3U1IB

Dengue virus protease covalently bound to a peptide
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
173
structure length
168
Chain Sequence
GGSGVLWDVPSPAELEEGVYRIKQQGIFGKTQVGVGVQKEGVFHTMWHVTRGAVLTHNGKRLEPNWASVKKDLISYGGGWRLSAQWQKGEEVQVIAVEPGKNPKNFQTMPGTFQTTTGEIGAIALDFKPGTSGSPIINREGKVVGLYGNGVVTKNGGYVSGIAQTNAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Serine protease subunit NS2B
publication title Ligand-bound structures of the dengue virus protease reveal the active conformation
pubmed doi rcsb
source organism Dengue virus 3
molecule tags Hydrolase/hydrolase inhibitor
total genus 28
structure length 168
sequence length 173
chains with identical sequence D
ec nomenclature ec 2.1.1.56: mRNA (guanine-N(7)-)-methyltransferase.
pdb deposition date 2011-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00949 Peptidase_S7 Peptidase S7, Flavivirus NS3 serine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3u1iB02
2.40.10.120 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 3u1iB01
2M5TA 1CO7E 2BY5X 3MI4A 1SLWB 1T8OA 2B9LA 3SU6A 2XCFA 2BY7X 2FPZA 3T62A 4YOGA 3DFLA 3GY3A 1NRPH 3SQEE 1PQ7A 2GCTC 1G32B 1AO5A 1QBVH 3VPKA 3D62A 2ZG0H 3PM3A 1EAWA 4Z0KA 3T26A 4CR9A 1BRAA 2GCHG 1ZZZA 2EC9H 2PUQH 1HJAC 3SV2H 1MAYA 1MKWH 2WUCA 1GI3A 1VITG 2J2UA 2C8ZB 3TITA 3SU5A 1FONA 1O31A 1FY4A 1XVMA 1EZQA 4B2CA 1H9LB 3Q76A 1V2WT 3DHKH 1ELGA 2ZP0H 3A89A 3OU0A 2PFEA 1TBRH 3SJOA 3NWUA 1O2HA 1TE0A 3UREA 6CHAB 1G9IE 4NZLA 3RXVA 3LONA 1C4Y2 2R9PA 1GBHA 1FV9A 4Y7AA 4BAMB 1GCTC 5FHTA 2F91A 1V2NT 3OY6U 3U69H 1MZDA 1NROH 3M5NA 1C1PA 3FAOA 4FU8A 1TOMH 1A5GH 2B7DH 3BG4C 3SJ9A 4CRBA 4B74A 2O9QA 1C9TA 3MNBA 5F6MA 3MO9A 5H4IB 1DUAA 1UVSH 1SGIB 3FVFB 1U6QA 3T27A 1UTQA 1A4WH 1V2PT 3MHWU 1NZQH 1AE5A 1GHXH 8GCHG 2QXGA 2GMTC 3DA9B 5F8ZA 1QJ7B 1SGNE 1UCYK 3EDXB 1GHBG 1EOJA 2J95A 3E1XB 3HK3B 4O97A 3M5OA 2ZDNA 4KTUA 1OXGA 3OTJE 2V3HH 1ANDA 1TIOA 3HKIB 3QN7A 2G52A 4GVUA 3PLBA 2R0KA 1GHAF 4Q7XA 7LPRA 2BD2A 2BDGA 1MMJN 2ZFTA 1WU1A 4WXIA 1KIGH 4XFQA 1MQ6A 2ZTXA 1P2KA 2AS9A 1DLEA 1GBLA 4X1RU 3PTBA 2ZWLH 5DP8A 2OQ5A 1EUFA 4JCNA 3SNEA 1UTPA 4XBCA 1HBTH 1PPZA 3S7KB 1O2ZA 1DSUA 3SQHE 2Y82A 2G4UA 3GDVA 4ZROA 1V2RT 4CRGA 5DJ7A 1D6RA 3M61U 3M7QA 3SUDA 1H1BA 5AHGH 1YPLH 3PMJA 5GJ4B 1HAVB 1SHYA 3E16B 1PYTC 3VGCC 1LKAA 4I31A 3V0XA 1MH0A 1LDTT 1V2UT 1CQQA 3M5LA 2WV5A 1IQGA 3A7TA 1TONA 1TBZH 3TK9A 4CHAB 2Q6FA 4DOQA 2VINA 1ACBE 1L2EA 3MWIU 4CH2B 1AIXH 5DP9A 5TCCA 1C4V2 1NFWA 1TMUH 1AQ7A 1CBWC 3BTHE 4FUBA 2SFAA 2ZFSA 1FPHH 1SMFE 3ATWA 1GMHF 1PPBH 3U8OH 3SU2A 2VWMA 3UY9A 1V2LT 3HATH 4MPUA 2VIVA 4TWWA 3TNTA 3SZEA 3A8AA 1Q2WA 9LPRA 1BITA 2FX6A 3S69A 1W3CA 1A0LA 5CHAC 1GI8B 1K1JA 3GISB 4K8BA 3OX7U 1S83A 1GI7B 1KXBA 4B75A 2FOFA 4UD9H 1OS8A 1T31A 2HPPH 3RMMH 4NCYA 3STIA 2G5VA 5C2ZA 2WPJS 1D3DB 2XC0A 4LXBH 5L6NH 1GGDC 1L4ZA 3S9CA 1TAWA 2TIOA 1HGTH 1P11E 1KXEA 2UUYA 1UK3A 4K69A 1CA0C 4NWLA 1W13U 3E3TA 4FUIA 4OGYA 1C5OH 1AGJA 1L0ZA 1UVTH 2VIPA 3CS7A 4X8SH 4TPYA 3EE0B 1AVWA 8LPRA 1TPOA 1BDAA 2NU1E 4DURA 2AERH 1DE7H 2ZGBH 1AWFH 1BJVA 2WPLS 2A4RA 2A45B 2D2DA 3UWIA 3MO6A 1MD7A 1FPCH 1UVOA 4FUFA 2HNTC 4X2YA 4ZHLU 1NU7B 2AEIH 1B0FA 4UONA 1YM0A 4B2AA 1YF4A 4FVDA 3MNCA 1E34B 3K6YA 2IPHA 3KQCA 5E2OA 1HNEE 1EOLA 1GHVH 1Y5UT 1PPCE 1ZPZA 4Y10E 3R0FA 2WYGA 5C5NA 2TGTA 1GHAG 1C2GA 3ZZDA 1E36B 2FOHA 1B0EA 2D8WA 1W7GH 2JH5D 1J9CH 2SGPE 1FY5A 1V2OT 1SGRE 1WCZA 3KF2A 1VZQH 2AGGX 3B9FH 3PMAB 3GY4A 3LGVA 3MH7A 3BEIB 1O5CB 5HGGA 3ZYDA 1O3GA 1D4PB 2ZO3H 2AMDA 2Z9IA 1L1NA 2F9NA 3A84A 3HKJB 3CS0A 3Q3YA 4ABAA 5IYTA 4JMYA 4R8TB 1BBRK 2BVSH 1Y5AT 1LPKB 1XUHA 1RS0A 1O5AB 3SU3A 1IOEA 1KLJH 5FAHA 1O32A 1SQOA 4ZHAA 4YT7H 5JPMH 7KMEH 1QURH 1C5WB 1SPJA 4XE4A 1TABE 4UE7H 2TGPZ 1ANBA 2A5KA 1JBUH 3H5CB 1RIWB 1FNIA 1HAIH 3P92A 1QY6A 2VGCC 1GI0A 3SJKA 1NFXA 2OUAA 2P3TB 2Z7FE 1ZHPA 1F7ZA 5B6OA 1EQ9A 1BUIA 1HV7A 1Y5BT 1A7SA 3KN2A 4PROA 2G55A 1EP5A 1TGSZ 2JETC 1F0SA 4BXSA 3FP8E 1CGIE 3TJNA 1QHRB 1TQ0B 1TYNA 1GMHG 2XWAA 1GBMA 4H6TA 1D9IA 3RM2H 3SU4A 3RXCA 2QY0B 1SOZA 2V35A 1GL0E 4X1QU 4Y0ZE 1QRWA 1O3LA 1JRTA 3Q00A 3ATIA 5C1UA 1ZPBA 3GY5A 5DP7A 1XUJA 1RTKA 1GBTA 1XVOA 2RCEA 1TPSA 2FESH 1MCVA 4TPIZ 3QWCH 1P02A 3F9EA 1BBRE 4RSPA 5LPFA 1K22H 5FCRA 4IMZA 1AUTC 2QN5T 5GNDA 3KCGH 1YPMH 1O37A 3P6ZB 4XBBA 1O3DA 3SI3H 5E0GA 1EKBB 3HGNA 1DOJA 2HNTF 1S82A 1GBDA 1UVPA 4Y11E 3GCTF 1C5LH 1GJ4H 1FJSA 4UFGH 2ZHWH 2WV9A 1OOKB 1IQKA 1GVKB 1QB1A 2ZU1A 2EI6A 1J8AA 1FY1A 1KTTB 1MKWK 4Z6AH 1BHXB 1CHOG 2VIOA 1HXEH 3RXRA 3ZVEA 4I8HA 4AX9H 2SGEE 3GICB 2ZI2H 4ZKNU 1HXFH 2PTCE 2QXJA 4ZHMU 4NZQA 5K7RA 1AWHB 2HALA 2STBE 2EI7A 1NRNH 3SV9A 1VJAU 4K8YA 1GJCB 1PQ5A 1XX9A 2FTMA 2Y5FA 2VVUA 4B6FA 3QTOH 1KDQB 1C1MA 2H5DA 1QR3E 2ODPA 4ISOA 1SGTA 1HDTH 3A80A 3ZZ3A 3LOXA 5FX6A 1TX7A 1QBOA 2OCVB 3ENSB 2BD4A 5A8XA 3OY5U 4JZFH 2PHBA 1ZHMA 1V6DA 3UR6A 2BX4A 1KYNA 3PO1C 1ZMLA 1F5KU 3MYWA 4X8VH 3TJOA 1SFQB 2NU0E 1S81A 4UFFH 5FPSA 7ESTE 1EATA 1BTPA 3ZV8A 3M3SA 1BQYA 1TNLA 1GI5A 1VR1H 4XBDA 3ZZ4A 1DFPA 1QL7A 2J9NA 8ESTE 1QTFA 3SNDA 1P9UA 4LOYH 1AU8A 4KGAA 3FP7E 2ZA5A 2Z9GA 4IN2A 1VCWA 4ESTE 4XDEA 4U30A 1N1LA 5DP3A 4OS7A 3A7XA 2P59A 3EGKH 2UUFB 1OYQA 1ETRH 2XNIA 3TK6A 3GCOA 1ELEE 3UNRA 1QIXB 6CHAC 4BAHB 2ZU3A 4ASHA 4WVPE 3BTTE 1DT2A 3TIUA 3RXPA 5C5OA 2D26C 1WUNH 1KLTA 1TQ7B 3PB1E 2A4GA 3VXFH 2JKHA 5T6GA 1CU1A 3NKKA 3FFGA 4NGAH 2BVXH 3VFEA 4SGBE 1LVBA 5EW2H 1C1OA 1GJDB 1HIAA 1BTHH 4X8UH 1GBCA 2XC5A 2FI3E 1DITH 2XW9A 4K5ZA 1OP8A 4IN1A 4H42U 4NG9H 1UJ1A 1E0FD 1AD8H 1SGFG 1DANH 5GIBA 3GCHC 4ZAEA 3I77A 4NA7A 2XYAA 2DUCA 3LJJA 3GY7A 5DP6A 1EPTA 1P2JA 1ANCA 2B0FA 2WINI 2ZGCA 3V13A 3RDZA 4DGJA 5F8XA 3ZZBA 2AGEX 1VCPA 3SGQE 3RXDA 3SGBE 3VB5A 3F6UH 3MH6A 5L2YH 5EQRA 2RA3A 2NU2E 3B8JA 1C5QA 2BZ6H 1J15A 5IDKA 1Y3WA 1MQ5A 1TNKA 4A1TA 1CHGA 3D49H 1ZMNA 2F4LA 3O8BA 5E8EH 3ZVGA 3GCTG 3RXBA 3QLPH 1V2MT 3ZZ7A 3LT3A 4GLYA 2ZDLA 2LNCA 1WXRA 4IS5A 2Q6DA 1ZR0A 4Y79A 1GDUA 2ZHEH 1FN8A 1O30A 1QB9A 4HGCA 3OSYA 1YPGH 2VB0A 3A7WA 1Q3XA 2F83A 4O3TA 1MTUA 2QF0A 3PYHA 4U32A 2SNWA 2Z3CA 1RFNA 3V3MA 5C1YA 4D7FA 1G3DA 1J14A 5GPIB 3W94A 4JZIA 1Y8TA 1WBGB 1LKBA 2P95A 2BDYA 1MTWA 5LH8A 3C27B 2C8YB 3AW1A 1TRYA 1BTYA 2P8OB 3BTQE 1P05A 2H6MA 2ZCLP 3GY2A 2W7SA 4CHAC 2PUXB 2ESTE 2A5IA 1V2JT 1G2MA 3RU4T 4D9QA 4OS4A 4Q7ZA 1UTOA 1YKTA 1AZ8A 4DIIH 1BTXA 1O3EA 3VEQB 1O3BA 3U98H 2A7HA 3SJIA 4FUCA 2PKAA 1O3AA 2AIQA 3LGIA 3SYJA 3P8OA 1ESTA 4LZ4B 3TH4H 1QNJA 1MTNB 2GVFA 3LKWA 2BY9X 2A4OA 1SGQE 2Y6TA 1PJPA 1EP6A 2FEQH 2J94A 1ZSKA 3M7TA 3SU1A 3SV6A 1O35A 3FZZA 3QGNB 1ELAA 1HYLA 3ODFA 2DE8A 5DGJA 4O3UA 2F9OA 2GD4B 3MU5A 1YPKH 1QJ6B 1P04A 1P2QA 1GG6C 2GV6A 3SZNA 4UFEH 3MO3A 2ASUB 1Z8GA 3P95A 1ESBA 3CENA 1P57B 1HIAB 2BDCA 3RXTA 2QGRA 2CHAC 3RXGA 1SGCA 2FM2A 1IHTH 4YLQH 1ZLRA 1O2WA 3BTME 3LPRA 4YTAA 2FTLE 1EJNA 3MMGA 4YLUA 2BQ7B 1IQEA 2EEKA 1O36A 1ZOMA 1OWJA 4U01A 4Q7YA 1FXYA 1TNGA 1XMNB 1EPTB 2OTVA 3M37A 4WF8A 5AVDA 4CRCA 1A3EH 1TA6A 4AFQA 1MBMA 1K1MA 3A85A 1V2TT 2PGBB 2HLCA 1GMDF 1O5EH 3AASA 1P06A 1B5GH 1UO6A 2ZECA 1C1UH 1AUJA 4GHTA 3PWBA 1D3QB 4AYYB 4CRAA 2Y7XA 3U8TH 1ZSJA 3TVJB 1THPB 1F0TA 4NA8A 4OS6A 1TX6A 1RGQA 3TH2H 1CGHA 4I32A 1LHFH 1XUIA 1MKXH 4ZH8A 1ZJDA 1C5XB 1C2FA 5T6FA 2THFB 1GBAA 4I33A 4HI3A 8KME2 4BAKB 1DWBH 1IQIA 1KLIH 2LPRA 1OWHA 1SR5C 4Y71A 1LPGB 2ZQ2A 1FQ3A 2WHXA 4IW4E 2G81E 4MNYA 1PQAA 2HPQH 5JYIA 3SUGA 4B2BA 4ZKRU 1F5RA 1DX5M 2A31A 2JH0D 1SSXA 2GX4A 1ID5H 4BOHA 1YPEH 1O2YA 3LGWA 3D23A 5B6LA 2TBSA 1OP0A 1A0HB 2Q6GA 5CE1A 2R0LA 3URDA 4JK5A 3M7UA 4ISIH 1XUKA 3L3TA 3S7HB 1UTJA 1A2CH 1XXFA 1O5GH 3EA8A 2A4QA 2QC2A 5JBTA 1FAXA 5C3NA 2F9PA 3MU1A 1NO9H 3QGJA 3WY8A 2PSYA 1H8DH 3SORA 1O2MA 2OC7A 2FIRH 1O0DH 3SHAH 2PKAB 3P8FA 4X2WA 1ARBA 4XSKU 3PROA 1UCYE 2AIPA 4D7GA 1CT0E 1ELFA 3MOCA 1LO6A 4B71A 2A32A 1DWEH 1WQVH 1QL8A 1GL1A 4Y8ZA 1AN1E 1Q31A 4D76A 1OYTH 2Z3DA 1YGCH 1P3CA 2VWNA 5BPEA 1RTLA 1TNIA 4DT7B 2YNAA 5ABWA 4X8TH 3MNXA 1F0UA 1XUFA 2J4IA 3BV9B 2VH0A 2IN2A 2ZC9H 1OWDA 2ALVA 2A7CA 1ELTA 3KHVA 4YESB 3L6PA 1ORFA 2GGVB 4NIVA 2RDLA 3UPEA 1EJMA 1BRCE 1EASA 3T2NA 3MU8A 3RU4D 1GI1A 1S84A 1ABJH 3LH1A 2GZ9A 2YNBA 4OM9A 2RA0A 4I8LA 1EJAA 1O3PB 1NT1A 1EAIA 3AAVA 3A7YA 2OP9A 5F03A 1K9OE 3TJVA 1Z6JH 2CN0H 1HJAB 1D3PB 3SUEA 4INKA 2STAE 1FY8E 1T32A 1HCGA 3PLPA 2ZPQA 4A7IB 3KIDU 3UOPA 1C1TA 1HAGE 4JYUH 1DM4B 1NN6A 3C1KA 2P3UB 3I78A 2WPMS 5FBIA 4K1EA 1OX1A 3RC5A 1P01A 1HUTH 5A0AE 1JXPA 3U8RH 1C5MD 1G36A 1NM6A 3TU7H 2BLOA 3TK5A 1GMDG 1DUEA 1ZJKA 1G37A 1C5NH 1N8OB 1XKBC 2FZZA 5L2ZH 1KXCA 2ZGJA 4Y8YA 1UTLM 4JZDH 1NC6A 3PTNA 3Q3KA 2TGAA 1T4VH 1BCUH 5GWZA 2FMJA 2H9EH 1GJ7B 1AB9B 2BMGB 3TPIZ 1SGFA 1C5RA 2QF3A 1QGFA 2HWLB 1E37B 4M9FA 3DT0H 2AGIX 5HXFA 1O2KA 2Y5HA 2G8TA 3RP2A 1BTWA 1ZPCA 4OS5A 2ZDVH 1C2IA 1E35B 2PW8H 1NESE 2Z3EA 1ZSLA 4E7NA 3A8BA 1LHDH 1KY9A 1LHCH 1ZGVA 1P3EA 3AK5A 2ZQ1A 1UK2A 2ANYA 2ZKSA 1NS3A 1C1NA 5LPEA 3BTKE 1J16A 5T3HA 1YPHE 3RMLH 2C90B 4KELA 3O8RA 3Q77A 3ZVDA 3JZ2B 3QZQA 1JOUB 2A0QB 1Z8JB 1S0RA 1G2LA 1DICA 2PR3A 4OGXA 2GT8A 3IWMA 3UQOA 3RXHA 4AGJA 2W26A 3GCNA 1O33A 3K2UA 5C1XA 1GDQA 2BD7A 3SN8A 4CRDA 3HPTB 4E06H 2ZIQH 2FOAA 5FBEA 5A8ZA 2AMPA 3N7OA 2F9UA 1Z1IA 2EA3A 1WTHD 2SGQE 5EW1H 1SOTA 1BZXE 1AZZA 2VIDA 1A3BH 1G30B 2Z9JA 3AW0A 1ZRBA 2GTBA 2FS9A 2BDAA 2FLRH 3LGTA 2ULLA 2P16A 5EQSA 3KGPA 3ZZ6A 1HB0B 3GY6A 3A82A 4AZ2B 1JIMA 1ZTKA 1TWXB 5AFYH 1BHXF 1YCPK 1WAYB 1TGBA 2OQUA 3VXEH 1HAHH 1YPJH 1TMBH 1KSNA 2BY8X 3BTDE 1CBWB 2WPIS 1B7XB 3KQBA 3OTPA 1P2MA 1JIRA 1QQUA 3MTYA 2FDAA 1C5TA 5EPYA 4M7GA 1TRMA 3H7OA 4MVNA 2Z94A 1QBNA 5T1VA 2VIQA 3SNBA 1WSSH 3CP7A 2B5TB 2A2QH 5DP4A 3RXKA 3E90B 3RXAA 2CF8H 4MQAA 3A8DA 2WYJA 3TH3H 1W2KH 4GHQA 1AE8H 5CHAB 1YP9A 1ETSH 1ZRKA 1JRSA 1DWDH 4JYVH 1S6FA 1C4U2 4DJZB 5FXLA 1C1WH 4AFSA 4WXVA 1KXAA 2ZF0H 3MH4A 3NZIA 5JDUB 4A1VA 1W8BH 3F68H 1ELCA 3E91A 1GJAB 6GCHF 3GYLB 4I8GA 5JBBS 3E0NB 2G00A 1G3BA 1SHHB 1LQEA 2W3IA 2VWLA 4BAQB 1TNJA 3T28A 3SU0A 1SVPA 1GDNA 3DD2H 2G51A 1OSSA 2OLGA 2OBQA 4Y76A 1DSTA 3QDZB 4AYVB 1FIZA 3A7VA 1C5SA 2K1QA 3RC6A 3MFJA 4BXWA 2UUKB 1S5SA 2VVVA 2ODYB 1QCPA 5ESBA 3GOVB 1GHWH 3BIVH 4X2XA 2B8OH 1IQFA 1GWAA 1UVUH 1MTNC 3H09A 1K1PA 2QYIA 5F8TA 1HFDA 2UUJB 2AMQA 1C9PA 4CBNA 2JH6D 3RXMA 2FOEA 4Y0YE 2ZTZA 4H4FA 4Y7BA 5T6DA 1BT7A 2ZHFH 2SNVA 3BTFE 1Y59T 2BQ6B 1LQDB 4K1SA 1KTSB 1AY6H 1Y3UA 3ZVFA 1GMCF 3F1SB 3SNCA 3VB6A 2C8WB 3BG8A 1VCQA 1GI9B 5A2MH 3GDSA 3U9AH 4GSOA 1GPZA 1FIWA 3RU4E 1CT4E 4KTSA 1Z1JA 1K1LA 1O3MA 2Y80A 2GCHF 4E05H 1AKSA 2BM2A 2VH6A 1P03A 3BN9A 2FI4E 2GP9B 2BHGA 2XTTB 2ZFFH 1NU9A 5GCHF 3M36A 3S9BA 4OS2A 4MG3A 5EXNA 2Y7ZA 1TFXA 1OP2A 1EPTC 4WH8A 4X1PU 4B6EA 3O8DA 1GHYH 2FX4A 3SBKA 2R2WU 1GJ5H 3U1IB 3E0PB 2FXRA 2VGCB 4ABFA 1O2QA 4X1NU 2BQWB 4NSYA 3RXLA 3QZRA 4RKJB 4ABBA 4LK4A 1WV7H 1YPHC 2QCYA 3LGUA 1ARCA 2ZU4A 3LC3A 3NPSA 3URCA 1ELDE 3HGPA 3R3GB 1AHTH 5EPNA 1TMTH 2PKSB 3TGJE 2OBOA 3M3VA 5AFZH 1DPOA 3MH5A 1IQJA 1QB6A 1ZGIA 1HAXB 3A87A 4GUXA 5DKMA 1UTNA 1O3CA 2G5NA 3PLKA 1HAZB 2FOGA 2R3YA 1ELBA 4R0IA 4FU7A 1IQMA 1E38B 2A2XH 2BXTH 3ITIA 1O2NA 1ZMJA 1OWKA 4DVAU 3VB7A 4Y6DA 3LH3A 1O2LA 2ZGHA 1BBRH 3FP6E 1H4WA 2PV9B 3SOSA 1C5YB 3GYMA 2O8WA 2BX3A 4D8NA 2CMYA 4J2YB 3RXSA 2ILNA 1AFQB 3ATKA 1ANEA 3JZ1B 1K28D 5EQQA 5K0HA 2WPHS 3SV8A 2TPIZ 3ATMA 3GY8A 3UR9A 1TLDA 5TJXA 4GPGA 6LPRA 1LMWB 1TNHA 1O34A 4YT6H 2ZFRH 4Q80A 1P2OA 2KAIA 1C2JA 2PSXA 1JMOH 1OPHB 1BJUA 4A6LA 1ABIH 2NWNA 5JBCS 5FCKA 2FWWA 4RI0A 1TGTA 1YC0A 3RXIA 1DDJA 7GCHF 1T8MA 3EAJA 1ZTLA 4H6SB 5DO4H 1GI6A 1SBWA 4ZUHA 3NK8A 1S0QA 2OXSA 5DG6A 1D3TB 2GZ7A 3ZZ5A 1O2OA 2HGTH 4AGKA 3S9AA 2A5AA 5FPTA 1W11U 4FUDA 5E0JA 3UFAA 1O38A 4NWKA 1A46H 2XC4A 3UOUA 4MPXA 5ESTE 1O5BB 2C93B 1TX8A 4NSVA 3AVZA 5A8YA 2QXIA 9ESTA 4WWYA 1MBQA 2FLBH 3RUOA 1QQ4A 3ESTA 1HAPH 4YOJA 1QA7A 1SI5H 4IBLH 2SGAA 1AVXA 3E8LA 2ANKH 1VGCB 1CE5A 1NY22 3TLOA 4ZXYH 1K2I1 1AKSB 4VGCB 1GMCG 3PO1B 2XBWA 3RXQA 2BB4A 4CREA 1G3CA 1YCPM 1EB1H 2ZDMA 1WOFA 1RRKA 4YO9A 2BLQA 5C20A 2ZPSA 4BTIB 2UWOA 3LDXH 2BD3A 3BF6H 3H7TA 2QV1A 1EZXC 4BAOB 1F2SE 1LCYA 3A8CA 1FDPA 1BMMH 2QXHA 1QL9A 2BXUH 2R3UA 3ATLA 1A0JA 2J38A 3EA9A 2BDHA 1O3JA 1A5IA 1XKAC 3UWJH 1O3OA 1BRUP 1F5LA 1MZAA 3T25A 3BEFB 1EAXA 3ZZ8A 2HNTE 1HAOH 5GCHG 3FANA 3SHCH 3TGKE 2FYQA 1EZSC 1P2NA 2XBVA 1O3IA 4MLFB 4WY3A 2SGFE 4ABDA 1C2EA 1JWTA 2ZTYA 4IMQA 4YZUA 4F49A 2VNTA 5EGMA 1N8OC 5HM2A 1N6YA 1W12U 3ZVBA 3AAUA 3KQDA 4K2YA 1YLDA 4A1XA 4MNWA 4ABHA 1MCTA 1IQHA 1H8IH 2QA9E 2TRMA 1GBJA 2XWBI 4XOJA 1Y3VA 1G3EA 1AB9C 3RMOH 3P8GA 3NXPA 1MAXA 1TB6H 2BZAA 5A0BA 3LC5A 1BMAA 4HTCH 1O2SA 2OINA 5J4QA 2VJ1A 1IQNA 2O8UA 4HZHA 3GCHB 3SUFA 2XXLA 4AN7A 3P17H 1FZZA 1RD3B 2O8MA 4AOQA 2D1JA 2AFQB 2H5CA 1ESAA 2P93A 4X6OA 1SGDE 1DVAH 1NRRH 1HLTH 2BDBA 2KAIB 3DFJA 4F4OC 4NIYA 1Z71A 3QO6A 5EXLA 2FI5E 3NCLA 3STJA 2ZFPH 2I6SA 3SGAE 1O5FH 3SI4H 1AMHA 4AB8A 1RIWC 1O2UA 1KXDA 5A0CA 1S6HA 1W7XH 2O8LA 2ZCKP 2ZU5A 3BIUH 1Y3YA 4MDSA 2XRCA 4IGDA 1CSOE 1XM1A 1TALA 4RN6A 1Z7KA 2ZCHP 5LPRA 1INCA 1C5ZB 3F9GA 7GCHG 1FLEE 1QFKH 2V6NA 2XCNA 1H9HE 1T8NA 4TYDA 4BANB 1OWIA 3UTUH 2SGDE 1W10U 2BLWA 2VVCA 5FPYA 1O2TA 1GBIA 1FY3A 1WQSA 4A5TS 3BTEE 2F9BH 3SO3A 4BTUB 4DIHH 1XUGA 1EB2A 2ZFQH 4BNRA 2ALPA 1FUJA 5I25A 1OWEA 2J92A 4AG2A 3KQEA 1BIOA 1GVLA 3SJ8A 1C2LA 4ZKOU 2GKVE 4FUEA 4NIXA 2C8XB 3IITA 5AF9H 2BDIA 1L4DA 2BOHB 2Z9KA 1SQTA 2UWLA 1PQ8A 5L30H 1O3FA 1V2VT 3A83A 3TGIE 2F9VA 4ABIA 2GCTB 4NIWA 1QA0A 3PV2A 1DXPA 4FU9A 2ZNKH 2BD5A 3ZYEA 5EG4A 1TPAE 1P09A 1C1RA 3D65E 3V7TA 2H2ZA 2AH4X 1VJ9U 1GJBB 1QJ1B 4AORA 3F9HA 1L1GA 1HJ8A 1A1RA 2GDDA 4ISNA 1Y3XA 3UIRA 4WMDA 4WMEA 2DE9A 4DY7B 2V0BA 1GG6B 3EYDA 4QT8C 2QIQA 1UK4A 3LGYA 2UWPA 1M9UA 2PTNA 1O2IA 4TWYA 1X7AC 4NFEA 1P0SH 3UUZA 4I8KA 3P70B 1BMLA 1UMAH 2FOCA 4AB9A 1XXDA 2CHAB 4WMFA 1BOQA 1NPMA 2FOMB 1AFEH 4FXGH 2I6QA 4ISHH 1GCTB 1NRSH 3DUXH 3OYPA 2PWXA 3G01A 1CHOF 2FP7B 1UHBA 1ELVA 1P12E 4ABGA 1C5PA 1O2XA 3ELAH 4B73A 4ZMAH 2CF9H 3W95A 3BG4B 1DY9A 4INLA 1HPGA 3EQ0H 2FODA 6ESTA 1IQLA 1KXFA 1BTZA 2HRVA 1V2KT 4TY6A 3ZZ9A 5CMXH 2ODQA 5PTPA 2W7UA 1T8LA 3K9XB 1T7CA 1P10A 2GMTB 1PPEE 2ZHDA 3RXUA 1W0YH 1PPGE 1DWCH 2HOBA 1PYTD 1AI8H 4NFFA 1DXWA 2FO9A 3PV5A 4FUJA 1GJ8B 1W0ZU 2WZQA 1BMNH 3K65B 1C2MA 3E6PH 5EXMA 5EODA 1PFXC 1NFUA 1SLXB 4IC5A 1KDQA 1LVMA 1CT2E 4X0WU 3VB4A 2F3CE 2VU8E 2AYWA 1GBEA 1RJXB 5FX5A 1DS2E 1K21H 4LZ1H 1EXFA 2WPKS 2FS8A 3K6ZA 4CH8B 4K60A 3U1JB 1WYKA 4E7RG 3M5MA 2OC0A 1SFIA 2BLVA 2XBYA 5A09A 1BB0B 5C67A 4THNH 1GHZA 1MU6B 2WUBA 4FUGA 4JZ1A 3ZVAA 4CR5A 1GJ9B 4FVBA 4B1TA 1LVYA 3M35A 4INHA 1NFYA 3A88A 3BTGE 1QRZA 1K1NA 1VITH 4ZXXH 2YOLA 1GVZA 3IG6B 3LJOA 3VGCB 4DG4A 1C5VA 2TGDA 2HVXA 2C3SA 1DLKB 1F92A 2NU4E 2QAAA 1S85A 1UCYH 3SV7A 3QX5H 1GI2A 3QUMP 3UQVA 2BYAX 1CGJE 2GV7A 3QTVH 4ABJA 1SGYE 5I46H 3SNAA 1K1OA 1O2PA 1SC8U 3PWCA 3LU9B 3A7ZA 2V3OH 2C4FH 2PKSC 1T4UH 2PGQB 5E2PA 3RXJA 2A7JA 4JYTA 2OC1A 3TJUA 2R2MB 5DP5A 4WH6A 4GCHF 2BD9A 4HFPB 5SGAE 3VB3A 1TGNA 1QRXA 2GT7A 4YM9A 1C2DA 1A61H 1DY8A 1TOCB 4B76A 1H9IE 1GCDA 3KL6A 2Z9LA 1EZUC 3GDUA 1Z6EA 5LGOA 3PMHB 1BA8B 1ZYOA 1AFQC 1NTPA 2Z6BD 4X6MA 1SL3A 2ZPRA 2VIWA 2IOTA 3B23B 3RLYH 1YBWA 3NUMA 1O39A 1UHBB 4DW2U 3M3TA 2OK5A 2H9HA 2IJOB 4RKOB 1LHEH 3MNSA 1GGDB 2ZU2A 4X6NA 3LIWA 5EOKA 5J4SA 1YLCA 2VWOA 4A92A 3ZZCA 4KKDA 1SLVB 1CA0B 2P8OC 4ISLA 1C1VH 3T29A 3HK6B 4DCDA 1J17T 1THSH 4X6PA 3I29A 1GBKA 5DPAA 2CXVA 1C5UA 1PPHE 2IJD1 4U2WA 1FMGA 1L1JA 2O8TA 2Y5GA 3MU0A 1YYY1 1O2JA 2ZHQH 3BTWE 1RXPA 4MNXA 2ZEBA 1CVWH 1MUEB 1O2RA 2W5EA 1FI8A 4K1TA 4D9RA 4SGAE 1VGCC 3L33A 4JK6A 4I8JA 1MKXK 1UTKA 2CJIA 1FAKH 1TBQH 4JZEH 4VGCC 1K1IA 1Z8RA 1CA8B 2NU3E 4CBOA 4UFDH 3F9FA 5HM9A 4I7YH 2OC8A 1RTFB 4BTTB 3S0NA 3EA7A 1NRQH 1SGPE 3ZZAA 5EU8A 2GDEH 4ABEA 1O5DH 2CGAA 2Q1JA 5DK1A 4AFZA 1W14U 5HYOA 3Q3XA 1LHGH 3RXOA 2WV4A 3FZDA 3PMBB 3RMNH 4O03A 2BY6X 3V12A 1VITF 1ZTJA 3MU4A 1WTGH 2W3KA 1EX3A 1P2IA 3RC4A 1V2QT 5JB8S 3ZV9A 2ANMH 4KTCA 5GXPA 1O3KA 3RM0H 1LVOA 3O8CA 2EI8A 1O3HA 2BTCE 1D6WA 4AG1A 1F0RA 1GJ6A 1ETTH 2CV3A 4NA9H 1Z8IB 4YOIA 3TNSA 2G4TA 1MTSA 3QK1A 2ZDKA 2XBXA 1GBFA 4J1YA 1N6XA 5TCAA 1O3NA 1ZHRA 1TA2A 2ANWA 2J34A 3RLWH 3RXEA 2JETB 1EAUA 2GZ8A 5E0HA 2ZZUH 1SG8B 4CRFA 1A5HA 1HRTH 4FUHA 1MU8B 1SGEE 5G4BA 1OKXA 4MPVA 4KP0A 4GCHG 4Y8XA 4WJG2 2P3FH 1HJ9A 4MPWA 1UTMA 8GCHF 5JB9S 1C1QA 1SLUB 1GHBF 1V3XA 4OS1A 3A81A 3BSQA 1C2KA 3P8NA 1FN6A 2H9TH 2RG3A 4UDWH 4X1SU 1IHSH 1THRH 4ZKSU 5BRRE 2FOBA 1BTUA 4O9VA 5ETXA 2VBCA 1BRBE 3BEUA 1AVGH 6GCHG 4K3JA 2Y81A 1MTVA 1C2HA 1O2GH 1C1SA 2BVRH 3RXFA 5JBAS 3PV4A 1P8VC 1IAUA 1GI4A 3UNSA 1TGCA 4Q2KA 5HMAA 3ZVCA 2ZDAH 4UEHH 3A86A 1P9SA 2BOKA 1SB1H 1HAYB 4GAWA 4X2VA 1LPZB 1MD8A 4MTBA 1SQAA 2FYRA 3SW2B 3UNQA 4MNVA 3T5FH 1TRNA 3ODDA 4IC6A 1PPFE 1V2ST 2BD8A 2OD3B 2P94A 4TY7A 1O2VA 1LTOA 2A1DB 1YCPH 1GBBA 3KNXA 4AFUA 3KEEA 1HAVA 2ZGXH 2PLXA 5GDSH 1TPPA 2H1UA
chains in the Genus database with same CATH superfamily
2M5TA 1CO7E 2BY5X 3MI4A 1SLWB 1T8OA 2B9LA 3SU6A 2XCFA 2BY7X 2FPZA 3T62A 4YOGA 3DFLA 3GY3A 4I86A 1NRPH 3SQEE 1PQ7A 2GCTC 1G32B 1AO5A 1QBVH 3VPKA 3D62A 2ZG0H 3PM3A 1EAWA 4Z0KA 3T26A 4CR9A 1BRAA 2GCHG 1ZZZA 2EC9H 2PUQH 2YMSC 1HJAC 3SV2H 1MAYA 1MKWH 2WUCA 1GI3A 1VITG 2J2UA 2C8ZB 3TITA 3SU5A 1FONA 1O31A 1FY4A 1XVMA 1EZQA 4B2CA 3KYGA 4P00A 1H9LB 3Q76A 1V2WT 3DHKH 1ELGA 2ZP0H 3A89A 3OU0A 2PFEA 1TBRH 3SJOA 3NWUA 1O2HA 1TE0A 3UREA 6CHAB 1G9IE 4NZLA 3RXVA 3LONA 1C4Y2 2R9PA 1GBHA 1FV9A 4Y7AA 4BAMB 1GCTC 5FHTA 2F91A 1V2NT 3OY6U 3U69H 1MZDA 1NROH 3M5NA 1C1PA 3FAOA 4FU8A 1TOMH 1A5GH 2B7DH 3BG4C 3SJ9A 4CRBA 4B74A 2O9QA 1C9TA 3MNBA 5F6MA 3MO9A 5H4IB 1DUAA 1UVSH 1SGIB 3FVFB 1U6QA 3OFND 3T27A 1UTQA 1A4WH 1V2PT 1EFRD 3MHWU 1NZQH 1AE5A 1GHXH 8GCHG 2QXGA 2GMTC 3DA9B 5F8ZA 1QJ7B 1SGNE 1UCYK 3EDXB 3NRLA 1GHBG 1EOJA 2J95A 3E1XB 3HK3B 4O97A 3M5OA 2ZDNA 4KTUA 1OXGA 4ZCNA 3OTJE 2J98A 2V3HH 1ANDA 1TIOA 3HKIB 3QN7A 2G52A 4GVUA 3PLBA 2R0KA 1GHAF 4Q7XA 7LPRA 2BD2A 2BDGA 1MMJN 2ZFTA 1WU1A 4WXIA 1KIGH 4XFQA 1MQ6A 4FOUC 2ZTXA 4TSFD 1QZ8A 1P2KA 2AS9A 1DLEA 1GBLA 4X1RU 3UB0A 3PTBA 2ZWLH 5DP8A 2OQ5A 1EUFA 4JCNA 3SNEA 1UTPA 4XBCA 1HBTH 1PPZA 3S7KB 1O2ZA 1DSUA 3SQHE 2Y82A 2G4UA 3GDVA 4ZROA 1V2RT 4CRGA 5DJ7A 1D6RA 3M61U 3M7QA 3SUDA 1H1BA 5AHGH 1YPLH 3PMJA 5GJ4B 1HAVB 1SHYA 3E16B 1PYTC 2L6OA 3VGCC 1LKAA 4I31A 3V0XA 1MH0A 1LDTT 1V2UT 1CQQA 3M5LA 2WV5A 1IQGA 3A7TA 1TONA 1TBZH 3TK9A 4CHAB 2Q6FA 4DOQA 2VINA 1ACBE 1L2EA 3MWIU 4CH2B 1AIXH 5DP9A 5TCCA 1C4V2 1NFWA 1TMUH 1AQ7A 1CBWC 5C17A 5KECA 3BTHE 4FUBA 2SFAA 2ZFSA 1FPHH 1SMFE 3ATWA 1GMHF 1PPBH 3U8OH 3SU2A 2VWMA 3UY9A 1V2LT 3OAAD 1WDIA 3HATH 4MPUA 2VIVA 4TWWA 3TNTA 3KQ5A 3SZEA 3A8AA 1Q2WA 9LPRA 1BITA 2FX6A 3S69A 1W3CA 1A0LA 5CHAC 1GI8B 1K1JA 3GISB 4K8BA 1H8ED 2M2AA 3OX7U 1S83A 1GI7B 1KXBA 4B75A 2FOFA 4UD9H 1OS8A 1T31A 2HPPH 3RMMH 4NCYA 3STIA 2G5VA 5C2ZA 2WPJS 1D3DB 2XC0A 4LXBH 5L6NH 1GGDC 1L4ZA 3S9CA 1TAWA 2TIOA 1HGTH 1P11E 1YY3A 1KXEA 2UUYA 1UK3A 4K69A 1CA0C 4NWLA 1W13U 3E3TA 4FUIA 4OGYA 1C5OH 1AGJA 1L0ZA 1UVTH 2VIPA 3CS7A 4X8SH 4TPYA 3EE0B 1AVWA 8LPRA 1TPOA 1BDAA 2NU1E 4DURA 2AERH 1DE7H 2ZGBH 1AWFH 2J98B 2GJGA 1BJVA 2WPLS 2A4RA 2A45B 2D2DA 3UWIA 3MO6A 1MD7A 1FPCH 1UVOA 4FUFA 2HNTC 4X2YA 4ZHLU 1NU7B 2AEIH 1B0FA 2JDID 4UONA 1YM0A 4B2AA 1YF4A 4FVDA 3MNCA 1E34B 3K6YA 2IPHA 3KQCA 5E2OA 1HNEE 1EOLA 1GHVH 1Y5UT 1PPCE 1ZPZA 4Y10E 3R0FA 2WYGA 5C5NA 2TGTA 1GHAG 1C2GA 3ZZDA 1E36B 2FOHA 1B0EA 2D8WA 1W7GH 2JH5D 2LELA 1J9CH 2SGPE 1FY5A 1V2OT 1SGRE 1WCZA 3KF2A 1VZQH 2AGGX 3B9FH 3PMAB 3GY4A 3LGVA 3MH7A 3BEIB 1O5CB 5HGGA 3ZYDA 1O3GA 1D4PB 2ZO3H 2AMDA 2Z9IA 1L1NA 2F9NA 3A84A 3HKJB 3CS0A 3Q3YA 4ABAA 5IYTA 4JMYA 4R8TB 1BBRK 2BVSH 1Y5AT 1LPKB 1XUHA 1RS0A 1O5AB 3SU3A 1IOEA 1KLJH 5FAHA 1O32A 1SQOA 4ZHAA 4YT7H 5JPMH 7KMEH 1QURH 1C5WB 1SPJA 4XE4A 1TABE 4UE7H 2TGPZ 1ANBA 2A5KA 1JBUH 3H5CB 1RIWB 1FNIA 1HAIH 3P92A 1QY6A 2VGCC 1GI0A 3SJKA 1NFXA 2OUAA 2P3TB 2Z7FE 1ZHPA 1F7ZA 5B6OA 1EQ9A 1BUIA 1HV7A 1Y5BT 1A7SA 3KN2A 4PROA 2G55A 1EP5A 1TGSZ 2JETC 1F0SA 2W6ID 4BXSA 3FP8E 1CGIE 3TJNA 1QHRB 1TQ0B 4HG6A 1TYNA 1GMHG 2XWAA 1GBMA 4H6TA 1D9IA 3RM2H 3SU4A 3UAIC 3RXCA 2QY0B 1SOZA 2V35A 1GL0E 4X1QU 4Y0ZE 1QRWA 1O3LA 1JRTA 2EY4C 3Q00A 3ATIA 5C1UA 1ZPBA 3GY5A 5DP7A 1XUJA 1RTKA 1GBTA 1XVOA 2RCEA 1TPSA 2FESH 1MCVA 4TPIZ 3QWCH 1P02A 3F9EA 1BBRE 4RSPA 5LPFA 1K22H 5FCRA 4IMZA 1AUTC 2QN5T 5GNDA 3KCGH 1YPMH 1O37A 3P6ZB 4XBBA 1O3DA 3SI3H 5E0GA 1EKBB 3HGNA 1DOJA 2HNTF 1S82A 1GBDA 1UVPA 4Y11E 3GCTF 1C5LH 1GJ4H 1FJSA 4UFGH 2ZHWH 2WV9A 1FX0B 1OOKB 1IQKA 1GVKB 1QB1A 2ZU1A 2EI6A 1J8AA 1FY1A 1KTTB 1MKWK 4Z6AH 1BHXB 1CHOG 2VIOA 1HXEH 3RXRA 3ZVEA 4I8HA 4AX9H 2SGEE 3GICB 2ZI2H 4ZKNU 1HXFH 2PTCE 2QXJA 4ZHMU 4NZQA 5K7RA 1AWHB 2HALA 2STBE 2EI7A 1NRNH 3SV9A 1VJAU 4K8YA 1GJCB 1PQ5A 1XX9A 2FTMA 5HKKD 2Y5FA 2VVUA 4B6FA 3QTOH 1KDQB 1C1MA 2H5DA 1QR3E 2ODPA 4ISOA 1SGTA 1HDTH 4Q4LA 3A80A 3ZZ3A 3LOXA 5FX6A 1TX7A 1QBOA 2OCVB 3ENSB 2BD4A 5A8XA 3OY5U 4JZFH 2PHBA 1ZHMA 1V6DA 3UR6A 2BX4A 1KYNA 1UW7A 3PO1C 2PP6A 1ZMLA 1F5KU 3MYWA 4X8VH 3TJOA 1SFQB 2NU0E 1S81A 4UFFH 5FPSA 7ESTE 1EATA 1BTPA 3ZV8A 3M3SA 1BQYA 1TNLA 1GI5A 5HIZA 1VR1H 4XBDA 3ZZ4A 1DFPA 1QL7A 2J9NA 8ESTE 1QTFA 3SNDA 2JIZD 1P9UA 4LOYH 1AU8A 4KGAA 3FP7E 2ZA5A 2Z9GA 4IN2A 1VCWA 4ESTE 4XDEA 4U30A 2HVYB 1N1LA 5DP3A 4OS7A 3A7XA 2P59A 3EGKH 2UUFB 1OYQA 1ETRH 4ASUD 2XNIA 3TK6A 3GCOA 1ELEE 3UNRA 1QIXB 6CHAC 4TT3D 4BAHB 2ZU3A 4ASHA 4WVPE 3BTTE 1DT2A 3TIUA 3RXPA 5C5OA 2D26C 1WUNH 1KLTA 1TQ7B 3PB1E 2A4GA 3VXFH 2JKHA 5T6GA 1CU1A 3NKKA 3FFGA 4NGAH 2BVXH 3VFEA 4AC9A 4SGBE 1LVBA 5EW2H 1C1OA 1GJDB 1HIAA 1BTHH 4X8UH 1GBCA 2XC5A 2FI3E 1DITH 2XW9A 4K5ZA 1OP8A 4IN1A 2XOKD 4H42U 4NG9H 1UJ1A 1E0FD 1AD8H 1SGFG 1DANH 5GIBA 3GCHC 4ZAEA 3I77A 3U28C 4NA7A 2XYAA 1SKYE 2JJ1D 2DUCA 3LJJA 3GY7A 5DP6A 1EPTA 1P2JA 1ANCA 2B0FA 2WINI 2ZGCA 3V13A 3RDZA 4DGJA 5F8XA 3ZZBA 2AGEX 1VCPA 3SGQE 3RXDA 3SGBE 3VB5A 3F6UH 2W6JD 3MH6A 5L2YH 5EQRA 2RA3A 2NU2E 3B8JA 1C5QA 2BZ6H 1J15A 5IDKA 1Y3WA 1MQ5A 1TNKA 4A1TA 1CHGA 3D49H 1ZMNA 2F4LA 3O8BA 5E8EH 3ZVGA 3GCTG 3RXBA 3QLPH 1V2MT 3ZZ7A 3LT3A 4GLYA 2ZDLA 2LNCA 1S6LA 4Z1MD 1WXRA 4IS5A 1SQRA 2Q6DA 1ZR0A 4Y79A 1GDUA 2ZHEH 1FN8A 1O30A 1QB9A 4HGCA 3OSYA 1YPGH 2VB0A 4P02A 3A7WA 1Q3XA 2F83A 4F55A 4O3TA 1MTUA 2QF0A 3PYHA 4U32A 2SNWA 2Z3CA 3OEED 1RFNA 2XNDD 3V3MA 5C1YA 4D7FA 1G3DA 1J14A 5GPIB 3W94A 4JZIA 1Y8TA 2WPDD 1WBGB 1LKBA 2P95A 2BDYA 1MTWA 5LH8A 3C27B 2C8YB 3AW1A 1TRYA 1BTYA 2P8OB 3BTQE 1P05A 2H6MA 2ZCLP 3GY2A 2W7SA 4CHAC 2PUXB 2ESTE 2A5IA 1V2JT 1G2MA 3RU4T 4D9QA 4OS4A 4Q7ZA 1UTOA 1YKTA 1AZ8A 4DIIH 1BTXA 1O3EA 3VEQB 1O3BA 3U98H 2A7HA 3SJIA 4FUCA 4XD7D 2PKAA 1O3AA 2F43B 2AIQA 3LGIA 3SYJA 3P8OA 1ESTA 4LZ4B 3TH4H 1QNJA 1MTNB 2GVFA 3LKWA 2BY9X 2A4OA 1SGQE 2Y6TA 1PJPA 1EP6A 1K0HA 2FEQH 2J94A 1ZSKA 3M7TA 3SU1A 3SV6A 1O35A 3F0OA 3FZZA 3QGNB 1ELAA 1HYLA 3ODFA 2DE8A 5DGJA 4O3UA 2F9OA 2GD4B 3MU5A 1YPKH 1QJ6B 1P04A 1P2QA 1GG6C 2GV6A 3SZNA 4UFEH 3MO3A 2ASUB 1Z8GA 3P95A 1ESBA 3CENA 1P57B 1HIAB 2BDCA 3RXTA 2QGRA 2CHAC 3RXGA 1SGCA 2FM2A 1IHTH 4YLQH 1ZLRA 1O2WA 3BTME 2K8IA 3LPRA 4YTAA 2FTLE 1EJNA 3MMGA 4YLUA 2BQ7B 1IQEA 2EEKA 1O36A 1ZOMA 2K0QA 1OWJA 3FO8D 4U01A 4Q7YA 1FXYA 1TNGA 1XMNB 1EPTB 2OTVA 3M37A 4WF8A 5AVDA 4CRCA 1A3EH 1TA6A 4ACBA 4AFQA 1MBMA 1K1MA 3A85A 1V2TT 2PGBB 2HLCA 1GMDF 2KM0A 1O5EH 3AASA 3EE7A 1P06A 1B5GH 1UO6A 2ZECA 1C1UH 1AUJA 4GHTA 3PWBA 5CHBA 1D3QB 4AYYB 4CRAA 2Y7XA 2KCYA 3U8TH 1ZSJA 3TVJB 1THPB 1F0TA 4NA8A 4OS6A 1TX6A 1RGQA 3TH2H 1CGHA 4I32A 1LHFH 1XUIA 1MKXH 4ZH8A 1ZJDA 1C5XB 1C2FA 5T6FA 2THFB 1GBAA 4I33A 3FOAA 4HI3A 8KME2 4BAKB 1DWBH 1IQIA 1KLIH 1OWHA 2LPRA 1SR5C 4Y71A 1LPGB 2ZQ2A 1FQ3A 2WHXA 4IW4E 2G81E 4MNYA 1PQAA 2HPQH 5JYIA 3SUGA 4B2BA 4ZKRU 1F5RA 1DX5M 2A31A 2JH0D 1SSXA 2GX4A 5C0TA 1ID5H 4BOHA 1YPEH 1O2YA 3LGWA 3D23A 5B6LA 2TBSA 1OP0A 1A0HB 2Q6GA 5CE1A 2R0LA 3URDA 4JK5A 3M7UA 3FKSD 4ISIH 1XUKA 3L3TA 3S7HB 1UTJA 1A2CH 1XXFA 1O5GH 3EA8A 2A4QA 2QC2A 5JBTA 1FAXA 5C3NA 2F9PA 3MU1A 1NO9H 3QGJA 3WY8A 2PSYA 1H8DH 3SORA 1O2MA 2OC7A 2FIRH 1O0DH 3SHAH 2PKAB 3P8FA 4X2WA 1ARBA 4XSKU 3PROA 1UCYE 2AIPA 4D7GA 1CT0E 1ELFA 3MOCA 1LO6A 4B71A 2A32A 1DWEH 1WQVH 1QL8A 1GL1A 4Y8ZA 1AN1E 1Q31A 4D76A 1OYTH 2Z3DA 1YGCH 1P3CA 2VWNA 5BPEA 1RTLA 1TNIA 4DT7B 2YNAA 5ABWA 4X8TH 3MNXA 1F0UA 1XUFA 2J4IA 3BV9B 2VH0A 2IN2A 2ZC9H 1OWDA 1W0JD 2ALVA 2A7CA 1ELTA 3KHVA 4YESB 1KMHB 1ORFA 2GGVB 3L6PA 4NIVA 2RDLA 3PRDA 3UPEA 1EJMA 1BRCE 1EASA 3T2NA 3MU8A 3RU4D 1GI1A 1S84A 1ABJH 3LH1A 2GZ9A 2YNBA 4OM9A 2RA0A 4I8LA 1EJAA 1O3PB 1NT1A 1EAIA 4F48B 3AAVA 3A7YA 2OP9A 5F03A 1K9OE 3TJVA 1Z6JH 2CN0H 1HJAB 1D3PB 3SUEA 4INKA 2STAE 1FY8E 1E1RD 1T32A 1HCGA 3PLPA 2ZPQA 4A7IB 3KIDU 3UOPA 3CNRA 1C1TA 1HAGE 4JYUH 1DM4B 1NN6A 3C1KA 2P3UB 3DSPA 2WPMS 3I78A 5FBIA 4K1EA 1COWD 1OX1A 3RC5A 1P01A 1HUTH 5A0AE 1JXPA 3U8RH 1C5MD 1G36A 1NM6A 3TU7H 2BLOA 3TK5A 1GMDG 1DUEA 1ZJKA 1G37A 1C5NH 1N8OB 1XKBC 2FZZA 5F53A 5L2ZH 1KXCA 2ZGJA 4Y8YA 1UTLM 4JZDH 1NC6A 3PTNA 3Q3KA 2TGAA 1T4VH 1BCUH 5GWZA 2FMJA 2H9EH 1GJ7B 1AB9B 2BMGB 3TPIZ 1SGFA 1C5RA 2QF3A 5KGOA 1QGFA 2HWLB 1E37B 4M9FA 3DT0H 2AGIX 5HXFA 1O2KA 2Y5HA 2G8TA 4YXWD 3RP2A 1BTWA 1ZPCA 4OS5A 2ZDVH 1C2IA 1E35B 2PW8H 3WWFA 2KZ4A 1NESE 2Z3EA 1ZSLA 3OEHD 3DCLA 4E7NA 3A8BA 1LHDH 1KY9A 1LHCH 1ZGVA 1P3EA 3AK5A 2ZQ1A 1UK2A 2ANYA 2ZKSA 1NS3A 1C1NA 5LPEA 3BTKE 1J16A 3DSGA 5T3HA 1YPHE 3RMLH 2C90B 4KELA 3O8RA 3Q77A 3ZVDA 3JZ2B 3QZQA 1JOUB 2A0QB 1Z8JB 1S0RA 1G2LA 1DICA 2PR3A 4OGXA 1NBMD 2GT8A 3IWMA 3UQOA 3RXHA 4AGJA 2W26A 3GCNA 1O33A 3K2UA 5C1XA 1GDQA 2BD7A 3SN8A 4CRDA 3HPTB 4E06H 2ZIQH 2FOAA 5FBEA 5A8ZA 2AMPA 3N7OA 2F9UA 1Z1IA 2EA3A 1WTHD 2SGQE 5KEDA 5EW1H 1SOTA 1BZXE 1AZZA 2VIDA 1A3BH 1G30B 2Z9JA 3AW0A 1ZRBA 2GTBA 2FS9A 2BDAA 2FLRH 3LGTA 2ULLA 2P16A 5EQSA 3KGPA 3ZZ6A 1HB0B 2QF4A 3GY6A 3A82A 4AZ2B 1JIMA 1ZTKA 2RDEA 1TWXB 5AFYH 1BHXF 1YLNA 1YCPK 1WAYB 1TGBA 2OQUA 3VXEH 1HAHH 1YPJH 1TMBH 1KSNA 4ACAA 2BY8X 3BTDE 1CBWB 2WPIS 1B7XB 3KQBA 3OTPA 5EJ1A 1P2MA 1JIRA 1QQUA 3MTYA 2FDAA 1C5TA 5EPYA 4M7GA 1TRMA 3H7OA 4MVNA 2QE7D 2Z94A 1QBNA 5T1VA 2VIQA 3SNBA 1WSSH 3CP7A 2B5TB 2A2QH 5DP4A 3RXKA 3E90B 3RXAA 2CF8H 4MQAA 3A8DA 2WYJA 3TH3H 1W2KH 4GHQA 1AE8H 5CHAB 1YP9A 1ETSH 1ZRKA 2V3MA 1JRSA 1DWDH 4JYVH 1S6FA 1C4U2 4DJZB 5FXLA 1C1WH 4AFSA 3GS9A 4WXVA 1KXAA 2ZF0H 3MH4A 3NZIA 5JDUB 4A1VA 1W8BH 3F68H 1ELCA 3E91A 1GJAB 6GCHF 3GYLB 4I8GA 5JBBS 3E0NB 2G00A 1G3BA 1SHHB 1LQEA 2W3IA 2VWLA 4BAQB 1TNJA 3T28A 3SU0A 1SVPA 1GDNA 3DD2H 2G51A 1OSSA 2OLGA 2OBQA 4Y76A 1DSTA 3QDZB 4AYVB 1FIZA 3A7VA 1C5SA 2K1QA 3RC6A 3MFJA 4BXWA 1BMFD 2UUKB 1S5SA 5EIYA 3F3BA 2VVVA 2ODYB 1QCPA 5ESBA 3GOVB 1GHWH 3BIVH 1W0KD 4X2XA 2B8OH 1IQFA 1GWAA 1UVUH 1MTNC 3H09A 1K1PA 2QYIA 5F8TA 1HFDA 2UUJB 3WWBA 2AMQA 1C9PA 4CBNA 2JH6D 3RXMA 2FOEA 4Y0YE 2ZTZA 4H4FA 4Y7BA 5T6DA 1BT7A 2ZHFH 2SNVA 3BTFE 1Y59T 2BQ6B 1LQDB 4K1SA 1KTSB 1AY6H 1Y3UA 3ZVFA 1GMCF 3F1SB 3SNCA 3VB6A 2C8WB 3BG8A 1VCQA 1GI9B 5A2MH 3GDSA 3U9AH 4GSOA 1GPZA 1FIWA 3RU4E 1CT4E 4KTSA 1Z1JA 1K1LA 2KCPA 5HIYA 1O3MA 2Y80A 2GCHF 4E05H 5EJZA 1AKSA 2BM2A 2VH6A 1P03A 3BN9A 2FI4E 2GP9B 2BHGA 2XTTB 2ZFFH 1NU9A 5GCHF 3M36A 3S9BA 4OS2A 4MG3A 5EXNA 2Y7ZA 1TFXA 1OP2A 1EPTC 4WH8A 4X1PU 4B6EA 3O8DA 1GHYH 2FX4A 3SBKA 2R2WU 1GJ5H 3U1IB 3E0PB 2FXRA 2VGCB 4ABFA 1O2QA 4X1NU 2BQWB 4NSYA 3RXLA 1E1QD 3QZRA 4RKJB 4ABBA 4LK4A 1WV7H 1YPHC 2QCYA 3LGUA 1ARCA 2ZU4A 3LC3A 3NPSA 3URCA 1ELDE 3HGPA 3R3GB 1AHTH 5EPNA 1TMTH 2PKSB 3TGJE 2OBOA 3M3VA 5AFZH 1DPOA 3MH5A 1IQJA 1QB6A 1ZGIA 1HAXB 3A87A 4GUXA 5DKMA 1UTNA 1O3CA 2G5NA 3PLKA 1HAZB 2FOGA 2R3YA 1ELBA 4R0IA 4FU7A 2JJ2D 1IQMA 1E38B 2A2XH 2BXTH 3ITIA 1O2NA 1ZMJA 1OWKA 4DVAU 2HLDD 4DT4A 3VB7A 4Y6DA 3LH3A 1O2LA 2ZGHA 1BBRH 3FP6E 1H4WA 2PV9B 3SOSA 1C5YB 3GYMA 2O8WA 2BX3A 4D8NA 2CMYA 4J2YB 3RXSA 2ILNA 1AFQB 3ATKA 1ANEA 3JZ1B 1K28D 5EQQA 5K0HA 2WPHS 3SV8A 2TPIZ 3ATMA 3GY8A 3UR9A 1TLDA 5TJXA 2EQNA 4GPGA 5FL7D 6LPRA 1LMWB 1TNHA 1O34A 4YT6H 2ZFRH 4Q80A 1P2OA 2KAIA 1C2JA 2PSXA 1JMOH 1OPHB 1BJUA 4A6LA 1ABIH 2NWNA 5JBCS 5FCKA 2FWWA 4RI0A 1TGTA 1YC0A 3RXIA 1DDJA 7GCHF 1T8MA 3EAJA 1ZTLA 4H6SB 1NBME 5DO4H 1GI6A 1SBWA 4ZUHA 3NK8A 1S0QA 2OXSA 5DG6A 1D3TB 2GZ7A 3ZZ5A 1O2OA 2HGTH 4AGKA 3S9AA 2A5AA 5FPTA 2KCAA 1W11U 4FUDA 5E0JA 3UFAA 1O38A 4NWKA 1A46H 2XC4A 3UOUA 4MPXA 5ESTE 1O5BB 2C93B 1TX8A 4NSVA 3AVZA 5A8YA 2QXIA 9ESTA 4WWYA 1MBQA 2FLBH 3N7EA 3RUOA 1QQ4A 3ESTA 3ZIAD 4YOJA 1HAPH 1QA7A 1SI5H 4IBLH 2SGAA 1AVXA 3E8LA 2ANKH 1VGCB 4RT0A 1CE5A 1NY22 3TLOA 4ZXYH 1K2I1 1AKSB 4VGCB 1GMCG 3PO1B 2XBWA 3FN8A 2BB4A 3RXQA 3W1EA 4CREA 1G3CA 1YCPM 1EB1H 2ZDMA 1WOFA 1RRKA 4YO9A 2BLQA 5C20A 2ZPSA 4BTIB 2UWOA 3LDXH 2BD3A 3BF6H 3H7TA 2QV1A 5EJLA 1EZXC 4BAOB 1F2SE 1LCYA 3A8CA 1FDPA 1BMMH 2QXHA 1QL9A 2BXUH 2R3UA 3ATLA 1A0JA 2J38A 5C94A 3EA9A 2BDHA 1O3JA 1A5IA 1XKAC 3UWJH 1O3OA 1BRUP 1F5LA 1MZAA 3T25A 3BEFB 1EAXA 3ZZ8A 2HNTE 1HAOH 5GCHG 3FANA 3SHCH 3TGKE 2FYQA 1EZSC 1P2NA 2XBVA 1O3IA 4MLFB 4WY3A 2SGFE 4ABDA 3PRBA 1C2EA 1JWTA 2ZTYA 4IMQA 3N99A 4YZUA 4F49A 2VNTA 5EGMA 1N8OC 5HM2A 1N6YA 1W12U 3ZVBA 3AAUA 3KQDA 4K2YA 1YLDA 4A1XA 4MNWA 4ABHA 1MCTA 1IQHA 1H8IH 2QA9E 2TRMA 1GBJA 5CDFE 2XWBI 4XOJA 1Y3VA 2LP6A 1G3EA 1AB9C 3RMOH 3P8GA 3NXPA 1MAXA 1TB6H 2BZAA 5A0BA 3LC5A 1BMAA 4HTCH 1O2SA 2OINA 5J4QA 2VJ1A 1IQNA 2O8UA 4HZHA 3GCHB 3SUFA 2XXLA 4AN7A 3P17H 1FZZA 1RD3B 2O8MA 4AOQA 2D1JA 2AFQB 2H5CA 1ESAA 2P93A 4X6OA 1SGDE 1DVAH 1NRRH 1HLTH 4FETA 2BDBA 2KAIB 3DFJA 4F4OC 4NIYA 1OHHD 1Z71A 3OE7D 3QO6A 5EXLA 2FI5E 3NCLA 3STJA 2ZFPH 2I6SA 3SGAE 1O5FH 3SI4H 1AMHA 3DSOA 4AB8A 1RIWC 1O2UA 1KXDA 5A0CA 1S6HA 1W7XH 2O8LA 2ZCKP 2ZU5A 3BIUH 1Y3YA 4MDSA 2XRCA 4IGDA 1CSOE 1XM1A 1TALA 4RN6A 1Z7KA 1VKYA 2ZCHP 5LPRA 1INCA 1C5ZB 3F9GA 7GCHG 1FLEE 1QFKH 2V6NA 2XCNA 2YMSD 1H9HE 1T8NA 4TYDA 4BANB 1OWIA 3UTUH 2SGDE 1W10U 2BLWA 2VVCA 5IK2D 5FPYA 1O2TA 1GBIA 1FY3A 2KX4A 1WQSA 4A5TS 3BTEE 2F9BH 3SO3A 4BTUB 4DIHH 1XUGA 1EB2A 2ZFQH 4BNRA 2ALPA 1FUJA 5I25A 1OWEA 2J92A 2WSSD 4AG2A 3KQEA 1BIOA 1GVLA 3SJ8A 1C2LA 4ZKOU 2GKVE 4FUEA 4NIXA 1YWUA 2C8XB 3IITA 5AF9H 2BDIA 1L4DA 2BOHB 2Z9KA 1SQTA 2UWLA 1PQ8A 5L30H 1O3FA 1V2VT 3A83A 3TGIE 2F9VA 4ABIA 2GCTB 2CK3D 4NIWA 1QA0A 3PV2A 1DXPA 4FU9A 2ZNKH 2BD5A 3ZYEA 5EG4A 1TPAE 1P09A 1C1RA 3D65E 3V7TA 2YMSB 2H2ZA 2AH4X 1VJ9U 1GJBB 1QJ1B 4AORA 3F9HA 1L1GA 1HJ8A 4RT1A 1A1RA 2GDDA 4ISNA 1Y3XA 3UIRA 5DSFA 4WMDA 4WMEA 2DE9A 4DY7B 2V0BA 1GG6B 3EYDA 4QT8C 3F2FA 2QIQA 1UK4A 3LGYA 2UWPA 1M9UA 2PTNA 2QF5A 1O2IA 4TWYA 1X7AC 4NFEA 1P0SH 3UUZA 4I8KA 3P70B 1BMLA 1UMAH 2FOCA 4AB9A 1XXDA 2CHAB 4WMFA 1BOQA 1NPMA 2FOMB 2KCOA 1AFEH 4FXGH 2I6QA 4ISHH 1GCTB 1NRSH 3DUXH 3OYPA 2PWXA 3G01A 1CHOF 2FP7B 1UHBA 1ELVA 1P12E 4ABGA 1C5PA 1O2XA 3ELAH 4B73A 4ZMAH 2CF9H 3W95A 3BG4B 3N7DA 2J97A 1DY9A 4INLA 2IPQX 1HPGA 3EQ0H 3VG8A 2FODA 6ESTA 1IQLA 1KXFA 1BTZA 2HRVA 1V2KT 4TY6A 3ZZ9A 5CMXH 2ODQA 5PTPA 2W7UA 1T8LA 3K9XB 1T7CA 1P10A 2GMTB 1PPEE 2ZHDA 3RXUA 1W0YH 1PPGE 1DWCH 2HOBA 1PYTD 1AI8H 4NFFA 1DXWA 2FO9A 3PV5A 4FUJA 1GJ8B 1W0ZU 2WZQA 1BMNH 3K65B 1C2MA 3E6PH 5EXMA 5EODA 1PFXC 1NFUA 1SLXB 4IC5A 1KDQA 1LVMA 1CT2E 4X0WU 3VB4A 2F3CE 2VU8E 2AYWA 1GBEA 1RJXB 5FX5A 1DS2E 1K21H 4LZ1H 1EXFA 2WPKS 2FS8A 3K6ZA 4CH8B 4K60A 3U1JB 1WYKA 4E7RG 3M5MA 2OC0A 1SFIA 2BLVA 2XBYA 5A09A 1BB0B 5C67A 2L74A 4THNH 1GHZA 2KFWA 1MU6B 2WUBA 4FUGA 4JZ1A 3ZVAA 4CR5A 1GJ9B 4FVBA 4B1TA 1LVYA 3M35A 4INHA 1NFYA 3A88A 3BTGE 1QRZA 1K1NA 1VITH 4ZXXH 2YOLA 1GVZA 3IG6B 3LJOA 3VGCB 4DG4A 1C5VA 2TGDA 2HVXA 2C3SA 1DLKB 1F92A 2NU4E 2QAAA 1S85A 1UCYH 3SV7A 3QX5H 1GI2A 3QUMP 3UQVA 2BYAX 1CGJE 2GV7A 3QTVH 4ABJA 1SGYE 5I46H 3MQKC 3SNAA 1K1OA 1O2PA 1SC8U 3PWCA 3LU9B 3A7ZA 2V3OH 2C4FH 2PKSC 1T4UH 2PGQB 5E2PA 4Q63A 3RXJA 3KYFA 3WW7A 2A7JA 4JYTA 2KR7A 2OC1A 3TJUA 2R2MB 5DP5A 4WH6A 4GCHF 2BD9A 4HFPB 5SGAE 3VB3A 1TGNA 1QRXA 2GT7A 4YM9A 2AHME 1C2DA 1A61H 1DY8A 1TOCB 4B76A 1H9IE 1GCDA 2RFKC 3KL6A 2Z9LA 1EZUC 3GDUA 1Z6EA 5DN6D 5LGOA 3PMHB 1BA8B 1ZYOA 1AFQC 1NTPA 2Z6BD 4X6MA 1SL3A 2ZPRA 2VIWA 2IOTA 3B23B 3RLYH 1YBWA 3NUMA 1O39A 1UHBB 4DW2U 3M3TA 2OK5A 2H9HA 2IJOB 4RKOB 1LHEH 3MNSA 1GGDB 2ZU2A 4X6NA 3LIWA 5EOKA 5J4SA 1YLCA 2VWOA 4A92A 3ZZCA 4KKDA 1SLVB 1CA0B 2P8OC 4ISLA 1C1VH 3T29A 3HK6B 4DCDA 1J17T 1THSH 4X6PA 3I29A 1GBKA 5DPAA 2CXVA 1C5UA 1PPHE 1MABB 2IJD1 4U2WA 1FMGA 1L1JA 2O8TA 2Y5GA 3MU0A 1YYY1 1O2JA 2ZHQH 3BTWE 1RXPA 4MNXA 2ZEBA 1CVWH 1MUEB 1O2RA 2W5EA 1FI8A 4K1TA 4D9RA 4SGAE 1VGCC 3L33A 4JK6A 4I8JA 1MKXK 1UTKA 2CJIA 1FAKH 1TBQH 4JZEH 4VGCC 1K1IA 1Z8RA 1CA8B 2NU3E 4CBOA 4UFDH 3F9FA 5HM9A 4I7YH 2OC8A 1RTFB 4BTTB 3S0NA 3EA7A 1NRQH 1SGPE 3ZZAA 5EU8A 3F2GA 2GDEH 4ABEA 1O5DH 2CGAA 2Q1JA 5DK1A 4AFZA 1W14U 5HYOA 3Q3XA 1LHGH 3RXOA 2WV4A 3FZDA 3PMBB 3RMNH 4O03A 2BY6X 3V12A 1VITF 1ZTJA 3MU4A 1WTGH 2W3KA 1EX3A 1P2IA 3RC4A 1V2QT 5JB8S 3ZV9A 2ANMH 1H8HD 4KTCA 5GXPA 1O3KA 3RM0H 1LVOA 3O8CA 2EI8A 1O3HA 2BTCE 1D6WA 4AG1A 3F0PA 1F0RA 1GJ6A 1ETTH 2CV3A 4NA9H 1Z8IB 4YOIA 3TNSA 2G4TA 1MTSA 3QK1A 2ZDKA 2XBXA 1GBFA 4J1YA 1N6XA 5TCAA 1O3NA 1ZHRA 1TA2A 2ANWA 2J34A 3RLWH 3RXEA 2JETB 1EAUA 2GZ8A 5E0HA 2ZZUH 1SG8B 4CRFA 1A5HA 1HRTH 4FUHA 1MU8B 1SGEE 4XRNA 5G4BA 1OKXA 4MPVA 4KP0A 4GCHG 4Y8XA 4WJG2 2P3FH 1HJ9A 4MPWA 1UTMA 8GCHF 5JB9S 1C1QA 1SLUB 5C0UA 1GHBF 1V3XA 4OS1A 3A81A 3BSQA 1C2KA 3P8NA 1FN6A 2H9TH 2RG3A 4UDWH 4X1SU 1IHSH 1THRH 4ZKSU 5BRRE 2FOBA 1BTUA 2V7QD 4O9VA 5ETXA 2VBCA 1BRBE 3BEUA 1AVGH 6GCHG 4K3JA 2Y81A 1MTVA 1C2HA 1O2GH 3F2HA 1C1SA 2BVRH 3RXFA 5JBAS 3PV4A 2J5UA 1P8VC 1IAUA 1GI4A 3UNSA 1TGCA 4Q2KA 5HMAA 3ZVCA 2ZDAH 4UEHH 3A86A 1P9SA 2BOKA 1SB1H 1HAYB 4GAWA 4X2VA 1LPZB 1MD8A 4MTBA 1SQAA 2FYRA 3SW2B 1E79D 3UNQA 4MNVA 3T5FH 1TRNA 3ODDA 4IC6A 1PPFE 1V2ST 2BD8A 2OD3B 2P94A 4TY7A 1O2VA 1LTOA 2A1DB 1YCPH 1GBBA 3KNXA 4AFUA 3KEEA 1HAVA 2ZGXH 2PLXA 5GDSH 1TPPA 2H1UA
chains in the Genus database with same CATH topology
2M5TA 1CO7E 2BY5X 3MI4A 1SLWB 1T8OA 2B9LA 3SU6A 2XCFA 2BY7X 2FPZA 3T62A 4YOGA 3DFLA 3GY3A 1NRPH 3SQEE 1PQ7A 2GCTC 1G32B 1AO5A 1QBVH 3VPKA 3D62A 2ZG0H 3PM3A 1EAWA 4Z0KA 3T26A 4CR9A 1BRAA 2GCHG 1ZZZA 2EC9H 2PUQH 2YMSC 1HJAC 3SV2H 1MAYA 1MKWH 2WUCA 1GI3A 1VITG 2J2UA 2C8ZB 3TITA 3SU5A 1FONA 1O31A 1FY4A 1XVMA 1EZQA 4B2CA 1H9LB 3Q76A 1V2WT 3DHKH 1ELGA 2ZP0H 3A89A 3OU0A 2PFEA 1TBRH 3SJOA 3NWUA 1O2HA 1TE0A 3UREA 6CHAB 1G9IE 4NZLA 3RXVA 3LONA 1C4Y2 2R9PA 1GBHA 1FV9A 4Y7AA 4BAMB 1GCTC 5FHTA 2F91A 1V2NT 3OY6U 3U69H 1MZDA 1NROH 3M5NA 1C1PA 3FAOA 4FU8A 1TOMH 1A5GH 2B7DH 3BG4C 3SJ9A 4CRBA 4B74A 2O9QA 1C9TA 3MNBA 5F6MA 3MO9A 5H4IB 1DUAA 1UVSH 1SGIB 3FVFB 1U6QA 3T27A 3OFND 1UTQA 1A4WH 1V2PT 1EFRD 3MHWU 1NZQH 1AE5A 1GHXH 8GCHG 2QXGA 2GMTC 3DA9B 5F8ZA 1QJ7B 1SGNE 1UCYK 3EDXB 3NRLA 1GHBG 1EOJA 2J95A 3E1XB 3HK3B 4O97A 3M5OA 2ZDNA 4KTUA 1OXGA 4ZCNA 3OTJE 2V3HH 1ANDA 1TIOA 3HKIB 3QN7A 2G52A 4GVUA 3PLBA 2R0KA 1GHAF 4Q7XA 7LPRA 2BD2A 2BDGA 1MMJN 2ZFTA 1WU1A 4WXIA 1KIGH 4XFQA 1MQ6A 2ZTXA 4TSFD 1P2KA 2AS9A 1DLEA 1GBLA 4X1RU 3UB0A 3PTBA 2ZWLH 5DP8A 2OQ5A 1EUFA 4JCNA 3SNEA 1UTPA 4XBCA 1HBTH 1PPZA 3S7KB 1O2ZA 1DSUA 3SQHE 2Y82A 2G4UA 3GDVA 4ZROA 1V2RT 4CRGA 5DJ7A 1D6RA 3M61U 3M7QA 3SUDA 1H1BA 5AHGH 1YPLH 3PMJA 5GJ4B 1HAVB 1SHYA 3E16B 1PYTC 2L6OA 3VGCC 1LKAA 4I31A 3V0XA 1MH0A 1LDTT 1V2UT 1CQQA 3M5LA 2WV5A 1IQGA 3A7TA 1TONA 1TBZH 3TK9A 4CHAB 2Q6FA 4DOQA 2VINA 1ACBE 1L2EA 3MWIU 4CH2B 1AIXH 5DP9A 5TCCA 1C4V2 1NFWA 1TMUH 1AQ7A 1CBWC 5C17A 3BTHE 4FUBA 2SFAA 2ZFSA 1FPHH 1SMFE 3ATWA 1GMHF 1PPBH 3U8OH 3SU2A 2VWMA 3UY9A 1V2LT 3OAAD 3HATH 4MPUA 2VIVA 4TWWA 3TNTA 3SZEA 3A8AA 1Q2WA 9LPRA 1BITA 2FX6A 3S69A 1W3CA 1A0LA 5CHAC 1GI8B 1K1JA 3GISB 4K8BA 1H8ED 2M2AA 3OX7U 1S83A 1GI7B 1KXBA 4B75A 2FOFA 4UD9H 1OS8A 1T31A 2HPPH 3RMMH 4NCYA 3STIA 2G5VA 5C2ZA 2WPJS 1D3DB 2XC0A 4LXBH 5L6NH 1GGDC 1L4ZA 3S9CA 1TAWA 2TIOA 1HGTH 1P11E 1KXEA 2UUYA 1UK3A 4K69A 1CA0C 4NWLA 1W13U 3E3TA 4FUIA 4OGYA 1C5OH 1AGJA 1L0ZA 1UVTH 2VIPA 3CS7A 4X8SH 4TPYA 3EE0B 1AVWA 8LPRA 1TPOA 1BDAA 2NU1E 4DURA 2AERH 1DE7H 2ZGBH 1AWFH 1BJVA 2WPLS 2A4RA 2A45B 2D2DA 3UWIA 3MO6A 1MD7A 1FPCH 1UVOA 4FUFA 2HNTC 4X2YA 4ZHLU 1NU7B 2AEIH 1B0FA 2JDID 4UONA 1YM0A 4B2AA 1YF4A 4FVDA 3MNCA 1E34B 3K6YA 2IPHA 3KQCA 5E2OA 1HNEE 1EOLA 1GHVH 1Y5UT 1PPCE 1ZPZA 4Y10E 3R0FA 2WYGA 5C5NA 2TGTA 1GHAG 1C2GA 3ZZDA 1E36B 2FOHA 1B0EA 2D8WA 1W7GH 2JH5D 2LELA 1J9CH 2SGPE 1FY5A 1V2OT 1SGRE 1WCZA 3KF2A 1VZQH 2AGGX 3B9FH 3PMAB 3GY4A 3LGVA 3MH7A 3BEIB 1O5CB 5HGGA 3ZYDA 1O3GA 1D4PB 2ZO3H 2AMDA 2Z9IA 1L1NA 2F9NA 3A84A 3HKJB 3CS0A 3Q3YA 4ABAA 5IYTA 4JMYA 4R8TB 1BBRK 2BVSH 1Y5AT 1LPKB 1XUHA 1RS0A 1O5AB 3SU3A 1IOEA 1KLJH 5FAHA 1O32A 1SQOA 4ZHAA 4YT7H 5JPMH 7KMEH 1QURH 1C5WB 1SPJA 4XE4A 1TABE 4UE7H 2TGPZ 1ANBA 2A5KA 1JBUH 3H5CB 1RIWB 1FNIA 1HAIH 3P92A 1QY6A 2VGCC 1GI0A 3SJKA 1NFXA 2OUAA 2P3TB 2Z7FE 1ZHPA 1F7ZA 5B6OA 1EQ9A 1BUIA 1HV7A 1Y5BT 1A7SA 3KN2A 4PROA 2G55A 1EP5A 1TGSZ 2JETC 1F0SA 2W6ID 4BXSA 3FP8E 1CGIE 3TJNA 1QHRB 1TQ0B 1TYNA 1GMHG 2XWAA 1GBMA 4H6TA 1D9IA 3RM2H 3SU4A 3RXCA 2QY0B 1SOZA 2V35A 1GL0E 4X1QU 4Y0ZE 1QRWA 1O3LA 1JRTA 3Q00A 3ATIA 5C1UA 1ZPBA 3GY5A 5DP7A 1XUJA 1RTKA 1GBTA 1XVOA 2RCEA 1TPSA 2FESH 1MCVA 4TPIZ 3QWCH 1P02A 3F9EA 1BBRE 4RSPA 5LPFA 1K22H 5FCRA 4IMZA 1AUTC 2QN5T 5GNDA 3KCGH 1YPMH 1O37A 3P6ZB 4XBBA 1O3DA 3SI3H 5E0GA 1EKBB 3HGNA 1DOJA 2HNTF 1S82A 1GBDA 1UVPA 4Y11E 3GCTF 1C5LH 1GJ4H 1FJSA 4UFGH 2ZHWH 2WV9A 1FX0B 1OOKB 1IQKA 1GVKB 1QB1A 2ZU1A 2EI6A 1J8AA 1FY1A 1KTTB 1MKWK 4Z6AH 1BHXB 1CHOG 2VIOA 1HXEH 3RXRA 3ZVEA 4I8HA 4AX9H 2SGEE 3GICB 2ZI2H 4ZKNU 1HXFH 2PTCE 2QXJA 4ZHMU 4NZQA 5K7RA 1AWHB 2HALA 2STBE 2EI7A 1NRNH 3SV9A 1VJAU 4K8YA 1GJCB 1PQ5A 1XX9A 2FTMA 5HKKD 2Y5FA 2VVUA 4B6FA 3QTOH 1KDQB 1C1MA 2H5DA 1QR3E 2ODPA 4ISOA 1SGTA 1HDTH 4Q4LA 3A80A 3ZZ3A 3LOXA 5FX6A 1TX7A 1QBOA 2OCVB 3ENSB 2BD4A 5A8XA 3OY5U 4JZFH 2PHBA 1ZHMA 1V6DA 3UR6A 2BX4A 1KYNA 3PO1C 1ZMLA 1F5KU 3MYWA 4X8VH 3TJOA 1SFQB 2NU0E 1S81A 4UFFH 5FPSA 7ESTE 1EATA 1BTPA 3ZV8A 3M3SA 1BQYA 1TNLA 1GI5A 1VR1H 4XBDA 3ZZ4A 1DFPA 1QL7A 2J9NA 8ESTE 1QTFA 3SNDA 2JIZD 1P9UA 4LOYH 1AU8A 4KGAA 3FP7E 2ZA5A 2Z9GA 4IN2A 1VCWA 4ESTE 4XDEA 4U30A 1N1LA 5DP3A 4OS7A 3A7XA 2P59A 3EGKH 2UUFB 1OYQA 1ETRH 4ASUD 2XNIA 3TK6A 3GCOA 1ELEE 3UNRA 1QIXB 6CHAC 4TT3D 4BAHB 2ZU3A 4ASHA 4WVPE 3BTTE 1DT2A 3TIUA 3RXPA 5C5OA 2D26C 1WUNH 1KLTA 1TQ7B 3PB1E 2A4GA 3VXFH 2JKHA 5T6GA 1CU1A 3NKKA 3FFGA 4NGAH 2BVXH 3VFEA 4SGBE 1LVBA 5EW2H 1C1OA 1GJDB 1HIAA 1BTHH 4X8UH 1GBCA 2XC5A 2FI3E 1DITH 2XW9A 4K5ZA 1OP8A 4IN1A 2XOKD 4H42U 4NG9H 1UJ1A 1E0FD 1AD8H 1SGFG 1DANH 5GIBA 3GCHC 4ZAEA 3I77A 4NA7A 2XYAA 1SKYE 2JJ1D 2DUCA 3LJJA 3GY7A 5DP6A 1EPTA 1P2JA 1ANCA 2B0FA 2WINI 2ZGCA 3V13A 3RDZA 4DGJA 5F8XA 3ZZBA 2AGEX 1VCPA 3SGQE 3RXDA 3SGBE 3VB5A 3F6UH 2W6JD 3MH6A 5L2YH 5EQRA 2RA3A 2NU2E 3B8JA 1C5QA 2BZ6H 1J15A 5IDKA 1Y3WA 1MQ5A 1TNKA 4A1TA 1CHGA 3D49H 1ZMNA 2F4LA 3O8BA 5E8EH 3ZVGA 3GCTG 3RXBA 3QLPH 1V2MT 3ZZ7A 3LT3A 4GLYA 2ZDLA 2LNCA 1S6LA 4Z1MD 1WXRA 4IS5A 2Q6DA 1ZR0A 4Y79A 1GDUA 2ZHEH 1FN8A 1O30A 1QB9A 4HGCA 3OSYA 1YPGH 2VB0A 3A7WA 1Q3XA 2F83A 4F55A 4O3TA 1MTUA 2QF0A 3PYHA 4U32A 2SNWA 2Z3CA 3OEED 1RFNA 3V3MA 2XNDD 5C1YA 4D7FA 1G3DA 1J14A 5GPIB 3W94A 4JZIA 1Y8TA 2WPDD 1WBGB 1LKBA 2P95A 2BDYA 1MTWA 5LH8A 3C27B 2C8YB 3AW1A 1TRYA 1BTYA 2P8OB 3BTQE 1P05A 2H6MA 2ZCLP 3GY2A 2W7SA 4CHAC 2PUXB 2ESTE 2A5IA 1V2JT 1G2MA 3RU4T 4D9QA 4OS4A 4Q7ZA 1UTOA 1YKTA 1AZ8A 4DIIH 1BTXA 1O3EA 3VEQB 1O3BA 3U98H 2A7HA 3SJIA 4FUCA 4XD7D 2PKAA 1O3AA 2F43B 2AIQA 3LGIA 3SYJA 3P8OA 1ESTA 4LZ4B 3TH4H 1QNJA 1MTNB 2GVFA 3LKWA 2BY9X 2A4OA 1SGQE 2Y6TA 1PJPA 1EP6A 2FEQH 2J94A 1ZSKA 3M7TA 3SU1A 3SV6A 1O35A 3F0OA 3FZZA 3QGNB 1ELAA 1HYLA 3ODFA 2DE8A 5DGJA 4O3UA 2F9OA 2GD4B 3MU5A 1YPKH 1QJ6B 1P04A 1P2QA 1GG6C 2GV6A 3SZNA 4UFEH 3MO3A 2ASUB 1Z8GA 3P95A 1ESBA 3CENA 1P57B 1HIAB 2BDCA 3RXTA 2QGRA 2CHAC 3RXGA 1SGCA 2FM2A 1IHTH 4YLQH 1ZLRA 1O2WA 3BTME 2K8IA 3LPRA 4YTAA 2FTLE 1EJNA 3MMGA 4YLUA 2BQ7B 1IQEA 2EEKA 1O36A 1ZOMA 2K0QA 1OWJA 3FO8D 4U01A 4Q7YA 1FXYA 1TNGA 1XMNB 1EPTB 2OTVA 3M37A 4WF8A 5AVDA 4CRCA 1A3EH 1TA6A 4AFQA 1MBMA 1K1MA 3A85A 1V2TT 2PGBB 2HLCA 1GMDF 2KM0A 1O5EH 3AASA 1P06A 1B5GH 1UO6A 2ZECA 1C1UH 1AUJA 4GHTA 3PWBA 5CHBA 1D3QB 4AYYB 4CRAA 2Y7XA 2KCYA 3U8TH 1ZSJA 3TVJB 1THPB 1F0TA 4NA8A 4OS6A 1TX6A 1RGQA 3TH2H 1CGHA 4I32A 1LHFH 1XUIA 1MKXH 4ZH8A 1ZJDA 1C5XB 1C2FA 5T6FA 2THFB 1GBAA 4I33A 3FOAA 4HI3A 8KME2 4BAKB 1DWBH 1IQIA 1KLIH 2LPRA 1OWHA 1SR5C 4Y71A 1LPGB 2ZQ2A 1FQ3A 2WHXA 4IW4E 2G81E 4MNYA 1PQAA 2HPQH 5JYIA 3SUGA 4B2BA 4ZKRU 1F5RA 1DX5M 2A31A 2JH0D 1SSXA 2GX4A 5C0TA 1ID5H 4BOHA 1YPEH 1O2YA 3LGWA 3D23A 5B6LA 2TBSA 1OP0A 1A0HB 2Q6GA 5CE1A 2R0LA 3URDA 4JK5A 3M7UA 3FKSD 4ISIH 1XUKA 3L3TA 3S7HB 1UTJA 1A2CH 1XXFA 1O5GH 3EA8A 2A4QA 2QC2A 5JBTA 1FAXA 5C3NA 2F9PA 3MU1A 1NO9H 3QGJA 3WY8A 2PSYA 1H8DH 3SORA 1O2MA 2OC7A 2FIRH 1O0DH 3SHAH 2PKAB 3P8FA 4X2WA 1ARBA 4XSKU 3PROA 1UCYE 2AIPA 4D7GA 1CT0E 1ELFA 3MOCA 1LO6A 4B71A 2A32A 1DWEH 1WQVH 1QL8A 1GL1A 4Y8ZA 1AN1E 1Q31A 4D76A 1OYTH 2Z3DA 1YGCH 1P3CA 2VWNA 5BPEA 1RTLA 1TNIA 4DT7B 2YNAA 5ABWA 4X8TH 3MNXA 1F0UA 1XUFA 2J4IA 3BV9B 2VH0A 2IN2A 2ZC9H 1OWDA 1W0JD 2ALVA 2A7CA 1ELTA 3KHVA 4YESB 3L6PA 1ORFA 2GGVB 4NIVA 1KMHB 2RDLA 3PRDA 3UPEA 1EJMA 1BRCE 1EASA 3T2NA 3MU8A 3RU4D 1GI1A 1S84A 1ABJH 3LH1A 2GZ9A 2YNBA 4OM9A 2RA0A 4I8LA 1EJAA 1O3PB 1NT1A 1EAIA 3AAVA 3A7YA 2OP9A 5F03A 1K9OE 3TJVA 1Z6JH 2CN0H 1HJAB 1D3PB 3SUEA 4INKA 2STAE 1FY8E 1E1RD 1T32A 1HCGA 3PLPA 2ZPQA 4A7IB 3KIDU 3UOPA 1C1TA 1HAGE 4JYUH 1DM4B 1NN6A 3C1KA 2P3UB 3I78A 2WPMS 5FBIA 3DSPA 4K1EA 1COWD 1OX1A 3RC5A 1P01A 1HUTH 5A0AE 1JXPA 3U8RH 1C5MD 1G36A 1NM6A 3TU7H 2BLOA 3TK5A 1GMDG 1DUEA 1ZJKA 1G37A 1C5NH 1N8OB 1XKBC 2FZZA 5L2ZH 5F53A 1KXCA 2ZGJA 4Y8YA 1UTLM