3U1IB

Dengue virus protease covalently bound to a peptide
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
173
structure length
168
Chain Sequence
GGSGVLWDVPSPAELEEGVYRIKQQGIFGKTQVGVGVQKEGVFHTMWHVTRGAVLTHNGKRLEPNWASVKKDLISYGGGWRLSAQWQKGEEVQVIAVEPGKNPKNFQTMPGTFQTTTGEIGAIALDFKPGTSGSPIINREGKVVGLYGNGVVTKNGGYVSGIAQTNAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Serine protease subunit NS2B
publication title Ligand-bound structures of the dengue virus protease reveal the active conformation
pubmed doi rcsb
source organism Dengue virus 3
total genus 28
structure length 168
sequence length 173
chains with identical sequence D
ec nomenclature ec 2.1.1.56: mRNA (guanine-N(7)-)-methyltransferase.
pdb deposition date 2011-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00949 Peptidase_S7 Peptidase S7, Flavivirus NS3 serine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3u1iB02
2.40.10.120 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 3u1iB01
1XUJA 4INKA 2VWOA 3FP6E 5GIBA 2Z9KA 2ASUB 4CRDA 2R3UA 2QAAA 2BY9X 2VVVA 2FS9A 2JKHA 4LXBH 1TRNA 1LKBA 1SG8B 3RM0H 3CP7A 1TGSZ 4DCDA 3LDXH 2ODPA 1ZGVA 5EQRA 2STAE 3ZVCA 2GMTB 2R0LA 3VPKA 1CE5A 4ABIA 1UCYE 1C5UA 2UWPA 1GGDC 4KELA 1GJ4H 4UE7H 2YNBA 4D9QA 3AASA 3VB3A 1KDQB 1GWAA 3E91A 1O2RA 3EQ0H 1B0FA 1A61H 1P11E 4OS5A 3UPEA 4ABDA 1FPHH 1O2KA 2Y6TA 1H9LB 3AVZA 2BVSH 2QN5T 3M61U 2J9NA 2GP9B 2Y82A 1BMLA 2VH0A 3H5CB 1C5WB 2OD3B 4JYVH 4XFQA 1SGPE 3F6UH 3VB4A 1TBQH 4E7NA 4XOJA 3T27A 1ZZZA 2VU8E 1CHOF 3E1XB 1G3EA 3TVJB 4K2YA 2ZU5A 5HYOA 3OTPA 1DXWA 2A5IA 3A7VA 3G01A 1CSOE 2XWAA 1ZHRA 5EPNA 1DY8A 3KIDU 4TY7A 4WMEA 1OYTH 1UK4A 1DWDH 1F0SA 1GI3A 1DITH 4KKDA 3BTKE 2V3OH 4TY6A 4ABEA 1SC8U 1TOCB 1VCWA 3TJVA 3R3GB 4B76A 4ZKOU 3A7YA 3DD2H 1A0HB 1A7SA 3OY6U 2ZEBA 3VXFH 1GBTA 1GHVH 1D6WA 5EU8A 1RTLA 3K2UA 1SR5C 2ZFPH 2QY0B 1AO5A 1UCYH 2AEIH 1GVZA 1HBTH 2GZ8A 2QIQA 1E37B 3C1KA 2TGDA 3UQVA 2ZHQH 4K60A 4Q2KA 2BM2A 2OC8A 4X1SU 5ESTE 1EAXA 1WTHD 5FPSA 1O2GH 4JZFH 2R0KA 1O36A 2CXVA 1O3CA 1ZHMA 3F68H 3SU4A 5A8YA 1BTYA 1W10U 2BLQA 1AQ7A 4UD9H 1DPOA 2OC1A 3SHCH 3TITA 3TK5A 4XBDA 5H4IB 2H9HA 2AGEX 3BTFE 1ZJKA 2HNTF 4NZQA 3VB5A 1CT0E 1C5YB 1YP9A 2A2XH 4X8SH 1SB1H 1FNIA 3MWIU 4JYTA 3SJOA 2H1UA 2LPRA 1P12E 1V2OT 1NT1A 1C1NA 2Q6FA 3F1SB 4SGBE 3SU2A 1HAZB 3TNSA 1NU7B 3SV8A 4AZ2B 1EZUC 3RXCA 2O8WA 1PPHE 4Y71A 1C2HA 1E36B 5LPEA 5HMAA 1AKSA 3M5OA 3NK8A 3E0NB 1GHYH 1G9IE 4GCHG 1ZTKA 2ZA5A 1FAXA 1TBRH 1TBZH 3MU4A 3TPIZ 2HPPH 4FUCA 3T26A 3ZZCA 4A92A 1MU8B 5CE1A 1DXPA 1WBGB 3PLKA 1TPOA 2SGAA 1EOJA 1BT7A 1O3JA 1FDPA 1YPLH 2R2MB 3LOXA 1E34B 3OY5U 4KTCA 1AZZA 2OBOA 4Y10E 1VITH 1A3EH 2FM2A 2P93A 3DFJA 4FU7A 3ATIA 5FHTA 1HAXB 4X6OA 3OTJE 2VGCB 3HATH 5JB9S 2C4FH 3E6PH 2G00A 1A5HA 4MG3A 3UR6A 1K1LA 2ZFFH 3KQEA 1UTJA 2GZ7A 3MH6A 2ZFSA 1S5SA 2ZTYA 1GJ9B 1OYQA 4JZEH 1ACBE 1UHBA 2ZPRA 1V2LT 5LH8A 3BTGE 1O2TA 2VIVA 1VITG 4MVNA 5LPFA 2FLRH 4BAMB 2ZG0H 1ELDE 1KYNA 2BB4A 2GCTC 4K1EA 3HKIB 1XMNB 1C2IA 2HALA 2ILNA 2QCYA 4ZHMU 3M5MA 3NZIA 5GNDA 1CA0B 2PW8H 1ETRH 4B6EA 3A8CA 1GBAA 2GCHG 5GJ4B 1C2FA 1O2NA 2Y7ZA 5L30H 2EI8A 2WYGA 1TFXA 3VGCB 1WTGH 3PO1C 3A8BA 2SNWA 1K1PA 5DP8A 5JBBS 1MTWA 2ZFTA 1GHZA 5E0HA 1EPTC 1NESE 1ZTLA 4QT8C 3LJJA 4YOGA 1P06A 1PJPA 4DY7B 3LU9B 1HAPH 1LQDB 1O3EA 1GBLA 1NFUA 3C27B 1SLUB 1A1RA 3RXMA 1T8OA 1ANDA 3RXTA 4DOQA 1B5GH 3UNSA 1D9IA 4IGDA 3RM2H 1EASA 5T6GA 4ESTE 3ZZ9A 1VGCC 2ZPQA 5DP3A 1V2QT 3A7TA 1SPJA 1JIRA 3TU7H 1UTLM 3GCTF 1THPB 9ESTA 5E8EH 1GMCG 4SGAE 1DOJA 1V2JT 3SUGA 1Y5BT 1GDNA 2FWWA 3QTOH 3A82A 1Q2WA 1ELAA 4NA9H 3A83A 1FY5A 3LGWA 1N8OB 4Q7YA 2WHXA 2OQUA 1O2LA 3GOVB 4RSPA 1OOKB 4K1SA 3E16B 3S9AA 3ZZ4A 2BDHA 2F4LA 1PQ5A 4Y7BA 5EG4A 1K2I1 5A0BA 4AN7A 4IN2A 1AVGH 4JK5A 1O38A 3UOPA 1LO6A 1OWEA 2BMGB 2VVUA 4IN1A 4CBOA 1XM1A 1ZSJA 3TLOA 4MTBA 4ABAA 1NRPH 1T8MA 2AMPA 1ZSKA 1BBRH 1T4VH 3GCNA 1C5OH 4X1RU 2ZDKA 2P3UB 3GY8A 1HAGE 7LPRA 2BD8A 1C1UH 1C2KA 2O8TA 1P0SH 1ZPCA 4K8YA 1F2SE 4TWWA 3PTNA 1GMHF 3DT0H 7GCHG 2J95A 1A2CH 1PPGE 2VWNA 3SV2H 1ESAA 2PUXB 5DKMA 1GHWH 1KLJH 1Q3XA 1V2PT 2BVXH 4CRBA 5L2ZH 2FIRH 3FAOA 1TMUH 3DUXH 1DX5M 3QK1A 1TRYA 1BCUH 1LPGB 4CR5A 3MMGA 2OINA 2ZGCA 3U98H 1AKSB 4TPYA 1F5RA 3O8CA 5IYTA 4DURA 1CGJE 4FVBA 3T2NA 1H9HE 5GPIB 1ZPZA 3MNXA 4ZAEA 4CH2B 2QF3A 3H09A 1FPCH 1ZTJA 4JZDH 1CGHA 1YPHC 1BITA 3RU4E 2PFEA 2XW9A 1W11U 3LGVA 1VITF 1SGFG 1THRH 3CS7A 1A0JA 1SGNE 1FONA 2WPMS 1NO9H 2XCFA 3LT3A 2C90B 4INLA 3NKKA 4YZUA 1HJ9A 2O8UA 1IAUA 2QC2A 2P95A 2BD2A 4ZKNU 2GCHF 2V3HH 3P8NA 5GWZA 1O2PA 5FCKA 2VBCA 4NIVA 1NROH 1GBMA 1KXBA 5FCRA 4MNWA 1C1PA 1N6YA 3SBKA 3M7QA 1G37A 5BPEA 2RA3A 2AFQB 1D3DB 3ENSB 4NCYA 1UHBB 4I8HA 1SVPA 1D3TB 1A46H 1PYTC 3SJ9A 1T31A 4K8BA 4I8LA 1NRQH 5G4BA 1YGCH 1MUEB 1AZ8A 1Z1IA 3RC5A 1ZOMA 1HYLA 2A5KA 1WSSH 2JETC 3UOUA 4AX9H 4FUBA 4ASHA 3RXPA 2ESTE 3FFGA 1BTPA 1MKXH 2V6NA 2A7CA 5AF9H 1OWIA 1QTFA 2GGVB 4AG1A 4DT7B 2Z9GA 5DP4A 2VIQA 1GMCF 1IQHA 3BTEE 1TX7A 1V2RT 2HLCA 1WUNH 4FUDA 3ODFA 2Q6DA 3U1IB 1O34A 5FPTA 1CGIE 1O3DA 4B2AA 3UR9A 4Y8YA 4BAOB 2BOKA 1BMNH 1C5PA 4BANB 1GBJA 3LKWA 1UTOA 4WXIA 3SOSA 2BDAA 1QNJA 1H8DH 1Y5UT 2G8TA 4AFQA 4HGCA 2C93B 4GHTA 1INCA 3ZZ8A 1ETTH 1QB1A 2Z3DA 1S85A 1BRUP 3SI3H 1F0RA 3NXPA 2ANWA 4AYVB 3PLPA 1T32A 1Z8RA 3L6PA 4ZMAH 1AWFH 1GDUA 1SGFA 1CHOG 4U32A 1LCYA 1O3PB 2GDEH 4NWKA 3QUMP 2Z94A 3LC3A 5DG6A 4UFGH 2AIPA 5JYIA 4K69A 3BN9A 1DUAA 1O5EH 5A8ZA 4CHAC 2OP9A 2Z9LA 1XXFA 1L4DA 2OQ5A 2VIPA 1G2LA 4ZH8A 1VR1H 4CH8B 7GCHF 1SOTA 2AMDA 1LHCH 2PWXA 1DICA 3BEFB 1GHBF 1GHAF 1C5ZB 2Y81A 2AGGX 1KXDA 2ODYB 1GGDB 2WYJA 1SGIB 1LMWB 3V7TA 2G52A 3QLPH 2ZU3A 1FI8A 3A8DA 4OS6A 1W0YH 2B9LA 3UWJH 3VFEA 1ANCA 2ZP0H 2FOBA 4JYUH 1L0ZA 1QBNA 4CBNA 4KTUA 2Q6GA 3S9CA 3RDZA 4I8KA 2ZC9H 2GTBA 3H7OA 1K1MA 4PROA 1J9CH 2FDAA 5ESBA 4ABFA 5TCAA 2A5AA 1ZMJA 1V6DA 3EYDA 1KTTB 1MCTA 1GBHA 1GJ7B 1GI1A 1DWBH 8GCHG 2BY5X 2FOFA 2XXLA 4BTTB 2H9EH 2BXUH 3MU8A 3P8FA 1TMBH 2G4TA 3MH7A 1MAYA 5A09A 2PGQB 1CT2E 4H42U 2Z9JA 1DANH 3RU4D 4O3UA 4ABBA 3W94A 2A4QA 2O8LA 1VJAU 5EXNA 4Y0YE 3GY6A 4JMYA 5IDKA 1K1IA 1P10A 4ZXXH 3A8AA 5GDSH 1FY8E 3F9HA 1IOEA 1G3CA 4JCNA 1TA2A 1PFXC 4X1QU 2NU2E 3P17H 3PLBA 1BOQA 1V2VT 2UUJB 3PM3A 2FI5E 4ISOA 3BIVH 4BAHB 3L3TA 1EAWA 1IQLA 1MAXA 1AU8A 3LGTA 1Y8TA 2STBE 3GYLB 2D2DA 3FANA 1O3GA 1MBQA 1O39A 2FOMB 1TQ0B 2BQWB 2CF8H 2BD4A 2PKSC 1G36A 3FP7E 1P9SA 1ZJDA 2LNCA 3UNQA 2BDYA 5TCCA 5FAHA 2ZCLP 4X8UH 1GL0E 3HGPA 3SNAA 1QB6A 2FOEA 4Z6AH 1C1TA 2FPZA 3UREA 1QHRB 3ZVAA 2A7JA 1NRRH 2TIOA 1TNLA 4DVAU 1V3XA 1SGYE 2B7DH 2UWOA 1C5NH 1C5VA 1CBWC 3M35A 1O3MA 1NTPA 1LVBA 4NZLA 1VJ9U 1YCPK 3GYMA 3JZ2B 5C1YA 2NU0E 5SGAE 2RCEA 1K28D 3MU1A 5T6DA 1BA8B 1O2JA 2ZHDA 3I77A 2FP7B 8KME2 1C1MA 4K3JA 1FV9A 1LVOA 2QXIA 2Y80A 1P03A 4ISIH 4MQAA 4DW2U 4ZROA 1S82A 4D7FA 5JPMH 2QYIA 5JBCS 2F9NA 1KTSB 1HAIH 3A86A 3LGYA 2W26A 5DP9A 2WV5A 3AAVA 5L2YH 1ID5H 2EI7A 3K9XB 2OLGA 1AE5A 2UUYA 1XVMA 5EGMA 1HJAC 2PKAA 1O32A 3BTME 3MFJA 1LTOA 2FLBH 3RC6A 5DPAA 1D3PB 5PTPA 1Y3VA 2XBVA 2FX6A 2ZHFH 3TGKE 1WYKA 5HXFA 3HK3B 4A1TA 5JBTA 1TNJA 3FVFB 1RFNA 2C3SA 2BD5A 1MQ5A 2A4RA 3PMAB 2ANKH 2JH6D 5E2OA 1K22H 4A1XA 1QCPA 3D49H 1BTXA 1P2KA 1RRKA 3A81A 1PYTD 1P05A 5C67A 5K7RA 1ARBA 1QR3E 3QO6A 1AFQC 1LPKB 3T25A 7KMEH 2H2ZA 3GCTG 5GCHG 2GCTB 4NSVA 1FZZA 3T29A 6CHAC 3MHWU 3BG4C 2AMQA 1T4UH 2BQ6B 3QGNB 1BJUA 1U6QA 2A7HA 3P8GA 3HKJB 4E05H 1SHHB 2IPHA 5CHAC 1Y3UA 3MU5A 4NGAH 2RG3A 1UTNA 2OCVB 4AFZA 1ZMLA 3SJ8A 1X7AC 8GCHF 5DGJA 2CHAC 3KHVA 4HFPB 3PO1B 1XVOA 1O5BB 5L6NH 1OP8A 3ZVEA 1MBMA 2WPKS 1BTZA 1UTPA 3BF6H 1FN6A 2D1JA 3URCA 1EPTB 1XUKA 2CMYA 1QFKH 2HWLB 1EOLA 4JK6A 3F9FA 1ELBA 3D62A 3KEEA 1O2QA 5B6OA 3KQCA 3Q76A 1AHTH 4X2XA 4JZIA 4LOYH 3TH3H 4BAQB 3M3VA 4GLYA 9LPRA 1C4V2 1C1SA 1GI4A 1JRTA 3E3TA 1ZHPA 1PQ7A 1VGCB 2UWLA 2PHBA 3MNSA 1KXCA 4FU9A 4WH6A 1C5SA 2Z3EA 2ZECA 1GMHG 2ZGJA 1O2XA 1JWTA 4ZKSU 1BB0B 1LDTT 1P9UA 3MI4A 4BXWA 4MPXA 3O8RA 3MTYA 1C2DA 3RXQA 4AOQA 3ATMA 2GD4B 2R9PA 5DJ7A 5EXMA 5FPYA 3RXUA 4BNRA 1E38B 1LQEA 1TGNA 4MNXA 3RXDA 3ELAH 2G5VA 3RXFA 3SI4H 1ESBA 3PWCA 4E06H 4Y0ZE 1F7ZA 3A84A 1SLWB 3PMBB 5E0JA 4YLQH 4ZHLU 2OC0A 3ZV8A 1BMAA 5DP6A 4AFUA 3UY9A 1XX9A 2VWMA 1GCDA 1GCTC 3ZZ6A 3TGIE 5FBIA 3U69H 1TYNA 1Z6JH 3ATWA 3SUEA 2GT8A 2XYAA 3SUDA 1BIOA 2WZQA 1A5IA 1QJ7B 4GUXA 2VNTA 2IJOB 1S81A 6ESTA 3SZEA 4B71A 4M7GA 2A32A 4B74A 3GCOA 4TWYA 3PWBA 4UONA 2BOHB 2DE8A 1H8IH 3SU1A 1BHXF 2PV9B 1YBWA 1YYY1 1S0QA 2BD7A 2ZQ1A 4AGKA 4UFDH 4ZXYH 1BBRE 3UWIA 3BEUA 4AB8A 2NU1E 3VEQB 1UCYK 3I29A 3SU5A 1MTSA 1WOFA 1AVXA 2GX4A 3ZZAA 1CT4E 3S7KB 1O37A 4Z0KA 2JH5D 4NG9H 3S0NA 4BTIB 2VVCA 3B9FH 2BDIA 4JZ1A 1AB9C 4WJG2 1AN1E 1FIZA 5GCHF 1GDQA 3TK6A 1GL1A 2PKAB 4MPVA 4VGCC 2XBYA 4YTAA 2F9PA 1K21H 2HOBA 2FMJA 4XBCA 4Y8XA 4K5ZA 1KLIH 1OKXA 1C4Y2 1SQAA 2W7SA 1V2MT 3S9BA 1ZRKA 2BX3A 4IC5A 4X6MA 2ZGXH 3MU0A 2F9VA 4O03A 3JZ1B 2ZTZA 3ZZBA 2ZDVH 1MKWH 1JRSA 4WMDA 4X8TH 3TJNA 2CN0H 2ZDAH 4B75A 3V0XA 2FX4A 2ZGBH 1UO6A 3KNXA 2XRCA 3RXHA 4F4OC 4DG4A 2B0FA 3MO9A 3U8OH 1C9PA 1UVSH 3NUMA 2JETB 1AUTC 2PUQH 3A85A 3ZYEA 3IITA 1GJ6A 2SFAA 5F8TA 1CU1A 1EXFA 4IS5A 1Z7KA 5HM9A 1P2JA 2SGPE 1S83A 3BIUH 1CVWH 1TGCA 5FBEA 3RXJA 1O3NA 1OXGA 5JDUB 2ZU1A 5FX5A 1P3EA 3B8JA 4XSKU 1WXRA 1ETSH 1GBEA 2SGFE 1GHBG 1GHAG 3LC5A 1HFDA 3ZV9A 2ZFQH 1TALA 1GJCB 1RTFB 1ANBA 3ATLA 4NSYA 1O2ZA 1V2WT 3VB6A 3A87A 1UJ1A 3Q00A 5A0AE 2VB0A 1SFQB 2ZHWH 2GT7A 1YPMH 5F8ZA 2H5DA 3V12A 1NN6A 1UVTH 1J15A 4OS1A 4BOHA 1DY9A 1WU1A 1ZMNA 1J14A 1QGFA 2P8OC 2FEQH 3Q77A 1YLDA 2AS9A 3SNCA 2QF0A 1QQ4A 2FXRA 1FLEE 2BQ7B 3M36A 1TQ7B 1BHXB 2GV7A 3SQEE 3QGJA 2XC5A 1L1NA 1GI8B 4CHAB 2ALVA 2FTMA 1TNHA 2DUCA 1XKAC 3L33A 3W95A 3GCHC 3R0FA 2ZU2A 4Q7ZA 2QV1A 2W5EA 4YT7H 4FVDA 3QTVH 1EP6A 2ZDMA 1C2EA 3SGBE 1DWCH 4GVUA 4HI3A 1V2TT 1FY3A 2ZDNA 4AFSA 2OTVA 2Z7FE 3RLWH 3A88A 1QRXA 6GCHF 3RXEA 3SZNA 1TAWA 1C1RA 3EDXB 3WY8A 1QJ6B 1O3HA 1M9UA 2BLVA 1NM6A 1F5LA 1RIWC 3F9GA 3UIRA 2PLXA 3ZVGA 1O2OA 2ZGHA 4FUJA 2R3YA 3VB7A 1XXDA 4X6PA 4Y76A 1HIAA 3PV4A 5FX6A 3TJUA 1C5TA 2PSYA 4I8GA 4NIYA 3SNDA 1O3AA 1P02A 3TGJE 1EJNA 1DWEH 2WPLS 4B73A 1AWHB 3KCGH 2TGPZ 2XBXA 2Z9IA 3AAUA 1P8VC 1MCVA 1WQSA 5EQSA 1DVAH 1O3IA 1YPHE 4LK4A 1BTHH 1D4PB 2WPHS 1C5QA 2ZNKH 1EB1H 4MDSA 2F9UA 1C1WH 1JOUB 2CGAA 1SLVB 1MKWK 3U8TH 1CHGA 4O97A 1L1GA 2ANYA 5C2ZA 1EQ9A 1NFYA 1OP0A 1Z6EA 2PSXA 1GMDG 1W13U 1K1NA 2W3KA 1K9OE 1BBRK 1W3CA 1GI9B 3ZYDA 5A0CA 1SL3A 1W7XH 2SGQE 5BRRE 3OSYA 1GJ5H 2PTCE 4J2YB 2C8ZB 3I78A 3KGPA 2BY6X 1GG6C 3MNCA 4ISNA 1TPSA 1K1OA 1O30A 2F3CE 1O5DH 2VINA 3SN8A 1O3FA 2BY8X 2AH4X 3Q3KA 2I6QA 1BRAA 2BD3A 1S6FA 4UFFH 1BRCE 3KQDA 4YT6H 4A7IB 1RS0A 1FY1A 2PKSB 3H7TA 4AYYB 1W8BH 1Z8JB 3ZZ7A 1JIMA 3M5NA 1MZAA 4CRFA 1RGQA 4HZHA 4LZ4B 4XBBA 1BZXE 3U9AH 1C2LA 3SGAE 4X6NA 3MO3A 1SGEE 1S6HA 2A4OA 3NWUA 1D3QB 2AIQA 2B5TB 1HB0B 2WUCA 1CBWB 5C20A 1UK3A 1EPTA 2CF9H 2ZWLH 2VIOA 3TH4H 1FUJA 4DIHH 3SHAH 1GJAB 1GJBB 2H6MA 1AGJA 1BMMH 1P2NA 3BTTE 4K1TA 4WWYA 4A1VA 2P3TB 1Z1JA 1S84A 1ELCA 1FJSA 1AIXH 4X1NU 3ITIA 3PV2A 3P92A 1LVMA 3ZZ5A 3RP2A 4WF8A 3TJOA 3QZQA 2G51A 3T62A 4WY3A 4WXVA 1HJAB 3PB1E 5ETXA 1C1VH 3TH2H 1EZSC 1G3BA 1DSTA 1HNEE 2VIWA 3TNTA 2G81E 1OX1A 1WQVH 2FS8A 4NA7A 4ZKRU 2BVRH 3B23B 2WPIS 1C4U2 2HVXA 4WMFA 1NU9A 1SHYA 3N7OA 1IQFA 4CRAA 4B2BA 4CRCA 1RJXB 1ABJH 4M9FA 1Y3XA 1ELVA 2JH0D 1RD3B 1DUEA 2WV9A 2F83A 3EGKH 5F6MA 1ZPBA 1RXPA 1HRTH 5C5NA 1AFQB 1MKXK 1AE8H 2VH6A 1A4WH 4MLFB 1O3KA 2J34A 1S0RA 6CHAB 1ABIH 2HRVA 3BG4B 2GZ9A 4A5TS 2IOTA 2UUKB 3GY4A 1V2UT 1W12U 1QJ1B 3AW1A 3PTBA 4THNH 5CHAB 5C3NA 1DLEA 4B6FA 4I32A 2A45B 1LHGH 8ESTE 1KY9A 2CHAB 4Y7AA 1OWKA 1QBOA 2ALPA 4YOJA 1UVUH 3V13A 4U01A 3RXAA 2W7UA 2CV3A 1FXYA 1B0EA 2WINI 3D23A 3QDZB 1ARCA 4MPWA 5AHGH 2BZ6H 2UUFB 4F49A 2M5TA 1GBBA 3UTUH 2RA0A 1QIXB 3RMNH 1HIAB 1GMDF 2FOAA 2AERH 2C8WB 1W7GH 2THFB 1MTNC 1UTKA 1O2WA 4AGJA 4OGXA 3K6YA 1PQAA 3UQOA 3DHKH 2FOGA 4X2VA 3EA9A 3T28A 4ABHA 3GDUA 5J4SA 2YNAA 1HXFH 4AORA 2OXSA 2QXHA 2YOLA 4NA8A 1YKTA 2OK5A 3RXVA 1BDAA 2ZI2H 2J38A 3M7TA 1O5GH 5F03A 1TONA 2G55A 4E7RG 1O2SA 1ZR0A 4AG2A 1P09A 1QRWA 1C1OA 4FUHA 5C5OA 4OS7A 1FIWA 2P59A 1HLTH 2XTTB 3RXKA 4A6LA 3ZVDA 1QA7A 4I33A 3BSQA 2BLOA 3F9EA 5JBAS 1TWXB 1IQGA 1EKBB 3SU3A 1BJVA 4B2CA 2OC7A 3UNRA 3FZZA 1NY22 2OBQA 5CMXH 1C1QA 2VJ1A 4GHQA 5T6FA 1OP2A 1MD8A 1G3DA 5E0GA 4NIXA 3A7WA 3BV9B 3GY3A 3RXGA 1HAVA 2O8MA 1GCTB 1MMJN 3ZZDA 3RMMH 4IMZA 2TPIZ 1MTUA 3PV5A 2TBSA 2C8YB 2G4UA 1SQOA 4R0IA 1NRNH 1DLKB 3ATKA 2H5CA 4HTCH 3STJA 4DGJA 2FODA 4FXGH 1HJ8A 5J4QA 2GVFA 2V0BA 3ZVBA 2PTNA 1ELFA 1QBVH 2SNVA 3SUFA 3OYPA 1PQ8A 5AFYH 1XUGA 1D6RA 3BG8A 3CS0A 2Z3CA 2A0QB 2BY7X 4FUEA 3MH4A 3SQHE 4H4FA 4BAKB 1EJMA 2CJIA 2PGBB 3P6ZB 1FY4A 2GKVE 2GMTC 3LH3A 3SO3A 3E0PB 1H4WA 2J4IA 3K6ZA 1IQMA 5GXPA 3RXLA 3ZZ3A 1BUIA 3SNBA 1ELGA 5FXLA 1EP5A 1B7XB 1GBCA 1SGDE 3BTQE 1ORFA 2ZFRH 1GI2A 4H6TA 1DM4B 1O5AB 2ZPSA 3DFLA 1KSNA 1GBKA 1AB9B 4OS4A 2P94A 3SV6A 1HAOH 3MNBA 2HPQH 1ZGIA 4KP0A 3RC4A 2D8WA 1N1LA 1G32B 3RMOH 4VGCB 4RI0A 2FTLE 2SGEE 1MD7A 1EATA 4NIWA 3HPTB 2Q1JA 1TLDA 3QN7A 4D76A 3U1JB 2BDBA 1O3BA 2XC0A 3BEIB 1O5CB 3EAJA 3IG6B 3SW2B 1Y3WA 1DT2A 1UTQA 2G5NA 2ZDLA 3ESTA 2ZQ2A 5E2PA 4Y8ZA 3MH5A 1LPZB 1FAKH 1VCPA 2NU4E 4X2WA 1BRBE 3U8RH 2O9QA 3GY7A 3RMLH 1FN8A 2FESH 5TJXA 2TGAA 3SJKA 5HGGA 1H9IE 1HGTH 5F8XA 3RUOA 2BZAA 1KXAA 1EAUA 3A80A 3SGQE 2TRMA 4LZ1H 4Q80A 3RXSA 1C2GA 2Y5FA 1A5GH 4KGAA 3RLYH 1A0LA 1W0ZU 2W3IA 1WV7H 1ZLRA 1IQIA 1HV7A 1O3LA 3LPRA 3NCLA 4X8VH 4I7YH 1GJ8B 3BTDE 2ZZUH 3SU0A 1CO7E 3KL6A 3ZVFA 5K0HA 3S7HB 1EJAA 1C2JA 4OGYA 5A2MH 3STIA 2F9OA 3SYJA 3CENA 1NC6A 3PROA 4B1TA 1HPGA 2WUBA 1P3CA 1MTVA 3KN2A 6GCHG 1UVOA 1SQTA 1BQYA 1SOZA 4IMQA 2BX4A 2ZO3H 1EZQA 1NFXA 4ABJA 1PPCE 1QURH 3PMJA 1YPEH 3NPSA 2EA3A 2DE9A 2XNIA 1A3BH 2FZZA 1C9TA 2V35A 5EODA 1PPFE 3AK5A 3M3SA 1DFPA 4YLUA 4J1YA 2SGDE 2A2QH 2A1DB 1NS3A 2P8OB 1FMGA 3FP8E 2ZIQH 3T5FH 1CQQA 1UTMA 3GY2A 1SI5H 4R8TB 1C5LH 1JXPA 3EA7A 4DIIH 1Z8GA 3A7XA 3A7ZA 3OU0A 4ISLA 2Z6BD 2H9TH 3GCHB 1ANEA 4U30A 1T8NA 2KAIA 3EA8A 1SBWA 4RKJB 1UK2A 1TX6A 1KXEA 1Y59T 5EW2H 1HAYB 2XC4A 2IJD1 3Q3XA 1TB6H 5DP7A 2ZCHP 2WV4A 3PYHA 2BHGA 2FO9A 1EZXC 1HAVB 5C1UA 2BDCA 3AW0A 1AD8H 1GHXH 2FOHA 1SFIA 4O3TA 4GPGA 1GI0A 3P70B 3TK9A 1C5RA 2B8OH 1W14U 2ODQA 1RIWB 2VGCC 3FZDA 1QQUA 1O2HA 1TABE 2QA9E 1IHSH 3O8DA 3LONA 5T3HA 1J16A 2ZF0H 2BYAX 1IHTH 1SGRE 2J92A 1YLCA 1EAIA 4IW4E 4FUGA 1G30B 3HGNA 5EXLA 5LPRA 5LGOA 3D65E 1BTWA 4OM9A 3LH1A 1EUFA 1O35A 2I6SA 4Y11E 1TRMA 3RXBA 3LIWA 1C5MD 2ANMH 1GI6A 1TIOA 5EOKA 1AFEH 2EC9H 2BDGA 1QL9A 4GCHF 4MNVA 4CR9A 1CA0C 3VXEH 3SORA 1G2MA 3EE0B 4RN6A 3S69A 1LHDH 1T8LA 3SNEA 4KTSA 3VGCC 1IQEA 1DS2E 2FYRA 4D7GA 3QWCH 4BXSA 1J8AA 1WAYB 1QB9A 4FUFA 5A8XA 1T7CA 1TMTH 5B6LA 1V2ST 1MU6B 1HXEH 3K65B 5DP5A 1KXFA 2ULLA 2EI6A 1QL8A 2IN2A 2VWLA 1UMAH 1NPMA 1GG6B 1XUFA 1OWJA 3PMHB 1LHFH 5EPYA 1EB2A 4WH8A 2FOCA 1KLTA 1NFWA 3HK6B 1SLXB 4ZHAA 4IBLH 1YM0A 5HM2A 1VZQH 1TA6A 2RDLA 1NRSH 1V2KT 1QL7A 3RU4T 5AFZH 1IQNA 2ZCKP 1CA8B 4MPUA 2BTCE 2C8XB 3P8OA 2HNTC 3A89A 6LPRA 3V3MA 1PPEE 4D9RA 3BTWE 1NZQH 3SU6A 4BTUB 2R2WU 4D8NA 2EEKA 1N8OC 4I31A 1YF4A 1JBUH 1H1BA 1MQ6A 1P57B 2P16A 1PPZA 1OWHA 7ESTE 1GJDB 2BD9A 1YPKH 1ELEE 1YCPM 1TNIA 3GDSA 4U2WA 1SSXA 1O31A 1FQ3A 1EX3A 1GI5A 1GBDA 2BXTH 2GV6A 1KDQA 1L1JA 1QA0A 3MOCA 3SV7A 1AI8H 2K1QA 1ZYOA 2QXGA 1GPZA 3RXRA 1QRZA 4XE4A 1LKAA 2Y7XA 4ISHH 3Q3YA 4NWLA 2J2UA 1DSUA 1LHEH 2WPJS 5DO4H 3MO6A 1OWDA 3E8LA 1DDJA 1Q31A 1GVLA 3IWMA 4UEHH 1O2VA 2F9BH 1LVYA 1BTUA 8LPRA 1TPPA 1Y3YA 3KQBA 2A4GA 1Z71A 1GBIA 4DJZB 1TE0A 2ZKSA 1O0DH 1YC0A 1AUJA 1TPAE 2HNTE 4MNYA 2XCNA 1P2OA 4FU8A 1TNGA 2GDDA 1SGCA 1IQJA 2HGTH 3RXOA 1MZDA 1RTKA 3M7UA 2J94A 1GBFA 2BLWA 1KIGH 2KAIB 3GDVA 1E0FD 5I46H 2ZTXA 1O2YA 4GAWA 4X2YA 1YCPH 1Y5AT 1O5FH 2AYWA 3KF2A 4IC6A 4Y6DA 1HAHH 4INHA 1UVPA 1YPGH 4TPIZ 3P95A 1N6XA 3LJOA 5I25A 1MH0A 4FUIA 2PR3A 4XDEA 4UFEH 5C1XA 3BTHE 3M3TA 1XUHA 1AVWA 2XBWA 3LGUA 3UFAA 2D26C 3UUZA 1O3OA 1THSH 1SMFE 4UDWH 1O2UA 3DA9B 3ODDA 1J17T 5EQQA 4AB9A 1TOMH 2Y5GA 1OPHB 1L4ZA 1MTNB 4X1PU 1TNKA 1P2MA 1VCQA 2QGRA 4YOIA 3GICB 1GI7B 3LGIA 1ZRBA 1GVKB 1QY6A 1O2IA 3SJIA 1AMHA 3OX7U 1SGTA 1XKBC 1F0TA 3GISB 3URDA 2TGTA 2XWBI 2FYQA 1ESTA 1IQKA 5ABWA 4TYDA 4CREA 3E90B 5EW1H 1JMOH 1W2KH 1K1JA 3O8BA 2A31A 1TGBA 1AY6H 3M37A 3QX5H 4NFFA 1Z8IB 2P3FH 1C5XB 4NFEA 1P01A 4X0WU 1OS8A 4O9VA 1DE7H 1YPJH 4YESB 1ZSLA 1E35B 4Y79A 4ABGA 1XUIA 4Q7XA 1TGTA 5AVDA 2Y5HA 3QZRA 4RKOB 1HCGA 3SV9A 4H6SB 3MYWA 1P2IA 1SGQE 4YO9A 5JB8S 1L2EA 5T1VA 1P2QA 4WVPE 1F0UA 1F5KU 2FI4E 2NU3E 2QXJA 1HUTH 2ZHEH 1HDTH 2AGIX 2VIDA 1PPBH 3M5LA 4CRGA 4I8JA 1F92A 1ELTA 1V2NT 1TX8A 2FI3E 1O33A 1O2MA 1P04A 2OUAA 3RXIA 1OSSA 4GSOA 2ZU4A 3TIUA 4YM9A 2F91A 1WCZA 1C2MA 4ZUHA 5DK1A 2NWNA 4OS2A 3GY5A
chains in the Genus database with same CATH superfamily
1XUJA 4INKA 2VWOA 3FP6E 5GIBA 2Z9KA 2ASUB 4CRDA 2R3UA 2QAAA 2BY9X 2VVVA 2FS9A 2JKHA 4LXBH 1TRNA 1LKBA 1SG8B 3RM0H 3CP7A 1TGSZ 4DCDA 3LDXH 2ODPA 1ZGVA 5EQRA 2STAE 3ZVCA 2GMTB 2R0LA 3VPKA 1CE5A 4ABIA 1UCYE 1C5UA 2UWPA 1GGDC 4KELA 1GJ4H 4UE7H 2YNBA 4D9QA 3AASA 3VB3A 1KDQB 1GWAA 3E91A 1O2RA 3EQ0H 1B0FA 1A61H 1P11E 4OS5A 3UPEA 4ABDA 1FPHH 1O2KA 2Y6TA 1H9LB 3AVZA 1VKYA 2BVSH 2QN5T 3M61U 2J9NA 2GP9B 4XRNA 2Y82A 1BMLA 2VH0A 3H5CB 5DSFA 1C5WB 2OD3B 4JYVH 4XFQA 1SGPE 3F6UH 3VB4A 1TBQH 4E7NA 4XOJA 3T27A 1ZZZA 4ACAA 2VU8E 1CHOF 3E1XB 1G3EA 3TVJB 4K2YA 2ZU5A 5HYOA 3OTPA 1DXWA 2A5IA 3A7VA 3KYGA 3G01A 1CSOE 2XWAA 1ZHRA 5EPNA 1DY8A 3KIDU 3MQKC 3GS9A 4TY7A 4WMEA 1OYTH 1UK4A 1DWDH 1F0SA 1GI3A 3UAIC 1DITH 4KKDA 3BTKE 3PRBA 2V3OH 4TY6A 4ABEA 1SC8U 1TOCB 1VCWA 3TJVA 3R3GB 4B76A 3WW7A 4ZKOU 3A7YA 3DD2H 1A0HB 1A7SA 3OY6U 2ZEBA 3VXFH 1GBTA 1GHVH 1D6WA 5EU8A 1RTLA 3K2UA 1SR5C 2ZFPH 2QY0B 1AO5A 1UCYH 2AEIH 1GVZA 1HBTH 2V7QD 2GZ8A 2JJ2D 2QIQA 1E37B 3C1KA 2TGDA 3UQVA 2ZHQH 4K60A 4Q2KA 2BM2A 2OC8A 1W0JD 4X1SU 5ESTE 1EAXA 1WTHD 5FPSA 1O2GH 4JZFH 2R0KA 1O36A 2CXVA 1O3CA 2LELA 1ZHMA 3F68H 3SU4A 5A8YA 1BTYA 1W10U 2BLQA 1AQ7A 4UD9H 1COWD 1DPOA 2OC1A 3SHCH 3TITA 3TK5A 4XBDA 5H4IB 2H9HA 2AGEX 3BTFE 1ZJKA 2HNTF 4NZQA 3VB5A 1CT0E 1C5YB 1YP9A 2A2XH 4X8SH 1SB1H 1FNIA 3MWIU 4JYTA 3SJOA 2H1UA 2LPRA 1P12E 1V2OT 1NT1A 1C1NA 2Q6FA 3F1SB 2KCYA 4SGBE 3SU2A 1HAZB 3TNSA 1NU7B 5EJ1A 3SV8A 4AZ2B 1EZUC 3RXCA 2O8WA 1PPHE 4Y71A 1C2HA 1E36B 5LPEA 5HMAA 1AKSA 3M5OA 3NK8A 3E0NB 1GHYH 1G9IE 4GCHG 1ZTKA 2ZA5A 1FAXA 1TBRH 1TBZH 3MU4A 3TPIZ 2HPPH 4FUCA 3T26A 3ZZCA 4AC9A 4A92A 1MU8B 5CE1A 1DXPA 1WBGB 3PLKA 1TPOA 3W1EA 2SGAA 1EOJA 1BT7A 1O3JA 1FDPA 1YPLH 2R2MB 3LOXA 1E34B 3OY5U 4KTCA 1AZZA 2OBOA 4Y10E 1VITH 1A3EH 2FM2A 2P93A 3DFJA 4FU7A 3ATIA 2KCAA 5FHTA 1HAXB 4X6OA 3OTJE 2VGCB 3HATH 5JB9S 2C4FH 3E6PH 2G00A 1A5HA 4MG3A 3UR6A 1K1LA 2ZFFH 3KQEA 1UTJA 2GZ7A 3MH6A 2ZFSA 1S5SA 2ZTYA 1GJ9B 1OYQA 4JZEH 1ACBE 1UHBA 2ZPRA 1V2LT 5LH8A 3BTGE 1O2TA 2VIVA 1VITG 4MVNA 5LPFA 2FLRH 4BAMB 2ZG0H 1ELDE 1KYNA 2BB4A 2GCTC 4K1EA 3HKIB 1XMNB 1C2IA 2HALA 2ILNA 2QCYA 4ZHMU 3M5MA 3NZIA 5GNDA 1CA0B 2KFWA 2PW8H 1ETRH 4B6EA 3A8CA 1GBAA 2GCHG 5GJ4B 1C2FA 1O2NA 2Y7ZA 5L30H 2EI8A 2WYGA 3NRLA 1TFXA 3VGCB 1WTGH 3PO1C 3A8BA 2SNWA 1K1PA 5DP8A 5JBBS 1MTWA 2ZFTA 4I86A 1GHZA 5E0HA 1EPTC 1NESE 1ZTLA 4QT8C 3LJJA 4YOGA 1P06A 1PJPA 4DY7B 3LU9B 1HAPH 1LQDB 1O3EA 1GBLA 1NFUA 3C27B 1SLUB 1A1RA 3RXMA 1T8OA 1ANDA 3RXTA 4DOQA 1B5GH 3UNSA 1D9IA 4IGDA 3RM2H 1EASA 5T6GA 4ESTE 1S6LA 3ZZ9A 1VGCC 2ZPQA 5DP3A 1V2QT 3A7TA 1SPJA 1JIRA 3TU7H 3F3BA 1UTLM 3DSOA 3GCTF 1THPB 9ESTA 5E8EH 1GMCG 4SGAE 1DOJA 1V2JT 3SUGA 1Y5BT 1GDNA 2FWWA 3QTOH 3A82A 1Q2WA 1ELAA 4NA9H 3A83A 1FY5A 3LGWA 1N8OB 2WHXA 4Q7YA 2OQUA 1O2LA 3GOVB 4RSPA 1OOKB 4K1SA 1QZ8A 2F4LA 3E16B 3S9AA 2BDHA 3ZZ4A 1PQ5A 4Y7BA 5EG4A 1K2I1 5A0BA 4AN7A 4IN2A 1AVGH 4JK5A 1O38A 3UOPA 1LO6A 1OWEA 2BMGB 2L6OA 2VVUA 4IN1A 4CBOA 1XM1A 1ZSJA 3TLOA 1E1QD 4MTBA 1NRPH 4ABAA 1T8MA 2AMPA 1ZSKA 1BBRH 1T4VH 3GCNA 1C5OH 4X1RU 2ZDKA 2P3UB 3GY8A 1HAGE 7LPRA 2BD8A 1C1UH 3N7DA 1C2KA 2O8TA 1P0SH 1ZPCA 4K8YA 3F2HA 1F2SE 4TWWA 3PTNA 1GMHF 3DT0H 7GCHG 2J95A 1A2CH 1PPGE 2VWNA 3SV2H 1ESAA 2PUXB 5DKMA 1GHWH 2IPQX 1KLJH 1Q3XA 1V2PT 2BVXH 4CRBA 5L2ZH 2FIRH 3FAOA 1TMUH 3DUXH 1DX5M 3QK1A 1TRYA 1BCUH 1LPGB 4CR5A 3MMGA 2OINA 2ZGCA 3U98H 1AKSB 4TPYA 1F5RA 3O8CA 5IYTA 4DURA 1CGJE 3F2GA 4FVBA 3T2NA 1H9HE 5GPIB 1ZPZA 3MNXA 4ZAEA 4CH2B 2QF3A 3H09A 1FPCH 5KECA 1ZTJA 4JZDH 1CGHA 1YPHC 1BITA 3RU4E 2PFEA 2XW9A 1W11U 3LGVA 1VITF 1SGFG 1THRH 3CS7A 1A0JA 4P02A 1SGNE 1FONA 2WPMS 1NO9H 2XCFA 3LT3A 2C90B 4INLA 3NKKA 4YZUA 1HJ9A 2O8UA 1IAUA 2J98A 2QC2A 2P95A 2BD2A 4ZKNU 2GCHF 2V3HH 3P8NA 5GWZA 1O2PA 5FCKA 2VBCA 4NIVA 2KCOA 1NROH 1GBMA 1KXBA 5FCRA 4MNWA 1C1PA 1N6YA 3SBKA 4F55A 3M7QA 1G37A 5BPEA 2RA3A 2AFQB 1D3DB 3ENSB 4NCYA 1UHBB 4I8HA 1BMFD 1SVPA 1D3TB 1A46H 1PYTC 3SJ9A 1T31A 4K8BA 4I8LA 1NRQH 5G4BA 1YGCH 1MUEB 1AZ8A 1Z1IA 3RC5A 5KEDA 1ZOMA 1HYLA 2A5KA 1WSSH 2JETC 3UOUA 4AX9H 4FUBA 4ASHA 3RXPA 2ESTE 3FFGA 1BTPA 1MKXH 2V6NA 2A7CA 5AF9H 1OWIA 1QTFA 2GGVB 4AG1A 4DT7B 2Z9GA 5DP4A 2VIQA 1GMCF 1IQHA 3BTEE 1TX7A 1V2RT 2HLCA 1WUNH 4FUDA 3ODFA 2Q6DA 3U1IB 1O34A 5FPTA 1CGIE 1O3DA 4B2AA 3UR9A 4Y8YA 2W6JD 4BAOB 2BOKA 1BMNH 1C5PA 4BANB 1GBJA 3LKWA 1UTOA 4WXIA 3SOSA 2BDAA 1QNJA 1H8DH 1Y5UT 2G8TA 4AFQA 4HGCA 2C93B 4GHTA 1INCA 3ZZ8A 1ETTH 1QB1A 2Z3DA 1S85A 1BRUP 3SI3H 1F0RA 3NXPA 4HG6A 2ANWA 4AYVB 3PLPA 1T32A 1Z8RA 3L6PA 4ZMAH 1AWFH 1GDUA 1SGFA 1CHOG 4U32A 1LCYA 1O3PB 2GDEH 4NWKA 3QUMP 2Z94A 3LC3A 5DG6A 4UFGH 2AIPA 5JYIA 4K69A 4XD7D 3BN9A 1DUAA 1O5EH 5EJLA 5A8ZA 4CHAC 2OP9A 2Z9LA 1XXFA 1L4DA 2OQ5A 2VIPA 1G2LA 4ZH8A 1VR1H 4CH8B 7GCHF 1NBME 1SOTA 2KX4A 2AMDA 1LHCH 2J97A 2PWXA 1DICA 3BEFB 1GHBF 1GHAF 1C5ZB 2Y81A 2AGGX 1KXDA 2ODYB 1GGDB 2WYJA 1SGIB 1LMWB 3V7TA 2G52A 3QLPH 2ZU3A 1FI8A 3A8DA 4OS6A 1W0YH 2B9LA 3UWJH 3VFEA 1ANCA 2ZP0H 5CDFE 2FOBA 4JYUH 1L0ZA 1QBNA 4CBNA 4KTUA 2Q6GA 3S9CA 3RDZA 4I8KA 2ZC9H 2GTBA 3H7OA 1K1MA 4PROA 1J9CH 2FDAA 5ESBA 4ABFA 5TCAA 2A5AA 1ZMJA 1V6DA 3EYDA 1KTTB 1MCTA 1GBHA 1GJ7B 1GI1A 3N7EA 1DWBH 3DSGA 8GCHG 2BY5X 2FOFA 2XXLA 4BTTB 2H9EH 2BXUH 3MU8A 3P8FA 1TMBH 2G4TA 3MH7A 1MAYA 5CHBA 5A09A 2PGQB 1CT2E 4H42U 2Z9JA 2GJGA 1DANH 3RU4D 4O3UA 4ABBA 3W94A 2A4QA 2O8LA 1VJAU 3OEED 5EXNA 4Y0YE 3GY6A 4JMYA 5IDKA 1K0HA 1K1IA 1P10A 4ZXXH 3A8AA 5GDSH 1FY8E 3F9HA 2KR7A 1G3CA 1IOEA 4JCNA 1TA2A 1PFXC 4X1QU 2NU2E 3P17H 3PLBA 1BOQA 2J98B 1V2VT 2UUJB 3PM3A 2FI5E 4ISOA 3BIVH 4BAHB 3L3TA 1EAWA 1IQLA 1MAXA 1AU8A 3LGTA 1Y8TA 2STBE 3GYLB 2D2DA 3FANA 1O3GA 1MBQA 1O39A 2FOMB 1TQ0B 2BQWB 2CF8H 2BD4A 2PKSC 1G36A 3FP7E 1P9SA 1ZJDA 2LNCA 3UNQA 2BDYA 5TCCA 2QF5A 5FAHA 2ZCLP 4X8UH 1GL0E 3HGPA 3SNAA 1QB6A 2FOEA 4Z6AH 1C1TA 2FPZA 3UREA 2L74A 1QHRB 3ZVAA 2A7JA 1NRRH 2TIOA 2WSSD 1TNLA 4DVAU 1V3XA 1SGYE 2B7DH 2UWOA 1C5NH 1C5VA 1CBWC 3M35A 1O3MA 1NTPA 1LVBA 4NZLA 1VJ9U 1YCPK 3GYMA 3JZ2B 5C1YA 2NU0E 5SGAE 2RCEA 1K28D 3MU1A 5T6DA 1BA8B 1O2JA 2ZHDA 3I77A 2FP7B 8KME2 1C1MA 4K3JA 1FV9A 1LVOA 2QXIA 2Y80A 1P03A 4ISIH 4MQAA 1OHHD 4DW2U 4ZROA 1S82A 4D7FA 5JPMH 2QYIA 5JBCS 2F9NA 1KTSB 1HAIH 3A86A 3LGYA 2W26A 5DP9A 2WV5A 3AAVA 5L2YH 1ID5H 2EI7A 3K9XB 2OLGA 1AE5A 2UUYA 1XVMA 5EGMA 1HJAC 2PKAA 1O32A 3BTME 3MFJA 1LTOA 2FLBH 3RC6A 5DPAA 5C17A 1D3PB 2CK3D 5PTPA 1Y3VA 2XBVA 2FX6A 3WWBA 2ZHFH 3TGKE 1WYKA 5HXFA 3HK3B 4A1TA 5JBTA 1TNJA 3FVFB 1RFNA 2C3SA 2BD5A 2KCPA 1MQ5A 2A4RA 3PMAB 2ANKH 2JH6D 5E2OA 1K22H 4A1XA 1QCPA 3D49H 1BTXA 1P2KA 1RRKA 3A81A 1PYTD 1P05A 4TSFD 5C67A 5K7RA 1ARBA 2EY4C 1QR3E 3QO6A 1AFQC 1LPKB 3T25A 7KMEH 1NBMD 2H2ZA 3GCTG 2W6ID 2GCTB 4NSVA 5GCHG 1FZZA 3T29A 6CHAC 3MHWU 3BG4C 2AMQA 1T4UH 2BQ6B 3QGNB 1BJUA 1U6QA 2A7HA 3P8GA 3HKJB 4E05H 1SHHB 2IPHA 5CHAC 2K8IA 2XNDD 1Y3UA 3MU5A 4NGAH 2RG3A 1UTNA 2OCVB 4AFZA 1ZMLA 3SJ8A 1X7AC 8GCHF 5DGJA 2CHAC 3KHVA 4HFPB 3PO1B 3VG8A 1XVOA 1O5BB 5L6NH 1OP8A 3ZVEA 1MBMA 2WPKS 1BTZA 1UTPA 3BF6H 1FN6A 2D1JA 3URCA 1EPTB 1XUKA 2CMYA 1QFKH 2HWLB 1EOLA 4JK6A 3F9FA 1ELBA 3D62A 3KEEA 4Q63A 1O2QA 5B6OA 3KQCA 3Q76A 1AHTH 4X2XA 4JZIA 4LOYH 3TH3H 4BAQB 3M3VA 4GLYA 9LPRA 1C4V2 1C1SA 1GI4A 1JRTA 3E3TA 1ZHPA 1PQ7A 1VGCB 2UWLA 3F0PA 2PHBA 3MNSA 1KXCA 4FU9A 4WH6A 1C5SA 2Z3EA 2ZECA 1GMHG 2ZGJA 1O2XA 1JWTA 4ZKSU 1BB0B 1LDTT 4DT4A 1P9UA 3MI4A 4BXWA 4MPXA 3O8RA 4Q4LA 3MTYA 1C2DA 3RXQA 4AOQA 3ATMA 2GD4B 2R9PA 5DJ7A 5EXMA 5FPYA 3RXUA 4BNRA 1E38B 1LQEA 1TGNA 2F43B 4MNXA 3RXDA 3ELAH 3OFND 2G5VA 3RXFA 3SI4H 1ESBA 3PWCA 4E06H 4Y0ZE 1F7ZA 2HLDD 3A84A 1SLWB 3PMBB 5E0JA 4YLQH 4ZHLU 2OC0A 3ZV8A 1BMAA 5DP6A 4AFUA 3UY9A 1XX9A 2VWMA 1GCDA 1GCTC 3ZZ6A 3TGIE 5FBIA 3U69H 1TYNA 1Z6JH 3ATWA 3SUEA 2RFKC 2GT8A 2XYAA 3SUDA 1BIOA 2WZQA 1A5IA 1QJ7B 4GUXA 2VNTA 2IJOB 1S81A 6ESTA 3SZEA 4B71A 4M7GA 2A32A 4B74A 3GCOA 5C94A 4TWYA 3PWBA 4UONA 2BOHB 2DE8A 1H8IH 3SU1A 1BHXF 2PV9B 1YBWA 1YYY1 1S0QA 2BD7A 2ZQ1A 4AGKA 4UFDH 4ZXYH 1BBRE 3UWIA 3BEUA 4AB8A 2NU1E 3VEQB 1UCYK 3I29A 3SU5A 1MABB 1MTSA 1WOFA 1AVXA 2GX4A 3ZZAA 1CT4E 5EJZA 3S7KB 1O37A 4Z0KA 2JH5D 4NG9H 3S0NA 4BTIB 2VVCA 3B9FH 2BDIA 4JZ1A 1AB9C 4YXWD 4WJG2 1AN1E 1FIZA 5GCHF 1GDQA 3TK6A 4FETA 1GL1A 2PKAB 4MPVA 4VGCC 2XBYA 4YTAA 2F9PA 1K21H 2HOBA 3DSPA 2FMJA 4XBCA 4Y8XA 4K5ZA 1KLIH 1OKXA 1E79D 1C4Y2 2EQNA 1SQAA 2W7SA 1V2MT 3S9BA 1ZRKA 2BX3A 4IC5A 4X6MA 2ZGXH 3MU0A 2F9VA 4O03A 3JZ1B 2ZTZA 3ZZBA 1UW7A 2ZDVH 1MKWH 1JRSA 4WMDA 4X8TH 3TJNA 2CN0H 2ZDAH 4B75A 3V0XA 2FX4A 2ZGBH 1UO6A 3KNXA 2XRCA 3RXHA 4F4OC 4DG4A 2B0FA 3MO9A 3U8OH 1C9PA 1UVSH 3NUMA 2JETB 1AUTC 1SQRA 2PUQH 3A85A 3ZYEA 3IITA 1GJ6A 2SFAA 5F8TA 1CU1A 1EXFA 4IS5A 1Z7KA 5HM9A 1P2JA 2SGPE 1S83A 3BIUH 1CVWH 1TGCA 5FBEA 1YWUA 3RXJA 1O3NA 1OXGA 5JDUB 2ZU1A 5FX5A 1P3EA 3B8JA 2LP6A 4XSKU 1WXRA 1ETSH 1GBEA 2SGFE 1GHBG 1GHAG 3LC5A 1HFDA 3ZV9A 2ZFQH 1TALA 1GJCB 1RTFB 1ANBA 3ATLA 4NSYA 1O2ZA 1V2WT 5C0TA 3VB6A 3A87A 1UJ1A 3Q00A 5A0AE 2VB0A 1SFQB 2ZHWH 2GT7A 1YPMH 5F8ZA 2H5DA 3V12A 1NN6A 1UVTH 1J15A 4OS1A 4BOHA 1DY9A 1WU1A 1ZMNA 1J14A 1QGFA 2P8OC 2FEQH 3Q77A 1YLDA 2AS9A 2WPDD 3SNCA 2QF0A 1QQ4A 2FXRA 1FLEE 2BQ7B 3M36A 1TQ7B 1BHXB 2GV7A 3SQEE 3QGJA 2XC5A 1L1NA 1GI8B 4CHAB 2ALVA 2FTMA 1TNHA 2DUCA 1XKAC 3L33A 3W95A 3GCHC 3R0FA 2ZU2A 4Q7ZA 2QV1A 2W5EA 4YT7H 4FVDA 3QTVH 1EP6A 2ZDMA 1C2EA 3SGBE 1DWCH 4GVUA 4HI3A 1H8HD 1V2TT 1FY3A 2ZDNA 4AFSA 2OTVA 2Z7FE 2V3MA 3RLWH 3A88A 1QRXA 6GCHF 3RXEA 3SZNA 1TAWA 5IK2D 1C1RA 3EDXB 3WY8A 1QJ6B 1O3HA 1M9UA 2BLVA 5HIYA 1NM6A 1F5LA 1RIWC 3F9GA 3UIRA 2J5UA 2PLXA 3ZVGA 1O2OA 2ZGHA 4FUJA 2R3YA 3VB7A 1XXDA 4X6PA 4Y76A 1HIAA 3PV4A 5FX6A 3TJUA 1C5TA 2PSYA 4I8GA 4NIYA 3SNDA 1O3AA 1P02A 3TGJE 1EJNA 1DWEH 2WPLS 4B73A 1AWHB 3KCGH 2TGPZ 2XBXA 2Z9IA 3AAUA 1P8VC 3EE7A 1MCVA 1WQSA 5EQSA 1DVAH 1O3IA 1YPHE 4LK4A 1BTHH 1D4PB 2WPHS 1C5QA 2ZNKH 1EB1H 4MDSA 2F9UA 1C1WH 1JOUB 2CGAA 1SLVB 1MKWK 3U8TH 1CHGA 4O97A 1L1GA 2ANYA 5C2ZA 1EQ9A 1NFYA 1OP0A 1Z6EA 2PSXA 1GMDG 1W13U 1K1NA 1YLNA 2W3KA 1K9OE 1BBRK 1W3CA 1GI9B 3ZYDA 5A0CA 1SL3A 1W7XH 1WDIA 2SGQE 5BRRE 3OSYA 1GJ5H 2PTCE 4J2YB 2C8ZB 3I78A 3KGPA 2BY6X 1GG6C 3MNCA 1SKYE 4ISNA 1TPSA 1K1OA 1O30A 2F3CE 1O5DH 2VINA 3SN8A 1O3FA 2BY8X 2AH4X 3Q3KA 2I6QA 1BRAA 2BD3A 1S6FA 4UFFH 1BRCE 3KQDA 4YT6H 4A7IB 1RS0A 1FY1A 2PKSB 3H7TA 4AYYB 1W8BH 1Z8JB 3ZZ7A 1JIMA 3M5NA 1MZAA 4CRFA 1RGQA 4HZHA 3ZIAD 4XBBA 4LZ4B 1BZXE 3U9AH 1C2LA 3FO8D 3SGAE 4X6NA 3MO3A 1SGEE 1S6HA 2A4OA 3NWUA 1D3QB 2AIQA 2B5TB 1HB0B 2WUCA 1CBWB 5C20A 1UK3A 5C0UA 1EPTA 2CF9H 2ZWLH 2VIOA 3TH4H 1FUJA 4DIHH 3SHAH 1GJAB 1GJBB 2H6MA 1AGJA 1BMMH 2PP6A 1P2NA 3BTTE 4K1TA 4WWYA 4RT1A 4A1VA 2P3TB 1Z1JA 1S84A 1ELCA 1FJSA 1AIXH 4X1NU 2M2AA 3ITIA 3PV2A 3P92A 1LVMA 3ZZ5A 3RP2A 4WF8A 3TJOA 3QZQA 2G51A 3T62A 4WY3A 4WXVA 1HJAB 3PB1E 5ETXA 1C1VH 3TH2H 1EZSC 1G3BA 1DSTA 1HNEE 2VIWA 3TNTA 2G81E 1OX1A 1WQVH 2YMSC 2FS8A 4NA7A 4ZKRU 2BVRH 3B23B 2WPIS 1C4U2 2HVXA 4WMFA 1NU9A 1SHYA 3N7OA 1IQFA 4CRAA 4B2BA 4CRCA 1RJXB 1ABJH 4M9FA 1Y3XA 1ELVA 2JH0D 1RD3B 1DUEA 2WV9A 2F83A 3EGKH 5F6MA 1ZPBA 1RXPA 1HRTH 5C5NA 1AFQB 2HVYB 1MKXK 1AE8H 2VH6A 1A4WH 3WWFA 4MLFB 1O3KA 2J34A 1S0RA 6CHAB 1ABIH 2HRVA 3BG4B 2GZ9A 4A5TS 2IOTA 2UUKB 3GY4A 1V2UT 1W12U 1QJ1B 3AW1A 3PTBA 4THNH 5CHAB 5C3NA 1DLEA 4B6FA 4I32A 2A45B 1LHGH 8ESTE 1KY9A 2CHAB 4Y7AA 1OWKA 1QBOA 2ALPA 4YOJA 1UVUH 3V13A 4U01A 3RXAA 2W7UA 2CV3A 1FXYA 1B0EA 2WINI 3D23A 3QDZB 1ARCA 4MPWA 5AHGH 2BZ6H 2UUFB 4F49A 2M5TA 1GBBA 3UTUH 2RA0A 1QIXB 3RMNH 1HIAB 1GMDF 2FOAA 3DCLA 2AERH 2C8WB 1W7GH 2THFB 1MTNC 1UTKA 1O2WA 4AGJA 4OGXA 3K6YA 1PQAA 3UQOA 3DHKH 2FOGA 4X2VA 3EA9A 3T28A 4ABHA 3GDUA 5J4SA 2YNAA 1HXFH 4AORA 2OXSA 2QXHA 2YOLA 4NA8A 1YKTA 2OK5A 3RXVA 1BDAA 2ZI2H 2J38A 3M7TA 1O5GH 5F03A 1TONA 2G55A 4E7RG 1O2SA 1ZR0A 4AG2A 1P09A 1QRWA 1C1OA 4FUHA 5C5OA 4OS7A 1FIWA 2P59A 1HLTH 2XTTB 3F0OA 3RXKA 4A6LA 3ZVDA 1QA7A 4Z1MD 4I33A 3BSQA 2BLOA 3F9EA 5JBAS 1TWXB 1IQGA 1EKBB 3SU3A 1BJVA 4B2CA 2OC7A 3UNRA 3FZZA 1NY22 2OBQA 5CMXH 1C1QA 2VJ1A 4GHQA 5T6FA 1OP2A 1MD8A 4P00A 1G3DA 5E0GA 4NIXA 3A7WA 3BV9B 3GY3A 4TT3D 3RXGA 1HAVA 2O8MA 1GCTB 1MMJN 3ZZDA 3RMMH 4IMZA 2TPIZ 1MTUA 3PV5A 2TBSA 2C8YB 2G4UA 1SQOA 4R0IA 1NRNH 1DLKB 3ATKA 2H5CA 4HTCH 3STJA 4DGJA 2FODA 4FXGH 1HJ8A 5J4QA 2GVFA 2V0BA 3OE7D 3ZVBA 2PTNA 1ELFA 1QBVH 2SNVA 3SUFA 2AHME 3OYPA 1PQ8A 5AFYH 5HKKD 1XUGA 1D6RA 3BG8A 3CS0A 2Z3CA 2A0QB 2BY7X 4FUEA 3MH4A 3SQHE 4H4FA 4BAKB 1EJMA 2CJIA 3FKSD 2PGBB 3P6ZB 1FY4A 2GKVE 2GMTC 3LH3A 3SO3A 3E0PB 1H4WA 2J4IA 3K6ZA 1IQMA 5GXPA 3PRDA 3RXLA 3ZZ3A 1BUIA 3SNBA 1ELGA 5FXLA 1EP5A 1B7XB 1GBCA 1SGDE 3BTQE 1ORFA 2ZFRH 1GI2A 4H6TA 1DM4B 1O5AB 2ZPSA 3DFLA 1KSNA 5FL7D 1GBKA 1AB9B 2QE7D 4OS4A 2P94A 3KQ5A 3SV6A 1W0KD 3MNBA 1HAOH 2HPQH 1ZGIA 4KP0A 3RC4A 2D8WA 1N1LA 1G32B 3RMOH 1FX0B 4RI0A 2FTLE 4VGCB 2SGEE 1MD7A 1EATA 4NIWA 3HPTB 2Q1JA 1TLDA 3QN7A 4D76A 3U1JB 2BDBA 1O3BA 2XC0A 3BEIB 1O5CB 3EAJA 3IG6B 3SW2B 1Y3WA 1DT2A 1UTQA 2G5NA 2ZDLA 3ESTA 2ZQ2A 5E2PA 4Y8ZA 3MH5A 1LPZB 1FAKH 1VCPA 2NU4E 4X2WA 1BRBE 3U8RH 2O9QA 3GY7A 3RMLH 1FN8A 2FESH 5TJXA 2TGAA 3SJKA 5HGGA 1H9IE 1HGTH 5F8XA 3RUOA 2BZAA 1KXAA 1EAUA 3A80A 3SGQE 2TRMA 4LZ1H 4Q80A 3RXSA 4FOUC 1C2GA 2Y5FA 1A5GH 4KGAA 3RLYH 1A0LA 1W0ZU 2W3IA 1WV7H 1ZLRA 1IQIA 1HV7A 1O3LA 3LPRA 3NCLA 4X8VH 4I7YH 1GJ8B 3BTDE 2ZZUH 3SU0A 5F53A 1CO7E 3KL6A 2RDEA 3ZVFA 5K0HA 3S7HB 1EJAA 1C2JA 2JDID 4OGYA 5A2MH 3STIA 2F9OA 3SYJA 3CENA 1NC6A 3PROA 4B1TA 1HPGA 2WUBA 1P3CA 1MTVA 3KN2A 6GCHG 1UVOA 2YMSD 1SQTA 1BQYA 1SOZA 4IMQA 2BX4A 2ZO3H 1EZQA 3U28C 1NFXA 4ABJA 1PPCE 1QURH 3PMJA 1YPEH 3NPSA 2EA3A 2DE9A 2XNIA 1A3BH 2FZZA 1C9TA 2V35A 5EODA 1PPFE 3AK5A 3M3SA 1DFPA 4YLUA 4J1YA 2SGDE 2A2QH 2A1DB 1NS3A 2P8OB 1FMGA 3FP8E 2ZIQH 3T5FH 1CQQA 1UTMA 3GY2A 1SI5H 4R8TB 1C5LH 1JXPA 3EA7A 4DIIH 1Z8GA 5EIYA 3A7XA 3A7ZA 3OU0A 4ISLA 2Z6BD 2H9TH 3GCHB 1ANEA 4U30A 1T8NA 2KAIA 3EA8A 1SBWA 4RKJB 1UK2A 1TX6A 1KXEA 1Y59T 5EW2H 1HAYB 2XC4A 2IJD1 3Q3XA 1E1RD 1TB6H 5DP7A 2ZCHP 2WV4A 3PYHA 2BHGA 2FO9A 1EZXC 1HAVB 4ZCNA 5C1UA 2BDCA 3AW0A 1AD8H 1GHXH 2FOHA 1SFIA 4O3TA 4GPGA 1GI0A 3P70B 3TK9A 1C5RA 2B8OH 1W14U 2ODQA 1RIWB 2VGCC 3FZDA 1QQUA 1O2HA 1TABE 2QA9E 1IHSH 3O8DA 3LONA 5T3HA 1J16A 2ZF0H 2BYAX 1IHTH 1SGRE 3FN8A 2J92A 1YLCA 1EAIA 4IW4E 4FUGA 3OAAD 1G30B 2JIZD 3HGNA 5EXLA 5LPRA 5LGOA 3D65E 1BTWA 4OM9A 3LH1A 1EUFA 1O35A 2I6SA 4Y11E 1TRMA 3RXBA 3LIWA 1C5MD 2ANMH 1GI6A 1TIOA 5EOKA 1AFEH 2EC9H 2BDGA 1QL9A 4GCHF 4MNVA 4CR9A 1CA0C 3VXEH 3SORA 5HIZA 1G2MA 3EE0B 4RN6A 3S69A 4ASUD 1LHDH 1T8LA 3SNEA 5DN6D 4KTSA 3VGCC 1IQEA 1DS2E 2FYRA 4D7GA 3QWCH 4BXSA 1J8AA 1WAYB 1QB9A 4FUFA 5A8XA 1T7CA 1TMTH 5B6LA 1V2ST 1MU6B 1HXEH 3K65B 5DP5A 1KXFA 2ULLA 2EI6A 1QL8A 2IN2A 2VWLA 1UMAH 1NPMA 1GG6B 1XUFA 1OWJA 3PMHB 1LHFH 5EPYA 1EB2A 4WH8A 2FOCA 1KLTA 1NFWA 3HK6B 1SLXB 4ZHAA 4IBLH 1YM0A 5HM2A 1VZQH 1TA6A 2RDLA 1NRSH 1V2KT 1QL7A 3RU4T 5AFZH 1IQNA 2ZCKP 1CA8B 4MPUA 2BTCE 2C8XB 3P8OA 2HNTC 3A89A 6LPRA 3V3MA 1PPEE 4D9RA 3BTWE 1NZQH 3SU6A 4BTUB 2R2WU 4D8NA 2EEKA 1N8OC 4I31A 1YF4A 1JBUH 1H1BA 1MQ6A 1P57B 2P16A 1PPZA 1OWHA 7ESTE 1GJDB 3F2FA 2BD9A 1YPKH 1ELEE 1YCPM 1TNIA 3GDSA 4U2WA 1SSXA 1O31A 1FQ3A 1EX3A 1GI5A 1GBDA 2BXTH 2GV6A 1KDQA 1L1JA 1QA0A 3MOCA 3SV7A 1AI8H 2K1QA 1ZYOA 2JJ1D 2QXGA 1GPZA 3RXRA 4ACBA 1QRZA 4XE4A 1LKAA 2Y7XA 2K0QA 4ISHH 3Q3YA 4NWLA 2J2UA 1DSUA 1LHEH 2WPJS 5DO4H 3MO6A 1OWDA 1YY3A 3E8LA 1DDJA 1Q31A 2YMSB 1GVLA 3CNRA 3IWMA 4UEHH 1O2VA 2F9BH 1LVYA 1BTUA 8LPRA 1TPPA 1Y3YA 3KQBA 2A4GA 1Z71A 1GBIA 4RT0A 1TE0A 4DJZB 2ZKSA 1O0DH 1YC0A 1AUJA 1TPAE 2HNTE 4MNYA 2XCNA 1P2OA 4FU8A 1TNGA 2GDDA 1SGCA 1IQJA 2HGTH 3RXOA 1MZDA 1RTKA 3M7UA 2J94A 1GBFA 2BLWA 1KIGH 2KAIB 4F48B 3GDVA 1E0FD 5I46H 3UB0A 2ZTXA 1O2YA 4GAWA 4X2YA 1YCPH 1Y5AT 1O5FH 2AYWA 3KF2A 4IC6A 4Y6DA 1HAHH 4INHA 1UVPA 1YPGH 4TPIZ 3P95A 1N6XA 3N99A 1EFRD 3LJOA 5I25A 1MH0A 4FUIA 2PR3A 4XDEA 4UFEH 5C1XA 3BTHE 3M3TA 1XUHA 1AVWA 2KM0A 2XBWA 3LGUA 3UFAA 2D26C 3UUZA 1O3OA 1THSH 1SMFE 4UDWH 1O2UA 3DA9B 1KMHB 3ODDA 1J17T 5EQQA 4AB9A 1TOMH 2Y5GA 1OPHB 1L4ZA 1MTNB 4X1PU 1TNKA 1P2MA 1VCQA 2QGRA 4YOIA 3GICB 1GI7B 3LGIA 1H8ED 1ZRBA 1GVKB 1QY6A 1O2IA 3SJIA 1AMHA 3OX7U 1SGTA 1XKBC 1F0TA 3GISB 3OEHD 3URDA 2TGTA 2XWBI 2FYQA 1ESTA 1IQKA 5ABWA 4TYDA 4CREA 3E90B 5EW1H 1JMOH 1W2KH 1K1JA 2KZ4A 3O8BA 2A31A 1TGBA 1AY6H 3M37A 3QX5H 4NFFA 1Z8IB 2P3FH 1C5XB 4NFEA 1P01A 4X0WU 1OS8A 4O9VA 1DE7H 1YPJH 4YESB 1ZSLA 1E35B 3KYFA 4Y79A 4ABGA 1XUIA 4Q7XA 1TGTA 5AVDA 2Y5HA 3QZRA 5KGOA 4RKOB 1HCGA 3SV9A 4H6SB 3MYWA 1P2IA 1SGQE 4YO9A 5JB8S 1L2EA 5T1VA 1P2QA 4WVPE 1F0UA 1F5KU 2FI4E 2NU3E 2QXJA 3FOAA 1HUTH 2ZHEH 1HDTH 2AGIX 2VIDA 1PPBH 3M5LA 4CRGA 4I8JA 1F92A 1ELTA 1V2NT 1TX8A 2FI3E 1O33A 1O2MA 1P04A 2OUAA 3RXIA 1OSSA 4GSOA 2ZU4A 3TIUA 4YM9A 2F91A 2QF4A 1WCZA 1C2MA 4ZUHA 5DK1A 2NWNA 4OS2A 2XOKD 3GY5A
chains in the Genus database with same CATH topology
1XUJA 4INKA 2VWOA 3FP6E 5GIBA 2Z9KA 2ASUB 4CRDA 2R3UA 2QAAA 2BY9X 2VVVA 2FS9A 2JKHA 4LXBH 1TRNA 1LKBA 1SG8B 3RM0H 3CP7A 1TGSZ 4DCDA 3LDXH 2ODPA 1ZGVA 5EQRA 2STAE 3ZVCA 2GMTB 2R0LA 3VPKA 1CE5A 4ABIA 1UCYE 1C5UA 2UWPA 1GGDC 4KELA 1GJ4H 4UE7H 2YNBA 4D9QA 3AASA 3VB3A 1KDQB 1GWAA 3E91A 1O2RA 3EQ0H 1B0FA 1A61H 1P11E 4OS5A 3UPEA 4ABDA 1FPHH 1O2KA 2Y6TA 1H9LB 3AVZA 2BVSH 2QN5T 3M61U 2J9NA 2GP9B 2Y82A 1BMLA 2VH0A 3H5CB 5DSFA 1C5WB 2OD3B 4JYVH 4XFQA 1SGPE 3F6UH 3VB4A 1TBQH 4E7NA 4XOJA 3T27A 1ZZZA 2VU8E 1CHOF 3E1XB 1G3EA 3TVJB 4K2YA 2ZU5A 5HYOA 3OTPA 1DXWA 2A5IA 3A7VA 3G01A 1CSOE 2XWAA 1ZHRA 5EPNA 1DY8A 3KIDU 3GS9A 4TY7A 4WMEA 1OYTH 1UK4A 1DWDH 1F0SA 1GI3A 1DITH 4KKDA 3BTKE 3PRBA 2V3OH 4TY6A 4ABEA 1SC8U 1TOCB 1VCWA 3TJVA 3R3GB 4B76A 3WW7A 4ZKOU 3A7YA 3DD2H 1A0HB 1A7SA 3OY6U 2ZEBA 3VXFH 1GBTA 1GHVH 1D6WA 5EU8A 1RTLA 3K2UA 1SR5C 2ZFPH 2QY0B 1AO5A 1UCYH 2AEIH 1GVZA 1HBTH 2V7QD 2GZ8A 2JJ2D 2QIQA 1E37B 3C1KA 2TGDA 3UQVA 2ZHQH 4K60A 4Q2KA 2BM2A 2OC8A 1W0JD 4X1SU 5ESTE 1EAXA 1WTHD 5FPSA 1O2GH 4JZFH 2R0KA 1O36A 2CXVA 1O3CA 2LELA 1ZHMA 3F68H 3SU4A 5A8YA 1BTYA 1W10U 2BLQA 1AQ7A 4UD9H 1COWD 1DPOA 2OC1A 3SHCH 3TITA 3TK5A 4XBDA 5H4IB 2H9HA 2AGEX 3BTFE 1ZJKA 2HNTF 4NZQA 3VB5A 1CT0E 1C5YB 1YP9A 2A2XH 4X8SH 1SB1H 1FNIA 3MWIU 4JYTA 3SJOA 2H1UA 2LPRA 1P12E 1V2OT 1NT1A 1C1NA 2Q6FA 3F1SB 2KCYA 4SGBE 3SU2A 1HAZB 3TNSA 1NU7B 3SV8A 4AZ2B 1EZUC 3RXCA 2O8WA 1PPHE 4Y71A 1C2HA 1E36B 5LPEA 5HMAA 1AKSA 3M5OA 3NK8A 3E0NB 1GHYH 1G9IE 4GCHG 1ZTKA 2ZA5A 1FAXA 1TBRH 1TBZH 3MU4A 3TPIZ 2HPPH 4FUCA 3T26A 3ZZCA 4A92A 1MU8B 5CE1A 1DXPA 1WBGB 3PLKA 1TPOA 3W1EA 2SGAA 1EOJA 1BT7A 1O3JA 1FDPA 1YPLH 2R2MB 3LOXA 1E34B 3OY5U 4KTCA 1AZZA 2OBOA 4Y10E 1VITH 1A3EH 2FM2A 2P93A 3DFJA 4FU7A 3ATIA 2KCAA 5FHTA 1HAXB 4X6OA 3OTJE 2VGCB 3HATH 5JB9S 2C4FH 3E6PH 2G00A 1A5HA 4MG3A 3UR6A 1K1LA 2ZFFH 3KQEA 1UTJA 2GZ7A 3MH6A 2ZFSA 1S5SA 2ZTYA 1GJ9B 1OYQA 4JZEH 1ACBE 1UHBA 2ZPRA 1V2LT 5LH8A 3BTGE 1O2TA 2VIVA 1VITG 4MVNA 5LPFA 2FLRH 4BAMB 2ZG0H 1ELDE 1KYNA 2BB4A 2GCTC 4K1EA 3HKIB 1XMNB 1C2IA 2HALA 2ILNA 2QCYA 4ZHMU 3M5MA 3NZIA 5GNDA 1CA0B 2PW8H 2KFWA 1ETRH 4B6EA 3A8CA 1GBAA 2GCHG 5GJ4B 1C2FA 1O2NA 2Y7ZA 5L30H 2EI8A 2WYGA 3NRLA 1TFXA 3VGCB 1WTGH 3PO1C 3A8BA 2SNWA 1K1PA 5DP8A 5JBBS 1MTWA 2ZFTA 1GHZA 5E0HA 1EPTC 1NESE 1ZTLA 4QT8C 3LJJA 4YOGA 1P06A 1PJPA 4DY7B 3LU9B 1HAPH 1LQDB 1O3EA 1GBLA 1NFUA 3C27B 1SLUB 1A1RA 3RXMA 1T8OA 1ANDA 3RXTA 4DOQA 1B5GH 3UNSA 1D9IA 4IGDA 3RM2H 1EASA 5T6GA 4ESTE 1S6LA 3ZZ9A 1VGCC 2ZPQA 5DP3A 1V2QT 3A7TA 1SPJA 1JIRA 3TU7H 3F3BA 1UTLM 3GCTF 3DSOA 1THPB 9ESTA 5E8EH 1GMCG 4SGAE 1DOJA 1V2JT 3SUGA 1Y5BT 1GDNA 2FWWA 3QTOH 3A82A 1Q2WA 1ELAA 4NA9H 3A83A 1FY5A 3LGWA 1N8OB 4Q7YA 2WHXA 2OQUA 1O2LA 3GOVB 4RSPA 1OOKB 4K1SA 3E16B 3S9AA 3ZZ4A 2BDHA 2F4LA 1PQ5A 4Y7BA 5EG4A 1K2I1 5A0BA 4AN7A 4IN2A 1AVGH 4JK5A 1O38A 3UOPA 1LO6A 1OWEA 2BMGB 2L6OA 2VVUA 4IN1A 4CBOA 1XM1A 1ZSJA 3TLOA 4MTBA 4ABAA 1NRPH 1E1QD 1T8MA 2AMPA 1ZSKA 1BBRH 1T4VH 3GCNA 1C5OH 4X1RU 2ZDKA 2P3UB 3GY8A 1HAGE 7LPRA 2BD8A 1C1UH 3N7DA 1C2KA 2O8TA 1P0SH 1ZPCA 4K8YA 3F2HA 1F2SE 4TWWA 3PTNA 1GMHF 3DT0H 7GCHG 2J95A 1A2CH 1PPGE 2VWNA 3SV2H 1ESAA 2PUXB 5DKMA 1GHWH 1KLJH 1Q3XA 1V2PT 2BVXH 4CRBA 5L2ZH 2FIRH 3FAOA 1TMUH 3DUXH 1DX5M 3QK1A 1TRYA 1BCUH 1LPGB 4CR5A 3MMGA 2OINA 2ZGCA 3U98H 1AKSB 4TPYA 1F5RA 3O8CA 5IYTA 4DURA 1CGJE 3F2GA 4FVBA 3T2NA 1H9HE 5GPIB 1ZPZA 3MNXA 4ZAEA 4CH2B 2QF3A 3H09A 1FPCH 1ZTJA 4JZDH 1CGHA 1YPHC 1BITA 3RU4E 2PFEA 2XW9A 1W11U 3LGVA 1VITF 1SGFG 1THRH 3CS7A 1A0JA 1SGNE 1FONA 2WPMS 1NO9H 2XCFA 3LT3A 2C90B 4INLA 3NKKA 4YZUA 1HJ9A 2O8UA 1IAUA 2QC2A 2P95A 2BD2A 4ZKNU 2GCHF 2V3HH 3P8NA 5GWZA 1O2PA 5FCKA 2VBCA 4NIVA 2KCOA 1NROH 1GBMA 1KXBA 5FCRA 4MNWA 1C1PA 1N6YA 3SBKA 4F55A 3M7QA 1G37A 5BPEA 2RA3A 2AFQB 1D3DB 3ENSB 4NCYA 1UHBB 4I8HA 1BMFD 1SVPA 1D3TB 1A46H 1PYTC 3SJ9A 1T31A 4K8BA 4I8LA 1NRQH 5G4BA 1YGCH 1MUEB 1AZ8A 1Z1IA 3RC5A 1ZOMA 1HYLA 2A5KA 1WSSH 2JETC 3UOUA 4AX9H 4FUBA 4ASHA 3RXPA 2ESTE 3FFGA 1BTPA 1MKXH 2V6NA 2A7CA 5AF9H 1OWIA 1QTFA 2GGVB 4AG1A 4DT7B 2Z9GA 5DP4A 2VIQA 1GMCF 1IQHA 3BTEE 1TX7A 1V2RT 2HLCA 1WUNH 4FUDA 3ODFA 2Q6DA 3U1IB 1O34A 5FPTA 1CGIE 1O3DA 4B2AA 3UR9A 4Y8YA 2W6JD 4BAOB 2BOKA 1BMNH 1C5PA 4BANB 1GBJA 3LKWA 1UTOA 4WXIA 3SOSA 2BDAA 1QNJA 1H8DH 1Y5UT 2G8TA 4AFQA 4HGCA 2C93B 4GHTA 1INCA 3ZZ8A 1ETTH 1QB1A 2Z3DA 1S85A 1BRUP 3SI3H 1F0RA 3NXPA 2ANWA 4AYVB 3PLPA 1T32A 1Z8RA 3L6PA 4ZMAH 1AWFH 1GDUA 1SGFA 1CHOG 4U32A 1LCYA 1O3PB 2GDEH 4NWKA 3QUMP 2Z94A 3LC3A 5DG6A 4UFGH 2AIPA 5JYIA 4K69A 4XD7D 3BN9A 1DUAA 1O5EH 5A8ZA 4CHAC 2OP9A 2Z9LA 1XXFA 1L4DA 2OQ5A 2VIPA 1G2LA 4ZH8A 1VR1H 4CH8B 7GCHF 1NBME 1SOTA 2AMDA 1LHCH 2PWXA 1DICA 3BEFB 1GHBF 1GHAF 1C5ZB 2Y81A 2AGGX 1KXDA 2ODYB 1GGDB 2WYJA 1SGIB 1LMWB 3V7TA 2G52A 3QLPH 2ZU3A 1FI8A 3A8DA 4OS6A 1W0YH 2B9LA 3UWJH 3VFEA 1ANCA 2ZP0H 5CDFE 2FOBA 4JYUH 1L0ZA 1QBNA 4CBNA 4KTUA 2Q6GA 3S9CA 3RDZA 4I8KA 2ZC9H 2GTBA 3H7OA 1K1MA 4PROA 1J9CH 2FDAA 5ESBA 4ABFA 5TCAA 2A5AA 1ZMJA 1V6DA 3EYDA 1KTTB 1MCTA 1GBHA 1GJ7B 1GI1A 3N7EA 1DWBH 8GCHG 2BY5X 2FOFA 2XXLA 4BTTB 2H9EH 2BXUH 3MU8A 3P8FA 1TMBH 2G4TA 3MH7A 1MAYA 5CHBA 5A09A 2PGQB 1CT2E 4H42U 2Z9JA 1DANH 3RU4D 4O3UA 4ABBA 3W94A 2A4QA 2O8LA 1VJAU 3OEED 5EXNA 4Y0YE 3GY6A 4JMYA 5IDKA 1K1IA 1P10A 4ZXXH 3A8AA 5GDSH 1FY8E 3F9HA 2KR7A 1IOEA 1G3CA 4JCNA 1TA2A 1PFXC 4X1QU 2NU2E 3P17H 3PLBA 1BOQA 1V2VT 2UUJB 3PM3A 2FI5E 4ISOA 3BIVH 4BAHB 3L3TA 1EAWA 1IQLA 1MAXA 1AU8A 3LGTA 1Y8TA 2STBE 3GYLB 2D2DA 3FANA 1O3GA 1MBQA 1O39A 2FOMB 1TQ0B 2BQWB 2CF8H 2BD4A 2PKSC 1G36A 3FP7E 1P9SA 1ZJDA 2LNCA 3UNQA 2BDYA 5TCCA 2QF5A 5FAHA 2ZCLP 4X8UH 1GL0E 3HGPA 3SNAA 1QB6A 2FOEA 4Z6AH 1C1TA 2FPZA 3UREA 1QHRB 3ZVAA 2A7JA 1NRRH 2TIOA 2WSSD 1TNLA 4DVAU 1V3XA 1SGYE 2B7DH 2UWOA 1C5NH 1C5VA 1CBWC 3M35A 1O3MA 1NTPA 1LVBA 4NZLA 1VJ9U 1YCPK 3GYMA 3JZ2B 5C1YA 2NU0E 5SGAE 2RCEA 1K28D 3MU1A 5T6DA 1BA8B 1O2JA 2ZHDA 3I77A 2FP7B 8KME2 1C1MA 4K3JA 1FV9A 1LVOA 2QXIA 2Y80A 1P03A 4ISIH 4MQAA 4DW2U 1OHHD 4ZROA 1S82A 4D7FA 5JPMH 2QYIA 5JBCS 2F9NA 1KTSB 1HAIH 3A86A 3LGYA 2W26A 5DP9A 2WV5A 3AAVA 5L2YH 1ID5H 2EI7A 3K9XB 2OLGA 1AE5A 2UUYA 1XVMA 5EGMA 1HJAC 2PKAA 1O32A 3BTME 3MFJA 1LTOA 2FLBH 3RC6A 5DPAA 5C17A 1D3PB 2CK3D 5PTPA 1Y3VA 2XBVA 2FX6A 3WWBA 2ZHFH 3TGKE 1WYKA 5HXFA 3HK3B 4A1TA 5JBTA 1TNJA 3FVFB 1RFNA 2C3SA 2BD5A 2KCPA 1MQ5A 2A4RA 3PMAB 2ANKH 2JH6D 5E2OA 1K22H 4A1XA 1QCPA 3D49H 1BTXA 1P2KA 1RRKA 3A81A 1PYTD 1P05A 5C67A 5K7RA 4TSFD 1ARBA 1QR3E 3QO6A 1AFQC 1LPKB 3T25A 7KMEH 1NBMD 2H2ZA 3GCTG 5GCHG 2GCTB 4NSVA 2W6ID 1FZZA 3T29A 6CHAC 3MHWU 3BG4C 2AMQA 1T4UH 2BQ6B 3QGNB 1BJUA 1U6QA 2A7HA 3P8GA 3HKJB 4E05H 1SHHB 2IPHA 5CHAC 2K8IA 2XNDD 1Y3UA 3MU5A 4NGAH 2RG3A 1UTNA 2OCVB 4AFZA 1ZMLA 3SJ8A 1X7AC 8GCHF 5DGJA 2CHAC 3KHVA 4HFPB 3PO1B 3VG8A 1XVOA 1O5BB 5L6NH 1OP8A 3ZVEA 1MBMA 2WPKS 1BTZA 1UTPA 3BF6H 1FN6A 2D1JA 3URCA 1EPTB 1XUKA 2CMYA 1QFKH 2HWLB 1EOLA 4JK6A 3F9FA 1ELBA 3D62A 3KEEA 4Q63A 1O2QA 5B6OA 3KQCA 3Q76A 1AHTH 4X2XA 4JZIA 4LOYH 3TH3H 4BAQB 3M3VA 4GLYA 9LPRA 1C4V2 1C1SA 1GI4A 1JRTA 3E3TA 1ZHPA 1PQ7A 1VGCB 2UWLA 3F0PA 2PHBA 3MNSA 1KXCA 4FU9A 4WH6A 1C5SA 2Z3EA 2ZECA 1GMHG 2ZGJA 1O2XA 1JWTA 4ZKSU 1BB0B 1LDTT 4DT4A 1P9UA 3MI4A 4BXWA 4MPXA 3O8RA 4Q4LA 3MTYA 1C2DA 3RXQA 4AOQA 3ATMA 2GD4B 2R9PA 5DJ7A 5EXMA 5FPYA 3RXUA 4BNRA 1E38B 1LQEA 1TGNA 4MNXA 3RXDA 2F43B 3ELAH 3OFND 2G5VA 3RXFA 3SI4H 1ESBA 3PWCA 4E06H 4Y0ZE 1F7ZA 2HLDD 3A84A 1SLWB 3PMBB 5E0JA 4YLQH 4ZHLU 2OC0A 3ZV8A 1BMAA 5DP6A 4AFUA 3UY9A 1XX9A 2VWMA 1GCDA 1GCTC 3ZZ6A 3TGIE 5FBIA 3U69H 1TYNA 1Z6JH 3ATWA 3SUEA 2GT8A 2XYAA 3SUDA 1BIOA 2WZQA 1A5IA 1QJ7B 4GUXA 2VNTA 2IJOB 1S81A 6ESTA 3SZEA 4B71A 4M7GA 2A32A 4B74A 3GCOA 4TWYA 3PWBA 4UONA 2BOHB 2DE8A 1H8IH 3SU1A 1BHXF 2PV9B 1YBWA 1YYY1 1S0QA 2BD7A 2ZQ1A 4AGKA 4UFDH 4ZXYH 1B