3GOVB

Crystal structure of the catalytic region of human masp-1
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
251
structure length
251
Chain Sequence
IFNGRPAQKGTTPWIAMLSHLNGQPFCGGSLLGSSWIVTAAHCLHQSLDPKDPTLRDSDLLSPSDFKIILGKHWRLRSDENEQHLGVKHTTLHPQYDPNTFENDVALVELLESPVLNAFVMPICLPEGPQQEGAMVIVSGWGKQFLQRFPETLMEIEIPIVDHSTCQKAYAPLKKKVTRDMICAGEKEGGKDACAGDSGGPMVTLNRERGQWYLVGTVSWGDDCGKKDRYGVYSYIHHNKDWIQRVTGVRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords MASP-1
publication title MASP-1, a promiscuous complement protease: structure of its catalytic region reveals the basis of its broad specificity.
pubmed doi rcsb
source organism Homo sapiens
total genus 49
structure length 251
sequence length 251
ec nomenclature ec 3.4.21.-:
pdb deposition date 2009-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3govB02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3govB01
2H5CA 1TA2A 1FAXA 3I77A 1A5GH 4ZKSU 2R0KA 2XBXA 3SW2B 1VZQH 1EPTA 2GZ8A 2PKSB 1BQYA 1HJAB 3BTGE 1A46H 1EQ9A 7GCHG 2TGDA 2PV9B 1EB1H 2GGVB 5DKMA 4X2VA 3GICB 3TH3H 4Y71A 1AGJA 1L2EA 2TBSA 2BX4A 2HPPH 4FVBA 4TPYA 3S7KB 4B2CA 3EA9A 1O3BA 3L3TA 1TA6A 1GMHF 4WF8A 3U9AH 4ABEA 3UNQA 3UR6A 1C1PA 5JBCS 1SGNE 2WPMS 3RU4E 1MD8A 1EAIA 2PGQB 4KP0A 3VB3A 3ZZ9A 1ELBA 4ASHA 1C2GA 2CMYA 2FMJA 4XE4A 2P93A 1C2DA 2RA3A 4JZIA 1W0YH 1GJ6A 1MAYA 2QXJA 3A8AA 1WQVH 3A85A 1FIWA 3HK3B 1RRKA 4X8VH 2FZZA 4SGBE 5F6MA 5A2MH 1NFWA 3MO9A 2WYGA 4IS5A 3GY2A 3RMLH 3UQVA 4UE7H 1P2QA 3PROA 4X2WA 1AZ8A 1AD8H 4ISHH 1S0QA 4OS1A 3D65E 1DX5M 1W7XH 2NU2E 1FY1A 3BIVH 3KEEA 5C20A 3SNDA 4X1NU 1O2JA 1NRQH 4ZHAA 1EB2A 1K1NA 3GY8A 3JZ1B 3PM3A 1A1RA 2BY6X 4X2YA 1SOZA 4X1QU 1UTMA 1DWDH 2XNIA 1NM6A 1O3IA 2BLVA 1QQUA 1WTGH 2C8ZB 2ZO3H 1E37B 1TQ0B 3SNCA 2JETB 2QC2A 1XXDA 5LPRA 4AZ2B 3P8NA 5ABWA 4RKJB 1PYTC 1YCPM 4AOQA 1UCYK 1XUFA 1WTHD 3ZZ4A 2BLOA 4THNH 1PJPA 3A8DA 1MKXK 3UY9A 2ODYB 4A5TS 1C5PA 1WYKA 2RA0A 5HMAA 3Q3YA 2EI8A 4B75A 4GSOA 1P12E 2ZA5A 1SC8U 2Y6TA 3MNBA 3ATLA 4BAMB 4AG1A 3AW1A 2A32A 1O30A 1UVOA 1UTJA 3OU0A 3S0NA 1C2LA 5EPNA 4DCDA 1H9LB 2C8YB 1GJDB 1JIRA 1MZAA 1OXGA 2VWNA 4E7NA 4NIYA 2PUQH 3QWCH 5B6OA 1SI5H 2VIOA 1KLIH 2BD2A 3DUXH 1HAXB 1DUEA 1SVPA 5FBIA 1N8OB 2PTNA 1EJMA 1AMHA 2ANYA 2WPIS 2ESTE 2FOHA 4JYUH 4Z0KA 3W95A 1SPJA 1YPLH 3MMGA 4GVUA 1QB9A 1HAGE 2C93B 2PUXB 4YESB 4Y8ZA 3ZVCA 1MBMA 1HYLA 3A86A 3URCA 1ANEA 1TRNA 2XC5A 3MNXA 4E05H 4TY7A 4WH8A 4MNYA 4X1PU 3V12A 1OYQA 1P2MA 3PMBB 1LPZB 4ESTE 3OY6U 2CF9H 5LPFA 1O5AB 2VH6A 1ELGA 2VGCB 1C5WB 3UWIA 1AY6H 1O3EA 1DOJA 2OUAA 4A6LA 5IYTA 1UVSH 1GHAF 3AAUA 2Q6FA 2HPQH 4UFFH 1O3AA 2AGIX 4ABFA 1GMCG 1BHXF 2BYAX 2FOCA 1W7GH 4Q7YA 1D6WA 1NO9H 4A7IB 1P0SH 2FTLE 1L1JA 1SMFE 2R2MB 1NESE 3RXCA 4VGCB 4CRBA 3TJUA 1CA0B 2BB4A 2AIQA 2BXTH 1KDQB 2HOBA 5AF9H 1GVLA 1QJ7B 1ID5H 1SR5C 2C8WB 2GCTC 3ATKA 4LK4A 4TPIZ 3DD2H 1B0EA 2P3TB 5E8EH 1GBBA 1ELAA 1SGFG 3BTKE 3ESTA 5DK1A 2NU3E 5K7RA 4QT8C 3LH3A 1SBWA 2B5TB 1GHVH 1HAYB 1KXEA 3MH7A 3Q00A 1O5EH 2V35A 2BVXH 1DFPA 3RC6A 3TJNA 3TH2H 1RTLA 3SN8A 1UJ1A 1IQJA 2F83A 5HXFA 1O3LA 1AVGH 3UTUH 4K1SA 2BX3A 4H42U 2OC8A 3KN2A 1XXFA 2GV7A 2OBQA 1AKSB 1K1PA 2RDLA 4RKOB 1C5MD 1A61H 1UTPA 2BLWA 3GCOA 4CR9A 3BEFB 2F3CE 1V2UT 3ZZ6A 1T32A 2B0FA 1QTFA 2FYQA 1DM4B 2A7CA 5GDSH 1MU6B 2H9TH 4D9QA 1E34B 1YC0A 2ANWA 1ZMLA 4BTTB 3GDVA 3R0FA 1HAIH 3QGNB 1MQ6A 1SLUB 2GDDA 1MD7A 2ZDKA 3IWMA 4MNXA 3PTBA 3BG8A 1GBLA 2CGAA 3RXKA 1CHOF 4I7YH 1V2WT 4X6PA 1QY6A 3O8BA 5EQRA 3K2UA 2GVFA 1GDNA 2Z9JA 1G3BA 4DIHH 4FUIA 1D3QB 2TGAA 1SGPE 2ZIQH 3LIWA 1BTXA 1YBWA 3TK9A 2AGEX 2Z3EA 5CMXH 2O8UA 3VPKA 2R3YA 4MTBA 1DITH 3VB7A 1LHGH 6CHAB 4Y8YA 4WJG2 4IBLH 4JZDH 2ZTYA 3PYHA 4ISLA 2BQWB 3RM0H 5E0HA 1GBJA 1S81A 3KHVA 2J94A 2GCHG 1G3EA 3STJA 3ZZ8A 3M5LA 4JCNA 1OP8A 1TX8A 1UVPA 3MWIU 1ELDE 5I46H 1AHTH 3Q3XA 1QURH 3KQCA 2HVXA 4IMZA 4O97A 1GDUA 1K21H 2OINA 1TMBH 4D7FA 9ESTA 2D26C 1H8DH 1NRPH 1BDAA 1O31A 1P11E 2ZDVH 4BXWA 1A5IA 5HYOA 3AAVA 3UFAA 4ISOA 1P2KA 1OP0A 3L33A 1D3DB 1KDQA 1F5LA 5AFYH 1RIWC 4AFZA 4WMDA 1TBQH 3ATWA 5GXPA 4HFPB 1GJ5H 1C5SA 2H5DA 1SGTA 3B8JA 1YLCA 3SU0A 1HJ8A 1THRH 2UWPA 1QJ6B 1UTOA 1ZSKA 1ARBA 4WY3A 2PSYA 5A0AE 5BRRE 1VCQA 3GDSA 1DPOA 1C5UA 4MPVA 2Z9KA 1AKSA 4K3JA 1S5SA 2GMTC 2VWOA 4OGXA 1OWJA 4GCHG 1GHYH 3M3VA 1GPZA 3SO3A 2BMGB 2BD7A 2G55A 3HGPA 1OYTH 4FVDA 1YPMH 4I8HA 2WPKS 5F8ZA 1Z7KA 1TALA 3UOUA 4Q7XA 1WQSA 7ESTE 1DUAA 1EZXC 2G8TA 3URDA 3VXFH 2VIDA 1SFQB 1Z8RA 4Y7BA 4A1TA 2W7SA 1CU1A 3RXMA 4YT7H 5PTPA 2OQ5A 4ABDA 1FDPA 1Y3WA 2ALVA 4AGKA 4UD9H 1EZUC 1GJ4H 1TBZH 1ZSLA 1PPEE 1A4WH 1YPJH 4I8JA 1LDTT 2FWWA 2G00A 4H6SB 3PMJA 2VWMA 1WAYB 6GCHF 4X1SU 1GG6C 2XRCA 1GDQA 5DJ7A 5CE1A 2GTBA 2EA3A 2BZ6H 1OKXA 3E8LA 3GY5A 4XFQA 1CT4E 1K1MA 1CBWC 3U8TH 3V0XA 1IHSH 3F1SB 2Z94A 2F9NA 3NUMA 2CF8H 4AG2A 1F0RA 2XBWA 1DANH 1ZTLA 3T29A 4A1VA 1B5GH 2HRVA 4ABIA 1DSTA 2XBVA 3GYLB 4ZMAH 1D6RA 2TRMA 4HZHA 3CP7A 1UVTH 1W14U 3WY8A 1GVZA 2Z9LA 4O3TA 4KTUA 3KL6A 1KXBA 1KXDA 4ABBA 3Q76A 4FU9A 1BTPA 1TOCB 3GCHC 3TJOA 3A8CA 3K9XB 3P70B 1TE0A 3SUDA 2ZHDA 1P3CA 1SHHB 2BXUH 2O8TA 3RXQA 1RTKA 4PROA 4DT7B 1H4WA 2OC0A 2F9OA 2ZHFH 5GWZA 1C5VA 2Q1JA 2QF3A 1EATA 1LHFH 1V2NT 3P6ZB 5DP6A 2J2UA 1ZHRA 5DPAA 1EKBB 2SFAA 1O3MA 1MTUA 1C1TA 2PWXA 1JRTA 1QB6A 1TX6A 1EUFA 1KTSB 2A2QH 1P10A 2AFQB 2LPRA 5JB8S 3CENA 2YOLA 1RXPA 2QYIA 1YYY1 1O2IA 1NZQH 1FQ3A 2OP9A 2SGQE 4TWWA 1K1LA 1BBRE 1SGEE 1CHGA 1P04A 5A8XA 3ZV9A 4IC5A 1BMMH 4I8GA 4Q2KA 2ZGXH 4TY6A 4M7GA 3BTDE 3PWBA 1ZHPA 4CHAC 1BCUH 3LC5A 1GBKA 3VEQB 1TB6H 1C5YB 4H4FA 4UFDH 4B74A 2J92A 1BRBE 1BTWA 4FUGA 2ZPSA 1FPHH 1W10U 3LJJA 1GJBB 3BF6H 1YPGH 3UREA 2ODQA 1YPHC 5AHGH 1TPPA 5EQSA 2O8LA 3DA9B 1CVWH 2CHAC 1C5ZB 1C2KA 4F49A 1LVOA 7KMEH 3M5NA 1EXFA 2AMPA 3A81A 1DICA 1LQDB 3T27A 2G5VA 5LPEA 1C1RA 1BZXE 1GWAA 1NRSH 3A84A 2RCEA 4IC6A 4KELA 1QJ1B 2B9LA 5GCHG 4BAQB 6ESTA 1Z6JH 1ELTA 4CRFA 3MNSA 1LPGB 2FX4A 4YLUA 1C2HA 1KYNA 1GI1A 1O5BB 2XWAA 1QCPA 1V2VT 4CREA 3ZYDA 3MU1A 3P95A 3ZZ3A 3STIA 1V2PT 1GBAA 2ZHQH 4ABAA 1CQQA 3QDZB 3LGVA 2BTCE 1O2VA 3KF2A 4AGJA 3U69H 1TYNA 5TCCA 3M37A 4YO9A 1LHCH 3A7XA 1GI3A 5L6NH 1QIXB 2DE8A 2ZTZA 1WUNH 1LTOA 2PR3A 1HPGA 2CJIA 2FX6A 1XM1A 1SLVB 1JXPA 4YOIA 2SGAA 1K22H 1NT1A 5T3HA 3SV2H 2TGTA 3UUZA 3OSYA 1OWIA 4X6NA 1KY9A 1EAUA 1A3BH 1QBNA 1C1SA 1SGCA 3F9HA 3SU3A 3TPIZ 1SGRE 1LHDH 3BTTE 4UFEH 3RXEA 2GP9B 2VH0A 7GCHF 1GJ9B 3O8DA 1OWKA 1GBEA 1DS2E 1BITA 1AE8H 1BRAA 1FY3A 3H7OA 4UONA 1UO6A 1JBUH 5DG6A 1SOTA 1MTWA 4TYDA 2ZG0H 4HGCA 1IAUA 1FAKH 3DT0H 4IMQA 2ZGCA 4NA9H 4AN7A 3RXAA 1YKTA 2A7HA 4ZHLU 5LGOA 4DIIH 2W26A 2A45B 4JZEH 2UUJB 3SU5A 3D49H 1TX7A 2GDEH 3TITA 2BD8A 1W12U 1J17T 4E7RG 1UTLM 2F9BH 4INHA 1VJ9U 2GCTB 1O33A 3H5CB 1XUHA 1TNHA 1Z6EA 2FLRH 1HXEH 3GISB 3KQEA 1X7AC 3UOPA 2ODPA 2ZECA 1WV7H 1A2CH 2A5AA 2PSXA 2A4QA 1C9PA 2CN0H 1ZTJA 3T2NA 1Y5AT 2BDBA 3RUOA 3SHCH 3ZVGA 3ATIA 1TQ7B 1O3HA 1AB9C 2WV4A 3UNRA 1VGCC 5C1XA 2J4IA 1J8AA 3EA7A 1D3PB 1ZJDA 3K6YA 1GGDC 1NS3A 2TPIZ 1O3NA 1S82A 3V13A 1C5TA 2V6NA 3ELAH 1QNJA 3LGIA 2ZU4A 1IHTH 3DFJA 2BVRH 1OP2A 5JYIA 1YPHE 4B73A 2ZPQA 1MU8B 1C4V2 1AFQC 1HAPH 1O36A 1O3DA 3FVFB 2BY7X 3QZQA 4O9VA 3ZVDA 1D9IA 4DJZB 1GBCA 1CGJE 1KXFA 5DP4A 4ABJA 1K1JA 5C1UA 4NFFA 1G30B 5FCRA 1BT7A 1GL0E 3LONA 1MZDA 2IPHA 4CH2B 4I31A 3S69A 1F0UA 1LO6A 4WMFA 2JH6D 2SGEE 3TGKE 4ZROA 1L1NA 2ZGHA 3NK8A 3KQDA 1T8LA 3BTHE 4WXIA 2ZU5A 3A7ZA 1O2XA 3MU5A 1AE5A 2P3UB 1NY22 5FPSA 2FDAA 4CBOA 2HALA 1K2I1 1O0DH 1O2OA 3R3GB 2OXSA 1NPMA 4ZH8A 1P02A 3V7TA 1XX9A 4RSPA 3LU9B 3BSQA 1EP6A 1A0JA 4MDSA 1TRYA 2FYRA 3FZDA 3SV6A 1S6HA 1NU7B 1CGIE 3DFLA 4Y0YE 2CXVA 1KSNA 1PQ7A 1AZZA 3K6ZA 2ZHWH 1TRMA 3RU4T 1GHAG 2A5IA 4B1TA 1FV9A 5A8ZA 3LC3A 5DP3A 4DVAU 5F8XA 1FN8A 3S9AA 1V2TT 2A0QB 1MBQA 2ZWLH 3RMMH 1HNEE 3GCTF 1ORFA 4AFQA 1C1WH 2ZFRH 4YOGA 1ETRH 1V2LT 2A2XH 3TK6A 2THFB 4B2AA 4NSVA 3MHWU 3RXIA 1TMTH 3F9FA 3E0PB 1O3KA 1MUEB 2ZFPH 5HM9A 1ETSH 1GBTA 1O2UA 1RIWB 3PLBA 5AFZH 2ZGJA 3QX5H 1SGQE 4X8TH 4Y6DA 8GCHG 2W7UA 2FS9A 3TU7H 2C4FH 1GHZA 4FUCA 3BG4C 1GMCF 1OPHB 1IQNA 4NG9H 2GD4B 5DO4H 2SNWA 2SGDE 2A4RA 2WYJA 2EI7A 1AIXH 3P8GA 2BDGA 2P8OB 1O5GH 2ZDMA 3M7TA 2FI4E 2Y82A 1T8OA 2FXRA 4NWKA 4A92A 1GMDG 2G81E 3PLKA 1TAWA 2VVCA 1ESBA 3SQEE 3SUGA 5GJ4B 1O2ZA 2GMTB 1BTUA 1O2PA 1UK3A 3MYWA 4BXSA 1MTNC 4MNWA 4CBNA 3MH6A 4WH6A 1DY9A 1SQAA 1Y3VA 4XBCA 5GIBA 5SGAE 5EG4A 3NWUA 3RLWH 1C1VH 3SUEA 1ZGIA 1C4Y2 5C5OA 3OTJE 4HI3A 1H8IH 4X6MA 1HB0B 3SGAE 1XVOA 2JKHA 5JB9S 2P16A 2DE9A 3KIDU 1GI4A 1H9IE 2Y81A 3T25A 5HM2A 2JETC 1YLDA 4B71A 3A7VA 3W94A 1RS0A 2BZAA 1L1GA 1TNJA 3SNBA 3RXUA 1GG6B 3O8RA 5FPYA 1UCYE 1CHOG 1FI8A 4BAOB 2J9NA 1WCZA 4IGDA 1GI9B 4ZAEA 4BNRA 2ZKSA 3A80A 2FOMB 2BQ7B 1IOEA 1YPKH 1H1BA 3IG6B 2ULLA 1CBWB 3LPRA 1J9CH 2A1DB 1O34A 3BTWE 1FZZA 1SG8B 1GI0A 2C8XB 1C2MA 4ZUHA 3TLOA 1TPSA 3MNCA 2HWLB 2C3SA 4FU8A 4YTAA 3ZZDA 2J38A 1GHWH 1KLTA 1RJXB 3SGQE 4MPXA 3PO1C 1Y8TA 8LPRA 1FLEE 3FP7E 1N8OC 2WUCA 1E38B 4JK5A 1V2JT 1F7ZA 1V2KT 3KQBA 3GCHB 3TIUA 2AEIH 1BIOA 1WBGB 1N6YA 1JOUB 7LPRA 1TFXA 2J95A 4K5ZA 2BOKA 5FX6A 4XDEA 1SLXB 4Y10E 2UWLA 2QAAA 3L6PA 3M3TA 3T28A 3A89A 1LCYA 3ATMA 2FOBA 1AUJA 2O8WA 3ZV8A 5EW2H 2GCHF 1G2LA 1ZMJA 1NRRH 4FUFA 3FP6E 3RXDA 1K1OA 5HGGA 1OWDA 2VVVA 1MKWH 1ZPCA 1WU1A 2FIRH 3M5MA 1HBTH 1K9OE 4GHTA 3BTQE 4DGJA 1HAHH 1BTZA 1QL9A 5J4SA 3KGPA 3TNSA 2FP7B 1CA0C 5F8TA 5L30H 1S0RA 1QRZA 1UTQA 1AVXA 3UPEA 1N1LA 1TGBA 2ZTXA 1C2FA 2QXIA 4K69A 2ANKH 2SGPE 3G01A 3EGKH 5C2ZA 3UR9A 1XUKA 3A83A 2ZU1A 1BBRH 1HV7A 3A8BA 2ZCKP 2Y5HA 2ALPA 1YCPH 4ZXXH 2GX4A 4FUJA 1ESTA 6LPRA 1C5RA 1GJAB 2AMQA 1HAVB 1EJAA 2CHAB 3GY3A 1AWFH 4CH8B 1N6XA 3BV9B 4BTUB 1DVAH 1Q31A 2ZPRA 3LDXH 4K8BA 4D9RA 4DURA 1SGYE 1GI8B 2QV1A 3PMHB 2ZF0H 2FM2A 1GHBG 1O3GA 3QK1A 4X1RU 4J2YB 3VB6A 1K28D 4YOJA 1PQ5A 2PKAB 2BD3A 1C5LH 1Y3YA 6GCHG 1BMLA 1HIAB 1QGFA 1OX1A 3P8FA 1RGQA 3GCNA 1C9TA 2Z6BD 3I29A 1MAXA 1DSUA 1O5CB 1D3TB 1FY5A 1ZZZA 2BDYA 2FOFA 1W2KH 4OS5A 1C4U2 3C1KA 3PLPA 1F2SE 1P8VC 5JBAS 1NN6A 3RXGA 4U01A 1IQIA 4K1EA 1IQGA 1RFNA 3VXEH 5AVDA 3SGBE 3QUMP 2HLCA 2W3IA 2QA9E 3Q77A 1BA8B 2ILNA 2F9PA 4XOJA 3SV9A 1JRSA 1F0SA 1F5RA 4NIWA 3SV8A 2I6SA 3FAOA 1FPCH 4O3UA 3B23B 2FPZA 1TGSZ 3F9EA 1T8MA 2I6QA 1SL3A 2AMDA 1D4PB 1J16A 1UHBB 1ZGVA 5EXNA 3QTOH 1GCTC 2UUKB 2QN5T 2FOAA 1ZLRA 4AORA 1W11U 3SOSA 1O5DH 5A8YA 1T7CA 2QY0B 3SHAH 1O39A 1B0FA 4I8LA 2AGGX 1QBOA 1ELVA 1O2GH 4UEHH 4O03A 1XUGA 2BM2A 4WMEA 4FXGH 1QFKH 1PPZA 2PFEA 1JWTA 1PQ8A 4GLYA 3SU4A 2F91A 4WVPE 1Y3XA 1G2MA 3BEIB 1G36A 2XCNA 2ZEBA 1O2RA 4UDWH 1PQAA 4KTCA 1OS8A 1CA8B 1NFXA 2NWNA 3SI4H 2VINA 1FMGA 3ITIA 1P57B 1FIZA 2V0BA 3SZNA 1QBVH 3H7TA 5FHTA 1ARCA 1KLJH 2HGTH 1Y3UA 3N7OA 1FN6A 4MNVA 2BQ6B 1OWHA 1AB9B 1EZSC 1O38A 1ZPBA 3B9FH 3BEUA 3HKJB 5CHAC 4ZXYH 5EU8A 3QN7A 1P01A 3NZIA 1HAVA 1BUIA 3SNEA 4NWLA 5E2OA 4WXVA 2BOHB 4Y79A 1GJ8B 1VCWA 1V2ST 1AUTC 5K0HA 1V3XA 3BTME 2BDAA 3M61U 3F9GA 1VITG 4INLA 1ESAA 3GY7A 3MFJA 1NROH 3ENSB 1KXAA 2PKAA 2HNTC 3A7YA 3MU8A 1K1IA 1HIAA 1ANCA 3HK6B 1P09A 4YZUA 3GYMA 4INKA 2SNVA 4GHQA 4YM9A 1AFQB 3E1XB 4Y76A 4DG4A 1AVWA 2GZ9A 1W8BH 2FO9A 5C1YA 1ABIH 1O2TA 1QRXA 3VGCC 4BAHB 2FI5E 2VVUA 1MQ5A 4AYVB 2BDHA 2OLGA 1Z8JB 3A82A 1TNIA 3LGUA 1TABE 3MO6A 3RU4D 2H9HA 4JZ1A 1SHYA 4NA7A 1DT2A 4NGAH 1Z1JA 5GCHF 3SJKA 1ZMNA 2R2WU 5EXLA 3SUFA 4R0IA 4X8UH 3SV7A 4JZFH 1QA7A 1ZYOA 3TH4H 3ZZ5A 1QA0A 3V3MA 2G51A 3VB4A 2PLXA 3OX7U 3RXVA 1P06A 3LOXA 3NKKA 1UMAH 1THPB 1UHBA 1EPTC 3M7UA 5JBTA 4LOYH 2XW9A 1QRWA 4X8SH 1B7XB 3A7WA 1GMHG 1GJCB 2PW8H 1UVUH 1NU9A 4R8TB 5A09A 4YT6H 3Q3KA 1GBDA 3D62A 4ZHMU 1O2QA 1ELFA 5L2YH 1UTKA 2ZCLP 1DWCH 4OGYA 1ETTH 1FONA 5ESBA 2H9EH 2YNBA 4AFUA 4X2XA 2Q6GA 1FJSA 1WSSH 1HLTH 1O3PB 3S7HB 2XWBI 2Y5FA 5TCAA 3ZZAA 4ABHA 2FLBH 1Q2WA 1C1QA 1ZOMA 3M5OA 1V2MT 4FUDA 3F68H 3MTYA 1L4ZA 3ZVFA 2Y7XA 3BG4B 3RXHA 1G3CA 1F5KU 4HTCH 3QTVH 1DXPA 5DGJA 3E90B 2AYWA 1TONA 5C67A 2WV5A 1SFIA 1C1MA 1P9SA 4A1XA 1IQFA 1C5QA 4DOQA 3SJ8A 4BTIB 1O3FA 3CS7A 4U2WA 2VIVA 1FUJA 2BD5A 3LKWA 2D8WA 2ZFQH 4AX9H 4JMYA 3PMAB 2W5EA 1MTNB 1AFEH 1SB1H 3AASA 1DXWA 1HUTH 3MO3A 2V3HH 3ZVEA 3ZZ7A 2Y5GA 1MH0A 2BDCA 1DLEA 3TVJB 3HKIB 2BDIA 1BOQA 3SI3H 2FOEA 3RXRA 1O2SA 1EP5A 1G32B 1SGIB 3RM2H 1O2WA 1QL7A 5LH8A 1C2JA 4MPWA 3SJIA 3MU0A 3UWJH 1ACBE 2W3KA 2OTVA 1P2NA 1DDJA 1V2QT 3U8OH 3TGJE 5ESTE 1Z8GA 5EPYA 3UQOA 1THSH 4XSKU 4K1TA 1EJNA 3HPTB 2FS8A 1EAXA 2JH0D 2P59A 5I25A 3SQHE 2HNTE 1IQMA 2Y7ZA 1QB1A 5FX5A 1GBFA 2Z3CA 2ZHEH 1XKBC 3RXSA 2BD9A 2ZDAH 3GOVB 2ZFTA 1IQHA 1T4VH 3KNXA 2TIOA 2J34A 3K65B 1Z1IA 2AS9A 3RXLA 3OYPA 1MTSA 4AYYB 3EE0B 2JH5D 3MH4A 3PO1B 1UCYH 2BD4A 1ZHMA 1GVKB 2PKSC 1HGTH 1HJAC 4I33A 2XTTB 1MKXH 2AH4X 4ZKRU 3ZZCA 4BANB 1LQEA 1ZSJA 5FPTA 2D2DA 1LKBA 1VITH 4FUHA 2OBOA 4CRGA 1VR1H 3MU4A 1XKAC 3TGIE 3GCTG 2ZP0H 1QL8A 1DLKB 3MI4A 1BRUP 3NPSA 1C2IA 1P3EA 1O3JA 1BHXB 1NTPA 1GI5A 2K1QA 3P8OA 1TOMH 1TNGA 3EA8A 3SU6A 3F6UH 4ABGA 1E36B 1HXFH 3LJOA 4GPGA 3U1JB 3U8RH 1MCTA 3FFGA 1NC6A 1PPFE 1LMWB 3LH1A 2OC7A 1GBHA 3A7TA 3M36A 3OY5U 1A3EH 2ZFFH 1E0FD 1TGTA 3NCLA 1GHXH 3QZRA 3TNTA 3UNSA 3PWCA 1TNLA 2ZU2A 2ZI2H 1TNKA 1F92A 2IOTA 2XXLA 5DP5A 1A0HB 4LXBH 1VJAU 2ZQ1A 1OSSA 1PYTD 2NU1E 2WUBA 8GCHF 1O3CA 3ZZBA 3EQ0H 4NZQA 1SSXA 3VB5A 1UK4A 2BLQA 2QGRA 5A0CA 3M3SA 3EDXB 1P9UA 2PHBA 1A7SA 4J1YA 5E2PA 1QR3E 4I8KA 5TJXA 3BTFE 2GZ7A 1OOKB 2FEQH 1AN1E 1GMDF 2RG3A 3T5FH 4ZKNU 4LZ1H 3SU1A 1IQLA 4NIVA 2F9VA 2XCFA 1O2NA 1XVMA 1C5OH 1AI8H 1F0TA 2LNCA 4WWYA 2XYAA 4NZLA 1AO5A 1C5NH 5C5NA 4NA8A 2Q6DA 4MG3A 4NIXA 1ANDA 3BN9A 2VU8E 3ZVAA 1J14A 2EEKA 2BY9X 2VIPA 4D8NA 2P3FH 1O5FH 1SGDE 1PPGE 1YP9A 1O2LA 5C3NA 3FZZA 2A7JA 1CO7E 1M9UA 1FXYA 3D23A 2A31A 3NXPA 4GUXA 3P17H 1Y5UT 3DHKH 3HGNA 4K60A 9LPRA 1LHEH 2FESH 1C1OA 1KTTB 3KCGH 1S83A 2PGBB 1A0LA 1P2JA 4FUBA 4LZ4B 1YF4A 2ZFSA 1FY8E 1O3OA 3ZVBA 1XUIA 3LT3A 2IJOB 3SU2A 3VFEA 1NFUA 1YM0A 1G3DA 1P2IA 4ISNA 1Y5BT 1KIGH 4U32A 1HRTH 1SQOA 2UUFB 1CSOE 2VIQA 2H6MA 2ZCHP 1CGHA 1MKWK 2O9QA 5DP8A 1MTVA 1MMJN 3E16B 4UFGH 1S85A 1FNIA 1GCTB 2VWLA 3SORA 1EZQA 5T6DA 3RC4A 2P94A 4I32A 1W0ZU 5FAHA 3E6PH 1ZPZA 4IW4E 1PPBH 3M7QA 3BIUH 2Z3DA 4U30A 5GPIB 2ZDNA 4D7GA 4XBBA 3QGJA 1GCDA 2G5NA 1O2YA 3MOCA 4NSYA 2BVSH 1GBIA 1Z8IB 4Y11E 2OD3B 1T4UH 2DUCA 2VGCC 2VB0A 4ZKOU 2EI6A 3U98H 1ZR0A 1BBRK 1Q3XA 1FY4A 2BHGA 2TGPZ 2A4GA 1YPEH 2XC0A 2CV3A 1YCPK 1LVMA 2GV6A 1AQ7A 2ZC9H 5E0GA 4AB9A 2WPJS 1P03A 4JYTA 5A0BA 4XBDA 1H9HE 3CS0A 2QF0A 4CHAB 4VGCC 3FP8E 3TK5A 1RD3B 4MVNA 3GY4A 3RXFA 2QCYA 5G4BA 3MH5A 1V2RT 5BPEA 3RXJA 1AWHB 1SGFA 1TMUH 2G4TA 1Y59T 4Y0ZE 2ZDLA 1DY8A 2OQUA 2WINI 2FODA 3SJOA 1G37A 3AVZA 3QO6A 1W13U 1HAZB 1DE7H 3EAJA 5EODA 2VJ1A 3JZ2B 3SBKA 2G52A 2FTMA 2UWOA 4SGAE 1TWXB 1ZRBA 2B8OH 3GY6A 1LPKB 1TGCA 5F03A 5CHAB 1JMOH 3QLPH 2P8OC 3T26A 2BY5X 1TPOA 1LVBA 1YGCH 1L0ZA 1DWBH 2R0LA 3FANA 1HJ9A 2ZQ2A 4GCHF 5FBEA 1PPHE 2ZU3A 3ODDA 2H2ZA 1TLDA 1EOJA 4TWYA 2FOGA 1AU8A 1SLWB 1V6DA 1QHRB 1W3CA 2IN2A 1O32A 2HNTF 1EOLA 1OWEA 5H4IB 2STBE 1O2MA 3RC5A 1UTNA 3RXOA 3VGCB 1O37A 4CR5A 2GKVE 1DWEH 1GHBF 1INCA 3LGWA 4IN2A 2BY8X 5JPMH 1J15A 4ISIH 1O35A 4YLQH 5EOKA 4Y7AA 1EX3A 2QIQA 1BMAA 4OS7A 1TIOA 3RP2A 4Z6AH 2KAIB 5DP7A 2Z9IA 2H1UA 2PTCE 1ELEE 1HDTH 2STAE 1CT0E 4B2BA 4Q80A 2ZNKH 1T31A 4OS2A 2A5KA 2GT7A 3PTNA 6CHAC 1HAOH 1EPTB 1NRNH 3U1IB 4K8YA 4CRAA 3S9BA 1GI6A 2VNTA 3RMOH 1E35B 1G9IE 2AERH 3RDZA 2Y80A 3RXPA 5IDKA 2XC4A 1C1UH 5DP9A 1XMNB 1PPCE 4AB8A 2O8MA 2ZGBH 3HATH 3RMNH 1PFXC 1SQTA 1ABJH 5FCKA 4H6TA 2Z7FE 1C5XB 1JIMA 2C90B 3O8CA 2ANMH 3RXBA 1RTFB 2NU0E 1BB0B 1V2OT 4MPUA 1BTYA 1P2OA 2SGFE 1TPAE 4NCYA 2QXHA 1ELCA 4DW2U 1BTHH 1ZTKA 3ZYEA 1IQKA 3M35A 1A5HA 4IN1A 4KGAA 1GBMA 1S6FA 8KME2 1S84A 1EAWA 1MCVA 1L4DA 2WPHS 2NU4E 3BTEE 1QQ4A 5L2ZH 4E06H 1BMNH 3ODFA 2UUYA 2A4OA 2YNAA 5EGMA 3A88A 4JYVH 2B7DH 1HFDA 2M5TA 2ASUB 5T6GA 2QXGA 3SJ9A 4MLFB 1BJUA 4RN6A 4Q7ZA 2Z9GA 2XBYA 1BJVA 1T8NA 2GT8A 3LGTA 4GAWA 1VGCB 8ESTE 3GDUA 3UIRA 1LKAA 2P95A 1UK2A 5FXLA 5T6FA 1GI7B 1GGDB 5EXMA 4FUEA 4X0WU 2R9PA 4OS4A 4CRDA 5J4QA 2F9UA 1GJ7B 3IITA 4B76A 1BRCE 2WPLS 3C27B 1KXCA 4MQAA 4JK6A 3E0NB 2FI3E 5JDUB 1TGNA 3LGYA 4FU7A 1ANBA 1Z71A 4BOHA 3S9CA 1GL1A 2V3OH 2G4UA 1O2KA 2EC9H 2OCVB 1U6QA 2R3UA 1CE5A 5JBBS 5EW1H 1LVYA 1EASA 4KTSA 1ZRKA 4BAKB 5E0JA 2OC1A 1XUJA 1IQEA 1ZJKA 3RXTA 1NFYA 3PV4A 3E3TA 1VCPA 3A87A 5EQQA 1VITF 3AW0A 1C1NA 4X6OA 2AIPA 3P92A 5ETXA 3E91A 3I78A 4D76A 4KKDA 3EYDA 1O2HA 2D1JA 3PB1E 2ZZUH 4F4OC 3T62A 3TJVA 4CRCA 1P05A 1C2EA 2VIWA 3RLYH 1WOFA 1CT2E 2KAIA 4K2YA 1HCGA 1GI2A 4Y8XA 1TBRH 4OS6A 4DY7B 4NFEA 3SNAA 4AFSA
chains in the Genus database with same CATH superfamily
2H5CA 1TA2A 1FAXA 3I77A 1A5GH 4ZKSU 2R0KA 2XBXA 3SW2B 1VZQH 1EPTA 2GZ8A 2PKSB 1BQYA 1HJAB 4P00A 3BTGE 1A46H 1EQ9A 7GCHG 2TGDA 2YMSD 3N99A 2PV9B 1EB1H 2GGVB 5DKMA 3GS9A 4X2VA 3GICB 3TH3H 4Y71A 1AGJA 1L2EA 2TBSA 5F53A 2BX4A 2HPPH 4FVBA 4TPYA 3S7KB 4B2CA 3EA9A 1O3BA 3L3TA 1TA6A 1GMHF 4WF8A 3U9AH 4ABEA 3UNQA 3UR6A 1C1PA 5JBCS 1SGNE 2WPMS 3RU4E 1MD8A 1EAIA 2PGQB 3ZIAD 4KP0A 3VB3A 3ZZ9A 1ELBA 4ASHA 1C2GA 2CMYA 2FMJA 4XE4A 2P93A 1C2DA 2RA3A 4JZIA 2LELA 3UB0A 1W0YH 1GJ6A 1MAYA 2QXJA 3A8AA 1WQVH 3A85A 1FIWA 3HK3B 1RRKA 4X8VH 2FZZA 4SGBE 5F6MA 5A2MH 1NFWA 3MO9A 2WYGA 4IS5A 3GY2A 3RMLH 3UQVA 4UE7H 1P2QA 3PROA 4X2WA 1AZ8A 1AD8H 4ISHH 1S0QA 4OS1A 3D65E 1DX5M 1W7XH 2NU2E 1FY1A 3BIVH 3KEEA 5C20A 3PV2A 3SNDA 4X1NU 1O2JA 1NRQH 4ZHAA 1EB2A 1K1NA 3GY8A 3JZ1B 3PM3A 1A1RA 2BY6X 4Q4LA 4X2YA 1SOZA 4X1QU 1UTMA 1DWDH 2XNIA 5C94A 1NM6A 1O3IA 2BLVA 1QQUA 1WTGH 2C8ZB 2ZO3H 1E37B 1TQ0B 3SNCA 2JETB 2QC2A 1XXDA 5LPRA 4AZ2B 3P8NA 5ABWA 4RKJB 1PYTC 1YCPM 3OEHD 4AOQA 1UCYK 1XUFA 1WTHD 3ZZ4A 2BLOA 4THNH 1PJPA 3A8DA 1MKXK 3UY9A 2K8IA 2ODYB 4A5TS 1C5PA 1WYKA 1E1QD 2RA0A 5HMAA 3Q3YA 3DSOA 2EI8A 4B75A 4GSOA 3EE7A 1P12E 2ZA5A 1SC8U 2Y6TA 3MNBA 3ATLA 4BAMB 4AG1A 3AW1A 2A32A 1O30A 1UVOA 1UTJA 3OU0A 3S0NA 1C2LA 5EPNA 4DCDA 1H9LB 2C8YB 1GJDB 1JIRA 1MZAA 1OXGA 2VWNA 4E7NA 2KX4A 4NIYA 2PUQH 3QWCH 5B6OA 1SI5H 2VIOA 1KLIH 2BD2A 3DUXH 1HAXB 1DUEA 1SVPA 5FBIA 1N8OB 2PTNA 1EJMA 1AMHA 2ANYA 2WPIS 2ESTE 2FOHA 4JYUH 4Z0KA 3W95A 1SPJA 1YPLH 3MMGA 4GVUA 1QB9A 1HAGE 3W1EA 2C93B 2PUXB 4YESB 4Y8ZA 3ZVCA 4ACBA 1MBMA 1HYLA 3A86A 3URCA 1ANEA 1TRNA 2XC5A 3MNXA 4E05H 4TY7A 4WH8A 4MNYA 4X1PU 3V12A 1OYQA 1P2MA 3PMBB 5T1VA 1LPZB 4ESTE 3OY6U 2CF9H 5LPFA 1O5AB 2VH6A 1ELGA 2VGCB 1C5WB 3UWIA 1AY6H 1O3EA 1DOJA 2OUAA 4A6LA 5IYTA 1UVSH 1GHAF 3AAUA 2Q6FA 2HPQH 4UFFH 1O3AA 2AGIX 4ABFA 1GMCG 1BHXF 2BYAX 2FOCA 1W7GH 4Q7YA 1D6WA 1NO9H 4A7IB 1P0SH 2FTLE 1L1JA 1SMFE 2R2MB 1NESE 3RXCA 4VGCB 4CRBA 3OFND 2OK5A 3TJUA 1CA0B 2BB4A 2AIQA 2BXTH 1KDQB 2HOBA 5AF9H 1GVLA 1QJ7B 1ID5H 1SR5C 2C8WB 2GCTC 3ATKA 4LK4A 4TPIZ 3DD2H 1B0EA 3PRDA 2P3TB 5E8EH 1GBBA 1ELAA 1SGFG 3BTKE 3ESTA 5DK1A 2NU3E 5K7RA 4QT8C 3LH3A 1SBWA 2B5TB 1GHVH 1HAYB 1KXEA 3MH7A 3Q00A 1O5EH 2V35A 2BVXH 1DFPA 3RC6A 3TJNA 3TH2H 1RTLA 3SN8A 1UJ1A 1IQJA 2F83A 5HXFA 1O3LA 1AVGH 1NBMD 3UTUH 4K1SA 2BX3A 4H42U 2OC8A 3KN2A 1XXFA 2GV7A 2OBQA 1AKSB 1K1PA 2RDLA 4RKOB 1C5MD 1A61H 1UTPA 2BLWA 3GCOA 4CR9A 3BEFB 2F3CE 1V2UT 3ZZ6A 1T32A 2B0FA 1QTFA 2FYQA 1DM4B 2A7CA 5GDSH 1MU6B 2H9TH 4D9QA 1E34B 1YC0A 3N7DA 1OHHD 2ANWA 1ZMLA 4BTTB 3GDVA 3R0FA 1HAIH 3QGNB 1MQ6A 1SLUB 2GDDA 1MD7A 2ZDKA 3IWMA 4RT0A 4MNXA 3PTBA 3BG8A 1GBLA 2CGAA 5HKKD 3RXKA 1CHOF 4I7YH 1V2WT 4X6PA 1QY6A 3O8BA 5EQRA 3K2UA 2GVFA 1GDNA 2Z9JA 1G3BA 4DIHH 4FUIA 1D3QB 2TGAA 1SGPE 2ZIQH 3LIWA 1BTXA 1YBWA 3TK9A 2AGEX 2Z3EA 5CMXH 2O8UA 3VPKA 2R3YA 4MTBA 1NBME 1DITH 2L6OA 3VB7A 1LHGH 6CHAB 4Y8YA 4WJG2 4IBLH 4JZDH 2ZTYA 3PYHA 4ISLA 2BQWB 3RM0H 2EY4C 5E0HA 1GBJA 1S81A 3KHVA 2J94A 2GCHG 1G3EA 3STJA 3ZZ8A 3M5LA 4JCNA 1OP8A 1TX8A 1UVPA 3MWIU 1ELDE 1YWUA 1AHTH 3F2GA 3Q3XA 5I46H 1QURH 3KQCA 2HVXA 4IMZA 5C0TA 4O97A 1GDUA 1K21H 2OINA 1TMBH 4D7FA 9ESTA 2D26C 1H8DH 1NRPH 1BDAA 1O31A 1P11E 2ZDVH 4BXWA 4FETA 1A5IA 5HYOA 3AAVA 3UFAA 4ISOA 2F4LA 1P2KA 1OP0A 3L33A 1D3DB 1KDQA 1F5LA 5AFYH 1RIWC 4AFZA 4WMDA 1TBQH 3ATWA 5GXPA 3DCLA 4HFPB 1GJ5H 1C5SA 2H5DA 1SGTA 3B8JA 1YLCA 3SU0A 1HJ8A 1THRH 2UWPA 1QJ6B 1UTOA 1ZSKA 1ARBA 4WY3A 5EJLA 2PSYA 5A0AE 5BRRE 1VCQA 3GDSA 1DPOA 1C5UA 4MPVA 2Z9KA 2XNDD 1AKSA 4K3JA 1S5SA 2GMTC 2VWOA 4OGXA 1OWJA 4GCHG 1GHYH 3M3VA 4XD7D 1GPZA 3SO3A 2BMGB 2BD7A 2G55A 3HGPA 1OYTH 4FVDA 4AC9A 1YPMH 4I8HA 2WPKS 5F8ZA 1Z7KA 1TALA 3UOUA 4Q7XA 1WQSA 7ESTE 1DUAA 1EZXC 2G8TA 3URDA 1SKYE 3VXFH 2VIDA 1SFQB 1Z8RA 4Y7BA 4A1TA 2W7SA 1CU1A 3RXMA 4YT7H 5PTPA 2OQ5A 4ABDA 1FDPA 1Y3WA 2ALVA 5CHBA 4AGKA 4UD9H 1EZUC 1GJ4H 1TBZH 1ZSLA 1PPEE 1A4WH 1YPJH 4I8JA 1LDTT 2FWWA 2G00A 4H6SB 3PMJA 2VWMA 1WAYB 6GCHF 4TSFD 4X1SU 1GG6C 2XRCA 1GDQA 4Q63A 5DJ7A 5CE1A 2GTBA 2EA3A 2BZ6H 1OKXA 3E8LA 3GY5A 4XFQA 1CT4E 1K1MA 1CBWC 3U8TH 3V0XA 1IHSH 3F1SB 2Z94A 2F9NA 3NUMA 2CF8H 4AG2A 1F0RA 2XBWA 1DANH 1ZTLA 3T29A 4A1VA 1B5GH 2HRVA 4ABIA 1DSTA 2XBVA 3GYLB 4ZMAH 1D6RA 2TRMA 4HZHA 3CP7A 1UVTH 1W14U 2WHXA 3WY8A 4Z1MD 1GVZA 2Z9LA 4O3TA 4KTUA 3KL6A 1KXBA 1KXDA 4ABBA 3Q76A 4FU9A 1BTPA 1TOCB 3GCHC 3TJOA 3A8CA 3K9XB 3P70B 1TE0A 3SUDA 2ZHDA 1P3CA 1SHHB 2BXUH 2O8TA 3RXQA 1RTKA 4PROA 4DT7B 1H4WA 2OC0A 2F9OA 2ZHFH 5GWZA 1C5VA 2Q1JA 2QF3A 1EATA 2K0QA 1LHFH 1V2NT 3P6ZB 5DP6A 2J2UA 1ZHRA 5DPAA 2WZQA 1EKBB 2SFAA 1O3MA 1MTUA 1C1TA 2PWXA 1JRTA 1QB6A 1TX6A 1EUFA 1KTSB 2A2QH 1P10A 2AFQB 3AK5A 2LPRA 5JB8S 3CENA 2YOLA 1RXPA 2QYIA 2YMSC 1YYY1 1O2IA 3FKSD 1NZQH 1FQ3A 2OP9A 2SGQE 4TWWA 1K1LA 1BBRE 5EJ1A 1SGEE 4F48B 1CHGA 1P04A 5A8XA 3ZV9A 4IC5A 1BMMH 4I8GA 4Q2KA 2ZGXH 4TY6A 4M7GA 3BTDE 3PWBA 1BMFD 1ZHPA 4CHAC 1BCUH 3LC5A 1GBKA 3VEQB 1TB6H 1C5YB 4H4FA 4UFDH 4B74A 2J92A 1BRBE 1BTWA 4FUGA 2ZPSA 1FPHH 1W10U 3LJJA 1GJBB 3BF6H 1YPGH 3UREA 2KR7A 2ODQA 1YPHC 5AHGH 1TPPA 5EQSA 2O8LA 3DA9B 1CVWH 2CHAC 1C5ZB 1C2KA 4F49A 2J98B 1LVOA 7KMEH 3M5NA 1EXFA 3OTPA 2AMPA 3A81A 1DICA 1LQDB 3T27A 2JIZD 2G5VA 5LPEA 1C1RA 1BZXE 1GWAA 1NRSH 3A84A 2RCEA 4IC6A 4KELA 1QJ1B 2B9LA 5GCHG 4BAQB 6ESTA 1Z6JH 1ELTA 4CRFA 3MNSA 4RI0A 1LPGB 2FX4A 4YLUA 1C2HA 1KYNA 1GI1A 1O5BB 2XWAA 1QCPA 1V2VT 4CREA 3ZYDA 2QE7D 3MU1A 3P95A 3STIA 3ZZ3A 1V2PT 1GBAA 2ZHQH 4ABAA 1CQQA 3QDZB 3LGVA 2BTCE 1O2VA 3KF2A 4AGJA 3U69H 3OEED 1TYNA 3CNRA 5TCCA 3M37A 4YO9A 1LHCH 3A7XA 1GI3A 5L6NH 1QIXB 2DE8A 2ZTZA 1WUNH 1LTOA 2PR3A 1HPGA 2CJIA 2FX6A 2IJD1 1XM1A 1QZ8A 1SLVB 1JXPA 4YOIA 2SGAA 1K22H 1NT1A 2KCPA 5T3HA 3SV2H 2TGTA 3UUZA 3OSYA 1OWIA 4X6NA 1KY9A 1EAUA 1A3BH 1QBNA 1C1SA 1SGCA 3F9HA 3SU3A 3TPIZ 1SGRE 1LHDH 2KCAA 3BTTE 4UFEH 3RXEA 2GP9B 2VH0A 7GCHF 1GJ9B 3O8DA 1OWKA 1GBEA 1DS2E 1BITA 1AE8H 1BRAA 1FY3A 3H7OA 4UONA 1UO6A 1JBUH 5DG6A 1SOTA 1MTWA 4TYDA 2ZG0H 4HGCA 1IAUA 1FAKH 3DT0H 4IMQA 2ZGCA 4NA9H 4AN7A 3RXAA 1YKTA 2A7HA 2AHME 4ZHLU 5LGOA 4DIIH 2W26A 2A45B 4JZEH 5DN6D 2UUJB 3SU5A 3D49H 1TX7A 2GDEH 3TITA 2BD8A 1W12U 1J17T 4E7RG 1UTLM 2F9BH 4INHA 1VJ9U 2GCTB 1O33A 3H5CB 1XUHA 1TNHA 1Z6EA 2FLRH 1HXEH 3GISB 3KQEA 1X7AC 3UOPA 2ODPA 2ZECA 1WV7H 1A2CH 2A5AA 2PSXA 2A4QA 1C9PA 2CN0H 1ZTJA 3T2NA 1Y5AT 2BDBA 3RUOA 3SHCH 3ZVGA 3ATIA 1TQ7B 1O3HA 1AB9C 2WV4A 3UNRA 3N7EA 1VGCC 5C1XA 2J4IA 1J8AA 3EA7A 2J98A 1D3PB 1ZJDA 3K6YA 1GGDC 3F0PA 1NS3A 2TPIZ 1O3NA 1S82A 3V13A 1C5TA 2V6NA 3ELAH 1QNJA 3LGIA 2ZU4A 1IHTH 3DFJA 2BVRH 1OP2A 5JYIA 1YPHE 4B73A 2ZPQA 2JJ1D 1MU8B 1C4V2 1AFQC 3DSGA 1HAPH 1O36A 1O3DA 3FVFB 2BY7X 3QZQA 4O9VA 3ZVDA 1D9IA 4DJZB 1GBCA 1CGJE 1KXFA 5DP4A 4ABJA 1K1JA 5C1UA 4NFFA 1G30B 5FCRA 1BT7A 1GL0E 3LONA 1MZDA 2IPHA 4CH2B 4I31A 3S69A 1F0UA 1LO6A 4WMFA 2JH6D 4ASUD 2SGEE 3TGKE 4ZROA 1L1NA 3MQKC 2ZGHA 3NK8A 3KQDA 1T8LA 3BTHE 4WXIA 2ZU5A 3A7ZA 1O2XA 3MU5A 1AE5A 2P3UB 1NY22 5FPSA 2FDAA 4CBOA 2HALA 1K2I1 1O0DH 1O2OA 3R3GB 2OXSA 1NPMA 4ZH8A 1P02A 3V7TA 1XX9A 4RSPA 3LU9B 3BSQA 1EP6A 1A0JA 4MDSA 1TRYA 2FYRA 3FZDA 3SV6A 1S6HA 2JJ2D 1NU7B 5B6LA 1CGIE 3DFLA 4Y0YE 2CXVA 5IK2D 1KSNA 1PQ7A 2QF4A 1AZZA 3K6ZA 4ZCNA 2ZHWH 1TRMA 3RU4T 1GHAG 2A5IA 4B1TA 1FV9A 5A8ZA 3LC3A 5DP3A 4DVAU 5F8XA 1FN8A 3S9AA 1V2TT 2A0QB 1MBQA 2ZWLH 3RMMH 1HNEE 3GCTF 1ORFA 4AFQA 1C1WH 2ZFRH 4YOGA 1ETRH 1V2LT 2A2XH 3TK6A 2THFB 4B2AA 4NSVA 2HVYB 3MHWU 3RXIA 1TMTH 3F9FA 3E0PB 1O3KA 1MUEB 2ZFPH 5C17A 5HM9A 1ETSH 1GBTA 1O2UA 1RIWB 3OAAD 3PLBA 5AFZH 2ZGJA 3QX5H 1SGQE 1SQRA 4X8TH 2KCOA 4Y6DA 8GCHG 2W7UA 2FS9A 3TU7H 2C4FH 1GHZA 4FUCA 3BG4C 1GMCF 1OPHB 1IQNA 4NG9H 2GD4B 5DO4H 2SNWA 2SGDE 2A4RA 2WYJA 2EI7A 1AIXH 3P8GA 1K0HA 2BDGA 2P8OB 1O5GH 2ZDMA 3M7TA 2FI4E 2Y82A 1T8OA 2FXRA 4NWKA 4A92A 1GMDG 2G81E 3PLKA 1TAWA 2VVCA 1ESBA 3SQEE 3SUGA 5GJ4B 1O2ZA 2KFWA 2GMTB 1BTUA 1O2PA 1UK3A 3MYWA 4BXSA 1MTNC 4MNWA 4CBNA 3MH6A 4WH6A 1DY9A 1SQAA 1Y3VA 2J5UA 4XBCA 5GIBA 5SGAE 5EG4A 3NWUA 3RLWH 1C1VH 3SUEA 1ZGIA 1C4Y2 5C5OA 3OTJE 4HI3A 1H8IH 4X6MA 1HB0B 3SGAE 1XVOA 2JKHA 5JB9S 2P16A 2DE9A 3KIDU 1GI4A 1H9IE 2Y81A 3T25A 5HM2A 2JETC 1YLDA 4OM9A 4B71A 3A7VA 3W94A 1E1RD 1RS0A 2BZAA 1L1GA 1TNJA 3SNBA 3RXUA 1GG6B 3O8RA 5FPYA 1UCYE 1CHOG 1FI8A 4BAOB 2J9NA 1WCZA 4IGDA 1GI9B 4ZAEA 4BNRA 2ZKSA 4TT3D 3A80A 2FOMB 2BQ7B 1IOEA 1YPKH 1H1BA 3IG6B 2ULLA 1CBWB 3LPRA 1J9CH 2A1DB 1O34A 3BTWE 1FZZA 1SG8B 1GI0A 2C8XB 1C2MA 4ZUHA 3TLOA 1TPSA 3MNCA 2HWLB 2C3SA 4FU8A 4YTAA 3ZZDA 2J38A 1GHWH 2HLDD 1KLTA 1RJXB 3SGQE 4MPXA 3PO1C 1Y8TA 2KM0A 8LPRA 1FLEE 3FP7E 1N8OC 2WUCA 1E38B 4JK5A 1V2JT 1F7ZA 1V2KT 3KQBA 3GCHB 3TIUA 2AEIH 1BIOA 1WBGB 1N6YA 1JOUB 7LPRA 1FX0B 1TFXA 2J95A 4K5ZA 2BOKA 5FX6A 4XDEA 1SLXB 2RDEA 4Y10E 2UWLA 3WWBA 2QAAA 3L6PA 3M3TA 3T28A 3A89A 1LCYA 3ATMA 2FOBA 1AUJA 2O8WA 3ZV8A 5EW2H 2GCHF 1G2LA 1ZMJA 3UAIC 1NRRH 4FUFA 2YMSB 3FP6E 3RXDA 1K1OA 5HGGA 1OWDA 2VVVA 1MKWH 1ZPCA 1WU1A 2FIRH 3M5MA 1HBTH 1K9OE 4GHTA 3BTQE 2KCYA 4DGJA 1HAHH 2M2AA 3FN8A 1BTZA 1QL9A 5J4SA 4ACAA 3KGPA 3TNSA 2FP7B 1CA0C 2J97A 5F8TA 5L30H 1S0RA 1QRZA 1UTQA 1AVXA 3UPEA 1N1LA 1TGBA 2ZTXA 1C2FA 2QXIA 4K69A 2ANKH 2SGPE 3G01A 3EGKH 5C2ZA 3UR9A 1XUKA 3A83A 2ZU1A 1BBRH 1HV7A 3A8BA 2ZCKP 2Y5HA 2ALPA 1YCPH 4ZXXH 2GX4A 4FUJA 1ESTA 6LPRA 1C5RA 1GJAB 2AMQA 1HAVB 1EJAA 2CHAB 3GY3A 1YLNA 1AWFH 4CH8B 1N6XA 3BV9B 4BTUB 1DVAH 1Q31A 2ZPRA 3LDXH 4FOUC 4K8BA 4D9RA 4DURA 1SGYE 1GI8B 2QV1A 3PMHB 2ZF0H 2FM2A 1GHBG 1O3GA 3QK1A 4X1RU 4J2YB 3VB6A 3PRBA 1K28D 5GNDA 4YOJA 1PQ5A 2PKAB 2BD3A 1C5LH 1Y3YA 3F0OA 6GCHG 1BMLA 1HIAB 1QGFA 1OX1A 3P8FA 1RGQA 3GCNA 1C9TA 2Z6BD 3I29A 1MAXA 1DSUA 1O5CB 1D3TB 1FY5A 1ZZZA 2BDYA 2FOFA 4HG6A 1W2KH 4OS5A 1C4U2 3C1KA 3PLPA 1F2SE 1P8VC 5JBAS 1NN6A 3RXGA 4U01A 1IQIA 4K1EA 1IQGA 1RFNA 3VXEH 5AVDA 3SGBE 2WPDD 3QUMP 2HLCA 2W3IA 2QA9E 3Q77A 1BA8B 2ILNA 2F9PA 4XOJA 3SV9A 1JRSA 1F0SA 1F5RA 4NIWA 3SV8A 2I6SA 3FAOA 1FPCH 4O3UA 3B23B 2FPZA 1TGSZ 3F9EA 5EJZA 1T8MA 2I6QA 1SL3A 2AMDA 1D4PB 1J16A 1UHBB 1ZGVA 5EXNA 3QTOH 1GCTC 2UUKB 2QN5T 2FOAA 1ZLRA 4AORA 1W11U 3SOSA 1O5DH 5A8YA 5KECA 1T7CA 2QY0B 3SHAH 1O39A 3F2FA 1B0FA 1KMHB 4I8LA 2AGGX 1QBOA 1ELVA 1O2GH 4UEHH 4O03A 1XUGA 2QF5A 2BM2A 4WMEA 4FXGH 1QFKH 1E79D 1PPZA 3PV5A 2PFEA 1JWTA 1PQ8A 4GLYA 3SU4A 2F91A 4WVPE 1Y3XA 1G2MA 3BEIB 1G36A 2XCNA 2ZEBA 1O2RA 4UDWH 1PQAA 4KTCA 1OS8A 1CA8B 1NFXA 2NWNA 2W6JD 3SI4H 2VINA 1FMGA 3ITIA 5KEDA 1P57B 2KZ4A 1FIZA 2V0BA 3SZNA 1QBVH 3H7TA 5FHTA 1ARCA 1KLJH 2HGTH 1Y3UA 3N7OA 1FN6A 4MNVA 2BQ6B 1OWHA 1AB9B 1EZSC 1O38A 1ZPBA 3B9FH 3BEUA 3HKJB 5CHAC 4ZXYH 5EU8A 3QN7A 1P01A 3NZIA 1HAVA 1BUIA 3SNEA 1VKYA 4NWLA 5E2OA 4WXVA 2BOHB 4Y79A 1GJ8B 1VCWA 1V2ST 1AUTC 5K0HA 1V3XA 3BTME 2BDAA 3M61U 3F9GA 1VITG 4INLA 1ESAA 3GY7A 3MFJA 1NROH 1W0KD 3ENSB 1KXAA 2PKAA 2HNTC 3A7YA 3MU8A 1K1IA 1HIAA 1ANCA 3HK6B 1P09A 4YZUA 3GYMA 4INKA 2SNVA 4GHQA 4YM9A 1AFQB 3E1XB 4Y76A 1EFRD 4DG4A 1AVWA 2GZ9A 1W8BH 2FO9A 5C1YA 1ABIH 1O2TA 1QRXA 3VGCC 4BAHB 2FI5E 2VVUA 1MQ5A 4AYVB 2BDHA 2OLGA 1Z8JB 3A82A 1TNIA 3LGUA 1TABE 3MO6A 3RU4D 2H9HA 4JZ1A 1SHYA 4NA7A 1DT2A 4NGAH 1Z1JA 5GCHF 3SJKA 1ZMNA 3SYJA 2R2WU 5EXLA 3SUFA 4R0IA 4X8UH 3SV7A 4JZFH 1QA7A 1ZYOA 3TH4H 3ZZ5A 1QA0A 3V3MA 2G51A 3VB4A 2PLXA 3OX7U 3H09A 3RXVA 1P06A 3LOXA 3NKKA 1UMAH 1THPB 1UHBA 1EPTC 2WV9A 3M7UA 5JBTA 4LOYH 2XW9A 1QRWA 4X8SH 1B7XB 3A7WA 1GMHG 1GJCB 2PW8H 1UVUH 1NU9A 4R8TB 5A09A 4YT6H 3Q3KA 1GBDA 3D62A 3DSPA 4ZHMU 1O2QA 1ELFA 5L2YH 1UTKA 2ZCLP 1DWCH 4OGYA 1ETTH 1FONA 5ESBA 2H9EH 2YNBA 4AFUA 4X2XA 2Q6GA 1FJSA 1WSSH 5KGOA 1HLTH 1O3PB 3S7HB 2XWBI 2Y5FA 5TCAA 3ZZAA 1COWD 4ABHA 2FLBH 1Q2WA 1C1QA 1ZOMA 3M5OA 1V2MT 4FUDA 3F68H 3MTYA 1L4ZA 3ZVFA 2Y7XA 3BG4B 3RXHA 1G3CA 1F5KU 3FOAA 4HTCH 3QTVH 1DXPA 5DGJA 3E90B 2AYWA 1TONA 5C67A 2WV5A 1SFIA 1C1MA 1P9SA 4A1XA 1IQFA 1C5QA 4DOQA 3SJ8A 4BTIB 1O3FA 3CS7A 4U2WA 2VIVA 1FUJA 2BD5A 3LKWA 2D8WA 2ZFQH 4AX9H 4JMYA 3PMAB 2W5EA 1MTNB 1AFEH 1SB1H 3AASA 1DXWA 1HUTH 3MO3A 2V3HH 3ZVEA 3ZZ7A 2Y5GA 1MH0A 2BDCA 1DLEA 3TVJB 3HKIB 2BDIA 1BOQA 3SI3H 2FOEA 3RXRA 1O2SA 1EP5A 1G32B 1SGIB 3RM2H 1O2WA 1QL7A 4YXWD 5LH8A 1C2JA 4MPWA 3SJIA 3MU0A 3UWJH 1ACBE 2W3KA 2OTVA 1P2NA 3FO8D 1DDJA 1V2QT 3U8OH 3TGJE 5ESTE 1Z8GA 5EPYA 3UQOA 1THSH 4XSKU 4K1TA 1EJNA 3HPTB 2FS8A 1EAXA 2JH0D 2P59A 5I25A 3SQHE 2HNTE 1IQMA 2Y7ZA 1QB1A 4DT4A 5FX5A 1GBFA 2Z3CA 2ZHEH 1XKBC 3RXSA 2BD9A 2ZDAH 3GOVB 2ZFTA 1IQHA 1T4VH 3KNXA 2V3MA 2TIOA 2J34A 3F2HA 3K65B 1Z1IA 1S6LA 2AS9A 3RXLA 4P02A 3KYFA 3OYPA 1MTSA 4AYYB 3EE0B 2JH5D 3MH4A 3PO1B 1UCYH 2BD4A 1ZHMA 1GVKB 2PKSC 1HGTH 1HJAC 4I33A 2XTTB 3NRLA 1MKXH 2AH4X 4ZKRU 3ZZCA 2EQNA 3KYGA 4BANB 1LQEA 1ZSJA 5FPTA 2D2DA 1LKBA 1VITH 2PP6A 2V7QD 4FUHA 2RFKC 2OBOA 4CRGA 1VR1H 3MU4A 1XKAC 3TGIE 3GCTG 2ZP0H 1QL8A 1DLKB 3MI4A 1BRUP 3NPSA 1C2IA 2GJGA 2LP6A 3U28C 1P3EA 5C0UA 1O3JA 1BHXB 2W6ID 1NTPA 1GI5A 2K1QA 3P8OA 1TOMH 1TNGA 3EA8A 3SU6A 3F6UH 4ABGA 1E36B 1HXFH 3LJOA 4GPGA 3U1JB 3U8RH 1MCTA 3FFGA 1NC6A 1PPFE 1LMWB 3LH1A 2OC7A 1GBHA 3A7TA 3M36A 3OY5U 1A3EH 2ZFFH 1E0FD 1TGTA 3NCLA 1GHXH 3QZRA 3TNTA 3UNSA 3PWCA 1TNLA 2ZU2A 1YY3A 2ZI2H 1TNKA 1F92A 2IOTA 2XXLA 5DP5A 1A0HB 4LXBH 1VJAU 2ZQ1A 1OSSA 1PYTD 5FL7D 2NU1E 2WUBA 8GCHF 1O3CA 3SZEA 3ZZBA 3EQ0H 4NZQA 1SSXA 3VB5A 1UK4A 2BLQA 2QGRA 5A0CA 3M3SA 3EDXB 1P9UA 2PHBA 1A7SA 4J1YA 5E2PA 1QR3E 4I8KA 2WSSD 5TJXA 3BTFE 2GZ7A 1OOKB 2FEQH 1AN1E 1GMDF 2RG3A 3T5FH 4ZKNU 1WXRA 4LZ1H 3SU1A 1IQLA 4NIVA 2F9VA 2XCFA 1O2NA 1XVMA 1C5OH 1AI8H 1F0TA 2LNCA 4WWYA 2XYAA 4NZLA 1AO5A 1C5NH 5C5NA 4NA8A 2Q6DA 4MG3A 4NIXA 1ANDA 3BN9A 2VU8E 3ZVAA 1J14A 2EEKA 2BY9X 2VIPA 4D8NA 2P3FH 1O5FH 1SGDE 1PPGE 1YP9A 1O2LA 5C3NA 3FZZA 2A7JA 1CO7E 1M9UA 1FXYA 3D23A 2A31A 3NXPA 4GUXA 3P17H 1Y5UT 3DHKH 3HGNA 4K60A 9LPRA 1LHEH 2FESH 1C1OA 1KTTB 3KCGH 1S83A 2PGBB 1A0LA 1P2JA 4FUBA 4LZ4B 1YF4A 2ZFSA 1FY8E 1O3OA 3ZVBA 4XRNA 1XUIA 3LT3A 2IJOB 3SU2A 3VFEA 1NFUA 1YM0A 1G3DA 1P2IA 4ISNA 1Y5BT 1KIGH 4U32A 1HRTH 1SQOA 2UUFB 1CSOE 2VIQA 2H6MA 2ZCHP 2CK3D 1CGHA 1MKWK 2O9QA 5DP8A 1MTVA 1MMJN 2XOKD 3E16B 4UFGH 1S85A 5EIYA 1FNIA 1GCTB 2VWLA 3SORA 1EZQA 5T6DA 3RC4A 2P94A 1H8ED 4I32A 1W0ZU 5FAHA 3E6PH 1ZPZA 4IW4E 1PPBH 3M7QA 3BIUH 2Z3DA 4U30A 5GPIB 2ZDNA 4D7GA 4XBBA 3QGJA 1GCDA 2G5NA 1O2YA 3MOCA 4NSYA 2BVSH 1GBIA 1Z8IB 4Y11E 2OD3B 1T4UH 2DUCA 2VGCC 2VB0A 4ZKOU 2EI6A 3U98H 1ZR0A 1BBRK 1Q3XA 1FY4A 2BHGA 2TGPZ 2A4GA 2VBCA 1YPEH 2XC0A 2CV3A 1YCPK 1LVMA 2GV6A 1AQ7A 2ZC9H 5E0GA 4AB9A 2WPJS 1P03A 4JYTA 5A0BA 4XBDA 1H9HE 2IPQX 3CS0A 2QF0A 4CHAB 4VGCC 3FP8E 3TK5A 1RD3B 4MVNA 3GY4A 3RXFA 2QCYA 5G4BA 3MH5A 1V2RT 5BPEA 3RXJA 1AWHB 1SGFA 1TMUH 2G4TA 1Y59T 4Y0ZE 2ZDLA 1DY8A 2OQUA 2WINI 2FODA 3SJOA 1G37A 3AVZA 3QO6A 1W13U 1HAZB 1DE7H 3EAJA 5EODA 2VJ1A 3JZ2B 3SBKA 2G52A 2FTMA 3VG8A 2UWOA 4SGAE 1TWXB 1ZRBA 2B8OH 3GY6A 1LPKB 1TGCA 5F03A 5CHAB 1JMOH 3QLPH 2P8OC 3T26A 2BY5X 1TPOA 1LVBA 1YGCH 1L0ZA 1DWBH 2R0LA 3FANA 1HJ9A 2ZQ2A 4GCHF 5FBEA 1PPHE 2ZU3A 3ODDA 2H2ZA 1TLDA 1EOJA 4TWYA 5CDFE 2FOGA 1AU8A 1SLWB 1V6DA 1QHRB 1W3CA 2IN2A 1O32A 2HNTF 1EOLA 1OWEA 5H4IB 2STBE 1O2MA 3RC5A 3WWFA 1UTNA 3RXOA 3VGCB 1O37A 4CR5A 2GKVE 1DWEH 1GHBF 1INCA 3LGWA 4IN2A 2BY8X 1W0JD 5JPMH 1J15A 4ISIH 1O35A 4YLQH 5EOKA 4Y7AA 1EX3A 2QIQA 1BMAA 4OS7A 1TIOA 3RP2A 4Z6AH 2KAIB 5DP7A 2Z9IA 2H1UA 2PTCE 1ELEE 1HDTH 2STAE 1CT0E 4B2BA 4Q80A 2ZNKH 1MABB 1T31A 2JDID 5DSFA 4OS2A 2A5KA 2GT7A 3OE7D 3PTNA 6CHAC 1HAOH 1EPTB 1NRNH 3U1IB 4K8YA 4CRAA 3S9BA 1GI6A 2VNTA 3RMOH 1E35B 1G9IE 2AERH 3RDZA 2Y80A 3RXPA 5IDKA 2XC4A 1C1UH 5DP9A 1XMNB 1PPCE 4AB8A 2O8MA 2ZGBH 3HATH 3RMNH 1PFXC 1SQTA 1ABJH 5FCKA 4H6TA 2Z7FE 1C5XB 1JIMA 2C90B 4I86A 3O8CA 2ANMH 3RXBA 1RTFB 2NU0E 1BB0B 1V2OT 4MPUA 1BTYA 1P2OA 2SGFE 1TPAE 4NCYA 2QXHA 1ELCA 4DW2U 1BTHH 1ZTKA 3ZYEA 1IQKA 3M35A 1A5HA 4IN1A 4KGAA 1GBMA 1S6FA 8KME2 1S84A 1EAWA 1MCVA 1L4DA 2WPHS 2NU4E 4M9FA 3BTEE 1QQ4A 5L2ZH 4E06H 1BMNH 2L74A 3ODFA 2UUYA 2A4OA 5HIYA 2YNAA 5EGMA 3A88A 4JYVH 2B7DH 1H8HD 1HFDA 2M5TA 2ASUB 5T6GA 2QXGA 3SJ9A 4MLFB 1BJUA 4RN6A 4Q7ZA 2Z9GA 2XBYA 1BJVA 1T8NA 2GT8A 3F3BA 3LGTA 4GAWA 1VGCB 4B6FA 3GDUA 8ESTE 3UIRA 1LKAA 2P95A 1UK2A 5FXLA 5T6FA 1GI7B 1GGDB 5EXMA 4FUEA 4X0WU 2R9PA 4OS4A 4CRDA 5J4QA 2F9UA 1GJ7B 3IITA 4B76A 1BRCE 2WPLS 3C27B 1KXCA 4MQAA 4JK6A 1UW7A 3E0NB 2FI3E 5JDUB 1TGNA 3LGYA 4FU7A 4RT1A 1ANBA 1Z71A 4BOHA 3S9CA 1GL1A 2V3OH 2G4UA 1O2KA 2EC9H 2OCVB 1U6QA 2R3UA 1CE5A 5JBBS 4F55A 5EW1H 1LVYA 1EASA 4KTSA 3KQ5A 1WDIA 1ZRKA 4BAKB 5E0JA 2OC1A 1XUJA 1IQEA 1ZJKA 3RXTA 1NFYA 3PV4A 3E3TA 1VCPA 3A87A 5EQQA 1VITF 3AW0A 1C1NA 3WW7A 4X6OA 4B6EA 2AIPA 3P92A 5ETXA 3E91A 2F43B 3I78A 4D76A 5HIZA 4KKDA 3EYDA 1O2HA 2D1JA 3PB1E 2ZZUH 4F4OC 3T62A 3TJVA 4CRCA 1P05A 1C2EA 2VIWA 3RLYH 1WOFA 1CT2E 2KAIA 4K2YA 1HCGA 1GI2A 4Y8XA 1TBRH 4OS6A 4DY7B 4NFEA 3SNAA 4AFSA
chains in the Genus database with same CATH topology
2H5CA 1TA2A 1FAXA 3I77A 1A5GH 4ZKSU 2R0KA 2XBXA 3SW2B 1VZQH 1EPTA 2GZ8A 2PKSB 1BQYA 1HJAB 3BTGE 1A46H 1EQ9A 7GCHG 2TGDA 2PV9B 1EB1H 2GGVB 5DKMA 4X2VA 3GICB 3TH3H 4Y71A 1AGJA 1L2EA 2TBSA 2BX4A 2HPPH 4FVBA 4TPYA 3S7KB 4B2CA 3EA9A 1O3BA 3L3TA 1TA6A 1GMHF 4WF8A 3U9AH 4ABEA 3UNQA 3UR6A 1C1PA 5JBCS 1SGNE 2WPMS 3RU4E 1MD8A 1EAIA 2PGQB 4KP0A 3VB3A 3ZZ9A 1ELBA 4ASHA 1C2GA 2CMYA 2FMJA 4XE4A 2P93A 1C2DA 2RA3A 4JZIA 1W0YH 1GJ6A 1MAYA 2QXJA 3A8AA 1WQVH 3A85A 1FIWA 3HK3B 1RRKA 4X8VH 2FZZA 4SGBE 5F6MA 5A2MH 1NFWA 3MO9A 2WYGA 4IS5A 3GY2A 3RMLH 3UQVA 4UE7H 1P2QA 3PROA 4X2WA 1AZ8A 1AD8H 4ISHH 1S0QA 4OS1A 3D65E 1DX5M 1W7XH 2NU2E 1FY1A 3BIVH 3KEEA 5C20A 3SNDA 4X1NU 1O2JA 1NRQH 4ZHAA 1EB2A 1K1NA 3GY8A 3JZ1B 3PM3A 1A1RA 2BY6X 4X2YA 1SOZA 4X1QU 1UTMA 1DWDH 2XNIA 1NM6A 1O3IA 2BLVA 1QQUA 1WTGH 2C8ZB 2ZO3H 1E37B 1TQ0B 3SNCA 2JETB 2QC2A 1XXDA 5LPRA 4AZ2B 3P8NA 5ABWA 4RKJB 1PYTC 1YCPM 4AOQA 1UCYK 1XUFA 1WTHD 3ZZ4A 2BLOA 4THNH 1PJPA 3A8DA 1MKXK 3UY9A 2ODYB 4A5TS 1C5PA 1WYKA 2RA0A 5HMAA 3Q3YA 2EI8A 4B75A 4GSOA 1P12E 2ZA5A 1SC8U 2Y6TA 3MNBA 3ATLA 4BAMB 4AG1A 3AW1A 2A32A 1O30A 1UVOA 1UTJA 3OU0A 3S0NA 1C2LA 5EPNA 4DCDA 1H9LB 2C8YB 1GJDB 1JIRA 1MZAA 1OXGA 2VWNA 4E7NA 4NIYA 2PUQH 3QWCH 5B6OA 1SI5H 2VIOA 1KLIH 2BD2A 3DUXH 1HAXB 1DUEA 1SVPA 5FBIA 1N8OB 2PTNA 1EJMA 1AMHA 2ANYA 2WPIS 2ESTE 2FOHA 4JYUH 4Z0KA 3W95A 1SPJA 1YPLH 3MMGA 4GVUA 1QB9A 1HAGE 2C93B 2PUXB 4YESB 4Y8ZA 3ZVCA 1MBMA 1HYLA 3A86A 3URCA 1ANEA 1TRNA 2XC5A 3MNXA 4E05H 4TY7A 4WH8A 4MNYA 4X1PU 3V12A 1OYQA 1P2MA 3PMBB 1LPZB 4ESTE 3OY6U 2CF9H 5LPFA 1O5AB 2VH6A 1ELGA 2VGCB 1C5WB 3UWIA 1AY6H 1O3EA 1DOJA 2OUAA 4A6LA 5IYTA 1UVSH 1GHAF 3AAUA 2Q6FA 2HPQH 4UFFH 1O3AA 2AGIX 4ABFA 1GMCG 1BHXF 2BYAX 2FOCA 1W7GH 4Q7YA 1D6WA 1NO9H 4A7IB 1P0SH 2FTLE 1L1JA 1SMFE 2R2MB 1NESE 3RXCA 4VGCB 4CRBA 3TJUA 1CA0B 2BB4A 2AIQA 2BXTH 1KDQB 2HOBA 5AF9H 1GVLA 1QJ7B 1ID5H 1SR5C 2C8WB 2GCTC 3ATKA 4LK4A 4TPIZ 3DD2H 1B0EA 2P3TB 5E8EH 1GBBA 1ELAA 1SGFG 3BTKE 3ESTA 5DK1A 2NU3E 5K7RA 4QT8C 3LH3A 1SBWA 2B5TB 1GHVH 1HAYB 1KXEA 3MH7A 3Q00A 1O5EH 2V35A 2BVXH 1DFPA 3RC6A 3TJNA 3TH2H 1RTLA 3SN8A 1UJ1A 1IQJA 2F83A 5HXFA 1O3LA 1AVGH 3UTUH 4K1SA 2BX3A 4H42U 2OC8A 3KN2A 1XXFA 2GV7A 2OBQA 1AKSB 1K1PA 2RDLA 4RKOB 1C5MD 1A61H 1UTPA 2BLWA 3GCOA 4CR9A 3BEFB 2F3CE 1V2UT 3ZZ6A 1T32A 2B0FA 1QTFA 2FYQA 1DM4B 2A7CA 5GDSH 1MU6B 2H9TH 4D9QA 1E34B 1YC0A 2ANWA 1ZMLA 4BTTB 3GDVA 3R0FA 1HAIH 3QGNB 1MQ6A 1SLUB 2GDDA 1MD7A 2ZDKA 3IWMA 4MNXA 3PTBA 3BG8A 1GBLA 2CGAA 3RXKA 1CHOF 4I7YH 1V2WT 4X6PA 1QY6A 3O8BA 5EQRA 3K2UA 2GVFA 1GDNA 2Z9JA 1G3BA 4DIHH 4FUIA 1D3QB 2TGAA 1SGPE 2ZIQH 3LIWA 1BTXA 1YBWA 3TK9A 2AGEX 2Z3EA 5CMXH 2O8UA 3VPKA 2R3YA 4MTBA 1DITH 3VB7A 1LHGH 6CHAB 4Y8YA 4WJG2 4IBLH 4JZDH 2ZTYA 3PYHA 4ISLA 2BQWB 3RM0H 5E0HA 1GBJA 1S81A 3KHVA 2J94A 2GCHG 1G3EA 3STJA 3ZZ8A 3M5LA 4JCNA 1OP8A 1TX8A 1UVPA 3MWIU 1ELDE 5I46H 1AHTH 3Q3XA 1QURH 3KQCA 2HVXA 4IMZA 4O97A 1GDUA 1K21H 2OINA 1TMBH 4D7FA 9ESTA 2D26C 1H8DH 1NRPH 1BDAA 1O31A 1P11E 2ZDVH 4BXWA 1A5IA 5HYOA 3AAVA 3UFAA 4ISOA 1P2KA 1OP0A 3L33A 1D3DB 1KDQA 1F5LA 5AFYH 1RIWC 4AFZA 4WMDA 1TBQH 3ATWA 5GXPA 4HFPB 1GJ5H 1C5SA 2H5DA 1SGTA 3B8JA 1YLCA 3SU0A 1HJ8A 1THRH 2UWPA 1QJ6B 1UTOA 1ZSKA 1ARBA 4WY3A 2PSYA 5A0AE 5BRRE 1VCQA 3GDSA 1DPOA 1C5UA 4MPVA 2Z9KA 1AKSA 4K3JA 1S5SA 2GMTC 2VWOA 4OGXA 1OWJA 4GCHG 1GHYH 3M3VA 1GPZA 3SO3A 2BMGB 2BD7A 2G55A 3HGPA 1OYTH 4FVDA 1YPMH 4I8HA 2WPKS 5F8ZA 1Z7KA 1TALA 3UOUA 4Q7XA 1WQSA 7ESTE 1DUAA 1EZXC 2G8TA 3URDA 3VXFH 2VIDA 1SFQB 1Z8RA 4Y7BA 4A1TA 2W7SA 1CU1A 3RXMA 4YT7H 5PTPA 2OQ5A 4ABDA 1FDPA 1Y3WA 2ALVA 4AGKA 4UD9H 1EZUC 1GJ4H 1TBZH 1ZSLA 1PPEE 1A4WH 1YPJH 4I8JA 1LDTT 2FWWA 2G00A 4H6SB 3PMJA 2VWMA 1WAYB 6GCHF 4X1SU 1GG6C 2XRCA 1GDQA 5DJ7A 5CE1A 2GTBA 2EA3A 2BZ6H 1OKXA 3E8LA 3GY5A 4XFQA 1CT4E 1K1MA 1CBWC 3U8TH 3V0XA 1IHSH 3F1SB 2Z94A 2F9NA 3NUMA 2CF8H 4AG2A 1F0RA 2XBWA 1DANH 1ZTLA 3T29A 4A1VA 1B5GH 2HRVA 4ABIA 1DSTA 2XBVA 3GYLB 4ZMAH 1D6RA 2TRMA 4HZHA 3CP7A 1UVTH 1W14U 3WY8A 1GVZA 2Z9LA 4O3TA 4KTUA 3KL6A 1KXBA 1KXDA 4ABBA 3Q76A 4FU9A 1BTPA 1TOCB 3GCHC 3TJOA 3A8CA 3K9XB 3P70B 1TE0A 3SUDA 2ZHDA 1P3CA 1SHHB 2BXUH 2O8TA 3RXQA 1RTKA 4PROA 4DT7B 1H4WA 2OC0A 2F9OA 2ZHFH 5GWZA 1C5VA 2Q1JA 2QF3A 1EATA 1LHFH 1V2NT 3P6ZB 5DP6A 2J2UA 1ZHRA 5DPAA 1EKBB 2SFAA 1O3MA 1MTUA 1C1TA 2PWXA 1JRTA 1QB6A 1TX6A 1EUFA 1KTSB 2A2QH 1P10A 2AFQB 2LPRA 5JB8S 3CENA 2YOLA 1RXPA 2QYIA 1YYY1 1O2IA 1NZQH 1FQ3A 2OP9A 2SGQE 4TWWA 1K1LA 1BBRE 1SGEE 1CHGA 1P04A 5A8XA 3ZV9A 4IC5A 1BMMH 4I8GA 4Q2KA 2ZGXH 4TY6A 4M7GA 3BTDE 3PWBA 1ZHPA 4CHAC 1BCUH 3LC5A 1GBKA 3VEQB 1TB6H 1C5YB 4H4FA 4UFDH 4B74A 2J92A 1BRBE 1BTWA 4FUGA 2ZPSA 1FPHH 1W10U 3LJJA 1GJBB 3BF6H 1YPGH 3UREA 2ODQA 1YPHC 5AHGH 1TPPA 5EQSA 2O8LA 3DA9B 1CVWH 2CHAC 1C5ZB 1C2KA 4F49A 1LVOA 7KMEH 3M5NA 1EXFA 2AMPA 3A81A 1DICA 1LQDB 3T27A 2G5VA 5LPEA 1C1RA 1BZXE 1GWAA 1NRSH 3A84A 2RCEA 4IC6A 4KELA 1QJ1B 2B9LA 5GCHG 4BAQB 6ESTA 1Z6JH 1ELTA 4CRFA 3MNSA 1LPGB 2FX4A 4YLUA 1C2HA 1KYNA 1GI1A 1O5BB 2XWAA 1QCPA 1V2VT 4CREA 3ZYDA 3MU1A 3P95A 3ZZ3A 3STIA 1V2PT 1GBAA 2ZHQH 4ABAA 1CQQA 3QDZB 3LGVA 2BTCE 1O2VA 3KF2A 4AGJA 3U69H 1TYNA 5TCCA 3M37A 4YO9A 1LHCH 3A7XA 1GI3A 5L6NH 1QIXB 2DE8A 2ZTZA 1WUNH 1LTOA 2PR3A 1HPGA 2CJIA 2FX6A 1XM1A 1SLVB 1JXPA 4YOIA 2SGAA 1K22H 1NT1A 5T3HA 3SV2H 2TGTA 3UUZA 3OSYA 1OWIA 4X6NA 1KY9A 1EAUA 1A3BH 1QBNA 1C1SA 1SGCA 3F9HA 3SU3A 3TPIZ 1SGRE 1LHDH 3BTTE 4UFEH 3RXEA 2GP9B 2VH0A 7GCHF 1GJ9B 3O8DA 1OWKA 1GBEA 1DS2E 1BITA 1AE8H 1BRAA 1FY3A 3H7OA 4UONA 1UO6A 1JBUH 5DG6A 1SOTA 1MTWA 4TYDA 2ZG0H 4HGCA 1IAUA 1FAKH 3DT0H 4IMQA 2ZGCA 4NA9H 4AN7A 3RXAA 1YKTA 2A7HA 4ZHLU 5LGOA 4DIIH 2W26A 2A45B 4JZEH 2UUJB 3SU5A 3D49H 1TX7A 2GDEH 3TITA 2BD8A 1W12U 1J17T 4E7RG 1UTLM 2F9BH 4INHA 1VJ9U 2GCTB 1O33A 3H5CB 1XUHA 1TNHA 1Z6EA 2FLRH 1HXEH 3GISB 3KQEA 1X7AC 3UOPA 2ODPA 2ZECA 1WV7H 1A2CH 2A5AA 2PSXA 2A4QA 1C9PA 2CN0H 1ZTJA 3T2NA 1Y5AT 2BDBA 3RUOA 3SHCH 3ZVGA 3ATIA 1TQ7B 1O3HA 1AB9C 2WV4A 3UNRA 1VGCC 5C1XA 2J4IA 1J8AA 3EA7A 1D3PB 1ZJDA 3K6YA 1GGDC 1NS3A 2TPIZ 1O3NA 1S82A 3V13A 1C5TA 2V6NA 3ELAH 1QNJA 3LGIA 2ZU4A 1IHTH 3DFJA 2BVRH 1OP2A 5JYIA 1YPHE 4B73A 2ZPQA 1MU8B 1C4V2 1AFQC 1HAPH 1O36A 1O3DA 3FVFB 2BY7X 3QZQA 4O9VA 3ZVDA 1D9IA 4DJZB 1GBCA 1CGJE 1KXFA 5DP4A 4ABJA 1K1JA 5C1UA 4NFFA 1G30B 5FCRA 1BT7A 1GL0E 3LONA 1MZDA 2IPHA 4CH2B 4I31A 3S69A 1F0UA 1LO6A 4WMFA 2JH6D 2SGEE 3TGKE 4ZROA 1L1NA 2ZGHA 3NK8A 3KQDA 1T8LA 3BTHE 4WXIA 2ZU5A 3A7ZA 1O2XA 3MU5A 1AE5A 2P3UB 1NY22 5FPSA 2FDAA 4CBOA 2HALA 1K2I1 1O0DH 1O2OA 3R3GB 2OXSA 1NPMA 4ZH8A 1P02A 3V7TA 1XX9A 4RSPA 3LU9B 3BSQA 1EP6A 1A0JA 4MDSA 1TRYA 2FYRA 3FZDA 3SV6A 1S6HA 1NU7B 1CGIE 3DFLA 4Y0YE 2CXVA 1KSNA 1PQ7A 1AZZA 3K6ZA 2ZHWH 1TRMA 3RU4T 1GHAG 2A5IA 4B1TA 1FV9A 5A8ZA 3LC3A 5DP3A 4DVAU 5F8XA 1FN8A 3S9AA 1V2TT 2A0QB 1MBQA 2ZWLH 3RMMH 1HNEE 3GCTF 1ORFA 4AFQA 1C1WH 2ZFRH 4YOGA 1ETRH 1V2LT 2A2XH 3TK6A 2THFB 4B2AA 4NSVA 3MHWU 3RXIA 1TMTH 3F9FA 3E0PB 1O3KA 1MUEB 2ZFPH 5HM9A 1ETSH 1GBTA 1O2UA 1RIWB 3PLBA 5AFZH 2ZGJA 3QX5H 1SGQE 4X8TH 4Y6DA 8GCHG 2W7UA 2FS9A 3TU7H 2C4FH 1GHZA 4FUCA 3BG4C 1GMCF 1OPHB 1IQNA 4NG9H 2GD4B 5DO4H 2SNWA 2SGDE 2A4RA 2WYJA 2EI7A 1AIXH 3P8GA 2BDGA 2P8OB 1O5GH 2ZDMA 3M7TA 2FI4E 2Y82A 1T8OA 2FXRA 4NWKA 4A92A 1GMDG 2G81E 3PLKA 1TAWA 2VVCA 1ESBA 3SQEE 3SUGA 5GJ4B 1O2ZA 2GMTB 1BTUA 1O2PA 1UK3A 3MYWA 4BXSA 1MTNC 4MNWA 4CBNA 3MH6A 4WH6A 1DY9A 1SQAA 1Y3VA 4XBCA 5GIBA 5SGAE 5EG4A 3NWUA 3RLWH 1C1VH 3SUEA 1ZGIA 1C4Y2 5C5OA 3OTJE 4HI3A 1H8IH 4X6MA 1HB0B 3SGAE 1XVOA 2JKHA 5JB9S 2P16A 2DE9A 3KIDU 1GI4A 1H9IE 2Y81A 3T25A 5HM2A 2JETC 1YLDA 4B71A 3A7VA 3W94A 1RS0A 2BZAA 1L1GA 1TNJA 3SNBA 3RXUA 1GG6B 3O8RA 5FPYA 1UCYE 1CHOG 1FI8A 4BAOB 2J9NA 1WCZA 4IGDA 1GI9B 4ZAEA 4BNRA 2ZKSA 3A80A 2FOMB 2BQ7B 1IOEA 1YPKH 1H1BA 3IG6B 2ULLA 1CBWB 3LPRA 1J9CH 2A1DB 1O34A 3BTWE 1FZZA 1SG8B 1GI0A 2C8XB 1C2MA 4ZUHA 3TLOA 1TPSA 3MNCA 2HWLB 2C3SA 4FU8A 4YTAA 3ZZDA 2J38A 1GHWH 1KLTA 1RJXB 3SGQE 4MPXA 3PO1C 1Y8TA 8LPRA 1FLEE 3FP7E 1N8OC 2WUCA 1E38B 4JK5A 1V2JT 1F7ZA 1V2KT 3KQBA 3GCHB