1A5IA

Catalytic domain of vampire bat (desmodus rotundus) saliva plasminogen activator in complex with egr-cmk (glu-gly-arg chloromethyl ketone)
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
265
structure length
265
Chain Sequence
b'TCGLRKYKEPQLHSTGGLFTDITSHPWQAAIFAQNRRSSGERFLCGGILISSCWVLTAAHCFQESYLPDQLKVVLGRTYRVKPGEEEQTFKVKKYIVHKEFDDDTYNNDIALLQLKSDSPQCAQESDSVRAICLPEANLQLPDWTECELSGYGKHKSSSPFYSEQLKEGHVRLYPSSRCAPKFLFNKTVTNNMLCAGDTRSGEIYPNVHDACQGDSGGPLVCMNDNHMTLLGIISWGVGCGEKDVPGVYTKVTNYLGWIRDNMHL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PLASMINOGEN ACTIVATOR
publication title Catalytic domain structure of vampire bat plasminogen activator: a molecular paradigm for proteolysis without activation cleavage.
pubmed doi rcsb
source organism Desmodus rotundus
molecule tags Hydrolase/hydrolase inhibitor
total genus 58
structure length 265
sequence length 265
ec nomenclature ec 3.4.21.68: T-plasminogen activator.
pdb deposition date 1998-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1a5iA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1a5iA01
2AMPA 1OWHA 3V3MA 2QY0B 1C9PA 1LO6A 1C5OH 2ZHQH 3KQEA 2FOMB 3KIDU 1NY22 2A7JA 3A89A 2B9LA 2PR3A 1HAXB 1VCWA 4AFQA 1F0RA 1XUHA 1UTLM 5FPYA 4ZMAH 3MU5A 4UFGH 4WWYA 2XWBI 3ZVGA 2STAE 8ESTE 1G32B 1T8MA 4ABJA 1XXFA 3SNCA 2BX4A 2CHAC 5G4BA 1V2TT 1O2JA 1KSNA 1UHBB 1LCYA 2FXRA 1UVTH 2VU8E 2FTLE 3TU7H 3TK9A 1C4U2 2F9VA 3F9GA 1XUFA 2TBSA 1MU8B 1GJAB 1TMBH 3U69H 2FESH 4AFSA 3KEEA 1O3FA 1AVGH 5JBAS 4JZFH 2HRVA 1BBRK 1Y59T 3K6YA 1GHWH 1EAXA 3TJNA 1B0EA 3SJIA 3TGJE 1FONA 1AIXH 2R0KA 4DOQA 1GI0A 3UR6A 1V2PT 4UD9H 1VJ9U 4A6LA 1C5SA 1BJVA 1IQGA 1LVMA 1LMWB 4DW2U 1EASA 2G8TA 1IHTH 1TGNA 2BZ6H 5A09A 1AO5A 1A5IA 1H1BA 3TH2H 2ZCKP 1HV7A 5EPNA 3QZQA 5LPFA 1NFXA 3GDUA 1OSSA 3M5MA 2TGTA 4AG2A 3KQCA 3BEUA 4Y0ZE 5C1XA 1NRPH 4BTIB 3GCTF 4GSOA 2ESTE 4AN7A 5BRRE 1C2KA 1D3PB 1C2HA 3GCHC 1O3PB 1BTXA 3M5NA 1PPFE 2JH0D 5T6FA 3SORA 1NU9A 1O3KA 2QYIA 4DGJA 2C3SA 1K1LA 4Y10E 3SJ8A 3URCA 3SQEE 4O9VA 2Y5GA 1YKTA 1EPTA 1PPZA 1BRUP 2Z3DA 5ESBA 1G9IE 2VB0A 3S7KB 3GCNA 3D49H 1GCDA 4X2YA 5PTPA 3T26A 5E0HA 2Z9GA 3QK1A 5GXPA 1SR5C 1BUIA 4Y71A 3MOCA 1YPHE 1VITG 2QA9E 3LJJA 4FU9A 1KXAA 1O3EA 4JYVH 2H6MA 3BEIB 1C1TA 4LOYH 1O3HA 1A5HA 3LPRA 3MH4A 3SV9A 1O2YA 2IN2A 2LPRA 2SGPE 4XE4A 2ZFFH 2BYAX 1O37A 3A86A 4BOHA 3P95A 7LPRA 4ABDA 2HALA 1PPHE 2ZP0H 4ZKSU 2EI7A 1FY8E 2ZG0H 2A2QH 3IITA 4NZLA 2UUYA 2QIQA 4K8BA 1Z8IB 2TRMA 2ZECA 2QXIA 3FZDA 2AYWA 2XBWA 5EXMA 1A0LA 2ANYA 4GHQA 1C5YB 1ZR0A 2SGDE 1QRWA 2BVRH 3SNBA 1HGTH 1VITH 4IC6A 1UVPA 1DPOA 1V3XA 1YCPH 3MWIU 1ELVA 2HVXA 2QXJA 1A0HB 3E6PH 2J92A 4CR9A 4ISIH 3SOSA 5F6MA 4I8HA 4ZAEA 1ZZZA 3MH6A 1P2IA 2F9PA 1O2SA 4K1EA 1O5EH 1NFYA 3SUEA 1GG6B 1ABIH 2F83A 2GZ9A 4B2AA 2XXLA 3Q3KA 1O2IA 4ASHA 4KP0A 1ZMJA 5FCKA 1GI6A 3AASA 1GMHG 2BDAA 2XBXA 4AG1A 1C2FA 1FXYA 2CGAA 3T5FH 4FXGH 2ZGCA 3HATH 2AS9A 2IJOB 1KY9A 3KL6A 2ZWLH 4FUBA 5F03A 2Z9KA 1O5BB 3I29A 1LPKB 4D9QA 4DIHH 4D76A 1ZJDA 3P8GA 3EGKH 4GUXA 1O2WA 3LONA 5F8TA 3NCLA 1IQMA 2VGCB 2ZDNA 4D7GA 4AYYB 1MQ6A 1P2MA 2A7CA 4ISLA 1FAKH 1CU1A 1P2JA 4O03A 3SHCH 4FU8A 1C4Y2 2A7HA 1DX5M 1GG6C 2D2DA 5ETXA 1CT2E 2AFQB 2SNVA 3SGBE 3TPIZ 1MTNC 4B2CA 4TYDA 1EPTB 2VVCA 1YPHC 1Y5BT 2Q1JA 4OGYA 2F9OA 1GMHF 6GCHF 2FI5E 2PWXA 1XVOA 1C1MA 2GCTC 4RKJB 3EA8A 1G3EA 3OSYA 1O3DA 1YPKH 5FPSA 3UR9A 3P17H 3B8JA 2F9NA 1FV9A 5JBCS 1AQ7A 4VGCB 1C1WH 3ZZAA 1D9IA 3GY7A 2J34A 1GBLA 3LIWA 3RU4T 1BTHH 3QUMP 1HFDA 3ZVAA 4XSKU 1QQ4A 1GJ4H 1GHXH 3M35A 5EQQA 1C2GA 1NTPA 4FUFA 1KTTB 3AW0A 4RSPA 4GVUA 3GOVB 5BPEA 1C5LH 3UFAA 2QXHA 2Z94A 3T25A 1EP5A 1FJSA 1XXDA 1AI8H 1EPTC 1SLVB 3ZZ4A 2PHBA 2P16A 4BAOB 3BTGE 3LH3A 4B75A 4MNXA 2BD3A 3KQBA 1QNJA 1GBMA 1NC6A 3RXRA 2XBVA 1O2XA 1S0QA 1PJPA 3D65E 1AVXA 2JETB 3LGYA 2ZGBH 1WOFA 2Z6BD 3QTOH 4JK6A 4VGCC 3URDA 1C1SA 2BVXH 1O2VA 3ZVEA 3UPEA 1J17T 1DWCH 1O36A 1JWTA 2ZPSA 3RXIA 1ESAA 3ZVDA 5LPEA 4NA8A 1C5QA 2XRCA 5DO4H 5TJXA 2K1QA 2FEQH 1WBGB 1SGIB 2Z3EA 1IQKA 4X8UH 1N1LA 1W8BH 5JYIA 2ZCHP 1UVOA 2UUFB 3EA7A 1KLIH 3SJOA 1O3GA 1S5SA 1YM0A 1EUFA 1MTWA 2NU4E 3LKWA 1G2MA 2W3IA 1JRTA 1T4UH 1ZHRA 2WPLS 4MPXA 3OY5U 4I8KA 4WY3A 1EJNA 5DP4A 1HPGA 1AKSA 1C2DA 1S83A 1YBWA 1RD3B 2O8TA 1G2LA 2OLGA 1P2KA 2PUQH 4INLA 2A32A 2BY5X 1TRYA 5EXNA 5E0GA 2BLOA 3RXFA 1IAUA 1MCVA 1GVLA 1QJ6B 3BTWE 1DVAH 5HXFA 1C5VA 1C1NA 1W12U 1YGCH 1TX6A 3RXVA 2BLVA 4Q7YA 3LGIA 2FPZA 1WQVH 3ZZ7A 1CE5A 3DA9B 3F9FA 2G5NA 1LHDH 3A8AA 5E0JA 1G3BA 3U98H 1OP8A 4OS4A 1SG8B 3NUMA 4LXBH 1UCYK 1GL0E 2A2XH 1O33A 3JZ1B 1BRCE 5F8ZA 1EOJA 3SNEA 1TQ7B 5C5NA 1Y5UT 3GICB 5DP8A 1L0ZA 2BZAA 4WXVA 2OP9A 1K2I1 1VR1H 5L2ZH 3DT0H 2G00A 3KQDA 2ZHDA 1OYTH 2Y80A 2F9UA 1BJUA 4INKA 1O3NA 1TRMA 2ZPQA 4KTSA 3VB7A 1ESTA 3UOPA 3CENA 4TY7A 3UNRA 5DG6A 4X1QU 1ORFA 5DKMA 3ZYEA 4K1SA 1SC8U 4FUCA 4CBOA 4IW4E 1NROH 1VGCC 1GBTA 3LGUA 1UK4A 3H5CB 2W3KA 5F8XA 3PMAB 2HPPH 1AE8H 6CHAC 2THFB 3BTTE 5GCHG 1Z6EA 3A85A 3A84A 4OS2A 1GI7B 2GVFA 1Q2WA 1V2QT 2XBYA 4I8GA 1WTGH 1W11U 3UQVA 1SQOA 4AX9H 1P02A 1SGFA 1DLKB 1O31A 1A46H 3Q3XA 1ZTJA 1AKSB 2OD3B 4HZHA 1OOKB 3FANA 4JK5A 2HNTF 2ZU4A 3RDZA 3STIA 1VCQA 4Y8YA 1PQ5A 3PB1E 3U8RH 1CVWH 1P2NA 3SGAE 2BDGA 1BTZA 1SLUB 2P3FH 2QF3A 2FX4A 2G4TA 3LOXA 3BTME 4UFEH 2TIOA 1OWJA 5GCHF 1HUTH 3SV6A 1O2NA 3QX5H 5T3HA 2ZZUH 1DITH 4YM9A 1SSXA 3SI4H 5L6NH 2Z9IA 3RP2A 2Z3CA 4GPGA 4K5ZA 1A3BH 3EE0B 4M7GA 3ZZ6A 1NN6A 1UTNA 4WXIA 1TYNA 5C1YA 2O8UA 1MZAA 1IHSH 1SPJA 1QA0A 2WUBA 4NWLA 1LPZB 2CMYA 3OU0A 2XNIA 3SU2A 2VIDA 1LKAA 3F9HA 1TNIA 2PV9B 2BM2A 1QRZA 1MKXH 1HXEH 3I78A 1GMCG 3PTNA 1CHOG 1MAXA 5C67A 1S6FA 4SGBE 5A8ZA 4X6OA 3F1SB 1LDTT 1XX9A 3CP7A 3M7TA 2W7SA 4BAQB 2OC7A 4NG9H 1O5AB 1TWXB 4E06H 3U1JB 2G55A 3V12A 1SGRE 1H8IH 3Q3YA 2VWMA 1DT2A 4Z0KA 4XBDA 1TABE 2H5CA 3C27B 1GBKA 1F92A 1BRAA 1C2MA 1HNEE 1QB6A 1BIOA 4H6SB 1AMHA 4AOQA 1NO9H 4WJG2 3E90B 2W5EA 4A5TS 3N7OA 2PLXA 3LT3A 2GT7A 5CHAC 2GD4B 1C5NH 2Z7FE 1LKBA 1MZDA 1LVBA 2PW8H 2ZDAH 5HM2A 3RXGA 1MAYA 4X1SU 1RJXB 1FY3A 1OXGA 1ETRH 4JZEH 4ZHAA 2ZHFH 5C1UA 1OWKA 2A0QB 3RXUA 2TGDA 1E35B 3OY6U 2Q6FA 2CJIA 1QURH 3M5LA 4AFZA 1MTSA 1VJAU 2BY9X 1EZQA 1ZRKA 4D9RA 3SU6A 1HCGA 3EA9A 2BDYA 1GGDC 3ODFA 2ALPA 1HLTH 3L6PA 4ESTE 3MH7A 1BA8B 1ZOMA 1GJ8B 4OS5A 3QWCH 1Q31A 1K1PA 3ATLA 3QGJA 4B1TA 3RUOA 3S7HB 1ZMNA 3MYWA 1TBZH 3LH1A 3UIRA 4DVAU 1BB0B 2FOCA 4JCNA 2BDBA 4NCYA 4LK4A 1PYTD 1QIXB 3P70B 3P8OA 3A87A 3RXKA 4B71A 3PO1B 4X6PA 2ASUB 5J4SA 1GWAA 3BSQA 3ATMA 2BQ6B 4ZKNU 2FODA 2J4IA 1O2OA 1V2OT 1SGEE 4OS7A 2SGFE 3RXBA 1TGBA 1MMJN 2AMDA 2FM2A 1RGQA 2ZFTA 1SQAA 5HM9A 3VB4A 2OCVB 1O0DH 2ZHWH 3W95A 2Y7XA 4DCDA 3O8BA 1O2TA 1DE7H 1IQJA 2EEKA 1A61H 3M36A 5AHGH 3K2UA 3A7ZA 5JPMH 1GHYH 1W2KH 3IWMA 1XVMA 3OX7U 5JDUB 1L1JA 3Q00A 3Q76A 4IGDA 1GCTC 1ZSLA 2ODQA 1BQYA 1OKXA 3A7VA 4MLFB 3GCTG 2H9TH 1OS8A 1SLXB 2ZPRA 1FDPA 1SHHB 3TGIE 1TBRH 4ZHLU 1SGCA 3MNXA 1O2ZA 1C5UA 1C1OA 2RA0A 3TK5A 1AHTH 1V2RT 3TNTA 2NU0E 1CSOE 1IOEA 4BTTB 1BMMH 2A45B 2EI6A 2WPIS 3UWIA 3TIUA 1V2LT 1G3CA 2O8MA 5B6OA 2XC4A 2XYAA 3O8RA 1UK3A 2ODYB 4FUDA 3ZZCA 1AB9B 2XCFA 3PYHA 3V7TA 1WTHD 1ELGA 3ZZ9A 1RIWB 2OXSA 2ANMH 4ZH8A 1AWHB 3SJKA 1WU1A 1GHAF 1NRRH 2OBOA 2V3HH 4Y7BA 2BX3A 2A31A 1S81A 2FI4E 1PQ7A 3E8LA 1EZXC 1QHRB 1UTKA 3QLPH 4YESB 1O2LA 1Y3WA 1HJAB 2OINA 2WYJA 1DDJA 1BTUA 3QDZB 1A2CH 1B7XB 1DLEA 1BRBE 1MD7A 1O3BA 2ZO3H 1GJBB 4INHA 4GCHF 1EZSC 4H42U 1AB9C 2Q6GA 3SU5A 1O5FH 1FY5A 1C5MD 1H4WA 1KXFA 1P03A 2WV5A 3SHAH 3HKJB 4E7RG 2BMGB 1TNLA 4TPIZ 4BXWA 1MBQA 1ZPBA 1TX7A 2ZFQH 2SGEE 3GY5A 4KELA 1TMTH 4U30A 1QBNA 3G01A 3T28A 3MU8A 1XKAC 5EW2H 1V2KT 2A4OA 3E16B 3BV9B 3PV4A 4E05H 3HK3B 3U9AH 1IQHA 1XUJA 8KME2 1O3MA 3GDVA 3MU4A 2GV7A 4K1TA 4I7YH 2JH6D 3ZZ5A 1DS2E 1NPMA 2R0LA 1ARBA 1FN6A 1TNGA 4HFPB 1SVPA 4NSYA 4WMEA 3RXLA 3LGVA 5ABWA 1AU8A 4ABAA 2OTVA 1THRH 2HLCA 1O2MA 4Y0YE 1Z8RA 2ZU3A 2V3OH 1THSH 3A83A 3BTDE 3M7QA 6GCHG 1C9TA 1YLDA 2FOFA 5C20A 2GCHG 5A0BA 1YF4A 1TPAE 1NESE 3EDXB 1FY4A 1DANH 1MD8A 1T32A 4NA7A 1FUJA 2Y5FA 1L4ZA 1P04A 3DUXH 1ANDA 2FO9A 1ANBA 4FVBA 1ZLRA 3LJOA 2B0FA 3FP7E 4NWKA 1CGJE 3E3TA 7GCHG 2BD8A 3RXQA 1BBRH 3ZVBA 3SV8A 1P3EA 1GI9B 2FIRH 2HGTH 1GBBA 2WPJS 3K65B 1ELTA 3TH3H 1TAWA 3AAUA 5EGMA 3E91A 5I46H 1TQ0B 5EODA 2Z9LA 4CRBA 1FMGA 2RCEA 1ZGIA 2O8LA 1ABJH 1K28D 1SI5H 1AGJA 3MH5A 1P06A 1AN1E 1M9UA 2O9QA 1OWIA 2GCHF 1G37A 1QB9A 1T8LA 1GI3A 2FMJA 3DD2H 1QL8A 1F2SE 2BQWB 3BTFE 2PSYA 1SL3A 4NZQA 7GCHF 1G3DA 1W7XH 1F7ZA 2Q6DA 3M3TA 3W94A 5E2OA 2ZA5A 2VGCC 1AZZA 5DP7A 2UWPA 2P3TB 5LGOA 4BXSA 5C5OA 1ESBA 4Q7XA 5DPAA 2VVUA 3GY8A 3VB3A 2D8WA 1FY1A 3BTQE 1UJ1A 2BY6X 1O3OA 4Z6AH 3VPKA 3A8DA 4X0WU 1INCA 3ZVCA 1QL9A 5FBIA 1HIAB 1LHFH 1Y3VA 2FX6A 1GL1A 4ZKOU 1YP9A 1O3CA 1O5DH 1QFKH 5JBBS 4GHTA 2WUCA 2SFAA 2R3UA 1SOTA 2BD7A 1EKBB 2BXTH 2I6SA 3SNDA 8LPRA 2FLRH 2FYQA 2ZKSA 2Y7ZA 5IYTA 1DICA 1JRSA 2C8XB 1O2HA 1GJCB 2VVVA 2AEIH 2AIPA 2VIQA 5I25A 7ESTE 3HKIB 1PQ8A 3SN8A 4YOGA 1K1OA 3PWCA 4I31A 1MTVA 2CF8H 1P57B 1H8DH 1RTKA 4YT7H 3F9EA 1GJ6A 1C1QA 1Y5AT 1H9IE 2QAAA 5E8EH 2BD2A 1GHBF 4CREA 1KIGH 2GT8A 3D62A 1RRKA 3UUZA 2IPHA 2A5IA 1K1JA 1GJDB 2CF9H 1LVYA 2JETC 4YZUA 2BD5A 4CRCA 4U01A 5GPIB 2PKSB 2B7DH 3OTJE 3S69A 1ELBA 3ELAH 1BITA 4A1XA 4ABHA 3TGKE 1B0FA 1DXPA 4ISHH 3LU9B 1Z1JA 3WY8A 1RTFB 2FDAA 1GJ9B 2A1DB 1PPEE 4YTAA 3A7TA 4UE7H 2DE8A 1SQTA 4O3UA 4RKOB 1SLWB 1A7SA 3M5OA 3SU1A 2SGAA 2JH5D 1J9CH 4XBBA 3O8CA 1G30B 1HXFH 1OWDA 1IQNA 2BDIA 1ANEA 3T2NA 4AORA 4IS5A 2RG3A 3BN9A 3F68H 3M37A 4K8YA 1K1NA 4GAWA 3FP6E 5FX5A 3RMMH 1T7CA 3M7UA 1T31A 2F3CE 1P11E 3FP8E 1QGFA 4JZDH 1O2PA 2GDEH 4WH6A 2TGAA 3MU0A 4MNVA 1YC0A 4ZXXH 2GZ7A 2ZU1A 4CH2B 3TJUA 1C5XB 1CBWB 4NIXA 2G4UA 4Y7AA 5T6DA 1TA2A 2F9BH 1GDQA 4ZHMU 4U32A 2QV1A 1A5GH 3HGNA 4ABEA 4JYTA 1AFEH 1SGPE 1QQUA 1BHXF 1DSTA 1TALA 3E1XB 1NRQH 4DY7B 1LHEH 2WV4A 3NZIA 2DE9A 3ESTA 3SV2H 3RM2H 1EP6A 4NIYA 2ZHEH 1S0RA 1CA8B 4FUGA 2VINA 3LC3A 1XM1A 1PFXC 1OP2A 1N8OB 1SFIA 4WVPE 3VB6A 3P6ZB 2BDCA 3ZV8A 3BTHE 3M61U 3V13A 5EXLA 2ZDVH 4KTCA 3KCGH 1S82A 2GX4A 2R3YA 1A0JA 2WPMS 2Y81A 3B9FH 1EZUC 5JB8S 1ELCA 1VCPA 1V2WT 3FFGA 3TJOA 1H9LB 5EG4A 1WQSA 4A1TA 5A0CA 1GI4A 2ZFPH 3MNBA 1GMDG 3UNSA 2JKHA 4CRAA 1V6DA 4NGAH 1FAXA 1HAZB 1B5GH 2UWLA 3MO9A 2FS9A 7KMEH 2R2WU 1AUJA 4BNRA 3S9BA 2BB4A 1GBIA 3UREA 2ZQ2A 5DGJA 4IBLH 1LPGB 3OYPA 4X2XA 5EU8A 1GJ7B 2AGEX 1GI2A 2GTBA 4IMQA 2G81E 1C5PA 3B23B 2VH6A 3ZZBA 1HAGE 4TWYA 2A4RA 2FWWA 2GMTB 3QTVH 2OC0A 4BTUB 5DP5A 1UCYE 3MHWU 2ODPA 2BHGA 2J95A 2ILNA 2FP7B 4X1NU 2ZFSA 2ZIQH 1GMDF 3EYDA 2ZNKH 1EAWA 2FOHA 4O3TA 3QN7A 4HGCA 4CRDA 1NU7B 1LHGH 3VEQB 1PYTC 2ZTZA 1DY8A 1UCYH 3TLOA 2FZZA 2ZU2A 1P10A 4K3JA 1AE5A 2FYRA 3DFJA 3C1KA 3GY2A 4ABGA 1JOUB 1O3AA 3KNXA 4BAMB 3PWBA 1HAHH 3UNQA 2BY8X 3NKKA 4YOIA 1TX8A 2ZGJA 4FUIA 1D3DB 4J1YA 4PROA 4MQAA 2GP9B 1GI1A 4Y79A 4R8TB 2TPIZ 2P94A 1O3LA 4A92A 1HJ9A 2AIQA 2ANKH 1ZJKA 1DXWA 1AWFH 1X7AC 1BMLA 1QRXA 2XCNA 3PLPA 3BIVH 1P8VC 1ZPZA 1V2ST 1C1UH 2ZEBA 2VIWA 4X8SH 3BG4B 3MNSA 3I77A 1C5WB 3KGPA 1MTUA 1YPGH 3QO6A 5DP6A 1O32A 4I8LA 3RMOH 1CGIE 1H9HE 3AAVA 1TNHA 2BLWA 5DK1A 5L2YH 2M5TA 3LDXH 1O39A 5FXLA 1UTJA 2ZQ1A 3K9XB 4X2WA 1ELFA 4I8JA 2D26C 1BT7A 1UMAH 4OGXA 4DT7B 1EJMA 2AMQA 4AB8A 2ZDKA 1ACBE 2HOBA 5A8YA 1JIMA 4X2VA 2XC0A 2P95A 4MVNA 1W10U 4Q2KA 3KHVA 3SZNA 1DWBH 1J16A 2CHAB 3TVJB 2NU2E 2J9NA 2UUKB 1GBEA 1GPZA 4BAKB 1K21H 4ISOA 1QCPA 2OQ5A 2WPHS 1QBOA 1L4DA 3SI3H 1SGYE 3PMBB 1NS3A 3S9AA 3LGWA 2QXGA 1BTPA 4YO9A 3H7TA 1V2UT 3DHKH 1SGQE 2YOLA 3RC6A 1MKWK 2VWLA 4MPWA 4NFEA 1P2QA 5HYOA 1NFWA 1THPB 1NFUA 2PSXA 1C2JA 3LGTA 4THNH 3PO1C 1C1RA 1QA7A 1QTFA 1TGCA 2FTMA 1YLCA 5T6GA 4AZ2B 1GHAG 4TY6A 3FVFB 3SGQE 2FOEA 2OBQA 1K22H 3UY9A 1ETTH 1QBVH 4Y76A 2NU1E 2NWNA 1OPHB 3GYMA 1HJ8A 4UEHH 1TPPA 2ULLA 5GDSH 1TPOA 1A1RA 2BY7X 1AVWA 1EATA 3RXMA 1Z8JB 2BVSH 1TFXA 1WCZA 2VIPA 1O3JA 3GCHB 3PMHB 3SU3A 5FAHA 5CE1A 3A80A 3VFEA 3BF6H 3FZZA 4GCHG 9LPRA 1GI8B 1TOCB 1W0ZU 2XW9A 1BMAA 4H4FA 3RU4D 1TRNA 1MU6B 4I32A 1C2EA 1MUEB 3RXCA 5AFYH 1W3CA 1J15A 1ZSJA 3UTUH 4XBCA 1ZHPA 1Q3XA 2J38A 3VB5A 3GY4A 4I33A 1Z7KA 1Y8TA 1SBWA 5E2PA 1ZTLA 3MFJA 2C4FH 2C8WB 2UWOA 1FPCH 1PPBH 1RTLA 1K1MA 2FOGA 2GZ8A 1AD8H 4OS1A 1F5LA 1IQEA 2SNWA 4A7IB 1L2EA 3TH4H 4ABIA 2OC1A 1YPLH 2V0BA 2BLQA 3U8TH 1O3IA 3A8BA 4MG3A 2GKVE 1Z8GA 3RXAA 3EAJA 3PLKA 5L30H 1P09A 2VH0A 1C5RA 2VNTA 4F4OC 1CT4E 2STBE 1GBHA 4Y8ZA 4MPUA 3TJVA 1N6YA 1GBFA 3AVZA 1RIWC 1P0SH 4Y8XA 1F5KU 3GY6A 1SMFE 3EQ0H 4MTBA 2XC5A 3NPSA 3SO3A 2ZDLA 1T4VH 1Y3XA 4ISNA 3GISB 1DUEA 4WMDA 1BCUH 1CA0B 1EB2A 4KTUA 1C5TA 1O35A 1LQDB 4UDWH 1JIRA 1JBUH 1FIZA 5A8XA 1HJAC 4YLUA 2BTCE 2OQUA 2V35A 3ZZ8A 1QJ7B 2RDLA 3BTKE 1EJAA 1HIAA 1IQIA 2P59A 1TNKA 1C2LA 3PMJA 3HPTB 1Y3YA 4FUJA 2F91A 4D8NA 3BTEE 1Z1IA 3SW2B 5LPRA 4YOJA 4SGAE 5EQSA 4D7FA 3RXSA 3ZVFA 1VITF 1BBRE 5J4QA 1CA0C 3T27A 1MKWH 4WF8A 1GHVH 3VXFH 3A82A 3P8FA 1AFQB 1J8AA 1HB0B 2FLBH 5JB9S 5AVDA 1A4WH 2H1UA 1V2NT 2D1JA 2EA3A 2A5KA 2BD4A 2VJ1A 3F6UH 2P3UB 1MTNB 5FBEA 2PGQB 2ZGHA 2FOBA 4ZKRU 3PROA 8GCHG 1T8OA 2W7UA 1D6WA 1YPJH 3MO6A 4DG4A 4NFFA 1KLTA 3RXTA 1VZQH 4WH8A 2GCTB 5K0HA 4NIWA 1GDUA 1NT1A 1WYKA 5FPTA 1GJ5H 4LZ4B 1C1PA 4KKDA 1P01A 3SV7A 1FI8A 1UTOA 5FHTA 1SGDE 1SGTA 2QCYA 4ZUHA 2SGQE 3VXEH 5GJ4B 1KDQA 4AGKA 1AFQC 2QN5T 1GBJA 4FVDA 3ATIA 1KXCA 1PPGE 4KGAA 3RC5A 2C90B 1AZ8A 1JXPA 3AW1A 2UUJB 2AGGX 1TONA 1O5CB 8GCHF 1QB1A 4BANB 1RXPA 2ZF0H 1IQFA 2ALVA 3NXPA 1G36A 1TB6H 6ESTA 1P2OA 2AGIX 1A3EH 3TK6A 2EI8A 1WSSH 1CQQA 2BDHA 3SUDA 4AYVB 4XDEA 4FUHA 1XUIA 3GY3A 1O2RA 1GBDA 1GI5A 3CS7A 1KXBA 2IOTA 1NRNH 1BTWA 4AGJA 3P92A 1F0TA 2Y82A 3SQHE 4X1PU 1V2VT 3RLWH 3GYLB 3E0PB 1FPHH 1GBAA 1GHBG 1GVKB 2ZTXA 1BOQA 3ZZ3A 5A0AE 1LHCH 2R9PA 3BIUH 4J2YB 1OX1A 1XMNB 1CHGA 3UOUA 4RN6A 2ZGXH 4CRGA 1AY6H 1TBQH 1MH0A 4NIVA 2A5AA 2HWLB 2J2UA 3M3SA 4B76A 1SFQB 1XUGA 3A7WA 2KAIA 2P8OB 4XFQA 1D3QB 2B5TB 1MBMA 1U6QA 2HPQH 1KXDA 1P9SA 2A4QA 2ZC9H 4X8TH 1RFNA 3ATKA 3RXOA 2W26A 4B74A 1EAIA 2P93A 1HAVA 4JMYA 2QF0A 3CS0A 1DM4B 1W14U 4ABBA 1YYY1 1O2UA 3FAOA 1BZXE 3RM0H 3QGNB 2BOKA 1L1GA 2FOAA 3U1IB 3KF2A 4TWWA 2BD9A 1DOJA 1HAYB 1KXEA 1OWEA 1PPCE 2B8OH 2PKAA 3LC5A 4TPYA 4CBNA 2H9EH 2BOHB 1C1VH 1UVUH 5AF9H 1DY9A 1HAPH 5FX6A 2Z9JA 2DUCA 2I6QA 1SHYA 4MDSA 2PTCE 2ZU5A 4IN2A 2OUAA 1KDQB 3IG6B 3Q77A 2P8OC 3MU1A 2ZDMA 1W13U 1NM6A 1W0YH 4A1VA 1W7GH 4H6TA 1GVZA 3ZZDA 3PTBA 3PM3A 2A4GA 1ELEE 1YPEH 1KTSB 2GDDA 1TOMH 4MPVA 1D6RA 3U8OH 3RC4A 1MKXK 3RMNH 1IQLA 1D4PB 4IN1A 2PKSC 1FLEE 1ZSKA 4K60A 2FI3E 1SB1H 3L3TA 3E0NB 4FU7A 1EOLA 4X8VH 1Y3UA 1MQ5A 5EW1H 5K7RA 3SUGA 2YNBA 2VWNA 3RXJA 4JZ1A 1FZZA 1S85A 3SUFA 3S0NA 1VGCB 5IDKA 5DJ7A 3UQOA 1E34B 3D23A 3M3VA 1HDTH 2ZFRH 5EPYA 1C2IA 1UTMA 6CHAB 1E36B 3DFLA 3SNAA 2H2ZA 4ZROA 5EOKA 4MNYA 2G52A 1C4V2 2FS8A 3A7XA 5TCCA 1RS0A 2HNTE 4HI3A 1PQAA 1ZTKA 1UTQA 1WV7H 1EQ9A 1EAUA 4IMZA 1FNIA 3T62A 2J94A 2KAIB 1P3CA 4X1RU 2BXUH 5LH8A 1Z71A 1E0FD 4K2YA 2AH4X 5H4IB 1Z6JH 4GLYA 1D3TB 4AB9A 3S9CA 1FIWA 2QC2A 1CO7E 2TGPZ 1HAVB 1P9UA 5EQRA 3ZYDA 3STJA 2ZTYA 1YPMH 5DP3A 4U2WA 2GV6A 1ZYOA 2H9HA 4UONA 3ATWA 1DWDH 1UVSH 1FN8A 1CBWC 3TITA 4LZ1H 2PKAB 1TA6A 3RXHA 1BMNH 1E37B 1F0SA 4YLQH 1EX3A 1TPSA 2R2MB 1HAOH 4X6NA 1LQEA 3MMGA 1S6HA 4BAHB 2BQ7B 3NWUA 1ETSH 1BHXB 3RMLH 1OP0A 3NK8A 1V2JT 2ANWA 3ZV9A 4YT6H 3A88A 1TE0A 2CN0H 3HGPA 1BDAA 2O8WA 5TCAA 1L1NA 4CR5A 1LVOA 1N6XA 3JZ2B 1XUKA 2ZCLP 2H5DA 5FCRA 1ANCA 1GBCA 2V6NA 2G51A 3KN2A 2VIVA 5AFZH 1UO6A 3BEFB 4XOJA 3BG8A 3L33A 4Y6DA 9ESTA 3ITIA 1AUTC 3SBKA 4CHAB 1N8OC 5HGGA 2AERH 4NSVA 2NU3E 1E38B 3VGCB 4AFUA 6LPRA 1CT0E 1EB1H 1SGFG 1TGSZ 5HMAA 4JYUH 1MCTA 4K69A 1ZPCA 2C93B 4ABFA 2CV3A 1WAYB 4JZIA 4UFDH 3T29A 2G5VA 1NRSH 3RU4E 1EXFA 2Y6TA 1O38A 1TMUH 3RXDA 1JMOH 4B73A 2GGVB 1UK2A 1TGTA 3HK6B 3ODDA 1YCPM 1TNJA 2PGBB 4UFFH 3R3GB 1O2GH 4B2BA 2HNTC 3SU4A 1F0UA 1ARCA 3MO3A 3V0XA 3SU0A 4OS6A 2CXVA 5CHAB 5C2ZA 5CMXH 2XTTB 3PLBA 1QY6A 3MTYA 1ZMLA 4CHAC 3RLYH 1F5RA 1QJ1B 5JBTA 1SOZA 5A2MH 3VGCC 2XWAA 4X6MA 3A8CA 2C8YB 1UHBA 1DUAA 3A81A 2LNCA 2GMTC 1GHZA 1HRTH 3RXEA 2QGRA 4Q80A 4ZXYH 4MNWA 1QR3E 1ZHMA 4Y11E 2WYGA 4DIIH 1C5ZB 1TLDA 3R0FA 1V2MT 2YNAA 2VIOA 4DURA 1GGDB 1FQ3A 1NZQH 4CRFA 2PTNA 3A7YA 1O5GH 1QL7A 3TNSA 2WPKS 1BTYA 1WUNH 1P05A 2Y5HA 3RXPA 1S84A 1GMCF 1O30A 1J14A 4CH8B 5GIBA 1CHOF 2PFEA 4R0IA 1O2QA 1ELAA 3K6ZA 1ZRBA 2OC8A 2VWOA 1P12E 3P8NA 3ENSB 4F49A 1TIOA 3MI4A 1ID5H 1T8NA 1ELDE 3H7OA 1GDNA 3GDSA 3SJ9A 2ZI2H 2WINI 5DP9A 1DWEH 4IC5A 2C8ZB 1KLJH 3GCOA 1DSUA 1ZGVA 3O8DA 1KYNA 5SGAE 2EC9H 1OYQA 5C3NA 1UTPA 3BG4C 4FUEA 1K9OE 4DJZB 1DFPA 4WMFA 4QT8C 5GWZA 3UWJH 1LTOA 1K1IA 1CGHA 1HYLA 1GCTB 4E7NA 3QZRA 1O2KA 1XKBC 3MNCA 4HTCH 1SGNE 1YCPK 1O34A 1HBTH 2PUXB 4NA9H 4Q7ZA 5ESTE 2RA3A 1HAIH 4O97A
chains in the Genus database with same CATH superfamily
2AMPA 1OWHA 3V3MA 2QY0B 1C9PA 1LO6A 1C5OH 2ZHQH 3KQEA 2FOMB 3KIDU 1NY22 2A7JA 3A89A 2B9LA 2PR3A 1HAXB 1VCWA 4AFQA 2WZQA 1F0RA 1XUHA 1UTLM 5FPYA 4ZMAH 3MU5A 4UFGH 4WWYA 4XRNA 2XWBI 3ZVGA 2STAE 8ESTE 1G32B 1T8MA 4ABJA 1XXFA 3SNCA 2BX4A 2CHAC 5G4BA 1V2TT 1O2JA 1KSNA 1UHBB 1LCYA 2FXRA 1UVTH 2VU8E 2FTLE 3TU7H 3TK9A 1C4U2 2F9VA 3F9GA 1XUFA 2TBSA 1MU8B 1GJAB 1TMBH 3U69H 2FESH 4AFSA 3KEEA 1O3FA 1AVGH 5JBAS 4JZFH 2HRVA 1BBRK 1Y59T 3K6YA 1GHWH 1EAXA 3TJNA 1B0EA 3SJIA 3TGJE 1FONA 1AIXH 2R0KA 3PV2A 4DOQA 1GI0A 3UR6A 1V2PT 4UD9H 1VJ9U 4A6LA 1C5SA 1BJVA 1IQGA 1LVMA 1LMWB 4DW2U 1EASA 2G8TA 1IHTH 1TGNA 2BZ6H 4RT1A 5A09A 1AO5A 1A5IA 1H1BA 3TH2H 2ZCKP 1HV7A 5EPNA 3QZQA 5LPFA 1NFXA 3GDUA 1OSSA 3M5MA 2TGTA 4AG2A 3KQCA 3BEUA 4Y0ZE 5C1XA 1NRPH 4BTIB 3GCTF 4GSOA 2ESTE 2PP6A 4AN7A 1C2KA 5BRRE 1D3PB 1C2HA 2HLDD 3GCHC 1O3PB 1BTXA 3M5NA 1PPFE 2JH0D 5T6FA 3SORA 1NU9A 1O3KA 2QYIA 4DGJA 2C3SA 1K1LA 4Y10E 3SJ8A 3URCA 5HIZA 3SQEE 2CK3D 2Y5GA 1YKTA 1EPTA 1PPZA 1BRUP 4O9VA 2F4LA 2Z3DA 5ESBA 1G9IE 2VB0A 3S7KB 3GCNA 3D49H 1GCDA 4X2YA 5PTPA 3T26A 5E0HA 2Z9GA 3QK1A 5GXPA 1SR5C 1BUIA 4Y71A 3MOCA 1YPHE 2QE7D 1VITG 2QA9E 3LJJA 4FU9A 3FN8A 1KXAA 1O3EA 4JYVH 2H6MA 3BEIB 1C1TA 4LOYH 1O3HA 2J5UA 1A5HA 3LPRA 3MH4A 3SV9A 1O2YA 2IN2A 2LPRA 2SGPE 4XE4A 2ZFFH 2BYAX 1O37A 3A86A 4BOHA 3P95A 7LPRA 4ABDA 2HALA 1PPHE 2ZP0H 4ZKSU 2EI7A 1FY8E 2ZG0H 2A2QH 3IITA 4NZLA 2UUYA 2QIQA 4K8BA 1Z8IB 2IJD1 2TRMA 2ZECA 2QXIA 3FZDA 2AYWA 2XBWA 5EXMA 1A0LA 2ANYA 4GHQA 1C5YB 1ZR0A 2SGDE 1QRWA 2BVRH 3SNBA 1HGTH 1VITH 4IC6A 1UVPA 1DPOA 1V3XA 1YCPH 3MWIU 1ELVA 2HVXA 2QXJA 1A0HB 3E6PH 2J92A 4CR9A 4ISIH 3SOSA 5F6MA 4I8HA 4ZAEA 1ZZZA 3MH6A 1P2IA 2F9PA 1O2SA 4K1EA 1O5EH 1NFYA 3SUEA 1GG6B 1ABIH 2F83A 2GZ9A 4B2AA 2XXLA 3Q3KA 1O2IA 4ASHA 4KP0A 1ZMJA 5FCKA 1GI6A 3AASA 1GMHG 2BDAA 2XBXA 4AG1A 1C2FA 1FXYA 2CGAA 3T5FH 4FXGH 2ZGCA 3HATH 2AS9A 2IJOB 1KY9A 3KL6A 2ZWLH 4FUBA 5F03A 2Z9KA 1O5BB 3I29A 1LPKB 4D9QA 4DIHH 4D76A 1ZJDA 3P8GA 3EGKH 4GUXA 1O2WA 3LONA 5F8TA 3NCLA 1IQMA 2VGCB 2ZDNA 4D7GA 4AYYB 1MQ6A 1P2MA 2A7CA 4ISLA 1FAKH 1CU1A 1P2JA 4O03A 3SHCH 4FU8A 1C4Y2 2A7HA 1DX5M 1GG6C 2D2DA 5ETXA 1CT2E 2AFQB 2SNVA 3SGBE 3TPIZ 3FKSD 2JDID 1MTNC 4B2CA 4P02A 4TYDA 1EPTB 2VVCA 1YPHC 1Y5BT 2Q1JA 4OGYA 2F9OA 3AK5A 1GMHF 6GCHF 2FI5E 2PWXA 1XVOA 1C1MA 2GCTC 4RKJB 3EA8A 1G3EA 3OSYA 1O3DA 1YPKH 5FPSA 3UR9A 3P17H 3B8JA 2F9NA 1FV9A 5JBCS 1AQ7A 4VGCB 1C1WH 3ZZAA 1D9IA 3GY7A 2J34A 1GBLA 3LIWA 3RU4T 1BTHH 3QUMP 1HFDA 3ZVAA 4XSKU 1QQ4A 1GJ4H 1GHXH 3M35A 5EQQA 1C2GA 1NTPA 4FUFA 1KTTB 3AW0A 4RSPA 4GVUA 3GOVB 5BPEA 1C5LH 3UFAA 2QXHA 2Z94A 3T25A 1EP5A 1FJSA 1XXDA 1AI8H 1EPTC 1SLVB 5EIYA 3ZZ4A 2PHBA 3N7DA 2P16A 4BAOB 3BTGE 3LH3A 4B75A 4MNXA 2BD3A 3KQBA 1QNJA 1GBMA 1NC6A 3RXRA 2XBVA 5DN6D 1O2XA 1S0QA 1PJPA 1E79D 3D65E 1AVXA 2JETB 3LGYA 2ZGBH 1WOFA 2Z6BD 3QTOH 4JK6A 4VGCC 3URDA 1C1SA 2BVXH 1O2VA 3ZVEA 3UPEA 1J17T 1DWCH 1O36A 1JWTA 2ZPSA 3RXIA 1ESAA 3ZVDA 5LPEA 4NA8A 1C5QA 2XRCA 5DO4H 5TJXA 2K1QA 2FEQH 1WBGB 1SGIB 2Z3EA 1IQKA 4X8UH 1N1LA 1W8BH 5JYIA 2ZCHP 4TT3D 1UVOA 2UUFB 3EA7A 1KLIH 3SJOA 1O3GA 1S5SA 1YM0A 1EUFA 1MTWA 2NU4E 3LKWA 1G2MA 2W3IA 1JRTA 1T4UH 1ZHRA 2WPLS 4MPXA 3OY5U 4I8KA 4WY3A 1EJNA 5DP4A 1HPGA 1AKSA 1C2DA 1S83A 1YBWA 1RD3B 3UB0A 2O8TA 1G2LA 2OLGA 1P2KA 2PUQH 4INLA 2A32A 2BY5X 1TRYA 5EXNA 3OEED 5E0GA 2BLOA 3RXFA 1IAUA 1MCVA 1GVLA 1QJ6B 3BTWE 4FETA 1DVAH 5HXFA 1C5VA 1C1NA 1W12U 1YGCH 1TX6A 3RXVA 2BLVA 4Q7YA 3LGIA 2FPZA 2VBCA 1WQVH 3ZZ7A 1CE5A 3DA9B 3F9FA 2G5NA 1LHDH 3A8AA 5E0JA 1G3BA 3U98H 1OP8A 4OS4A 1SG8B 3NUMA 4LXBH 1UCYK 4DT4A 1NBMD 1GL0E 2A2XH 1O33A 3JZ1B 1BRCE 5F8ZA 1EOJA 3SNEA 1TQ7B 5C5NA 4YXWD 1Y5UT 3GICB 5DP8A 1L0ZA 2BZAA 4WXVA 2OP9A 1K2I1 1VR1H 5L2ZH 3DT0H 2G00A 3KQDA 3F2GA 2ZHDA 1OYTH 2Y80A 2F9UA 1BJUA 4INKA 1O3NA 1TRMA 2ZPQA 4KTSA 3VB7A 1ESTA 3UOPA 3CENA 4TY7A 3UNRA 5DG6A 4X1QU 1ORFA 5C17A 5DKMA 3ZYEA 2EQNA 4K1SA 1SC8U 4FUCA 4CBOA 4IW4E 1NROH 1VGCC 3MQKC 1GBTA 3LGUA 1UK4A 3H5CB 2XOKD 2W3KA 5F8XA 3PMAB 2HPPH 1AE8H 6CHAC 5EJLA 2THFB 3BTTE 5GCHG 1Z6EA 3A85A 3A84A 3KYFA 3DSGA 4OS2A 1GI7B 2GVFA 1Q2WA 1V2QT 2XBYA 4I8GA 1WTGH 1W11U 3UQVA 1SQOA 4AX9H 1P02A 1SGFA 1DLKB 5F53A 1O31A 1A46H 3Q3XA 1ZTJA 1AKSB 2OD3B 4HZHA 1OOKB 3FANA 2KCOA 4JK5A 2HNTF 2ZU4A 3RDZA 3STIA 1VCQA 4Y8YA 1PQ5A 3PB1E 3U8RH 1CVWH 1P2NA 3SGAE 2BDGA 1BTZA 2GJGA 4M9FA 1SLUB 2P3FH 2QF3A 2FX4A 2G4TA 3DCLA 3LOXA 3BTME 4UFEH 3KQ5A 2TIOA 1OWJA 5GCHF 1HUTH 3SV6A 1O2NA 3QX5H 5T3HA 2ZZUH 1DITH 4YM9A 1SSXA 3SI4H 5L6NH 2Z9IA 3RP2A 2Z3CA 4GPGA 4K5ZA 1A3BH 3EE0B 4M7GA 3ZZ6A 1NN6A 1UTNA 4WXIA 1TYNA 1W0KD 5C1YA 2O8UA 1MZAA 1IHSH 1SPJA 1QA0A 2WUBA 4AC9A 4NWLA 1LPZB 2CMYA 3OU0A 2XNIA 3SU2A 2VIDA 4FOUC 1LKAA 3F9HA 1TNIA 2PV9B 2BM2A 1QRZA 1EFRD 1MKXH 1HXEH 3I78A 1GMCG 3PTNA 1CHOG 1MAXA 5C67A 4RT0A 1S6FA 4SGBE 5A8ZA 4X6OA 3F1SB 1LDTT 1XX9A 3CP7A 3M7TA 2W7SA 4BAQB 2OC7A 4NG9H 1O5AB 1TWXB 4E06H 5C0TA 3U1JB 2G55A 3V12A 1SGRE 1H8IH 3Q3YA 2VWMA 1DT2A 4Z0KA 4XBDA 1TABE 2H5CA 3C27B 1GBKA 1F92A 1BRAA 1C2MA 1HNEE 1QB6A 1BIOA 4H6SB 1AMHA 4AOQA 1NO9H 4WJG2 3E90B 2W5EA 4A5TS 3N7OA 2PLXA 3LT3A 2GT7A 5CHAC 2GD4B 1C5NH 2Z7FE 1LKBA 1MZDA 1S6LA 1LVBA 2PW8H 2ZDAH 5HM2A 3RXGA 1MAYA 4X1SU 3N99A 1RJXB 3GS9A 1FY3A 3OFND 1OXGA 1ETRH 4JZEH 3W1EA 4ZHAA 2ZHFH 5C1UA 1OWKA 2A0QB 3RXUA 2TGDA 1E35B 3OY6U 2Q6FA 2CJIA 1QURH 3M5LA 4AFZA 1MTSA 1VJAU 2BY9X 1EZQA 1ZRKA 1H8HD 4D9RA 3SU6A 1HCGA 4B6EA 3EA9A 2BDYA 1GGDC 3ODFA 2ALPA 1HLTH 3L6PA 4ESTE 3MH7A 1BA8B 1ZOMA 1GJ8B 4OS5A 3QWCH 1Q31A 1K1PA 3ATLA 3QGJA 4B1TA 1W0JD 3RUOA 3S7HB 1ZMNA 3MYWA 1TBZH 3LH1A 3UIRA 4DVAU 1BB0B 2FOCA 4JCNA 2BDBA 4NCYA 4LK4A 1PYTD 1QIXB 3P70B 3P8OA 3A87A 3RXKA 4B71A 3PO1B 4X6PA 2ASUB 5J4SA 1GWAA 3BSQA 3ATMA 2BQ6B 4ZKNU 2FODA 2J4IA 1O2OA 1V2OT 1SGEE 4OS7A 2SGFE 3RXBA 1TGBA 1MMJN 2AMDA 2FM2A 1RGQA 2ZFTA 1SQAA 5HM9A 3VB4A 2OCVB 1O0DH 2ZHWH 5CHBA 3W95A 2Y7XA 4DCDA 3O8BA 1O2TA 1DE7H 1IQJA 2EEKA 1A61H 3M36A 5AHGH 3K2UA 3A7ZA 5JPMH 1GHYH 1W2KH 3IWMA 1XVMA 3OX7U 5JDUB 4B6FA 1L1JA 3Q00A 3Q76A 4IGDA 3OE7D 1GCTC 1ZSLA 2ODQA 1BQYA 1OKXA 3A7VA 4MLFB 3GCTG 2H9TH 1OS8A 1SLXB 2ZPRA 1FDPA 1SHHB 3TGIE 1TBRH 4ZHLU 3DSPA 1SGCA 3MNXA 1O2ZA 1C5UA 1C1OA 2RA0A 3TK5A 2W6JD 1AHTH 1V2RT 3TNTA 2NU0E 1CSOE 1IOEA 4BTTB 1BMMH 2A45B 2EI6A 2YMSD 2WPIS 3UWIA 3TIUA 1V2LT 1G3CA 2O8MA 5B6OA 2XC4A 2XYAA 3O8RA 1UK3A 2ODYB 4FUDA 3ZZCA 2LP6A 4F55A 1AB9B 2XCFA 3PYHA 3V7TA 1WTHD 1ELGA 3ZZ9A 2V3MA 1RIWB 2OXSA 2ANMH 4ZH8A 1AWHB 3SJKA 1WU1A 1GHAF 1NRRH 2OBOA 2V3HH 4Y7BA 2BX3A 2A31A 2J97A 1S81A 2FI4E 1PQ7A 3E8LA 1EZXC 5C0UA 1QHRB 1UTKA 3QLPH 4YESB 1O2LA 1Y3WA 1HJAB 2OINA 2WYJA 1DDJA 1BTUA 2K0QA 3QDZB 1A2CH 5EJ1A 1B7XB 1DLEA 1BRBE 1MD7A 1O3BA 2ZO3H 1GJBB 4INHA 4GCHF 1EZSC 4H42U 1AB9C 2Q6GA 3SU5A 1O5FH 1WXRA 1FY5A 1C5MD 3PRBA 1H4WA 4ZCNA 1KXFA 1P03A 2WV5A 3KYGA 3SHAH 3HKJB 4E7RG 2BMGB 1TNLA 4TPIZ 4BXWA 1MBQA 1ZPBA 1TX7A 2ZFQH 2SGEE 3GY5A 4KELA 1TMTH 4U30A 1QBNA 2WHXA 3G01A 3T28A 2KCPA 3F0OA 3MU8A 5KGOA 1XKAC 5EW2H 1V2KT 2A4OA 3E16B 3BV9B 3PV4A 4E05H 3HK3B 3U9AH 1IQHA 1XUJA 8KME2 1O3MA 3GDVA 3MU4A 2GV7A 4K1TA 4I7YH 2JH6D 3ZZ5A 1DS2E 1NPMA 2R0LA 1ARBA 1FN6A 1TNGA 4HFPB 1SVPA 4NSYA 4WMEA 3RXLA 3LGVA 5ABWA 1AU8A 4ABAA 2OTVA 1THRH 2HLCA 1O2MA 4Y0YE 1Z8RA 2ZU3A 2V3OH 1THSH 3A83A 3BTDE 3M7QA 3WW7A 6GCHG 1C9TA 1YLDA 2FOFA 5C20A 2GCHG 5A0BA 1YF4A 1TPAE 1NESE 3EDXB 1FY4A 1DANH 1MD8A 1T32A 4NA7A 1FUJA 2Y5FA 1L4ZA 1P04A 3DUXH 1ANDA 2FO9A 1ANBA 4FVBA 1ZLRA 3LJOA 2B0FA 3FP7E 4NWKA 1CGJE 3E3TA 7GCHG 1E1QD 2BD8A 3RXQA 1BBRH 3ZVBA 3SV8A 1P3EA 1GI9B 2FIRH 2HGTH 1GBBA 2WPJS 3K65B 1ELTA 3TH3H 1TAWA 3AAUA 5EGMA 3E91A 5I46H 1TQ0B 5EODA 2Z9LA 4CRBA 1FMGA 2RCEA 1ZGIA 2O8LA 1ABJH 1K28D 1SI5H 1AGJA 3MH5A 1P06A 1AN1E 1M9UA 1QB9A 1OWIA 2GCHF 1G37A 1T8LA 2O9QA 1GI3A 3PRDA 1YY3A 2FMJA 3DD2H 4Z1MD 1QL8A 1F2SE 2BQWB 3BTFE 2PSYA 1SL3A 4NZQA 7GCHF 1G3DA 1W7XH 1F7ZA 2Q6DA 3M3TA 3W94A 5E2OA 2ZA5A 2VGCC 1AZZA 5DP7A 2UWPA 2P3TB 5LGOA 4BXSA 2JJ2D 1ESBA 4Q7XA 5DPAA 2VVUA 5C5OA 3GY8A 3VB3A 2D8WA 1FY1A 3BTQE 1UJ1A 2BY6X 1O3OA 4Z6AH 3VPKA 3A8DA 4X0WU 1INCA 3ZVCA 1QL9A 5FBIA 4XD7D 1HIAB 1LHFH 1Y3VA 2FX6A 1GL1A 4ZKOU 1YP9A 1O3CA 1O5DH 2KCAA 1QFKH 5JBBS 1UW7A 2AHME 4GHTA 2WUCA 2SFAA 2R3UA 1SOTA 2BD7A 1EKBB 2IPQX 2BXTH 2I6SA 3SNDA 8LPRA 2FLRH 2FYQA 2ZKSA 2Y7ZA 5IYTA 1DICA 1JRSA 2C8XB 1O2HA 1GJCB 2VVVA 2AEIH 2AIPA 2VIQA 3F2FA 5I25A 7ESTE 3HKIB 1PQ8A 3SN8A 4YOGA 1K1OA 3PWCA 4I31A 1MTVA 2CF8H 1P57B 1H8DH 1RTKA 5HKKD 4YT7H 3F9EA 1GJ6A 1C1QA 1Y5AT 1H9IE 2QAAA 5E8EH 2BD2A 1GHBF 4CREA 1KIGH 2GT8A 3D62A 1RRKA 3UUZA 2IPHA 2A5IA 1K1JA 1GJDB 2CF9H 1LVYA 2JETC 4YZUA 2BD5A 4CRCA 4U01A 5GPIB 2PKSB 2B7DH 3OTJE 3S69A 1ELBA 3ELAH 1BITA 4A1XA 4ABHA 3TGKE 1B0FA 1DXPA 4ISHH 3LU9B 2V7QD 4P00A 1Z1JA 5FL7D 3WY8A 1RTFB 2FDAA 1GJ9B 2A1DB 1PPEE 4YTAA 3A7TA 4UE7H 2DE8A 1SQTA 4O3UA 4RKOB 1SLWB 1A7SA 3M5OA 1OHHD 3SU1A 2SGAA 2JH5D 1J9CH 4XBBA 3O8CA 1G30B 1HXFH 1OWDA 1IQNA 2BDIA 2KZ4A 1ANEA 4RI0A 3T2NA 4AORA 4IS5A 2RG3A 3BN9A 3F68H 3M37A 4K8YA 1K1NA 4GAWA 3FP6E 5FX5A 3RMMH 1T7CA 3M7UA 1T31A 2F3CE 1P11E 3FP8E 1QGFA 4JZDH 1O2PA 2GDEH 4WH6A 2TGAA 3MU0A 4MNVA 1YC0A 4ZXXH 2GZ7A 2ZU1A 4CH2B 3TJUA 1C5XB 1CBWB 4NIXA 2XNDD 2G4UA 4Y7AA 5T6DA 1TA2A 1YWUA 2F9BH 1GDQA 4ZHMU 4U32A 2QV1A 1A5GH 3HGNA 4ABEA 4JYTA 1AFEH 1SGPE 1QQUA 1BHXF 1DSTA 1TALA 3E1XB 1NRQH 4DY7B 1LHEH 2WV4A 3NZIA 2DE9A 3ESTA 3SV2H 3RM2H 1EP6A 4NIYA 2ZHEH 1S0RA 1CA8B 4FUGA 2VINA 3LC3A 1XM1A 1PFXC 1OP2A 1N8OB 1SFIA 4WVPE 3VB6A 3P6ZB 2BDCA 2QF4A 3ZV8A 3BTHE 3M61U 3V13A 2K8IA 1COWD 5EXLA 2ZDVH 4KTCA 3KCGH 1S82A 2GX4A 2R3YA 1A0JA 2WPMS 2Y81A 3B9FH 4OM9A 1EZUC 5JB8S 1ELCA 2WSSD 5GNDA 5T1VA 1VCPA 1V2WT 3FFGA 3TJOA 1H9LB 5EG4A 1WQSA 4A1TA 5A0CA 1GI4A 1E1RD 2ZFPH 3MNBA 3EE7A 5DSFA 1GMDG 3UNSA 2JKHA 4CRAA 1V6DA 4NGAH 1FAXA 1HAZB 1B5GH 2UWLA 3MO9A 2FS9A 7KMEH 2R2WU 1K0HA 1AUJA 4BNRA 3S9BA 3WWBA 3DSOA 2BB4A 1GBIA 3UREA 2ZQ2A 5DGJA 4IBLH 1LPGB 3OYPA 4X2XA 5EU8A 1GJ7B 2AGEX 1GI2A 2GTBA 4IMQA 2G81E 1C5PA 3B23B 2VH6A 3ZZBA 1HAGE 4TWYA 2A4RA 2FWWA 2GMTB 3QTVH 2OC0A 2WPDD 4BTUB 5DP5A 1UCYE 3MHWU 2ODPA 2BHGA 2J95A 2ILNA 2FP7B 4X1NU 2ZFSA 2ZIQH 1GMDF 3EYDA 2ZNKH 1EAWA 2FOHA 4O3TA 3QN7A 1WDIA 4HGCA 4CRDA 1NU7B 1LHGH 3VEQB 1PYTC 2ZTZA 1DY8A 1UCYH 3TLOA 2FZZA 2ZU2A 1P10A 4K3JA 1AE5A 2FYRA 3DFJA 3C1KA 3GY2A 4HG6A 4ABGA 1JOUB 1O3AA 3KNXA 4BAMB 3PWBA 1HAHH 3UNQA 2BY8X 3NKKA 4YOIA 1TX8A 2ZGJA 4FUIA 1D3DB 4J1YA 4PROA 4MQAA 2GP9B 1GI1A 4Y79A 4R8TB 2TPIZ 2P94A 1O3LA 2YMSB 4A92A 1HJ9A 2AIQA 2ANKH 1ZJKA 1DXWA 1AWFH 1X7AC 1BMLA 1QRXA 2XCNA 3PLPA 3BIVH 1P8VC 1ZPZA 1V2ST 1C1UH 2ZEBA 2VIWA 4X8SH 3BG4B 3MNSA 3I77A 1C5WB 3KGPA 1MTUA 1YPGH 3QO6A 5DP6A 1O32A 4I8LA 3RMOH 1CGIE 1H9HE 3AAVA 1TNHA 2BLWA 5DK1A 5L2YH 2M5TA 3LDXH 1O39A 5HIYA 3U28C 5FXLA 1UTJA 2ZQ1A 3K9XB 4X2WA 1FX0B 1ELFA 4I8JA 2D26C 1BT7A 1UMAH 4OGXA 4DT7B 1EJMA 2AMQA 4AB8A 2ZDKA 1ACBE 2HOBA 5A8YA 1JIMA 4X2VA 2XC0A 2P95A 4MVNA 1W10U 3WWFA 4Q2KA 3KHVA 3SZEA 3SZNA 1DWBH 1J16A 2CHAB 3TVJB 2NU2E 2J9NA 2UUKB 1GBEA 1GPZA 2KCYA 4BAKB 1K21H 4ISOA 1QCPA 2OQ5A 2WPHS 1QBOA 1L4DA 3N7EA 3SI3H 1SGYE 3PMBB 1NS3A 3S9AA 3LGWA 2QXGA 1BTPA 4YO9A 3H7TA 1V2UT 3DHKH 1SGQE 2YOLA 3RC6A 1MKWK 2VWLA 4MPWA 4NFEA 1P2QA 5HYOA 1NFWA 1THPB 1NFUA 2PSXA 1C2JA 3LGTA 4THNH 3PO1C 1C1RA 1QA7A 1QTFA 1TGCA 2FTMA 1YLCA 5T6GA 4AZ2B 1GHAG 4TY6A 3FVFB 3SGQE 2FOEA 2OBQA 1K22H 3UY9A 1ETTH 1QBVH 4Y76A 2NU1E 2NWNA 1OPHB 3GYMA 1HJ8A 4UEHH 1TPPA 2ULLA 5GDSH 1TPOA 1A1RA 2BY7X 1AVWA 1EATA 2OK5A 3RXMA 4TSFD 1Z8JB 2BVSH 1TFXA 1WCZA 3OAAD 2VIPA 1O3JA 3GCHB 4Q63A 3OEHD 3PMHB 3SU3A 5FAHA 5CE1A 3A80A 3VG8A 2J98A 3VFEA 3BF6H 3FZZA 4GCHG 9LPRA 1GI8B 1TOCB 1W0ZU 2XW9A 1BMAA 4H4FA 3RU4D 1TRNA 1MU6B 4I32A 1C2EA 1MUEB 3RXCA 5AFYH 1W3CA 1J15A 1ZSJA 3UTUH 4XBCA 1ZHPA 1Q3XA 2J38A 3VB5A 3GY4A 4I33A 1Z7KA 1Y8TA 1SBWA 5E2PA 1ZTLA 3MFJA 2C4FH 2C8WB 2UWOA 1FPCH 1PPBH 1RTLA 1K1MA 2FOGA 2GZ8A 1AD8H 1MABB 4OS1A 1F5LA 1IQEA 2SNWA 4A7IB 1L2EA 3TH4H 4ABIA 2OC1A 1YPLH 2V0BA 2BLQA 2LELA 3U8TH 1O3IA 3A8BA 5KECA 4MG3A 2GKVE 1Z8GA 3RXAA 3EAJA 3PLKA 5L30H 1P09A 2VH0A 3PV5A 3UAIC 1C5RA 2VNTA 4F4OC 1CT4E 2STBE 1GBHA 4Y8ZA 4MPUA 3TJVA 1N6YA 1GBFA 3AVZA 1RIWC 1P0SH 4Y8XA 1F5KU 3GY6A 1SMFE 3EQ0H 4MTBA 2XC5A 3NPSA 3SO3A 2ZDLA 1T4VH 1Y3XA 4ISNA 3GISB 1DUEA 4WMDA 1BCUH 3ZIAD 1CA0B 1EB2A 4KTUA 1C5TA 1O35A 1LQDB 4UDWH 1JIRA 1JBUH 2KFWA 1FIZA 3OTPA 5A8XA 1HJAC 4YLUA 4I86A 2BTCE 2OQUA 2V35A 3ZZ8A 1QJ7B 2RDLA 3BTKE 1EJAA 1HIAA 1IQIA 5B6LA 2P59A 1TNKA 3FOAA 1C2LA 2JJ1D 3PMJA 3HPTB 5C94A 1Y3YA 4FUJA 1YLNA 2F91A 4D8NA 3BTEE 1Z1IA 3SW2B 5LPRA 4YOJA 4SGAE 5EQSA 4D7FA 3RXSA 3ZVFA 1VITF 1BBRE 5J4QA 1CA0C 3T27A 1MKWH 4WF8A 1GHVH 3VXFH 3A82A 3P8FA 1NBME 1AFQB 1J8AA 1HB0B 2FLBH 2J98B 5JB9S 5AVDA 1A4WH 2H1UA 1V2NT 2D1JA 2EA3A 2A5KA 2BD4A 2VJ1A 3F6UH 2P3UB 1MTNB 5FBEA 2PGQB 2ZGHA 2FOBA 4ZKRU 3PROA 8GCHG 1T8OA 2RDEA 1D6WA 1YPJH 2W7UA 3MO6A 4DG4A 4NFFA 1KLTA 3RXTA 1VZQH 4WH8A 2GCTB 5K0HA 4NIWA 3F0PA 1GDUA 1NT1A 1WYKA 5FPTA 1GJ5H 4LZ4B 1C1PA 4KKDA 1P01A 3SV7A 1FI8A 1UTOA 5FHTA 1SGDE 1SGTA 2QCYA 4ZUHA 2SGQE 3VXEH 2WV9A 5GJ4B 1KDQA 4AGKA 1AFQC 2QN5T 1GBJA 4FVDA 3ATIA 1KXCA 1PPGE 4KGAA 3RC5A 2C90B 1AZ8A 1JXPA 3AW1A 2UUJB 2AGGX 1TONA 1O5CB 8GCHF 1QB1A 4BANB 1RXPA 2L6OA 2ZF0H 1IQFA 2ALVA 3NXPA 1G36A 1TB6H 6ESTA 1P2OA 2AGIX 1A3EH 3TK6A 2EI8A 1WSSH 1CQQA 2BDHA 3SUDA 4AYVB 4XDEA 4FUHA 1XUIA 3GY3A 1O2RA 1GBDA 1GI5A 3CS7A 1KXBA 2IOTA 1NRNH 1BTWA 4AGJA 3P92A 1F0TA 2Y82A 3SQHE 4X1PU 1V2VT 3RLWH 3GYLB 3E0PB 1FPHH 1GBAA 1GHBG 1GVKB 2ZTXA 1BOQA 3ZZ3A 5A0AE 1LHCH 2R9PA 3BIUH 4J2YB 1OX1A 1XMNB 1CHGA 3UOUA 1KMHB 4RN6A 4F48B 2ZGXH 4CRGA 1AY6H 1TBQH 1MH0A 4NIVA 4ACBA 4ACAA 2A5AA 2HWLB 2J2UA 3M3SA 4B76A 1SFQB 1XUGA 3A7WA 2KAIA 2P8OB 4XFQA 1D3QB 2B5TB 1MBMA 1U6QA 2HPQH 1KXDA 1P9SA 2A4QA 2ZC9H 4X8TH 1RFNA 3ATKA 3RXOA 2W26A 4B74A 1EAIA 2P93A 1HAVA 4JMYA 2QF0A 3CS0A 1DM4B 1W14U 4ABBA 1YYY1 1O2UA 3FAOA 1BZXE 3RM0H 3QGNB 2BOKA 1L1GA 2FOAA 3U1IB 5CDFE 3KF2A 4TWWA 2BD9A 1DOJA 1HAYB 1KXEA 1OWEA 1PPCE 2B8OH 2PKAA 3LC5A 4TPYA 4CBNA 2H9EH 2BOHB 2L74A 1C1VH 1UVUH 5AF9H 1DY9A 1HAPH 5FX6A 2Z9JA 2DUCA 2I6QA 1SHYA 4MDSA 2PTCE 2ZU5A 4IN2A 2OUAA 1KDQB 3IG6B 3Q77A 2P8OC 3MU1A 2ZDMA 1W13U 1NM6A 1W0YH 4A1VA 1W7GH 4H6TA 3NRLA 3SYJA 1GVZA 3ZZDA 3PTBA 3PM3A 2QF5A 2A4GA 1ELEE 1YPEH 1KTSB 2GDDA 1TOMH 4MPVA 1D6RA 3F2HA 3U8OH 3RC4A 1MKXK 3RMNH 1IQLA 1D4PB 4IN1A 2PKSC 1FLEE 1ZSKA 4K60A 2FI3E 2EY4C 1SB1H 3L3TA 3E0NB 4FU7A 1EOLA 4X8VH 1Y3UA 1MQ5A 5EW1H 5K7RA 3SUGA 2YNBA 2VWNA 3RXJA 4JZ1A 1FZZA 1S85A 3SUFA 3S0NA 1VGCB 5IDKA 5DJ7A 3UQOA 1E34B 3D23A 3M3VA 1HDTH 2ZFRH 5EPYA 1C2IA 1UTMA 2RFKC 6CHAB 1E36B 3DFLA 3SNAA 2H2ZA 4ZROA 5EOKA 4MNYA 2G52A 1C4V2 2FS8A 3A7XA 5TCCA 1RS0A 2HNTE 4HI3A 1PQAA 1ZTKA 1UTQA 2W6ID 1WV7H 1EQ9A 1EAUA 2HVYB 4IMZA 1FNIA 3T62A 2J94A 2KAIB 1P3CA 4X1RU 5EJZA 2BXUH 5LH8A 1Z71A 1E0FD 4K2YA 2AH4X 5H4IB 1Z6JH 4GLYA 1D3TB 4Q4LA 4AB9A 3S9CA 1FIWA 1SKYE 2QC2A 1CO7E 2TGPZ 1HAVB 1P9UA 5EQRA 3ZYDA 3STJA 2ZTYA 1YPMH 5DP3A 4U2WA 2GV6A 1ZYOA 2H9HA 4UONA 3ATWA 1DWDH 1UVSH 1FN8A 1CBWC 3TITA 4LZ1H 2PKAB 1TA6A 2KM0A 3RXHA 1BMNH 1E37B 1F0SA 4YLQH 1EX3A 1TPSA 2R2MB 1HAOH 4X6NA 1LQEA 3H09A 3MMGA 1S6HA 4BAHB 2BQ7B 3NWUA 1ETSH 3F3BA 4ASUD 1BHXB 3RMLH 1OP0A 3NK8A 1V2JT 1VKYA 2ANWA 3ZV9A 4YT6H 3A88A 1TE0A 2CN0H 3HGPA 1BDAA 2O8WA 5TCAA 1L1NA 4CR5A 1LVOA 1N6XA 3JZ2B 1XUKA 2ZCLP 2H5DA 2KR7A 5FCRA 1ANCA 1GBCA 2V6NA 2G51A 3KN2A 3FO8D 2VIVA 5AFZH 1UO6A 3BEFB 4XOJA 3BG8A 3L33A 4Y6DA 9ESTA 3ITIA 1AUTC 3SBKA 4CHAB 1N8OC 5HGGA 2AERH 4NSVA 2NU3E 1E38B 1QZ8A 3VGCB 4AFUA 2F43B 6LPRA 1CT0E 1EB1H 1SGFG 1TGSZ 5HMAA 4JYUH 1MCTA 4K69A 1ZPCA 2C93B 4ABFA 2CV3A 1WAYB 4JZIA 4UFDH 3T29A 2G5VA 1NRSH 3RU4E 1EXFA 2Y6TA 1O38A 1TMUH 3RXDA 1JMOH 4B73A 2GGVB 1UK2A 1TGTA 3HK6B 3ODDA 1YCPM 1TNJA 2PGBB 4UFFH 3CNRA 3R3GB 1O2GH 4B2BA 2HNTC 3SU4A 1F0UA 1ARCA 3MO3A 3V0XA 3SU0A 4OS6A 2CXVA 5CHAB 5C2ZA 5CMXH 2XTTB 3PLBA 1QY6A 3MTYA 5KEDA 1ZMLA 4CHAC 3RLYH 1F5RA 1QJ1B 5JBTA 1SOZA 5A2MH 3VGCC 2XWAA 4X6MA 2JIZD 3A8CA 2C8YB 1UHBA 1DUAA 3A81A 2LNCA 2GMTC 1GHZA 1HRTH 1H8ED 3RXEA 2QGRA 4Q80A 4ZXYH 4MNWA 1QR3E 1ZHMA 4Y11E 2WYGA 4DIIH 1C5ZB 1TLDA 3R0FA 5IK2D 1V2MT 2YNAA 2VIOA 4DURA 1GGDB 1FQ3A 1NZQH 4CRFA 2PTNA 3A7YA 1O5GH 1QL7A 3TNSA 2WPKS 1BTYA 1WUNH 1P05A 2Y5HA 3RXPA 1S84A 1GMCF 1O30A 1J14A 4CH8B 5GIBA 1CHOF 2PFEA 4R0IA 1O2QA 1ELAA 3K6ZA 1ZRBA 2OC8A 2VWOA 1P12E 3P8NA 3ENSB 2YMSC 4F49A 1TIOA 2KX4A 3MI4A 1ID5H 1T8NA 1ELDE 3H7OA 1GDNA 3GDSA 3SJ9A 2ZI2H 2WINI 5DP9A 1DWEH 4IC5A 2C8ZB 1KLJH 3GCOA 1DSUA 1ZGVA 3O8DA 1KYNA 5SGAE 2EC9H 1OYQA 5C3NA 1UTPA 3BG4C 4FUEA 1K9OE 4DJZB 2M2AA 1DFPA 4WMFA 4QT8C 5GWZA 3UWJH 1LTOA 1K1IA 1CGHA 1BMFD 1HYLA 1GCTB 4E7NA 3QZRA 1O2KA 1XKBC 3MNCA 1SQRA 4HTCH 1SGNE 1YCPK 1O34A 1HBTH 2PUXB 4NA9H 4Q7ZA 5ESTE 2RA3A 1HAIH 4O97A
chains in the Genus database with same CATH topology
2AMPA 1OWHA 3V3MA 2QY0B 1C9PA 1LO6A 1C5OH 2ZHQH 3KQEA 2FOMB 3KIDU 1NY22 2A7JA 3A89A 2B9LA 2PR3A 1HAXB 1VCWA 4AFQA 1F0RA 1XUHA 1UTLM 5FPYA 4ZMAH 3MU5A 4UFGH 4WWYA 2XWBI 3ZVGA 2STAE 8ESTE 1G32B 1T8MA 4ABJA 1XXFA 3SNCA 2BX4A 2CHAC 5G4BA 1V2TT 1O2JA 1KSNA 1UHBB 1LCYA 2FXRA 1UVTH 2VU8E 2FTLE 3TU7H 3TK9A 1C4U2 2F9VA 3F9GA 1XUFA 2TBSA 1MU8B 1GJAB 1TMBH 3U69H 2FESH 4AFSA 3KEEA 1O3FA 1AVGH 5JBAS 4JZFH 2HRVA 1BBRK 1Y59T 3K6YA 1GHWH 1EAXA 3TJNA 1B0EA 3SJIA 3TGJE 1FONA 1AIXH 2R0KA 4DOQA 1GI0A 3UR6A 1V2PT 4UD9H 1VJ9U 4A6LA 1C5SA 1BJVA 1IQGA 1LVMA 1LMWB 4DW2U 1EASA 2G8TA 1IHTH 1TGNA 2BZ6H 5A09A 1AO5A 1A5IA 1H1BA 3TH2H 2ZCKP 1HV7A 5EPNA 3QZQA 5LPFA 1NFXA 3GDUA 1OSSA 3M5MA 2TGTA 4AG2A 3KQCA 3BEUA 4Y0ZE 5C1XA 1NRPH 4BTIB 3GCTF 4GSOA 2ESTE 4AN7A 5BRRE 1C2KA 1D3PB 1C2HA 3GCHC 1O3PB 1BTXA 3M5NA 1PPFE 2JH0D 5T6FA 3SORA 1NU9A 1O3KA 2QYIA 4DGJA 2C3SA 1K1LA 4Y10E 3SJ8A 3URCA 3SQEE 4O9VA 2Y5GA 1YKTA 1EPTA 1PPZA 1BRUP 2Z3DA 5ESBA 1G9IE 2VB0A 3S7KB 3GCNA 3D49H 1GCDA 4X2YA 5PTPA 3T26A 5E0HA 2Z9GA 3QK1A 5GXPA 1SR5C 1BUIA 4Y71A 3MOCA 1YPHE 1VITG 2QA9E 3LJJA 4FU9A 1KXAA 1O3EA 4JYVH 2H6MA 3BEIB 1C1TA 4LOYH 1O3HA 1A5HA 3LPRA 3MH4A 3SV9A 1O2YA 2IN2A 2LPRA 2SGPE 4XE4A 2ZFFH 2BYAX 1O37A 3A86A 4BOHA 3P95A 7LPRA 4ABDA 2HALA 1PPHE 2ZP0H 4ZKSU 2EI7A 1FY8E 2ZG0H 2A2QH 3IITA 4NZLA 2UUYA 2QIQA 4K8BA 1Z8IB 2TRMA 2ZECA 2QXIA 3FZDA 2AYWA 2XBWA 5EXMA 1A0LA 2ANYA 4GHQA 1C5YB 1ZR0A 2SGDE 1QRWA 2BVRH 3SNBA 1HGTH 1VITH 4IC6A 1UVPA 1DPOA 1V3XA 1YCPH 3MWIU 1ELVA 2HVXA 2QXJA 1A0HB 3E6PH 2J92A 4CR9A 4ISIH 3SOSA 5F6MA 4I8HA 4ZAEA 1ZZZA 3MH6A 1P2IA 2F9PA 1O2SA 4K1EA 1O5EH 1NFYA 3SUEA 1GG6B 1ABIH 2F83A 2GZ9A 4B2AA 2XXLA 3Q3KA 1O2IA 4ASHA 4KP0A 1ZMJA 5FCKA 1GI6A 3AASA 1GMHG 2BDAA 2XBXA 4AG1A 1C2FA 1FXYA 2CGAA 3T5FH 4FXGH 2ZGCA 3HATH 2AS9A 2IJOB 1KY9A 3KL6A 2ZWLH 4FUBA 5F03A 2Z9KA 1O5BB 3I29A 1LPKB 4D9QA 4DIHH 4D76A 1ZJDA 3P8GA 3EGKH 4GUXA 1O2WA 3LONA 5F8TA 3NCLA 1IQMA 2VGCB 2ZDNA 4D7GA 4AYYB 1MQ6A 1P2MA 2A7CA 4ISLA 1FAKH 1CU1A 1P2JA 4O03A 3SHCH 4FU8A 1C4Y2 2A7HA 1DX5M 1GG6C 2D2DA 5ETXA 1CT2E 2AFQB 2SNVA 3SGBE 3TPIZ 1MTNC 4B2CA 4TYDA 1EPTB 2VVCA 1YPHC 1Y5BT 2Q1JA 4OGYA 2F9OA 1GMHF 6GCHF 2FI5E 2PWXA 1XVOA 1C1MA 2GCTC 4RKJB 3EA8A 1G3EA 3OSYA 1O3DA 1YPKH 5FPSA 3UR9A 3P17H 3B8JA 2F9NA 1FV9A 5JBCS 1AQ7A 4VGCB 1C1WH 3ZZAA 1D9IA 3GY7A 2J34A 1GBLA 3LIWA 3RU4T 1BTHH 3QUMP 1HFDA 3ZVAA 4XSKU 1QQ4A 1GJ4H 1GHXH 3M35A 5EQQA 1C2GA 1NTPA 4FUFA 1KTTB 3AW0A 4RSPA 4GVUA 3GOVB 5BPEA 1C5LH 3UFAA 2QXHA 2Z94A 3T25A 1EP5A 1FJSA 1XXDA 1AI8H 1EPTC 1SLVB 3ZZ4A 2PHBA 2P16A 4BAOB 3BTGE 3LH3A 4B75A 4MNXA 2BD3A 3KQBA 1QNJA 1GBMA 1NC6A 3RXRA 2XBVA 1O2XA 1S0QA 1PJPA 3D65E 1AVXA 2JETB 3LGYA 2ZGBH 1WOFA 2Z6BD 3QTOH 4JK6A 4VGCC 3URDA 1C1SA 2BVXH 1O2VA 3ZVEA 3UPEA 1J17T 1DWCH 1O36A 1JWTA 2ZPSA 3RXIA 1ESAA 3ZVDA 5LPEA 4NA8A 1C5QA 2XRCA 5DO4H 5TJXA 2K1QA 2FEQH 1WBGB 1SGIB 2Z3EA 1IQKA 4X8UH 1N1LA 1W8BH 5JYIA 2ZCHP 1UVOA 2UUFB 3EA7A 1KLIH 3SJOA 1O3GA 1S5SA 1YM0A 1EUFA 1MTWA 2NU4E 3LKWA 1G2MA 2W3IA 1JRTA 1T4UH 1ZHRA 2WPLS 4MPXA 3OY5U 4I8KA 4WY3A 1EJNA 5DP4A 1HPGA 1AKSA 1C2DA 1S83A 1YBWA 1RD3B 2O8TA 1G2LA 2OLGA 1P2KA 2PUQH 4INLA 2A32A 2BY5X 1TRYA 5EXNA 5E0GA 2BLOA 3RXFA 1IAUA 1MCVA 1GVLA 1QJ6B 3BTWE 1DVAH 5HXFA 1C5VA 1C1NA 1W12U 1YGCH 1TX6A 3RXVA 2BLVA 4Q7YA 3LGIA 2FPZA 1WQVH 3ZZ7A 1CE5A 3DA9B 3F9FA 2G5NA 1LHDH 3A8AA 5E0JA 1G3BA 3U98H 1OP8A 4OS4A 1SG8B 3NUMA 4LXBH 1UCYK 1GL0E 2A2XH 1O33A 3JZ1B 1BRCE 5F8ZA 1EOJA 3SNEA 1TQ7B 5C5NA 1Y5UT 3GICB 5DP8A 1L0ZA 2BZAA 4WXVA 2OP9A 1K2I1 1VR1H 5L2ZH 3DT0H 2G00A 3KQDA 2ZHDA 1OYTH 2Y80A 2F9UA 1BJUA 4INKA 1O3NA 1TRMA 2ZPQA 4KTSA 3VB7A 1ESTA 3UOPA 3CENA 4TY7A 3UNRA 5DG6A 4X1QU 1ORFA 5DKMA 3ZYEA 4K1SA 1SC8U 4FUCA 4CBOA 4IW4E 1NROH 1VGCC 1GBTA 3LGUA 1UK4A 3H5CB 2W3KA 5F8XA 3PMAB 2HPPH 1AE8H 6CHAC 2THFB 3BTTE 5GCHG 1Z6EA 3A85A 3A84A 4OS2A 1GI7B 2GVFA 1Q2WA 1V2QT 2XBYA 4I8GA 1WTGH 1W11U 3UQVA 1SQOA 4AX9H 1P02A 1SGFA 1DLKB 1O31A 1A46H 3Q3XA 1ZTJA 1AKSB 2OD3B 4HZHA 1OOKB 3FANA 4JK5A 2HNTF 2ZU4A 3RDZA 3STIA 1VCQA 4Y8YA 1PQ5A 3PB1E 3U8RH 1CVWH 1P2NA 3SGAE 2BDGA 1BTZA 1SLUB 2P3FH 2QF3A 2FX4A 2G4TA 3LOXA 3BTME 4UFEH 2TIOA 1OWJA 5GCHF 1HUTH 3SV6A 1O2NA 3QX5H 5T3HA 2ZZUH 1DITH 4YM9A 1SSXA 3SI4H 5L6NH 2Z9IA 3RP2A 2Z3CA 4GPGA 4K5ZA 1A3BH 3EE0B 4M7GA 3ZZ6A 1NN6A 1UTNA 4WXIA 1TYNA 5C1YA 2O8UA 1MZAA 1IHSH 1SPJA 1QA0A 2WUBA 4NWLA 1LPZB 2CMYA 3OU0A 2XNIA 3SU2A 2VIDA 1LKAA 3F9HA 1TNIA 2PV9B 2BM2A 1QRZA 1MKXH 1HXEH 3I78A 1GMCG 3PTNA 1CHOG 1MAXA 5C67A 1S6FA 4SGBE 5A8ZA 4X6OA 3F1SB 1LDTT 1XX9A 3CP7A 3M7TA 2W7SA 4BAQB 2OC7A 4NG9H 1O5AB 1TWXB 4E06H 3U1JB 2G55A 3V12A 1SGRE 1H8IH 3Q3YA 2VWMA 1DT2A 4Z0KA 4XBDA 1TABE 2H5CA 3C27B 1GBKA 1F92A 1BRAA 1C2MA 1HNEE 1QB6A 1BIOA 4H6SB 1AMHA 4AOQA 1NO9H 4WJG2 3E90B 2W5EA 4A5TS 3N7OA 2PLXA 3LT3A 2GT7A 5CHAC 2GD4B 1C5NH 2Z7FE 1LKBA 1MZDA 1LVBA 2PW8H 2ZDAH 5HM2A 3RXGA 1MAYA 4X1SU 1RJXB 1FY3A 1OXGA 1ETRH 4JZEH 4ZHAA 2ZHFH 5C1UA 1OWKA 2A0QB 3RXUA 2TGDA 1E35B 3OY6U 2Q6FA 2CJIA 1QURH 3M5LA 4AFZA 1MTSA 1VJAU 2BY9X 1EZQA 1ZRKA 4D9RA 3SU6A 1HCGA 3EA9A 2BDYA 1GGDC 3ODFA 2ALPA 1HLTH 3L6PA 4ESTE 3MH7A 1BA8B 1ZOMA 1GJ8B 4OS5A 3QWCH 1Q31A 1K1PA 3ATLA 3QGJA 4B1TA 3RUOA 3S7HB 1ZMNA 3MYWA 1TBZH 3LH1A 3UIRA 4DVAU 1BB0B 2FOCA 4JCNA 2BDBA 4NCYA 4LK4A 1PYTD 1QIXB 3P70B 3P8OA 3A87A 3RXKA 4B71A 3PO1B 4X6PA 2ASUB 5J4SA 1GWAA 3BSQA 3ATMA 2BQ6B 4ZKNU 2FODA 2J4IA 1O2OA 1V2OT 1SGEE 4OS7A 2SGFE 3RXBA 1TGBA 1MMJN 2AMDA 2FM2A 1RGQA 2ZFTA 1SQAA 5HM9A 3VB4A 2OCVB 1O0DH 2ZHWH 3W95A 2Y7XA 4DCDA 3O8BA 1O2TA 1DE7H 1IQJA 2EEKA 1A61H 3M36A 5AHGH 3K2UA 3A7ZA 5JPMH 1GHYH 1W2KH 3IWMA 1XVMA 3OX7U 5JDUB 1L1JA 3Q00A 3Q76A 4IGDA 1GCTC 1ZSLA 2ODQA 1BQYA 1OKXA 3A7VA 4MLFB 3GCTG 2H9TH 1OS8A 1SLXB 2ZPRA 1FDPA 1SHHB 3TGIE 1TBRH 4ZHLU 1SGCA 3MNXA 1O2ZA 1C5UA 1C1OA 2RA0A 3TK5A 1AHTH 1V2RT 3TNTA 2NU0E 1CSOE 1IOEA 4BTTB 1BMMH 2A45B 2EI6A 2WPIS 3UWIA 3TIUA 1V2LT 1G3CA 2O8MA 5B6OA 2XC4A 2XYAA 3O8RA 1UK3A 2ODYB 4FUDA 3ZZCA 1AB9B 2XCFA 3PYHA 3V7TA 1WTHD 1ELGA 3ZZ9A 1RIWB 2OXSA 2ANMH 4ZH8A 1AWHB 3SJKA 1WU1A 1GHAF 1NRRH 2OBOA 2V3HH 4Y7BA 2BX3A 2A31A 1S81A 2FI4E 1PQ7A 3E8LA 1EZXC 1QHRB 1UTKA 3QLPH 4YESB 1O2LA 1Y3WA 1HJAB 2OINA 2WYJA 1DDJA 1BTUA 3QDZB 1A2CH 1B7XB 1DLEA 1BRBE 1MD7A 1O3BA 2ZO3H 1GJBB 4INHA 4GCHF 1EZSC 4H42U 1AB9C 2Q6GA 3SU5A 1O5FH 1FY5A 1C5MD 1H4WA 1KXFA 1P03A 2WV5A 3SHAH 3HKJB 4E7RG 2BMGB 1TNLA 4TPIZ 4BXWA 1MBQA 1ZPBA 1TX7A 2ZFQH 2SGEE 3GY5A 4KELA 1TMTH 4U30A 1QBNA 3G01A 3T28A 3MU8A 1XKAC 5EW2H 1V2KT 2A4OA 3E16B 3BV9B 3PV4A 4E05H 3HK3B 3U9AH 1IQHA 1XUJA 8KME2 1O3MA 3GDVA 3MU4A 2GV7A 4K1TA 4I7YH 2JH6D 3ZZ5A 1DS2E 1NPMA 2R0LA 1ARBA 1FN6A 1TNGA 4HFPB 1SVPA 4NSYA 4WMEA 3RXLA 3LGVA 5ABWA 1AU8A 4ABAA 2OTVA 1THRH 2HLCA 1O2MA 4Y0YE 1Z8RA 2ZU3A 2V3OH 1THSH 3A83A 3BTDE 3M7QA 6GCHG 1C9TA 1YLDA 2FOFA 5C20A 2GCHG 5A0BA 1YF4A 1TPAE 1NESE 3EDXB 1FY4A 1DANH 1MD8A 1T32A 4NA7A 1FUJA 2Y5FA 1L4ZA 1P04A 3DUXH 1ANDA 2FO9A 1ANBA 4FVBA 1ZLRA 3LJOA 2B0FA 3FP7E 4NWKA 1CGJE 3E3TA 7GCHG 2BD8A 3RXQA 1BBRH 3ZVBA 3SV8A 1P3EA 1GI9B 2FIRH 2HGTH 1GBBA 2WPJS 3K65B 1ELTA 3TH3H 1TAWA 3AAUA 5EGMA 3E91A 5I46H 1TQ0B 5EODA 2Z9LA 4CRBA 1FMGA 2RCEA 1ZGIA 2O8LA 1ABJH 1K28D 1SI5H 1AGJA 3MH5A 1P06A 1AN1E 1M9UA 2O9QA 1OWIA 2GCHF 1G37A 1QB9A 1T8LA 1GI3A 2FMJA 3DD2H 1QL8A 1F2SE 2BQWB 3BTFE 2PSYA 1SL3A 4NZQA 7GCHF 1G3DA 1W7XH 1F7ZA 2Q6DA 3M3TA 3W94A 5E2OA 2ZA5A 2VGCC 1AZZA 5DP7A 2UWPA 2P3TB 5LGOA 4BXSA 5C5OA 1ESBA 4Q7XA 5DPAA 2VVUA 3GY8A 3VB3A 2D8WA 1FY1A 3BTQE 1UJ1A 2BY6X 1O3OA 4Z6AH 3VPKA 3A8DA 4X0WU 1INCA 3ZVCA 1QL9A 5FBIA 1HIAB 1LHFH 1Y3VA 2FX6A 1GL1A 4ZKOU 1YP9A 1O3CA 1O5DH 1QFKH 5JBBS 4GHTA 2WUCA 2SFAA 2R3UA 1SOTA 2BD7A 1EKBB 2BXTH 2I6SA 3SNDA 8LPRA 2FLRH 2FYQA 2ZKSA 2Y7ZA 5IYTA 1DICA 1JRSA 2C8XB 1O2HA 1GJCB 2VVVA 2AEIH 2AIPA 2VIQA 5I25A 7ESTE 3HKIB 1PQ8A 3SN8A 4YOGA 1K1OA 3PWCA 4I31A 1MTVA 2CF8H 1P57B 1H8DH 1RTKA 4YT7H 3F9EA 1GJ6A 1C1QA 1Y5AT 1H9IE 2QAAA 5E8EH 2BD2A 1GHBF 4CREA 1KIGH