 1P2MA 5E2OA 3U69H 1TPPA 1GBBA 1SG8B 3GY2A 1O32A 5B6OA 1G3DA 3LIWA 1JIRA 1FQ3A 2BY9X 1COWD 1GJDB 2BVSH 2Q1JA 2RFKC 3SUGA 4FVDA 2ZTYA 1O5GH 4Z0KA 3A7YA 4LZ1H 3BG4C 2JH6D 2BY7X 2F9BH 1TBRH 4A1VA 3DFLA 3MO3A 1S6LA 1GBFA 1TLDA 3ATWA 2BD7A 2ZDAH 3BTTE 5AVDA 3PB1E 1RIWB 1P10A 5L2YH 2VWMA 4J1YA 5C5NA 4UONA 1PQ8A 5GNDA 3T26A 2QIQA 5EXLA 1Y3WA 1IQHA 1AVGH 2GV6A 2JIZD 2WUCA 3BF6H 1GMDF 3KQCA 3KCGH 1DVAH 5DP8A 2PTCE 2FO9A 4YOIA 4K1TA 2BD4A 4ZAEA 2K1QA 2OC8A 1ZSKA 4WMFA 1CGJE 2Z6BD 1Z6EA 2ZEBA 4YOGA 1K0HA 1AE8H 1L2EA 2FLRH 1SHHB 2OD3B 4I8HA 2QYIA 3A87A 5EPYA 2ILNA 2VIPA 2Z94A 3IITA 3QN7A 4AFZA 3RC4A 1UVPA 4JK6A 1W7XH 3SV8A 4XBCA 2ZGHA 1NBMD 4GPGA 1W11U 2A4QA 1P2OA 1OP8A 1O0DH 2F91A 5F8ZA 1NRQH 1ZZZA 1OWHA 1W10U 1ARBA 1Q31A 1D9IA 1TPAE 4AFSA 2Y82A 2PSYA 4AOQA 3BV9B 1W0JD 2BM2A 1NPMA 4OM9A 5FL7D 1UVTH 2B8OH 3ZVDA 1SGNE 3TNSA 3VB4A 4FUFA 5C20A 2ZQ2A 4NSYA 1O2WA 1OYTH 2XYAA 2Z9IA 3DA9B 1P09A 1V2NT 2VB0A 1NY22 1SGRE 4YESB 3TGJE 1E0FD 2TGAA 2KFWA 3UB0A 5DJ7A 4X8TH 1MCTA 1OS8A 1IQFA 2BLWA 2UWOA 4PROA 1C1UH 1ANCA 1BTHH 1ELFA 1SVPA 1BRBE 3O8DA 4K1EA 3P70B 2XNIA 1XKBC 1YCPH 1MH0A 1TNIA 3UPEA 5DSFA 1GHAF 3AASA 3Q3XA 1IQJA 4NWLA 4THNH 1H1BA 3S0NA 1HGTH 2FI5E 1EJAA 2J34A 1EPTC 1BB0B 4ZKSU 1NFWA 1PPEE 3AVZA 1ELBA 1SQRA 4Y7AA 3RXUA 1QB9A 3H7OA 3GY6A 2GZ9A 3KL6A 4BAMB 2B5TB 4K3JA 3L3TA 3RU4E 1SFQB 2JETC 2SFAA 2GJGA 1O5FH 2V3MA 3M3VA 3A8CA 3SORA 1SGQE 3O8RA 3DCLA 3NK8A 2AS9A 1HJ8A 1MD7A 1CSOE 3PWBA 3GS9A 3P8GA 6GCHF 4OS6A 1KXBA 4R8TB 1T4UH 1EZQA 2ZCHP 4TT3D 1HIAB 2QXHA 1IHSH 3I77A 1C5SA 3UNRA 4FOUC 1MTSA 2Q6GA 1ABJH 2C8ZB 5DP4A 1DE7H 1L1GA 1PYTC 4B71A 1Y59T 1LQEA 1J14A 1FAKH 2G55A 1P04A 2FXRA 1GI8B 3RUOA 3TIUA 1EZSC 4NIXA 4IMQA 3F2GA 1ELEE 2ZU3A 1GCTB 1O2JA 4BANB 1ZSJA 1A0HB 2W3IA 3SJ9A 1GI0A 4CHAB 1HAIH 2Z9KA 4X1SU 4ASUD 3SU5A 5HM2A 2KR7A 2VH0A 2ALPA 2BLOA 4RT1A 2ZFPH 2LELA 4FU9A 1A46H 3U98H 4H6TA 3PMBB 5CHAC 1VR1H 2ZQ1A 1CA0B 1ZJDA 4BNRA 4Q2KA 2F9VA 1FDPA 3FANA 1IAUA 4B74A 1HB0B 4BTTB 1BITA 5FPTA 4H6SB 4Z6AH 3QTOH 1S83A 4B76A 1O34A 3SU4A 1FN8A 1P3EA 2A5KA 2P3FH 2AEIH 3KNXA 4CRFA 1P9SA 4FVBA 4WVPE 1UTOA 1O3MA 1FY3A 3ZV8A 4DIHH 1H4WA 1DM4B 1LVBA 1YLCA 2HRVA 3BTEE 2BX4A 3GCTF 1K1PA 4IGDA 1OWDA 1YF4A 3SUEA 4NZQA 2FP7B 5C1YA 2G81E 7GCHG 3MTYA 1V2QT 2GCHG 8LPRA 1JMOH 1C5UA 2H5CA 1O35A 4Y76A 3SU6A 3HK6B 1QA0A 1EOJA 1NU7B 3NKKA 1BQYA 3F9FA 3MH4A 1MCVA 2P95A 1AVXA 2CK3D 1OWJA 1FIWA 1W7GH 1TNLA 4NGAH 4E05H 1SFIA 3AAVA 3GICB 1AMHA 3SO3A 3RLWH 1LVYA 1BUIA 1BBRK 3B9FH 1G37A 4NCYA 3LGYA 1G30B 1D6WA 3N7EA 4NIVA 3BTQE 2D8WA 4ABJA 5DO4H 3LC3A 1KLTA 1O2RA 1UTLM 2THFB 3W95A 2FOMB 5LH8A 1QBVH 1O3DA 3VB3A 5EW2H 1DUAA 3MU4A 1UHBB 1OSSA 5KECA 1P03A 3SI3H 2BY6X 5HM9A 1IQEA 4JYTA 5PTPA 1O2YA 4YLQH 1T4VH 2D2DA 4F48B 1UTKA 3L6PA 4NZLA 1QBOA 1HAXB 4HTCH 1X7AC 2STAE 3B23B 4BAOB 1FNIA 1VITG 2ZFRH 4Q7XA 3KIDU 1DT2A 3A7XA 2GMTC 2TGPZ 5GPIB 3MFJA 1THPB 1GJ7B 1AZZA 2WPLS 1QRWA 2H5DA 2QCYA 3RU4T 2PP6A 2D26C 2RA0A 4H4FA 4AZ2B 1TABE 3ATKA 6CHAB 4ISHH 5JDUB 1UTJA 2OQ5A 2ZU2A 3LU9B 1CT4E 2HWLB 1Y5BT 1YC0A 3PTBA 2FOBA 1AU8A 3SV2H 1S6FA 2OXSA 1KXAA 3A84A 2QXIA 5FHTA 2VH6A 4ABDA 3BEUA 4I86A 1ZTLA 1BZXE 3H7TA 5GIBA 1TA2A 3F0OA 3QDZB 1C5VA 1C5LH 4B2BA 2OINA 2ZHDA 1AZ8A 3EA8A 2G00A 3OEHD 3PV2A 3K9XB 2P8OB 1SLWB 2HVXA 1GL0E 2L74A 1EJNA 1HDTH 1YP9A 1LCYA 2AERH 2H1UA 3FP6E 4Y8ZA 3SU0A 2ZZUH 1EFRD 3OY6U 3EGKH 5F53A 1WCZA 5A8YA 1RFNA 3GOVB 3FFGA 4D8NA 4I33A 5JBTA 2R3YA 1O3OA 3OTJE 1HAZB 3F2FA 2FDAA 1QRXA 5FPSA 3DHKH 1YWUA 1YPEH 1MU8B 3OTPA 2BD2A 3T27A 1QL7A 3V12A 2QAAA 3ENSB 2CHAB 4WXVA 4YTAA 1EP6A 3VFEA 3F2HA 1YPKH 3E3TA 2ESTE 2A7CA 1J8AA 3N99A 2W6JD 1C4Y2 1GBHA 4IS5A 1NO9H 2VINA 3MH6A 1F0RA 1QL8A 1T8NA 3GCHB 2HLDD 3RM2H 1INCA 1Y3YA 4K1SA 5EG4A 1Q3XA 1FN6A 3P8FA 1M9UA 3F9HA 3PO1C 2ASUB 3QK1A 1SGFA 3ZZ5A 4RKOB 3RXTA 1A2CH 7ESTE 2PTNA 3A7TA 3E8LA 5JBBS 1FPHH 2BZ6H 2FZZA 1Q2WA 4XSKU 2JH5D 1ELGA 3BTHE 4FUBA 1O2GH 5HYOA 1KXFA 4ZXYH 1F7ZA 2F9OA 1U6QA 3NUMA 2ANYA 1O30A 2SNWA 1HJAB 1TRYA 1K1NA 1V2TT 1ZR0A 1IOEA 5C5OA 3RXMA 2ODYB 1FX0B 1BMMH 4AFUA 1SPJA 1JOUB 3QTVH 1O36A 3S69A 4JZDH 3MO9A 1ZPBA 4A6LA 5ESBA 4AG1A 3EYDA 1MTVA 2Q6DA 3GISB 3SHCH 1XUKA 1YCPM 3QWCH 3RXOA 3ZVFA 1UK2A 2VGCC 3QX5H 1E35B 3KQEA 3NCLA 2FM2A 1ZGVA 2O8TA 2XWAA 5DK1A 1EUFA 1FI8A 1CHOG 3S9CA 2C3SA 2ZKSA 2ZDNA 2FESH 3F68H 1C1PA 4NA7A 2JH0D 3TITA 1DOJA 5C94A 4BAKB 2BQ6B 1BMLA 3P95A 1HCGA 5G4BA 3SN8A 1UTPA 5JYIA 2ANKH 3S9BA 1MBQA 2BYAX 4D76A 5FCKA 1SGPE 3N7DA 2UUFB 5IK2D 3TH4H 3T28A 1C5ZB 1DX5M 1L1NA 2J94A 1GHWH 2BDYA 1K28D 1C5RA 2FI4E 1P3CA 1HAOH 3PLPA 2W7SA 1OKXA 1Z1JA 4YZUA 2TPIZ 2OTVA 1UTQA 1BIOA 3RXQA 5T6GA 1VCWA 2ANMH 5F6MA 2EA3A 2VVVA 1JWTA 3KQBA 1DY8A 8ESTE 2IJOB 5E8EH 2QF0A 5IYTA 3TNTA 1C1MA 2ZIQH 4Q7YA 1C5XB 3D62A 4X1NU 1K1LA 3SV9A 4DW2U 3SGBE 1QJ6B 1BDAA 1RTKA 1ETRH 4X6NA 1HAPH 4CR5A 2G8TA 1ID5H 4MPXA 5DP7A 1GMDG 1L4ZA 1ZRBA 1QHRB 2OLGA 4MNYA 4NG9H 3WWBA 2PR3A 3STIA 4K5ZA 5JPMH 4K2YA 2P93A 2Y5GA 1Z8IB 3RP2A 2BDCA 5CMXH 1EB1H 2M5TA 2ZGXH 4WH6A 1PYTD 2A4OA 1C1TA 1N8OC 4WMDA 1TOCB 3HGNA 3OAAD 5DPAA 4DVAU 4ZKRU 1V2KT 1V3XA 3SQEE 2VIQA 4H42U 4X0WU 4BTIB 1CGIE 1P2IA 1CT2E 1BCUH 2STBE 2VVCA 2Q6FA 4I32A 4MG3A 1EXFA 3LGWA 3FN8A 4AB8A 3OU0A 1BTPA 4K8YA 1A5IA 4A1TA 3A89A 3CS7A 5F8XA 1ZYOA 4HI3A 1CA8B 2WPDD 4OS1A 3HGPA 1FXYA 2ZU5A 1Z8JB 4ABIA 3A8AA 2ZU4A 3A7VA 5T6FA 3PTNA 1YPMH 1F0UA 5A2MH 2HOBA 3VGCC 3SHAH 1BT7A 5DP9A 3PV4A 5EQSA 2SGDE 4X6PA 5J4SA 1RD3B 3HK3B 3BTKE 4IC6A 2QF5A 3SUFA 1YPLH 1TONA 1MKXH 1OWEA 2OBQA 2AIPA 3BG8A 2XBXA 2CMYA 1RIWC 2BOKA 1DWBH 1GBEA 1B0EA 4ISOA 4ISNA 4J2YB 3DSPA 1QR3E 1GJBB 5ESTE 4Y0YE 1GHAG 3VB6A 2ZO3H 4BTUB 1IQLA 2G5VA 1HIAA 5AFZH 3DSGA 3EA7A 3SJKA 3SW2B 3VG8A 5EXNA 2F4LA 2HALA 1A0LA 3OEED 4X2XA 3IG6B 3OX7U 3WY8A 2ZECA 3E91A 4GLYA 1C2MA 4K8BA 1C5PA 2A31A 4RT0A 3KN2A 1ELVA 3SUDA 1SI5H 3D23A 1SGYE 5J4QA 4DT4A 2ZDMA 1F5KU 1VCPA 2C8WB 3LJJA 2K0QA 3OSYA 2FODA 4U30A 1DFPA 5FX6A 3LKWA 1ZPCA 4X1QU 3M5NA 1WU1A 4XOJA 2PSXA 1C4U2 3ZVEA 6GCHG 5HXFA 2VNTA 3GY3A 3RXSA 1TB6H 3F9GA 3E0PB 3QGJA 4TWYA 4ZKNU 1K1MA 2GVFA 3KYGA 1V2WT 2SGPE 2XBYA 3UWJH 2H9TH 4K69A 2BY8X 2ZDKA 1H8DH 2EQNA 2F9NA 1MD8A 3DT0H
chains in the Genus database with same CATH topology
2HGTH 3RXVA 1GVLA 5DP6A 3RXAA 1P8VC 3ZZDA 1KXCA 3MU0A 1KIGH 1BJVA 1MBMA 1TNGA 1NU9A 1E34B 3PROA 1YKTA 3C1KA 2O8WA 1UCYK 1O2HA 3N7OA 5FBIA 4WY3A 3LC5A 2ALVA 1GHVH 5K0HA 2XW9A 4CRGA 3B8JA 1ZLRA 2QF3A 4O03A 1ETSH 1AUTC 3SU2A 1T32A 3M7UA 1ANEA 4ESTE 2QV1A 3SU1A 2HNTE 1LHFH 1PPCE 1UVUH 1E38B 4I8GA 1KLJH 2UUKB 1EOLA 2O8MA 1P2QA 1K22H 1ZHRA 1JIMA 2A4GA 2AFQB 1UVSH 1GJ9B 2WPKS 4IBLH 4X2WA 1NFXA 1O2QA 4BAQB 2HPQH 4NFFA 5EW1H 4LK4A 1GVZA 1EB2A 3UREA 5FPYA 1IQMA 1AIXH 1O5CB 1AUJA 4ZHMU 2A32A 1W2KH 1MTNB 1NZQH 4A1XA 3M7TA 3KHVA 1ZSLA 1RTLA 1BTUA 3GCTG 7KMEH 2B7DH 5AFYH 3LH3A 3T29A 4AYVB 2AYWA 4VGCB 3KEEA 1RGQA 1AKSA 5C3NA 2ZG0H 1UHBA 1ZMJA 1Y5UT 2Y80A 1FJSA 4FUIA 4JCNA 4MDSA 2ZHWH 1ANBA 4GUXA 2TRMA 4X2VA 1GDUA 3BTFE 1XMNB 2C90B 1LHDH 4TWWA 4XE4A 1TNKA 4WWYA 2V0BA 4TY7A 4ABBA 9ESTA 1S5SA 5LPRA 5FAHA 1BMAA 1WTGH 3K65B 2FI3E 3LGTA 1G36A 3TK6A 1MZAA 5C1UA 3M36A 1KDQA 1KTTB 2WPHS 1GBMA 3TK5A 1GCTC 2ODPA 3MNBA 3UNSA 2WPJS 1YPHC 1C2IA 2EC9H 4CHAC 3RMOH 1LO6A 5HMAA 1OP2A 1AE5A 2SGFE 4X8UH 3STJA 4JK5A 1EPTB 1SSXA 3U8OH 1C2JA 2FIRH 2ZGBH 2RDLA 3FZDA 1GHYH 5DP5A 1AN1E 1CA0C 1T31A 2W7UA 4CR9A 1QJ1B 1AGJA 1F5RA 3R0FA 1OPHB 3RXLA 3A88A 1XXFA 1WBGB 1ESTA 4U01A 4JZEH 3S9AA 4E7RG 4HZHA 3A80A 2BDIA 5EGMA 2BD9A 5EQRA 3TPIZ 1SOZA 1FLEE 3ZVGA 3ZZCA 2VWOA 1TX8A 1FPCH 4NA8A 1MQ5A 2BZAA 3BTDE 1WQSA 4HGCA 2BXTH 3MNSA 1BTXA 1HAHH 3MNCA 2XC4A 1KLIH 2FOGA 4MQAA 1SQOA 1EQ9A 2O9QA 3BTME 2AGEX 2F83A 1AY6H 3TLOA 3M7QA 1QURH 1NESE 2BY5X 3R3GB 3ZVCA 1LHEH 3F6UH 2J2UA 1F5LA 4B2AA 1TGCA 5LPEA 3RXKA 1MUEB 1VZQH 2C93B 2CXVA 3HATH 1WV7H 4DCDA 1NRNH 2D1JA 3ODDA 1G9IE 2XXLA 1DDJA 2ZC9H 3M5LA 1C1QA 5EODA 4AGKA 1TMTH 1AI8H 1Y8TA 1NS3A 1TE0A 5A0CA 3ZZ9A 2G4UA 4FU7A 1YPJH 1D4PB 3V7TA 5CHAB 3VXFH 2DE9A 3W94A 1GJ4H 2W3KA 1BRUP 2J95A 2RA3A 1LKAA 1TOMH 2VIDA 4YT6H 2PKSB 2Z3CA 1PJPA 4XDEA 1GMCF 1MAXA 5F03A 5A0AE 1CO7E 4ZUHA 1AVWA 4GHTA 1C5YB 1CT0E 1GJ5H 5A8ZA 4GHQA 3TVJB 1P05A 1QB6A 1TQ7B 2G5NA 1FUJA 3P6ZB 1XVMA 1SLUB 1S81A 1DXPA 3UUZA 2CV3A 4Y6DA 1AKSB 9LPRA 1GCDA 1GL1A 4OS5A 1LQDB 3ESTA 4LOYH 1P02A 2FOAA 2NWNA 2W26A 1PPFE 1DS2E 3ZV9A 2A2QH 2AGGX 5GJ4B 3T62A 2A1DB 1EATA 1T8LA 3LGUA 2BVRH 6CHAC 1ANDA 2BMGB 1S0RA 2HLCA 2WINI 2BXUH 3P17H 3G01A 3O8CA 2R9PA 1QGFA 3RMNH 1SGIB 1KDQB 2TIOA 2ZHFH 4YM9A 1SQTA 3PMJA 3L33A 3BSQA 1O3CA 1KXEA 3I29A 5JBAS 1VITH 3BIVH 1DY9A 2NU3E 2WPIS 1OXGA 1SOTA 3E90B 1MKWH 3S7KB 5IDKA 1TFXA 2IOTA 1B5GH 1WSSH 4F4OC 1GVKB 1XXDA 2P8OC 3RXDA 1Z8RA 2XBWA 3VPKA 4OS2A 3EE0B 3U9AH 1ARCA 1O2IA 1P2KA 3IWMA 1C5OH 2VIVA 1A7SA 2H2ZA 1SMFE 2Z3EA 3RM0H 3SBKA 5A09A 3A8BA 1BTYA 1VGCB 3SJIA 1T8OA 1AB9B 4OGYA 1O5EH 1ZRKA 1HFDA 5FBEA 4Y8YA 2EI8A 2J4IA 1SC8U 1LTOA 1DLEA 2G4TA 3EDXB 1TMBH 2A45B 2CHAC 3M37A 4FUDA 3A85A 4JZ1A 3KF2A 3AW1A 2GCTB 1LHGH 1NRPH 1GBKA 2R2WU 1HBTH 1YCPK 2A2XH 1F0TA 4RSPA 1D6RA 2NU1E 3GCHC 1L4DA 3UOUA 1YGCH 4BOHA 1EX3A 1P0SH 1UO6A 3GDVA 2BX3A 1O3LA 1TAWA 1HRTH 2A0QB 3LGIA 1D3DB 3GDUA 1G3EA 4YO9A 4CBNA 2BDAA 1OX1A 1W14U 5TCCA 1WOFA 4X1RU 4D7GA 2Z9GA 3M5MA 3TJOA 3KQDA 4UFGH 2R3UA 4MPUA 4CH2B 5BRRE 1SLVB 1FIZA 2R0KA 1GDNA 1RJXB 3TK9A 1EZUC 1IQKA 1C2DA 1DXWA 1PQ7A 1ELTA 4M7GA 1HJAC 1TQ0B 4D9QA 1YYY1 2FYRA 3UOPA 2VIWA 1G2LA 1GI5A 4DJZB 2O8UA 1A3EH 4CRAA 1GBJA 1RRKA 2ZFQH 3SOSA 4MNWA 2YOLA 1K2I1 1CHGA 1P9UA 4D9RA 1UTNA 2BQWB 4KP0A 1EAXA 2P16A 3ATLA 3OY5U 1FZZA 2VWLA 5A8XA 1LDTT 3ZZ6A 4SGBE 2BD5A 2P59A 1HLTH 4ZROA 3SZNA 2GDDA 3V13A 3ZVBA 4DOQA 1V2JT 2P94A 4LXBH 5FX5A 1UCYH 1UVOA 3DD2H 5ABWA 1V2MT 3GY4A 2ZCLP 4FUEA 1TX7A 4WMEA 3QUMP 4Y7BA 3M5OA 2EI6A 3RMMH 1AFQB 1PPGE 2TGDA 3RXEA 2GGVB 2ZPSA 1SGEE 3QLPH 2A7JA 1C2EA 3M3SA 1FY5A 4TY6A 3EA9A 3M35A 3NXPA 2Y7XA 5AF9H 3TU7H 3GCOA 1AFEH 4DG4A 3ITIA 4CH8B 1C2GA 2EI7A 4Y11E 1GGDB 1TALA 4ZH8A 3Q00A 1TYNA 3Q3YA 3TJNA 2ZGCA 1V2PT 4AGJA 2Z9JA 4IMZA 1IQIA 1EAWA 4I8JA 1XUFA 3T2NA 1S84A 3ZZ8A 2XC5A 1BMNH 2J92A 4GCHF 3SGAE 1O2XA 1J16A 1C1WH 1C5QA 5L2ZH 1ELDE 1SLXB 2XC0A 1WYKA 4LZ4B 1NROH 1N6YA 2IN2A 4FUCA 1DWCH 1HNEE 4KKDA 1IQGA 3LJOA 1GMHF 3FVFB 1F0SA 1LVOA 1WAYB 1P12E 1Z6JH 2FMJA 2G52A 2OUAA 3S7HB 4FXGH 2ZHEH 1C5WB 1NC6A 1D3QB 4NWKA 2RCEA 3U8TH 1CVWH 4AG2A 1QIXB 3BEIB 3ZZAA 3FZZA 1RXPA 2ZI2H 4KTUA 1L1JA 1Z7KA 2ZP0H 2QXJA 2TBSA 1H9LB 1YM0A 5DKMA 1C1NA 1ZHMA 1PPBH 1K1IA 1HAYB 2H9HA 4A92A 1C4V2 4IN1A 1AWFH 1DICA 1UK3A 2PKAB 4ZKOU 2KAIB 1CQQA 2WUBA 1GHXH 1FAXA 2ZTXA 2C8YB 1K21H 2SGEE 2ZDLA 2ZCKP 1UK4A 4DT7B 2Z3DA 2ZFSA 1A4WH 1OOKB 2P3UB 1UJ1A 1FONA 1V2OT 5L30H 4KGAA 6ESTA 2ZHQH 2EEKA 1H9IE 1JRSA 4TPYA 3MU1A 4IN2A 2PHBA 4YT7H 1O2NA 1PQAA 1J9CH 1CBWB 4JZFH 1O3JA 4NFEA 4TYDA 2HNTF 2V6NA 1TNHA 5TCAA 2ZWLH 2AMDA 5LPFA 4FUJA 4K60A 1KYNA 1QRZA 1C1OA 4DURA 3TH3H 1C5TA 1B0FA 5DP3A 4ASHA 4CREA 1FV9A 3SJOA 4Y71A 2RG3A 4JZIA 5BPEA 1ESBA 1GI1A 1SQAA 1J17T 1HJ9A 2ZU1A 1DSUA 1XM1A 3ZZBA 2GZ8A 4XBDA 4NIYA 4INHA 3TJUA 3MI4A 1QTFA 1TGBA 1A0JA 2JKHA 1QQ4A 4ABEA 3LH1A 3RLYH 1EPTA 5H4IB 1O2LA 3CP7A 2OQUA 2FLBH 2FOCA 5AHGH 5EU8A 1Z8GA 2IPHA 5C2ZA 2G51A 5GCHF 3AW0A 3DFJA 4B2CA 2VWNA 3VGCB 4MPWA 4ABHA 2BD8A 1BBRH 1AO5A 2Y5HA 1BRAA 1CGHA 2I6QA 1DWEH 1ABIH 1K1JA 3TH2H 3UIRA 5L6NH 5EPNA 5F8TA 1GG6B 1GI6A 4NSVA 5JBCS 1T7CA 3RXIA 1UTMA 5JB9S 1GJCB 1G2MA 1F92A 3DUXH 1O3HA 1HXEH 2WV5A 2GD4B 4ZMAH 1ZPZA 3A7WA 1ZJKA 1GWAA 3BG4B 2Y6TA 7LPRA 1O37A 1WQVH 1O39A 3D65E 1SBWA 2GP9B 1GHBF 1GI2A 2I6SA 2VIOA 1SGFG 1O2OA 1THSH 2WPMS 1MQ6A 4UDWH 3PMHB 2FOHA 2ZTZA 1MZDA 1PQ5A 1ZGIA 1HPGA 2Y81A 1O5BB 1ORFA 2ANWA 1GBDA 4B1TA 1UCYE 1FY1A 3NWUA 1MTNC 8GCHF 2GV7A 4O97A 1XX9A 1IHTH 2YNBA 3Q77A 1QA7A 3FP8E 3SNBA 1NFYA 2GT7A 2HPPH 4UFEH 5HGGA 3ZVAA 4VGCC 1MMJN 2Y7ZA 2XWBI 2FS9A 3MH5A 1CE5A 4ABFA 2W5EA 3RXFA 2FPZA 2F3CE 1DLKB 1Y3UA 4FU8A 2GDEH 1NTPA 3M3TA 4YOJA 2BLVA 3TGIE 1XKAC 4X8VH 1G32B 3H5CB 4IW4E 2ULLA 3MYWA 4F49A 5GDSH 3GYMA 4U2WA 2CF9H 4I8LA 1C2KA 4A5TS 1DANH 3P92A 1EZXC 4CBOA 5TJXA 2GZ7A 2LNCA 4JYVH 3RU4D 3LOXA 3E1XB 2SGQE 4AB9A 1O3KA 1ZHPA 4AFQA 2B0FA 3LDXH 1MU6B 2A5IA 1A3BH 4OS7A 4GAWA 1EAUA 4A7IB 2XBVA 3FP7E 4X6MA 2R0LA 1GJAB 5EXMA 1A5HA 1XUHA 2PLXA 4JMYA 4CRCA 1GMCG 3QZQA 1TRNA 1Y3XA 2BVXH 2H9EH 2P3TB 2UWLA 3GDSA 1LVMA 4KELA 1ESAA 3VEQB 1HAGE 1GBTA 1NRSH 5EOKA 2V35A 2UUJB 3QGNB 1DPOA 1W8BH 3UFAA 1A1RA 3V3MA 3Q3KA 4UE7H 1QFKH 1S0QA 2GT8A 1QB1A 2QXGA 1TWXB 1G3BA 4WJG2 1SGTA 1C1VH 5ETXA 5GWZA 3A82A 1A5GH 1BHXB 2NU0E 5C1XA 3VXEH 3HKIB 1EASA 4O9VA 3PM3A 4B73A 2JETB 3A86A 1SGDE 5FCRA 3M61U 3UR9A 4KTSA 1GI3A 4Q7ZA 2J9NA 4BXSA 2BDHA 1GDQA 1IQNA 1OYQA 4IC5A 2PV9B 1TPOA 1P2NA 4MNVA 2FWWA 4UFFH 2PW8H 1TA6A 2ZPRA 3URDA 1C2FA 1KY9A 3SV7A 3U8RH 5I25A 1V2UT 1YLDA 4Y79A 1AD8H 5K7RA 1P01A 1BJUA 2F9UA 4UD9H 3RXPA 1QBNA 2CJIA 4JYUH 3F1SB 6LPRA 3SI4H 3BIUH 1EAIA 5EQQA 3MU8A 2Z9LA 1SL3A 2OC7A 1LHCH 3JZ2B 3U1IB 1DITH 2OC0A 2DE8A 1B7XB 2PKSC 3OYPA 3PLKA 1OWKA 3EQ0H 5I46H 3SU3A 1MKXK 3MU5A 1C1SA 2GX4A 4FUHA 4I31A 1ELAA 4AYYB 5T6DA 1GBIA 4NA9H 2XCNA 1SR5C 1O5DH 2B9LA 4DGJA 3GYLB 4Q80A 1W3CA 3P8OA 1KSNA 1V2VT 5E0GA 3RXJA 2GKVE 2BDGA 3SNAA 1O2KA 2OC1A 1O3FA 4D7FA 3GY7A 1O2VA 3NZIA 4OGXA 1H9HE 1SGCA 3CENA 1O2PA 1C2LA 1ZMLA 1BBRE 2FYQA 4ABAA 4E7NA 1V6DA 4I8KA 1O38A 2BB4A 1L0ZA 4MVNA 1TGSZ 2PWXA 3URCA 1PPZA 3BEFB 1GBAA 4MTBA 4I7YH 2TGTA 4ZHAA 2AH4X 3ZZ3A 5LGOA 1UMAH 2BLQA 3HKJB 4AX9H 1TBQH 2ZDVH 3SNEA 2ZFTA 8KME2 1TRMA 4X6OA 1GJ8B 1GJ6A 3ZYDA 3ELAH 1ZTKA 1YBWA 1F2SE 2VVUA 3UTUH 1NT1A 1P11E 4Y0ZE 1GBCA 1BOQA 2ODQA 2WV4A 1D3PB 2SNVA 2CF8H 1W13U 3NPSA 3LONA 4UEHH 2FEQH 1AWHB 4X2YA 5T3HA 1VGCC 3P8NA 1TX6A 4MPVA 4WF8A 1P06A 1GBLA 1AB9C 2Y5FA 1O2TA 2A5AA 1P2JA 2ZF0H 4INKA 5DGJA 2QC2A 3E16B 4MNXA 2HNTC 3AAUA 1O2UA 1O31A 3T5FH 2GCTC 3BN9A 3CS0A 4DIIH 3RXBA 5E2PA 3E6PH 1MTWA 1GI4A 2LPRA 1Z71A 5E0HA 3A8DA 3MH7A 3UY9A 1MTUA 2UUYA 3K6ZA 2C4FH 4B75A 2FTMA 2AIQA 4ABGA 4KTCA 5GXPA 1K1OA 2ZPQA 1C1RA 1BTWA 3GY8A 3MHWU 5A0BA 2GMTB 1Z1IA 1QJ7B 2PGQB 4Y10E 3SQHE 1D3TB 4RN6A 4BXWA 1LMWB 1ZOMA 3RDZA 1PFXC 2OBOA 4GCHG 1W0ZU 3SV6A 1WTHD 1HXFH 2VU8E 1E36B 1LPZB 1C2HA 7GCHF