1C5WB

Structural basis for selectivity of a small molecule, s1-binding, sub-micromolar inhibitor of urokinase type plasminogen activator
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
248
structure length
248
Chain Sequence
IIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLMSPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTICLPSMYNDPQFGTSCEITGFGKEASTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHTKEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (UROKINASE-TYPE PLASMINOGEN ACTIVATOR)
publication title Structural basis for selectivity of a small molecule, S1-binding, submicromolar inhibitor of urokinase-type plasminogen activator.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Blood clotting
total genus 50
structure length 248
sequence length 248
ec nomenclature ec 3.4.21.73: U-plasminogen activator.
pdb deposition date 1999-12-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1c5wB02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1c5wB01
1TPSA 2WV4A 5C1UA 4JYTA 3GY6A 2OBQA 3V7TA 1RRKA 1OSSA 1RXPA 2TIOA 4Y8ZA 1BUIA 3MMGA 9ESTA 5EG4A 3M61U 1O2MA 3VGCB 3NPSA 5B6OA 3A7WA 4FU7A 1WOFA 2NU3E 2AMQA 1V2NT 3TNTA 5DP7A 1VR1H 1XUHA 2K1QA 4NWKA 4MVNA 5GCHG 4JZDH 3KF2A 4WVPE 1Z8JB 2JETC 3MYWA 1GL0E 1HV7A 1MAYA 3RP2A 1DE7H 3ATWA 2RCEA 1C1OA 1YC0A 2WPHS 7GCHF 1V2PT 2H1UA 2BXTH 1C2GA 2DUCA 1JOUB 2A5AA 5C5NA 5DP4A 4DGJA 2PKSB 1BDAA 2A4OA 4WMFA 1C1VH 1RJXB 3BG4B 1P01A 3RXJA 5DJ7A 4U2WA 1MU6B 3SBKA 1ID5H 2H9EH 1P57B 1NRNH 2VIWA 3ZZAA 1ZHPA 3MU0A 1BHXF 1GHZA 4AB8A 4AZ2B 4BAHB 1ELTA 3LH1A 2UWPA 5HM2A 1C5RA 1EZUC 1GMCF 2BVXH 3UR9A 3ZVEA 3ATKA 3E91A 1MU8B 1PQ8A 1Z8IB 2FI5E 1EP5A 1D3TB 1C9TA 3A83A 2SGDE 1LTOA 1TA6A 3MU4A 1TQ0B 2WINI 3A81A 5A8ZA 5A8YA 1OWEA 4NCYA 1VITH 3FAOA 1GHBF 2PTCE 1GI8B 2ASUB 1GBTA 3TJUA 3SUDA 3A86A 4GCHG 2OXSA 1GI6A 4A1TA 2FLRH 3QO6A 1E37B 4ABHA 1ABJH 1ANBA 1G3DA 1GBAA 1FJSA 1W14U 4XBBA 5HM9A 2OQ5A 4JK6A 4FU9A 2ZQ1A 2QY0B 3VEQB 2STBE 2OTVA 1UMAH 1BMMH 4K8YA 1GVKB 2D2DA 1GBFA 1GCTC 3RMMH 3MO6A 1UCYK 2BD7A 2XXLA 4O97A 3FVFB 5EOKA 3RXCA 3MNSA 4GUXA 1PPFE 1YBWA 1AUTC 5GIBA 3PLPA 2FOBA 1O3IA 1L4ZA 3M3SA 3ITIA 4Z6AH 2ZFQH 3BTEE 1VGCB 4AB9A 1W13U 4IN1A 4Y7BA 2ZGXH 3KNXA 1G3BA 1LQDB 4D8NA 1X7AC 1CA8B 1ESTA 3S9BA 1FXYA 1HLTH 2P59A 2WYJA 1DT2A 5HMAA 3QLPH 1TFXA 3LOXA 1CGHA 1MUEB 2TPIZ 1F0RA 1N6XA 4BTUB 3A84A 1PQ5A 1IQEA 2FESH 2P3UB 1QB9A 4WH6A 4OS1A 1ORFA 1DICA 1WCZA 1KXBA 1Y5BT 1MQ5A 2R0KA 1Y3VA 4KTUA 1OWJA 2XWBI 2Z6BD 1BHXB 1XUGA 3RMNH 3SU6A 1C4U2 2A7HA 3SNEA 1TMUH 2VB0A 1HAHH 3FANA 1EAIA 1NRQH 5IYTA 1JIMA 1YP9A 3M37A 1O36A 4TPYA 1DXWA 2A2QH 3CS0A 3KQBA 4TYDA 4HFPB 1UCYE 2FWWA 3PO1B 1AIXH 1CGJE 2ZDLA 1S0RA 1SVPA 1GCDA 1ARBA 1Q31A 1W0ZU 1CT2E 2FS8A 3ZZDA 2G8TA 2W26A 3GY4A 2BOKA 5F8ZA 1ZTJA 4TPIZ 2BD5A 1WBGB 1V2ST 1LHDH 2F91A 5LGOA 1O2JA 4ZHLU 4QT8C 2BZAA 1LPKB 1QA0A 1TLDA 3A88A 1C1PA 3GCTG 3VB4A 1C2JA 4HI3A 1SLXB 2ZGBH 3N7OA 5FXLA 1ANEA 2ZA5A 4I8JA 3E90B 1GMHG 1FY8E 4GPGA 4JK5A 5A0BA 1XVOA 2G5VA 4AFZA 4NIWA 3HPTB 1MMJN 1MTSA 2GMTB 2ZHEH 1MKWH 2CV3A 2UUFB 3HKIB 1K1MA 2XCNA 4I8HA 2XCFA 2UUYA 1TBQH 1TWXB 1V2RT 2QXIA 3EYDA 5DK1A 1GG6C 1GDUA 1C5OH 3EA7A 4XBCA 3QZQA 1GBKA 1ELGA 1NRSH 2BD3A 4ZKOU 1O0DH 1O5DH 3LGWA 1C2IA 5DP3A 1ZYOA 4ABBA 4F49A 5EXMA 1DXPA 3ENSB 1C2MA 1XUIA 7ESTE 6CHAB 8GCHF 3E0PB 3QGJA 3RXMA 4NIVA 3V12A 1P2QA 3LU9B 1SGYE 5LPRA 3E6PH 2XBVA 1P05A 1HJ9A 1IQJA 2D1JA 3P70B 2AS9A 4ISLA 2J92A 3GDVA 4ZXYH 1TX7A 4J2YB 3BTDE 4Y79A 1SGEE 4J1YA 1C2KA 2HNTE 1O3AA 1OWKA 3NXPA 3KN2A 5EXLA 1FONA 1A0HB 1TABE 2SFAA 5I25A 4BXWA 1DY8A 1ESBA 1PPBH 3MFJA 4UDWH 1KDQA 5I46H 1GJCB 1RIWB 5A0AE 2TGAA 5C67A 3RXHA 1P06A 5F8TA 1SPJA 2QAAA 1TOMH 3A7YA 2IPHA 3LGYA 1K1JA 1RS0A 2P93A 4ABEA 1D9IA 4LOYH 5JPMH 1YKTA 1E35B 1YCPM 1UHBB 2F9BH 3P95A 3HGNA 3M7QA 5BPEA 2R0LA 4OGYA 1TGTA 2BVSH 2AH4X 2G55A 4AFQA 2P8OB 2J94A 3Q76A 2NU1E 1WV7H 2ZIQH 1BA8B 1EJAA 1O5AB 1ZOMA 3RXBA 4ZKRU 1ZSLA 2OLGA 2VGCB 2QA9E 4TY6A 5A09A 1H9HE 1G2MA 2VH6A 3OY5U 4A5TS 2Y80A 1IQNA 1MD7A 5C1YA 1V2UT 1O3GA 4WMDA 3MHWU 1CSOE 1XXDA 3EDXB 4X8TH 3VB3A 4BTTB 4DT7B 1KDQB 1O5FH 1DVAH 1GVLA 4YLUA 1DSUA 3QK1A 1DS2E 1A4WH 1T4VH 1CHOF 3K6YA 1UTOA 3GOVB 2HGTH 1GI4A 4DIHH 5FBIA 4JCNA 2RDLA 4XE4A 2WUBA 1DSTA 1FV9A 5EQRA 1UCYH 3BF6H 1B0EA 3ZZ4A 1Q2WA 3BIVH 1CGIE 3UNRA 1Z8GA 2Y81A 1IQFA 1XM1A 4INLA 6LPRA 1AU8A 3TGKE 3QTVH 4IGDA 1G32B 3D49H 1EOJA 1FIZA 1Y5AT 2QCYA 5ETXA 3RXIA 2BZ6H 1GWAA 2V3OH 2JH5D 2Y7ZA 1ZPZA 4KELA 1EJMA 1DUEA 3SN8A 1EAXA 1GJ4H 2C3SA 3V3MA 1EAUA 4PROA 3EAJA 1ZR0A 3Q3XA 1SMFE 4ABAA 5JYIA 1SC8U 3M7UA 2BOHB 4HGCA 3NCLA 4YOIA 2XYAA 1W0YH 5F6MA 1IHTH 4CRGA 1SGRE 2GT7A 4FUGA 1DLKB 3M5MA 1TMTH 1AKSA 2FEQH 4CRCA 3F9EA 4I8KA 1ZLRA 1HAPH 5K0HA 3BEIB 4GAWA 3RXSA 1EKBB 1UVPA 2BQ7B 1K2I1 2SGQE 1PPGE 2OC7A 1C5UA 2FI3E 2BY5X 2V3HH 3IWMA 3RLYH 1P04A 1EZSC 3GCOA 3TJVA 2HNTF 1MTVA 5GDSH 4AN7A 1KLIH 3GISB 1TRMA 1VJ9U 4YLQH 1BZXE 3HATH 4DJZB 4WXIA 2ZO3H 1KXEA 3BSQA 3KGPA 1D3QB 2QXGA 1A0LA 3E0NB 1ZPCA 3KHVA 5DP8A 4Y8YA 5FX6A 1KSNA 3A8CA 3DUXH 1CA0B 2FOAA 2FYRA 5LPFA 1QJ6B 1GHVH 1SFQB 2BY8X 3ZV8A 1GBIA 1DFPA 1FY3A 3TGJE 1BTYA 4ABGA 3ZZCA 1C1RA 2WYGA 2D26C 1P11E 3CS7A 1ZMJA 3BV9B 1AKSB 1T31A 1LQEA 2A5KA 1E34B 3LGIA 2C8XB 1NRRH 3PLKA 5G4BA 4CH2B 1O2NA 3RUOA 3A7VA 3M3TA 3KL6A 3FZZA 2HPQH 2PWXA 1BOQA 2F9UA 2Y6TA 1ZGIA 2BM2A 3RMOH 3ZYDA 1ETRH 5DG6A 2W7UA 2A7JA 4KP0A 2CF8H 2P3FH 1SQTA 5EPNA 5DKMA 4ZMAH 3PM3A 4JZ1A 2ZFTA 3SNDA 3TJNA 5AHGH 2BDAA 1T8LA 1A2CH 2THFB 1IHSH 3BTWE 4GLYA 1C1WH 4ZAEA 1ZMNA 1O3BA 1DY9A 2ZU3A 3SQHE 1TA2A 4X1RU 4CREA 2UWOA 1LPZB 2RG3A 4IW4E 4AFUA 1AQ7A 1P2MA 3LGUA 4B76A 5GWZA 2ODYB 4WMEA 1C5TA 2A4GA 1HBTH 2BDGA 3RC4A 1INCA 1T7CA 4CRBA 1V2WT 3ESTA 1HAZB 4DVAU 1P3EA 3A8AA 1HPGA 1ELVA 3P8NA 1O2HA 4BOHA 1EPTC 4IMQA 4Y8XA 3NZIA 4YT7H 1GMDF 3M3VA 3STJA 3TJOA 4YOGA 1L1JA 1MH0A 1CBWC 1V3XA 4X8VH 1AVGH 1GGDB 3ODDA 1C5YB 3PWCA 1MKWK 1YPLH 5EODA 5H4IB 2WV5A 3VB7A 4Q7ZA 1SSXA 2ZHWH 3ZVAA 3U1JB 1AHTH 1NPMA 4UE7H 3U98H 2R2WU 6GCHG 1O5GH 3H7TA 4I33A 1YPKH 3GICB 2PSXA 1Z71A 5FX5A 4BNRA 1H1BA 3RMLH 5DGJA 4K69A 3SJOA 2FP7B 3SJIA 2XC0A 1ABIH 1K1LA 2GCHG 2ZEBA 1P0SH 4K5ZA 4A1XA 3ZZ8A 3A7ZA 1TNKA 1RGQA 1A0JA 1GHAG 2GV7A 2ZF0H 4GSOA 3T29A 5FBEA 1IQKA 3PWBA 4MLFB 1TGBA 4JMYA 3BTHE 3AAUA 1XKAC 1JMOH 1FN8A 4MNVA 1TPOA 1FQ3A 4CRDA 3F68H 2FMJA 3MH6A 2AGGX 2F9OA 2PW8H 3KEEA 3P17H 1A5HA 3RXVA 4A6LA 2WPJS 2TRMA 1C5ZB 1AD8H 1P2IA 2ZKSA 1C5WB 1AFQC 2SNWA 5EQQA 3NKKA 1DOJA 3RXOA 1V2TT 2Y5FA 4RKJB 4I8LA 1NFYA 4XFQA 3T28A 3MNCA 1NROH 3PYHA 4X8UH 2ZWLH 5AFZH 2FDAA 4JZEH 5GPIB 8GCHG 2FX4A 2GZ8A 2W3KA 3UNQA 1VITF 3M5LA 1ZSJA 5GJ4B 5CHAB 1L1GA 1ZJKA 4ABFA 1J9CH 1MD8A 1C2LA 1Z1IA 2FOFA 3TK9A 3ZZ6A 2ALVA 4DOQA 2QF3A 4VGCB 3ELAH 3AVZA 3V13A 4NFEA 2TGTA 2A45B 1O30A 1THPB 3ZV9A 1TGNA 3EGKH 3GCHB 3E8LA 1O3MA 4X2WA 1FAKH 1KY9A 3P92A 1A7SA 2BDYA 1SLUB 4M7GA 3GY2A 4K2YA 2GKVE 2A5IA 2B0FA 1EXFA 3PMHB 3NWUA 5EQSA 2FZZA 1GJ6A 1LVBA 3VGCC 2EI6A 2J38A 1P09A 3VFEA 1NU7B 3ZVDA 5J4SA 2BMGB 4AYVB 1TX6A 2H5DA 1O33A 1PPCE 4NGAH 1GJ5H 2SGEE 4NWLA 2BXUH 1GJAB 1BTZA 1TPPA 2STAE 3I78A 1S0QA 1FNIA 1FI8A 3TLOA 2VIDA 4JZIA 3K2UA 1C1QA 2J9NA 3F9FA 2A0QB 1YYY1 1Y3XA 4BXSA 2Y82A 2B5TB 4UD9H 1BBRK 2VIQA 1KXCA 2KAIA 2BQ6B 2O9QA 1YPMH 5AFYH 4UEHH 1AB9B 1L0ZA 3GY5A 3BG4C 1DLEA 4WY3A 3CP7A 1UTLM 1XUJA 4RN6A 5EPYA 1FN6A 3RU4T 4DW2U 1HCGA 3UQVA 9LPRA 4MDSA 2O8WA 1AWHB 4K60A 3S9CA 1C1UH 2QXJA 4FUBA 1TRNA 4X6NA 4Q7XA 3D65E 1AY6H 1HAIH 1IQHA 4IS5A 4OS7A 2XBXA 3DT0H 4FU8A 1YF4A 3S7KB 1M9UA 2SGAA 1C4V2 1QL7A 1W2KH 3L3TA 2HOBA 1S81A 5T6DA 1SGDE 1AZ8A 3BG8A 4O03A 5JB8S 4Q7YA 2ZHDA 3SV2H 1TOCB 2CF9H 2ZPQA 1MTNB 1HXFH 1FAXA 1BMAA 1EP6A 1HYLA 1N6YA 1ZZZA 2BTCE 4B74A 5EW2H 2ILNA 1K21H 1TONA 3S69A 3F9HA 4XOJA 4JYVH 1DPOA 2XWAA 1O3OA 4CRAA 2ZFFH 5AF9H 1ZRKA 1O35A 3A7TA 2BDBA 1WYKA 1BBRE 2Z9JA 2BX4A 2I6QA 3C27B 3KQEA 2P94A 2V6NA 2OC1A 5FCKA 5E2OA 1D6RA 1F5LA 1UTQA 1VGCC 4FUCA 1EAWA 1O39A 3SUGA 3LPRA 5JBCS 4ABDA 3SHCH 2PUQH 3M7TA 1GBJA 2HWLB 2VNTA 1SGFG 1AGJA 1O2WA 1E38B 1UJ1A 5FPYA 3B9FH 2OINA 1FIWA 1FY5A 3AAVA 4CR9A 3RM2H 1G3CA 1JBUH 1YPJH 1AUJA 3ZYEA 3H5CB 2ZU4A 3E16B 4YO9A 3RC6A 4CBNA 2Z94A 3F1SB 1O31A 1UO6A 4OS5A 3Q00A 1A1RA 1OS8A 3I77A 1T8NA 3F6UH 3UNSA 1D4PB 4FUFA 1GHXH 4NZLA 4Y0YE 1C5PA 1O2XA 2AERH 3LC5A 4D9QA 3UY9A 4KKDA 2PGBB 4B73A 1WTGH 1VCQA 3PO1C 1TNLA 2ZFSA 1IQIA 1O3CA 4UFGH 1N1LA 5GCHF 2AMDA 4IMZA 3U69H 1EZQA 3K9XB 3LJOA 4X1NU 4OS6A 2Z3CA 1SFIA 1NM6A 1GI9B 3PMAB 4Y7AA 1GI2A 1PPHE 1F92A 1MCVA 2QXHA 1WQVH 3SGAE 4MQAA 2W7SA 2ZPSA 4Q80A 2ULLA 4RSPA 1QQUA 1G30B 3TVJB 2TGDA 1GBBA 1SB1H 2A7CA 1AE8H 2HPPH 4NIXA 1A3EH 2ZCLP 1C5SA 1UVTH 4CHAB 3EE0B 1AVWA 1UK4A 4ESTE 1TGSZ 1QB1A 2BLVA 3BTFE 1DDJA 3DFJA 4LZ4B 3T26A 1V2LT 1KIGH 4X2XA 1HJAB 2O8MA 3VB5A 1FY4A 2Q6GA 3DFLA 4HTCH 2BB4A 1W8BH 2GMTC 2Q6DA 1K22H 2BY6X 1EJNA 5HYOA 1ARCA 4WH8A 1FUJA 1O38A 1BTUA 2ZTZA 1DWDH 5C3NA 2A31A 1QRZA 4MTBA 1ESAA 3GCNA 1BIOA 4AG1A 5J4QA 4MNWA 1OOKB 3E1XB 4XDEA 2Z9LA 3BTME 4CH8B 1HIAA 1PQAA 1V2OT 1DWCH 3M5OA 2PV9B 5DO4H 1UVOA 1QNJA 4TWWA 3SNCA 3P8OA 1O32A 4FVDA 4JYUH 5A8XA 3ZVCA 2BVRH 2XNIA 4GCHF 4ISNA 6CHAC 1F0TA 4BAKB 1QJ7B 2FI4E 2V35A 3TK5A 3SW2B 4Y6DA 3BTGE 3BTTE 5EGMA 3I29A 4ZHMU 3SV8A 3GYLB 2GZ9A 2EA3A 3MWIU 1LDTT 1B0FA 3RXAA 2FOMB 4NA8A 1A3BH 1CVWH 1EB1H 4KTCA 2QC2A 4X1QU 2ZU1A 3DD2H 4FXGH 2F9PA 5C1XA 1FMGA 2ZECA 3EA9A 2BLWA 2OC8A 1NT1A 2J2UA 1WQSA 2XRCA 2ZPRA 4D7GA 5FPSA 1J14A 1EZXC 1EASA 2SGPE 2VU8E 1RIWC 4FUIA 2H6MA 1OKXA 2G5NA 1BBRH 2PLXA 2A32A 2ZU5A 3SU4A 1ELDE 1BCUH 1JXPA 1UTKA 3RXFA 1L4DA 1PPEE 2JH0D 4NA9H 1W3CA 2XW9A 3SU2A 5GXPA 1HXEH 3QX5H 5TCAA 2CHAB 2P8OC 1JWTA 3HK3B 2OP9A 3T2NA 1SLVB 1SHHB 1ELCA 2C8YB 2VGCC 1SR5C 5ESTE 4HZHA 5FAHA 7GCHG 1S5SA 1W12U 1Z1JA 1GDNA 4UFFH 1O2LA 3G01A 1Y3WA 3R0FA 3W94A 3RXQA 4Q2KA 2C8ZB 3LIWA 1KXAA 1T32A 3L33A 4IC6A 2TGPZ 5TJXA 3U8RH 1W10U 3UOPA 2RA3A 2FOEA 2BY7X 2FLBH 4MG3A 1TE0A 1TBZH 1TGCA 1RFNA 1YPEH 1LVOA 1L2EA 4ZKSU 1S6HA 1EPTA 1MBQA 1DWBH 1OP8A 2ANWA 1PFXC 1GMCG 1GI7B 1LKAA 4CRFA 1HB0B 2BQWB 1RTKA 1ELBA 1NS3A 4IC5A 2GCTC 4BAOB 1K1OA 1UK2A 2R2MB 2AEIH 2EC9H 3QZRA 3PV4A 2FTLE 1WAYB 1N8OB 2PKAA 1IQGA 1C1SA 3GYMA 4YM9A 1FDPA 1Y8TA 2AIPA 1H8DH 1MQ6A 1GHBG 3GCTF 1KXFA 3FP8E 1FZZA 1RTFB 1BMLA 1OWDA 1MCTA 3UPEA 3BEFB 3SZNA 2BD2A 3RXKA 3STIA 5JBAS 2ODPA 5LPEA 1GMHF 3V0XA 4DG4A 4SGAE 2ZHFH 3QUMP 2F3CE 3M5NA 1GBCA 1PYTC 3AASA 5FCRA 1F7ZA 3L6PA 2Z3DA 1A61H 3SU1A 5C5OA 1J16A 3IITA 1W7GH 2JH6D 2AFQB 1C2EA 1HAVA 1Y59T 4ZHAA 1Z8RA 2BD9A 2Z9GA 1F2SE 4R8TB 3RXPA 4H4FA 1BRUP 3P8GA 2B9LA 2GV6A 2NU4E 4IN2A 1LVMA 5T3HA 3SJ9A 1V2MT 3ZVGA 4FVBA 1HAOH 1SBWA 4Y11E 2ZNKH 3UR6A 4U30A 1SQOA 1MZAA 3A87A 3OTJE 2HVXA 1YLCA 5HXFA 5L6NH 1LHCH 1O3FA 4BAQB 1P9UA 1SLWB 4E05H 1YCPK 3Q77A 1UTPA 1F0UA 2BDCA 3RXGA 5SGAE 1HAGE 1C5NH 2BLOA 1IQLA 1YPHC 2OCVB 2G51A 3LGVA 4Y76A 4A1VA 4Z0KA 1ZPBA 1FY1A 1EB2A 1CA0C 2SGFE 3KQCA 3TH3H 4H42U 2VIOA 2VWOA 3GDUA 1LHFH 3EQ0H 1THRH 1A5GH 1HFDA 3QN7A 1NRPH 2ZP0H 2VVUA 2WUCA 2BX3A 4WXVA 2CMYA 1T4UH 3OY6U 2J95A 3SU0A 3SNAA 1F5KU 1HDTH 4I8GA 4CBOA 2GDDA 3JZ2B 5L2YH 3NK8A 3P6ZB 1P2KA 2GP9B 3TK6A 1G2LA 1NC6A 4ISOA 3A8BA 2FXRA 1DUAA 1GI3A 2QIQA 2BDHA 2HLCA 1NU9A 3ATMA 1O2VA 5TCCA 2G4UA 4AFSA 2JETB 5CE1A 4B2AA 1D3DB 4X2VA 3SGBE 2VWNA 1GJDB 2XBWA 2GGVB 3BTKE 2AMPA 2Z3EA 2F9VA 2VWMA 1BTHH 2ZGCA 3PLBA 1CE5A 1QBVH 1QTFA 3K6ZA 4NSYA 1C2FA 2NU2E 2ZDVH 3LH3A 3AW0A 3PB1E 1TX8A 1O2GH 3SJ8A 3KQDA 1QBOA 2FM2A 1RD3B 1JRSA 1TNIA 1XMNB 1J17T 1O37A 3A80A 1YM0A 1PPZA 4NG9H 4X1SU 3SI3H 3T27A 3TNSA 4K1SA 1O2OA 2WPMS 5PTPA 4A92A 1OP0A 3FP6E 2V0BA 2VH0A 2IN2A 3MH7A 1TB6H 1WUNH 1GJ8B 1TNJA 2IJOB 1O5CB 4IBLH 5F8XA 2Q1JA 2HNTC 1LO6A 1S83A 5FPTA 3VB6A 2PUXB 1WU1A 2WPIS 1QCPA 3M35A 2R9PA 3DHKH 2ZGHA 2ZDMA 1P2OA 1AMHA 1U6QA 1GGDC 2D8WA 2EI7A 8ESTE 1TBRH 1CU1A 1KTSB 2ALPA 1TNHA 4NA7A 1O5BB 2QF0A 2O8LA 1GCTB 3QWCH 1C5LH 2C90B 4TY7A 1XKBC 2VIVA 1L1NA 2W5EA 1AZZA 3MNBA 1NZQH 1CQQA 2UUJB 3SOSA 3T5FH 3ZZBA 2DE8A 4E7NA 4GHTA 3U9AH 2UWLA 4ZH8A 3SU5A 1SGPE 5C20A 1O2ZA 1TQ7B 3OX7U 3RLWH 1S85A 5JB9S 1BB0B 1SI5H 3FP7E 2G81E 1O2IA 4LXBH 4AGJA 1P03A 3ATIA 3UQOA 1TALA 1O34A 2H2ZA 2YNAA 2Z9IA 5JBTA 3HKJB 2R3YA 1S84A 1BTWA 1OXGA 4THNH 1C5QA 3O8CA 3ATLA 3ZVBA 3OYPA 1QR3E 2ZCKP 2GZ7A 1MTUA 1LMWB 1QY6A 5E0JA 2FTMA 1NFWA 4BAMB 4KGAA 2QN5T 2HALA 1G3EA 1K28D 3TPIZ 3U8TH 3UOUA 3MO9A 3LJJA 3M36A 1VCWA 1AFEH 3ZZ3A 1KTTB 4YZUA 3RU4E 1O2SA 2PKSC 5T6FA 5CHAC 3VXFH 3RU4D 3HGPA 1HNEE 1C1MA 1ZGVA 3PTNA 3OU0A 1KLTA 1GJ7B 1P8VC 4ZXXH 1BT7A 2H9TH 1P2JA 3U8OH 4VGCC 1TPAE 1MTWA 2XC5A 1CHOG 1HAYB 3GCHC 4INHA 1PQ7A 3SQEE 3UTUH 1C1TA 1GBHA 1MKXH 2PSYA 2VVVA 1FPHH 3RDZA 3SV7A 4D7FA 1LVYA 1O2UA 2PTNA 4O3TA 3LGTA 3BIUH 2QV1A 5AVDA 5CMXH 2BDIA 4YESB 1QRWA 1V2JT 3LT3A 1PYTD 1IOEA 3MU1A 2WPKS 2KAIB 2ODQA 4R0IA 3MO3A 2OBOA 3A7XA 1LKBA 3Q3KA 1D6WA 5LH8A 5EW1H 1BRCE 1ZSKA 1SG8B 4WF8A 4DY7B 1OYQA 1YCPH 1FPCH 1XVMA 5C2ZA 2FYQA 1GG6B 1ELAA 4RKOB 3RXTA 1O3PB 4FUHA 3TH2H 1AB9C 1J8AA 3MI4A 1OWIA 1BITA 1B7XB 4MPWA 2PR3A 3MU8A 2J34A 1SGTA 2GDEH 1WSSH 1GBLA 2ZG0H 4JZFH 3PMJA 2OQUA 4WJG2 1NN6A 1Z6EA 8KME2 4X6PA 2QGRA 4XSKU 2YNBA 3SUFA 1SOZA 4OGXA 2FOHA 1YPHE 1HAXB 3D23A 4X0WU 1OWHA 1Y5UT 1NTPA 3SO3A 2VVCA 4X6OA 1P9SA 4INKA 5E8EH 6GCHF 1Y3UA 1A5IA 1GL1A 1BTXA 1O2YA 1BTPA 2B7DH 3ODFA 3HK6B 2M5TA 1O2PA 2ANKH 1UTJA 2G52A 1SGNE 5ABWA 1Z6JH 2A4QA 4DCDA 1V6DA 1MTNC 7KMEH 2ZC9H 2GCHF 2DE9A 3PTBA 4E7RG 5E2PA 4O3UA 3UWJH 1AI8H 5L30H 2ZDAH 1V2VT 1GHAF 1ZMLA 3MH4A 4MPVA 4ISIH 1H9LB 1AWFH 4YOJA 1FLEE 4ISHH 2ANMH 1QBNA 1ZHRA 1QGFA 1K9OE 3ZZ7A 1DANH 3O8BA 4YTAA 1GI5A 3SU3A 2Y5GA 2FOGA 4B1TA 3QTOH 1UK3A 3WY8A 3SV6A 1NO9H 2ANYA 2VWLA 1GI0A 4I32A 7LPRA 1GI1A 3W95A 1TRYA 2GT8A 1DWEH 3B23B 2VIPA 1O3EA 3SGQE 1E36B 2G4TA 1V2KT 3U1IB 1P3CA 1P10A 1O2RA 1VJAU 3OSYA 2H5CA 1YPGH 1UHBA 5HGGA 2IOTA 1VCPA 1OX1A 4H6SB 5E0HA 2ZTYA 1SOTA 2ZFRH 1KLJH 2ZQ2A 4MPXA 4B2CA 1ZJDA 4I31A 3GDSA 4B71A 3LC3A 2J4IA 2VJ1A 4U01A 4ZKNU 5DP9A 1Q3XA 2C8WB 1DITH 1CO7E 3URCA 2GD4B 3ZVFA 4MNYA 1GHWH 4FUEA 2A4RA 2OD3B 2FX6A 5DP5A 1TIOA 1AO5A 1OPHB 4O9VA 1TNGA 4D9RA 1QL9A 5T6GA 4F4OC 3A82A 3O8DA 2Y5HA 4LK4A 2ZTXA 3LONA 3UUZA 2QYIA 4CR5A 3CENA 4K1TA 1TAWA 1SGIB 3SHAH 4MPUA 1GMDG 2B8OH 1G9IE 1C2DA 1GHYH 2EI8A 1SL3A 1BRBE 3FFGA 3PROA 1C4Y2 1YLDA 1H8IH 4H6TA 5DPAA 4ZUHA 1IAUA 2ZFPH 1T8OA 1ETTH 1RTLA 2O8TA 3RXDA 1SGCA 2FODA 1K1PA 1B5GH 1W11U 3MNXA 4ASHA 2ZDNA 1NFUA 1LHEH 1MAXA 2O8UA 2YOLA 4U32A 1C2HA 1ZRBA 1QA7A 1MBMA 1HUTH 4ABIA 1HJ8A 1P2NA 2TBSA 4MNXA 2GVFA 1WTHD 3BTQE 3SNBA 2SNVA 2AIQA 3QGNB 4NIYA 2BD8A 1O5EH 3GY7A 2PGQB 4CHAC 4Y71A 5IDKA 3P8FA 3AW1A 1AVXA 1O2QA 2A1DB 1HJAC 2LPRA 2JKHA 1A46H 1O3JA 1HIAB 2ZHQH 4WWYA 4Y0ZE 5K7RA 1EUFA 1H9IE 1UVUH 1S82A 1Z7KA 1Y3YA 1H4WA 1P12E 2AGIX 3LKWA 4UONA 8LPRA 3MH5A 2XC4A 1C9PA 3E3TA 3S0NA 2OUAA 1ZTKA 3TH4H 3BN9A 3BEUA 3H7OA 1IQMA 3SORA 3SV9A 2GCTB 1JRTA 1QJ1B 3K65B 3S9AA 2A2XH 1G36A 1GBDA 3A85A 1UVSH 2CJIA 3PMBB 1K1NA 1O3DA 1EOLA 1HRTH 3RXEA 2W3IA 1GBMA 2VINA 4OS4A 2LNCA 1DM4B 3UFAA 3S7HB 2FIRH 3A8DA 2F83A 1J15A 2RA0A 3T25A 1VITG 1THSH 4I7YH 1BJVA 1TMBH 2ZU2A 3FZDA 1QQ4A 1GVZA 4XBDA 4BANB 4DIIH 2FOCA 1O2KA 4KTSA 3ZZ5A 4GVUA 3KIDU 1GDQA 2R3UA 6ESTA 5L2ZH 4GHQA 1O3HA 3Q3YA 1LHGH 5JBBS 1XUFA 1HGTH 2BD4A 3QDZB 1P02A 3D62A 3O8RA 5DP6A 5FHTA 1XXFA 1C1NA 2ZGJA 4AORA 3TGIE 1C5MD 3F9GA 4X8SH 2FO9A 1ZHMA 1UTNA 1QRXA 4FUJA 4X2YA 1C5XB 1V2QT 2XTTB 4FUDA 2C4FH 3MOCA 1ETSH 4X1PU 1KXDA 1JIRA 1QL8A 4LZ1H 3MTYA 4K8BA 1GJBB 3SI4H 1OP2A 4K1EA 2CHAC 2ESTE 1LPGB 4TWYA 2ZDKA 1QIXB 1MKXK 2OC0A 1ACBE 1CHGA 3SJKA 4AG2A 3TIUA 3A89A 3DA9B 3ZZ9A 4B75A 2F9NA 2ZI2H 2C93B 3NUMA 2P95A 1QURH 1EPTB 2GTBA 1S6FA 4K3JA 5BRRE 3RXUA 2Q6FA 1E0FD 2ZCHP 3B8JA 1VZQH 2Y7XA 1QHRB 2BHGA 2AGEX 3MU5A 4A7IB 1SHYA 4DURA 2ZZUH 1CBWB 2PKAB 4ZROA 1MZDA 2AYWA 1C5VA 1ANDA 1NFXA 3RXLA 2PHBA 3RC5A 3URDA 1YGCH 2NWNA 4UFEH 3SUEA 1EATA 5F03A 4NZQA 1BRAA 1O3LA 1W7XH 3JZ1B 3TITA 2XBYA 4YT6H 1K1IA 1QFKH 1ELFA 4AX9H 1BQYA 3GY8A 1SGFA 1D3PB 2BYAX 1N8OC 1TYNA 2HRVA 2H9HA 2CXVA 3UREA 1SGQE 1O3NA 1ELEE 1XUKA 2BY9X 2P16A 1O3KA 2CGAA 4NSVA 3T62A 1ANCA 1HAVB 1KYNA 4UFDH 3UWIA 1AE5A 1PJPA 3RXRA 1CT0E 2NU0E 3KCGH 2CN0H 1BJUA 1SQAA 2FPZA 1G37A 1QB6A 5EU8A 2Z7FE 4SGBE 2BLQA 1LCYA 2FS9A 1GBEA 4E06H 1AFQB 4Y10E 1ZTLA 1O2TA 4D76A 1XX9A 5E0GA 5JDUB 1UTMA 3TU7H 2G00A 2GX4A 5EXNA 3GY3A 3EA8A 4NFFA 3LDXH 4AGKA 4X6MA 4OS2A 2I6SA 2WPLS 1CT4E 3R3GB 4AYYB 1GJ9B 1EX3A 2PFEA 5ESBA 1AN1E 3IG6B 4B2BA 3VXEH 1BMNH 3C1KA 2Z9KA 3RM0H 3UIRA 5A0CA 1F0SA 2P3TB 2UUKB 5A2MH 4ABJA 4BTIB 1NY22 1F5RA 1EQ9A 4AOQA 1OYTH 1NESE 1GPZA 1T8MA 2EEKA 1DX5M 3VPKA
chains in the Genus database with same CATH superfamily
1TPSA 2WV4A 5C1UA 4JYTA 3GY6A 2OBQA 3V7TA 1RRKA 1OSSA 1RXPA 2TIOA 4Y8ZA 1BUIA 3MMGA 9ESTA 5EG4A 3M61U 3DSPA 1O2MA 3VGCB 3NPSA 5B6OA 3A7WA 4FU7A 1WOFA 2NU3E 2AMQA 1V2NT 2WPDD 3N7EA 3F2FA 3TNTA 5DP7A 1VR1H 1XUHA 2K1QA 4NWKA 4MVNA 5GCHG 4JZDH 3KF2A 3OE7D 4WVPE 1Z8JB 3WWFA 2JETC 3MYWA 1GL0E 1HV7A 1MAYA 3RP2A 1DE7H 3ATWA 2RCEA 2QE7D 1C1OA 1YC0A 2WPHS 3DSGA 7GCHF 1V2PT 2H1UA 2BXTH 1C2GA 2DUCA 5KEDA 1JOUB 2A5AA 5C5NA 5DP4A 4DGJA 2PKSB 1BDAA 2A4OA 4WMFA 1C1VH 1RJXB 3BG4B 1P01A 5CDFE 3RXJA 5DJ7A 4U2WA 1MU6B 3SBKA 1ID5H 2H9EH 1P57B 1NRNH 2VIWA 3ZZAA 3OTPA 1ZHPA 3MU0A 1BHXF 1GHZA 4AB8A 2KX4A 4AZ2B 4BAHB 1ELTA 2PP6A 5FL7D 3LH1A 2UWPA 5HM2A 1C5RA 1EZUC 1GMCF 2BVXH 3UR9A 3ZVEA 3ATKA 3E91A 1MU8B 1PQ8A 1Z8IB 2FI5E 1EP5A 1D3TB 1C9TA 3A83A 2SGDE 1LTOA 1TA6A 3MU4A 1TQ0B 5C17A 2WINI 3A81A 5A8ZA 5A8YA 1OWEA 4NCYA 1VITH 3FAOA 1GHBF 2PTCE 1GI8B 2ASUB 1GBTA 3TJUA 3SUDA 3A86A 4GCHG 2OXSA 1GI6A 4A1TA 2FLRH 3QO6A 1E37B 4ABHA 1ABJH 1ANBA 1G3DA 1GBAA 1FJSA 1W14U 4XBBA 5HM9A 2OQ5A 4JK6A 4FU9A 2ZQ1A 2QY0B 3VEQB 2STBE 2OTVA 1UMAH 1BMMH 4K8YA 1GVKB 2D2DA 1GBFA 1GCTC 3RMMH 3MO6A 1UCYK 2L74A 2BD7A 2XXLA 4O97A 3FVFB 5EOKA 3RXCA 3MNSA 4GUXA 1PPFE 1YBWA 2F4LA 1AUTC 4XRNA 5GIBA 3PLPA 2FOBA 1O3IA 1L4ZA 3M3SA 3ITIA 4Z6AH 3DCLA 2ZFQH 3BTEE 1VGCB 4AB9A 5KECA 1W13U 4IN1A 4Y7BA 2ZGXH 3KNXA 1G3BA 1LQDB 4D8NA 1X7AC 1CA8B 1ESTA 3S9BA 1FXYA 1HLTH 2P59A 4P00A 2WYJA 1DT2A 5HMAA 3F0PA 3QLPH 1TFXA 3LOXA 1CGHA 1MUEB 2RFKC 2TPIZ 1F0RA 1N6XA 4BTUB 3A84A 1PQ5A 1IQEA 2FESH 2P3UB 1QB9A 4WH6A 4OS1A 1ORFA 1DICA 1WCZA 1KXBA 2EQNA 1Y5BT 1MQ5A 2R0KA 1Y3VA 2WV9A 4KTUA 1OWJA 2XWBI 2Z6BD 1BHXB 1XUGA 3RMNH 3SU6A 1C4U2 2A7HA 3SNEA 1TMUH 3FO8D 2VB0A 1HAHH 5IK2D 3FANA 1EAIA 1NRQH 5IYTA 1JIMA 1YP9A 3M37A 1O36A 4TPYA 1DXWA 2A2QH 3CS0A 3KQBA 4TYDA 4HFPB 1UCYE 2FWWA 3PO1B 1AIXH 1CGJE 2LELA 2ZDLA 1S0RA 1SVPA 1GCDA 1ARBA 1Q31A 1W0ZU 1CT2E 2FS8A 3ZZDA 2G8TA 2W26A 2XNDD 3GY4A 2BOKA 5F8ZA 1ZTJA 4TPIZ 2KCOA 2BD5A 1WBGB 1V2ST 5DSFA 1LHDH 2F91A 5LGOA 1O2JA 4ZHLU 4QT8C 2BZAA 1LPKB 1QA0A 1TLDA 3A88A 1C1PA 3GCTG 3VB4A 1C2JA 4HI3A 1SLXB 2ZGBH 3N7OA 5FXLA 1ANEA 2ZA5A 4I8JA 3E90B 1GMHG 1FY8E 4GPGA 4JK5A 5A0BA 1XVOA 2G5VA 4AFZA 2WHXA 4NIWA 3HPTB 1MMJN 1MTSA 2GMTB 2ZHEH 1MKWH 2CV3A 2UUFB 3HKIB 1K1MA 2XCNA 4I8HA 2XCFA 5HIZA 2UUYA 1TBQH 1TWXB 1V2RT 2QXIA 3EYDA 5DK1A 1GG6C 1GDUA 1C5OH 3EA7A 4XBCA 3QZQA 1GBKA 1ELGA 1NRSH 2BD3A 4ZKOU 1O0DH 1O5DH 3LGWA 1C2IA 5DP3A 1ZYOA 4ABBA 4F49A 5EXMA 1DXPA 3ENSB 1C2MA 1XUIA 7ESTE 6CHAB 8GCHF 3E0PB 3QGJA 3RXMA 4NIVA 3V12A 1P2QA 3LU9B 1SGYE 5LPRA 3E6PH 2XBVA 1P05A 1HJ9A 1IQJA 2D1JA 3P70B 2AS9A 4ISLA 2J92A 3GDVA 4ZXYH 5EJLA 1TX7A 4J2YB 2OK5A 3BTDE 3VG8A 4Y79A 1SGEE 4J1YA 1C2KA 2HNTE 1O3AA 1OWKA 3NXPA 3KN2A 5EXLA 1FONA 1A0HB 1TABE 2SFAA 5I25A 4BXWA 1DY8A 1ESBA 1PPBH 3MFJA 4UDWH 1KDQA 5I46H 1GJCB 1RIWB 5A0AE 2TGAA 5C67A 3RXHA 1P06A 5F8TA 1SPJA 2QAAA 1TOMH 3A7YA 2IPHA 3LGYA 2JJ2D 1K1JA 1RS0A 2P93A 1QZ8A 4ABEA 1D9IA 4LOYH 5JPMH 1YKTA 1E35B 1YCPM 1UHBB 2F9BH 3P95A 3HGNA 3M7QA 5BPEA 2R0LA 4OGYA 1TGTA 2BVSH 2AH4X 2G55A 4AFQA 2P8OB 2J94A 3Q76A 2NU1E 1WV7H 2ZIQH 1BA8B 1EJAA 1O5AB 1ZOMA 3RXBA 4ZKRU 1ZSLA 2OLGA 2VGCB 2QA9E 4TY6A 3F2HA 5A09A 1H9HE 1G2MA 2VH6A 3OY5U 4A5TS 2Y80A 1IQNA 1MD7A 1EFRD 1V2UT 5C1YA 1O3GA 4WMDA 3MHWU 1CSOE 5F53A 1XXDA 3EDXB 4X8TH 3VB3A 4BTTB 4DT7B 3FKSD 1KDQB 1O5FH 4Q63A 1DVAH 1GVLA 4YLUA 1DSUA 3QK1A 1DS2E 1A4WH 1T4VH 1CHOF 3K6YA 1UTOA 3GOVB 2HGTH 1GI4A 4DIHH 5FBIA 4JCNA 2RDLA 4XE4A 2WUBA 1DSTA 1FV9A 5EQRA 1UCYH 3MQKC 3BF6H 1B0EA 3ZZ4A 1Q2WA 3BIVH 1CGIE 3UNRA 1Z8GA 2Y81A 1IQFA 1XM1A 4INLA 6LPRA 1AU8A 3PRBA 3QTVH 3TGKE 4IGDA 1G32B 3D49H 1EOJA 1FIZA 1Y5AT 2QCYA 2F43B 5ETXA 3RXIA 2BZ6H 1GWAA 2V3OH 2JH5D 2Y7ZA 1ZPZA 4KELA 1EJMA 1DUEA 3SN8A 1EAXA 1GJ4H 2C3SA 3V3MA 1EAUA 4PROA 3EAJA 1ZR0A 3Q3XA 1SMFE 4ABAA 5JYIA 1SC8U 5DN6D 3M7UA 2BOHB 4HGCA 3NCLA 4YOIA 2XYAA 1W0YH 3OFND 5F6MA 1IHTH 4CRGA 1SGRE 2GT7A 4FUGA 1DLKB 3M5MA 1TMTH 1AKSA 2FEQH 4CRCA 3F9EA 4I8KA 1ZLRA 1HAPH 5K0HA 3BEIB 4GAWA 3RXSA 1EKBB 1UVPA 2BQ7B 1K2I1 2SGQE 1PPGE 2OC7A 1C5UA 2FI3E 2BY5X 2V3HH 3IWMA 3RLYH 1P04A 1EZSC 3GCOA 3TJVA 2HNTF 1MTVA 5GDSH 4AN7A 1KLIH 3GISB 1TRMA 1VJ9U 4YLQH 1BZXE 3HATH 4DJZB 4WXIA 2ZO3H 1KXEA 3BSQA 3KGPA 1D3QB 2QXGA 1A0LA 3E0NB 1ZPCA 3KHVA 5DP8A 4Y8YA 5FX6A 1KSNA 3A8CA 3DUXH 1CA0B 1KMHB 2FOAA 2FYRA 5LPFA 1QJ6B 1GHVH 1SFQB 2BY8X 3ZV8A 1GBIA 1DFPA 1FY3A 3TGJE 1BTYA 4ABGA 3ZZCA 1C1RA 2WYGA 2D26C 1P11E 3CS7A 1ZMJA 3BV9B 1AKSB 1T31A 1LQEA 2A5KA 1E34B 3LGIA 2C8XB 1NRRH 3PLKA 5G4BA 4CH2B 1O2NA 3RUOA 2KM0A 2LP6A 3A7VA 3M3TA 3KL6A 3FZZA 2HPQH 2PWXA 1BOQA 2F9UA 2Y6TA 1ZGIA 2BM2A 5KGOA 3RMOH 3ZYDA 1ETRH 5DG6A 2W7UA 2A7JA 4KP0A 2CF8H 2P3FH 1SQTA 5EPNA 5DKMA 4ZMAH 3PM3A 4JZ1A 2ZFTA 3SNDA 3TJNA 5AHGH 2BDAA 1T8LA 3EE7A 1A2CH 2THFB 1IHSH 3BTWE 4GLYA 1C1WH 4ZAEA 1ZMNA 2YMSD 1O3BA 1DY9A 2KCAA 2ZU3A 3SQHE 1TA2A 4X1RU 4CREA 2UWOA 1LPZB 2RG3A 4IW4E 4AFUA 1AQ7A 1E1RD 5HIYA 1P2MA 3LGUA 4B76A 5GWZA 2ODYB 4WMEA 1C5TA 2A4GA 1HBTH 1FX0B 2BDGA 3RC4A 1INCA 1T7CA 4CRBA 1V2WT 3ESTA 1HAZB 4DVAU 1P3EA 3A8AA 1HPGA 1ELVA 3P8NA 1O2HA 4BOHA 1EPTC 4IMQA 3U28C 4Y8XA 3NZIA 4YT7H 1GMDF 3M3VA 3STJA 3TJOA 4YOGA 1L1JA 1MH0A 4I86A 1CBWC 1V3XA 4X8VH 1AVGH 1GGDB 3ODDA 1C5YB 3PWCA 3SZEA 1MKWK 1YPLH 5EODA 5H4IB 2WV5A 3VB7A 4Q7ZA 1SSXA 2ZHWH 3ZVAA 3U1JB 1AHTH 1NPMA 4UE7H 3U98H 2R2WU 6GCHG 1O5GH 3KQ5A 3H7TA 4I33A 1YPKH 3GICB 2PSXA 1Z71A 5FX5A 4BNRA 1H1BA 3RMLH 5DGJA 4K69A 4ASUD 3SJOA 2FP7B 3SJIA 2XC0A 1ABIH 1K1LA 2GCHG 2ZEBA 1P0SH 2J97A 4K5ZA 4A1XA 3ZZ8A 3A7ZA 1TNKA 1RGQA 1A0JA 1GHAG 2GV7A 2ZF0H 4GSOA 3T29A 5FBEA 1IQKA 3PWBA 4MLFB 1TGBA 4JMYA 3BTHE 3AAUA 1XKAC 1JMOH 1FN8A 4MNVA 1TPOA 1FQ3A 3OEED 4CRDA 3PRDA 3F68H 2FMJA 3MH6A 2AGGX 2F9OA 2PW8H 3KEEA 3P17H 1A5HA 3RXVA 4A6LA 2WPJS 2TRMA 1C5ZB 1AD8H 1P2IA 2JIZD 2ZKSA 1C5WB 1AFQC 2SNWA 5EQQA 3NKKA 1DOJA 3RXOA 1V2TT 2Y5FA 4RKJB 4I8LA 1NFYA 4XFQA 3T28A 3MNCA 1NROH 3PYHA 4X8UH 2ZWLH 5AFZH 2FDAA 4JZEH 5GPIB 8GCHG 2FX4A 2GZ8A 2W3KA 3UNQA 1VITF 3M5LA 1ZSJA 5GJ4B 5CHAB 1L1GA 1ZJKA 4ABFA 1J9CH 1MD8A 1C2LA 1Z1IA 2FOFA 3TK9A 3ZZ6A 2ALVA 4DOQA 2QF3A 4XD7D 4VGCB 3ELAH 3AVZA 3V13A 4NFEA 2TGTA 2A45B 1O30A 1THPB 3ZV9A 1TGNA 3EGKH 3GCHB 3E8LA 1O3MA 4X2WA 1FAKH 1KY9A 3P92A 1A7SA 2BDYA 1SLUB 4M7GA 3GY2A 4K2YA 2GKVE 2A5IA 1OHHD 2B0FA 1EXFA 3PMHB 3NWUA 5EQSA 2FZZA 1GJ6A 1LVBA 3VGCC 2EI6A 2J38A 1P09A 3VFEA 1NU7B 3ZVDA 5J4SA 2BMGB 4AYVB 1TX6A 2H5DA 1O33A 1PPCE 4NGAH 1GJ5H 2SGEE 4NWLA 2BXUH 1GJAB 1BTZA 1TPPA 2STAE 3I78A 1S0QA 1FNIA 1FI8A 3TLOA 2VIDA 4JZIA 3K2UA 1C1QA 2J9NA 3F9FA 2A0QB 4ZCNA 1YYY1 1Y3XA 4BXSA 2Y82A 2B5TB 4UD9H 4OM9A 1BBRK 2VIQA 1KXCA 2KAIA 2BQ6B 2O9QA 4FOUC 1YPMH 5AFYH 4UEHH 1AB9B 1L0ZA 3GY5A 3BG4C 1DLEA 4WY3A 3CP7A 1UTLM 1XUJA 4RN6A 5EPYA 1FN6A 3RU4T 4DW2U 1HCGA 3N7DA 3UQVA 9LPRA 4MDSA 2O8WA 1AWHB 4K60A 3S9CA 1C1UH 2QXJA 4FUBA 1TRNA 4X6NA 4Q7XA 3D65E 1AY6H 1HAIH 1IQHA 4IS5A 4OS7A 2XBXA 3DT0H 4FU8A 1YF4A 3S7KB 1M9UA 2SGAA 1C4V2 1QL7A 1W2KH 3L3TA 5EJ1A 2HOBA 1S81A 5T6DA 1SGDE 1AZ8A 3BG8A 4O03A 5JB8S 4Q7YA 2ZHDA 3SV2H 5C94A 1TOCB 2CF9H 2ZPQA 1MTNB 1HXFH 1FAXA 1BMAA 1EP6A 1HYLA 1N6YA 1ZZZA 2BTCE 4B74A 5EW2H 2YMSB 2ILNA 1K21H 1TONA 3S69A 3F9HA 4XOJA 4JYVH 1DPOA 2XWAA 1O3OA 4CRAA 2ZFFH 5AF9H 1ZRKA 1O35A 3A7TA 2BDBA 1WYKA 1BBRE 2Z9JA 2BX4A 2I6QA 3C27B 3KQEA 2P94A 2V6NA 2OC1A 5FCKA 5E2OA 1VKYA 1D6RA 1F5LA 1UTQA 1VGCC 4FUCA 1EAWA 1O39A 3SUGA 3LPRA 5JBCS 4ABDA 3SHCH 2PUQH 3M7TA 1GBJA 2HWLB 2VNTA 1SGFG 1AGJA 1O2WA 1E38B 4Q4LA 2IPQX 1UJ1A 5FPYA 3B9FH 3CNRA 2OINA 1FIWA 1FY5A 3AAVA 4CR9A 3RM2H 1G3CA 1JBUH 1YPJH 1AUJA 3ZYEA 3H5CB 2ZU4A 3E16B 4YO9A 3FOAA 3RC6A 4CBNA 2Z94A 3F1SB 1O31A 1UO6A 4OS5A 3Q00A 1A1RA 1OS8A 3I77A 1SKYE 1T8NA 3F6UH 3UNSA 1D4PB 4FUFA 1GHXH 4NZLA 4Y0YE 1C5PA 1O2XA 2AERH 3LC5A 4D9QA 3UY9A 4KKDA 2PGBB 4B73A 1WTGH 1VCQA 3PO1C 1TNLA 2ZFSA 1IQIA 1O3CA 4UFGH 1N1LA 5GCHF 2AMDA 4IMZA 3U69H 1EZQA 3K9XB 3LJOA 4X1NU 3W1EA 4OS6A 2Z3CA 1SFIA 1NM6A 1GI9B 3PMAB 4Y7AA 1GI2A 1PPHE 1F92A 1MCVA 2QXHA 1WQVH 3SGAE 4MQAA 2W7SA 2ZPSA 4Q80A 2ULLA 4RSPA 1QQUA 1G30B 3TVJB 2TGDA 1MABB 1GBBA 1SB1H 2A7CA 1AE8H 2HPPH 4NIXA 1A3EH 2ZCLP 1C5SA 1UVTH 4CHAB 3EE0B 1AVWA 1UK4A 4ESTE 1TGSZ 1QB1A 2BLVA 3BTFE 1DDJA 3DFJA 4LZ4B 3T26A 1V2LT 1KIGH 4X2XA 1HJAB 2O8MA 3VB5A 1FY4A 2Q6GA 3DFLA 4HTCH 2BB4A 1W8BH 2GMTC 2Q6DA 1K22H 2BY6X 1EJNA 5HYOA 1ARCA 4WH8A 1FUJA 1O38A 1BTUA 2ZTZA 3UB0A 1DWDH 5C3NA 2A31A 1QRZA 4MTBA 1ESAA 3GCNA 1BIOA 4AG1A 5J4QA 4MNWA 1OOKB 3E1XB 4XDEA 2Z9LA 3BTME 4CH8B 1HIAA 1PQAA 1V2OT 5T1VA 1DWCH 3M5OA 2PV9B 5DO4H 1UVOA 1QNJA 4TWWA 3SNCA 3P8OA 1O32A 4FVDA 4JYUH 5A8XA 3ZVCA 5GNDA 2BVRH 2XNIA 4GCHF 4ISNA 6CHAC 3KYGA 1F0TA 4BAKB 1QJ7B 2FI4E 2V35A 3TK5A 3SW2B 4Y6DA 3BTGE 3BTTE 5EGMA 3I29A 4ZHMU 3SV8A 3GYLB 2GZ9A 2EA3A 4F48B 3MWIU 1LDTT 1B0FA 3RXAA 2FOMB 4NA8A 2KCPA 1COWD 1A3BH 1CVWH 1EB1H 4KTCA 2QC2A 4B6EA 4X1QU 2ZU1A 3DD2H 4FXGH 2F9PA 5C1XA 1FMGA 2ZECA 3EA9A 2BLWA 2OC8A 1NT1A 2J2UA 1WQSA 2XRCA 2ZPRA 4D7GA 5FPSA 1J14A 1EZXC 1EASA 2SGPE 2VU8E 1RIWC 4FUIA 1S6LA 2H6MA 1OKXA 2G5NA 1BBRH 2V7QD 2PLXA 2A32A 2ZU5A 3SU4A 1ELDE 1BCUH 1JXPA 1UTKA 3RXFA 1L4DA 1PPEE 2JH0D 4NA9H 1W3CA 2XW9A 3SU2A 2IJD1 1HXEH 5GXPA 3QX5H 5TCAA 2CHAB 2P8OC 1JWTA 3HK3B 2OP9A 3T2NA 1SLVB 1SHHB 1ELCA 2C8YB 2VGCC 1SR5C 5ESTE 3F0OA 3SYJA 4HZHA 5FAHA 7GCHG 1S5SA 1W12U 1Z1JA 1GDNA 4UFFH 1O2LA 3G01A 1Y3WA 4RT0A 3R0FA 3W94A 3RXQA 4Q2KA 2C8ZB 3LIWA 1KXAA 1T32A 3L33A 4IC6A 2TGPZ 5TJXA 3U8RH 1W10U 3UOPA 2RA3A 4ACAA 2FOEA 2BY7X 2FLBH 4MG3A 1TE0A 1TBZH 1TGCA 1RFNA 1YPEH 4TSFD 1LVOA 1L2EA 4ZKSU 1S6HA 1EPTA 1MBQA 1DWBH 1OP8A 2ANWA 1PFXC 1GMCG 1GI7B 1LKAA 4CRFA 1HB0B 2RDEA 2BQWB 1RTKA 1ELBA 1NS3A 4IC5A 2GCTC 4BAOB 1K1OA 1UK2A 2R2MB 2AEIH 2EC9H 3QZRA 3PV4A 2FTLE 1WAYB 1N8OB 2PKAA 1IQGA 1C1SA 3GYMA 4YM9A 1FDPA 1Y8TA 2AIPA 1H8DH 1MQ6A 1GHBG 3GCTF 1KXFA 3FP8E 1FZZA 1RTFB 1BMLA 1OWDA 1MCTA 3UPEA 3BEFB 3SZNA 2BD2A 3RXKA 3STIA 5JBAS 2ODPA 5LPEA 1GMHF 3V0XA 4DG4A 4SGAE 2ZHFH 3QUMP 2F3CE 3M5NA 1YY3A 1GBCA 1PYTC 3AASA 5FCRA 1F7ZA 2GJGA 3L6PA 2Z3DA 1A61H 3SU1A 2J98A 1J16A 3IITA 5C5OA 1W7GH 2JH6D 3F2GA 2AFQB 2M2AA 1C2EA 1H8ED 1HAVA 1Y59T 4ZHAA 1Z8RA 2BD9A 2Z9GA 1F2SE 4R8TB 3RXPA 4H4FA 1BRUP 3OAAD 2HVYB 3P8GA 2B9LA 2GV6A 2NU4E 4IN2A 1LVMA 5T3HA 3SJ9A 1V2MT 3ZVGA 4FVBA 1HAOH 1SBWA 4Y11E 2ZNKH 3UR6A 4U30A 2KFWA 1SQOA 1MZAA 3A87A 3OTJE 2HVXA 1YLCA 5HXFA 5L6NH 1LHCH 1O3FA 4BAQB 1P9UA 1SLWB 4E05H 1YCPK 1WXRA 3Q77A 1UTPA 2J5UA 1F0UA 2BDCA 3RXGA 5SGAE 1HAGE 1E1QD 1C5NH 2BLOA 1IQLA 1YPHC 2OCVB 2G51A 3LGVA 4Y76A 4A1VA 4Z0KA 1ZPBA 1FY1A 3FN8A 1EB2A 1CA0C 2SGFE 3KQCA 3TH3H 4H42U 2VIOA 2VWOA 3GDUA 1LHFH 3EQ0H 1THRH 3NRLA 1A5GH 1HFDA 3QN7A 1NRPH 2ZP0H 2VVUA 2WUCA 2BX3A 4WXVA 2CMYA 1T4UH 3OY6U 2J95A 3SU0A 3GS9A 1F5KU 3SNAA 1HDTH 4I8GA 4CBOA 2GDDA 3JZ2B 5L2YH 3NK8A 3P6ZB 1P2KA 2GP9B 3TK6A 4FETA 1G2LA 1NC6A 4ISOA 3A8BA 2FXRA 1DUAA 1GI3A 2QIQA 2BDHA 3UAIC 2HLCA 1NU9A 3ATMA 1O2VA 5TCCA 1BMFD 2G4UA 4AFSA 4DT4A 2JETB 5CE1A 4B2AA 1D3DB 4X2VA 3SGBE 2VWNA 1GJDB 2XBWA 2GGVB 3BTKE 2CK3D 2AMPA 2Z3EA 2F9VA 2VWMA 1BTHH 2ZGCA 3PLBA 1CE5A 1QBVH 1QTFA 3K6ZA 4NSYA 1C2FA 2NU2E 2ZDVH 3LH3A 3AW0A 3PB1E 1TX8A 1O2GH 3SJ8A 3KQDA 1QBOA 2FM2A 1RD3B 1JRSA 1TNIA 1XMNB 1J17T 1O37A 3A80A 1YM0A 1PPZA 4NG9H 4X1SU 3SI3H 3T27A 3TNSA 4K1SA 1O2OA 2WPMS 5PTPA 4A92A 1OP0A 3FP6E 2V0BA 2VH0A 2IN2A 3MH7A 1TB6H 1WUNH 1GJ8B 1TNJA 2IJOB 1O5CB 4IBLH 5F8XA 2Q1JA 2HNTC 1LO6A 1S83A 5FPTA 3VB6A 2PUXB 1WU1A 2WPIS 1QCPA 3M35A 3DSOA 2R9PA 3N99A 3DHKH 2ZGHA 2ZDMA 1P2OA 1AMHA 1U6QA 1GGDC 2D8WA 2EI7A 8ESTE 1TBRH 1CU1A 1KTSB 5EIYA 2ALPA 1TNHA 4NA7A 1O5BB 2QF0A 2O8LA 1GCTB 3QWCH 1C5LH 2C90B 4TY7A 1XKBC 2VIVA 1L1NA 2W5EA 1AZZA 3MNBA 1NZQH 1CQQA 2UUJB 3SOSA 3T5FH 3ZZBA 2DE8A 4E7NA 4GHTA 3U9AH 2UWLA 4ZH8A 3SU5A 1SGPE 5C20A 1O2ZA 1TQ7B 3OX7U 3RLWH 1S85A 2KR7A 5JB9S 1BB0B 1SI5H 3FP7E 2G81E 1O2IA 4LXBH 3WW7A 1P03A 1SQRA 4AGJA 3ATIA 3UQOA 1TALA 1O34A 2H2ZA 2YNAA 2Z9IA 5JBTA 3HKJB 2R3YA 3ZIAD 1S84A 4M9FA 1BTWA 1OXGA 4THNH 1C5QA 3O8CA 3ATLA 3ZVBA 3OYPA 1QR3E 2ZCKP 2GZ7A 1MTUA 1LMWB 1QY6A 5E0JA 2FTMA 1NFWA 4BAMB 4KGAA 2QN5T 2HALA 1G3EA 1K28D 3F3BA 3TPIZ 3U8TH 3UOUA 3MO9A 3LJJA 3M36A 1VCWA 1AFEH 3ZZ3A 1KTTB 1W0KD 4YZUA 3RU4E 1O2SA 2PKSC 5T6FA 5CHAC 3VXFH 3RU4D 3HGPA 1HNEE 1C1MA 1ZGVA 3PTNA 3OU0A 1KLTA 1GJ7B 1P8VC 4ZXXH 1BT7A 2H9TH 1P2JA 3U8OH 4VGCC 1TPAE 1MTWA 2XC5A 1CHOG 1HAYB 2WSSD 3GCHC 4INHA 1PQ7A 3SQEE 3UTUH 1C1TA 1GBHA 1MKXH 2PSYA 2VVVA 2V3MA 1FPHH 3RDZA 3SV7A 4D7FA 1LVYA 1O2UA 2PTNA 4O3TA 3LGTA 3BIUH 2QV1A 5AVDA 5CMXH 2BDIA 4YESB 1QRWA 1V2JT 3LT3A 1PYTD 1IOEA 3MU1A 2QF5A 2WPKS 1E79D 2KAIB 2ODQA 3KYFA 4R0IA 3MO3A 2OBOA 3A7XA 1UW7A 1LKBA 3Q3KA 1D6WA 5LH8A 5EW1H 1BRCE 1ZSKA 1SG8B 4WF8A 4DY7B 1OYQA 1YCPH 1FPCH 1XVMA 5C2ZA 2FYQA 1GG6B 1ELAA 3WWBA 4RKOB 3RXTA 1O3PB 4FUHA 3TH2H 1AB9C 1J8AA 3MI4A 1OWIA 1BITA 2K0QA 1B7XB 3PV5A 4MPWA 2PR3A 3MU8A 2J34A 1SGTA 2GDEH 1WSSH 1GBLA 2ZG0H 4JZFH 3PMJA 2OQUA 4WJG2 1NN6A 1Z6EA 8KME2 4X6PA 2QGRA 4XSKU 2YNBA 3SUFA 1SOZA 4OGXA 1YLNA 2FOHA 1YPHE 4YXWD 1HAXB 3D23A 4X0WU 1OWHA 1Y5UT 1NTPA 2K8IA 3SO3A 2VVCA 4X6OA 1P9SA 4INKA 5E8EH 6GCHF 1Y3UA 1A5IA 1GL1A 2HLDD 1BTXA 1O2YA 1BTPA 2B7DH 3ODFA 3HK6B 2M5TA 1O2PA 2ANKH 1UTJA 2G52A 1SGNE 2JDID 5ABWA 3OEHD 1Z6JH 2A4QA 4DCDA 1V6DA 1MTNC 7KMEH 2ZC9H 2GCHF 2DE9A 3PTBA 4E7RG 5E2PA 4O3UA 3UWJH 1AI8H 5L30H 2ZDAH 1V2VT 1GHAF 2YMSC 1ZMLA 3MH4A 4MPVA 4ISIH 1H9LB 1AWFH 4YOJA 1FLEE 2EY4C 4ISHH 2ANMH 1QBNA 1ZHRA 1QGFA 1K9OE 3ZZ7A 1DANH 3O8BA 4YTAA 1GI5A 3SU3A 2Y5GA 2FOGA 4B1TA 3QTOH 1UK3A 3WY8A 3SV6A 1NO9H 2ANYA 2VWLA 2AHME 1GI0A 4I32A 7LPRA 1GI1A 3W95A 2XOKD 1TRYA 2GT8A 1DWEH 3B23B 2VIPA 1O3EA 3SGQE 1E36B 2G4TA 1V2KT 3U1IB 1P3CA 1P10A 1O2RA 1VJAU 3OSYA 2H5CA 1YPGH 1UHBA 5HGGA 2IOTA 1VCPA 1OX1A 4H6SB 5E0HA 2ZTYA 1SOTA 2ZFRH 1KLJH 2ZQ2A 4MPXA 4B2CA 1ZJDA 4I31A 3GDSA 4B71A 3LC3A 2J4IA 2VJ1A 4U01A 4ZKNU 5DP9A 1Q3XA 2C8WB 1DITH 1CO7E 3URCA 2GD4B 3ZVFA 4MNYA 1GHWH 4FUEA 2A4RA 2OD3B 1W0JD 2FX6A 5DP5A 2W6JD 2L6OA 1TIOA 4RI0A 1AO5A 1OPHB 4O9VA 1TNGA 4D9RA 1QL9A 5T6GA 4F4OC 3A82A 3O8DA 2Y5HA 4LK4A 2ZTXA 3LONA 3UUZA 2QYIA 4CR5A 3CENA 4K1TA 1TAWA 1SGIB 3SHAH 4MPUA 1GMDG 2B8OH 1G9IE 4AC9A 1C2DA 1GHYH 2EI8A 1SL3A 1BRBE 3FFGA 3PROA 1C4Y2 1YLDA 1H8IH 4H6TA 5DPAA 4ZUHA 1IAUA 2ZFPH 1T8OA 1ETTH 1RTLA 2O8TA 3RXDA 5C0TA 1SGCA 2FODA 1K1PA 1B5GH 1W11U 3MNXA 4ASHA 2ZDNA 4F55A 1NFUA 1LHEH 1MAXA 2O8UA 2YOLA 4U32A 1C2HA 1ZRBA 1QA7A 1MBMA 1HUTH 4ABIA 1HJ8A 1P2NA 2TBSA 4MNXA 2GVFA 1WTHD 3BTQE 3SNBA 3AK5A 2SNVA 2AIQA 3QGNB 4NIYA 2BD8A 1O5EH 3GY7A 2PGQB 4CHAC 4Y71A 5IDKA 3P8FA 5C0UA 3AW1A 1AVXA 1O2QA 2A1DB 1HJAC 2LPRA 2JKHA 1A46H 1O3JA 1HIAB 2ZHQH 4WWYA 4Y0ZE 5K7RA 1EUFA 1H9IE 1UVUH 1S82A 1Z7KA 4HG6A 1Y3YA 1H4WA 1P12E 2AGIX 3LKWA 4UONA 8LPRA 3MH5A 2XC4A 1C9PA 3E3TA 3S0NA 2OUAA 1ZTKA 3TH4H 3BN9A 3BEUA 2VBCA 3H7OA 1IQMA 3SORA 3SV9A 4P02A 2GCTB 1JRTA 1QJ1B 3K65B 3S9AA 2A2XH 1G36A 1GBDA 3A85A 1UVSH 2CJIA 3PMBB 1K1NA 1O3DA 1EOLA 1HRTH 3RXEA 2W3IA 1GBMA 2KZ4A 2VINA 2LNCA 4OS4A 1DM4B 1YWUA 4Z1MD 4TT3D 3UFAA 3S7HB 2FIRH 3A8DA 2F83A 1J15A 2RA0A 3T25A 1VITG 1THSH 4I7YH 1BJVA 1TMBH 2ZU2A 3FZDA 1QQ4A 1GVZA 4XBDA 4BANB 4DIIH 2FOCA 1O2KA 3H09A 4KTSA 3ZZ5A 5HKKD 4GVUA 3KIDU 1GDQA 1K0HA 2R3UA 6ESTA 5L2ZH 4GHQA 1O3HA 3Q3YA 1LHGH 5JBBS 1XUFA 1HGTH 2BD4A 3QDZB 1P02A 3D62A 3O8RA 5DP6A 5FHTA 1XXFA 1C1NA 2ZGJA 4AORA 3TGIE 1C5MD 3F9GA 1WDIA 4X8SH 2FO9A 1ZHMA 1UTNA 1QRXA 4FUJA 4X2YA 1C5XB 2W6ID 1V2QT 2XTTB 4FUDA 2C4FH 3MOCA 1ETSH 4X1PU 1KXDA 1JIRA 1QL8A 1NBME 4LZ1H 3MTYA 4K8BA 1GJBB 3SI4H 1OP2A 4K1EA 2CHAC 1NBMD 2ESTE 1LPGB 4TWYA 2ZDKA 1QIXB 1MKXK 1ACBE 2OC0A 1CHGA 3SJKA 2QF4A 4AG2A 3TIUA 3A89A 3DA9B 3ZZ9A 4B75A 2F9NA 2ZI2H 2C93B 3NUMA 2P95A 1QURH 1EPTB 2GTBA 1S6FA 4K3JA 5BRRE 3RXUA 2Q6FA 3PV2A 1E0FD 2ZCHP 3B8JA 1VZQH 2Y7XA 1QHRB 2BHGA 2AGEX 3MU5A 4A7IB 1SHYA 4DURA 4ACBA 2ZZUH 1CBWB 2PKAB 4ZROA 1MZDA 2AYWA 1C5VA 1ANDA 1NFXA 2KCYA 3RXLA 2PHBA 3RC5A 3URDA 1YGCH 2NWNA 4UFEH 3SUEA 1EATA 5F03A 4NZQA 1BRAA 1O3LA 1W7XH 3JZ1B 3TITA 2XBYA 4YT6H 1K1IA 1QFKH 1ELFA 4AX9H 1BQYA 3GY8A 1SGFA 1D3PB 5EJZA 2BYAX 1N8OC 1TYNA 2HRVA 2H9HA 2CXVA 3UREA 1SGQE 4RT1A 1O3NA 2WZQA 1ELEE 1XUKA 5B6LA 2BY9X 2J98B 2P16A 1O3KA 2CGAA 4NSVA 3T62A 1ANCA 1HAVB 1KYNA 4UFDH 3UWIA 1AE5A 1PJPA 3RXRA 1CT0E 2NU0E 3KCGH 2CN0H 1BJUA 1SQAA 2FPZA 1G37A 1QB6A 5EU8A 2Z7FE 4SGBE 2BLQA 1LCYA 2FS9A 1GBEA 4E06H 1AFQB 4Y10E 1ZTLA 1O2TA 4D76A 1XX9A 5E0GA 5JDUB 1UTMA 3TU7H 2G00A 2GX4A 5EXNA 3GY3A 3EA8A 4NFFA 5CHBA 3LDXH 4AGKA 4X6MA 4OS2A 2I6SA 2WPLS 1CT4E 3R3GB 4AYYB 4B6FA 1H8HD 1GJ9B 1EX3A 2PFEA 5ESBA 1AN1E 3IG6B 4B2BA 3VXEH 1BMNH 3C1KA 2Z9KA 3RM0H 3UIRA 5A0CA 1F0SA 2JJ1D 2P3TB 2UUKB 5A2MH 4ABJA 4BTIB 1NY22 1F5RA 1EQ9A 4AOQA 1OYTH 1NESE 1GPZA 1T8MA 2EEKA 1DX5M 3VPKA
chains in the Genus database with same CATH topology
1TPSA 2WV4A 5C1UA 4JYTA 3GY6A 2OBQA 3V7TA 1RRKA 1OSSA 1RXPA 2TIOA 4Y8ZA 1BUIA 3MMGA 9ESTA 5EG4A 3M61U 1O2MA 3VGCB 3NPSA 5B6OA 3A7WA 4FU7A 1WOFA 2NU3E 2AMQA 1V2NT 3TNTA 5DP7A 1VR1H 1XUHA 2K1QA 4NWKA 4MVNA 5GCHG 4JZDH 3KF2A 4WVPE 1Z8JB 2JETC 3MYWA 1GL0E 1HV7A 1MAYA 3RP2A 1DE7H 3ATWA 2RCEA 1C1OA 1YC0A 2WPHS 7GCHF 1V2PT 2H1UA 2BXTH 1C2GA 2DUCA 1JOUB 2A5AA 5C5NA 5DP4A 4DGJA 2PKSB 1BDAA 2A4OA 4WMFA 1C1VH 1RJXB 3BG4B 1P01A 3RXJA 5DJ7A 4U2WA 1MU6B 3SBKA 1ID5H 2H9EH 1P57B 1NRNH 2VIWA 3ZZAA 1ZHPA 3MU0A 1BHXF 1GHZA 4AB8A 4AZ2B 4BAHB 1ELTA 3LH1A 2UWPA 5HM2A 1C5RA 1EZUC 1GMCF 2BVXH 3UR9A 3ZVEA 3ATKA 3E91A 1MU8B 1PQ8A 1Z8IB 2FI5E 1EP5A 1D3TB 1C9TA 3A83A 2SGDE 1LTOA 1TA6A 3MU4A 1TQ0B 2WINI 3A81A 5A8ZA 5A8YA 1OWEA 4NCYA 1VITH 3FAOA 1GHBF 2PTCE 1GI8B 2ASUB 1GBTA 3TJUA 3SUDA 3A86A 4GCHG 2OXSA 1GI6A 4A1TA 2FLRH 3QO6A 1E37B 4ABHA 1ABJH 1ANBA 1G3DA 1GBAA 1FJSA 1W14U 4XBBA 5HM9A 2OQ5A 4JK6A 4FU9A 2ZQ1A 2QY0B 3VEQB 2STBE 2OTVA 1UMAH 1BMMH 4K8YA 1GVKB 2D2DA 1GBFA 1GCTC 3RMMH 3MO6A 1UCYK 2BD7A 2XXLA 4O97A 3FVFB 5EOKA 3RXCA 3MNSA 4GUXA 1PPFE 1YBWA 1AUTC 5GIBA 3PLPA 2FOBA 1O3IA 1L4ZA 3M3SA 3ITIA 4Z6AH 2ZFQH 3BTEE 1VGCB 4AB9A 1W13U 4IN1A 4Y7BA 2ZGXH 3KNXA 1G3BA 1LQDB 4D8NA 1X7AC 1CA8B 1ESTA 3S9BA 1FXYA 1HLTH 2P59A 2WYJA 1DT2A 5HMAA 3QLPH 1TFXA 3LOXA 1CGHA 1MUEB 2TPIZ 1F0RA 1N6XA 4BTUB 3A84A 1PQ5A 1IQEA 2FESH 2P3UB 1QB9A 4WH6A 4OS1A 1ORFA 1DICA 1WCZA 1KXBA 1Y5BT 1MQ5A 2R0KA 1Y3VA 4KTUA 1OWJA 2XWBI 2Z6BD 1BHXB 1XUGA 3RMNH 3SU6A 1C4U2 2A7HA 3SNEA 1TMUH 2VB0A 1HAHH 3FANA 1EAIA 1NRQH 5IYTA 1JIMA 1YP9A 3M37A 1O36A 4TPYA 1DXWA 2A2QH 3CS0A 3KQBA 4TYDA 4HFPB 1UCYE 2FWWA 3PO1B 1AIXH 1CGJE 2ZDLA 1S0RA 1SVPA 1GCDA 1ARBA 1Q31A 1W0ZU 1CT2E 2FS8A 3ZZDA 2G8TA 2W26A 3GY4A 2BOKA 5F8ZA 1ZTJA 4TPIZ 2BD5A 1WBGB 1V2ST 1LHDH 2F91A 5LGOA 1O2JA 4ZHLU 4QT8C 2BZAA 1LPKB 1QA0A 1TLDA 3A88A 1C1PA 3GCTG 3VB4A 1C2JA 4HI3A 1SLXB 2ZGBH 3N7OA 5FXLA 1ANEA 2ZA5A 4I8JA 3E90B 1GMHG 1FY8E 4GPGA 4JK5A 5A0BA 1XVOA 2G5VA 4AFZA 4NIWA 3HPTB 1MMJN 1MTSA 2GMTB 2ZHEH 1MKWH 2CV3A 2UUFB 3HKIB 1K1MA 2XCNA 4I8HA 2XCFA 2UUYA 1TBQH 1TWXB 1V2RT 2QXIA 3EYDA 5DK1A 1GG6C 1GDUA 1C5OH 3EA7A 4XBCA 3QZQA 1GBKA 1ELGA 1NRSH 2BD3A 4ZKOU 1O0DH 1O5DH 3LGWA 1C2IA 5DP3A 1ZYOA 4ABBA 4F49A 5EXMA 1DXPA 3ENSB 1C2MA 1XUIA 7ESTE 6CHAB 8GCHF 3E0PB 3QGJA 3RXMA 4NIVA 3V12A 1P2QA 3LU9B 1SGYE 5LPRA 3E6PH 2XBVA 1P05A 1HJ9A 1IQJA 2D1JA 3P70B 2AS9A 4ISLA 2J92A 3GDVA 4ZXYH 1TX7A 4J2YB 3BTDE 4Y79A 1SGEE 4J1YA 1C2KA 2HNTE 1O3AA 1OWKA 3NXPA 3KN2A 5EXLA 1FONA 1A0HB 1TABE 2SFAA 5I25A 4BXWA 1DY8A 1ESBA 1PPBH 3MFJA 4UDWH 1KDQA 5I46H 1GJCB 1RIWB 5A0AE 2TGAA 5C67A 3RXHA 1P06A 5F8TA 1SPJA 2QAAA 1TOMH 3A7YA 2IPHA 3LGYA 1K1JA 1RS0A 2P93A 4ABEA 1D9IA 4LOYH 5JPMH 1YKTA 1E35B 1YCPM 1UHBB 2F9BH 3P95A 3HGNA 3M7QA 5BPEA 2R0LA 4OGYA 1TGTA 2BVSH 2AH4X 2G55A 4AFQA 2P8OB 2J94A 3Q76A 2NU1E 1WV7H 2ZIQH 1BA8B 1EJAA 1O5AB 1ZOMA 3RXBA 4ZKRU 1ZSLA 2OLGA 2VGCB 2QA9E 4TY6A 5A09A 1H9HE 1G2MA 2VH6A 3OY5U 4A5TS 2Y80A 1IQNA 1MD7A 5C1YA 1V2UT 1O3GA 4WMDA 3MHWU 1CSOE 1XXDA 3EDXB 4X8TH 3VB3A 4BTTB 4DT7B 1KDQB 1O5FH 1DVAH 1GVLA 4YLUA 1DSUA 3QK1A 1DS2E 1A4WH 1T4VH 1CHOF 3K6YA 1UTOA 3GOVB 2HGTH 1GI4A 4DIHH 5FBIA 4JCNA 2RDLA 4XE4A 2WUBA 1DSTA 1FV9A 5EQRA 1UCYH 3BF6H 1B0EA 3ZZ4A 1Q2WA 3BIVH 1CGIE 3UNRA 1Z8GA 2Y81A 1IQFA 1XM1A 4INLA 6LPRA 1AU8A 3TGKE 3QTVH 4IGDA 1G32B 3D49H 1EOJA 1FIZA 1Y5AT 2QCYA 5ETXA 3RXIA 2BZ6H 1GWAA 2V3OH 2JH5D 2Y7ZA 1ZPZA 4KELA 1EJMA 1DUEA 3SN8A 1EAXA 1GJ4H 2C3SA 3V3MA 1EAUA 4PROA 3EAJA 1ZR0A 3Q3XA 1SMFE 4ABAA 5JYIA 1SC8U 3M7UA 2BOHB 4HGCA 3NCLA 4YOIA 2XYAA 1W0YH 5F6MA 1IHTH 4CRGA 1SGRE 2GT7A 4FUGA 1DLKB 3M5MA 1TMTH 1AKSA 2FEQH 4CRCA 3F9EA 4I8KA 1ZLRA 1HAPH 5K0HA 3BEIB 4GAWA 3RXSA 1EKBB 1UVPA 2BQ7B 1K2I1 2SGQE 1PPGE 2OC7A 1C5UA 2FI3E 2BY5X 2V3HH 3IWMA 3RLYH 1P04A 1EZSC 3GCOA 3TJVA 2HNTF 1MTVA 5GDSH 4AN7A 1KLIH 3GISB 1TRMA 1VJ9U 4YLQH 1BZXE 3HATH 4DJZB 4WXIA 2ZO3H 1KXEA 3BSQA 3KGPA 1D3QB 2QXGA 1A0LA 3E0NB 1ZPCA 3KHVA 5DP8A 4Y8YA 5FX6A 1KSNA 3A8CA 3DUXH 1CA0B 2FOAA 2FYRA 5LPFA 1QJ6B 1GHVH 1SFQB 2BY8X 3ZV8A 1GBIA 1DFPA 1FY3A 3TGJE 1BTYA 4ABGA 3ZZCA 1C1RA 2WYGA 2D26C 1P11E 3CS7A 1ZMJA 3BV9B 1AKSB 1T31A 1LQEA 2A5KA 1E34B 3LGIA 2C8XB 1NRRH 3PLKA 5G4BA 4CH2B 1O2NA 3RUOA 3A7VA 3M3TA 3KL6A 3FZZA 2HPQH 2PWXA 1BOQA 2F9UA 2Y6TA 1ZGIA 2BM2A 3RMOH 3ZYDA 1ETRH 5DG6A 2W7UA 2A7JA 4KP0A 2CF8H 2P3FH 1SQTA 5EPNA 5DKMA 4ZMAH 3PM3A 4JZ1A 2ZFTA 3SNDA 3TJNA 5AHGH 2BDAA 1T8LA 1A2CH 2THFB 1IHSH 3BTWE 4GLYA 1C1WH 4ZAEA 1ZMNA 1O3BA 1DY9A 2ZU3A 3SQHE 1TA2A 4X1RU 4CREA 2UWOA 1LPZB 2RG3A 4IW4E 4AFUA 1AQ7A 1P2MA 3LGUA 4B76A 5GWZA 2ODYB 4WMEA 1C5TA 2A4GA 1HBTH 2BDGA 3RC4A 1INCA 1T7CA 4CRBA 1V2WT 3ESTA 1HAZB 4DVAU 1P3EA 3A8AA 1HPGA 1ELVA 3P8NA 1O2HA 4BOHA 1EPTC 4IMQA 4Y8XA 3NZIA 4YT7H 1GMDF 3M3VA 3STJA 3TJOA 4YOGA 1L1JA 1MH0A 1CBWC 1V3XA 4X8VH 1AVGH 1GGDB 3ODDA 1C5YB 3PWCA 1MKWK 1YPLH 5EODA 5H4IB 2WV5A 3VB7A 4Q7ZA 1SSXA 2ZHWH 3ZVAA 3U1JB 1AHTH 1NPMA 4UE7H 3U98H 2R2WU 6GCHG 1O5GH 3H7TA 4I33A 1YPKH 3GICB 2PSXA 1Z71A 5FX5A 4BNRA 1H1BA 3RMLH 5DGJA 4K69A 3SJOA 2FP7B 3SJIA 2XC0A 1ABIH 1K1LA 2GCHG 2ZEBA 1P0SH 4K5ZA 4A1XA 3ZZ8A 3A7ZA 1TNKA 1RGQA 1A0JA 1GHAG 2GV7A 2ZF0H 4GSOA 3T29A 5FBEA 1IQKA 3PWBA 4MLFB 1TGBA 4JMYA 3BTHE 3AAUA 1XKAC 1JMOH 1FN8A 4MNVA 1TPOA 1FQ3A 4CRDA 3F68H 2FMJA 3MH6A 2AGGX 2F9OA 2PW8H 3KEEA 3P17H 1A5HA 3RXVA 4A6LA 2WPJS 2TRMA 1C5ZB 1AD8H 1P2IA 2ZKSA 1C5WB 1AFQC 2SNWA 5EQQA 3NKKA 1DOJA 3RXOA 1V2TT 2Y5FA 4RKJB 4I8LA 1NFYA 4XFQA 3T28A 3MNCA 1NROH 3PYHA 4X8UH 2ZWLH 5AFZH 2FDAA 4JZEH 5GPIB 8GCHG 2FX4A 2GZ8A 2W3KA 3UNQA 1VITF 3M5LA 1ZSJA 5GJ4B 5CHAB 1L1GA 1ZJKA 4ABFA 1J9CH 1MD8A 1C2LA 1Z1IA 2FOFA 3TK9A 3ZZ6A 2ALVA 4DOQA 2QF3A 4VGCB 3ELAH 3AVZA 3V13A 4NFEA 2TGTA 2A45B 1O30A 1THPB 3ZV9A 1TGNA 3EGKH 3GCHB 3E8LA 1O3MA 4X2WA 1FAKH 1KY9A 3P92A 1A7SA 2BDYA 1SLUB 4M7GA 3GY2A 4K2YA 2GKVE 2A5IA 2B0FA 1EXFA 3PMHB 3NWUA 5EQSA 2FZZA 1GJ6A 1LVBA 3VGCC 2EI6A 2J38A 1P09A 3VFEA 1NU7B 3ZVDA 5J4SA 2BMGB 4AYVB 1TX6A 2H5DA 1O33A 1PPCE 4NGAH 1GJ5H 2SGEE 4NWLA 2BXUH 1GJAB 1BTZA 1TPPA 2STAE 3I78A 1S0QA 1FNIA 1FI8A 3TLOA 2VIDA 4JZIA 3K2UA 1C1QA 2J9NA 3F9FA 2A0QB 1YYY1 1Y3XA 4BXSA 2Y82A 2B5TB 4UD9H 1BBRK 2VIQA 1KXCA 2KAIA 2BQ6B 2O9QA 1YPMH 5AFYH 4UEHH 1AB9B 1L0ZA 3GY5A 3BG4C 1DLEA 4WY3A 3CP7A 1UTLM 1XUJA 4RN6A 5EPYA 1FN6A 3RU4T 4DW2U 1HCGA 3UQVA 9LPRA 4MDSA 2O8WA 1AWHB 4K60A 3S9CA 1C1UH 2QXJA 4FUBA 1TRNA 4X6NA 4Q7XA 3D65E 1AY6H 1HAIH 1IQHA 4IS5A 4OS7A 2XBXA 3DT0H 4FU8A 1YF4A 3S7KB 1M9UA 2SGAA 1C4V2 1QL7A 1W2KH 3L3TA 2HOBA 1S81A 5T6DA 1SGDE 1AZ8A 3BG8A 4O03A 5JB8S 4Q7YA 2ZHDA 3SV2H 1TOCB 2CF9H 2ZPQA 1MTNB 1HXFH 1FAXA 1BMAA 1EP6A 1HYLA 1N6YA 1ZZZA 2BTCE 4B74A 5EW2H 2ILNA 1K21H 1TONA 3S69A 3F9HA 4XOJA 4JYVH 1DPOA 2XWAA 1O3OA 4CRAA 2ZFFH 5AF9H 1ZRKA 1O35A 3A7TA 2BDBA 1WYKA 1BBRE 2Z9JA 2BX4A 2I6QA 3C27B 3KQEA 2P94A 2V6NA 2OC1A 5FCKA 5E2OA 1D6RA 1F5LA 1UTQA 1VGCC 4FUCA 1EAWA 1O39A 3SUGA 3LPRA 5JBCS 4ABDA 3SHCH 2PUQH 3M7TA 1GBJA 2HWLB 2VNTA 1SGFG 1AGJA 1O2WA 1E38B 1UJ1A 5FPYA 3B9FH 2OINA 1FIWA 1FY5A 3AAVA 4CR9A 3RM2H 1G3CA 1JBUH 1YPJH 1AUJA 3ZYEA 3H5CB 2ZU4A 3E16B 4YO9A 3RC6A 4CBNA 2Z94A 3F1SB 1O31A 1UO6A 4OS5A 3Q00A 1A1RA 1OS8A 3I77A 1T8NA 3F6UH 3UNSA 1D4PB 4FUFA 1GHXH 4NZLA 4Y0YE 1C5PA 1O2XA 2AERH 3LC5A 4D9QA 3UY9A 4KKDA 2PGBB 4B73A 1WTGH 1VCQA 3PO1C 1TNLA 2ZFSA 1IQIA 1O3CA 4UFGH 1N1LA 5GCHF 2AMDA 4IMZA 3U69H 1EZQA 3K9XB 3LJOA 4X1NU 4OS6A 2Z3CA 1SFIA 1NM6A 1GI9B 3PMAB 4Y7AA 1GI2A 1PPHE 1F92A 1MCVA 2QXHA 1WQVH 3SGAE 4MQAA 2W7SA 2ZPSA 4Q80A 2ULLA 4RSPA 1QQUA 1G30B 3TVJB 2TGDA 1GBBA 1SB1H 2A7CA 1AE8H 2HPPH 4NIXA 1A3EH 2ZCLP 1C5SA 1UVTH 4CHAB 3EE0B 1AVWA 1UK4A 4ESTE 1TGSZ 1QB1A 2BLVA 3BTFE 1DDJA 3DFJA 4LZ4B 3T26A 1V2LT 1KIGH 4X2XA 1HJAB 2O8MA 3VB5A 1FY4A 2Q6GA 3DFLA 4HTCH 2BB4A 1W8BH 2GMTC 2Q6DA 1K22H 2BY6X 1EJNA 5HYOA 1ARCA 4WH8A 1FUJA 1O38A 1BTUA 2ZTZA 1DWDH 5C3NA 2A31A 1QRZA 4MTBA 1ESAA 3GCNA 1BIOA 4AG1A 5J4QA 4MNWA 1OOKB 3E1XB