4ABDA

Fragments bound to bovine trypsin for the sampl challenge
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Dingo Dataset: A Comprehensive Set of Data for the Sampl Challenge.
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords CATIONIC TRYPSIN
total genus 58
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2011-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4abdA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4abdA02
4ABJA 1PJPA 5FX5A 2P3UB 2IOTA 3VPKA 1Z8IB 2ANKH 3UTUH 1UVSH 1HAIH 3RM2H 1TONA 4LZ1H 1DVAH 1O5DH 4NIYA 3EDXB 1BCUH 4CHAB 4INHA 1TGTA 1ABJH 3HK3B 3NZIA 2ZDAH 2G55A 3KQDA 1CSOE 1WCZA 1KSNA 1DWDH 2AIQA 2CHAB 1MD7A 3M5OA 3BTKE 1GWAA 1E0FD 3BTHE 3RXPA 2FX6A 1TGNA 3L6PA 1YBWA 1XX9A 3PO1B 2DE8A 4A1TA 1O2HA 1FY8E 1TX8A 4B2BA 2IPHA 3RM0H 2V0BA 1ZTKA 3HPTB 1THRH 1NU7B 2EI8A 1TX6A 2OP9A 1O5FH 1P04A 1GGDC 4WMEA 2A5IA 5EG4A 3SNCA 1AKSB 2JETC 3PWCA 4B1TA 3GY2A 4E7RG 3T28A 1UTMA 4BAHB 2GGVB 4UE7H 2ZDNA 2TPIZ 4Y10E 3ZV8A 1MAXA 1C2DA 3LONA 2VH6A 6CHAB 1DITH 1SFQB 2AS9A 2Z3EA 4ISHH 1EP5A 1IQGA 5GIBA 5C5NA 3CP7A 3TGKE 2FTMA 4HI3A 2PKSB 1HXEH 1HGTH 1THSH 1YPLH 3SUDA 1P2JA 3F1SB 1C9PA 4BAQB 1F0RA 1VCPA 1XMNB 4FUCA 3NPSA 1ELCA 4ABDA 5BRRE 5JB8S 3O8BA 1GJ6A 1ACBE 4YT7H 2BXUH 4TYDA 4QT8C 3FZDA 3RU4D 2A32A 4K8YA 2JH0D 2BOHB 2QYIA 4TPYA 2WPJS 2O8TA 1NN6A 3GCTG 5C5OA 1O3OA 2PWXA 2YOLA 5AF9H 1T8OA 1GVKB 1BTXA 2A5KA 2FODA 1W2KH 1VGCC 1GJ8B 3U9AH 5K0HA 2ANWA 2W3IA 1UVTH 4FVBA 3S0NA 5EGMA 4IGDA 1HBTH 2B7DH 2J4IA 1RTKA 3P8FA 3SJKA 5FBEA 1O2KA 1SGDE 8LPRA 3RXOA 3MH5A 3QK1A 3EAJA 2ZEBA 1HAYB 2NWNA 3M3VA 1L0ZA 3A86A 2AMQA 6GCHG 3M5LA 2BX4A 1C2IA 1RGQA 3KL6A 2PLXA 5A0BA 1L4DA 3M5NA 1GBMA 2C8XB 1PPZA 4O9VA 5DK1A 2BY6X 4WXVA 5DPAA 1ANBA 2C3SA 1AUJA 2V6NA 1FPHH 2ZDMA 1MTSA 1Y5UT 2P3FH 3H7TA 1GJDB 4K60A 2QA9E 3MH7A 1QBNA 1GJ7B 1AE8H 3LC3A 5EPNA 3ZVDA 2PW8H 2V35A 3M3SA 1A4WH 2PSYA 1GJ5H 2AMDA 2ZU1A 1S0RA 3TGIE 1GHXH 1CT4E 1HAVA 2XW9A 3OTJE 3I29A 1VITF 2ZFTA 4INKA 3CS0A 4X2WA 3V13A 4DCDA 1MZDA 3ESTA 1YM0A 3MMGA 2HWLB 1C5SA 1ETTH 1TX7A 2NU0E 3EA9A 1MMJN 2SGDE 4M7GA 5CMXH 1GBKA 2A7CA 4R8TB 1C2JA 2BM2A 1LVOA 1HJ8A 1C1PA 1C5PA 1XUKA 2BDGA 3S7KB 4UFDH 2FOBA 2J38A 3KQCA 1L4ZA 1OX1A 1XUHA 3PTNA 1P11E 3TVJB 2CF9H 3JZ2B 1DLKB 2P94A 2ZCKP 4X2VA 1GCTC 2O8WA 3SI3H 2YNBA 5FPSA 1DLEA 2DE9A 2BDYA 1ZHRA 3T26A 5G4BA 1NPMA 2VGCB 3UREA 4CR9A 4YM9A 1FY1A 5AVDA 3TH2H 3FVFB 1LTOA 1BJUA 1W3CA 3SV6A 3E16B 2AIPA 3A85A 1QJ6B 1MBQA 5C67A 1J15A 3B9FH 3BN9A 2WUBA 5F6MA 1ETSH 4JYTA 2C8YB 2AEIH 3KNXA 5HM2A 3AVZA 1NESE 2A4RA 1V2RT 1G3DA 1GG6B 4I8KA 1VZQH 1MBMA 2FZZA 1O3JA 3FFGA 1GJ9B 2EEKA 1BITA 2BLOA 3ENSB 4NGAH 3RXFA 3A7WA 4E7NA 1SGEE 1N6XA 3GY8A 3Q3YA 3W94A 1ZTJA 4B76A 1TPSA 1LPKB 3SUEA 1GBFA 4Y7BA 3ZVAA 1EAWA 2AH4X 3EYDA 1ID5H 2VWNA 2NU2E 1F0SA 2STAE 4U30A 1LQEA 2BD7A 4CHAC 5LH8A 1LHEH 4FUEA 1BT7A 1OWIA 1KDQB 2PR3A 2Z3DA 3TIUA 1QBOA 2PGQB 1BQYA 2R9PA 4UFFH 3RXVA 3ZZ7A 3S69A 3DHKH 1Z7KA 2G52A 2H6MA 4U01A 2J92A 1GBAA 3RC5A 1P3CA 2HNTC 4Y79A 3VXFH 3QTVH 3PM3A 2ALVA 4K1EA 4X6MA 1SLXB 1FIZA 1ZHPA 3M7TA 3SNEA 3VXEH 2BY8X 1YPHC 1T31A 1SL3A 1O3LA 2VIWA 2ULLA 3M3TA 1GHAF 3RXGA 1NZQH 4X8SH 4YESB 1JRSA 2SGQE 4B71A 1ELBA 3ZZ8A 1GMCF 1SHHB 2ALPA 3V3MA 3TK9A 2TIOA 2WINI 1DE7H 1A0HB 1ZR0A 1V2MT 2BQ6B 3DA9B 4ZKSU 1GCDA 5F03A 2BY7X 2F9NA 3RDZA 7ESTE 4ZKRU 1NC6A 1SOZA 2WV4A 3NWUA 2ZC9H 3D49H 5EXNA 4DURA 5LPEA 4JYUH 1P09A 1ELGA 1O3CA 1SQOA 2A31A 1AUTC 3GY3A 2CN0H 1C2HA 2Q1JA 1BTZA 4ISNA 3RU4E 5GWZA 1S5SA 1AI8H 1S85A 2ZQ2A 4ISIH 4YLQH 1E35B 3ZZDA 1NRRH 1EJNA 2FOMB 2TGDA 4UEHH 4F49A 1UTOA 2HGTH 1C1SA 1VCQA 2VB0A 1G37A 2FLBH 1TAWA 2ZWLH 1TB6H 1KLJH 2GDDA 1NFUA 3A89A 1EZUC 3RXJA 4AYVB 1C5UA 2ZCLP 1Y3XA 5SGAE 1GHBF 3NXPA 3SJIA 4FUJA 3NK8A 4ZKOU 2ESTE 1OP2A 2PKAB 2TGTA 5TJXA 3BF6H 2G81E 5AHGH 2F9PA 1JOUB 1C9TA 2XYAA 3ZZ9A 1C1MA 1EJMA 2ODQA 2QN5T 1QRXA 1HXFH 4MTBA 3LIWA 1UTJA 1KXFA 1ABIH 3Q76A 3MTYA 4DVAU 4D7FA 2FTLE 5DP7A 3SNBA 4DOQA 1Z8RA 1K2I1 1A3BH 3L33A 3BEUA 5C1XA 1GBHA 1K1NA 1DUAA 3NUMA 1TNIA 1C1NA 3AW1A 1FZZA 5PTPA 3SQEE 1GL0E 3WY8A 1O3PB 3NKKA 3PMHB 2A0QB 4I8JA 1K1PA 3U8RH 3FP8E 1E36B 1RTLA 2A4GA 1J8AA 1K1LA 4E05H 1IAUA 4I32A 1BB0B 3B8JA 2Z9JA 2FOEA 2R2MB 3PMAB 4E06H 1FMGA 3A7VA 1O5CB 4FU8A 2Q6FA 4PROA 1SGCA 3RXMA 4NA9H 3TU7H 3BTWE 1UVUH 3ZZCA 3TLOA 1HB0B 4JZIA 1C5ZB 4OS4A 1BTHH 1D3PB 3HKJB 1TMBH 3A8DA 2PTNA 2QC2A 1SQTA 1T8MA 1WU1A 1UCYH 3L3TA 4CBNA 1P2NA 1BTPA 1C1VH 2VWOA 3QDZB 1K21H 1QJ7B 1IQEA 4D76A 1HJ9A 3RXKA 1ZTLA 1DX5M 2O8UA 4AZ2B 1C2MA 2Z94A 2ZDVH 1TWXB 1SGTA 4A7IB 1O3DA 1NRPH 1V2OT 3LC5A 1YC0A 1IQMA 2IJOB 4B74A 1WQVH 3QZQA 2ZDLA 2FI4E 1C5LH 1BHXF 2DUCA 1DXPA 2BB4A 1GBJA 2J9NA 3TK6A 1G3EA 1T4UH 4RKJB 2A2XH 4JK6A 1P2MA 1GI5A 5T6GA 3M37A 2PUQH 1AVWA 1LVBA 3FANA 4ABAA 1DICA 2GCHF 3OX7U 1LKAA 4K69A 2AGEX 1RIWB 1N8OB 1FV9A 3A8CA 3RMOH 2ZGBH 1TLDA 4K1TA 1LHDH 5GCHF 1DDJA 4CR5A 3SW2B 2OCVB 3GICB 3URDA 3MI4A 3QO6A 1QCPA 1SGYE 1T32A 4ZKNU 2VIOA 4KELA 1QL8A 3MU1A 7GCHF 1HAOH 1TIOA 1GI4A 1SC8U 5JPMH 1YPHE 1DFPA 4BNRA 5A8XA 1QGFA 2PSXA 3R3GB 3T27A 1D9IA 5DP4A 1GI2A 2ZG0H 3RP2A 3R0FA 1QBVH 2FOHA 3GCOA 2XWAA 1RTFB 2QCYA 4WMFA 4Y7AA 2THFB 1VCWA 1DWCH 5E0GA 3S9BA 1KXEA 4Y0YE 1XVMA 1UK4A 2BZ6H 3UNQA 4A92A 3U1IB 3A80A 1GI1A 5ESTE 2V3HH 1EOLA 1VITG 2FIRH 3RU4T 2ZGXH 1FXYA 3A8BA 4BAOB 1GI9B 2A7JA 3PROA 4AGJA 1ZRBA 1W12U 1AVGH 2CJIA 2BDHA 1IQFA 2H9HA 4Y0ZE 2Z9GA 1AN1E 4TY7A 3MYWA 1QB1A 3MNCA 4JK5A 3E3TA 4NG9H 1SLUB 2GKVE 1XXFA 1W7GH 1A1RA 1YPEH 3RXHA 4LZ4B 4NA8A 7GCHG 4ESTE 3SV9A 3P92A 4X1PU 3SU5A 1VR1H 1BRCE 5FHTA 1MKWK 4YT6H 1M9UA 2O8LA 1K1JA 2A5AA 4GCHG 5JBTA 1MU8B 1O39A 2HLCA 1NTPA 3EE0B 4YLUA 1P02A 2GTBA 1HUTH 3KEEA 1EPTC 3TJNA 1Z1JA 2BLQA 1CU1A 1EZQA 5CHAB 2BD4A 4X6OA 1FJSA 1O2LA 2CV3A 2OTVA 4FVDA 1C5NH 3ZVGA 1UVOA 2BD3A 1HAGE 1PQ5A 1P3EA 1C1TA 3M7QA 4BTTB 2Q6DA 1BZXE 1O5EH 1GBLA 2ZHQH 2F83A 2WPMS 1C5QA 1CVWH 4GSOA 1ELAA 1S84A 3TH3H 2ZZUH 1F2SE 3E6PH 2CF8H 1TGCA 2BX3A 1AIXH 4AG1A 5T3HA 2UUJB 1LMWB 2QXJA 4BAKB 1OPHB 1O2XA 2OINA 1CE5A 1O2VA 3A83A 4X1RU 3IITA 4X1QU 5JBAS 1O3KA 2WPHS 1SFIA 4HZHA 5F8XA 4MG3A 3MU4A 1WV7H 1BTUA 2J95A 1CA0C 4ZH8A 3VGCC 4AOQA 2ZA5A 2ODPA 2ZHEH 4JZDH 4GUXA 5JBBS 5EQRA 3SHAH 3BIVH 2PKSC 1C4Y2 1TQ0B 2HVXA 4GLYA 4CH8B 4WMDA 1SBWA 1SMFE 1FN6A 2HOBA 1O3EA 3GOVB 2UUKB 4X6NA 2ASUB 1DUEA 2SGFE 4KP0A 2YNAA 3A88A 2WYJA 1G2MA 4Y11E 1QL9A 3BTME 1EXFA 1GHZA 2GZ8A 3UUZA 1QA0A 2Y7XA 1GBEA 1RD3B 3JZ1B 1U6QA 3ODDA 1ZMJA 2Y6TA 4MPUA 4WF8A 4AG2A 1XUGA 4NA7A 1TNHA 1YLCA 1S83A 2XCFA 1F0TA 3BG8A 3DUXH 1MTVA 4UDWH 3QWCH 3SO3A 2ODYB 4I8HA 2EI6A 1L1GA 1K1MA 1QR3E 3SU2A 5TCAA 2PHBA 2ZU2A 3DFJA 4XSKU 4RKOB 3AAUA 3QLPH 1DY9A 1GI0A 1E37B 4F4OC 1ESAA 1WUNH 1T7CA 1PYTC 4NWLA 1OWJA 3PLPA 1YP9A 2C93B 4ZUHA 3GY5A 1FUJA 1ZRKA 3Q77A 4LXBH 1V6DA 4AFUA 2ZGHA 1ESBA 4X8UH 4UFEH 1OP8A 2ZCHP 1RJXB 4GPGA 3SI4H 1WQSA 2TGAA 2UWLA 1A0JA 4Q2KA 1UTQA 2ANMH 1G30B 1NY22 1TNGA 1PPBH 3S9CA 1C5RA 1ZPCA 1GI7B 1Y3YA 2HRVA 3FP6E 1LO6A 3K6YA 3SGBE 8KME2 2Z9IA 3S7HB 3RXDA 3PYHA 1DOJA 4ZXYH 3LJOA 2VGCC 1Q31A 1SHYA 1T8LA 3ZZBA 1TPOA 2FI5E 3PV4A 2EA3A 3A8AA 4ABBA 1GCTB 1VGCB 5HMAA 4XDEA 2FO9A 4BXSA 2HNTE 2ZFSA 4JMYA 3TGJE 1GVZA 4O3TA 1OWKA 1CQQA 1THPB 8GCHF 5L2YH 1P2QA 3LGVA 5JB9S 1SGFG 4VGCC 1C5YB 4JZFH 1ZSKA 1H9HE 3SU6A 3T29A 2UWOA 1V2NT 1AZ8A 1C2GA 3K2UA 1AGJA 4XE4A 3UOPA 3HGPA 1HV7A 3A82A 1C1OA 3TH4H 3W95A 2FS8A 1IHSH 2FS9A 3RMMH 4MLFB 2Y7ZA 1Z8GA 2GX4A 4FUIA 1GBBA 3P8GA 4AB9A 1QHRB 3STIA 1ELVA 1UCYK 4OS5A 6CHAC 2J34A 1ZPBA 4NWKA 3TJOA 1O2MA 1GPZA 2RG3A 3ELAH 1KYNA 4XBDA 4CRDA 4ZMAH 3GYLB 1YCPH 2H5DA 3G01A 1ZGVA 3SV7A 2G5NA 5CE1A 1MTWA 1C4U2 1OP0A 3SUGA 1A61H 3GY7A 1GBDA 2ZU3A 3VB7A 3GY6A 3LH3A 2VIDA 1K9OE 5B6OA 1P9UA 2OC7A 3KN2A 4X0WU 2XBXA 4TPIZ 1V2PT 2PUXB 1GDQA 1MD8A 2GMTB 2P93A 3PO1C 4CBOA 5T6FA 1O35A 4FUHA 2SGEE 1CA0B 3VGCB 5L30H 1GI8B 2OQUA 5JBCS 2UUYA 1O2RA 5J4QA 1NFWA 1AFQB 1CBWC 2FMJA 4X8TH 2JETB 3LU9B 3LH1A 1V2LT 2D8WA 3MO6A 5GCHG 2BVRH 1MKXH 1EAUA 1MQ5A 1YKTA 2TRMA 3RXUA 1OYQA 1TGSZ 3SBKA 2Z9LA 7KMEH 1F5RA 1BDAA 2GVFA 4WY3A 1C5MD 1WTHD 2C8WB 2PV9B 2BVSH 1MTNB 1OSSA 5DP6A 2ANYA 4DIHH 5DP9A 1O2IA 2A4OA 1CT0E 1ARCA 4KTSA 2P8OB 1O36A 4ISLA 4KGAA 4GHTA 4CREA 5GXPA 4H42U 1OOKB 1ELTA 1EZSC 1ANCA 1C4V2 2WUCA 3IWMA 1ZJDA 1YYY1 1AWHB 5JYIA 4YOIA 2K1QA 4HGCA 3V7TA 4BAMB 1UO6A 3SQHE 1AO5A 1RFNA 3SV8A 2AGGX 3A7XA 1C1RA 3BEIB 1QURH 4Q7YA 1BRUP 1A46H 5HGGA 4DW2U 5DJ7A 1G3BA 1GHYH 1TA2A 2LPRA 2BLWA 3VB6A 3LT3A 1K22H 2ILNA 3K9XB 4GVUA 1TBQH 1UK3A 1A7SA 2OD3B 1JIMA 2ZTZA 4YTAA 1B0FA 1EB2A 3B23B 1QJ1B 1VJAU 4I33A 2A2QH 1ZLRA 2P95A 1TBRH 3OU0A 2H2ZA 2ZPQA 3ATWA 1TALA 3GCNA 4FUGA 1YPKH 3LJJA 1G36A 1GHAG 1T8NA 1SGNE 3ZZ3A 4WJG2 3UR9A 1O3MA 1FQ3A 1BMLA 2F91A 4XBBA 1PQAA 1FI8A 3SZNA 2XBYA 4FU7A 1TYNA 3MH4A 1BRBE 4X8VH 1AHTH 4D8NA 1AFEH 2XBVA 1PPFE 2KAIA 2FLRH 1ZJKA 3LGWA 3TJUA 1KTTB 2FPZA 1C2KA 1O2ZA 1YCPM 4YOJA 1QA7A 1BIOA 3KQEA 2QV1A 1ZSJA 2GZ7A 1K28D 3UWIA 1NM6A 4IMZA 1QQUA 4FXGH 2Y82A 3GDVA 3P70B 4NSYA 1QY6A 2OC1A 4JCNA 8ESTE 1BA8B 4IC5A 3P95A 2BDCA 2O9QA 1GHWH 2QXGA 4FU9A 1TRYA 4MDSA 4Y8XA 1ZOMA 1IQIA 4KKDA 1TRNA 5IYTA 1GJCB 1MKWH 4U32A 1ANEA 3ZZ5A 2ZTXA 1UMAH 3M7UA 4TWWA 3SJ9A 2BD8A 1TABE 3PLBA 4AFSA 1Z71A 1YF4A 1GBCA 1D4PB 5FPTA 1HLTH 1O5GH 1UTLM 1Z1IA 4CRBA 1O2WA 5E0JA 3ZVBA 3VFEA 5J4SA 3UQVA 3PWBA 2GV7A 2ZQ1A 2STBE 1LVYA 1C2EA 1H4WA 1HPGA 2UWPA 1EJAA 2I6SA 2WPLS 4I31A 1D3DB 3UIRA 3T62A 1N8OC 4AN7A 4INLA 1PQ8A 1X7AC 1FDPA 1V2VT 1ZPZA 4AGKA 1D3TB 5FX6A 4AB8A 4MNXA 3SJ8A 3T5FH 4IN1A 1C1UH 1DSTA 4AFZA 2QIQA 5EXLA 1O2SA 1K1OA 4TY6A 1SSXA 1O2JA 1SLWB 4NCYA 5DKMA 1E38B 2ZPSA 2A1DB 1QIXB 1Y3WA 1P2OA 3SNDA 1AE5A 1CGIE 1S81A 4FUFA 5E0HA 2LNCA 2GZ9A 4UD9H 1KTSB 1HIAB 4LK4A 1WSSH 1MH0A 5ABWA 1OWDA 1O3IA 3O8DA 1KLIH 1EKBB 3PLKA 5FCRA 1ESTA 1TE0A 1F0UA 3I78A 1GMDG 5LGOA 2GV6A 1QL7A 2C90B 1Y5BT 1W0ZU 4J2YB 4ABIA 1SGQE 2XXLA 1O5BB 1XXDA 3GDSA 3T25A 4AFQA 2XWBI 1JWTA 2SFAA 1FY5A 1AZZA 1L1JA 5JDUB 1F5KU 3RMLH 1IQHA 2G51A 1GHBG 3VB5A 4B75A 3GCHB 3SU3A 2Z3CA 3RMNH 1HJAC 3TITA 1V2ST 1FLEE 3MNXA 2ZP0H 3ZV9A 1FY3A 5CHAC 1S6FA 3KIDU 2VVUA 1TBZH 1A3EH 1MU6B 3VB4A 5LPFA 1V2QT 1QB9A 1G2LA 1Z6JH 3MU0A 1CA8B 4B73A 1P10A 3A7ZA 3BTDE 4O3UA 3GCHC 1YLDA 5L6NH 2ZF0H 4D9RA 5IDKA 1LVMA 2BMGB 5A0CA 3GY4A 2SGAA 3MNBA 2VWLA 4I8LA 1F5LA 3O8RA 3BEFB 5EXMA 1DPOA 2FESH 3LKWA 3UR6A 3GCTF 1GI6A 2FI3E 1O31A 1V2UT 3SV2H 1WBGB 2QAAA 1MCVA 1HAZB 3UWJH 4ZHAA 1MZAA 1MAYA 1P2KA 1Z6EA 3TPIZ 1EUFA 4MNWA 2GD4B 1K1IA 1ZMLA 2Q6GA 1Y3VA 1HJAB 2G4TA 4IS5A 1LHCH 1N6YA 4K8BA 1ARBA 1H8IH 1WAYB 1J17T 3BV9B 1MTNC 4FUBA 3PMBB 1AFQC 1JXPA 1BRAA 2SGPE 1NO9H 3UOUA 2VIVA 1TNJA 4GHQA 4MPXA 2JH5D 1P05A 1NROH 1C5WB 5EQQA 2Z7FE 2W26A 2XBWA 2Y5HA 3ZVCA 1WTGH 1IQJA 2A45B 2GCTC 2R2WU 4NZQA 3QGNB 4UFGH 5HYOA 2R3YA 1P2IA 1KXAA 1GMHG 1UTPA 4OS2A 4A1XA 2R0KA 4OGYA 2XNIA 4DJZB 1CGJE 2FDAA 2BQ7B 3O8CA 1SVPA 3SGQE 2XC0A 3QTOH 1A5IA 2NU1E 3E8LA 5DP8A 4FUDA 2ZI2H 5EW2H 4DGJA 2VVCA 1QQ4A 1HAPH 4KTCA 2Y81A 2PGBB 2ZGCA 4NIWA 4Y71A 1EPTA 1EX3A 3F9EA 1NFXA 1C2LA 4NFEA 3TK5A 1H8DH 1G9IE 2RDLA 4WWYA 5HXFA 3LGTA 4IMQA 1O2YA 4IC6A 5FPYA 1AD8H 3H5CB 2A7HA 1HAXB 4VGCB 3BSQA 2FOCA 4IN2A 1D6RA 1ORFA 2NU4E 2XTTB 2FYQA 8GCHG 4XFQA 1TPAE 3KCGH 4ASHA 1UTKA 1PQ7A 1BOQA 2Z9KA 1T4VH 2AMPA 5LPRA 2VIQA 4RSPA 2H9TH 3ATMA 1SGRE 2B5TB 1KLTA 1UCYE 2FOAA 1C5TA 2BZAA 1YGCH 4ISOA 1J9CH 3VEQB 4DIIH 2H1UA 1V2TT 3QZRA 1PPHE 1E34B 5DP5A 2G8TA 1LKBA 1BBRH 3STJA 2F9VA 1FY4A 3U1JB 4Y8YA 1V3XA 1CBWB 1EOJA 1W11U 5GJ4B 3TNSA 3BTFE 1EAIA 3RXEA 5C2ZA 1KXDA 2CXVA 4I8GA 4NFFA 3ZVEA 2GMTC 1PPGE 3CS7A 3T2NA 3V12A 2VINA 2FP7B 1AWFH 1LPGB 1QRWA 2UUFB 1FAXA 4ZROA 2OC8A 1A2CH 4NIVA 3ATIA 3M61U 3CENA 1DWEH 3E0NB 3OYPA 2R3UA 1W14U 1GJAB 3RLYH 1O37A 4A6LA 4GAWA 1LHFH 2OQ5A 2BD5A 1AKSA 3PMJA 4NIXA 3EA8A 3MO3A 1CHOG 2ZGJA 2VIPA 4ZHMU 1F92A 1XKAC 1EP6A 2ZECA 1KY9A 3A7YA 1B5GH 3KF2A 1O3NA 3BG4C 2EI7A 1ELFA 3KGPA 3TJVA 2G00A 2Y5GA 2ZHFH 4WH8A 4WH6A 1MUEB 1O2NA 3Q00A 4CH2B 1ELEE 2VNTA 3LGYA 1GBTA 4JYVH 1J14A 3ITIA 1P01A 2BDAA 2NU3E 5I25A 2OBOA 5FAHA 4CRFA 2FEQH 1JRTA 4MVNA 3H7OA 2HPQH 1J16A 1BJVA 1O33A 1W13U 3Q3XA 1NFYA 1WOFA 3A87A 1GBIA 4OGXA 3P17H 4TWYA 3LPRA 3ATLA 3RXLA 1TMTH 1OKXA 1O2QA 3HGNA 2RA3A 3PB1E 5DO4H 1P12E 1OYTH 2ZFPH 3UNRA 2ZO3H 2OLGA 4H6SB 4Z6AH 1IQKA 2BLVA 1O0DH 3UY9A 1LCYA 4ABGA 1O3BA 1AMHA 1UHBA 3EQ0H 3LDXH 4YZUA 2VWMA 2C4FH 2BXTH 3U8OH 2B8OH 2VH0A 3S9AA 4UONA 1W8BH 1PFXC 1UVPA 4MQAA 2XRCA 4OS6A 4KTUA 1JBUH 3F9GA 1SI5H 3RXRA 4A1VA 1IHTH 2J94A 3K65B 3M5MA 4ZAEA 4ABHA 2B0FA 1TOCB 2HALA 3ZYEA 1ELDE 1O2TA 4D9QA 1V2JT 3ZZ4A 1FONA 1ZGIA 1NRNH 3F9FA 1Z8JB 1GMDF 1AQ7A 1PPEE 1TNKA 2OUAA 2H9EH 2VU8E 3FAOA 1AU8A 4H6TA 3D23A 1CHGA 1ETRH 4DG4A 3LGIA 4BANB 1A5HA 6LPRA 3MU5A 4J1YA 1BBRE 2FOGA 1FN8A 1FPCH 2BD2A 1QRZA 5DGJA 2WYGA 4MNYA 3P8OA 2AERH 1SPJA 3SJOA 1S6HA 2OBQA 1YPMH 3GDUA 1SLVB 3OY5U 2J2UA 1DY8A 1LDTT 3E0PB 4Z0KA 2RCEA 2BY9X 2M5TA 4A5TS 1EZXC 3BG4B 5FXLA 1HYLA 5T6DA 1IQLA 1QFKH 4MPWA 3HATH 1B0EA 5AFYH 1NRSH 4DT7B 4Y6DA 1SOTA 2BDIA 4D7GA 1GHVH 3LOXA 1TNLA 1O5AB 4LOYH 2XC4A 3SORA 3TNTA 4Q7XA 1BUIA 1D6WA 1H9LB 1GGDB 2C8ZB 1ANDA 4YO9A 3K6ZA 2ZHWH 1W7XH 2GCTB 1CGHA 3F68H 2FM2A 3BTTE 1XUJA 1HDTH 3HKIB 4X1SU 3URCA 3PTBA 5L2ZH 4BTUB 2W3KA 1BTWA 2B9LA 4K1SA 5C1UA 3DT0H 1HFDA 1D3QB 2BQWB 3RC4A 1MTUA 5K7RA 2P59A 6ESTA 1GI3A 3ZVFA 5I46H 1BTYA 4U2WA 1TPPA 4ZHLU 5EQSA 2R0LA 3SN8A 1O3HA 1P0SH 3BTGE 2WPIS 1TOMH 1YCPK 4OS1A 1O3FA 1BBRK 3P8NA 3I77A 2ZIQH 1O34A 1C1WH 1UK2A 2BTCE 1KDQA 2F9BH 1P9SA 1EQ9A 1XUFA 2KAIB 1DXWA 3UQOA 2ZDKA 1S82A 2D1JA 2VVVA 5GPIB 4THNH 1YPJH 3BTQE 5EU8A 4K2YA 4CRGA 1C5XB 5DP3A 5A8ZA 2FX4A 3AW0A 4Y76A 1YPGH 3UPEA 3ATKA 2Y80A 3D62A 4BTIB 2XCNA 3MWIU 3Q3KA 4Q80A 1TA6A 1H9IE 1FNIA 1MKXK 2BOKA 1IOEA 3RXBA 4CRCA 1TRMA 1OXGA 3MO9A 5C1YA 3QN7A 2GT7A 1CO7E 1EPTB 1S0QA 3C27B 3HK6B 4ABEA 3MOCA 3RLWH 1G3CA 1FAKH 2QF0A 2W7UA 4NZLA 1EB1H 1DANH 2CMYA 2ZU5A 1UJ1A 4SGAE 4WXIA 3FP7E 1BMMH 2W5EA 1A5GH 1V2WT 1DT2A 1W10U 3UFAA 4XOJA 5A8YA 3A7TA 1EASA 4IBLH 3AAVA 2P16A 5EODA 2ZFFH 2ZNKH 2F9UA 1AB9B 2HPPH 2TBSA 1A0LA 2ZPRA 4B2CA 5HM9A 1XM1A 5DG6A 1P06A 1SR5C 5C20A 2F3CE 2ZFRH 3OSYA 1UHBB 3RXQA 1RXPA 1VITH 1RIWC 1C1QA 1O3GA 3RXAA 2AFQB 2AYWA 3LGUA 2PKAA 4AYYB 1Y5AT 1ZHMA 1ZYOA 3P6ZB 4R0IA 4H4FA 2RA0A 2WV5A 2FXRA 3KQBA 1SGIB 4ZXXH 6GCHF 1LHGH 1SG8B 3MU8A 1AVXA 2SNVA 1P57B 4RN6A 2FWWA 1O38A 1O2UA 1Y3UA 1BMAA 2TGPZ 1HIAA 1L1NA 3MH6A 1TFXA 1TGBA 2AGIX 4JZEH 3GISB 4ABFA 1LPZB 1ZSLA 5H4IB 5FBIA 3C1KA 4SGBE 2FOFA 1ZZZA 2ZKSA 3EGKH 1PYTD 1DWBH 2W7SA 1GJ4H 3M36A 1NRQH 2HNTF 3SU0A 3SU4A 3E90B 1O2OA 1NU9A 1HAVB 2WPKS 1HRTH 2ZU4A 2ZTYA 3D65E 2O8MA 2XC5A 2ZFQH 1GMHF 1G32B 2QXIA 3OY6U 5TCCA 4X2XA 1LQDB 1O2GH 1OS8A 1Q3XA 2CGAA 5EPYA 3SNAA 1XUIA 3U98H 2ZHDA 5AFZH 1Y8TA 2CHAC 1QNJA 1V2KT 1Q2WA 5ETXA 3U69H 1CHOF 3U8TH 1DSUA 5F8TA 1UTNA 2BVXH 3DD2H 1KIGH 1EATA 1KXBA 1MQ6A 1HCGA 2V3OH 1SQAA 5A2MH 1GJBB 3A81A 3RXCA 1BHXB 7LPRA 1TQ7B 4YOGA 2GCHG 3MNSA 2BYAX 3N7OA 3SUFA 1HAHH 2GP9B 2I6QA 3MHWU 3SHCH 1DS2E 1GDNA 3MFJA 3GYMA 1TMUH 1AB9C 1GDUA 2SNWA 3KHVA 5BPEA 1MCTA 4WVPE 4O97A 3ZZAA 1XKBC 1C5OH 3EA7A 4AORA 1INCA 5E2OA 1ZMNA 1HNEE 3RXTA 1H1BA 3V0XA 1P8VC 3ZYDA 3AASA 1DM4B 2EC9H 4K5ZA 2JH6D 5A0AE 1VJ9U 5FCKA 9ESTA 4MNVA 1SGPE 3RUOA 5EOKA 2GDEH 3F9HA 4AX9H 2QY0B 3E1XB 4B2AA 3BTEE 1QB6A 3E91A 4Q7ZA 2PFEA 3RXIA 3RXSA 5E2PA 3SU1A 1IQNA 3SOSA 2PTCE 1SGFA 4I7YH 5EW1H 1BMNH 2QXHA 1O32A 1W0YH 2BDBA 5F8ZA 3FZZA 4K3JA 3RC6A 3ZZ6A 2OC0A 1JMOH 1RS0A 1P03A 2BY5X 1XVOA 1GG6C 2OXSA 1EAXA 2BD9A 3QUMP 1PPCE 1QTFA 3SGAE 4BXWA 3IG6B 2A4QA 1GVLA 2D2DA 1L2EA 3M35A 1GMCG 1O3AA 1NS3A 1OWEA 3UNSA 4MPVA 4X2YA 1NT1A 4X6PA 4GCHF 4O03A 1Y59T 1O30A 1FIWA 1WYKA 3DFLA 4OS7A 2VJ1A 4X1NU 5E8EH 9LPRA 4Y8ZA 1O2PA 5GDSH 2QGRA 2G4UA 5A09A 4HTCH 4DY7B 2JKHA 2P3TB 3QX5H 3F6UH 2H5CA 4JZ1A 2FYRA 3ODFA 1JIRA 1RRKA 2QF3A 4NSVA 4CRAA 3QGJA 3VB3A 2Y5FA 1KXCA 4IW4E 1N1LA 4XBCA 1GL1A 4BOHA 2P8OC 1AY6H 1B7XB 2F9OA 2G5VA 2GT8A 4HFPB 1OWHA 5ESBA 3A84A 1SB1H 2IN2A 2Z6BD 1C2FA 1C5VA 2BHGA 5C3NA 1CT2E 3BIUH 3NCLA 2D26C 1F7ZA
chains in the Genus database with same CATH superfamily
4ABJA 1PJPA 5FX5A 2P3UB 2IOTA 3VPKA 1Z8IB 2ANKH 3UTUH 1UVSH 1HAIH 3RM2H 1TONA 4LZ1H 1DVAH 1O5DH 4NIYA 3EDXB 1BCUH 4CHAB 4INHA 1TGTA 1ABJH 3HK3B 3NZIA 2ZDAH 2G55A 3KQDA 1CSOE 1WCZA 1KSNA 2QF4A 1DWDH 2AIQA 2CHAB 1MD7A 3M5OA 3BTKE 1GWAA 1E0FD 3BTHE 3RXPA 2FX6A 1TGNA 3L6PA 1YBWA 1XX9A 3PO1B 2DE8A 4A1TA 1O2HA 1FY8E 1TX8A 4B2BA 2IPHA 3GS9A 3RM0H 2V0BA 1ZTKA 3HPTB 1THRH 1NU7B 2EI8A 1TX6A 2OP9A 1O5FH 1P04A 1GGDC 4WMEA 2A5IA 5EG4A 3SNCA 1AKSB 2JETC 3PWCA 4B1TA 3GY2A 4E7RG 3T28A 1UTMA 4BAHB 2GGVB 4UE7H 2ZDNA 2TPIZ 4Y10E 3ZV8A 1MAXA 1C2DA 2KX4A 3LONA 2VH6A 6CHAB 1DITH 1SFQB 2AS9A 2Z3EA 4ISHH 1EP5A 1IQGA 5GIBA 5C5NA 3CP7A 3TGKE 2FTMA 4HI3A 2PKSB 1HXEH 1HGTH 1THSH 1YPLH 3SUDA 1P2JA 3F1SB 1C9PA 4BAQB 1F0RA 1VCPA 1XMNB 4FUCA 3NPSA 1ELCA 4ABDA 5BRRE 5JB8S 3O8BA 1GJ6A 1ACBE 4M9FA 4YT7H 2BXUH 4TYDA 4QT8C 3FZDA 3RU4D 2A32A 4K8YA 2JH0D 2BOHB 3WWBA 2QYIA 4TPYA 2WPJS 2O8TA 1NN6A 3GCTG 5C5OA 1O3OA 2PWXA 2YOLA 5AF9H 1T8OA 1GVKB 1BTXA 1YLNA 2A5KA 1W2KH 1VGCC 1GJ8B 2FODA 3U9AH 2ANWA 5K0HA 2W3IA 1UVTH 4FVBA 3U28C 3S0NA 5EGMA 4IGDA 1HBTH 2B7DH 3PRBA 2J4IA 1RTKA 3P8FA 3SJKA 5FBEA 3FO8D 1O2KA 1SGDE 8LPRA 4TSFD 3RXOA 3MH5A 1YY3A 3QK1A 3EAJA 2ZEBA 1HAYB 2NWNA 3M3VA 1L0ZA 3A86A 5DSFA 2AMQA 2KCPA 6GCHG 3M5LA 2BX4A 1C2IA 1RGQA 5GNDA 3KL6A 2PLXA 5A0BA 1L4DA 3M5NA 1GBMA 2C8XB 1PPZA 4O9VA 5DK1A 2BY6X 3ZIAD 4WXVA 5DPAA 1ANBA 2C3SA 1AUJA 2V6NA 1FPHH 2ZDMA 1MTSA 1Y5UT 2P3FH 3H7TA 1GJDB 4K60A 2QA9E 3MH7A 1QBNA 1GJ7B 1AE8H 3LC3A 5EPNA 3ZVDA 2PW8H 2V35A 3M3SA 1A4WH 2PSYA 1GJ5H 2AMDA 2ZU1A 1S0RA 3TGIE 1GHXH 1CT4E 1HAVA 2XW9A 3OTJE 3I29A 1VITF 2ZFTA 4INKA 3CS0A 2WV9A 4X2WA 3V13A 4DCDA 1MZDA 3ESTA 1YM0A 3MMGA 2HWLB 1C5SA 1ETTH 1TX7A 2NU0E 3EA9A 1MMJN 2SGDE 4M7GA 5CMXH 1GBKA 2A7CA 4R8TB 1C2JA 2BM2A 1LVOA 1HJ8A 1C1PA 1C5PA 1XUKA 2BDGA 3S7KB 4UFDH 2FOBA 2J38A 3KQCA 1L4ZA 1OX1A 1XUHA 3PTNA 1P11E 2F43B 3TVJB 2CF9H 3JZ2B 1DLKB 2QF5A 2P94A 2ZCKP 4X2VA 1GCTC 2O8WA 3SI3H 3KYFA 2YNBA 5FPSA 1DLEA 2DE9A 2BDYA 1ZHRA 2HLDD 1QZ8A 3T26A 5G4BA 1NPMA 2VGCB 3OEED 3UREA 4CR9A 4YM9A 1FY1A 5AVDA 3TH2H 3FVFB 1LTOA 1BJUA 1W3CA 1NBMD 3SV6A 3E16B 3SZEA 2AIPA 3A85A 1QJ6B 1MBQA 3F0OA 5C67A 1J15A 3B9FH 3BN9A 2WUBA 3DCLA 5F6MA 1ETSH 4JYTA 2C8YB 2AEIH 3KNXA 5HM2A 3AVZA 1NESE 2A4RA 1V2RT 1G3DA 1GG6B 4I8KA 1VZQH 1MBMA 2FZZA 1O3JA 3FFGA 1GJ9B 2EEKA 1BITA 2BLOA 3ENSB 4NGAH 2J98A 3RXFA 3A7WA 4E7NA 1SGEE 1N6XA 3GY8A 3Q3YA 3W94A 1ZTJA 4DT4A 4B76A 1TPSA 1LPKB 3SUEA 1GBFA 4Y7BA 3ZVAA 1EAWA 2AH4X 3EYDA 1ID5H 2NU2E 2VWNA 1F0SA 2STAE 4U30A 4TT3D 3DSGA 1LQEA 2BD7A 4CHAC 5LH8A 1LHEH 4FUEA 1BT7A 1OWIA 1KDQB 2PR3A 2Z3DA 3TIUA 1QBOA 2PGQB 1BQYA 2R9PA 1SKYE 4UFFH 3RXVA 3ZZ7A 3S69A 3DHKH 1Z7KA 2G52A 2H6MA 4U01A 2J92A 1GBAA 3RC5A 3OFND 3DSPA 1P3CA 2HNTC 4Y79A 3VXFH 3QTVH 3PM3A 2ALVA 4K1EA 4X6MA 1SLXB 1FIZA 1ZHPA 3M7TA 3SNEA 3VXEH 2BY8X 1YPHC 1T31A 1SL3A 1O3LA 2VIWA 2ULLA 3M3TA 1GHAF 3RXGA 1NZQH 4X8SH 4YESB 1JRSA 2SGQE 4B71A 1ELBA 3ZZ8A 1GMCF 1SHHB 2ALPA 3V3MA 3TK9A 2TIOA 2WINI 1DE7H 1A0HB 1ZR0A 1V2MT 2BQ6B 2JIZD 3DA9B 4ZKSU 1GCDA 5F03A 2BY7X 2F9NA 3RDZA 7ESTE 2CK3D 4ZKRU 1NC6A 1SOZA 2WV4A 3NWUA 2IJD1 2ZC9H 3D49H 5EXNA 4DURA 5LPEA 4JYUH 1P09A 1ELGA 1O3CA 1SQOA 2A31A 5HIZA 1AUTC 3GY3A 2CN0H 1C2HA 2Q1JA 1BTZA 4ISNA 3RU4E 5GWZA 1S5SA 1AI8H 1S85A 2ZQ2A 4ISIH 4YLQH 1E35B 2JDID 3ZZDA 1NRRH 3H09A 1EJNA 2FOMB 5EJ1A 2TGDA 4UEHH 4F49A 1UTOA 2HGTH 1C1SA 1VCQA 2VB0A 1G37A 2FLBH 1TAWA 2ZWLH 1TB6H 1KLJH 2GDDA 1FX0B 1NFUA 3A89A 2OK5A 1EZUC 3RXJA 5KEDA 4AYVB 1C5UA 2ZCLP 1Y3XA 1H8ED 5SGAE 1GHBF 3NXPA 3OE7D 4FUJA 3NK8A 3SJIA 3W1EA 4ZKOU 2ESTE 1OP2A 2PKAB 2TGTA 5TJXA 3BF6H 1COWD 2G81E 5AHGH 2F9PA 1JOUB 1C9TA 2XYAA 5CDFE 3ZZ9A 1C1MA 1EJMA 2ODQA 2QN5T 1QRXA 1HXFH 4MTBA 3LIWA 1UTJA 1KXFA 1ABIH 3Q76A 3MTYA 4DVAU 4D7FA 2FTLE 5DP7A 3SNBA 4DOQA 1Z8RA 1K2I1 1A3BH 3L33A 3BEUA 5C1XA 1GBHA 1K1NA 1BMFD 1DUAA 3NUMA 1TNIA 1C1NA 3AW1A 1FZZA 5PTPA 3SQEE 1GL0E 3WY8A 1O3PB 3NKKA 3PMHB 2A0QB 4I8JA 1K1PA 3U8RH 3FP8E 1E36B 1RTLA 2A4GA 1J8AA 5C0TA 1K1LA 4E05H 1IAUA 4I32A 1BB0B 3B8JA 2Z9JA 2FOEA 2R2MB 3PMAB 4E06H 1FMGA 3A7VA 1O5CB 4FU8A 2Q6FA 4PROA 1SGCA 3RXMA 4NA9H 3TU7H 3BTWE 1UVUH 3ZZCA 3TLOA 1HB0B 4JZIA 1C5ZB 4OS4A 1BTHH 1D3PB 3HKJB 4XD7D 1TMBH 3A8DA 2PTNA 2QC2A 1SQTA 1T8MA 4I86A 1WU1A 1UCYH 3L3TA 4CBNA 1P2NA 1BTPA 1C1VH 2VWOA 3QDZB 1K21H 1QJ7B 1IQEA 4D76A 1HJ9A 3RXKA 1ZTLA 2VBCA 5C94A 1DX5M 2O8UA 4AZ2B 1C2MA 2Z94A 2ZDVH 1TWXB 1SGTA 4A7IB 1O3DA 1NRPH 1V2OT 3LC5A 1W0JD 1YC0A 1IQMA 2IJOB 4B74A 1WQVH 3QZQA 2ZDLA 2FI4E 1C5LH 2KZ4A 1BHXF 2DUCA 1DXPA 2BB4A 1GBJA 2J9NA 3TK6A 2L74A 1G3EA 1T4UH 4RKJB 2A2XH 4JK6A 1P2MA 1GI5A 5T6GA 3M37A 2PUQH 3UAIC 1AVWA 1LVBA 3FANA 4ABAA 1DICA 2GCHF 3OX7U 1LKAA 4K69A 2AGEX 5HKKD 1RIWB 1N8OB 1FV9A 3A8CA 3RMOH 2ZGBH 1TLDA 4K1TA 1LHDH 5GCHF 1DDJA 4CR5A 3SW2B 2OCVB 3GICB 3URDA 3MI4A 3QO6A 1QCPA 1SGYE 1T32A 4ZKNU 2VIOA 4KELA 1QL8A 3MU1A 7GCHF 1HAOH 1TIOA 1GI4A 1SC8U 5JPMH 1YPHE 1DFPA 4BNRA 5A8XA 3F2GA 1QGFA 2PSXA 3F2FA 3R3GB 3T27A 1D9IA 5DP4A 1GI2A 2ZG0H 3RP2A 3R0FA 1QBVH 2FOHA 3GCOA 2XWAA 1RTFB 2QCYA 4WMFA 4Y7AA 2THFB 1VCWA 1DWCH 5E0GA 3S9BA 1KXEA 4Y0YE 1XVMA 1UK4A 2BZ6H 3UNQA 4A92A 3U1IB 3A80A 1GI1A 5ESTE 2V3HH 1EOLA 1VITG 2FIRH 3RU4T 2ZGXH 1FXYA 3A8BA 4BAOB 1GI9B 2A7JA 3PROA 4AGJA 1ZRBA 1W12U 1AVGH 2CJIA 2BDHA 1IQFA 2H9HA 4Y0ZE 2Z9GA 3UB0A 1AN1E 4TY7A 3MYWA 1QB1A 3MNCA 4JK5A 3E3TA 4NG9H 1SLUB 2GKVE 1XXFA 1W7GH 1A1RA 1YPEH 3RXHA 4LZ4B 4NA8A 7GCHG 4ESTE 3SV9A 3P92A 4X1PU 3SU5A 1VR1H 1BRCE 2XNDD 5FHTA 1MKWK 4FOUC 4OM9A 4YT6H 1M9UA 2O8LA 1K1JA 2A5AA 4GCHG 5JBTA 1MU8B 1O39A 2HLCA 1NTPA 3EE0B 4YLUA 1P02A 2GTBA 1HUTH 3KEEA 2KFWA 1EPTC 3TJNA 1Z1JA 2BLQA 1CU1A 1EZQA 5CHAB 2BD4A 4X6OA 1FJSA 1O2LA 2CV3A 3KYGA 2OTVA 4FVDA 1C5NH 3ZVGA 1UVOA 2BD3A 1HAGE 1PQ5A 1P3EA 1C1TA 3M7QA 4BTTB 2Q6DA 1BZXE 1O5EH 1GBLA 2ZHQH 2F83A 2WPMS 5EJLA 1C5QA 1CVWH 4GSOA 1ELAA 1S84A 3EE7A 3TH3H 2ZZUH 1F2SE 3E6PH 2CF8H 1TGCA 2BX3A 1AIXH 4AG1A 5T3HA 2UUJB 1LMWB 2QXJA 4BAKB 4P02A 1OPHB 1O2XA 2OINA 1CE5A 1O2VA 2WSSD 3A83A 4X1RU 3IITA 4X1QU 5JBAS 1O3KA 2WPHS 1SFIA 4HZHA 5F8XA 4MG3A 3MU4A 1WV7H 1BTUA 2J95A 1CA0C 4ZH8A 3VGCC 4AOQA 2ZA5A 2ODPA 2ZHEH 4JZDH 4GUXA 5JBBS 4Q4LA 5EQRA 3SHAH 3BIVH 1EFRD 2PKSC 1C4Y2 1TQ0B 2HVXA 4GLYA 4CH8B 4WMDA 1SBWA 1SMFE 1FN6A 2HOBA 1O3EA 3GOVB 2UUKB 4X6NA 5T1VA 2ASUB 1DUEA 2SGFE 4KP0A 2YNAA 1NBME 3A88A 2WYJA 1G2MA 4Y11E 1QL9A 3BTME 1EXFA 5KGOA 5KECA 1GHZA 2GZ8A 3UUZA 1QA0A 2Y7XA 1GBEA 1RD3B 3JZ1B 1U6QA 3ODDA 1ZMJA 2Y6TA 4MPUA 4WF8A 4AG2A 1XUGA 4NA7A 1TNHA 1YLCA 2WZQA 1S83A 2XCFA 1F0TA 3BG8A 3DUXH 1MTVA 4UDWH 3QWCH 3SO3A 2ODYB 4I8HA 2JJ1D 2EI6A 1L1GA 1K1MA 1QR3E 3SU2A 5TCAA 2PHBA 2ZU2A 3OEHD 3DFJA 4XSKU 4RKOB 3FN8A 3AAUA 3QLPH 1DY9A 1GI0A 1E37B 4F4OC 2EY4C 1ESAA 3PV2A 1WUNH 1T7CA 1PYTC 4NWLA 3SYJA 1OWJA 3PLPA 4F55A 1VKYA 1YP9A 2C93B 4ZUHA 3GY5A 5C17A 1FUJA 1ZRKA 3Q77A 4LXBH 1V6DA 4AFUA 2ZGHA 1ESBA 4X8UH 4UFEH 1OP8A 2ZCHP 1RJXB 4GPGA 3SI4H 1WQSA 2TGAA 2UWLA 1A0JA 4Q2KA 1UTQA 2ANMH 1G30B 1NY22 1TNGA 1PPBH 3S9CA 1C5RA 1ZPCA 1GI7B 1Y3YA 2HRVA 3FP6E 1LO6A 3K6YA 3SGBE 8KME2 2Z9IA 3S7HB 3RXDA 3PYHA 1DOJA 4ZXYH 3LJOA 2VGCC 1Q31A 1SHYA 1T8LA 3ZZBA 1TPOA 2FI5E 3PV4A 2EA3A 3A8AA 4ABBA 1GCTB 1VGCB 5HMAA 4XDEA 4Q63A 2FO9A 4BXSA 2HNTE 2ZFSA 4JMYA 3TGJE 1GVZA 4O3TA 1OWKA 1WXRA 1CQQA 1THPB 8GCHF 5L2YH 1P2QA 3LGVA 3F2HA 5JB9S 1SGFG 4VGCC 1C5YB 4JZFH 1ZSKA 1H9HE 3SU6A 3T29A 2UWOA 1V2NT 1AZ8A 1C2GA 3K2UA 1AGJA 4XE4A 3UOPA 3HGPA 1HV7A 3A82A 1C1OA 3TH4H 3W95A 4B6EA 2FS8A 1IHSH 2FS9A 3RMMH 4MLFB 2Y7ZA 1Z8GA 2GX4A 4FUIA 1GBBA 3P8GA 4AB9A 1QHRB 3STIA 1ELVA 1UCYK 4OS5A 6CHAC 2J34A 1ZPBA 4NWKA 3TJOA 1O2MA 1GPZA 2RG3A 3ELAH 1KYNA 4XBDA 4CRDA 4ZMAH 3GYLB 1YCPH 2H5DA 3G01A 1ZGVA 3SV7A 2G5NA 1KMHB 5HIYA 5CE1A 1MTWA 1C4U2 1OP0A 3SUGA 1A61H 3GY7A 1GBDA 2ZU3A 3VB7A 3GY6A 3LH3A 2VIDA 1K9OE 5B6OA 1P9UA 2OC7A 3KN2A 4X0WU 2XBXA 4TPIZ 1V2PT 2PUXB 1GDQA 1MD8A 2GMTB 2P93A 3PO1C 4CBOA 5T6FA 1O35A 4FUHA 2SGEE 1CA0B 3VGCB 5L30H 1GI8B 2OQUA 5JBCS 2UUYA 1O2RA 5J4QA 1NFWA 1AFQB 1CBWC 2FMJA 4X8TH 2JETB 3LU9B 3LH1A 1UW7A 1V2LT 2D8WA 3MO6A 5GCHG 2BVRH 1MKXH 1EAUA 1MQ5A 1YKTA 2TRMA 3RXUA 4Z1MD 1OYQA 1TGSZ 3SBKA 2Z9LA 7KMEH 1F5RA 1BDAA 2GVFA 4WY3A 1C5MD 1WTHD 2C8WB 2PV9B 2BVSH 1MTNB 1OSSA 5DP6A 2ANYA 4DIHH 5DP9A 1O2IA 2A4OA 1CT0E 1ARCA 4KTSA 2P8OB 1O36A 4ISLA 4KGAA 4GHTA 2J97A 4CREA 5GXPA 4H42U 1OOKB 1ELTA 2LP6A 2K0QA 1EZSC 1E1QD 1ANCA 1C4V2 2WUCA 3IWMA 1ZJDA 1YYY1 1AWHB 5JYIA 4YOIA 2K1QA 4HGCA 3V7TA 4BAMB 1UO6A 3SQHE 1AO5A 1RFNA 3SV8A 2AGGX 3A7XA 1C1RA 3BEIB 1QURH 4Q7YA 1BRUP 1A46H 2XOKD 5HGGA 3FKSD 4DW2U 2JJ2D 5DJ7A 1G3BA 1GHYH 1TA2A 2LPRA 2BLWA 3VB6A 3LT3A 1K22H 2ILNA 3KQ5A 3K9XB 4GVUA 1TBQH 1UK3A 1A7SA 2OD3B 1JIMA 2ZTZA 4YTAA 1B0FA 1EB2A 3B23B 1QJ1B 1VJAU 2YMSD 4I33A 2A2QH 1ZLRA 2P95A 3N99A 3PV5A 1TBRH 3OU0A 2H2ZA 2ZPQA 3ATWA 1TALA 3GCNA 4FUGA 1YPKH 3LJJA 1G36A 1GHAG 1T8NA 1SGNE 3ZZ3A 4WJG2 3UR9A 1O3MA 1FQ3A 1BMLA 2F91A 4XBBA 1PQAA 1FI8A 3SZNA 2XBYA 4AC9A 4FU7A 1TYNA 3MH4A 1BRBE 4X8VH 1AHTH 4D8NA 1AFEH 2XBVA 1PPFE 2KAIA 2FLRH 1ZJKA 3LGWA 3TJUA 1KTTB 2FPZA 1C2KA 1O2ZA 1YCPM 4YOJA 1QA7A 2WHXA 1BIOA 3KQEA 1WDIA 2QV1A 1ZSJA 2GZ7A 1K28D 3UWIA 1NM6A 4IMZA 1QQUA 4FXGH 2Y82A 3GDVA 3P70B 4NSYA 1QY6A 2OC1A 4JCNA 8ESTE 1BA8B 4IC5A 3P95A 2BDCA 2O9QA 1GHWH 2QXGA 4FU9A 1TRYA 4MDSA 5DN6D 4Y8XA 1ZOMA 2V3MA 1IQIA 4KKDA 1TRNA 5IYTA 1GJCB 1MKWH 4U32A 1ANEA 3ZZ5A 2ZTXA 1UMAH 3M7UA 4TWWA 3SJ9A 2BD8A 1TABE 3PLBA 4AFSA 1Z71A 1YF4A 1GBCA 1D4PB 5FPTA 1HLTH 1O5GH 2RDEA 1UTLM 1Z1IA 4CRBA 1O2WA 5E0JA 2RFKC 3ZVBA 3VFEA 5J4SA 3UQVA 3PWBA 2GV7A 2ZQ1A 2STBE 1LVYA 1C2EA 1H4WA 3PRDA 4FETA 1HPGA 2UWPA 1EJAA 2I6SA 2WPLS 2PP6A 4I31A 1D3DB 3UIRA 3T62A 1N8OC 4AN7A 4INLA 1PQ8A 1X7AC 1FDPA 1V2VT 1ZPZA 4AGKA 1D3TB 5FX6A 4AB8A 4MNXA 3WWFA 3SJ8A 3T5FH 4IN1A 1C1UH 1DSTA 4AFZA 2QIQA 5EXLA 1O2SA 1K1OA 4TY6A 1SSXA 4ZCNA 1O2JA 2IPQX 1SLWB 4NCYA 5DKMA 1E38B 2ZPSA 2A1DB 1QIXB 1Y3WA 1P2OA 3SNDA 1AE5A 1CGIE 1S81A 4FUFA 5E0HA 2KCYA 2LNCA 2GZ9A 4UD9H 1KTSB 1HIAB 4LK4A 1WSSH 1MH0A 5ABWA 1OWDA 1O3IA 3O8DA 1KLIH 1EKBB 3PLKA 3F0PA 3FOAA 5FCRA 1ESTA 1TE0A 1F0UA 3I78A 1GMDG 5LGOA 2GV6A 1QL7A 2C90B 1Y5BT 1W0ZU 4J2YB 4ABIA 1SGQE 2XXLA 1O5BB 1XXDA 3GDSA 3T25A 4AFQA 2XWBI 1JWTA 1S6LA 1FY5A 2SFAA 1AZZA 1L1JA 5JDUB 1F5KU 3RMLH 1IQHA 2G51A 1GHBG 3VB5A 4B75A 3GCHB 3SU3A 2Z3CA 3RMNH 1HJAC 3TITA 1V2ST 1FLEE 3MNXA 2ZP0H 3ZV9A 1FY3A 5CHAC 1S6FA 3KIDU 2VVUA 1TBZH 1A3EH 2WPDD 1MU6B 3VB4A 5LPFA 1V2QT 2J5UA 1QB9A 1G2LA 1Z6JH 3MU0A 4B6FA 1CA8B 4B73A 1P10A 3A7ZA 3BTDE 4O3UA 3GCHC 1YLDA 5L6NH 2ZF0H 3OTPA 4D9RA 5IDKA 1LVMA 2BMGB 5A0CA 3GY4A 2SGAA 3MNBA 2VWLA 4I8LA 5CHBA 1F5LA 3O8RA 3BEFB 5EXMA 1DPOA 2FESH 3LKWA 3UR6A 3GCTF 1GI6A 2FI3E 1O31A 1V2UT 3SV2H 1WBGB 2QAAA 1MCVA 1HAZB 3UWJH 4ZHAA 1MZAA 1MAYA 1P2KA 1Z6EA 3TPIZ 1EUFA 4MNWA 2GD4B 1K1IA 1ZMLA 2Q6GA 1Y3VA 1HJAB 2G4TA 4IS5A 1LHCH 1N6YA 4K8BA 1ARBA 1H8IH 1WAYB 1J17T 3BV9B 1MTNC 4FUBA 2J98B 3PMBB 1AFQC 1JXPA 1BRAA 2SGPE 1NO9H 3UOUA 2VIVA 1TNJA 4GHQA 4MPXA 2JH5D 1P05A 1NROH 1C5WB 5EQQA 2Z7FE 2W26A 2XBWA 1H8HD 2KCAA 2Y5HA 3ZVCA 1WTGH 1IQJA 2A45B 2GCTC 2R2WU 4NZQA 3QGNB 4UFGH 5HYOA 2R3YA 1P2IA 1KXAA 1GMHG 1UTPA 4OS2A 4A1XA 2R0KA 4OGYA 2XNIA 2KM0A 4DJZB 1CGJE 2FDAA 2BQ7B 3O8CA 1SVPA 3SGQE 2XC0A 3QTOH 1A5IA 2NU1E 3E8LA 5DP8A 4FUDA 2ZI2H 5EW2H 4DGJA 2VVCA 2V7QD 1QQ4A 1HAPH 4KTCA 2Y81A 2PGBB 2ZGCA 4NIWA 4Y71A 1EPTA 1EX3A 3F9EA 1NFXA 1C2LA 4NFEA 3TK5A 1H8DH 1G9IE 2RDLA 4WWYA 5HXFA 3LGTA 4IMQA 4RT0A 1O2YA 4IC6A 5FPYA 1AD8H 3H5CB 2A7HA 1HAXB 4VGCB 3BSQA 2FOCA 4IN2A 1D6RA 1ORFA 2NU4E 2XTTB 2FYQA 8GCHG 4XFQA 1TPAE 3KCGH 4ASHA 1UTKA 1PQ7A 1BOQA 2Z9KA 1T4VH 2M2AA 2AMPA 5LPRA 2VIQA 4RSPA 2H9TH 3ATMA 1SGRE 4ACAA 2B5TB 1KLTA 1UCYE 2FOAA 1C5TA 2BZAA 1MABB 1YGCH 4ISOA 5F53A 1J9CH 3VEQB 4DIIH 2H1UA 1V2TT 3QZRA 1PPHE 1E34B 5DP5A 2G8TA 1LKBA 1BBRH 3STJA 2F9VA 1FY4A 3U1JB 4Y8YA 1V3XA 1CBWB 1EOJA 1W11U 5GJ4B 3TNSA 3BTFE 1EAIA 3RXEA 5C2ZA 1KXDA 2CXVA 4I8GA 4NFFA 3ZVEA 4ASUD 2GMTC 1PPGE 3CS7A 3T2NA 3V12A 2VINA 2FP7B 1AWFH 1LPGB 1QRWA 2UUFB 1FAXA 4ZROA 2OC8A 1A2CH 4NIVA 3ATIA 3M61U 3CENA 1DWEH 3E0NB 3OYPA 2K8IA 2R3UA 1W14U 1GJAB 3RLYH 1O37A 4A6LA 4GAWA 1LHFH 2OQ5A 2BD5A 1AKSA 3PMJA 4NIXA 3EA8A 3MO3A 1CHOG 2ZGJA 2VIPA 4ZHMU 2KCOA 1F92A 1XKAC 1EP6A 2ZECA 1KY9A 3A7YA 1B5GH 3KF2A 1O3NA 3BG4C 2EI7A 1ELFA 3KGPA 3TJVA 2G00A 4HG6A 2Y5GA 2ZHFH 4WH8A 4WH6A 1MUEB 1O2NA 3Q00A 4CH2B 1ELEE 2VNTA 3LGYA 1GBTA 5FL7D 4JYVH 1J14A 3ITIA 1P01A 2BDAA 2NU3E 5I25A 2OBOA 5FAHA 4CRFA 2FEQH 1JRTA 4MVNA 3H7OA 2HPQH 1J16A 1BJVA 3N7EA 1O33A 1W13U 3Q3XA 1NFYA 1WOFA 3A87A 1GBIA 4OGXA 3P17H 4TWYA 3LPRA 3ATLA 3RXLA 1TMTH 1OKXA 1O2QA 3HGNA 2RA3A 2HVYB 3PB1E 5DO4H 1P12E 1OYTH 2ZFPH 3UNRA 2ZO3H 2OLGA 1E1RD 4H6SB 4Z6AH 1IQKA 2BLVA 1O0DH 3UY9A 1LCYA 4ABGA 1O3BA 1AMHA 1UHBA 3EQ0H 3LDXH 4YZUA 2VWMA 2C4FH 2BXTH 3U8OH 2B8OH 2VH0A 3S9AA 4UONA 1W8BH 5EJZA 1PFXC 1UVPA 4MQAA 2XRCA 4OS6A 2GJGA 4KTUA 1JBUH 3F9GA 1SI5H 3RXRA 4A1VA 1IHTH 2J94A 3K65B 3M5MA 3OAAD 4ZAEA 4ABHA 2B0FA 1TOCB 2HALA 3ZYEA 1ELDE 1O2TA 4D9QA 1V2JT 3ZZ4A 1FONA 1ZGIA 1NRNH 3F9FA 1Z8JB 3CNRA 1GMDF 1AQ7A 1PPEE 1TNKA 2OUAA 2H9EH 2VU8E 3FAOA 4XRNA 1AU8A 4H6TA 3D23A 1CHGA 1ETRH 4DG4A 3LGIA 4BANB 1A5HA 6LPRA 3MU5A 4J1YA 1BBRE 2FOGA 1FN8A 1FPCH 2BD2A 1QRZA 2W6ID 5DGJA 2WYGA 4MNYA 3P8OA 2AERH 2LELA 1SPJA 3SJOA 1S6HA 2OBQA 1YPMH 3GDUA 1SLVB 3OY5U 2J2UA 1DY8A 1LDTT 3E0PB 4Z0KA 2RCEA 2BY9X 2M5TA 4A5TS 1EZXC 3BG4B 5FXLA 1HYLA 5T6DA 1IQLA 1QFKH 4MPWA 3HATH 1B0EA 5AFYH 1NRSH 4DT7B 4Y6DA 1SOTA 2BDIA 4D7GA 1GHVH 2L6OA 3LOXA 1TNLA 1O5AB 4LOYH 2XC4A 3SORA 3TNTA 4Q7XA 2EQNA 1BUIA 1D6WA 1H9LB 1GGDB 2C8ZB 1ANDA 4YO9A 3K6ZA 3N7DA 2ZHWH 1W7XH 2GCTB 1CGHA 3F68H 2FM2A 3BTTE 1XUJA 1HDTH 3HKIB 4X1SU 3URCA 3PTBA 2F4LA 4BTUB 5L2ZH 2W3KA 1BTWA 2B9LA 4K1SA 5C1UA 3DT0H 1HFDA 1D3QB 2BQWB 3RC4A 1MTUA 5K7RA 2P59A 6ESTA 1GI3A 3ZVFA 5I46H 1BTYA 4U2WA 1TPPA 4ZHLU 5EQSA 2R0LA 3SN8A 1O3HA 1P0SH 3BTGE 1TOMH 2WPIS 1YCPK 4OS1A 1O3FA 1BBRK 3P8NA 3I77A 2ZIQH 1O34A 5C0UA 4F48B 1C1WH 1UK2A 2BTCE 1KDQA 2F9BH 1P9SA 1EQ9A 1XUFA 2KAIB 1DXWA 3UQOA 2YMSB 2ZDKA 1S82A 2D1JA 2VVVA 5GPIB 4THNH 1YPJH 3BTQE 5EU8A 4K2YA 3DSOA 4CRGA 1C5XB 5DP3A 5A8ZA 2FX4A 3AW0A 4Y76A 1YPGH 3UPEA 3ATKA 2Y80A 3D62A 4BTIB 2XCNA 3MWIU 3Q3KA 4Q80A 1TA6A 1H9IE 1FNIA 1MKXK 2BOKA 1IOEA 3RXBA 4CRCA 1TRMA 1OXGA 3MO9A 5C1YA 3QN7A 4YXWD 2GT7A 5EIYA 1CO7E 1EPTB 1S0QA 3C27B 3HK6B 4ABEA 3MOCA 3RLWH 1G3CA 1FAKH 2QF0A 2W7UA 4NZLA 1EB1H 1DANH 2CMYA 2ZU5A 1UJ1A 4SGAE 5B6LA 4WXIA 3FP7E 1BMMH 2W5EA 1A5GH 1V2WT 1DT2A 1W10U 3UFAA 4XOJA 5A8YA 3A7TA 1EASA 4IBLH 3AAVA 2P16A 5EODA 2ZFFH 2ZNKH 2F9UA 1AB9B 2HPPH 2TBSA 1A0LA 2ZPRA 4B2CA 5HM9A 1XM1A 5DG6A 1P06A 1SR5C 5C20A 2F3CE 2ZFRH 3OSYA 3AK5A 1UHBB 3VG8A 3RXQA 1RXPA 1VITH 1YWUA 1RIWC 1C1QA 1O3GA 3RXAA 5IK2D 2AFQB 2AYWA 3LGUA 2PKAA 4AYYB 1Y5AT 1ZHMA 1ZYOA 3P6ZB 4R0IA 4H4FA 2RA0A 2WV5A 3WW7A 2FXRA 3KQBA 4RT1A 1SGIB 4ZXXH 6GCHF 1LHGH 1SG8B 1W0KD 3MU8A 1AVXA 2SNVA 1P57B 4RN6A 2FWWA 1O38A 1O2UA 1Y3UA 4RI0A 1K0HA 1BMAA 2TGPZ 1HIAA 1L1NA 3MH6A 1TFXA 1TGBA 2AGIX 4JZEH 3GISB 4ABFA 1LPZB 3NRLA 1ZSLA 5H4IB 5FBIA 3C1KA 4SGBE 2FOFA 1ZZZA 2ZKSA 3EGKH 1PYTD 1DWBH 2W7SA 1GJ4H 3M36A 1NRQH 2HNTF 3SU0A 3SU4A 3E90B 1O2OA 1NU9A 1HAVB 2WPKS 1HRTH 2ZU4A 2ZTYA 3D65E 2O8MA 2XC5A 2ZFQH 1GMHF 1G32B 2QXIA 3OY6U 5TCCA 4X2XA 1LQDB 1O2GH 1OS8A 1Q3XA 2CGAA 5EPYA 3SNAA 1XUIA 3U98H 2AHME 2ZHDA 5AFZH 1Y8TA 2CHAC 1QNJA 1V2KT 1Q2WA 5ETXA 3U69H 1CHOF 3U8TH 1DSUA 2W6JD 5F8TA 1UTNA 2BVXH 3DD2H 1KIGH 1EATA 1KXBA 1MQ6A 1HCGA 2V3OH 1SQAA 5A2MH 1GJBB 3A81A 3RXCA 1BHXB 7LPRA 1TQ7B 4YOGA 2GCHG 3MNSA 2BYAX 3N7OA 3SUFA 1HAHH 2GP9B 2I6QA 3MHWU 3SHCH 1DS2E 1GDNA 3MFJA 3GYMA 1TMUH 1AB9C 1GDUA 2SNWA 3KHVA 5BPEA 1MCTA 4WVPE 4O97A 3ZZAA 1XKBC 1C5OH 3EA7A 4AORA 1INCA 5E2OA 1ZMNA 1HNEE 3RXTA 1H1BA 3V0XA 1P8VC 2YMSC 3ZYDA 3AASA 1DM4B 2EC9H 1SQRA 4K5ZA 3MQKC 2JH6D 5A0AE 1VJ9U 5FCKA 9ESTA 4MNVA 4ACBA 1SGPE 3RUOA 3F3BA 5EOKA 2GDEH 3F9HA 4AX9H 2QY0B 3E1XB 1E79D 4B2AA 3BTEE 1QB6A 3E91A 4Q7ZA 2PFEA 3RXIA 3RXSA 5E2PA 3SU1A 1IQNA 3SOSA 2PTCE 1SGFA 4I7YH 5EW1H 1BMNH 2QXHA 1O32A 1W0YH 2BDBA 5F8ZA 3FZZA 4K3JA 3RC6A 3ZZ6A 2OC0A 1OHHD 1JMOH 1RS0A 1P03A 2BY5X 1XVOA 1GG6C 2OXSA 1EAXA 2BD9A 4P00A 3QUMP 1PPCE 1QTFA 3SGAE 4BXWA 2QE7D 3IG6B 2A4QA 1GVLA 2KR7A 2D2DA 1L2EA 3M35A 1GMCG 1O3AA 1NS3A 1OWEA 3UNSA 4MPVA 4X2YA 1NT1A 4X6PA 4GCHF 4O03A 1Y59T 1O30A 1FIWA 1WYKA 3DFLA 4OS7A 2VJ1A 4X1NU 5E8EH 9LPRA 4Y8ZA 1O2PA 5GDSH 2QGRA 2G4UA 5A09A 4HTCH 4DY7B 2JKHA 2P3TB 3QX5H 3F6UH 2H5CA 4JZ1A 2FYRA 3ODFA 1JIRA 1RRKA 2QF3A 4NSVA 4CRAA 3QGJA 3VB3A 2Y5FA 1KXCA 4IW4E 1N1LA 4XBCA 1GL1A 4BOHA 2P8OC 1AY6H 1B7XB 2F9OA 2G5VA 2GT8A 4HFPB 1OWHA 5ESBA 3A84A 1SB1H 2IN2A 2Z6BD 1C2FA 1C5VA 2BHGA 5C3NA 1CT2E 3BIUH 3NCLA 2D26C 1F7ZA
chains in the Genus database with same CATH topology
4ABJA 1PJPA 5FX5A 2P3UB 2IOTA 3VPKA 1Z8IB 2ANKH 3UTUH 1UVSH 1HAIH 3RM2H 1TONA 4LZ1H 1DVAH 1O5DH 4NIYA 3EDXB 1BCUH 4CHAB 4INHA 1TGTA 1ABJH 3HK3B 3NZIA 2ZDAH 2G55A 3KQDA 1CSOE 1WCZA 1KSNA 1DWDH 2AIQA 2CHAB 1MD7A 3M5OA 3BTKE 1GWAA 1E0FD 3BTHE 3RXPA 2FX6A 1TGNA 3L6PA 1YBWA 1XX9A 3PO1B 2DE8A 4A1TA 1O2HA 1FY8E 1TX8A 4B2BA 2IPHA 3RM0H 2V0BA 1ZTKA 3HPTB 1THRH 1NU7B 2EI8A 1TX6A 2OP9A 1O5FH 1P04A 1GGDC 4WMEA 2A5IA 5EG4A 3SNCA 1AKSB 2JETC 3PWCA 4B1TA 3GY2A 4E7RG 3T28A 1UTMA 4BAHB 2GGVB 4UE7H 2ZDNA 2TPIZ 4Y10E 3ZV8A 1MAXA 1C2DA 3LONA 2VH6A 6CHAB 1DITH 1SFQB 2AS9A 2Z3EA 4ISHH 1EP5A 1IQGA 5GIBA 5C5NA 3CP7A 3TGKE 2FTMA 4HI3A 2PKSB 1HXEH 1HGTH 1THSH 1YPLH 3SUDA 1P2JA 3F1SB 1C9PA 4BAQB 1F0RA 1VCPA 1XMNB 4FUCA 3NPSA 1ELCA 4ABDA 5BRRE 5JB8S 3O8BA 1GJ6A 1ACBE 4YT7H 2BXUH 4TYDA 4QT8C 3FZDA 3RU4D 2A32A 4K8YA 2JH0D 2BOHB 2QYIA 4TPYA 2WPJS 2O8TA 1NN6A 3GCTG 5C5OA 1O3OA 2PWXA 2YOLA 5AF9H 1T8OA 1GVKB 1BTXA 2A5KA 2FODA 1W2KH 1VGCC 1GJ8B 3U9AH 5K0HA 2ANWA 2W3IA 1UVTH 4FVBA 3S0NA 5EGMA 4IGDA 1HBTH 2B7DH 2J4IA 1RTKA 3P8FA 3SJKA 5FBEA 1O2KA 1SGDE 8LPRA 3RXOA 3MH5A 3QK1A 3EAJA 2ZEBA 1HAYB 2NWNA 3M3VA 1L0ZA 3A86A 2AMQA 6GCHG 3M5LA 2BX4A 1C2IA 1RGQA 3KL6A 2PLXA 5A0BA 1L4DA 3M5NA 1GBMA 2C8XB 1PPZA 4O9VA 5DK1A 2BY6X 4WXVA 5DPAA 1ANBA 2C3SA 1AUJA 2V6NA 1FPHH 2ZDMA 1MTSA 1Y5UT 2P3FH 3H7TA 1GJDB 4K60A 2QA9E 3MH7A 1QBNA 1GJ7B 1AE8H 3LC3A 5EPNA 3ZVDA 2PW8H 2V35A 3M3SA 1A4WH 2PSYA 1GJ5H 2AMDA 2ZU1A 1S0RA 3TGIE 1GHXH 1CT4E 1HAVA 2XW9A 3OTJE 3I29A 1VITF 2ZFTA 4INKA 3CS0A 4X2WA 3V13A 4DCDA 1MZDA 3ESTA 1YM0A 3MMGA 2HWLB 1C5SA 1ETTH 1TX7A 2NU0E 3EA9A 1MMJN 2SGDE 4M7GA 5CMXH 1GBKA 2A7CA 4R8TB 1C2JA 2BM2A 1LVOA 1HJ8A 1C1PA 1C5PA 1XUKA 2BDGA 3S7KB 4UFDH 2FOBA 2J38A 3KQCA 1L4ZA 1OX1A 1XUHA 3PTNA 1P11E 3TVJB 2CF9H 3JZ2B 1DLKB 2P94A 2ZCKP 4X2VA 1GCTC 2O8WA 3SI3H 2YNBA 5FPSA 1DLEA 2DE9A 2BDYA 1ZHRA 3T26A 5G4BA 1NPMA 2VGCB 3UREA 4CR9A 4YM9A 1FY1A 5AVDA 3TH2H 3FVFB 1LTOA 1BJUA 1W3CA 3SV6A 3E16B 2AIPA 3A85A 1QJ6B 1MBQA 5C67A 1J15A 3B9FH 3BN9A 2WUBA 5F6MA 1ETSH 4JYTA 2C8YB 2AEIH 3KNXA 5HM2A 3AVZA 1NESE 2A4RA 1V2RT 1G3DA 1GG6B 4I8KA 1VZQH 1MBMA 2FZZA 1O3JA 3FFGA 1GJ9B 2EEKA 1BITA 2BLOA 3ENSB 4NGAH 3RXFA 3A7WA 4E7NA 1SGEE 1N6XA 3GY8A 3Q3YA 3W94A 1ZTJA 4B76A 1TPSA 1LPKB 3SUEA 1GBFA 4Y7BA 3ZVAA 1EAWA 2AH4X 3EYDA 1ID5H 2VWNA 2NU2E 1F0SA 2STAE 4U30A 1LQEA 2BD7A 4CHAC 5LH8A 1LHEH 4FUEA 1BT7A 1OWIA 1KDQB 2PR3A 2Z3DA 3TIUA 1QBOA 2PGQB 1BQYA 2R9PA 4UFFH 3RXVA 3ZZ7A 3S69A 3DHKH 1Z7KA 2G52A 2H6MA 4U01A 2J92A 1GBAA 3RC5A 1P3CA 2HNTC 4Y79A 3VXFH 3QTVH 3PM3A 2ALVA 4K1EA 4X6MA 1SLXB 1FIZA 1ZHPA 3M7TA 3SNEA 3VXEH 2BY8X 1YPHC 1T31A 1SL3A 1O3LA 2VIWA 2ULLA 3M3TA 1GHAF 3RXGA 1NZQH 4X8SH 4YESB 1JRSA 2SGQE 4B71A 1ELBA 3ZZ8A 1GMCF 1SHHB 2ALPA 3V3MA 3TK9A 2TIOA 2WINI 1DE7H 1A0HB 1ZR0A 1V2MT 2BQ6B 3DA9B 4ZKSU 1GCDA 5F03A 2BY7X 2F9NA 3RDZA 7ESTE 4ZKRU 1NC6A 1SOZA 2WV4A 3NWUA 2ZC9H 3D49H 5EXNA 4DURA 5LPEA 4JYUH 1P09A 1ELGA 1O3CA 1SQOA 2A31A 1AUTC 3GY3A 2CN0H 1C2HA 2Q1JA 1BTZA 4ISNA 3RU4E 5GWZA 1S5SA 1AI8H 1S85A 2ZQ2A 4ISIH 4YLQH 1E35B 3ZZDA 1NRRH 1EJNA 2FOMB 2TGDA 4UEHH 4F49A 1UTOA 2HGTH 1C1SA 1VCQA 2VB0A 1G37A 2FLBH 1TAWA 2ZWLH 1TB6H 1KLJH 2GDDA 1NFUA 3A89A 1EZUC 3RXJA 4AYVB 1C5UA 2ZCLP 1Y3XA 5SGAE 1GHBF 3NXPA 3SJIA 4FUJA 3NK8A 4ZKOU 2ESTE 1OP2A 2PKAB 2TGTA 5TJXA 3BF6H 2G81E 5AHGH 2F9PA 1JOUB 1C9TA 2XYAA 3ZZ9A 1C1MA 1EJMA 2ODQA 2QN5T 1QRXA 1HXFH 4MTBA 3LIWA 1UTJA 1KXFA 1ABIH 3Q76A 3MTYA 4DVAU 4D7FA 2FTLE 5DP7A 3SNBA 4DOQA 1Z8RA 1K2I1 1A3BH 3L33A 3BEUA 5C1XA 1GBHA 1K1NA 1DUAA 3NUMA 1TNIA 1C1NA 3AW1A 1FZZA 5PTPA 3SQEE 1GL0E 3WY8A 1O3PB 3NKKA 3PMHB 2A0QB 4I8JA 1K1PA 3U8RH 3FP8E 1E36B 1RTLA 2A4GA 1J8AA 1K1LA 4E05H 1IAUA 4I32A 1BB0B 3B8JA 2Z9JA 2FOEA 2R2MB 3PMAB 4E06H 1FMGA 3A7VA 1O5CB 4FU8A 2Q6FA 4PROA 1SGCA 3RXMA 4NA9H 3TU7H 3BTWE 1UVUH 3ZZCA 3TLOA 1HB0B 4JZIA 1C5ZB 4OS4A 1BTHH 1D3PB 3HKJB 1TMBH 3A8DA 2PTNA 2QC2A 1SQTA 1T8MA 1WU1A 1UCYH 3L3TA 4CBNA 1P2NA 1BTPA 1C1VH 2VWOA 3QDZB 1K21H 1QJ7B 1IQEA 4D76A 1HJ9A 3RXKA 1ZTLA 1DX5M 2O8UA 4AZ2B 1C2MA 2Z94A 2ZDVH 1TWXB 1SGTA 4A7IB 1O3DA 1NRPH 1V2OT 3LC5A 1YC0A 1IQMA 2IJOB 4B74A 1WQVH 3QZQA 2ZDLA 2FI4E 1C5LH 1BHXF 2DUCA 1DXPA 2BB4A 1GBJA 2J9NA 3TK6A 1G3EA 1T4UH 4RKJB 2A2XH 4JK6A 1P2MA 1GI5A 5T6GA 3M37A 2PUQH 1AVWA 1LVBA 3FANA 4ABAA 1DICA 2GCHF 3OX7U 1LKAA 4K69A 2AGEX 1RIWB 1N8OB 1FV9A 3A8CA 3RMOH 2ZGBH 1TLDA 4K1TA 1LHDH 5GCHF 1DDJA 4CR5A 3SW2B 2OCVB 3GICB 3URDA 3MI4A 3QO6A 1QCPA 1SGYE 1T32A 4ZKNU 2VIOA 4KELA 1QL8A 3MU1A 7GCHF 1HAOH 1TIOA 1GI4A 1SC8U 5JPMH 1YPHE 1DFPA 4BNRA 5A8XA 1QGFA 2PSXA 3R3GB 3T27A 1D9IA 5DP4A 1GI2A 2ZG0H 3RP2A 3R0FA 1QBVH 2FOHA 3GCOA 2XWAA 1RTFB 2QCYA 4WMFA 4Y7AA 2THFB 1VCWA 1DWCH 5E0GA 3S9BA 1KXEA 4Y0YE 1XVMA 1UK4A 2BZ6H 3UNQA 4A92A 3U1IB 3A80A 1GI1A 5ESTE 2V3HH 1EOLA 1VITG 2FIRH 3RU4T 2ZGXH 1FXYA 3A8BA 4BAOB 1GI9B 2A7JA 3PROA 4AGJA 1ZRBA 1W12U 1AVGH 2CJIA 2BDHA 1IQFA 2H9HA 4Y0ZE 2Z9GA 1AN1E 4TY7A 3MYWA 1QB1A 3MNCA 4JK5A 3E3TA 4NG9H 1SLUB 2GKVE 1XXFA 1W7GH 1A1RA 1YPEH 3RXHA 4LZ4B 4NA8A 7GCHG 4ESTE 3SV9A 3P92A 4X1PU 3SU5A 1VR1H 1BRCE 5FHTA 1MKWK 4YT6H 1M9UA 2O8LA 1K1JA 2A5AA 4GCHG 5JBTA 1MU8B 1O39A 2HLCA 1NTPA 3EE0B 4YLUA 1P02A 2GTBA 1HUTH 3KEEA 1EPTC 3TJNA 1Z1JA 2BLQA 1CU1A 1EZQA 5CHAB 2BD4A 4X6OA 1FJSA 1O2LA 2CV3A 2OTVA 4FVDA 1C5NH 3ZVGA 1UVOA 2BD3A 1HAGE 1PQ5A 1P3EA 1C1TA 3M7QA 4BTTB 2Q6DA 1BZXE 1O5EH 1GBLA 2ZHQH 2F83A 2WPMS 1C5QA 1CVWH 4GSOA 1ELAA 1S84A 3TH3H 2ZZUH 1F2SE 3E6PH 2CF8H 1TGCA 2BX3A 1AIXH 4AG1A 5T3HA 2UUJB 1LMWB 2QXJA 4BAKB 1OPHB 1O2XA 2OINA 1CE5A 1O2VA 3A83A 4X1RU 3IITA 4X1QU 5JBAS 1O3KA 2WPHS 1SFIA 4HZHA 5F8XA 4MG3A 3MU4A 1WV7H 1BTUA 2J95A 1CA0C 4ZH8A 3VGCC 4AOQA 2ZA5A 2ODPA 2ZHEH 4JZDH 4GUXA 5JBBS 5EQRA 3SHAH 3BIVH 2PKSC 1C4Y2 1TQ0B 2HVXA 4GLYA 4CH8B 4WMDA 1SBWA 1SMFE 1FN6A 2HOBA 1O3EA 3GOVB 2UUKB 4X6NA 2ASUB 1DUEA 2SGFE 4KP0A 2YNAA 3A88A 2WYJA 1G2MA 4Y11E 1QL9A 3BTME 1EXFA 1GHZA 2GZ8A 3UUZA 1QA0A 2Y7XA 1GBEA 1RD3B 3JZ1B 1U6QA 3ODDA 1ZMJA 2Y6TA 4MPUA 4WF8A 4AG2A 1XUGA 4NA7A 1TNHA 1YLCA 1S83A 2XCFA 1F0TA 3BG8A 3DUXH 1MTVA 4UDWH 3QWCH 3SO3A 2ODYB 4I8HA 2EI6A 1L1GA 1K1MA 1QR3E 3SU2A 5TCAA 2PHBA 2ZU2A 3DFJA 4XSKU 4RKOB 3AAUA 3QLPH 1DY9A 1GI0A 1E37B 4F4OC 1ESAA 1WUNH 1T7CA 1PYTC 4NWLA 1OWJA 3PLPA 1YP9A 2C93B 4ZUHA 3GY5A 1FUJA 1ZRKA 3Q77A 4LXBH 1V6DA 4AFUA 2ZGHA 1ESBA 4X8UH 4UFEH 1OP8A 2ZCHP 1RJXB 4GPGA 3SI4H 1WQSA 2TGAA 2UWLA 1A0JA 4Q2KA 1UTQA 2ANMH 1G30B 1NY22 1TNGA 1PPBH 3S9CA 1C5RA 1ZPCA 1GI7B 1Y3YA 2HRVA 3FP6E 1LO6A 3K6YA 3SGBE 8KME2 2Z9IA 3S7HB 3RXDA 3PYHA 1DOJA 4ZXYH 3LJOA 2VGCC 1Q31A 1SHYA 1T8LA 3ZZBA 1TPOA 2FI5E 3PV4A 2EA3A 3A8AA 4ABBA 1GCTB 1VGCB 5HMAA 4XDEA 2FO9A 4BXSA 2HNTE 2ZFSA 4JMYA 3TGJE 1GVZA 4O3TA 1OWKA 1CQQA 1THPB 8GCHF 5L2YH 1P2QA 3LGVA 5JB9S 1SGFG 4VGCC 1C5YB 4JZFH 1ZSKA 1H9HE 3SU6A 3T29A 2UWOA 1V2NT 1AZ8A 1C2GA 3K2UA 1AGJA 4XE4A 3UOPA 3HGPA 1HV7A 3A82A 1C1OA 3TH4H 3W95A 2FS8A 1IHSH 2FS9A 3RMMH 4MLFB 2Y7ZA 1Z8GA 2GX4A 4FUIA 1GBBA 3P8GA 4AB9A 1QHRB 3STIA 1ELVA 1UCYK 4OS5A 6CHAC 2J34A 1ZPBA 4NWKA 3TJOA 1O2MA 1GPZA 2RG3A 3ELAH 1KYNA 4XBDA 4CRDA 4ZMAH 3GYLB 1YCPH 2H5DA 3G01A 1ZGVA 3SV7A 2G5NA 5CE1A 1MTWA 1C4U2 1OP0A 3SUGA 1A61H 3GY7A 1GBDA 2ZU3A 3VB7A 3GY6A 3LH3A 2VIDA 1K9OE 5B6OA 1P9UA 2OC7A 3KN2A 4X0WU 2XBXA 4TPIZ 1V2PT 2PUXB 1GDQA 1MD8A 2GMTB 2P93A 3PO1C 4CBOA 5T6FA 1O35A 4FUHA 2SGEE 1CA0B 3VGCB 5L30H 1GI8B 2OQUA 5JBCS 2UUYA 1O2RA 5J4QA 1NFWA 1AFQB 1CBWC 2FMJA 4X8TH 2JETB 3LU9B 3LH1A 1V2LT 2D8WA 3MO6A 5GCHG 2BVRH 1MKXH 1EAUA 1MQ5A 1YKTA 2TRMA 3RXUA 1OYQA 1TGSZ 3SBKA 2Z9LA 7KMEH 1F5RA 1BDAA 2GVFA 4WY3A 1C5MD 1WTHD 2C8WB 2PV9B 2BVSH 1MTNB 1OSSA 5DP6A 2ANYA 4DIHH 5DP9A 1O2IA 2A4OA 1CT0E 1ARCA 4KTSA 2P8OB 1O36A 4ISLA 4KGAA 4GHTA 4CREA 5GXPA 4H42U 1OOKB 1ELTA 1EZSC 1ANCA 1C4V2 2WUCA 3IWMA 1ZJDA 1YYY1 1AWHB 5JYIA 4YOIA 2K1QA 4HGCA 3V7TA 4BAMB 1UO6A 3SQHE 1AO5A 1RFNA 3SV8A 2AGGX 3A7XA 1C1RA 3BEIB 1QURH 4Q7YA 1BRUP 1A46H 5HGGA 4DW2U 5DJ7A 1G3BA 1GHYH 1TA2A 2LPRA 2BLWA