4ABDA

Fragments bound to bovine trypsin for the sampl challenge
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords CATIONIC TRYPSIN
publication title The Dingo Dataset: A Comprehensive Set of Data for the Sampl Challenge.
pubmed doi rcsb
total genus 58
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2011-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4abdA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4abdA02
2FOAA 3ENSB 1QBOA 5E0GA 3ZZ8A 2FI3E 2ZQ1A 1SGCA 3F6UH 4WXVA 2HLCA 2WPIS 1L0ZA 3E8LA 4HTCH 1TGTA 2ZPRA 4JMYA 1GHVH 3MWIU 2RCEA 2GV6A 4X2YA 1AGJA 1O3AA 1GI4A 1NS3A 3EA8A 2A2QH 1IQKA 1KY9A 1AHTH 3MH7A 2KAIB 1O2WA 3MH6A 1SFIA 3NUMA 1G36A 4TWWA 3SNAA 3SJ9A 1CHOF 2EI6A 2GD4B 2R3YA 5EXMA 2ZZUH 1ZPCA 5JBAS 1RGQA 2BY8X 1UVPA 1DE7H 1Y3YA 1A2CH 3ZV9A 1ARBA 2FPZA 2GMTC 5K0HA 1XMNB 3E90B 1SQOA 3D65E 3UNSA 2BD4A 2ZG0H 2PTNA 1GMDG 1F7ZA 1UCYH 4R0IA 1CA0B 4NA8A 5C20A 2C8XB 4UDWH 2GZ9A 1ZSKA 4WF8A 1XUJA 3IWMA 1UTMA 1EOLA 3LJJA 2ZGHA 4GUXA 1P2OA 3DT0H 2O8MA 1DITH 2F9UA 5AFYH 4FUIA 4Z6AH 3RC4A 3UUZA 1UTOA 1SGIB 1GI2A 1PJPA 4DOQA 2W7SA 5AHGH 1BBRK 1K1NA 2C8YB 1OWKA 3TH3H 1GBLA 1FDPA 1RS0A 1BHXF 1C1UH 2PLXA 4Y10E 1FN8A 3P8OA 4K1TA 3UWJH 2XNIA 1YPJH 4IGDA 2JH5D 4ZMAH 1RIWC 5DK1A 2D1JA 3EYDA 5L30H 1NFWA 1O5EH 3ZVGA 2B5TB 4YT6H 1LHCH 5F8XA 1K1JA 4IMQA 3LGVA 3RU4T 1EUFA 1CGHA 4K8YA 3TIUA 3O8RA 1DLKB 2G8TA 1Y5AT 2J38A 2Q6GA 4X1QU 3MNXA 1E38B 3C1KA 3LGUA 2Y81A 1TGBA 1BQYA 1TPOA 4ABDA 1V2QT 1V2UT 1GL1A 1O5DH 1JWTA 4A1TA 1O0DH 5GWZA 1XUGA 1GHAG 1BMNH 1AVGH 1K1IA 2QXJA 4TWYA 5JYIA 1XUFA 1O5CB 1THSH 1T4UH 2ZEBA 4Y6DA 3ATIA 5SGAE 2V6NA 3TK6A 2A5KA 2UWPA 4E06H 1E37B 1C5SA 2GZ8A 1XKBC 3F9GA 1MKXH 1P2QA 2OTVA 1HJAC 3HPTB 5DKMA 1UTLM 3BG4C 4WXIA 2TPIZ 1T7CA 2ZGJA 1SBWA 1ACBE 3SGQE 2VB0A 1HIAB 2GCTB 3KGPA 2ZDVH 2SNVA 1MZAA 4ISNA 4NZQA 1GI5A 4AZ2B 1LTOA 2QAAA 5HM9A 1VJ9U 1BITA 3KL6A 4I8GA 4K60A 3ZVEA 1C1WH 2FMJA 1THPB 1K1OA 3GCHC 4NA7A 3KNXA 1EB2A 1ABIH 2ZQ2A 2CGAA 2UWLA 3C27B 3P70B 1FPCH 1N6YA 3GOVB 1UJ1A 1FY8E 1O2ZA 2ZTYA 1JIRA 1OP8A 5F6MA 4DURA 1SLWB 3AAUA 3K9XB 1GBMA 1OP2A 2WPMS 3S0NA 2A4QA 1PQAA 1TMUH 1LQDB 1BMLA 1N8OC 2GTBA 1ELVA 3SU0A 4FXGH 3BEIB 3URCA 4Y8YA 4YLQH 4B2CA 1WTGH 3NCLA 1GHBF 4NSVA 1V2PT 2Z9JA 4D7FA 1TPSA 2WYGA 1BTUA 1T8OA 2PUXB 2UWOA 1NFUA 1GL0E 1C1OA 1SOZA 2AIQA 1EOJA 4AG2A 3GYLB 1YLDA 1TLDA 1MU6B 1O3LA 1C5TA 1WOFA 2P3TB 3K6ZA 3M5MA 5GJ4B 4TY7A 3ZVCA 1UK3A 1Z1JA 3ELAH 4RN6A 3RMOH 1HBTH 1A0HB 2XYAA 5FXLA 1MTSA 2G52A 1P9SA 2A5AA 1O34A 1JOUB 4GHTA 2FX6A 4K2YA 1Z8RA 2B0FA 3EA9A 1S81A 1YP9A 1TGSZ 1IQEA 4AFUA 1UK2A 2ZKSA 4AGKA 1CHGA 4WY3A 5TJXA 5F03A 1TNGA 1TX6A 2AIPA 1QBNA 3QGNB 5JB9S 1QQ4A 7ESTE 4ZHAA 1EAUA 1UTNA 5DP4A 3SNCA 1GJ6A 4Q80A 1BTPA 1OWEA 3GICB 4UE7H 1DSTA 3NKKA 2BDHA 3UR6A 2ZGBH 3VGCB 1RTLA 3EAJA 3TGIE 4CHAB 3T25A 3SUFA 1KTSB 2HGTH 3SU4A 1S5SA 5GPIB 5DP6A 4CRDA 4X8VH 1C2GA 1VITH 1Z6EA 1MMJN 1KDQB 2ZHWH 1Y3WA 2GKVE 2H5DA 2QA9E 3OTJE 2B9LA 1ORFA 2AMPA 1HAPH 3P8FA 3QTVH 3F9HA 2HNTF 5HM2A 3JZ1B 4B2AA 5BRRE 1KTTB 3UTUH 3RXIA 2ANYA 1YPLH 4KTUA 4DW2U 4ESTE 1F0SA 1V3XA 4BXWA 2ZFQH 1AVWA 1HRTH 1O2YA 4Y7AA 4Q7XA 6LPRA 4DT7B 3QN7A 1C5PA 4AYYB 4CREA 1QJ7B 1CQQA 4B1TA 4ZHLU 1GJCB 3KQBA 3P95A 2W3KA 1O35A 2ZU5A 1GBCA 1GDNA 2QY0B 5FPSA 2Y80A 1FY3A 3RXQA 1AU8A 3V0XA 1DY8A 1DWDH 1HXEH 2BQ6B 2XW9A 2ZPQA 2ANMH 1W13U 3RMMH 3S69A 2AS9A 2F83A 1V2MT 4CBNA 1YPKH 3NXPA 1LHDH 1ARCA 2VJ1A 1SQTA 1G32B 1ZHRA 1UHBA 1G3EA 1TNIA 3U1JB 1UCYK 2AEIH 2AH4X 2Z7FE 1NESE 1BCUH 4D76A 2SNWA 2A5IA 3ZZ7A 1O2OA 4BXSA 1K9OE 1GI7B 1K1LA 3Q3YA 3A89A 1BBRH 1ZSJA 1HAHH 4BAHB 1Y3UA 1AD8H 2ZIQH 4BTUB 1QB9A 4H42U 5E0HA 4JYVH 2J9NA 2BQ7B 1QL9A 4ISHH 5E2PA 1C1VH 1O2RA 3QO6A 4NIXA 4Q7YA 5HYOA 3TVJB 1RTKA 2BY9X 2F9NA 1NU7B 5A8XA 1B0FA 1GMCF 3PMAB 1O3FA 1VITF 2H5CA 5HGGA 3M3TA 3CP7A 1GBHA 1P2IA 1UO6A 1TX8A 1MQ5A 3SJOA 5GXPA 1P03A 2BDCA 1WQVH 2EC9H 4DCDA 1ELFA 5C5OA 2HWLB 1QJ6B 1KXBA 2PHBA 5DPAA 3E91A 5C3NA 4Y71A 3KEEA 1QIXB 1XXFA 1SGDE 1KLJH 1TYNA 1ZLRA 1W3CA 2HOBA 3TITA 3KIDU 1P2MA 1SVPA 2Z94A 1N1LA 4MNXA 4U30A 1KXEA 4IMZA 1F5RA 2WUCA 3S9AA 1C9TA 1TBQH 3SQHE 1Z6JH 2Z3CA 1FONA 1FI8A 3EGKH 1DWCH 1OOKB 2H2ZA 3S7KB 4KELA 4X2VA 1FIZA 3GCTG 1TRYA 5BPEA 2W3IA 2UUJB 1O2PA 2ESTE 4BNRA 1F0TA 3O8BA 1XM1A 3A7WA 4KGAA 3M61U 1L1NA 2ODQA 1LCYA 2CJIA 2PUQH 2BLOA 1QHRB 2VH0A 1S83A 3LGIA 1LHEH 3ZZ5A 2VVVA 2ZNKH 4WJG2 1HNEE 2Z3EA 5EQSA 3MO6A 3MNCA 5JPMH 4A1XA 4ABGA 1FY4A 3GY6A 3H7TA 4X2XA 3KQEA 2UUFB 3TJOA 1NY22 3UOPA 2VGCC 2IJOB 3NZIA 4MG3A 5EODA 1DLEA 1IHSH 5L6NH 4DVAU 2R9PA 1LKAA 2HPQH 2PSYA 5EW2H 1G3DA 1Z71A 5EGMA 1AFQC 2Y5FA 4UFEH 1IQLA 4I8HA 1AWHB 3FVFB 3M5OA 3GCNA 3SNBA 1VCWA 2QV1A 2A45B 2BX3A 1GWAA 3ATWA 5E2OA 1WYKA 3RXSA 4KTCA 3FP8E 2O9QA 3GISB 1BRUP 4OGYA 2Y7ZA 4WMEA 2ZFTA 1ZSLA 2JH6D 3MNSA 3LC5A 4WH8A 1CT4E 2STBE 1W8BH 1S0QA 1RJXB 1A0LA 3M3SA 1GMHG 2WPHS 1AQ7A 1C2LA 2ZFRH 4IC6A 2M5TA 4GLYA 3K2UA 5FPYA 1ZMLA 1P3CA 4BAKB 1IQGA 2A7CA 1JRTA 1FN6A 4FU9A 4TY6A 1TNLA 4YLUA 5J4QA 2WPKS 4XBCA 1F5KU 2FDAA 1K2I1 2ZDNA 1JBUH 3ATLA 2FIRH 2NU2E 2VIQA 5T6DA 1ESTA 5A0AE 1GHWH 4GCHF 4MPXA 3M37A 1AE8H 3QX5H 3F9EA 1S6HA 3SU6A 5LGOA 3URDA 3VB7A 4AG1A 2ASUB 4FUFA 1SLUB 5E8EH 1EASA 1TBRH 2BY7X 1HAGE 1C5QA 3ATKA 4MNVA 5B6OA 5FCRA 4VGCB 4F4OC 1NM6A 1F2SE 1SGPE 2JH0D 2C4FH 1HAVA 2BDYA 1DICA 1V2LT 1G9IE 1CBWB 1CE5A 4NWKA 1C2MA 1TONA 1Z7KA 3BIUH 4SGAE 3T29A 1JXPA 2BD9A 1KLIH 2A7HA 2PKSC 2FOCA 5DP8A 3MOCA 4UFGH 2THFB 3W94A 5A2MH 1C5OH 4AYVB 2XC0A 4DIHH 1A5IA 1C2IA 4E7RG 2R0LA 2WUBA 1EZUC 1GGDC 4X8SH 1UTPA 2GP9B 2VWNA 3HATH 1O5BB 4TPYA 1P10A 3LONA 1ANCA 1Z1IA 2G51A 4DG4A 3L6PA 3STIA 1GJ9B 4RKJB 3M7TA 5EPNA 2RA3A 4HZHA 1RXPA 4B71A 4Z0KA 4X2WA 1UMAH 4WH6A 3UQOA 1XUHA 1E34B 5ESTE 1DX5M 4YOGA 1UCYE 1YCPM 5T3HA 1EAWA 3A7YA 1VCPA 2GDEH 3PM3A 1TMTH 1V6DA 2FOFA 4JYTA 3VFEA 1LDTT 2ULLA 2G55A 2UUYA 3ODFA 1IQFA 8LPRA 1TOMH 2H9EH 2OQUA 4XBDA 7GCHF 3SW2B 2ZTXA 1TQ0B 1DVAH 1MQ6A 4YOIA 4XE4A 1P05A 2JETC 5A09A 2SGPE 1XKAC 4CR5A 2BLQA 1WQSA 3GY2A 2FOBA 1GI3A 3BSQA 4TYDA 4UD9H 4AFZA 1C5WB 1TNHA 1GBBA 1TA6A 1DANH 1ZMNA 4NZLA 1P57B 2OP9A 3KQDA 4X1PU 3MTYA 4GPGA 4ABEA 4JZDH 3F1SB 2ZI2H 4X6MA 1GBDA 3GYMA 4MPWA 2ZHDA 3BF6H 5I25A 2F91A 2O8UA 1AKSA 4AORA 1LVBA 1TPPA 2BLVA 1O5AB 1AFEH 1NFXA 1TAWA 3SUDA 3VEQB 1OXGA 2C3SA 2ZU1A 1O2VA 1QY6A 4JK5A 2R3UA 2GV7A 2VIWA 1OS8A 2OC1A 1TALA 1O36A 1CSOE 2FM2A 3S7HB 1L4ZA 1HXFH 4K8BA 1PYTD 1YPEH 1V2RT 7KMEH 5FHTA 4ABAA 2STAE 3RXAA 4JZ1A 3PMBB 2FOHA 5CMXH 5DP5A 1O2MA 3N7OA 1W0ZU 1ANBA 1GPZA 1SGQE 1O32A 1ETRH 5T6GA 3I29A 1YGCH 3A8AA 1ZGVA 3A7VA 1YCPH 2DE8A 3QTOH 4FUJA 5IYTA 4BANB 2PGQB 1G2MA 1HAYB 4INKA 1W7XH 1O31A 2ZCHP 3A82A 3RUOA 3LIWA 3SHAH 5EQRA 4WVPE 1O2JA 4ZAEA 1T8MA 2D8WA 1Q31A 2NU0E 3LT3A 2GCHG 1SGFG 5EXLA 3MFJA 3T28A 1YLCA 3DA9B 3VPKA 1O3EA 3U8RH 2PKAB 4IN2A 2R2WU 5E0JA 3MH5A 4IS5A 2OC8A 1SMFE 3TNSA 3U69H 3SN8A 2J34A 1C1SA 3SQEE 5C1UA 1EATA 3ZYEA 2OQ5A 3P17H 3V3MA 1LO6A 3RXHA 2SGDE 2HNTE 1O5FH 4FUHA 4AFQA 1BZXE 2A32A 2F9OA 1PFXC 5GCHG 3FFGA 3Q76A 5FBIA 4UEHH 1EJNA 2BZ6H 4WMDA 1CVWH 2GCTC 4Y76A 2OLGA 4MPUA 4ABFA 1BA8B 1FXYA 1O39A 1GBAA 4I7YH 4O9VA 4THNH 1AO5A 1S82A 2AGGX 4YT7H 1NRSH 3ZZ3A 4RKOB 4I31A 1GJBB 5L2ZH 1NN6A 2H9HA 4A1VA 1P8VC 1TBZH 5EG4A 3BIVH 5EU8A 1BRAA 3GCHB 1ZZZA 1S0RA 1G2LA 1V2OT 4AX9H 3A8BA 3PLKA 2NWNA 2F9PA 1O3CA 4HGCA 1GJ7B 3SJKA 3RXRA 1D3DB 4Q2KA 3ZZAA 1HGTH 3KN2A 3T62A 3U1IB 1C4Y2 1BRBE 4NSYA 3RU4D 3WY8A 1PPFE 1FNIA 4FUGA 5C1YA 4JYUH 3M3VA 1K1MA 1L1GA 2BD2A 3BTTE 3NWUA 1YPHE 2XWAA 3DFJA 1BTHH 3E3TA 4I8KA 2I6SA 3D49H 1PPBH 1MBQA 3QZRA 3SHCH 4BOHA 3BTDE 3RMLH 2BXTH 1O2XA 1LVOA 1QGFA 3MI4A 4M7GA 2PWXA 1DXWA 1K1PA 2A7JA 1CHOG 2OBQA 4CBOA 2IOTA 4DGJA 2Q1JA 2F9VA 3PLPA 1QL8A 4HFPB 4F49A 2ODYB 5FX5A 1NRPH 3RLYH 4FVDA 2IPHA 2Z3DA 1LVYA 1GG6B 2Y82A 3RLWH 2VH6A 3A7XA 1D3PB 2TGPZ 3S9BA 4XOJA 4BTIB 4XFQA 1ZRKA 1DDJA 3GDVA 6ESTA 1UVUH 1GHXH 2V3HH 3AAVA 2ZFSA 1SGEE 3AASA 5DJ7A 5C1XA 2BOKA 2ILNA 1SG8B 1FLEE 2A4OA 5EOKA 3ZZ4A 2C8WB 3A85A 1P01A 2FWWA 2FOMB 1EAIA 1O3KA 5AFZH 3TGKE 3Q3XA 1AMHA 2GGVB 1F92A 1PQ8A 1DY9A 1J9CH 2SGEE 2B8OH 2BDGA 1OYTH 1QB1A 1C2EA 2AGEX 1ZR0A 2VIDA 1AUJA 1OWHA 3I77A 2ZCLP 1B0EA 2ZWLH 1AB9C 1J17T 5A8ZA 1EPTA 1HAOH 3TK9A 1WAYB 1BTWA 3V12A 3VB6A 5GDSH 5LH8A 1TMBH 4AOQA 1IAUA 2PGBB 3LH3A 2A31A 1MAYA 1GHZA 2ZGCA 3ZZ6A 1CGJE 4O03A 1SL3A 3TH4H 1GJ8B 1EZXC 1VZQH 1K22H 1MH0A 1BUIA 5TCCA 4D7GA 1WV7H 3EDXB 1DM4B 3P6ZB 1AZZA 3RXLA 1TOCB 1C1RA 5DG6A 1B5GH 3K65B 1NRRH 2B7DH 1BHXB 1PPGE 1SQAA 1NO9H 1HLTH 1UVTH 2FLBH 4FUCA 2BYAX 1BBRE 4D9RA 1GCTB 1P2JA 1O2TA 3FZZA 1K21H 4Q7ZA 5TCAA 1INCA 4ZKOU 1FY5A 1IOEA 1O3BA 4MVNA 1D3TB 4CH8B 1AVXA 3PO1C 3KCGH 3HGNA 5FCKA 2PSXA 2FXRA 5DP9A 3SV9A 1CGIE 2BX4A 2ZU4A 2F3CE 2ZDMA 1S84A 1CU1A 4YO9A 1SGTA 1P0SH 5EXNA 1DOJA 1ZJKA 1ZMJA 3PB1E 5CHAB 1AE5A 2AGIX 1W0YH 1GJDB 1RD3B 2GVFA 2Y7XA 5JBBS 1SHHB 1TB6H 1KIGH 2QIQA 3GY4A 4ASHA 4BAQB 2KAIA 3BG8A 4DJZB 1WSSH 3RXPA 1O37A 4K69A 1KXAA 1BTZA 2FLRH 1T8NA 2ZO3H 1O2HA 1P06A 1TGNA 3A84A 1DWBH 1SI5H 3LGWA 1CT2E 1O2SA 1TABE 3UOUA 1O5GH 5C2ZA 1O2UA 4JCNA 1QNJA 1E0FD 1ANEA 3UQVA 1H8DH 1GHBG 3ZV8A 2XBWA 7LPRA 3QZQA 4ISIH 3AW0A 2FX4A 4YM9A 1GI0A 1YCPK 1TRMA 1W14U 2Y5GA 1XUKA 1G37A 4FU8A 1ELTA 2VINA 2VWMA 1GBFA 1O3JA 5J4SA 3VB3A 1O2NA 2SGQE 1ZTJA 3TGJE 3TH2H 4H6TA 4Y8ZA 1ETSH 3PTBA 1EX3A 1Q2WA 4I8JA 4NIWA 1NRQH 4R8TB 1FAKH 1GVKB 1W12U 3BTQE 1GVZA 4JK6A 2GX4A 2XBVA 2ZHEH 4ABJA 5ETXA 1G3CA 2ZU3A 4ZH8A 4UONA 4A6LA 2XXLA 2EA3A 1C5UA 2J92A 2SGAA 1OWIA 1XUIA 3A88A 1A5HA 1GMDF 3SU3A 4UFDH 1O3IA 1GBEA 2SFAA 5I46H 4MNWA 4X1NU 2VWLA 3L33A 1FMGA 1C4U2 3Q3KA 1BDAA 3H7OA 5EPYA 2BM2A 2NU1E 2Q6DA 3TLOA 3A8DA 4X1RU 1QR3E 2VGCB 1MAXA 1E36B 2C90B 2XCNA 1WTHD 1P04A 1RRKA 4ZKRU 3GCOA 4NIVA 2FODA 3U98H 1C5RA 1VJAU 1E35B 3MO9A 1MD8A 3UFAA 4ABBA 1FAXA 4NG9H 4AB8A 2CHAB 1SGYE 5F8ZA 1KSNA 1QA0A 2RG3A 4X6PA 1J15A 1MTNC 2P3FH 2BD5A 2QXIA 1ANDA 4U2WA 5JBCS 1KXCA 1SHYA 4WMFA 1UK4A 1GBJA 1NROH 1TWXB 5JBTA 1C5MD 5LPEA 4AFSA 2BDBA 2WPLS 3SV8A 1Y59T 1HIAA 1JRSA 2P16A 3DD2H 3A8CA 3K6YA 3MU8A 2ZDAH 1O3HA 2XBXA 2BY5X 4MTBA 3MNBA 3M5NA 3SUGA 1DSUA 2BY6X 1BJVA 3OX7U 3ITIA 1LHGH 2J94A 3UNRA 4BTTB 3BTFE 4X0WU 4BAOB 2VNTA 4LZ4B 1HDTH 3S9CA 2D26C 2OD3B 1KXDA 3ZVFA 1BIOA 1EPTC 3A86A 2H9TH 2NU4E 5FX6A 1SFQB 8GCHG 1IQHA 1FPHH 4H6SB 1C5VA 1VGCB 1GHAF 3BTEE 2AFQB 2GCHF 1DUEA 2FS8A 1A7SA 3HK3B 4KTSA 1DT2A 2ALVA 2XC5A 3KF2A 3RC6A 1EZSC 2ZU2A 1ELAA 3QK1A 5EQQA 2FYRA 3TU7H 1DFPA 3CENA 5ABWA 5G4BA 1U6QA 3R3GB 3A80A 2XCFA 3PMHB 1YF4A 6CHAC 4AGJA 1D6WA 3LOXA 1PQ7A 1V2NT 2P8OC 3RP2A 1A3EH 2VVCA 4CRGA 2ZPSA 2TBSA 3E6PH 1V2JT 1GBTA 2FTLE 1GCDA 2V3OH 1FZZA 1VITG 3L3TA 3OY5U 5AVDA 1KYNA 1QRWA 4MPVA 4OS1A 4B74A 5DO4H 3ZZDA 1YM0A 1BT7A 4K3JA 3OYPA 2DE9A 1GGDB 1A1RA 5LPRA 3LH1A 1MZDA 1YKTA 4YESB 3ZVBA 2TIOA 2FYQA 1QL7A 1UHBB 5A0BA 4XBBA 1QJ1B 3P8GA 2FEQH 4H4FA 2ZTZA 3GY8A 4Y0YE 1OSSA 3T5FH 1G3BA 2W5EA 1UTJA 2H1UA 1Z8GA 2XTTB 3SNDA 1O2GH 1FQ3A 4O3TA 1X7AC 1SSXA 2ZFPH 2WV4A 2ZECA 3MU1A 1ESBA 1O3DA 2VWOA 2Z9IA 1O33A 3MMGA 3VXEH 1LHFH 1NC6A 4PROA 5HXFA 2BB4A 3RM0H 3U8OH 1T32A 4YOJA 2JETB 2GMTB 3AW1A 4GVUA 4FVBA 4DIIH 1KDQA 4AB9A 1NT1A 1ZTKA 2R0KA 2A2XH 3IG6B 2VIPA 3D62A 4FUEA 4B76A 2O8WA 4D8NA 3SORA 1O2IA 3PV4A 2CF9H 5A0CA 2ANWA 1CA0C 1NZQH 2BD7A 1Y5BT 1SR5C 1O3GA 4NWLA 3TJUA 3RXFA 5T6FA 3P8NA 3Q77A 1EQ9A 1H4WA 4E7NA 1AZ8A 1OWJA 3MU0A 3MU5A 2TGTA 3FAOA 2BDIA 2G4UA 2ALPA 2QXHA 1LPGB 2IN2A 1HYLA 1C9PA 1P3EA 1QTFA 4YTAA 3M7QA 2W26A 2BLWA 1Z8JB 8ESTE 1EB1H 1PPCE 2Z9GA 1PPHE 1LPKB 2SGFE 3STJA 5H4IB 1MU8B 1ZRBA 3V13A 1C2DA 4K1EA 3BEUA 1RIWB 4I33A 1O2QA 1D3QB 1RTFB 2BVXH 1MCTA 4UFFH 1BTYA 1GJAB 1IQJA 5DGJA 2CXVA 9ESTA 1O30A 3SOSA 3ZVAA 4X8TH 3MHWU 3ZYDA 2BQWB 3KHVA 1HFDA 4XSKU 2VU8E 3RXKA 1SB1H 3NK8A 1YBWA 2NU3E 3B23B 1ZPZA 6GCHG 1C2KA 3UIRA 1ABJH 3UY9A 1C1MA 3RXEA 1V2ST 3U9AH 1V2KT 2FESH 2QC2A 1GI1A 1OKXA 3M5LA 2Z6BD 1BJUA 3B9FH 4GCHG 3LPRA 3P92A 1CT0E 1MTWA 4U01A 1GJ4H 1Y3XA 2G81E 1THRH 3A81A 3FZDA 1IHTH 4NA9H 1GI8B 4D9QA 1HAIH 3QDZB 2BMGB 2FZZA 1OWDA 1ELEE 1BMMH 3SZNA 3BTHE 1HPGA 1WCZA 4MNYA 3QLPH 1ELBA 1FJSA 1UTKA 4GHQA 4X1SU 1F0UA 2ZCKP 3MU4A 1HJAB 3TJVA 1D9IA 2Y5HA 3BG4B 1J16A 1C5NH 1GJ5H 1NRNH 1H1BA 3D23A 2Z9LA 1EP6A 1XX9A 1C2JA 2QYIA 3RXBA 1C1QA 5AF9H 2PR3A 3SU1A 2FP7B 2P59A 1C5LH 1AY6H 1O3PB 2ZGXH 2VIOA 1BOQA 2F9BH 5F8TA 1H9LB 1O3OA 1YYY1 1P09A 1TRNA 4ABIA 5JDUB 2P3UB 5FBEA 3H5CB 4FUBA 1ELDE 3ODDA 3W95A 1QFKH 1QRZA 4CRBA 2I6QA 2OXSA 3ATMA 1W11U 1MKWK 2FTMA 3PMJA 1A4WH 1N8OB 3O8DA 5HMAA 3RU4E 3MO3A 3FP7E 4Y8XA 2P94A 1P2KA 3SU5A 3UWIA 1CA8B 2Z9KA 4TPIZ 2AYWA 1SC8U 4A5TS 4Y7BA 1LVMA 2BVSH 2FOGA 3M36A 3SJ8A 1ZYOA 3EE0B 1OX1A 1L2EA 2BTCE 4CH2B 1K28D 7GCHG 1A5GH 1HAVB 1HB0B 1H8IH 1QA7A 4E05H 1D4PB 2QF3A 2G5NA 1HJ8A 5DP3A 3EA7A 4A7IB 3SV7A 1W10U 3GDSA 1NU9A 2AMDA 3BEFB 3UPEA 3PLBA 3Q00A 5K7RA 3O8CA 1MUEB 2G00A 3TJNA 1LPZB 1ELGA 3UREA 1M9UA 1C4V2 1GG6C 4ISOA 4K5ZA 2WINI 1VR1H 3GCTF 4MDSA 3RM2H 1AUTC 3LJOA 2WYJA 2FI5E 1D6RA 2A4RA 3RXMA 5JB8S 1BMAA 3LGTA 1GDUA 4ZHMU 1HCGA 3HKJB 1SLXB 1TFXA 3CS7A 4ZROA 1C5YB 2ZDLA 1KLTA 1FV9A 1P11E 2LPRA 2A0QB 3RC5A 9LPRA 3SO3A 1YPMH 2FS9A 3DUXH 4ZXXH 1ZOMA 1NFYA 1PPEE 1BRCE 1EAXA 1EXFA 2BHGA 2C93B 3VGCC 5A8YA 3ESTA 4CHAC 2HRVA 2A4GA 3MH4A 1WU1A 2ANKH 1YC0A 1TGCA 3SUEA 2RDLA 2D2DA 3HGPA 4XDEA 1ZPBA 5C5NA 2OC7A 3SI4H 1S85A 1HUTH 2O8LA 3SI3H 3RXGA 1TX7A 2EI8A 1ESAA 2TGDA 3SU2A 3RXOA 3SV2H 1AB9B 2WPJS 4IW4E 2PFEA 2ZFFH 2Q6FA 1Y5UT 3PWBA 1G30B 1ZGIA 1IQIA 1EJMA 4NIYA 1HAZB 3PWCA 3HK6B 2EI7A 1FIWA 1QCPA 1FY1A 3LU9B 1H9IE 1C1PA 1C2FA 4ABHA 3E1XB 1ZHPA 2J4IA 4IN1A 1AKSB 1TQ7B 3RXDA 4WWYA 2HPPH 2JKHA 4OS7A 1P12E 1C2HA 1F5LA 1GMHF 1TNKA 1NTPA 3DFLA 4LOYH 2QCYA 2QN5T 1HJ9A 2OCVB 2WV5A 2O8TA 3GY3A 4INHA 2H6MA 2QF0A 2HVXA 1VCQA 2XC4A 1ID5H 5PTPA 1GCTC 5EW1H 3ZZBA 2ZHFH 1WBGB 4LXBH 3HKIB 1P02A 4I8LA 3R0FA 2AMQA 2J2UA 1ZJDA 1UVOA 1UTQA 1O3NA 3PO1B 4JZEH 3BTME 1SOTA 1MBMA 2P93A 2DUCA 2R2MB 4FU7A 1PQ5A 1JMOH 1ELCA 1QQUA 2AERH 4JZIA 2RA0A 4NGAH 2ZF0H 8GCHF 4J1YA 1O2LA 1EKBB 4B75A 1GVLA 3E16B 3OY6U 2ODPA 4IC5A 5CHAC 1SGNE 3KQCA 2PTCE 1DWEH 1T8LA 2K1QA 4ISLA 1O2KA 4SGBE 1MTUA 2CN0H 3CS0A 3VXFH 4BAMB 3GY7A 3TK5A 2CV3A 1GHYH 2XRCA 2V35A 1J8AA 1B7XB 1C1TA 2VVUA 3RXVA 1RFNA 3T26A 2YNAA 3OSYA 1BTXA 2TRMA 4K1SA 4CRAA 1SLVB 1SPJA 1DPOA 2BOHB 3M35A 1TIOA 4J2YB 4O97A 3TPIZ 3IITA 1O3MA 3BTWE 3PTNA 2XBYA 2ZA5A 4Y79A 1WUNH 1HV7A 2G4TA 3FANA 4KKDA 3B8JA 4GSOA 1C5XB 4LK4A 1YPGH 3RXUA 4OS2A 2VIVA 4I32A 3SJIA 1MTVA 2Y6TA 3SBKA 2FOEA 1L1JA 2ZP0H 2TGAA 1C5ZB 3LDXH 2G5VA 1XVOA 2BD3A 3RXTA 3MYWA 2BD8A 3RMNH 2QGRA 3TNTA 1EJAA 3DHKH 1H9HE 1JIMA 1A3BH 2YOLA 2C8ZB 3OU0A 1OPHB 3A7ZA 1KXFA 4YZUA 5LPFA 1IQMA 4INLA 4HI3A 4JZFH 5ESBA 3M7UA 1GBKA 3VB4A 3BN9A 3SGAE 2EEKA 2ZHQH 4NFFA 4ZKNU 1O38A 1MD7A 3U8TH 2P95A 1J14A 1Z8IB 2OC0A 1ETTH 3F9FA 2OBOA 1N6XA 1AI8H 1XVMA 1ZTLA 4AN7A 3BTGE 4QT8C 2FI4E 2J95A 3GDUA 4LZ1H 3RDZA 1Q3XA 1ZHMA 1MKXK 1UVSH 1T4VH 1BB0B 1HAXB 3A83A 3UR9A 1L4DA 3AVZA 2LNCA 3ZZCA 3LC3A 3PROA 1P9UA 1GBIA 3SGBE 4X6NA 5FAHA 1AFQB 1PYTC 3QGJA 5C67A 2GDDA 3BTKE 2ZDKA 4Y11E 2PKAA 1QBVH 3A7TA 3A87A 3EQ0H 1DUAA 3UNQA 1MKWH 2HALA 1EZQA 4OGXA 4B2BA 5CE1A 1A61H 1C1NA 1F0RA 1TE0A 1TNJA 4U32A 3T27A 4ZXYH 2OUAA 3GY5A 2CHAC 4KP0A 1LQEA 1MTNB 1Y3VA 4GAWA 4CRCA 2BDAA 5FPTA 2FO9A 1LMWB 2PW8H 3RXCA 2BVRH 1CO7E 1V2TT 4ZKSU 1NPMA 4RSPA 4OS4A 3I78A 2OINA 2PV9B 2XWBI 4A92A 1DS2E 3NPSA 2YNBA 3LKWA 3ZVDA 4Y0ZE 3FP6E 3T2NA 1SGFA 1A0JA 1GDQA 4MLFB 1FUJA 4O3UA 1GI6A 1GI9B 4ZUHA 2UUKB 3G01A 2BXUH 4NFEA 1EP5A 6GCHF 4OS5A 1AIXH 1DXPA 2V0BA 2ZC9H 1XXDA 1OP0A 2HNTC 3QUMP 4MQAA 1EPTB 1W7GH 3BV9B 1TA2A 1A46H 1V2VT 1VGCC 4FUDA 1IQNA 1AWFH 2A1DB 3V7TA 8KME2 1TPAE 1AN1E 4CRFA 1MCVA 1T31A 4X8UH 1QRXA 1Y8TA 3ZZ9A 2BZAA 4VGCC 1PPZA 3E0PB 3PYHA 5IDKA 1OYQA 4OS6A 2CF8H 4IBLH 3VB5A 2QXGA 3SNEA 1CBWC 1SGRE 2CMYA 1GMCG 1QB6A 6CHAB 5GCHF 2PKSB 2P8OB 2W7UA 3SV6A 3E0NB 3LGYA 1W2KH 3JZ2B 4CR9A 1QURH 1S6FA 2GT7A 1P2NA 3RXJA 1V2WT 5DP7A 5GIBA 3F68H 4B73A 5L2YH 4X6OA 4DY7B 2GZ7A 1YPHC 2GT8A 1LKBA 4NCYA 3QWCH
chains in the Genus database with same CATH superfamily
2FOAA 3ENSB 2IJD1 1QBOA 5E0GA 3ZZ8A 2FI3E 2ZQ1A 1SGCA 3F6UH 4WXVA 2HLCA 2WPIS 1L0ZA 3E8LA 4HTCH 1TGTA 2ZPRA 4JMYA 1GHVH 2WZQA 3MWIU 2RCEA 2GV6A 2KCOA 4X2YA 1AGJA 1O3AA 1GI4A 1NS3A 3EA8A 2A2QH 1IQKA 1KY9A 1AHTH 3MH7A 2KAIB 1O2WA 3MH6A 4ACBA 2WSSD 1SFIA 3NUMA 1G36A 1KMHB 4TWWA 3SNAA 3SJ9A 2K0QA 1CHOF 2EI6A 1NBMD 2GD4B 2R3YA 5EXMA 2ZZUH 1ZPCA 5JBAS 1RGQA 2BY8X 1UVPA 1DE7H 1Y3YA 1A2CH 3ZV9A 1ARBA 2FPZA 2GMTC 1NBME 5K0HA 1XMNB 3E90B 1SQOA 3D65E 3UNSA 3W1EA 2BD4A 2ZG0H 2PTNA 1GMDG 1F7ZA 1UCYH 4R0IA 1CA0B 4NA8A 5C20A 2C8XB 4UDWH 2GZ9A 1ZSKA 4WF8A 1XUJA 3IWMA 1UTMA 1EOLA 3LJJA 2ZGHA 4GUXA 1P2OA 3DT0H 2O8MA 1DITH 2F9UA 5AFYH 4FUIA 4Z6AH 3RC4A 3UUZA 1UTOA 1SGIB 3OE7D 1GI2A 1PJPA 4DOQA 2W7SA 5AHGH 1BBRK 1K1NA 3F0PA 2C8YB 1OWKA 3TH3H 1GBLA 1FDPA 1RS0A 1BHXF 1C1UH 2PLXA 4Y10E 2CK3D 1FN8A 3P8OA 4K1TA 4I86A 3UWJH 2XNIA 1YPJH 4IGDA 2JH5D 4ZMAH 1RIWC 5DK1A 5DN6D 2D1JA 3EYDA 5L30H 1NFWA 1O5EH 3ZVGA 2B5TB 4YT6H 1LHCH 5F8XA 1K1JA 4IMQA 3LGVA 3RU4T 2LP6A 1EUFA 1CGHA 4K8YA 2L74A 3TIUA 3O8RA 1DLKB 2G8TA 4FETA 1Y5AT 2J38A 2Q6GA 4X1QU 3MNXA 1E38B 3C1KA 3LGUA 2Y81A 1TGBA 1BQYA 1TPOA 4ABDA 1V2QT 1V2UT 1GL1A 1O5DH 1JWTA 4A1TA 1O0DH 5GWZA 1XUGA 1GHAG 1BMNH 3KYFA 1AVGH 1K1IA 2QXJA 4TWYA 5JYIA 1XUFA 1O5CB 1THSH 2RFKC 1T4UH 2ZEBA 4Y6DA 3ATIA 5SGAE 2V6NA 3TK6A 1COWD 2A5KA 2UWPA 4E06H 1E37B 1C5SA 2GZ8A 1XKBC 3F9GA 1MKXH 1P2QA 2OTVA 1HJAC 4B6FA 3HPTB 1H8ED 5DKMA 1UTLM 3BG4C 4WXIA 2TPIZ 1T7CA 2ZGJA 1SBWA 1ACBE 3SGQE 2VB0A 1HIAB 2GCTB 3KGPA 2ZDVH 2SNVA 1MZAA 4ISNA 4ASUD 4NZQA 1GI5A 4AZ2B 1LTOA 2QAAA 5HM9A 1VJ9U 1BITA 3KL6A 4I8GA 4K60A 3ZVEA 1C1WH 2FMJA 1THPB 1K1OA 3GCHC 4NA7A 3KNXA 1EB2A 1ABIH 2ZQ2A 2CGAA 2UWLA 3C27B 3P70B 2KFWA 1FPCH 1N6YA 3GOVB 1UJ1A 1FY8E 1O2ZA 2ZTYA 1JIRA 5HIYA 3PRBA 1OP8A 5F6MA 4DURA 1SLWB 3AAUA 3K9XB 1GBMA 1OP2A 2WPMS 3S0NA 2A4QA 1PQAA 1TMUH 1LQDB 1BMLA 1N8OC 2GTBA 1ELVA 3SU0A 4FXGH 3BEIB 3URCA 4Y8YA 4YLQH 4B2CA 1WTGH 3NCLA 1GHBF 4NSVA 1V2PT 2Z9JA 3OTPA 4D7FA 1TPSA 2WYGA 1BTUA 1T8OA 2PUXB 2UWOA 1NFUA 1GL0E 1C1OA 1SOZA 2AIQA 1EOJA 4AG2A 3GYLB 1YLDA 1TLDA 1MU6B 1O3LA 1C5TA 1WOFA 2P3TB 3K6ZA 3M5MA 5GJ4B 4TY7A 3ZVCA 1UK3A 1Z1JA 3ELAH 4RN6A 3RMOH 1HBTH 1A0HB 2XYAA 5FXLA 1MTSA 2G52A 1P9SA 2A5AA 1O34A 1JOUB 4GHTA 2FX6A 4K2YA 1Z8RA 2B0FA 3EA9A 1S81A 1YP9A 1TGSZ 1IQEA 4AFUA 1UK2A 2ZKSA 4AGKA 1CHGA 4WY3A 5TJXA 5F03A 1TNGA 1TX6A 2AIPA 2JIZD 5GNDA 5C0TA 1QBNA 3QGNB 5JB9S 1QQ4A 7ESTE 4ZHAA 1EAUA 1UTNA 5DP4A 1SKYE 3SNCA 1GJ6A 4Q80A 1BTPA 1OWEA 3GICB 4UE7H 1DSTA 3NKKA 2BDHA 3UR6A 2ZGBH 3VGCB 1RTLA 3EAJA 3TGIE 4CHAB 3T25A 3SUFA 1KTSB 2HGTH 3SU4A 1S5SA 5GPIB 3KYGA 5DP6A 4CRDA 4X8VH 1C2GA 5KECA 1VITH 1Z6EA 1MMJN 1KDQB 2ZHWH 1Y3WA 2EY4C 2GKVE 2H5DA 2QA9E 3OTJE 2B9LA 1ORFA 2AMPA 1HAPH 3P8FA 3QTVH 3F9HA 2HNTF 5HM2A 3JZ1B 4B2AA 3N7EA 5BRRE 1KTTB 2PP6A 3UTUH 3RXIA 2ANYA 1YPLH 4RT1A 4KTUA 4DW2U 4ESTE 1F0SA 1V3XA 4BXWA 2ZFQH 1AVWA 1HRTH 1O2YA 4Y7AA 4Q7XA 3FO8D 6LPRA 1OHHD 4DT7B 3QN7A 1C5PA 4AYYB 4CREA 1QJ7B 1CQQA 4B1TA 4ZHLU 1GJCB 2KCPA 3KQBA 3P95A 2HLDD 2W3KA 1O35A 2ZU5A 1GBCA 1GDNA 2QY0B 5FPSA 2Y80A 1FY3A 3RXQA 1AU8A 3V0XA 1DY8A 1DWDH 1HXEH 2BQ6B 2XW9A 2ZPQA 2ANMH 1W13U 3RMMH 3S69A 2AS9A 2F83A 1V2MT 4CBNA 1YPKH 3NXPA 1LHDH 1ARCA 2VJ1A 1SQTA 1G32B 1ZHRA 2XOKD 1UHBA 1G3EA 1TNIA 3U1JB 1UCYK 2AEIH 2AH4X 2Z7FE 1NESE 4XRNA 1BCUH 4Q63A 4D76A 2SNWA 2A5IA 3ZZ7A 1O2OA 4BXSA 1K9OE 1GI7B 1K1LA 3Q3YA 3A89A 1BBRH 1ZSJA 1HAHH 4BAHB 1Y3UA 1AD8H 2ZIQH 4BTUB 1QB9A 4H42U 5E0HA 4JYVH 2J9NA 2BQ7B 1QL9A 4ISHH 5E2PA 1C1VH 1O2RA 3QO6A 4NIXA 1VKYA 4Q7YA 5HYOA 3TVJB 3UAIC 1RTKA 2BY9X 2F9NA 1NU7B 5A8XA 1B0FA 1GMCF 3PMAB 1O3FA 1VITF 2H5CA 5HGGA 3M3TA 3CP7A 1GBHA 1P2IA 1UO6A 1TX8A 1MQ5A 3SJOA 5GXPA 1P03A 2BDCA 1WQVH 2EC9H 4DCDA 1ELFA 5C5OA 2HWLB 1QJ6B 1KXBA 2PHBA 5DPAA 3E91A 5C3NA 4Y71A 3KEEA 1QIXB 2F4LA 1XXFA 1SGDE 1KLJH 1TYNA 1ZLRA 4OM9A 1W3CA 2HOBA 3TITA 3KIDU 1P2MA 1SVPA 2Z94A 1N1LA 4MNXA 4U30A 1KXEA 4IMZA 1F5RA 2WUCA 3S9AA 1C9TA 1TBQH 3SQHE 1Z6JH 2Z3CA 1FONA 1FI8A 3EGKH 1DWCH 1OOKB 2H2ZA 3S7KB 4KELA 4X2VA 1FIZA 3GCTG 1TRYA 5BPEA 2W3IA 2UUJB 1O2PA 2ESTE 4BNRA 1F0TA 3O8BA 1XM1A 3A7WA 4KGAA 3M61U 1L1NA 2ODQA 1LCYA 2CJIA 2PUQH 2BLOA 1QHRB 2VH0A 1S83A 3LGIA 1LHEH 3ZZ5A 2VVVA 2ZNKH 4WJG2 1HNEE 2Z3EA 5EQSA 3MO6A 3MNCA 5JPMH 4A1XA 4ABGA 1FY4A 4TSFD 3GY6A 3H7TA 4X2XA 3KQEA 2UUFB 3TJOA 1NY22 3UOPA 2VGCC 2IJOB 3NZIA 4MG3A 5EODA 1DLEA 2YMSC 1IHSH 5L6NH 4DVAU 2R9PA 1LKAA 2HPQH 2PSYA 5EW2H 1G3DA 1Z71A 5EGMA 5EIYA 1AFQC 2Y5FA 5C0UA 4UFEH 1IQLA 4I8HA 1AWHB 3FVFB 3M5OA 3GCNA 3SNBA 1VCWA 2QV1A 2A45B 2BX3A 1GWAA 3ATWA 5E2OA 1WYKA 3RXSA 4KTCA 3FP8E 2O9QA 3GISB 1BRUP 4OGYA 2Y7ZA 4WMEA 2ZFTA 1ZSLA 2JH6D 3MNSA 3FOAA 3LC5A 4WH8A 1CT4E 2STBE 1W8BH 1S0QA 1RJXB 1A0LA 3M3SA 1GMHG 2WPHS 1AQ7A 1C2LA 2ZFRH 4IC6A 2M5TA 4GLYA 3K2UA 5FPYA 1ZMLA 1P3CA 4BAKB 1IQGA 2A7CA 1JRTA 1FN6A 4FU9A 3EE7A 1TNLA 4TY6A 4YLUA 3DCLA 5J4QA 2WPKS 4XBCA 1F5KU 2FDAA 1K2I1 2ZDNA 1JBUH 3ATLA 3F0OA 2FIRH 2NU2E 2VIQA 5T6DA 1ESTA 5A0AE 1GHWH 4GCHF 4MPXA 3M37A 3FN8A 1AE8H 3QX5H 3F9EA 1S6HA 3SU6A 5LGOA 3URDA 3VB7A 4AG1A 2ASUB 4FUFA 1SLUB 5E8EH 1EASA 1TBRH 2BY7X 1HAGE 2XNDD 1C5QA 3ATKA 4MNVA 5B6OA 5FCRA 4VGCB 4F4OC 1NM6A 1F2SE 1SGPE 2KR7A 2JH0D 2C4FH 1HAVA 2BDYA 1DICA 1V2LT 1G9IE 1CBWB 1CE5A 4NWKA 1C2MA 1TONA 1Z7KA 3BIUH 4SGAE 3T29A 1JXPA 2BD9A 1KLIH 2A7HA 2FOCA 2PKSC 5DP8A 3MOCA 4UFGH 2THFB 3ZIAD 3W94A 5A2MH 1C5OH 4AYVB 2XC0A 4DIHH 1A5IA 1C2IA 4E7RG 5HKKD 2R0LA 2WUBA 1EZUC 1GGDC 4X8SH 1UTPA 2GP9B 2VWNA 3HATH 1O5BB 4TPYA 1P10A 3LONA 1ANCA 1Z1IA 2G51A 5CHBA 3L6PA 4DG4A 3STIA 1GJ9B 4RKJB 3M7TA 5EPNA 2RA3A 4HZHA 1RXPA 4B71A 4Z0KA 4X2WA 1UMAH 4WH6A 3UQOA 1XUHA 1E34B 5ESTE 1DX5M 4YOGA 1UCYE 1YCPM 5T3HA 2GJGA 1EAWA 3A7YA 1VCPA 2V3MA 2GDEH 3PM3A 1TMTH 1V6DA 2FOFA 4JYTA 3VFEA 1LDTT 2ULLA 2G55A 2UUYA 3ODFA 1IQFA 8LPRA 1TOMH 2H9EH 2OQUA 4XBDA 7GCHF 3SW2B 2ZTXA 1TQ0B 1DVAH 1MQ6A 4YOIA 4XE4A 1P05A 2JETC 5A09A 2SGPE 1XKAC 4CR5A 2BLQA 1WQSA 3GY2A 2FOBA 1GI3A 3BSQA 2WHXA 4TYDA 4UD9H 4AFZA 1C5WB 1TNHA 1GBBA 1TA6A 1W0JD 1DANH 1ZMNA 4NZLA 1E1QD 1P57B 2OP9A 3KQDA 4X1PU 3MTYA 4GPGA 4ABEA 4JZDH 3F1SB 2ZI2H 4X6MA 1GBDA 3GYMA 4MPWA 2ZHDA 3BF6H 5I25A 2F91A 2O8UA 1AKSA 4AORA 1LVBA 1TPPA 2BLVA 1O5AB 1AFEH 1NFXA 1TAWA 3SUDA 3VEQB 1OXGA 2C3SA 2EQNA 2ZU1A 3FKSD 1O2VA 1QY6A 4JK5A 2R3UA 2GV7A 2VIWA 1OS8A 2OC1A 1TALA 1O36A 1CSOE 2FM2A 3S7HB 1L4ZA 1MABB 1HXFH 4K8BA 1PYTD 1YPEH 1V2RT 7KMEH 5FHTA 4ABAA 2STAE 3RXAA 4JZ1A 3PMBB 2FOHA 5CMXH 3F2GA 5DP5A 1O2MA 1EFRD 3N7OA 1W0ZU 1ANBA 1GPZA 1SGQE 1O32A 2QE7D 1ETRH 5T6GA 3I29A 1YGCH 3A8AA 1ZGVA 3A7VA 1YCPH 2DE8A 3QTOH 4FUJA 5IYTA 4BANB 2PGQB 1G2MA 1HAYB 2KCAA 4INKA 1W7XH 1O31A 2ZCHP 3A82A 3RUOA 3LIWA 3SHAH 5EQRA 1BMFD 4WVPE 1O2JA 4ZAEA 1T8MA 2D8WA 1Q31A 2NU0E 3LT3A 2GCHG 1SGFG 5EXLA 3MFJA 3T28A 1YLCA 3DA9B 3VPKA 1O3EA 3U8RH 2PKAB 4IN2A 2R2WU 2QF4A 5E0JA 3MH5A 4IS5A 2OC8A 1SMFE 5KEDA 3TNSA 3U69H 3SN8A 2J98B 2J34A 1C1SA 3SQEE 5C1UA 1EATA 3ZYEA 2OQ5A 3P17H 3V3MA 1LO6A 3CNRA 3RXHA 2SGDE 2HNTE 1O5FH 4FUHA 4AFQA 1BZXE 2A32A 2F9OA 1PFXC 5GCHG 3FFGA 3Q76A 4DT4A 5FBIA 4UEHH 1EJNA 2BZ6H 4WMDA 1CVWH 2GCTC 4Y76A 2OLGA 2VBCA 4MPUA 1BA8B 1FXYA 4ABFA 1O39A 3PV5A 1GBAA 4I7YH 4O9VA 4THNH 1AO5A 1S82A 2AGGX 4YT7H 1NRSH 4TT3D 1YWUA 3ZZ3A 4RKOB 4I31A 1GJBB 5L2ZH 1NN6A 2H9HA 4A1VA 1P8VC 1TBZH 5EG4A 3BIVH 5EU8A 1BRAA 3GCHB 1ZZZA 1S0RA 1G2LA 1V2OT 4AX9H 3A8BA 3PLKA 2F9PA 2NWNA 1O3CA 4HGCA 1GJ7B 3SJKA 3RXRA 1D3DB 4Q2KA 3ZZAA 1HGTH 3KN2A 3T62A 2AHME 3U1IB 1C4Y2 1BRBE 4NSYA 5EJLA 3RU4D 3WY8A 1PPFE 3SZEA 1FNIA 4FUGA 5C1YA 4JYUH 3M3VA 1K1MA 1L1GA 2BD2A 3BTTE 3NWUA 1YPHE 2XWAA 3DFJA 1BTHH 3E3TA 4I8KA 2I6SA 3D49H 1PPBH 1MBQA 3QZRA 3SHCH 4Z1MD 4BOHA 3BTDE 3RMLH 2BXTH 1O2XA 1LVOA 1QZ8A 1QGFA 3MI4A 4M7GA 2PWXA 1DXWA 1K1PA 2A7JA 1CHOG 2OBQA 4CBOA 2IOTA 4DGJA 2Q1JA 2F9VA 3PLPA 1H8HD 1QL8A 4HFPB 4F49A 2ODYB 5FX5A 1NRPH 3RLYH 4FVDA 2IPHA 2Z3DA 1LVYA 1GG6B 2Y82A 3RLWH 2VH6A 3A7XA 1D3PB 2TGPZ 3S9BA 4XOJA 4BTIB 4XFQA 1ZRKA 1DDJA 3GDVA 6ESTA 1UVUH 1GHXH 2V3HH 3AAVA 2ZFSA 1SGEE 3AASA 5DJ7A 5C1XA 2BOKA 2ILNA 1SG8B 1FLEE 2A4OA 5EOKA 3ZZ4A 2C8WB 3A85A 1P01A 5CDFE 2FWWA 2FOMB 1EAIA 1O3KA 5AFZH 3TGKE 3Q3XA 1AMHA 2GGVB 1F92A 2K8IA 1PQ8A 1DY9A 1J9CH 2SGEE 2B8OH 2BDGA 1OYTH 1QB1A 1C2EA 2AGEX 1ZR0A 5C94A 2VIDA 2WV9A 1AUJA 1OWHA 3I77A 2ZCLP 1B0EA 2ZWLH 1AB9C 1J17T 5A8ZA 1EPTA 1HAOH 3TK9A 1WAYB 1BTWA 3V12A 3VB6A 5GDSH 5LH8A 1TMBH 4AOQA 1IAUA 2PGBB 3LH3A 4P02A 2A31A 1MAYA 1GHZA 2ZGCA 3ZZ6A 1CGJE 4O03A 1SL3A 3TH4H 1GJ8B 1EZXC 1VZQH 1K22H 1MH0A 1BUIA 5TCCA 4D7GA 1WV7H 3EDXB 1DM4B 3P6ZB 1AZZA 3RXLA 1TOCB 1C1RA 5DG6A 1B5GH 3K65B 2QF5A 1NRRH 2B7DH 1BHXB 1PPGE 1SQAA 1NO9H 1HLTH 1UVTH 2FLBH 4FUCA 2BYAX 1BBRE 4D9RA 1GCTB 1P2JA 1O2TA 3FZZA 1K21H 4Q7ZA 5TCAA 1INCA 4ZKOU 1FY5A 1IOEA 1O3BA 4MVNA 1D3TB 4CH8B 1AVXA 3PO1C 1YLNA 3KCGH 3HGNA 5FCKA 2PSXA 2FXRA 5DP9A 3SV9A 1CGIE 2BX4A 2ZU4A 2F3CE 2ZDMA 1S84A 1CU1A 4YO9A 1SGTA 1P0SH 5EXNA 1DOJA 1ZJKA 1ZMJA 3PB1E 5CHAB 1AE5A 2AGIX 1W0YH 1GJDB 1RD3B 2GVFA 2Y7XA 5JBBS 1SHHB 1TB6H 1KIGH 4F48B 2QIQA 3GY4A 4ASHA 4BAQB 2F43B 2KAIA 3BG8A 4DJZB 1WSSH 3RXPA 1O37A 4K69A 1KXAA 1BTZA 2FLRH 1T8NA 2ZO3H 1O2HA 1P06A 1TGNA 3A84A 1DWBH 1SI5H 3LGWA 1UW7A 1CT2E 1O2SA 1TABE 3UOUA 1O5GH 5C2ZA 1O2UA 4JCNA 1QNJA 1E0FD 4FOUC 4M9FA 1ANEA 3N7DA 3UQVA 1H8DH 1GHBG 3ZV8A 2XBWA 7LPRA 3QZQA 4ISIH 3AW0A 2FX4A 4YM9A 4Q4LA 1GI0A 1YCPK 1TRMA 1W14U 3WWBA 2Y5GA 1XUKA 1G37A 4FU8A 1ELTA 2VINA 2VWMA 1GBFA 1O3JA 5J4SA 3VB3A 1O2NA 2SGQE 1ZTJA 3TGJE 3TH2H 4H6TA 4Y8ZA 1ETSH 3PTBA 2V7QD 1EX3A 1Q2WA 4I8JA 4NIWA 1NRQH 4R8TB 1FAKH 1GVKB 5EJ1A 1W12U 3BTQE 1GVZA 4JK6A 2GX4A 2XBVA 2ZHEH 4ABJA 5IK2D 5ETXA 1G3CA 2ZU3A 4ZH8A 4UONA 4A6LA 2XXLA 2EA3A 4RT0A 1C5UA 2J92A 2SGAA 4F55A 1OWIA 1XUIA 3A88A 1A5HA 1GMDF 3DSOA 3SU3A 4UFDH 1O3IA 1GBEA 2SFAA 5I46H 4MNWA 4X1NU 2VWLA 3L33A 1FMGA 1C4U2 3Q3KA 1BDAA 3H7OA 5EPYA 2BM2A 2NU1E 2Q6DA 3TLOA 3A8DA 4X1RU 1QR3E 2VGCB 1MAXA 1E36B 2C90B 2XCNA 1WTHD 1P04A 1RRKA 4ZKRU 3GCOA 4NIVA 2FODA 3U98H 1C5RA 1VJAU 1E35B 3MO9A 1MD8A 3UFAA 4ABBA 1FAXA 4NG9H 5F53A 2KCYA 4AB8A 2CHAB 2OK5A 1SGYE 5F8ZA 1KSNA 1QA0A 2RG3A 4ACAA 4X6PA 1J15A 1MTNC 2P3FH 2BD5A 2QXIA 1ANDA 4U2WA 5JBCS 1KXCA 1SHYA 4WMFA 1UK4A 1GBJA 1NROH 1TWXB 5JBTA 1C5MD 5LPEA 4AFSA 2BDBA 2WPLS 3SV8A 1Y59T 1HIAA 1JRSA 2P16A 3DD2H 3A8CA 3K6YA 3MU8A 2ZDAH 1O3HA 2XBXA 2BY5X 4MTBA 3MNBA 3M5NA 2W6JD 3SUGA 1DSUA 2BY6X 1BJVA 3OX7U 3ITIA 1LHGH 2J94A 3UNRA 4BTTB 3BTFE 4X0WU 4BAOB 2JJ1D 2VNTA 1E1RD 4LZ4B 1HDTH 3S9CA 2D26C 2OD3B 1KXDA 3ZVFA 1BIOA 1EPTC 3A86A 2H9TH 2NU4E 5FX6A 1SFQB 8GCHG 1IQHA 1FPHH 4H6SB 1C5VA 1VGCB 1GHAF 3BTEE 2AFQB 2L6OA 2GCHF 1DUEA 2FS8A 1A7SA 3HK3B 4KTSA 1DT2A 5C17A 2ALVA 2XC5A 3KF2A 3RC6A 1EZSC 2ZU2A 1ELAA 2WPDD 3QK1A 5EQQA 2FYRA 3TU7H 1DFPA 3CENA 5ABWA 3OEED 1U6QA 5G4BA 3R3GB 3A80A 2XCFA 3PMHB 1YF4A 6CHAC 4AGJA 1D6WA 3LOXA 1PQ7A 1V2NT 2P8OC 3RP2A 1A3EH 2VVCA 4CRGA 2ZPSA 2TBSA 3E6PH 1V2JT 1GBTA 2FTLE 1GCDA 2V3OH 1FZZA 1VITG 3L3TA 3OY5U 5AVDA 1KYNA 1QRWA 4MPVA 4OS1A 4B74A 5DO4H 3ZZDA 1YM0A 1BT7A 4K3JA 3OYPA 2DE9A 3OFND 1GGDB 1A1RA 5LPRA 3LH1A 1MZDA 1YKTA 4YESB 3ZVBA 2TIOA 2FYQA 1QL7A 1UHBB 3WWFA 5A0BA 4XBBA 1QJ1B 3P8GA 2FEQH 4H4FA 2ZTZA 3GY8A 4Y0YE 1OSSA 3T5FH 1WXRA 1G3BA 2W5EA 1UTJA 2H1UA 1Z8GA 2XTTB 3SNDA 1O2GH 1FQ3A 4O3TA 1X7AC 1SSXA 2ZFPH 2WV4A 2ZECA 3MU1A 1ESBA 1O3DA 2VWOA 3OEHD 2Z9IA 1O33A 3MMGA 3VXEH 1LHFH 1NC6A 4PROA 5HXFA 2BB4A 3RM0H 3U8OH 1T32A 4YOJA 2JETB 2GMTB 3AW1A 4GVUA 4FVBA 4RI0A 4DIIH 1KDQA 4AB9A 1NT1A 1ZTKA 2R0KA 2A2XH 3IG6B 2VIPA 3D62A 4FUEA 4B76A 2O8WA 4D8NA 3SORA 1O2IA 3PV4A 2CF9H 5A0CA 2ANWA 1CA0C 1NZQH 2BD7A 1Y5BT 1SR5C 1O3GA 4NWLA 3TJUA 3RXFA 5T6FA 3P8NA 3F2FA 3Q77A 1EQ9A 1H4WA 4E7NA 1AZ8A 1OWJA 3MU0A 2M2AA 3MU5A 2TGTA 3FAOA 2BDIA 2G4UA 2ALPA 2QXHA 1LPGB 2IN2A 1HYLA 5EJZA 1C9PA 1P3EA 2YMSD 1QTFA 4YTAA 3M7QA 3SYJA 2W26A 2BLWA 1Z8JB 8ESTE 1EB1H 1PPCE 2Z9GA 1PPHE 1LPKB 2SGFE 3STJA 5H4IB 1MU8B 1ZRBA 3V13A 1C2DA 4K1EA 3BEUA 1RIWB 4I33A 1O2QA 1D3QB 1RTFB 2BVXH 1MCTA 4UFFH 1BTYA 1GJAB 1IQJA 5DGJA 2CXVA 9ESTA 1O30A 3SOSA 3ZVAA 4X8TH 3MHWU 3ZYDA 2BQWB 3KHVA 1HFDA 4XSKU 2VU8E 3RXKA 1SB1H 3NK8A 1YBWA 2NU3E 3B23B 1ZPZA 6GCHG 1C2KA 3UIRA 1ABJH 3UY9A 1C1MA 3UB0A 3RXEA 1V2ST 3U9AH 1V2KT 2FESH 2QC2A 1GI1A 1OKXA 3M5LA 2Z6BD 1BJUA 3B9FH 4GCHG 3LPRA 3P92A 1CT0E 1MTWA 4U01A 1GJ4H 1Y3XA 2G81E 1THRH 3A81A 3FZDA 1IHTH 4NA9H 1GI8B 4D9QA 1HAIH 3QDZB 2JJ2D 2BMGB 2FZZA 1OWDA 1ELEE 1BMMH 3SZNA 3BTHE 1HPGA 1WCZA 4MNYA 3QLPH 1ELBA 1FJSA 1UTKA 4GHQA 4X1SU 1F0UA 2ZCKP 3MU4A 1HJAB 3TJVA 1FX0B 1D9IA 2Y5HA 3BG4B 1J16A 1C5NH 1GJ5H 1NRNH 1H1BA 3D23A 2Z9LA 1EP6A 1XX9A 1C2JA 2QYIA 3RXBA 1C1QA 5AF9H 2PR3A 3SU1A 2FP7B 2P59A 1C5LH 1AY6H 1O3PB 2ZGXH 2VIOA 1BOQA 2F9BH 5F8TA 1H9LB 1O3OA 1YYY1 1P09A 1TRNA 4ABIA 5JDUB 2P3UB 5FBEA 3H5CB 4FUBA 1ELDE 3ODDA 3W95A 1QFKH 1S6LA 2J5UA 1QRZA 4CRBA 2I6QA 2OXSA 3ATMA 1W11U 5KGOA 1MKWK 2FTMA 3PMJA 3DSPA 1A4WH 1N8OB 3O8DA 5HMAA 3RU4E 3MO3A 3FP7E 4Y8XA 2P94A 1P2KA 3SU5A 3UWIA 1CA8B 2Z9KA 4HG6A 2AYWA 1SC8U 4TPIZ 4Y7BA 4A5TS 1LVMA 2BVSH 1W0KD 2FOGA 3M36A 3SJ8A 1ZYOA 3EE0B 1OX1A 1L2EA 2BTCE 4CH2B 1K28D 7GCHG 1A5GH 1HAVB 1HB0B 1H8IH 1QA7A 4E05H 1D4PB 2QF3A 2G5NA 1HJ8A 5DP3A 3WW7A 3EA7A 4A7IB 3SV7A 1W10U 3GDSA 1NU9A 3GS9A 2AMDA 2JDID 3BEFB 3PLBA 3Q00A 3UPEA 5K7RA 3O8CA 1MUEB 2G00A 3TJNA 1LPZB 1ELGA 3UREA 1M9UA 1C4V2 1GG6C 4ISOA 4K5ZA 2WINI 1VR1H 3GCTF 4MDSA 3RM2H 4AC9A 1AUTC 3LJOA 2WYJA 2FI5E 1D6RA 2A4RA 3RXMA 5JB8S 1BMAA 3LGTA 1GDUA 4ZHMU 1HCGA 3HKJB 1SLXB 1TFXA 3CS7A 4ZROA 1C5YB 2ZDLA 1KLTA 1FV9A 1P11E 2LPRA 2A0QB 3RC5A 9LPRA 3U28C 3SO3A 1YPMH 2FS9A 3DUXH 4ZXXH 1ZOMA 1NFYA 1PPEE 3AK5A 1BRCE 1EAXA 1EXFA 2BHGA 2C93B 3VGCC 5A8YA 3ESTA 4CHAC 2HRVA 2A4GA 3MH4A 1WU1A 2ANKH 1YC0A 1TGCA 3SUEA 2RDLA 2D2DA 3HGPA 4ZCNA 4XDEA 1ZPBA 5C5NA 2OC7A 3SI4H 1S85A 1HUTH 2O8LA 3SI3H 3RXGA 1TX7A 2J97A 2EI8A 1ESAA 2TGDA 3SU2A 3RXOA 2W6ID 3SV2H 1AB9B 2WPJS 4IW4E 2PFEA 2ZFFH 2Q6FA 1Y5UT 3PWBA 1G30B 1ZGIA 1IQIA 1EJMA 4NIYA 1HAZB 4XD7D 3PWCA 3HK6B 2EI7A 1FIWA 1QCPA 1FY1A 3LU9B 1H9IE 1C1PA 1C2FA 4ABHA 3E1XB 1ZHPA 2J4IA 4IN1A 1AKSB 1SQRA 1TQ7B 3RXDA 4WWYA 2HPPH 2JKHA 4OS7A 1P12E 1C2HA 1F5LA 1GMHF 1TNKA 1NTPA 3DFLA 3DSGA 4LOYH 2QCYA 2QN5T 1HJ9A 2OCVB 2WV5A 4YXWD 2O8TA 3GY3A 4INHA 2H6MA 2QF0A 1K0HA 2RDEA 2HVXA 1VCQA 2XC4A 1ID5H 5PTPA 1GCTC 5EW1H 3ZZBA 2ZHFH 1WBGB 4LXBH 3HKIB 1P02A 4I8LA 3R0FA 2AMQA 2J2UA 1ZJDA 1UVOA 1UTQA 1O3NA 3PO1B 4JZEH 3BTME 1SOTA 1MBMA 2IPQX 2P93A 2DUCA 2R2MB 4FU7A 1PQ5A 1JMOH 1ELCA 1QQUA 2AERH 4JZIA 2RA0A 4NGAH 2ZF0H 8GCHF 4J1YA 1O2LA 1EKBB 5DSFA 4B75A 1GVLA 3E16B 3OY6U 2ODPA 4IC5A 5CHAC 1SGNE 3KQCA 2PTCE 5B6LA 1DWEH 2LELA 1T8LA 2K1QA 4ISLA 1O2KA 4SGBE 1MTUA 2CN0H 3CS0A 3VXFH 4BAMB 3GY7A 3TK5A 2CV3A 1GHYH 2XRCA 2V35A 1J8AA 1B7XB 1C1TA 2VVUA 3RXVA 1RFNA 3T26A 2YNAA 3OSYA 1BTXA 2TRMA 4K1SA 4CRAA 1SLVB 1SPJA 1DPOA 2BOHB 3M35A 1TIOA 4J2YB 4O97A 3TPIZ 3IITA 1O3MA 3BTWE 3PTNA 2XBYA 2ZA5A 4Y79A 1WUNH 1HV7A 3PRDA 3F3BA 2G4TA 3FANA 4KKDA 3B8JA 4GSOA 1C5XB 4LK4A 1YPGH 3RXUA 4OS2A 2VIVA 4I32A 3SJIA 1MTVA 3N99A 2Y6TA 3SBKA 2FOEA 1L1JA 2ZP0H 2TGAA 1C5ZB 3LDXH 2G5VA 1XVOA 2BD3A 3RXTA 3MYWA 2BD8A 3RMNH 2QGRA 3TNTA 1EJAA 3DHKH 1H9HE 1JIMA 1A3BH 2YOLA 2C8ZB 3OU0A 1OPHB 3A7ZA 1KXFA 4YZUA 5LPFA 1IQMA 4INLA 4HI3A 4JZFH 5ESBA 2HVYB 3M7UA 1GBKA 3VB4A 3BN9A 3SGAE 2EEKA 1WDIA 2ZHQH 4NFFA 4ZKNU 1O38A 4B6EA 1MD7A 3U8TH 2P95A 1J14A 1Z8IB 2OC0A 1ETTH 3NRLA 3F9FA 2OBOA 1N6XA 1AI8H 1XVMA 1ZTLA 4AN7A 3BTGE 4QT8C 2FI4E 2J95A 3GDUA 4LZ1H 3RDZA 3H09A 1Q3XA 1ZHMA 1MKXK 1UVSH 1T4VH 2YMSB 1BB0B 1HAXB 3OAAD 3A83A 5FL7D 3UR9A 1L4DA 3AVZA 2LNCA 3ZZCA 3LC3A 3PROA 1P9UA 1GBIA 3SGBE 4X6NA 5FAHA 1AFQB 1PYTC 1YY3A 3QGJA 5C67A 2GDDA 3BTKE 2ZDKA 4Y11E 2PKAA 1QBVH 3A7TA 3A87A 3EQ0H 1DUAA 3UNQA 1MKWH 2HALA 1EZQA 4OGXA 4B2BA 5CE1A 1A61H 1C1NA 1F0RA 1TE0A 1TNJA 4U32A 3T27A 2J98A 4ZXYH 2OUAA 3GY5A 2CHAC 4KP0A 2KM0A 1LQEA 1MTNB 1Y3VA 4GAWA 4CRCA 2BDAA 5FPTA 2FO9A 1LMWB 2PW8H 3RXCA 2BVRH 1CO7E 1V2TT 1E79D 4ZKSU 1NPMA 4RSPA 4OS4A 3I78A 2OINA 2PV9B 2XWBI 3PV2A 4A92A 1DS2E 2KZ4A 3NPSA 2YNBA 3LKWA 3ZVDA 4Y0ZE 3FP6E 3T2NA 3MQKC 1SGFA 1A0JA 1GDQA 4MLFB 1FUJA 4O3UA 1GI6A 1GI9B 4ZUHA 2UUKB 3G01A 2BXUH 4NFEA 1EP5A 6GCHF 3VG8A 4OS5A 3F2HA 1AIXH 1DXPA 2V0BA 2ZC9H 2KX4A 1XXDA 1OP0A 2HNTC 3QUMP 4MQAA 1EPTB 1W7GH 3BV9B 1TA2A 1A46H 1V2VT 1VGCC 4FUDA 1IQNA 1AWFH 2A1DB 3V7TA 8KME2 1TPAE 1AN1E 4CRFA 1MCVA 1T31A 4X8UH 1QRXA 1Y8TA 3ZZ9A 2BZAA 4VGCC 1PPZA 3E0PB 3PYHA 3KQ5A 5IDKA 1OYQA 4OS6A 2CF8H 4IBLH 3VB5A 2QXGA 3SNEA 5T1VA 1CBWC 1SGRE 2CMYA 1GMCG 1QB6A 6CHAB 5GCHF 2PKSB 2P8OB 2W7UA 3SV6A 3E0NB 3LGYA 1W2KH 3JZ2B 4CR9A 1QURH 1S6FA 2GT7A 1P2NA 3RXJA 1V2WT 5DP7A 5GIBA 4P00A 3F68H 4B73A 5HIZA 5L2YH 4X6OA 4DY7B 2GZ7A 1YPHC 2GT8A 1LKBA 4NCYA 3QWCH
chains in the Genus database with same CATH topology
2FOAA 3ENSB 1QBOA 5E0GA 3ZZ8A 2FI3E 2ZQ1A 1SGCA 3F6UH 4WXVA 2HLCA 2WPIS 1L0ZA 3E8LA 4HTCH 1TGTA 2ZPRA 4JMYA 1GHVH 3MWIU 2RCEA 2GV6A 4X2YA 1AGJA 1O3AA 1GI4A 1NS3A 3EA8A 2A2QH 1IQKA 1KY9A 1AHTH 3MH7A 2KAIB 1O2WA 3MH6A 1SFIA 3NUMA 1G36A 4TWWA 3SNAA 3SJ9A 1CHOF 2EI6A 2GD4B 2R3YA 5EXMA 2ZZUH 1ZPCA 5JBAS 1RGQA 2BY8X 1UVPA 1DE7H 1Y3YA 1A2CH 3ZV9A 1ARBA 2FPZA 2GMTC 5K0HA 1XMNB 3E90B 1SQOA 3D65E 3UNSA 2BD4A 2ZG0H 2PTNA 1GMDG 1F7ZA 1UCYH 4R0IA 1CA0B 4NA8A 5C20A 2C8XB 4UDWH 2GZ9A 1ZSKA 4WF8A 1XUJA 3IWMA 1UTMA 1EOLA 3LJJA 2ZGHA 4GUXA 1P2OA 3DT0H 2O8MA 1DITH 2F9UA 5AFYH 4FUIA 4Z6AH 3RC4A 3UUZA 1UTOA 1SGIB 1GI2A 1PJPA 4DOQA 2W7SA 5AHGH 1BBRK 1K1NA 2C8YB 1OWKA 3TH3H 1GBLA 1FDPA 1RS0A 1BHXF 1C1UH 2PLXA 4Y10E 1FN8A 3P8OA 4K1TA 3UWJH 2XNIA 1YPJH 4IGDA 2JH5D 4ZMAH 1RIWC 5DK1A 2D1JA 3EYDA 5L30H 1NFWA 1O5EH 3ZVGA 2B5TB 4YT6H 1LHCH 5F8XA 1K1JA 4IMQA 3LGVA 3RU4T 1EUFA 1CGHA 4K8YA 3TIUA 3O8RA 1DLKB 2G8TA 1Y5AT 2J38A 2Q6GA 4X1QU 3MNXA 1E38B 3C1KA 3LGUA 2Y81A 1TGBA 1BQYA 1TPOA 4ABDA 1V2QT 1V2UT 1GL1A 1O5DH 1JWTA 4A1TA 1O0DH 5GWZA 1XUGA 1GHAG 1BMNH 1AVGH 1K1IA 2QXJA 4TWYA 5JYIA 1XUFA 1O5CB 1THSH 1T4UH 2ZEBA 4Y6DA 3ATIA 5SGAE 2V6NA 3TK6A 2A5KA 2UWPA 4E06H 1E37B 1C5SA 2GZ8A 1XKBC 3F9GA 1MKXH 1P2QA 2OTVA 1HJAC 3HPTB 5DKMA 1UTLM 3BG4C 4WXIA 2TPIZ 1T7CA 2ZGJA 1SBWA 1ACBE 3SGQE 2VB0A 1HIAB 2GCTB 3KGPA 2ZDVH 2SNVA 1MZAA 4ISNA 4NZQA 1GI5A 4AZ2B 1LTOA 2QAAA 5HM9A 1VJ9U 1BITA 3KL6A 4I8GA 4K60A 3ZVEA 1C1WH 2FMJA 1THPB 1K1OA 3GCHC 4NA7A 3KNXA 1EB2A 1ABIH 2ZQ2A 2CGAA 2UWLA 3C27B 3P70B 1FPCH 1N6YA 3GOVB 1UJ1A 1FY8E 1O2ZA 2ZTYA 1JIRA 1OP8A 5F6MA 4DURA 1SLWB 3AAUA 3K9XB 1GBMA 1OP2A 2WPMS 3S0NA 2A4QA 1PQAA 1TMUH 1LQDB 1BMLA 1N8OC 2GTBA 1ELVA 3SU0A 4FXGH 3BEIB 3URCA 4Y8YA 4YLQH 4B2CA 1WTGH 3NCLA 1GHBF 4NSVA 1V2PT 2Z9JA 4D7FA 1TPSA 2WYGA 1BTUA 1T8OA 2PUXB 2UWOA 1NFUA 1GL0E 1C1OA 1SOZA 2AIQA 1EOJA 4AG2A 3GYLB 1YLDA 1TLDA 1MU6B 1O3LA 1C5TA 1WOFA 2P3TB 3K6ZA 3M5MA 5GJ4B 4TY7A 3ZVCA 1UK3A 1Z1JA 3ELAH 4RN6A 3RMOH 1HBTH 1A0HB 2XYAA 5FXLA 1MTSA 2G52A 1P9SA 2A5AA 1O34A 1JOUB 4GHTA 2FX6A 4K2YA 1Z8RA 2B0FA 3EA9A 1S81A 1YP9A 1TGSZ 1IQEA 4AFUA 1UK2A 2ZKSA 4AGKA 1CHGA 4WY3A 5TJXA 5F03A 1TNGA 1TX6A 2AIPA 1QBNA 3QGNB 5JB9S 1QQ4A 7ESTE 4ZHAA 1EAUA 1UTNA 5DP4A 3SNCA 1GJ6A 4Q80A 1BTPA 1OWEA 3GICB 4UE7H 1DSTA 3NKKA 2BDHA 3UR6A 2ZGBH 3VGCB 1RTLA 3EAJA 3TGIE 4CHAB 3T25A 3SUFA 1KTSB 2HGTH 3SU4A 1S5SA 5GPIB 5DP6A 4CRDA 4X8VH 1C2GA 1VITH 1Z6EA 1MMJN 1KDQB 2ZHWH 1Y3WA 2GKVE 2H5DA 2QA9E 3OTJE 2B9LA 1ORFA 2AMPA 1HAPH 3P8FA 3QTVH 3F9HA 2HNTF 5HM2A 3JZ1B 4B2AA 5BRRE 1KTTB 3UTUH 3RXIA 2ANYA 1YPLH 4KTUA 4DW2U 4ESTE 1F0SA 1V3XA 4BXWA 2ZFQH 1AVWA 1HRTH 1O2YA 4Y7AA 4Q7XA 6LPRA 4DT7B 3QN7A 1C5PA 4AYYB 4CREA 1QJ7B 1CQQA 4B1TA 4ZHLU 1GJCB 3KQBA 3P95A 2W3KA 1O35A 2ZU5A 1GBCA 1GDNA 2QY0B 5FPSA 2Y80A 1FY3A 3RXQA 1AU8A 3V0XA 1DY8A 1DWDH 1HXEH 2BQ6B 2XW9A 2ZPQA 2ANMH 1W13U 3RMMH 3S69A 2AS9A 2F83A 1V2MT 4CBNA 1YPKH 3NXPA 1LHDH 1ARCA 2VJ1A 1SQTA 1G32B 1ZHRA 1UHBA 1G3EA 1TNIA 3U1JB 1UCYK 2AEIH 2AH4X 2Z7FE 1NESE 1BCUH 4D76A 2SNWA 2A5IA 3ZZ7A 1O2OA 4BXSA 1K9OE 1GI7B 1K1LA 3Q3YA 3A89A 1BBRH 1ZSJA 1HAHH 4BAHB 1Y3UA 1AD8H 2ZIQH 4BTUB 1QB9A 4H42U 5E0HA 4JYVH 2J9NA 2BQ7B 1QL9A 4ISHH 5E2PA 1C1VH 1O2RA 3QO6A 4NIXA 4Q7YA 5HYOA 3TVJB 1RTKA 2BY9X 2F9NA 1NU7B 5A8XA 1B0FA 1GMCF 3PMAB 1O3FA 1VITF 2H5CA 5HGGA 3M3TA 3CP7A 1GBHA 1P2IA 1UO6A 1TX8A 1MQ5A 3SJOA 5GXPA 1P03A 2BDCA 1WQVH 2EC9H 4DCDA 1ELFA 5C5OA 2HWLB 1QJ6B 1KXBA 2PHBA 5DPAA 3E91A 5C3NA 4Y71A 3KEEA 1QIXB 1XXFA 1SGDE 1KLJH 1TYNA 1ZLRA 1W3CA 2HOBA 3TITA 3KIDU 1P2MA 1SVPA 2Z94A 1N1LA 4MNXA 4U30A 1KXEA 4IMZA 1F5RA 2WUCA 3S9AA 1C9TA 1TBQH 3SQHE 1Z6JH 2Z3CA 1FONA 1FI8A 3EGKH 1DWCH 1OOKB 2H2ZA 3S7KB 4KELA 4X2VA 1FIZA 3GCTG 1TRYA 5BPEA 2W3IA 2UUJB 1O2PA 2ESTE 4BNRA 1F0TA 3O8BA 1XM1A 3A7WA 4KGAA 3M61U 1L1NA 2ODQA 1LCYA 2CJIA 2PUQH 2BLOA 1QHRB 2VH0A 1S83A 3LGIA 1LHEH 3ZZ5A 2VVVA 2ZNKH 4WJG2 1HNEE 2Z3EA 5EQSA 3MO6A 3MNCA 5JPMH 4A1XA 4ABGA 1FY4A 3GY6A 3H7TA 4X2XA 3KQEA 2UUFB 3TJOA 1NY22 3UOPA 2VGCC 2IJOB 3NZIA 4MG3A 5EODA 1DLEA 1IHSH 5L6NH 4DVAU 2R9PA 1LKAA 2HPQH 2PSYA 5EW2H 1G3DA 1Z71A 5EGMA 1AFQC 2Y5FA 4UFEH 1IQLA 4I8HA 1AWHB 3FVFB 3M5OA 3GCNA 3SNBA 1VCWA 2QV1A 2A45B 2BX3A 1GWAA 3ATWA 5E2OA 1WYKA 3RXSA 4KTCA 3FP8E 2O9QA 3GISB 1BRUP 4OGYA 2Y7ZA 4WMEA 2ZFTA 1ZSLA 2JH6D 3MNSA 3LC5A 4WH8A 1CT4E 2STBE 1W8BH 1S0QA 1RJXB 1A0LA 3M3SA 1GMHG 2WPHS 1AQ7A 1C2LA 2ZFRH 4IC6A 2M5TA 4GLYA 3K2UA 5FPYA 1ZMLA 1P3CA 4BAKB 1IQGA 2A7CA 1JRTA 1FN6A 4FU9A 4TY6A 1TNLA 4YLUA 5J4QA 2WPKS 4XBCA 1F5KU 2FDAA 1K2I1 2ZDNA 1JBUH 3ATLA 2FIRH 2NU2E 2VIQA 5T6DA 1ESTA 5A0AE 1GHWH 4GCHF 4MPXA 3M37A 1AE8H 3QX5H 3F9EA 1S6HA 3SU6A 5LGOA 3URDA 3VB7A 4AG1A 2ASUB 4FUFA 1SLUB 5E8EH 1EASA 1TBRH 2BY7X 1HAGE 1C5QA 3ATKA 4MNVA 5B6OA 5FCRA 4VGCB 4F4OC 1NM6A 1F2SE 1SGPE 2JH0D 2C4FH 1HAVA 2BDYA 1DICA 1V2LT 1G9IE 1CBWB 1CE5A 4NWKA 1C2MA 1TONA 1Z7KA 3BIUH 4SGAE 3T29A 1JXPA 2BD9A 1KLIH 2A7HA 2PKSC 2FOCA 5DP8A 3MOCA 4UFGH 2THFB 3W94A 5A2MH 1C5OH 4AYVB 2XC0A 4DIHH 1A5IA 1C2IA 4E7RG 2R0LA 2WUBA 1EZUC 1GGDC 4X8SH 1UTPA 2GP9B 2VWNA 3HATH 1O5BB 4TPYA 1P10A 3LONA 1ANCA 1Z1IA 2G51A 4DG4A 3L6PA 3STIA 1GJ9B 4RKJB 3M7TA 5EPNA 2RA3A 4HZHA 1RXPA 4B71A 4Z0KA 4X2WA 1UMAH 4WH6A 3UQOA 1XUHA 1E34B 5ESTE 1DX5M 4YOGA 1UCYE 1YCPM 5T3HA 1EAWA 3A7YA 1VCPA 2GDEH 3PM3A 1TMTH 1V6DA 2FOFA 4JYTA 3VFEA 1LDTT 2ULLA 2G55A 2UUYA 3ODFA 1IQFA 8LPRA 1TOMH 2H9EH 2OQUA 4XBDA 7GCHF 3SW2B 2ZTXA 1TQ0B 1DVAH 1MQ6A 4YOIA 4XE4A 1P05A 2JETC 5A09A 2SGPE 1XKAC 4CR5A 2BLQA 1WQSA 3GY2A 2FOBA 1GI3A 3BSQA 4TYDA 4UD9H 4AFZA 1C5WB 1TNHA 1GBBA 1TA6A 1DANH 1ZMNA 4NZLA 1P57B 2OP9A 3KQDA 4X1PU 3MTYA 4GPGA 4ABEA 4JZDH 3F1SB 2ZI2H 4X6MA 1GBDA 3GYMA 4MPWA 2ZHDA 3BF6H 5I25A 2F91A 2O8UA 1AKSA 4AORA 1LVBA 1TPPA 2BLVA 1O5AB 1AFEH 1NFXA 1TAWA 3SUDA 3VEQB 1OXGA 2C3SA 2ZU1A 1O2VA 1QY6A 4JK5A 2R3UA 2GV7A 2VIWA 1OS8A 2OC1A 1TALA 1O36A 1CSOE 2FM2A 3S7HB 1L4ZA 1HXFH 4K8BA 1PYTD 1YPEH 1V2RT 7KMEH 5FHTA 4ABAA 2STAE 3RXAA 4JZ1A 3PMBB 2FOHA 5CMXH 5DP5A 1O2MA 3N7OA 1W0ZU 1ANBA 1GPZA 1SGQE 1O32A 1ETRH 5T6GA 3I29A 1YGCH 3A8AA 1ZGVA 3A7VA 1YCPH 2DE8A 3QTOH 4FUJA 5IYTA 4BANB 2PGQB 1G2MA 1HAYB 4INKA 1W7XH 1O31A 2ZCHP 3A82A 3RUOA 3LIWA 3SHAH 5EQRA 4WVPE 1O2JA 4ZAEA 1T8MA 2D8WA 1Q31A 2NU0E 3LT3A 2GCHG 1SGFG 5EXLA 3MFJA 3T28A 1YLCA 3DA9B 3VPKA 1O3EA 3U8RH 2PKAB 4IN2A 2R2WU 5E0JA 3MH5A 4IS5A 2OC8A 1SMFE 3TNSA 3U69H 3SN8A 2J34A 1C1SA 3SQEE 5C1UA 1EATA 3ZYEA 2OQ5A 3P17H 3V3MA 1LO6A 3RXHA 2SGDE 2HNTE 1O5FH 4FUHA 4AFQA 1BZXE 2A32A 2F9OA 1PFXC 5GCHG 3FFGA 3Q76A 5FBIA 4UEHH 1EJNA 2BZ6H 4WMDA 1CVWH 2GCTC 4Y76A 2OLGA 4MPUA 4ABFA 1BA8B 1FXYA 1O39A 1GBAA 4I7YH 4O9VA 4THNH 1AO5A 1S82A 2AGGX 4YT7H 1NRSH 3ZZ3A 4RKOB 4I31A 1GJBB 5L2ZH 1NN6A 2H9HA 4A1VA 1P8VC 1TBZH 5EG4A 3BIVH 5EU8A 1BRAA 3GCHB 1ZZZA 1S0RA 1G2LA 1V2OT 4AX9H 3A8BA 3PLKA 2NWNA 2F9PA 1O3CA 4HGCA 1GJ7B 3SJKA 3RXRA 1D3DB 4Q2KA 3ZZAA 1HGTH 3KN2A 3T62A 3U1IB 1C4Y2 1BRBE 4NSYA 3RU4D 3WY8A 1PPFE 1FNIA 4FUGA 5C1YA 4JYUH 3M3VA 1K1MA 1L1GA 2BD2A 3BTTE 3NWUA 1YPHE 2XWAA 3DFJA 1BTHH 3E3TA 4I8KA 2I6SA 3D49H 1PPBH 1MBQA 3QZRA 3SHCH 4BOHA 3BTDE 3RMLH 2BXTH 1O2XA 1LVOA 1QGFA 3MI4A 4M7GA 2PWXA 1DXWA 1K1PA 2A7JA 1CHOG 2OBQA 4CBOA 2IOTA 4DGJA 2Q1JA 2F9VA 3PLPA 1QL8A 4HFPB 4F49A 2ODYB 5FX5A 1NRPH 3RLYH 4FVDA 2IPHA 2Z3DA 1LVYA 1GG6B 2Y82A 3RLWH 2VH6A 3A7XA 1D3PB 2TGPZ 3S9BA 4XOJA 4BTIB 4XFQA 1ZRKA 1DDJA 3GDVA 6ESTA 1UVUH 1GHXH 2V3HH 3AAVA 2ZFSA 1SGEE 3AASA 5DJ7A 5C1XA 2BOKA 2ILNA 1SG8B 1FLEE 2A4OA 5EOKA 3ZZ4A 2C8WB 3A85A 1P01A 2FWWA 2FOMB 1EAIA 1O3KA 5AFZH 3TGKE 3Q3XA 1AMHA 2GGVB 1F92A 1PQ8A 1DY9A 1J9CH 2SGEE 2B8OH 2BDGA 1OYTH 1QB1A 1C2EA 2AGEX 1ZR0A 2VIDA 1AUJA 1OWHA 3I77A 2ZCLP 1B0EA 2ZWLH 1AB9C 1J17T 5A8ZA 1EPTA 1HAOH 3TK9A 1WAYB 1BTWA 3V12A 3VB6A 5GDSH 5LH8A 1TMBH 4AOQA 1IAUA 2PGBB 3LH3A 2A31A 1MAYA 1GHZA 2ZGCA 3ZZ6A 1CGJE 4O03A 1SL3A 3TH4H 1GJ8B 1EZXC 1VZQH 1K22H 1MH0A 1BUIA 5TCCA 4D7GA 1WV7H 3EDXB 1DM4B 3P6ZB 1AZZA 3RXLA <