1C5WB

Structural basis for selectivity of a small molecule, s1-binding, sub-micromolar inhibitor of urokinase type plasminogen activator
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
248
structure length
248
Chain Sequence
IIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLMSPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTICLPSMYNDPQFGTSCEITGFGKEASTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHTKEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Blood clotting
molecule keywords PROTEIN (UROKINASE-TYPE PLASMINOGEN ACTIVATOR)
publication title Structural basis for selectivity of a small molecule, S1-binding, submicromolar inhibitor of urokinase-type plasminogen activator.
pubmed doi rcsb
source organism Homo sapiens
total genus 50
structure length 248
sequence length 248
ec nomenclature ec 3.4.21.73: U-plasminogen activator.
pdb deposition date 1999-12-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1c5wB02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1c5wB01
2A32A 2OLGA 1AO5A 1HDTH 3UR9A 5DGJA 1N6YA 5A2MH 1O3DA 2ZU5A 1NRSH 3MU1A 2VB0A 2FDAA 3OY6U 3ZVAA 1O30A 1O3IA 2XWBI 3SU4A 2BD9A 1DS2E 2FMJA 1B0FA 1TMUH 1EOJA 3A7XA 1GJ6A 3MWIU 2JKHA 3BTEE 4MPWA 2BY8X 4B2AA 4AGJA 4UD9H 2O8WA 2RA0A 3GY8A 4F4OC 2QGRA 2R3UA 1MTVA 3A8AA 2YNBA 3LU9B 1D6WA 1ZPBA 1H4WA 2V3HH 3AAVA 3L3TA 4FXGH 1OWJA 1Y5UT 2GCTC 2VWLA 5DP5A 2H2ZA 3E8LA 1TX7A 1TGCA 3Q76A 1FPCH 1E36B 3OY5U 3D65E 3TK6A 3AVZA 3MH7A 2BQ6B 5DP6A 3BEFB 1Y3UA 2P8OC 1D3TB 3BEIB 1O38A 2XBWA 1QA7A 3SUFA 2GKVE 2EC9H 4Y10E 3ZZ5A 1BBRK 1CT0E 1AVGH 2BZAA 3S69A 1O5CB 1QGFA 3HGPA 2THFB 2PKAA 1E38B 1AFQB 4B2BA 2VGCC 2GZ8A 1Q2WA 2XRCA 3RXIA 1L0ZA 5E0GA 3TIUA 1LVOA 4Y8YA 1SSXA 2EI8A 1FLEE 3E3TA 5HGGA 3SU5A 4CHAC 2ZECA 1P8VC 3U8TH 2BDBA 2VIQA 1GJAB 4X8VH 1MZAA 1Z71A 4CREA 1AKSB 1J15A 3RXTA 2C8WB 2A7JA 5JBAS 2QXGA 4AZ2B 1BTZA 3BTDE 1SC8U 3FAOA 1O3EA 1OWIA 1UVSH 1KTSB 4AFUA 4Z0KA 3ATWA 6GCHF 2HPQH 1O2MA 1V2VT 3ENSB 1A5HA 2WPMS 4MNWA 3U69H 3KQDA 3A84A 3K2UA 4D7FA 4JZFH 3H7TA 1P11E 3Q3XA 3VB7A 2VU8E 5TCCA 1BHXB 4AB8A 1O39A 2QV1A 1AFQC 1NZQH 2VVVA 2WPHS 5CE1A 2TGTA 5GJ4B 1DITH 1FN8A 2ZHFH 2AGGX 1ABJH 1YPHE 2AMPA 1RGQA 1K1MA 2Z6BD 2CF8H 3W95A 1RS0A 3BIUH 2ZGCA 2A4GA 1E0FD 1V6DA 2Y80A 3GCNA 2GDEH 4UFGH 4B75A 2F9OA 3G01A 3V12A 3ZZDA 1IQLA 1P9SA 1KXFA 4YLUA 3MI4A 1DUEA 3I29A 1JRSA 2ZU4A 4HZHA 1OSSA 4CR9A 1EASA 3VGCB 2IJOB 4ISNA 3GCHB 1GI3A 2BY9X 4LZ4B 1EXFA 5F8TA 4R0IA 4SGBE 1FY3A 1O2UA 1PQ5A 2GV7A 4B2CA 4D7GA 5EPYA 4X8UH 1PPFE 5C1UA 2FM2A 1GJDB 2ZTYA 1C1UH 2OC0A 3F9EA 1BOQA 2HPPH 1ELAA 5GCHG 1PPEE 1P2KA 3RXCA 2GCHF 3ATKA 1QQUA 5F8XA 2QXJA 1O3GA 1NO9H 1O2VA 3GY2A 1DXPA 1O2WA 1IHTH 3P8NA 3E6PH 1GJBB 3H7OA 4ABHA 1W0YH 2P95A 3HKIB 3PLPA 3MU4A 1ANEA 4X2WA 4HFPB 7LPRA 2WPIS 1PPBH 1SOZA 3DA9B 4JYVH 1C5UA 4FVBA 3RU4T 3SZNA 2OQUA 4AN7A 1MKWK 2P3TB 3DD2H 2PHBA 5I46H 4FUFA 2Z7FE 1G3CA 2IN2A 1HXEH 2F83A 2NU3E 3PYHA 3O8CA 1SQAA 1OX1A 1PPCE 4WMFA 3PB1E 3PTBA 1RIWB 1MTUA 1SLUB 1QRXA 2G8TA 2QYIA 5ESBA 1C2DA 1SMFE 2M5TA 1Z7KA 3OSYA 5I25A 3M5OA 1CU1A 1AFEH 1S0QA 4ZAEA 1ELVA 1YPKH 3A7WA 4WH8A 3GY4A 4DCDA 1T7CA 1HLTH 1OYQA 2J9NA 2VWOA 4IN2A 1MAYA 3FZZA 1EJMA 1IQHA 1CHOF 4FUEA 1GMCG 1EPTA 1GBAA 1AU8A 1WOFA 2BLOA 4OS5A 1ZRBA 3AAUA 1C4Y2 4NSYA 4FU9A 3SJ8A 4U01A 4UONA 1FY5A 4GSOA 4GUXA 3ATMA 3SV8A 4MPVA 1A1RA 1G36A 1SFIA 3O8RA 3TVJB 1K1OA 2G4TA 3P70B 3RMLH 1ZHRA 1SGIB 2UUYA 2TGAA 2BB4A 3A81A 2G5NA 2QIQA 2LPRA 1ZPCA 4KGAA 2VWMA 5EQQA 1QRZA 1W12U 1GCDA 2GV6A 3BTME 1LHDH 2A31A 2ZGHA 3P95A 1SR5C 3SNEA 3ZZCA 1NTPA 4D9RA 5L30H 1HAXB 3B8JA 3RMOH 4O9VA 2PUXB 1DWCH 3PROA 5CHAC 4YT7H 2ZG0H 2PV9B 1YPJH 4UEHH 2G81E 4OS6A 1C5NH 1BHXF 1S84A 3F1SB 1YBWA 5SGAE 2ZFFH 4NZQA 4AYVB 4FU8A 3QUMP 1TQ0B 3RC4A 1ZPZA 4TY7A 1GMDG 2ZGJA 3SW2B 5FCRA 1FPHH 1GI0A 1DDJA 4NG9H 5DO4H 1TLDA 5IDKA 4XBDA 1KTTB 3GISB 3SNBA 4CRGA 1RTFB 5A8ZA 4TWWA 1IOEA 4BANB 1HCGA 1ZSKA 2SGAA 6CHAB 1V2QT 2C90B 1TOMH 3QGNB 1O33A 1WTGH 1E37B 1A0JA 3TH3H 1O31A 3KIDU 3U8OH 3TU7H 2QF0A 3UREA 2W26A 1J9CH 1BUIA 2Z9GA 3AW0A 4QT8C 1S5SA 1A61H 1DY9A 1FONA 4RN6A 3RMNH 5HYOA 5DK1A 4LK4A 1AKSA 4DIIH 2BDCA 1B7XB 3FVFB 3RDZA 5DP9A 3STJA 3F6UH 2XNIA 5FXLA 3RXEA 3SU3A 1G3DA 3M5MA 1QB6A 3M36A 1TBQH 3D49H 1O35A 3ATLA 2P3UB 2B7DH 3RLWH 1J14A 1YC0A 2IOTA 1C2KA 2P3FH 2LNCA 1V2JT 3A86A 4X8TH 1OS8A 1ACBE 5JDUB 2VWNA 1WUNH 2D26C 2STBE 3KL6A 4I31A 2JETB 2PKSC 2OC8A 5T3HA 3TH4H 1T31A 1K1JA 4OS2A 1TNKA 3BF6H 4I32A 1CGIE 1C5VA 1AE8H 1ETTH 4ISHH 2W3KA 1QB1A 3UUZA 1JIMA 1AN1E 3L33A 1DX5M 2ZDLA 1O3JA 3TNTA 5LPEA 1UK2A 3M37A 2BDHA 1DUAA 1CHGA 1GI7B 2FX6A 4ABDA 5EXNA 1ELEE 4NA9H 2F9PA 2ZHEH 1A3BH 4DOQA 1CA0B 4DJZB 1AWFH 4MQAA 1AZ8A 1UTOA 1O3KA 1AHTH 4H6SB 1K28D 3F68H 3I77A 3PMBB 1ELFA 2ASUB 1TX8A 1O2XA 3KN2A 2ZQ2A 2BYAX 4YOGA 1ZRKA 3EA8A 3RXDA 1HGTH 3A8BA 1DFPA 1TABE 3E0NB 2FYRA 2BM2A 1P3CA 1SPJA 1UVTH 3QLPH 3EDXB 2D1JA 4Q80A 2W7UA 3ZZ9A 1NM6A 1SGNE 5EW1H 1C5PA 1NRRH 1NPMA 5DJ7A 2OQ5A 1O2RA 2FI5E 1HNEE 1FJSA 1C5TA 4X6OA 3SI3H 3T29A 3T62A 2ZP0H 2O8UA 4FUHA 2OINA 1RXPA 2CN0H 1V2UT 5BPEA 1WYKA 1JWTA 3A87A 3PWCA 1EZQA 1LPKB 1O32A 1AVXA 1HUTH 1DVAH 4X0WU 4DY7B 2SFAA 1WV7H 2O9QA 1H8DH 2PSXA 2UWLA 3B9FH 3A82A 1NN6A 3MNSA 4NSVA 1XUFA 1O3BA 2KAIA 1YCPH 4YZUA 1LKBA 1TBRH 3S9AA 4NWKA 5C2ZA 4YLQH 3DFJA 2C4FH 3I78A 3O8BA 4FUCA 2P93A 2AFQB 2RG3A 3QTVH 1CA0C 1NY22 1C1VH 3MHWU 4K1TA 1Y3XA 3CP7A 4M7GA 3SI4H 1O2IA 4O97A 4LZ1H 1OOKB 3P8GA 4B76A 1FN6A 1ARBA 5FBIA 1X7AC 3UOPA 4J1YA 3KNXA 3LOXA 2BTCE 3D23A 3QGJA 2GP9B 1JMOH 2BY5X 3HKJB 1NC6A 1AWHB 1EZXC 2BDIA 3GDSA 1GHAG 2CJIA 5HXFA 3T27A 1TNLA 4DGJA 1Z8GA 4XBBA 2B9LA 4D9QA 1LVMA 2W5EA 4CH8B 1THPB 4X6MA 1KSNA 1M9UA 1O3LA 2NU1E 4H6TA 4OS4A 4RSPA 4WXVA 2FTLE 4DVAU 3RXLA 2SGDE 1EB1H 1BRBE 1TA6A 1GBHA 3MH5A 5GIBA 4O3TA 1E35B 4OGXA 3PMHB 3PTNA 1C4U2 3M3SA 4Q7YA 3UNQA 1NT1A 4ZKSU 5DPAA 3E1XB 1C5OH 3RXBA 3Q77A 2GZ7A 1QL9A 2BDAA 4ZMAH 3PWBA 3FP7E 2OBOA 1SGQE 1SGEE 1GPZA 2Y5FA 1SGDE 2Y81A 2GCTB 2ZCLP 2GDDA 1GJ4H 3GY3A 1GBKA 3GY7A 7ESTE 2Z3CA 1SGYE 2QXHA 3ELAH 3LIWA 1ANDA 1BMAA 3GY5A 1GHWH 3ZZBA 1TGTA 2A5AA 3A7YA 3SJ9A 4E05H 1O2PA 1UTLM 1D9IA 1EP5A 1GHAF 1SLVB 2P8OB 3KGPA 3MFJA 1GVLA 1T32A 4AOQA 1FNIA 2ZTXA 4X2VA 3ZVEA 3CS7A 4I8JA 1N8OC 1HYLA 1FY4A 1XUHA 1F0RA 2VGCB 3MO6A 1UK4A 2V35A 1VCQA 4X2XA 1IQEA 2F91A 1T8LA 1DWBH 2VH0A 3BTKE 3ZZAA 2H9HA 1RD3B 1H9LB 3IITA 3BTGE 2I6SA 4CHAB 2BHGA 1EZUC 3OU0A 1HIAB 3KCGH 1FQ3A 3MMGA 4ZKRU 3MNCA 4LOYH 1N6XA 3Q00A 1GI2A 3NUMA 3HGNA 4PROA 4XOJA 1CSOE 1P06A 2C8ZB 1PJPA 2FI3E 5FCKA 1ZSJA 3ZVFA 1SGPE 1O2HA 3A88A 2BMGB 3RXJA 2Z3EA 1EX3A 1TPOA 1ZJDA 1Z6EA 2ZGXH 4GLYA 4NA8A 1C5LH 1H1BA 4JK5A 1DT2A 3V0XA 1TIOA 2WINI 4HTCH 4K1EA 4OGYA 2J95A 6GCHG 5HM9A 3LJOA 5L6NH 4ASHA 1RJXB 2ZCKP 3IG6B 1IQGA 1FMGA 2Y5HA 1KLJH 1XX9A 3U9AH 1FY8E 1K2I1 1XXDA 5IYTA 4NFFA 1JIRA 1Q31A 2VVCA 4TPIZ 3SUEA 2XCFA 4KP0A 2BXTH 3VB5A 2ZU3A 2V3OH 1QR3E 1GVZA 5E2PA 1YPGH 5A8YA 6ESTA 3BTFE 1EB2A 3EYDA 1RTKA 1JRTA 2BOKA 4INKA 1MBMA 1GI6A 1PPGE 3ATIA 2A4OA 3RXQA 2WV5A 1V2KT 1NFYA 2HGTH 2G55A 2C93B 1MCVA 1G32B 2G00A 5FX6A 4MPUA 3GYLB 1DY8A 5EODA 2JH5D 1W3CA 1S6FA 4Y7BA 2QC2A 2A0QB 5A0AE 4CRCA 2Y7XA 4Y7AA 1O5EH 4AORA 1GGDC 4A1XA 1GJCB 5C3NA 1DM4B 1AE5A 1KDQB 2BD2A 2J92A 1O3HA 3K65B 1TFXA 3A85A 3LGTA 4BAHB 1Z6JH 2ILNA 4MNYA 4RKJB 1T8NA 1AQ7A 5DP4A 3SV7A 1GVKB 2YOLA 4CRBA 1F0UA 2ZDAH 1BRCE 4YOIA 3S0NA 2VIVA 2SGPE 4ZKOU 2AH4X 4NA7A 2J38A 4JZ1A 1XM1A 1UMAH 5EGMA 4ABBA 2GCHG 2WV4A 1C5ZB 2ALVA 4X2YA 1C2LA 5G4BA 1GBIA 2I6QA 3F9HA 3C1KA 4X1QU 1ZHPA 1EAUA 2TGDA 2K1QA 4THNH 1TE0A 3ZVBA 3EA7A 3A89A 2FZZA 2YNAA 1AMHA 1BDAA 4KTSA 1CBWC 1UTMA 4MNVA 2QF3A 1BMNH 3A80A 1QJ1B 2ZO3H 2BXUH 4CH2B 2ZPQA 2WPLS 3VB3A 4TYDA 2B8OH 2FO9A 1ESAA 1MZDA 3PMJA 3T28A 1ELDE 1AGJA 2ZGBH 4Z6AH 3RXFA 1XKAC 1A5GH 1C1TA 1W8BH 1BTWA 3U1JB 3SQEE 2AGEX 1JOUB 1SQTA 1O5BB 2GD4B 1Z1JA 2TRMA 2F9VA 3RXMA 2PUQH 2A7CA 2AGIX 2AEIH 5A0BA 5FX5A 2P59A 2BX3A 4ZXYH 4F49A 1GDUA 1FUJA 3ITIA 5LH8A 3FANA 3RC5A 3A83A 2Q6FA 1W11U 3PV4A 5JBCS 2HNTC 1ETRH 3SGAE 3SJIA 1DWDH 4Q2KA 4DW2U 2OD3B 3ZZ8A 1Y3YA 5DKMA 1ZZZA 5F03A 3SGBE 1TOCB 2ZA5A 1SG8B 1D4PB 2BDYA 4A92A 2WYGA 1OWKA 2F9NA 1TGBA 1P2IA 4O03A 1CHOG 4KTUA 2XC4A 1BZXE 3LC5A 5E0HA 1OKXA 1CGHA 1O2JA 4DURA 1YGCH 3SOSA 3S7HB 5FPYA 4IN1A 1KXDA 2XXLA 1KIGH 5GPIB 4YM9A 1LPGB 1MTNC 5TJXA 2BQ7B 2R0KA 1WSSH 2FESH 1NRQH 1SGCA 4Y0ZE 1LQEA 1O3NA 4KELA 1UCYE 1WBGB 1Z1IA 1UJ1A 2HVXA 4INHA 1O3CA 1HJ8A 1P01A 1LTOA 1SOTA 2Q6GA 4NIVA 1EZSC 1LO6A 1GBMA 1KLIH 2O8MA 1GBDA 1C1OA 1YPLH 2BVSH 2FLRH 3BTQE 4U30A 3KQBA 2DE9A 2FOMB 5CHAB 1SHYA 3V7TA 1UVUH 1SGTA 1UTJA 1CT4E 3BTWE 4AYYB 4MPXA 2NU4E 1HJAC 3QX5H 1ESTA 1GL0E 3IWMA 3QO6A 1KY9A 2OC7A 1K1LA 3RMMH 4Y0YE 1GDNA 3OX7U 3O8DA 3SNCA 5K7RA 4KKDA 2G51A 2F3CE 2WPJS 1TYNA 1N1LA 3M61U 3UIRA 4HI3A 1C1QA 4FUGA 3K9XB 4CRDA 2UUFB 2ZFPH 3E16B 4WWYA 1QBOA 4K2YA 4GCHF 4ZHLU 4WMDA 5CMXH 2Z9JA 4AFQA 1UO6A 3URDA 4ZUHA 1TGSZ 4FUBA 2G52A 1A2CH 1MBQA 2BD5A 4WY3A 4BTIB 3GOVB 4BXWA 2BVXH 1K21H 2QY0B 2UUJB 2PW8H 3SHAH 1ZYOA 3FZDA 4JK6A 1OYTH 3QN7A 1J8AA 2PTCE 1ZTLA 3HK6B 4WMEA 1K1PA 4Y79A 1AZZA 1VR1H 4B74A 2H9EH 3Q3KA 4KTCA 1PQ8A 3RC6A 4ABFA 3MNXA 1EJNA 1O3MA 4NIWA 1ZMJA 2PKSB 2GT7A 4AGKA 1MKXH 2FXRA 4A6LA 2A5IA 3ZVGA 3RXVA 1P02A 3DT0H 1V2TT 3SJOA 1QRWA 3C27B 2BDGA 1YYY1 1P10A 3CENA 2Y82A 2OXSA 5FAHA 3E91A 1EAXA 4IMQA 5EU8A 1T8MA 4FVDA 1K1NA 1BIOA 3SN8A 1HAZB 2A4RA 2SNWA 1GBLA 3EE0B 1KLTA 1BA8B 1SVPA 3BG8A 1C5YB 2PR3A 2ZZUH 3GDVA 9LPRA 1SLXB 4D76A 2AMQA 1SGFG 1NFXA 1GI4A 2Z9LA 4IC6A 5EW2H 3UWIA 2TGPZ 3TJUA 4U2WA 2HNTE 1GI1A 2XC5A 1C5MD 3SORA 2B0FA 3F9FA 2SGFE 2J94A 1WQSA 3W94A 4NFEA 4MTBA 1HB0B 1TPAE 1O2SA 2ZDKA 4X8SH 2BX4A 8KME2 2PKAB 1Y59T 3BG4C 3GCOA 1WQVH 4E7RG 1ZR0A 3GCTF 4NIXA 3TLOA 3SO3A 2R0LA 4X6PA 4INLA 2OUAA 2D2DA 5FHTA 3B23B 1EATA 2H5CA 2O8TA 1V2OT 1LDTT 1HRTH 3TH2H 1W0ZU 1QB9A 1SQOA 1LPZB 1TWXB 2O8LA 5JB8S 2JH6D 3M7QA 3PLBA 2IPHA 1L4DA 1P9UA 2ODQA 1F0TA 1WTHD 1C2JA 1Z8JB 3V13A 2BY7X 4I33A 2PLXA 3TPIZ 3NWUA 5E2OA 5E8EH 3SGQE 5C1XA 3FP8E 4IBLH 3SU2A 4FUIA 1DWEH 3NK8A 1S6HA 2H1UA 3PM3A 4CBNA 2CMYA 2R3YA 3RM0H 3QZQA 2QAAA 3UNSA 2ZQ1A 2PGBB 4IMZA 1G3EA 4YOJA 2CHAC 1FAXA 4XSKU 2XTTB 3TJOA 1F92A 5GXPA 1B5GH 4TWYA 5A8XA 2NWNA 5J4QA 1GJ5H 1ANCA 3P6ZB 2ZNKH 4ZH8A 1PQ7A 1V2RT 4R8TB 5AVDA 3RUOA 3SUGA 1T8OA 3LJJA 1ID5H 3NPSA 1AB9C 1T4VH 2EI7A 4LXBH 4MG3A 3ZZ4A 5C20A 1O5DH 2OBQA 1FIWA 1HAHH 1ZGVA 2J34A 4BAMB 1WU1A 2D8WA 3LGYA 4ZKNU 1C5SA 5ESTE 1Y5BT 1VGCC 4I8KA 2BLVA 1YM0A 1P2OA 3VFEA 1GDQA 2FOAA 4BXSA 3QTOH 1TMBH 1P04A 5PTPA 1A46H 1TQ7B 1G37A 2ANWA 1Y8TA 3HK3B 4K69A 5LPFA 1ZTJA 4UFFH 1D3QB 1UTNA 1O34A 3SJKA 2XCNA 3EQ0H 3TGJE 1LMWB 2BVRH 1UHBB 1HV7A 2R2MB 1SGFA 3BN9A 5JB9S 3UQOA 2QXIA 2PTNA 1C1SA 3KQCA 3KF2A 1N8OB 1CE5A 2HRVA 1MQ6A 2OP9A 1OP8A 3KHVA 2ZIQH 1GHZA 4Y8XA 2ZHWH 1ARCA 2ZDVH 3RXKA 2ZKSA 8ESTE 2FI4E 4WJG2 5L2ZH 4GVUA 2QN5T 4MNXA 2G5VA 1MTSA 1O3FA 3UNRA 1Y3WA 1VCPA 1P2MA 1DXWA 1OWEA 3UWJH 1O2ZA 1K22H 1BJVA 4NZLA 3STIA 4ABIA 1IQJA 1BB0B 1U6QA 3DFLA 2NU2E 2CV3A 1ELTA 1DE7H 3EGKH 1S85A 7GCHF 1NFUA 1AD8H 2PFEA 2G4UA 1GHBF 1DSTA 1ZMLA 3KEEA 1VZQH 5J4SA 1SHHB 3S9BA 2WPKS 1EKBB 3VXFH 1MU8B 2FODA 4K5ZA 4AX9H 5LPRA 2VIDA 3LDXH 1QY6A 2FS9A 1GBEA 1KYNA 3T5FH 3UFAA 2C3SA 3TGKE 2JH0D 1H8IH 1A5IA 1BTXA 4CR5A 2BD3A 3UY9A 4ISIH 1BBRH 1BITA 1YCPK 2ZPRA 2TPIZ 2A4QA 1S82A 4K8YA 7KMEH 1MH0A 2Q1JA 1C1MA 1HFDA 2BLQA 1BTHH 3T26A 4NCYA 3LGWA 1QNJA 1O5AB 4I7YH 3M3VA 1GBJA 5ETXA 1KXBA 1TPSA 1TA2A 8GCHF 4X1PU 3BSQA 1SB1H 2GZ9A 1TNGA 4RKOB 4U32A 3LONA 1QL7A 3TGIE 1EPTB 4MDSA 5ABWA 1V2NT 1P12E 2STAE 1SL3A 1TNHA 2CF9H 3NZIA 3V3MA 1UCYK 4UDWH 1GGDB 2ZDNA 5LGOA 3A8DA 3KQEA 3BV9B 1Y3VA 5HM2A 2FOFA 2TIOA 1P09A 3QDZB 6LPRA 5AFZH 1VITG 1NROH 2UUKB 5A09A 1O5FH 5T6DA 1TRYA 4UE7H 4BNRA 2NU0E 4DIHH 4XE4A 4CRFA 1XUKA 4OS7A 1O3AA 2OTVA 3LC3A 4ZXXH 4FUJA 3RXSA 1QBNA 2PSYA 4NWLA 4XBCA 1AIXH 1UTKA 2XWAA 1BRAA 3GDUA 3A7ZA 2GVFA 1FIZA 2A1DB 4A1VA 1A7SA 2GX4A 2ZFRH 4YESB 4YTAA 1LHGH 1GI5A 3HPTB 2HOBA 3QK1A 1W13U 3RXHA 4Y11E 4IGDA 1ESBA 5HMAA 2EI6A 1F5LA 1KXCA 1T4UH 4OS1A 1D3DB 2VJ1A 1CBWB 1TB6H 1WAYB 2ZDMA 1GJ7B 1EPTC 1C5XB 1BT7A 4I8HA 1C1WH 1JBUH 4NIYA 5F8ZA 4AFZA 3D62A 3TITA 1G2LA 5DP7A 2J2UA 2ZFSA 3ZVDA 1LVBA 2GMTB 2FEQH 3WY8A 1TALA 1VITF 5T6FA 3EA9A 1BTYA 1LQDB 3BIVH 1QFKH 2FOHA 1A3EH 4Y76A 3MO3A 1C2HA 1L1GA 3LT3A 1ZSLA 2AMDA 1GHVH 4ZHAA 5T6GA 3URCA 8LPRA 1OWHA 1HPGA 3SHCH 1C1RA 1C1NA 1SLWB 2Y5GA 1C5QA 5E0JA 3S7KB 2XW9A 4I8LA 2FP7B 3M7TA 1CO7E 5C5NA 2ESTE 2BZ6H 2AIPA 5C5OA 1PYTC 2OC1A 1C2GA 3GYMA 2VVUA 5BRRE 1L1JA 4MVNA 5FPSA 2ODPA 4Y71A 4XDEA 3LGVA 1RTLA 1L4ZA 3RXAA 1C2FA 1HAYB 1O2QA 1MKWH 5AF9H 4AG1A 1J17T 5JYIA 3S9CA 1MTWA 1UVPA 2ZEBA 1Z8IB 2C8XB 3RXGA 1O2YA 2GMTC 1NFWA 3QWCH 3RU4E 2WUCA 1RFNA 3A7VA 4ABJA 1MTNB 1P3EA 4Y6DA 1AY6H 3MOCA 2FTMA 5JPMH 4J2YB 4IW4E 1A0LA 2VIWA 1XMNB 2OCVB 1BJUA 3SV6A 2DUCA 3VB4A 1HXFH 1GBFA 5EPNA 2ZU2A 3K6YA 2J4IA 1SBWA 3E90B 4WF8A 3U98H 3UTUH 4FUDA 1XKBC 1XUGA 3A7TA 1NESE 2FOCA 4UFEH 2FOEA 4HGCA 2FS8A 3RP2A 3LGUA 1LVYA 1ELBA 2CXVA 3MU0A 1HJAB 2VH6A 3HATH 1QURH 2PGQB 3VPKA 4WH6A 2P16A 3M3TA 3M7UA 1TAWA 3A8CA 1UHBA 3CS0A 4A5TS 3DHKH 1TRMA 2ZHQH 4Q7ZA 1QQ4A 4X1NU 4A1TA 4ESTE 1BRUP 2BD4A 1GBCA 3MU8A 3RU4D 3MH6A 1THSH 1YKTA 1D3PB 1QHRB 3JZ1B 4GHTA 1BQYA 3K6ZA 1C2MA 2KAIB 5K0HA 1THRH 3LKWA 1GCTB 5EQRA 3ZZ3A 3LPRA 4WVPE 3FP6E 1DSUA 3FFGA 5F6MA 1QTFA 4GCHG 3M35A 3R0FA 3SU1A 4GHQA 1MQ5A 1S0RA 3ZYEA 4ZROA 1FI8A 1HAVB 2C8YB 1ZMNA 1NU7B 2BY6X 1OPHB 4ABAA 2A45B 1YLDA 4K8BA 3RXOA 3VGCC 2Z3DA 3GCHC 2FIRH 1YP9A 4B71A 5DP8A 1G30B 2BD7A 1ZHMA 5C67A 5JBTA 1PQAA 1B0EA 4K1SA 1V2LT 2B5TB 1C5RA 1YLCA 2FX4A 4SGAE 5GWZA 1AUTC 2FOGA 1HAPH 1O3OA 2Q6DA 2UWOA 3PMAB 1TGNA 1F7ZA 5GCHF 1OXGA 4JZDH 1XVOA 1OP0A 2FYQA 1ELGA 3AW1A 1KXAA 1QBVH 1L1NA 2VIOA 2XBVA 5A0CA 1CA8B 2A2QH 1GHXH 1C9TA 3ODDA 4X6NA 1O36A 2SNVA 3U1IB 3RM2H 1QJ6B 1GCTC 1HIAA 1BBRE 3PO1B 2ZTZA 3OYPA 2Y7ZA 1C9PA 1TMTH 2HALA 4BAOB 1GBTA 1FY1A 1GMHG 1LCYA 3SU0A 1LHCH 1Y5AT 9ESTA 4O3UA 3T25A 4UFDH 3P8FA 1AUJA 1OWDA 2QA9E 4VGCB 1FXYA 1XUIA 1GI8B 2V6NA 4E7NA 1GBBA 3TK9A 4XFQA 2HWLB 2VIPA 4E06H 1MD8A 2ZF0H 1RIWC 2HNTF 3BG4B 4MLFB 2H5DA 1ZOMA 2RA3A 3SBKA 1HAGE 1TNIA 4TPYA 4NGAH 1BMMH 1O2NA 2SGEE 2ZC9H 3GCTG 3DUXH 3TNSA 1VJ9U 1F0SA 4AFSA 5AFYH 1QL8A 5DG6A 1IHSH 3UQVA 1EOLA 3UPEA 4DT7B 2BQWB 1C2EA 3ESTA 1IQFA 4ISLA 1LKAA 1BCUH 1UTPA 3ZVCA 3T2NA 2A2XH 1V3XA 1G9IE 2AIQA 3H5CB 1GL1A 5L2YH 3P8OA 2ANYA 1A4WH 1C5WB 1V2MT 1GMCF 3PO1C 3BTTE 1FV9A 2V0BA 3TK5A 2P94A 3VB6A 1GMHF 2RCEA 3ODFA 1HAOH 2ALPA 5EG4A 5TCAA 1P03A 1PPHE 1AVWA 4I8GA 2EEKA 5FBEA 2ZWLH 2ZCHP 4JZIA 1IAUA 1O2OA 2A7HA 4WXIA 1QA0A 1PYTD 3SUDA 2SGQE 1AI8H 1KDQA 4IS5A 3QZRA 4ZHMU 4VGCC 1K9OE 1S81A 4JYTA 1ANBA 2CHAB 2ZU1A 3ZZ7A 1IQIA 1EAIA 2WYJA 1SI5H 3ZV9A 1ETSH 2F9UA 5JBBS 1W2KH 4FU7A 4H4FA 1P05A 2Z9KA 1PPZA 3L6PA 1GJ8B 1XVMA 1EP6A 2FWWA 1P2JA 2FPZA 3MU5A 3MTYA 3MYWA 2BOHB 2AYWA 5EOKA 1C1PA 1MU6B 1AB9B 3PLKA 2ZFQH 3EAJA 1EQ9A 1DLKB 1P2NA 2Y6TA 1TNJA 5GDSH 1H9IE 1O2TA 2WUBA 4BAQB 1O2KA 1PFXC 1EUFA 1VGCB 1ZLRA 1GMDF 2XYAA 1W7XH 1TBZH 4ISOA 2GGVB 3MNBA 3RXRA 3UOUA 1D6RA 3RLYH 2BLWA 3MO9A 2PWXA 2R2WU 3Q3YA 1TX6A 2ZI2H 1MKXK 4Q7XA 4ABEA 6CHAC 1GHYH 1TPPA 3VXEH 5EXLA 1EJAA 3N7OA 3OTJE 1F5KU 3SQHE 3E0PB 1YPEH 3P92A 1TONA 2VNTA 1CQQA 2VINA 2FOBA 2ZPSA 4GAWA 4JMYA 3VEQB 1GI9B 1MD7A 1LHEH 1MMJN 4AG2A 1GWAA 1MAXA 2W7SA 1VITH 1CVWH 2A5KA 3M5NA 2F9BH 3R3GB 3U8RH 3P17H 1UK3A 1DPOA 1BTPA 4BTUB 5H4IB 1HBTH 1ZGIA 1GJ9B 2XBYA 2DE8A 2W3IA 4JCNA 2ZHDA 3SU6A 3LH1A 4ABGA 3AASA 1QIXB 2RDLA 1Q3XA 1DANH 1WCZA 4K3JA 1O2GH 3UR6A 1NU9A 1INCA 1O0DH 1DLEA 1P57B 2Z9IA 4GPGA 1QCPA 4TY6A 2UWPA 4Y8ZA 1KXEA 2AERH 2XC0A 3ZZ6A 4YO9A 1XUJA 7GCHG 4IC5A 2HLCA 4DG4A 1YCPM 1NRNH 1VJAU 3MH4A 1GHBG 1LHFH 1NRPH 1F5RA 1O5GH 2JETC 3BEUA 3TJNA 1GG6B 1C2IA 3SV9A 4CRAA 1YF4A 2ZFTA 1EAWA 4X1RU 1F2SE 3SNDA 2H9TH 1OP2A 4D8NA 4K60A 1RRKA 3NKKA 2ANKH 4YT6H 3NCLA 1FDPA 5AHGH 3TJVA 1W14U 1ZTKA 4JZEH 3GICB 4BTTB 3RXPA 1XXFA 5DP3A 1UVOA 3M5LA 1HAVA 2AS9A 1HAIH 1J16A 1O37A 2Z94A 8GCHG 1H9HE 1ZJKA 2BD8A 2ULLA 1P2QA 1UTQA 1MCTA 1V2ST 4JYUH 1UCYH 1YPMH 1HJ9A 1S83A 4X1SU 2ODYB 3ZV8A 1G2MA 2GTBA 1W10U 4CBOA 1TRNA 1V2PT 1CT2E 5FPTA 1E34B 1A0HB 1G3BA 2QCYA 1DOJA 1FZZA 1YPHC 3ZYDA 3LGIA 2XBXA 2FLBH 3SNAA 1BTUA 1GG6C 5EQSA 1BMLA 1IQNA 3RXUA 4AB9A 5B6OA 1SGRE 1O2LA 1SFQB 3NXPA 4BOHA 3JZ2B 2ANMH 1C4V2 1MUEB 1VCWA 2EA3A 4BAKB 1IQMA 1Z8RA 1V2WT 1K1IA 1W7GH 1O3PB 3GY6A 3LH3A 1FAKH 3BTHE 1ELCA 1ORFA 5C1YA 4B1TA 2H6MA 1NS3A 1CGJE 4A7IB 1ABIH 2GT8A 1JXPA 1L2EA 1IQKA 1QJ7B 2R9PA 1DICA 3F9GA 4H42U 3SV2H 4B73A 5EXMA 1P0SH 2TBSA 2CGAA
chains in the Genus database with same CATH superfamily
2A32A 2OLGA 1AO5A 1HDTH 3UR9A 5DGJA 1N6YA 5A2MH 1O3DA 2ZU5A 1NRSH 3MU1A 2VB0A 2FDAA 3OY6U 3ZVAA 1O30A 1O3IA 2XWBI 3SU4A 2BD9A 1DS2E 2FMJA 1B0FA 1TMUH 1EOJA 3A7XA 1GJ6A 3MWIU 2JKHA 3BTEE 4MPWA 2BY8X 4B2AA 4AGJA 4UD9H 2O8WA 2RA0A 3GY8A 4F4OC 2QGRA 2L74A 2R3UA 1MTVA 2QF4A 3A8AA 2YNBA 3LU9B 1D6WA 1ZPBA 1H4WA 2V3HH 3AAVA 3L3TA 4FXGH 1OWJA 1Y5UT 2GCTC 2VWLA 5DP5A 2H2ZA 5B6LA 3E8LA 1TX7A 1TGCA 3Q76A 1FPCH 1E36B 5DN6D 3OY5U 3D65E 3TK6A 3AVZA 3MH7A 2BQ6B 5DP6A 3BEFB 1Y3UA 2P8OC 1D3TB 3BEIB 1O38A 2XBWA 1QA7A 3SUFA 5C0TA 2GKVE 2EC9H 4Y10E 3ZZ5A 1BBRK 1CT0E 3UB0A 1AVGH 2BZAA 3S69A 1O5CB 1QGFA 3HGPA 2THFB 2PKAA 1E38B 1AFQB 4B2BA 2VGCC 2GZ8A 1Q2WA 2XRCA 3RXIA 1L0ZA 5E0GA 3TIUA 1LVOA 4Y8YA 1SSXA 2EI8A 1FLEE 3E3TA 5HGGA 3SU5A 3ZIAD 4CHAC 2ZECA 1P8VC 3U8TH 2BDBA 2VIQA 1GJAB 4X8VH 2VBCA 1MZAA 1Z71A 4CREA 1AKSB 1J15A 3RXTA 2C8WB 2A7JA 5JBAS 2QXGA 4AZ2B 1BTZA 3BTDE 1SC8U 3FAOA 1O3EA 1OWIA 1UVSH 1KTSB 3F2GA 4AFUA 4Z0KA 3ATWA 6GCHF 2QE7D 2HPQH 1O2MA 1V2VT 3ENSB 3DSOA 1A5HA 2WPMS 4MNWA 3U69H 2JIZD 3KQDA 3A84A 3GS9A 3K2UA 4D7FA 4HG6A 3H7TA 1P11E 3Q3XA 4JZFH 3VB7A 2VU8E 5TCCA 1BHXB 4AB8A 1O39A 2QV1A 1AFQC 1NZQH 2VVVA 2WPHS 5CE1A 2TGTA 5GJ4B 1DITH 1FN8A 2ZHFH 3WWBA 2F4LA 2AGGX 2LELA 1ABJH 2KX4A 1YPHE 2AMPA 1RGQA 1K1MA 2Z6BD 2CF8H 3W95A 5C17A 1RS0A 3BIUH 2ZGCA 2A4GA 1E0FD 1V6DA 2Y80A 3GCNA 2GDEH 4UFGH 4B75A 2F9OA 3G01A 3V12A 3ZZDA 1IQLA 1P9SA 1KXFA 4YLUA 3MI4A 1DUEA 3I29A 1JRSA 2ZU4A 5GNDA 4HZHA 1OSSA 4CR9A 1EASA 3VGCB 2IJOB 4ISNA 3GCHB 1GI3A 2BY9X 4LZ4B 1EXFA 5F8TA 4R0IA 4SGBE 1FY3A 1O2UA 1PQ5A 2GV7A 4B2CA 4D7GA 5EPYA 4X8UH 1PPFE 2KCPA 5C1UA 2FM2A 1GJDB 2ZTYA 1C1UH 2OC0A 3F9EA 1BOQA 2HPPH 1ELAA 5GCHG 1PPEE 1P2KA 3RXCA 2GCHF 3SZEA 3ATKA 4F55A 2M2AA 1QQUA 5F8XA 2QXJA 1O3GA 1NO9H 1O2VA 3GY2A 1DXPA 1O2WA 1IHTH 3P8NA 3E6PH 1GJBB 3H7OA 4ABHA 1W0YH 2P95A 3HKIB 3PLPA 3MU4A 1ANEA 4X2WA 4HFPB 7LPRA 2WPIS 1PPBH 1SOZA 3DA9B 5DSFA 4JYVH 1C5UA 4FVBA 3RU4T 3SZNA 2V3MA 2OQUA 4AN7A 1MKWK 2P3TB 3DD2H 2PHBA 5I46H 4FUFA 2Z7FE 1G3CA 2IN2A 1HXEH 2F83A 2NU3E 3PYHA 3O8CA 1SQAA 1OX1A 1PPCE 4WMFA 3PB1E 3PTBA 1RIWB 1MTUA 1SLUB 1QRXA 2G8TA 5T1VA 2QYIA 5ESBA 1C2DA 1SMFE 2M5TA 1Z7KA 3OSYA 5I25A 3M5OA 1CU1A 1AFEH 2KCYA 2EY4C 1S0QA 4ZAEA 1ELVA 1YPKH 3A7WA 4WH8A 3GY4A 4DCDA 1T7CA 1HLTH 1OYQA 2J9NA 2VWOA 4IN2A 1MAYA 3FZZA 1EJMA 1IQHA 1CHOF 4FUEA 1GMCG 1EPTA 1GBAA 1AU8A 1WOFA 2BLOA 4OS5A 1ZRBA 3AAUA 1C4Y2 4NSYA 4FU9A 3SJ8A 4U01A 4UONA 1FY5A 4GSOA 4GUXA 3ATMA 3SV8A 4MPVA 1A1RA 1G36A 1SFIA 3O8RA 3TVJB 1K1OA 2G4TA 3P70B 3RMLH 1ZHRA 1SGIB 2UUYA 2TGAA 2BB4A 3A81A 2G5NA 2QIQA 2LPRA 1ZPCA 4KGAA 2VWMA 5EQQA 1QRZA 1W12U 1GCDA 2GV6A 3BTME 1LHDH 2A31A 2ZGHA 3P95A 1SR5C 3SNEA 3ZZCA 1NTPA 4D9RA 5L30H 1EFRD 1HAXB 3B8JA 3RMOH 4O9VA 2PUXB 2W6JD 1DWCH 3PROA 5CHAC 4YT7H 2ZG0H 2PV9B 3F0OA 1YPJH 4UEHH 2G81E 4OS6A 1C5NH 1BHXF 1S84A 3F1SB 1YBWA 5SGAE 2ZFFH 4NZQA 4AYVB 4FU8A 3QUMP 1TQ0B 3RC4A 1ZPZA 4TY7A 1GMDG 2ZGJA 3SW2B 5FCRA 1FPHH 1GI0A 1DDJA 4NG9H 5DO4H 1TLDA 5IDKA 4XBDA 1KTTB 3GISB 3SNBA 4CRGA 1RTFB 5A8ZA 4TWWA 1IOEA 4BANB 1HCGA 1ZSKA 2SGAA 6CHAB 1V2QT 2C90B 1TOMH 3QGNB 1O33A 1WTGH 1E37B 1A0JA 3TH3H 1O31A 3KIDU 3U8OH 3TU7H 2QF0A 3UREA 2W26A 1J9CH 1BUIA 2Z9GA 3AW0A 4QT8C 1S5SA 1A61H 1DY9A 1FONA 4RN6A 3RMNH 5HYOA 5DK1A 4LK4A 1AKSA 4DIIH 2BDCA 1B7XB 3FVFB 2J98A 3RDZA 5DP9A 3STJA 3F6UH 1SKYE 2XNIA 5FXLA 3RXEA 3SU3A 1G3DA 3M5MA 1QB6A 3M36A 1TBQH 3D49H 1O35A 3ATLA 2P3UB 3N99A 2B7DH 3RLWH 1J14A 1YC0A 2IOTA 1C2KA 2LNCA 2P3FH 1V2JT 3A86A 4X8TH 1OS8A 1ACBE 5JDUB 3F3BA 2VWNA 1WUNH 2D26C 2L6OA 2STBE 3KL6A 4I31A 2JETB 2JJ1D 2PKSC 2OC8A 5T3HA 3TH4H 1T31A 1K1JA 4OS2A 1TNKA 3BF6H 4I32A 5KECA 1CGIE 1C5VA 1AE8H 1ETTH 4ISHH 2W3KA 1QB1A 3UUZA 1JIMA 1AN1E 3L33A 1DX5M 2ZDLA 1O3JA 3TNTA 5LPEA 1UK2A 3M37A 2BDHA 1DUAA 1CHGA 1GI7B 2FX6A 4ABDA 5EXNA 1ELEE 4NA9H 2F9PA 2ZHEH 1A3BH 4DOQA 1CA0B 4DJZB 1AWFH 4MQAA 1AZ8A 1UTOA 1O3KA 1AHTH 4H6SB 1K28D 3F68H 3I77A 3PMBB 1ELFA 2ASUB 1TX8A 1O2XA 3KN2A 2ZQ2A 2BYAX 4YOGA 1ZRKA 3EA8A 3RXDA 1HGTH 3A8BA 1DFPA 1TABE 3E0NB 2FYRA 2BM2A 1P3CA 2J97A 1SPJA 1UVTH 3QLPH 3EDXB 2D1JA 4Q80A 1YLNA 2W7UA 3ZZ9A 1NM6A 1SGNE 5EW1H 1C5PA 1NRRH 1NPMA 5DJ7A 2OQ5A 1O2RA 2FI5E 4ACAA 1HNEE 1FJSA 1C5TA 4X6OA 3SI3H 3T29A 3T62A 2ZP0H 2O8UA 4FUHA 2OINA 1RXPA 2CN0H 1H8HD 1V2UT 5BPEA 1WYKA 1JWTA 3A87A 3PWCA 1EZQA 1LPKB 1O32A 1AVXA 1HUTH 1DVAH 4X0WU 4DY7B 2SFAA 1WV7H 2O9QA 1H8DH 2PSXA 2UWLA 3B9FH 3A82A 1NN6A 3MNSA 4NSVA 1XUFA 1O3BA 2KAIA 1YCPH 4YZUA 1LKBA 1TBRH 3S9AA 4NWKA 3PRBA 4YLQH 5C2ZA 3DFJA 2C4FH 3I78A 3O8BA 4FUCA 2P93A 2AFQB 2RG3A 3QTVH 1CA0C 1NY22 1C1VH 3MHWU 4K1TA 1Y3XA 3CP7A 4M7GA 3SI4H 1O2IA 4O97A 4LZ1H 1OOKB 3P8GA 4B76A 1FN6A 1ARBA 5FBIA 1X7AC 3UOPA 4J1YA 3KNXA 3LOXA 2BTCE 3D23A 3QGJA 2GP9B 1JMOH 2BY5X 3HKJB 1NC6A 1AWHB 1EZXC 2BDIA 3GDSA 1GHAG 2CJIA 5HXFA 3T27A 1TNLA 4DGJA 1Z8GA 4XBBA 2B9LA 4D9QA 1LVMA 2W5EA 4CH8B 2WSSD 1THPB 4X6MA 1KSNA 1M9UA 1O3LA 2NU1E 4H6TA 4OS4A 1BMFD 4RSPA 4WXVA 2FTLE 4DVAU 3RXLA 2SGDE 1EB1H 1BRBE 1TA6A 1GBHA 3MH5A 5GIBA 4O3TA 1E35B 2IPQX 4OGXA 3PMHB 3F2FA 3PTNA 1C4U2 3M3SA 4Q7YA 3UNQA 1NT1A 4ZKSU 5DPAA 3E1XB 1C5OH 3RXBA 3Q77A 2GZ7A 1QL9A 2BDAA 4ZMAH 3PWBA 3FP7E 2OBOA 1SGQE 1SGEE 1GPZA 2Y5FA 1SGDE 2Y81A 2GCTB 2ZCLP 2GDDA 1GJ4H 3GY3A 1GBKA 3GY7A 7ESTE 2Z3CA 1SGYE 2QXHA 3ELAH 3LIWA 1ANDA 1BMAA 3GY5A 1GHWH 3ZZBA 1TGTA 2A5AA 3A7YA 3SJ9A 4E05H 1O2PA 1UTLM 1D9IA 1EP5A 1GHAF 1SLVB 2P8OB 3KGPA 3MFJA 1GVLA 1T32A 4AOQA 1FNIA 2ZTXA 4X2VA 3ZVEA 3CS7A 4I8JA 1N8OC 1HYLA 1FY4A 1XUHA 1F0RA 2VGCB 3MO6A 1UK4A 2V35A 1VCQA 4X2XA 1IQEA 2F91A 1T8LA 1DWBH 2VH0A 3BTKE 3ZZAA 2H9HA 1RD3B 1H9LB 2K0QA 3IITA 3BTGE 2I6SA 4CHAB 2BHGA 1EZUC 3OU0A 1HIAB 3KCGH 1FQ3A 3MMGA 4ZKRU 3MNCA 4LOYH 1N6XA 3Q00A 1GI2A 3NUMA 3HGNA 4PROA 4XOJA 1CSOE 1P06A 2C8ZB 1PJPA 2FI3E 5FCKA 1ZSJA 3ZVFA 1SGPE 1O2HA 3A88A 2BMGB 3RXJA 2Z3EA 1EX3A 1TPOA 1ZJDA 1Z6EA 1YY3A 2ZGXH 4GLYA 4NA8A 1C5LH 1H1BA 4JK5A 1DT2A 3V0XA 1TIOA 2WINI 4HTCH 4K1EA 4OGYA 2J95A 6GCHG 5HM9A 3LJOA 5L6NH 4ASHA 1RJXB 2ZCKP 3IG6B 1IQGA 2XNDD 1FMGA 2Y5HA 1KLJH 1XX9A 3U9AH 1FY8E 1K2I1 1WXRA 1XXDA 1E1RD 5IYTA 4NFFA 1JIRA 1Q31A 2VVCA 4TPIZ 3SUEA 2XCFA 4KP0A 2BXTH 3VB5A 2ZU3A 1W0JD 2V3OH 1QR3E 1GVZA 5E2PA 1YPGH 5A8YA 6ESTA 3PRDA 3BTFE 1EB2A 3EYDA 1RTKA 1JRTA 2BOKA 4INKA 1MBMA 1GI6A 1PPGE 3ATIA 2A4OA 3RXQA 2WV5A 1V2KT 1NFYA 2HGTH 2G55A 2C93B 1MCVA 1G32B 2G00A 5FX6A 4MPUA 3GYLB 1DY8A 2KR7A 5EODA 2JH5D 1W3CA 1S6FA 2PP6A 4Y7BA 2QC2A 2A0QB 5A0AE 4CRCA 2Y7XA 4Y7AA 1O5EH 1FX0B 4AORA 1GGDC 4A1XA 1GJCB 5C3NA 1DM4B 1AE5A 1KDQB 2BD2A 2J92A 1O3HA 3K65B 1TFXA 3A85A 3LGTA 3KYFA 4BAHB 1Z6JH 2ILNA 4MNYA 4RKJB 1T8NA 1AQ7A 5DP4A 3SV7A 1GVKB 2YOLA 4CRBA 1F0UA 2ZDAH 1BRCE 4YOIA 3S0NA 2VIVA 2SGPE 4ZKOU 2AH4X 4NA7A 2J38A 4JZ1A 1XM1A 1UMAH 5EGMA 4ABBA 2GCHG 2WV4A 1C5ZB 2ALVA 4X2YA 1C2LA 5G4BA 1GBIA 2I6QA 3F9HA 3C1KA 4X1QU 3VG8A 1ZHPA 1EAUA 2TGDA 2K1QA 4THNH 1TE0A 3ZVBA 3EA7A 3A89A 2FZZA 2YNAA 1AMHA 1BDAA 3F0PA 3NRLA 4KTSA 1CBWC 1UTMA 4MNVA 1SQRA 2QF3A 3N7DA 1BMNH 3A80A 1QJ1B 2W6ID 2ZO3H 2WZQA 2BXUH 4CH2B 2ZPQA 2WPLS 3VB3A 4TYDA 2B8OH 2FO9A 1ESAA 1MZDA 3PMJA 4RT0A 3T28A 1ELDE 1UW7A 1AGJA 2ZGBH 4Z6AH 3RXFA 1XKAC 1A5GH 1C1TA 1W8BH 1BTWA 3U1JB 3SQEE 2AGEX 1JOUB 1SQTA 1O5BB 2GD4B 1Z1JA 2TRMA 2F9VA 3RXMA 2PUQH 2A7CA 3OFND 2AGIX 2AEIH 5A0BA 5FX5A 2P59A 2BX3A 1E1QD 4ZXYH 4F49A 1GDUA 3FKSD 1FUJA 3ITIA 2WHXA 5LH8A 3FANA 3RC5A 3A83A 2Q6FA 4Z1MD 1W11U 3FOAA 3PV4A 5JBCS 2HNTC 1ETRH 3SGAE 3SJIA 1DWDH 4Q2KA 4DW2U 3AK5A 2OD3B 3ZZ8A 1Y3YA 5DKMA 1ZZZA 5F03A 3F2HA 1TOCB 2ZA5A 3SGBE 1SG8B 4Q4LA 1D4PB 2BDYA 4A92A 2WYGA 1OWKA 2F9NA 1TGBA 1P2IA 4O03A 1CHOG 3U28C 4KTUA 2XC4A 1BZXE 3LC5A 5E0HA 1OKXA 1CGHA 1O2JA 4DURA 1YGCH 3SOSA 3S7HB 5FPYA 4IN1A 1KXDA 2XXLA 1KIGH 5GPIB 4YM9A 1LPGB 1MTNC 5TJXA 2BQ7B 2R0KA 1WSSH 4ASUD 2FESH 1NRQH 1SGCA 4Y0ZE 3W1EA 1LQEA 1O3NA 4KELA 1UCYE 1WBGB 1Z1IA 1UJ1A 2HVXA 4INHA 1O3CA 1HJ8A 1P01A 1LTOA 1COWD 1SOTA 2Q6GA 4NIVA 5EIYA 1EZSC 1LO6A 1GBMA 1KLIH 2O8MA 1GBDA 1NBME 1C1OA 2JDID 1YPLH 2BVSH 2FLRH 3BTQE 4U30A 3KQBA 5HIZA 2DE9A 2FOMB 5CHAB 1SHYA 4XRNA 3V7TA 1UVUH 3OEHD 1SGTA 1UTJA 1CT4E 2RFKC 3BTWE 4AYYB 4MPXA 2NU4E 1HJAC 3QX5H 1ESTA 1GL0E 3IWMA 3QO6A 1KY9A 2OC7A 1K1LA 3RMMH 4Y0YE 1E79D 3KYGA 1GDNA 3OX7U 3O8DA 3SNCA 5K7RA 4KKDA 2G51A 2F3CE 2WPJS 1TYNA 2F43B 1N1LA 3M61U 3N7EA 3UIRA 4HI3A 1OHHD 1C1QA 4FUGA 3K9XB 4CRDA 2UUFB 2ZFPH 3E16B 4WWYA 1QBOA 4K2YA 4GCHF 4ZHLU 4WMDA 5CMXH 2Z9JA 4AFQA 1UO6A 3URDA 4ZUHA 1TGSZ 4FUBA 2G52A 1A2CH 1MBQA 2BD5A 4WY3A 4BTIB 3GOVB 4BXWA 2BVXH 1K21H 2QY0B 2UUJB 2PW8H 3SHAH 1ZYOA 3OAAD 3FZDA 4JK6A 1OYTH 3QN7A 1J8AA 2PTCE 1ZTLA 3HK6B 4WMEA 1K1PA 4Y79A 1AZZA 1VR1H 4B74A 4F48B 2H9EH 3Q3KA 4KTCA 1PQ8A 3RC6A 4ABFA 3MNXA 1EJNA 1O3MA 4NIWA 1ZMJA 2PKSB 2GT7A 4Q63A 4AGKA 1MKXH 2FXRA 4A6LA 2A5IA 3ZVGA 3RXVA 1P02A 3DT0H 1V2TT 3SJOA 1QRWA 3C27B 2BDGA 1YYY1 1P10A 3CENA 2Y82A 2OXSA 3MQKC 5FAHA 3E91A 1EAXA 4IMQA 5EU8A 1T8MA 4FVDA 1W0KD 1K1NA 1BIOA 3SN8A 1HAZB 2A4RA 2SNWA 1GBLA 3EE0B 1KLTA 1BA8B 1SVPA 3BG8A 1C5YB 2PR3A 2ZZUH 3GDVA 9LPRA 1SLXB 4D76A 2AMQA 1SGFG 1NFXA 1GI4A 2Z9LA 4IC6A 5EW2H 3UWIA 2TGPZ 3TJUA 4U2WA 2HNTE 1GI1A 2XC5A 1C5MD 2XOKD 3SORA 2B0FA 3F9FA 2SGFE 5IK2D 2J94A 1WQSA 3W94A 4NFEA 4MTBA 1HB0B 1TPAE 1O2SA 2ZDKA 4X8SH 2BX4A 5KGOA 2PKAB 8KME2 1Y59T 3BG4C 3GCOA 1WQVH 4E7RG 1ZR0A 3GCTF 4NIXA 2HLDD 3TLOA 3SO3A 2R0LA 2J5UA 4X6PA 4INLA 2OUAA 2D2DA 5FHTA 3B23B 1EATA 2H5CA 2O8TA 1V2OT 1LDTT 1HRTH 5C0UA 3TH2H 4P00A 1W0ZU 1QB9A 1SQOA 1LPZB 2KZ4A 1TWXB 4B6FA 2K8IA 2O8LA 5JB8S 2JH6D 3M7QA 3PLBA 2IPHA 1L4DA 1P9UA 2ODQA 1F0TA 1WTHD 1C2JA 1Z8JB 3V13A 2BY7X 4I33A 2PLXA 3TPIZ 3NWUA 5E2OA 5E8EH 3SGQE 5C1XA 3FP8E 4IBLH 1QZ8A 3SU2A 4FUIA 1DWEH 3NK8A 1S6HA 2H1UA 3PM3A 4CBNA 2V7QD 5CHBA 2CMYA 2R3YA 3RM0H 3QZQA 2QAAA 3UNSA 2ZQ1A 2PGBB 4IMZA 1G3EA 4YOJA 2CHAC 1FAXA 4XSKU 3DCLA 2XTTB 3TJOA 1F92A 5GXPA 3DSPA 1B5GH 4TWYA 5A8XA 2NWNA 5J4QA 1GJ5H 1ANCA 3P6ZB 2ZNKH 4ZH8A 1PQ7A 1V2RT 4R8TB 5AVDA 3RUOA 3UAIC 3SUGA 1T8OA 3LJJA 1ID5H 3NPSA 1AB9C 1T4VH 2EI7A 4LXBH 4MG3A 3ZZ4A 5C20A 1O5DH 2OBQA 1FIWA 1HAHH 1ZGVA 2J34A 4BAMB 1WU1A 2D8WA 3LGYA 4ZKNU 1C5SA 5ESTE 1Y5BT 1VGCC 4I8KA 5C94A 2BLVA 1YM0A 1P2OA 3VFEA 1GDQA 2FOAA 4BXSA 3QTOH 1TMBH 1P04A 5PTPA 4AC9A 1A46H 1TQ7B 1G37A 2WV9A 2ANWA 1Y8TA 3HK3B 4K69A 5LPFA 1ZTJA 4UFFH 1D3QB 1UTNA 1O34A 3SJKA 2XCNA 3EQ0H 3TGJE 1LMWB 2BVRH 1UHBB 1HV7A 2R2MB 1SGFA 4ZCNA 3BN9A 5JB9S 5CDFE 3UQOA 2QXIA 2PTNA 1C1SA 3KQCA 3KF2A 1N8OB 1CE5A 2HRVA 1MQ6A 2OP9A 1OP8A 3KHVA 2ZIQH 1GHZA 4Y8XA 2ZHWH 1ARCA 2ZDVH 3RXKA 3WWFA 4TT3D 2ZKSA 8ESTE 2FI4E 4WJG2 5L2ZH 4GVUA 2QN5T 4MNXA 2G5VA 1MTSA 1O3FA 3UNRA 1Y3WA 1VCPA 1P2MA 1DXWA 1OWEA 3UWJH 1O2ZA 1K22H 1BJVA 4NZLA 3STIA 4ABIA 1IQJA 1BB0B 1U6QA 3DFLA 2NU2E 2CV3A 1ELTA 1DE7H 1WDIA 3EGKH 1S85A 7GCHF 1NFUA 1AD8H 2PFEA 2G4UA 1GHBF 1DSTA 1ZMLA 3KEEA 1VZQH 5J4SA 1SHHB 3S9BA 2WPKS 1EKBB 3VXFH 1MU8B 2FODA 4K5ZA 4AX9H 5LPRA 2VIDA 3LDXH 1QY6A 2FS9A 1GBEA 1KYNA 3T5FH 3UFAA 2C3SA 3TGKE 2JH0D 1H8IH 1A5IA 1BTXA 4P02A 4CR5A 2BD3A 3UY9A 4ISIH 1BBRH 1BITA 1YCPK 2ZPRA 2TPIZ 2A4QA 1S82A 4K8YA 7KMEH 1MH0A 2Q1JA 1C1MA 1HFDA 2HVYB 2BLQA 4DT4A 1BTHH 3T26A 4NCYA 3LGWA 1QNJA 1O5AB 4I7YH 3M3VA 1GBJA 5ETXA 1KXBA 1TPSA 1TA2A 4OM9A 8GCHF 4X1PU 3BSQA 1SB1H 2GZ9A 1TNGA 4XD7D 4RKOB 4U32A 3LONA 1QL7A 3TGIE 1EPTB 4MDSA 5ABWA 1V2NT 1P12E 2STAE 1SL3A 1TNHA 2CF9H 2EQNA 3NZIA 3V3MA 1UCYK 4UDWH 1GGDB 2ZDNA 5LGOA 3A8DA 3KQEA 3BV9B 1Y3VA 5HM2A 2FOFA 2TIOA 1P09A 3QDZB 6LPRA 5AFZH 1VITG 1NROH 2UUKB 5A09A 1O5FH 5T6DA 1TRYA 4UE7H 4BNRA 2NU0E 4DIHH 4XE4A 4CRFA 1XUKA 4OS7A 1O3AA 2OTVA 3LC3A 4ZXXH 4FUJA 3RXSA 1QBNA 2PSYA 4NWLA 4XBCA 1AIXH 1UTKA 2XWAA 1BRAA 2CK3D 3GDUA 3A7ZA 2GVFA 1FIZA 2A1DB 4A1VA 2YMSC 1A7SA 2GX4A 2ZFRH 4YESB 4YTAA 1LHGH 1GI5A 3HPTB 2HOBA 3QK1A 1W13U 3RXHA 4Y11E 4IGDA 1ESBA 5HMAA 2EI6A 2KM0A 1F5LA 1KXCA 1T4UH 3PV2A 4OS1A 1D3DB 2VJ1A 1CBWB 1TB6H 1WAYB 2ZDMA 1GJ7B 1EPTC 1C5XB 1BT7A 4I8HA 1C1WH 1JBUH 4NIYA 5F8ZA 4AFZA 3D62A 3TITA 1G2LA 5DP7A 2J2UA 2ZFSA 3ZVDA 1LVBA 2GMTB 2FEQH 4FOUC 3WY8A 1TALA 1VITF 5T6FA 3EA9A 1BTYA 1LQDB 3BIVH 1QFKH 2FOHA 1A3EH 4Y76A 3MO3A 1C2HA 1L1GA 3LT3A 1ZSLA 2AMDA 1GHVH 4ZHAA 5T6GA 3URCA 8LPRA 1OWHA 1HPGA 3SHCH 1C1RA 1C1NA 1SLWB 2Y5GA 1C5QA 2J98B 5E0JA 3S7KB 2XW9A 4I8LA 2FP7B 3M7TA 3OE7D 2WPDD 1CO7E 5C5NA 2ESTE 2BZ6H 2AIPA 5C5OA 1PYTC 2OC1A 1C2GA 3GYMA 2VVUA 5BRRE 1L1JA 2IJD1 4MVNA 5FPSA 5KEDA 2ODPA 4Y71A 4XDEA 3LGVA 1RTLA 4TSFD 1L4ZA 2RDEA 1S6LA 2OK5A 1C2FA 3RXAA 1HAYB 2LP6A 1O2QA 1MKWH 5AF9H 4AG1A 1J17T 5JYIA 3S9CA 1MTWA 1UVPA 2ZEBA 1Z8IB 2C8XB 3RXGA 1O2YA 2GMTC 1NFWA 3QWCH 3RU4E 2WUCA 1RFNA 3A7VA 3FO8D 4ABJA 1MTNB 1P3EA 4Y6DA 1AY6H 3MOCA 2FTMA 5JPMH 4J2YB 4IW4E 1A0LA 2VIWA 1XMNB 2OCVB 1BJUA 3SV6A 2DUCA 3VB4A 1HXFH 1GBFA 5EPNA 2ZU2A 2KFWA 3K6YA 2J4IA 1SBWA 3E90B 4WF8A 3U98H 3UTUH 4FUDA 1XKBC 1XUGA 3A7TA 1NESE 2FOCA 4UFEH 2FOEA 4HGCA 2FS8A 3RP2A 3LGUA 1LVYA 1ELBA 2CXVA 3MU0A 1HJAB 3KQ5A 2VH6A 3HATH 1QURH 2PGQB 3VPKA 4WH6A 2P16A 3M3TA 3M7UA 1TAWA 3A8CA 1UHBA 3CS0A 4A5TS 3DHKH 1TRMA 2ZHQH 4Q7ZA 1QQ4A 4X1NU 4A1TA 4ESTE 1BRUP 2BD4A 1GBCA 3MU8A 5EJZA 3RU4D 3MH6A 1THSH 1YKTA 1D3PB 1QHRB 3JZ1B 4GHTA 4I86A 1BQYA 3K6ZA 1C2MA 2KAIB 5K0HA 1THRH 3LKWA 1GCTB 5EQRA 3ZZ3A 3LPRA 4WVPE 3FP6E 1DSUA 3FFGA 5F6MA 1QTFA 4GCHG 3M35A 3R0FA 3SU1A 4GHQA 1MQ5A 1S0RA 3ZYEA 4ZROA 1FI8A 1HAVB 2C8YB 1ZMNA 1NU7B 2BY6X 1OPHB 4ABAA 2A45B 1YLDA 4K8BA 3RXOA 3VGCC 2GJGA 2Z3DA 3GCHC 2FIRH 1YP9A 4B71A 5DP8A 1G30B 2BD7A 1ZHMA 2KCOA 4B6EA 5C67A 1PQAA 5JBTA 1B0EA 4K1SA 1V2LT 2B5TB 1C5RA 1YLCA 2FX4A 4SGAE 5GWZA 1AUTC 2FOGA 1HAPH 1O3OA 2Q6DA 2UWOA 3PMAB 1TGNA 1F7ZA 3EE7A 5GCHF 1OXGA 4JZDH 1XVOA 1OP0A 2FYQA 1ELGA 3AW1A 1KXAA 5FL7D 1QBVH 1L1NA 2VIOA 2XBVA 5A0CA 1YWUA 1CA8B 2A2QH 1GHXH 1C9TA 3ODDA 4X6NA 1O36A 2SNVA 3U1IB 3RM2H 1QJ6B 3H09A 1GCTC 1HIAA 1BBRE 3PO1B 2ZTZA 3OYPA 2Y7ZA 1C9PA 1TMTH 2HALA 4YXWD 4BAOB 1GBTA 1FY1A 1GMHG 1LCYA 3SU0A 2YMSD 1LHCH 1NBMD 1Y5AT 9ESTA 4O3UA 3T25A 4UFDH 3P8FA 1AUJA 1OWDA 4RI0A 2QA9E 4VGCB 1FXYA 1XUIA 1GI8B 2V6NA 1KMHB 1GBBA 3TK9A 4E7NA 4XFQA 2HWLB 2VIPA 4E06H 1MD8A 4M9FA 2ZF0H 1RIWC 2HNTF 3BG4B 4MLFB 2H5DA 1ZOMA 2RA3A 3SBKA 1HAGE 1TNIA 4TPYA 4NGAH 1BMMH 1O2NA 2SGEE 2ZC9H 3GCTG 3DUXH 3TNSA 1VJ9U 1F0SA 4AFSA 5AFYH 1QL8A 5DG6A 1IHSH 3UQVA 1EOLA 3UPEA 4DT7B 2BQWB 1C2EA 3ESTA 1IQFA 4ISLA 1LKAA 1BCUH 1UTPA 3ZVCA 3T2NA 2A2XH 1V3XA 1G9IE 2AIQA 3H5CB 1GL1A 5L2YH 3P8OA 3WW7A 2ANYA 1A4WH 3CNRA 1C5WB 1V2MT 1GMCF 3PO1C 3BTTE 1FV9A 2V0BA 3TK5A 2P94A 3VB6A 1GMHF 2RCEA 3ODFA 1HAOH 2ALPA 5EG4A 5TCAA 1P03A 1PPHE 1AVWA 4I8GA 2EEKA 5FBEA 2ZWLH 2ZCHP 4JZIA 1IAUA 1O2OA 2A7HA 4WXIA 1QA0A 1PYTD 3SUDA 2SGQE 1AI8H 1KDQA 4IS5A 3QZRA 4ZHMU 4VGCC 1K9OE 1S81A 4ACBA 4JYTA 1ANBA 2CHAB 2ZU1A 3ZZ7A 1IQIA 1EAIA 2WYJA 1SI5H 3ZV9A 1ETSH 2F9UA 5JBBS 1W2KH 4FU7A 4H4FA 1P05A 2Z9KA 1PPZA 3L6PA 1GJ8B 1XVMA 1EP6A 2FWWA 1P2JA 2FPZA 3MU5A 3MTYA 3MYWA 2BOHB 2AYWA 5EOKA 1C1PA 1MU6B 3OTPA 1AB9B 3PLKA 2ZFQH 3EAJA 1EQ9A 1DLKB 1P2NA 2Y6TA 1TNJA 5GDSH 1H9IE 1O2TA 2WUBA 4BAQB 1O2KA 1PFXC 1EUFA 1VGCB 1ZLRA 1GMDF 2XYAA 1W7XH 1TBZH 4ISOA 2GGVB 3MNBA 3RXRA 3UOUA 1D6RA 3RLYH 2BLWA 3MO9A 2PWXA 2R2WU 3Q3YA 1TX6A 2ZI2H 1MKXK 4Q7XA 4ABEA 6CHAC 1GHYH 1TPPA 3VXEH 5EXLA 1EJAA 3N7OA 3OTJE 1F5KU 2QF5A 3E0PB 1YPEH 3SQHE 3P92A 1TONA 2VNTA 1CQQA 2VINA 2FOBA 2ZPSA 4GAWA 4JMYA 3VEQB 1GI9B 1MD7A 1LHEH 1MMJN 4AG2A 1GWAA 1MAXA 2W7SA 5EJ1A 1VITH 1CVWH 2A5KA 3M5NA 2F9BH 3R3GB 3U8RH 3P17H 1UK3A 1DPOA 5HKKD 1BTPA 4BTUB 3PV5A 5H4IB 1HBTH 1ZGIA 2AHME 1GJ9B 2XBYA 2DE8A 2W3IA 4JCNA 2ZHDA 3SU6A 3LH1A 3SYJA 4ABGA 3AASA 1QIXB 2RDLA 1Q3XA 1DANH 1WCZA 4K3JA 1O2GH 3UR6A 1NU9A 5F53A 1INCA 1MABB 1O0DH 1DLEA 1P57B 2Z9IA 4GPGA 1QCPA 4TY6A 2UWPA 4Y8ZA 1KXEA 2AERH 2XC0A 3ZZ6A 1H8ED 4YO9A 5HIYA 1XUJA 7GCHG 4IC5A 2HLCA 4DG4A 1YCPM 1NRNH 1VJAU 3MH4A 1GHBG 1LHFH 1NRPH 1F5RA 1O5GH 2JETC 3BEUA 3TJNA 1GG6B 1C2IA 3SV9A 1VKYA 4CRAA 5EJLA 2JJ2D 1YF4A 2ZFTA 1EAWA 4X1RU 1F2SE 3SNDA 2H9TH 1OP2A 4D8NA 4K60A 1RRKA 3NKKA 2ANKH 4YT6H 3NCLA 1FDPA 5AHGH 3TJVA 1W14U 3OEED 1ZTKA 4JZEH 3GICB 4BTTB 4FETA 3RXPA 1XXFA 5DP3A 1UVOA 3M5LA 1HAVA 2AS9A 1HAIH 1J16A 1O37A 2Z94A 8GCHG 1H9HE 1ZJKA 2BD8A 2ULLA 1P2QA 1UTQA 1MCTA 1V2ST 4JYUH 1UCYH 1YPMH 1HJ9A 1S83A 4X1SU 2ODYB 3ZV8A 1G2MA 2GTBA 1W10U 4CBOA 1TRNA 1V2PT 1CT2E 5FPTA 1E34B 1A0HB 1G3BA 2QCYA 1DOJA 1FZZA 1YPHC 4RT1A 3ZYDA 3LGIA 2XBXA 2FLBH 3SNAA 1BTUA 1GG6C 5EQSA 1BMLA 1IQNA 3FN8A 3RXUA 4AB9A 5B6OA 1K0HA 1SGRE 1O2LA 1SFQB 3NXPA 4BOHA 3JZ2B 2ANMH 1C4V2 1MUEB 1VCWA 2EA3A 4BAKB 2KCAA 1IQMA 1Z8RA 1V2WT 3DSGA 2YMSB 1K1IA 1W7GH 1O3PB 3GY6A 3LH3A 1FAKH 3BTHE 1ELCA 1ORFA 5C1YA 4B1TA 2H6MA 1NS3A 1CGJE 4A7IB 1ABIH 2GT8A 1JXPA 1L2EA 1IQKA 1QJ7B 2R9PA 1DICA 3F9GA 4H42U 3SV2H 4B73A 5EXMA 1P0SH 2TBSA 2CGAA
chains in the Genus database with same CATH topology
2A32A 2OLGA 1AO5A 1HDTH 3UR9A 5DGJA 1N6YA 5A2MH 1O3DA 2ZU5A 1NRSH 3MU1A 2VB0A 2FDAA 3OY6U 3ZVAA 1O30A 1O3IA 2XWBI 3SU4A 2BD9A 1DS2E 2FMJA 1B0FA 1TMUH 1EOJA 3A7XA 1GJ6A 3MWIU 2JKHA 3BTEE 4MPWA 2BY8X 4B2AA 4AGJA 4UD9H 2O8WA 2RA0A 3GY8A 4F4OC 2QGRA 2R3UA 1MTVA 3A8AA 2YNBA 3LU9B 1D6WA 1ZPBA 1H4WA 2V3HH 3AAVA 3L3TA 4FXGH 1OWJA 1Y5UT 2GCTC 2VWLA 5DP5A 2H2ZA 3E8LA 1TX7A 1TGCA 3Q76A 1FPCH 1E36B 3OY5U 3D65E 3TK6A 3AVZA 3MH7A 2BQ6B 5DP6A 3BEFB 1Y3UA 2P8OC 1D3TB 3BEIB 1O38A 2XBWA 1QA7A 3SUFA 2GKVE 2EC9H 4Y10E 3ZZ5A 1BBRK 1CT0E 1AVGH 2BZAA 3S69A 1O5CB 1QGFA 3HGPA 2THFB 2PKAA 1E38B 1AFQB 4B2BA 2VGCC 2GZ8A 1Q2WA 2XRCA 3RXIA 1L0ZA 5E0GA 3TIUA 1LVOA 4Y8YA 1SSXA 2EI8A 1FLEE 3E3TA 5HGGA 3SU5A 4CHAC 2ZECA 1P8VC 3U8TH 2BDBA 2VIQA 1GJAB 4X8VH 1MZAA 1Z71A 4CREA 1AKSB 1J15A 3RXTA 2C8WB 2A7JA 5JBAS 2QXGA 4AZ2B 1BTZA 3BTDE 1SC8U 3FAOA 1O3EA 1OWIA 1UVSH 1KTSB 4AFUA 4Z0KA 3ATWA 6GCHF 2HPQH 1O2MA 1V2VT 3ENSB 1A5HA 2WPMS 4MNWA 3U69H 3KQDA 3A84A 3K2UA 4D7FA 4JZFH 3H7TA 1P11E 3Q3XA 3VB7A 2VU8E 5TCCA 1BHXB 4AB8A 1O39A 2QV1A 1AFQC 1NZQH 2VVVA 2WPHS 5CE1A 2TGTA 5GJ4B 1DITH 1FN8A 2ZHFH 2AGGX 1ABJH 1YPHE 2AMPA 1RGQA 1K1MA 2Z6BD 2CF8H 3W95A 1RS0A 3BIUH 2ZGCA 2A4GA 1E0FD 1V6DA 2Y80A 3GCNA 2GDEH 4UFGH 4B75A 2F9OA 3G01A 3V12A 3ZZDA 1IQLA 1P9SA 1KXFA 4YLUA 3MI4A 1DUEA 3I29A 1JRSA 2ZU4A 4HZHA 1OSSA 4CR9A 1EASA 3VGCB 2IJOB 4ISNA 3GCHB 1GI3A 2BY9X 4LZ4B 1EXFA 5F8TA 4R0IA 4SGBE 1FY3A 1O2UA 1PQ5A 2GV7A 4B2CA 4D7GA 5EPYA 4X8UH 1PPFE 5C1UA 2FM2A 1GJDB 2ZTYA 1C1UH 2OC0A 3F9EA 1BOQA 2HPPH 1ELAA 5GCHG 1PPEE 1P2KA 3RXCA 2GCHF 3ATKA 1QQUA 5F8XA 2QXJA 1O3GA 1NO9H 1O2VA 3GY2A 1DXPA 1O2WA 1IHTH 3P8NA 3E6PH 1GJBB 3H7OA 4ABHA 1W0YH 2P95A 3HKIB 3PLPA 3MU4A 1ANEA 4X2WA 4HFPB 7LPRA 2WPIS 1PPBH 1SOZA 3DA9B 4JYVH 1C5UA 4FVBA 3RU4T 3SZNA 2OQUA 4AN7A 1MKWK 2P3TB 3DD2H 2PHBA 5I46H 4FUFA 2Z7FE 1G3CA 2IN2A 1HXEH 2F83A 2NU3E 3PYHA 3O8CA 1SQAA 1OX1A 1PPCE 4WMFA 3PB1E 3PTBA 1RIWB 1MTUA 1SLUB 1QRXA 2G8TA 2QYIA 5ESBA 1C2DA 1SMFE 2M5TA 1Z7KA 3OSYA 5I25A 3M5OA 1CU1A 1AFEH 1S0QA 4ZAEA 1ELVA 1YPKH 3A7WA 4WH8A 3GY4A 4DCDA 1T7CA 1HLTH 1OYQA 2J9NA 2VWOA 4IN2A 1MAYA 3FZZA 1EJMA 1IQHA 1CHOF 4FUEA 1GMCG 1EPTA 1GBAA 1AU8A 1WOFA 2BLOA 4OS5A 1ZRBA 3AAUA 1C4Y2 4NSYA 4FU9A 3SJ8A 4U01A 4UONA 1FY5A 4GSOA 4GUXA 3ATMA 3SV8A 4MPVA 1A1RA 1G36A 1SFIA 3O8RA 3TVJB 1K1OA 2G4TA 3P70B 3RMLH 1ZHRA 1SGIB 2UUYA 2TGAA 2BB4A 3A81A 2G5NA 2QIQA 2LPRA 1ZPCA 4KGAA 2VWMA 5EQQA 1QRZA 1W12U 1GCDA 2GV6A 3BTME 1LHDH 2A31A 2ZGHA 3P95A 1SR5C 3SNEA 3ZZCA 1NTPA 4D9RA 5L30H 1HAXB 3B8JA 3RMOH 4O9VA 2PUXB 1DWCH 3PROA 5CHAC 4YT7H 2ZG0H 2PV9B 1YPJH 4UEHH 2G81E 4OS6A 1C5NH 1BHXF 1S84A 3F1SB 1YBWA 5SGAE 2ZFFH 4NZQA 4AYVB 4FU8A 3QUMP 1TQ0B 3RC4A 1ZPZA 4TY7A 1GMDG 2ZGJA 3SW2B 5FCRA 1FPHH 1GI0A 1DDJA 4NG9H 5DO4H 1TLDA 5IDKA 4XBDA 1KTTB 3GISB 3SNBA 4CRGA 1RTFB 5A8ZA 4TWWA 1IOEA 4BANB 1HCGA 1ZSKA 2SGAA 6CHAB 1V2QT 2C90B 1TOMH 3QGNB 1O33A 1WTGH 1E37B 1A0JA 3TH3H 1O31A 3KIDU 3U8OH 3TU7H 2QF0A 3UREA 2W26A 1J9CH 1BUIA 2Z9GA 3AW0A 4QT8C 1S5SA 1A61H 1DY9A 1FONA 4RN6A 3RMNH 5HYOA 5DK1A 4LK4A 1AKSA 4DIIH 2BDCA 1B7XB 3FVFB 3RDZA 5DP9A 3STJA 3F6UH 2XNIA 5FXLA 3RXEA 3SU3A 1G3DA 3M5MA 1QB6A 3M36A 1TBQH 3D49H 1O35A 3ATLA 2P3UB 2B7DH 3RLWH 1J14A 1YC0A 2IOTA 1C2KA 2P3FH 2LNCA 1V2JT 3A86A 4X8TH 1OS8A 1ACBE 5JDUB 2VWNA 1WUNH 2D26C 2STBE 3KL6A 4I31A 2JETB 2PKSC 2OC8A 5T3HA 3TH4H 1T31A 1K1JA 4OS2A 1TNKA 3BF6H 4I32A 1CGIE 1C5VA 1AE8H 1ETTH 4ISHH 2W3KA 1QB1A 3UUZA 1JIMA 1AN1E 3L33A 1DX5M 2ZDLA 1O3JA 3TNTA 5LPEA 1UK2A 3M37A 2BDHA 1DUAA 1CHGA 1GI7B 2FX6A 4ABDA 5EXNA 1ELEE 4NA9H 2F9PA 2ZHEH 1A3BH 4DOQA 1CA0B 4DJZB 1AWFH 4MQAA 1AZ8A 1UTOA 1O3KA 1AHTH 4H6SB 1K28D 3F68H 3I77A 3PMBB 1ELFA 2ASUB 1TX8A 1O2XA 3KN2A 2ZQ2A 2BYAX 4YOGA 1ZRKA 3EA8A 3RXDA 1HGTH 3A8BA 1DFPA 1TABE 3E0NB 2FYRA 2BM2A 1P3CA 1SPJA 1UVTH 3QLPH 3EDXB 2D1JA 4Q80A 2W7UA 3ZZ9A 1NM6A 1SGNE 5EW1H 1C5PA 1NRRH 1NPMA 5DJ7A 2OQ5A 1O2RA 2FI5E 1HNEE 1FJSA 1C5TA 4X6OA 3SI3H 3T29A 3T62A 2ZP0H 2O8UA 4FUHA 2OINA 1RXPA 2CN0H 1V2UT 5BPEA 1WYKA 1JWTA 3A87A 3PWCA 1EZQA 1LPKB 1O32A 1AVXA 1HUTH 1DVAH 4X0WU 4DY7B 2SFAA 1WV7H 2O9QA 1H8DH 2PSXA 2UWLA 3B9FH 3A82A 1NN6A 3MNSA 4NSVA 1XUFA 1O3BA 2KAIA 1YCPH 4YZUA 1LKBA 1TBRH 3S9AA 4NWKA 5C2ZA 4YLQH 3DFJA 2C4FH 3I78A 3O8BA 4FUCA 2P93A 2AFQB 2RG3A 3QTVH 1CA0C 1NY22 1C1VH 3MHWU 4K1TA 1Y3XA 3CP7A 4M7GA 3SI4H 1O2IA 4O97A 4LZ1H 1OOKB 3P8GA 4B76A 1FN6A 1ARBA 5FBIA 1X7AC 3UOPA 4J1YA 3KNXA 3LOXA 2BTCE 3D23A 3QGJA 2GP9B 1JMOH 2BY5X 3HKJB 1NC6A 1AWHB 1EZXC 2BDIA 3GDSA 1GHAG 2CJIA 5HXFA 3T27A 1TNLA 4DGJA 1Z8GA 4XBBA 2B9LA 4D9QA 1LVMA 2W5EA 4CH8B 1THPB 4X6MA 1KSNA 1M9UA 1O3LA 2NU1E 4H6TA 4OS4A 4RSPA 4WXVA 2FTLE 4DVAU 3RXLA 2SGDE 1EB1H 1BRBE 1TA6A 1GBHA 3MH5A 5GIBA 4O3TA 1E35B 4OGXA 3PMHB 3PTNA 1C4U2 3M3SA 4Q7YA 3UNQA 1NT1A 4ZKSU 5DPAA 3E1XB 1C5OH 3RXBA 3Q77A 2GZ7A 1QL9A 2BDAA 4ZMAH 3PWBA 3FP7E 2OBOA 1SGQE 1SGEE 1GPZA 2Y5FA 1SGDE 2Y81A 2GCTB 2ZCLP 2GDDA 1GJ4H 3GY3A 1GBKA 3GY7A 7ESTE 2Z3CA 1SGYE 2QXHA 3ELAH 3LIWA 1ANDA 1BMAA 3GY5A 1GHWH 3ZZBA 1TGTA 2A5AA 3A7YA 3SJ9A 4E05H 1O2PA 1UTLM 1D9IA 1EP5A 1GHAF 1SLVB 2P8OB 3KGPA 3MFJA 1GVLA 1T32A 4AOQA 1FNIA 2ZTXA 4X2VA 3ZVEA 3CS7A 4I8JA 1N8OC 1HYLA 1FY4A 1XUHA 1F0RA 2VGCB 3MO6A 1UK4A 2V35A 1VCQA 4X2XA 1IQEA 2F91A 1T8LA 1DWBH 2VH0A 3BTKE 3ZZAA 2H9HA 1RD3B 1H9LB 3IITA 3BTGE 2I6SA 4CHAB 2BHGA 1EZUC 3OU0A 1HIAB 3KCGH 1FQ3A 3MMGA 4ZKRU 3MNCA 4LOYH 1N6XA 3Q00A 1GI2A 3NUMA 3HGNA 4PROA 4XOJA 1CSOE 1P06A 2C8ZB 1PJPA 2FI3E 5FCKA 1ZSJA 3ZVFA 1SGPE 1O2HA 3A88A 2BMGB 3RXJA 2Z3EA 1EX3A 1TPOA 1ZJDA 1Z6EA 2ZGXH 4GLYA 4NA8A 1C5LH 1H1BA 4JK5A 1DT2A 3V0XA 1TIOA 2WINI 4HTCH 4K1EA 4OGYA 2J95A 6GCHG 5HM9A 3LJOA 5L6NH 4ASHA 1RJXB 2ZCKP 3IG6B 1IQGA 1FMGA 2Y5HA 1KLJH 1XX9A 3U9AH 1FY8E 1K2I1 1XXDA 5IYTA 4NFFA 1JIRA 1Q31A 2VVCA 4TPIZ 3SUEA 2XCFA 4KP0A 2BXTH 3VB5A 2ZU3A 2V3OH 1QR3E 1GVZA 5E2PA 1YPGH 5A8YA 6ESTA 3BTFE 1EB2A 3EYDA 1RTKA 1JRTA 2BOKA 4INKA 1MBMA 1GI6A 1PPGE 3ATIA 2A4OA 3RXQA 2WV5A 1V2KT 1NFYA 2HGTH 2G55A 2C93B 1MCVA 1G32B 2G00A 5FX6A 4MPUA 3GYLB 1DY8A 5EODA 2JH5D 1W3CA 1S6FA 4Y7BA 2QC2A 2A0QB 5A0AE 4CRCA 2Y7XA 4Y7AA 1O5EH 4AORA 1GGDC 4A1XA 1GJCB 5C3NA 1DM4B 1AE5A 1KDQB 2BD2A 2J92A 1O3HA 3K65B 1TFXA 3A85A 3LGTA 4BAHB 1Z6JH 2ILNA 4MNYA 4RKJB 1T8NA 1AQ7A 5DP4A 3SV7A 1GVKB 2YOLA 4CRBA 1F0UA 2ZDAH 1BRCE 4YOIA 3S0NA 2VIVA 2SGPE 4ZKOU 2AH4X 4NA7A 2J38A 4JZ1A 1XM1A 1UMAH 5EGMA 4ABBA 2GCHG 2WV4A 1C5ZB 2ALVA 4X2YA 1C2LA 5G4BA 1GBIA 2I6QA 3F9HA 3C1KA 4X1QU 1ZHPA 1EAUA 2TGDA 2K1QA 4THNH 1TE0A 3ZVBA 3EA7A 3A89A 2FZZA 2YNAA 1AMHA 1BDAA 4KTSA 1CBWC 1UTMA 4MNVA 2QF3A 1BMNH 3A80A 1QJ1B 2ZO3H 2BXUH 4CH2B 2ZPQA 2WPLS 3VB3A 4TYDA 2B8OH 2FO9A 1ESAA 1MZDA 3PMJA 3T28A 1ELDE 1AGJA 2ZGBH 4Z6AH 3RXFA 1XKAC 1A5GH 1C1TA 1W8BH 1BTWA 3U1JB 3SQEE 2AGEX 1JOUB 1SQTA 1O5BB 2GD4B 1Z1JA 2TRMA 2F9VA 3RXMA 2PUQH 2A7CA 2AGIX 2AEIH 5A0BA 5FX5A 2P59A 2BX3A 4ZXYH 4F49A 1GDUA 1FUJA 3ITIA 5LH8A 3FANA 3RC5A 3A83A 2Q6FA 1W11U 3PV4A 5JBCS 2HNTC 1ETRH 3SGAE 3SJIA 1DWDH 4Q2KA 4DW2U 2OD3B 3ZZ8A 1Y3YA 5DKMA 1ZZZA 5F03A 3SGBE 1TOCB 2ZA5A 1SG8B 1D4PB 2BDYA 4A92A 2WYGA 1OWKA 2F9NA 1TGBA 1P2IA 4O03A 1CHOG 4KTUA 2XC4A 1BZXE 3LC5A 5E0HA 1OKXA 1CGHA 1O2JA 4DURA 1YGCH 3SOSA 3S7HB 5FPYA 4IN1A 1KXDA 2XXLA 1KIGH 5GPIB 4YM9A 1LPGB 1MTNC 5TJXA 2BQ7B 2R0KA 1WSSH 2FESH 1NRQH 1SGCA 4Y0ZE 1LQEA 1O3NA 4KELA 1UCYE 1WBGB 1Z1IA 1UJ1A 2HVXA 4INHA 1O3CA 1HJ8A 1P01A 1LTOA 1SOTA 2Q6GA 4NIVA 1EZSC 1LO6A 1GBMA 1KLIH 2O8MA 1GBDA 1C1OA 1YPLH 2BVSH 2FLRH 3BTQE 4U30A 3KQBA 2DE9A 2FOMB 5CHAB 1SHYA 3V7TA 1UVUH 1SGTA 1UTJA 1CT4E 3BTWE 4AYYB 4MPXA 2NU4E 1HJAC 3QX5H 1ESTA 1GL0E 3IWMA 3QO6A 1KY9A 2OC7A 1K1LA 3RMMH 4Y0YE 1GDNA 3OX7U 3O8DA 3SNCA 5K7RA 4KKDA 2G51A 2F3CE 2WPJS 1TYNA 1N1LA 3M61U 3UIRA 4HI3A 1C1QA 4FUGA 3K9XB 4CRDA 2UUFB 2ZFPH 3E16B 4WWYA 1QBOA 4K2YA 4GCHF 4ZHLU 4WMDA 5CMXH 2Z9JA 4AFQA 1UO6A 3URDA 4ZUHA 1TGSZ 4FUBA 2G52A 1A2CH 1MBQA 2BD5A 4WY3A 4BTIB 3GOVB 4BXWA 2BVXH