1A5IA

Catalytic domain of vampire bat (desmodus rotundus) saliva plasminogen activator in complex with egr-cmk (glu-gly-arg chloromethyl ketone)
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
265
structure length
265
Chain Sequence
TCGLRKYKEPQLHSTGGLFTDITSHPWQAAIFAQNRRSSGERFLCGGILISSCWVLTAAHCFQESYLPDQLKVVLGRTYRVKPGEEEQTFKVKKYIVHKEFDDDTYNNDIALLQLKSDSPQCAQESDSVRAICLPEANLQLPDWTECELSGYGKHKSSSPFYSEQLKEGHVRLYPSSRCAPKFLFNKTVTNNMLCAGDTRSGEIYPNVHDACQGDSGGPLVCMNDNHMTLLGIISWGVGCGEKDVPGVYTKVTNYLGWIRDNMHL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PLASMINOGEN ACTIVATOR
publication title Catalytic domain structure of vampire bat plasminogen activator: a molecular paradigm for proteolysis without activation cleavage.
pubmed doi rcsb
source organism Desmodus rotundus
molecule tags Hydrolase/hydrolase inhibitor
total genus 58
structure length 265
sequence length 265
ec nomenclature ec 3.4.21.68: T-plasminogen activator.
pdb deposition date 1998-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1a5iA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1a5iA01
5CHAB 3BTFE 2QF0A 3UQOA 1Q31A 3MNSA 3UPEA 1SB1H 2ZGJA 2Z9GA 1H9HE 1GJCB 3SNEA 2XRCA 3MU4A 1O2ZA 2R2WU 3SNDA 2RA3A 4MPWA 1TYNA 1C5RA 1HAVA 3R3GB 3FP8E 1S6FA 2FOFA 3GCNA 4DVAU 1DT2A 2EEKA 1NS3A 1KLJH 3ATLA 5DP5A 2QY0B 1O2QA 1C1UH 4UDWH 1IQGA 2ZP0H 2KAIB 4K8BA 5L6NH 1MQ5A 1GVKB 4IW4E 2FTMA 2D1JA 3RU4D 1TX7A 3NUMA 1S85A 3K6YA 4ZMAH 2ZDAH 5EXNA 3VB7A 4LK4A 2BX4A 1JOUB 3SZNA 1EX3A 2ZCLP 5HMAA 4DY7B 3E3TA 2Z6BD 2TGPZ 1GI9B 4R0IA 3LU9B 3ZZBA 1ETRH 3A83A 4FUIA 1HPGA 1CGHA 1WU1A 1RGQA 2F3CE 3O8DA 1Z71A 2XBYA 1TB6H 3RMMH 2ZECA 1L2EA 1UCYH 1KIGH 3BTTE 3K65B 4D7FA 1ZTLA 2GVFA 1JWTA 3ITIA 1RIWB 1ZYOA 4BTIB 2ZCKP 5BRRE 1AIXH 2ZKSA 6GCHG 1BTPA 1OOKB 1XUJA 1KLTA 1XUHA 3P6ZB 4KKDA 1GVLA 2F9BH 2PKAA 3TH2H 5DO4H 2ZF0H 1ZSKA 1FAKH 1EP5A 1WQSA 3NPSA 1SGEE 3ATWA 1C5LH 3ZZ3A 1C1NA 1HCGA 4K1TA 4ABGA 1ZGVA 5JBTA 3PM3A 1V2NT 1HJ9A 1GGDC 1TBZH 4IBLH 1BRUP 1DVAH 1L4DA 1EZQA 2HNTF 2P95A 2UUYA 4A1VA 2LNCA 3LGUA 3F6UH 4VGCC 1X7AC 1MMJN 2QN5T 2Y82A 2A7HA 3ZZ5A 1AVGH 3V3MA 1XX9A 1TBRH 3A7ZA 4ZHLU 3RXCA 2Y80A 3SNAA 1C5ZB 2QA9E 4YLUA 4Y8ZA 4CRAA 1Y8TA 3RDZA 1TGBA 1GCTB 1AZZA 1F0SA 2P93A 1SGTA 3SU1A 3MWIU 1D3PB 1TMBH 1Z8IB 1G3DA 1QHRB 1VITH 3DFJA 1WYKA 4IMZA 1GHXH 2CN0H 1TONA 5T6GA 4X1SU 2Z9LA 2FESH 2UUFB 2AERH 1O2MA 1LMWB 2EI6A 3GYMA 1NRQH 1B0FA 2M5TA 3ZV8A 1ZSLA 2ZGHA 3A8DA 2SGFE 3EA8A 1T8MA 3K6ZA 2FS9A 4IMQA 1Y3VA 3BTHE 1UTJA 1VZQH 1OWKA 1DLEA 1SLWB 5JB8S 4I31A 1V2ST 1UO6A 1BTWA 3R0FA 5LH8A 4B2AA 1SGNE 3GCHC 4X6PA 4AOQA 1OP2A 5HGGA 1E34B 1P9SA 5EXMA 1GCDA 5F03A 1SGCA 2HVXA 3ELAH 1JXPA 4XE4A 2UUJB 2W7UA 3GICB 1C1SA 5FHTA 1S0QA 4BXWA 5LPRA 3FP7E 3SU2A 1T31A 3S7HB 1AHTH 1LKBA 1UVTH 3EA7A 1O3NA 1HLTH 1YYY1 3V0XA 2VIDA 2VGCB 5EQSA 4B73A 3MO3A 1SHYA 4JMYA 1ZRBA 4XBCA 2KAIA 1BRCE 1DICA 3M3TA 3MFJA 2V3HH 2ZFRH 3ZZ9A 1AWHB 1PQ5A 1O2KA 2RA0A 2PKSB 2ILNA 1MTSA 1K1PA 3SV7A 4ZXXH 1DY8A 2PTNA 1MTWA 2Y7ZA 3FAOA 3LOXA 4MVNA 1ARCA 2WV4A 1FZZA 4DG4A 1KYNA 3ZZDA 1BRAA 1DSTA 4YTAA 1EZXC 3RLWH 5EQQA 1WCZA 3PLBA 1FJSA 1GJBB 1GBBA 2C8WB 3A86A 3W94A 2QF3A 3ATIA 4K2YA 1NRSH 1LQEA 2ZQ1A 1MUEB 2H2ZA 1EOLA 2WYGA 2H5DA 3SN8A 1NO9H 3H7OA 5C3NA 1QNJA 4WJG2 2BQ7B 4ABJA 4ZHAA 1BT7A 1TPSA 8ESTE 3MTYA 3GY3A 1A2CH 3GY7A 1ELFA 1TGSZ 4ISNA 3P92A 3RC5A 4ZHMU 4D8NA 4I8HA 5E0JA 3W95A 2RDLA 3P95A 2R9PA 1BJVA 1N8OC 1O34A 1BRBE 5T6FA 1AGJA 3PTNA 5FAHA 2HPPH 4BANB 1ABJH 1BTUA 3T26A 1L0ZA 1EQ9A 1C1OA 5GCHF 3RXSA 3VXFH 1FY5A 1XXDA 1MD8A 4LZ4B 3RUOA 2P94A 2BLWA 3M5OA 5HM2A 1O5DH 2FLRH 2GT7A 4GCHF 2FYQA 2A45B 4FVBA 1Z8JB 3B8JA 3ODFA 4ISOA 1ANBA 1XUFA 4ABEA 1EZSC 1GWAA 1O2LA 4ZKOU 5A8YA 1EASA 5EPYA 3LKWA 3EYDA 1P2NA 2HNTC 1W0ZU 1CBWC 1DXPA 1OP8A 2PV9B 4GAWA 4ISIH 1TIOA 1BTXA 1ZMJA 3Q76A 5A0BA 3IWMA 1EUFA 1DANH 2BLOA 4GHQA 5CE1A 1QURH 3FVFB 2RG3A 1XMNB 1DWCH 1GBAA 1LO6A 1O2JA 1YLDA 1ZJKA 4Q7ZA 3SORA 3QWCH 4CR9A 1GGDB 4K1EA 1NY22 3SJ8A 1FXYA 3IITA 3MNBA 2A4RA 2P3FH 1V2UT 3V12A 4ABFA 1SGFA 1SQAA 5A8ZA 1O2RA 4VGCB 4OS7A 3SU5A 1DY9A 2FI5E 4Y7AA 5H4IB 5LPFA 1O2HA 4AGKA 1C9PA 1ARBA 1RFNA 3EDXB 1TX8A 3MU1A 4O3UA 1G3BA 1O2YA 1PYTC 1SQTA 4X2VA 1MU6B 4NA8A 1VJ9U 2PHBA 1CHGA 1A1RA 3VB5A 1OYTH 1O3IA 3TVJB 1EAUA 4WXVA 1UVOA 2Z9IA 2OCVB 5HXFA 1SGIB 4MQAA 1Z7KA 3QO6A 3A7VA 2FM2A 4XBBA 3URDA 3SV8A 1N6XA 1F7ZA 1O3BA 3DHKH 4KTUA 1QA7A 1PPGE 1K28D 1FONA 1ACBE 1O2SA 1YPHE 2ZDKA 1L1NA 2R3UA 3A81A 1V2OT 3UY9A 1JBUH 1C1MA 2VVVA 1TGNA 1PQ8A 1LKAA 2BLVA 2BQWB 3GCTF 3GCHB 3TJNA 5E8EH 4I8KA 1O39A 3BTEE 2SGAA 1J16A 2XWBI 1J9CH 1LDTT 1WBGB 1QA0A 2FOGA 4KTCA 3QUMP 3LH1A 1WOFA 1ELEE 4INHA 4WXIA 6LPRA 5FXLA 1THPB 1KLIH 3M36A 1OWJA 4MLFB 2VJ1A 1E37B 5ETXA 3RXEA 2FIRH 5C5NA 5F6MA 3RXTA 1NESE 2ZPQA 4X8VH 2TGTA 3SJIA 3SHCH 1TQ7B 2GP9B 4Y6DA 1GPZA 2XC5A 2OTVA 3Q77A 1ZSJA 4R8TB 3UWJH 5DP9A 8GCHF 1AWFH 1OS8A 2ZTYA 3D49H 2GDEH 3AW1A 4WMFA 1FN8A 5IYTA 2PGQB 1ZPBA 2GCTC 3QLPH 4CRGA 1O2OA 1MKWK 3AAVA 3RMOH 4AYVB 4LZ1H 3S0NA 1O3LA 4CRDA 1K22H 2XTTB 3TH4H 1P0SH 3F1SB 1HGTH 3LGVA 5FX6A 1BB0B 2C4FH 3KIDU 2B8OH 1CU1A 4X0WU 3P8GA 1A4WH 1SLXB 2OBOA 4IC5A 2ZG0H 1C2FA 2R3YA 1UVUH 4X8UH 2OC8A 1BBRK 1RTFB 1C4Y2 1VCPA 3A8AA 4E06H 2O9QA 1A46H 4NFEA 2ZHQH 2VIWA 1BCUH 1NRPH 3TU7H 3RXRA 3BTWE 1NZQH 4H4FA 3VEQB 4ZUHA 1SC8U 1GHAG 1MTUA 1AQ7A 1GBKA 4O9VA 3DUXH 5A0CA 2I6SA 4MPUA 1MBQA 1UTMA 2VIQA 1VJAU 3RM2H 5E2OA 1BTZA 2ZZUH 1CSOE 1N8OB 2FOAA 3OTJE 2D26C 1P09A 1TMUH 3BN9A 4TWYA 3SQHE 4A6LA 4CBOA 1P05A 1GMCF 1HJAC 1MTVA 1EB2A 2XBVA 1CHOF 3LT3A 3BEFB 4CRBA 1EXFA 2DUCA 2Z9KA 2GDDA 2GZ7A 2Q1JA 1O37A 1C2LA 2XWAA 1V2RT 2TRMA 3QGNB 1O2NA 2Y7XA 5L2ZH 2SGQE 1EAIA 3MU5A 1O5CB 1YC0A 4Y0ZE 2W3IA 1MD7A 4AORA 1IQNA 2PUXB 2ZGCA 1KTSB 1P2OA 4A5TS 1CBWB 2BYAX 1AN1E 1IHTH 2O8WA 2ZFTA 2ZU4A 3V13A 2V0BA 3KQBA 1EPTB 1O5AB 1P3CA 5G4BA 2A7JA 1FV9A 3GOVB 3HKIB 3N7OA 4A1XA 2ZFQH 1LPGB 1O3FA 1S5SA 1K1IA 4AB9A 2FMJA 1EZUC 3V7TA 1LVYA 1AZ8A 1G9IE 3EGKH 2FPZA 4ZH8A 1GHBG 2FOHA 5GJ4B 3UOUA 1TGTA 3DD2H 1A0LA 2OINA 1FI8A 1GI3A 1FQ3A 4CREA 1O3JA 1XM1A 2VVCA 3OU0A 2BDAA 3L3TA 1TOCB 1V2MT 3OYPA 1GI1A 2ZDNA 4Y0YE 1AVXA 1IQMA 5E0HA 5J4SA 4CHAC 3T2NA 2TGDA 2WPHS 2ZFFH 3U98H 7KMEH 1P04A 2NU4E 2GCHF 1NPMA 2C8XB 4MPXA 3RXIA 1J14A 2BY7X 2A4QA 3A7XA 4AG2A 3M7UA 1GG6C 1O35A 3BTME 3HK3B 3MMGA 2BX3A 4E7RG 4IS5A 2UWOA 2ANMH 4JYTA 1D3DB 1QQ4A 1O5GH 3LIWA 2CF9H 2NU2E 2AGIX 1GHVH 1KXBA 1GDNA 1QY6A 2PUQH 2GZ8A 1C4V2 3SV2H 1C2MA 1Q3XA 3HKJB 1O2IA 2ZU1A 3T25A 3UIRA 4U01A 2BZAA 1ANDA 5E2PA 1CE5A 1G2MA 3ZVCA 3ZVBA 1K2I1 2BDBA 2A32A 3EE0B 1D6RA 3K2UA 3RXKA 1O3EA 2QC2A 2CHAC 2VH6A 2ULLA 5C20A 3TNSA 3MNXA 2XNIA 6CHAB 4YOGA 1O3AA 3PV4A 3ZZ7A 1GHWH 5T3HA 1WQVH 1O3CA 2P8OC 3SV6A 1TA2A 4PROA 3VGCC 3GY5A 1O3MA 2ZGXH 1GBTA 1SQOA 4UFEH 4JK5A 4OGXA 1QB1A 4XFQA 1TALA 1UCYE 2SFAA 3UTUH 1IQLA 4Z6AH 1F0UA 1RD3B 4U2WA 2GCTB 4YT6H 3MU0A 1GHZA 2ZU5A 3ZZ4A 5FCKA 1GI5A 3TITA 2XCNA 1O3OA 3HGPA 2SGEE 2I6QA 1WV7H 3UQVA 4CR5A 3NKKA 2BVRH 4H6TA 4I8LA 3SJKA 5JBCS 3PMJA 1U6QA 3GCOA 3I77A 3PLKA 1O33A 5A0AE 1DWDH 3NWUA 1IQEA 1P10A 3U8OH 1PPEE 3A88A 1G30B 3MO6A 1DFPA 4YOJA 5BPEA 3UFAA 1QB6A 1P2IA 4YM9A 3U69H 1TPPA 1LPKB 1O3HA 2F9OA 5LGOA 3ZZCA 1T8NA 4X6OA 1LHFH 1QL8A 2V6NA 4O3TA 1LQDB 1ID5H 5J4QA 3U8TH 2PGBB 2P16A 1EPTA 3SUEA 4WH8A 3U8RH 4ABBA 3GDSA 2F9VA 4AYYB 1QRWA 1T4VH 3PO1C 3FZDA 3Q3YA 4NG9H 1ELCA 2GGVB 1GMDF 2EA3A 1HJAB 5L2YH 3URCA 2FX6A 4AG1A 2ZNKH 3MH4A 3TNTA 3RXBA 2FOCA 4D76A 2R0KA 3SU0A 4GPGA 2J95A 2OC0A 2R0LA 3CS0A 1GVZA 2ANKH 2AS9A 4BXSA 2VIVA 1PPFE 2QGRA 1GBEA 1T32A 4ABDA 1Y3WA 2H6MA 4ISLA 1ETSH 4X1RU 1QB9A 4BNRA 4DURA 3RXUA 1K1NA 1DPOA 4E05H 1ANCA 1XKBC 4X2YA 4H6SB 3D62A 1W8BH 3VXEH 2H1UA 1C5QA 2OLGA 7LPRA 4DIIH 3GYLB 4GSOA 2YNBA 3LPRA 5JPMH 1UK2A 1NM6A 1QBNA 2F9NA 5C5OA 1TE0A 1TA6A 2W7SA 1ELAA 2CV3A 4YT7H 4RN6A 1P06A 4BOHA 4Y11E 3RXHA 3SU4A 1SMFE 4IGDA 1KTTB 2FLBH 4MTBA 5AHGH 5DGJA 1YPLH 4MDSA 2FOEA 2FODA 2ZDLA 1LHEH 1MAXA 1P12E 1NU7B 1YBWA 2A4GA 3K9XB 1MKXH 4JYVH 1K1OA 2TPIZ 4Q7XA 1TRYA 1W14U 1SPJA 4WF8A 4NA7A 2BXTH 4FUBA 1K21H 3NK8A 4CHAB 2F83A 1UHBB 3T5FH 1N1LA 1DUAA 4IN1A 1SFIA 3F9HA 1HBTH 1Y5AT 2J94A 1ZPZA 1EAWA 1J15A 1GG6B 2GMTC 1E0FD 1WSSH 1H8IH 2GT8A 4KGAA 1IOEA 3TGJE 4SGBE 4TYDA 1TNLA 4BAKB 2FP7B 4NIVA 5A2MH 4B1TA 1FPHH 1AE8H 2H9TH 3ESTA 4YZUA 1W2KH 2VU8E 1IHSH 3QTVH 4AZ2B 1O3KA 5GXPA 1AI8H 2IN2A 2EI8A 4I8GA 2AMPA 1QBOA 3E0NB 1FY1A 4DJZB 2CJIA 3QK1A 4TPIZ 2ZGBH 3PWCA 3A84A 4Y8XA 2ODQA 1VGCC 1G3EA 3RMNH 1NFWA 1P8VC 1UK4A 2F9UA 4X1NU 4ABHA 1P02A 2A2QH 2ZU3A 2CHAB 3P70B 2BM2A 4INKA 2Q6DA 3U1IB 2B7DH 1C2EA 1TBQH 1W13U 3QN7A 3FZZA 2G5VA 2P8OB 1G3CA 1KDQB 4NIWA 2GKVE 4OS4A 2PWXA 3H5CB 1W11U 1NT1A 4OS5A 1ZLRA 2ZTXA 3MHWU 1VCQA 3LC5A 1L4ZA 4UFGH 2G51A 2HALA 1YCPK 2UWLA 2QXIA 1F5RA 3HGNA 2XCFA 1FY4A 4TPYA 3SNCA 2C90B 3M5MA 4MNWA 1LVMA 4AFQA 5T6DA 3MH6A 1C2JA 2Y5HA 2ZWLH 1HIAB 3BSQA 2A2XH 1HNEE 1W3CA 2NWNA 1DWBH 5A09A 1ORFA 1AD8H 2GX4A 4GVUA 2STAE 3QZRA 1P3EA 1GMHG 4FU7A 1AKSB 2QCYA 2AGGX 4ZXYH 1UVSH 5EXLA 2BOKA 1SI5H 3I29A 5PTPA 4NWLA 4B75A 1V2VT 3A7WA 2HNTE 2XXLA 4GLYA 1CA8B 3MNCA 2J38A 2OQUA 3EQ0H 3TJOA 1GBJA 4D7GA 1AFQC 1DE7H 1LPZB 1ELVA 1ZPCA 1TLDA 3ZVDA 2A5AA 4K8YA 2BHGA 1QRZA 5AFZH 3PO1B 4ESTE 1C5NH 3SOSA 1EJAA 2J2UA 1L1JA 5DP6A 1Y3YA 1BMLA 1F0RA 1HJ8A 2VWNA 1E38B 1C5SA 2WPKS 5C1YA 2J34A 4X8TH 3LJOA 3O8BA 1AE5A 5AVDA 3RXDA 1INCA 3T28A 2BD5A 2WPMS 4NWKA 4X1QU 7GCHF 1V2KT 2Y5FA 4B76A 2OC1A 1TNGA 1QGFA 1SLUB 3LGWA 1FLEE 3G01A 3HATH 3I78A 3NXPA 3S9AA 1G37A 3TPIZ 1VCWA 1UHBA 2BD7A 3Q00A 1FIWA 1LVBA 1CT0E 1UTLM 1GBFA 3SJ9A 3ATKA 1BOQA 3F68H 4X8SH 1MZDA 4ABAA 2G55A 2B0FA 4JZFH 1NFUA 1LHCH 1NTPA 1TMTH 3P8OA 1V2LT 2Y81A 2Z3CA 2ESTE 1SGPE 4U32A 1FDPA 1S83A 3PWBA 4RKOB 3KQDA 3RXFA 1V2TT 5EPNA 3BTDE 1CQQA 1K9OE 1K1JA 3L6PA 2Z7FE 1A5GH 3AAUA 4I33A 1HAGE 2QAAA 2C3SA 2J4IA 4JYUH 3LGYA 3QGJA 5F8TA 1V2JT 2CGAA 2BDGA 5FX5A 3SGBE 5C67A 4CRFA 2A5IA 4OS6A 4NGAH 4UFDH 1THRH 1O31A 1XUGA 4JZ1A 3SGQE 1IQIA 3A8BA 3E90B 1QL7A 2DE9A 2ANWA 2WV5A 3M5NA 1P11E 3PYHA 1Z1IA 2QIQA 4Q80A 3UWIA 2W5EA 4YLQH 3T62A 2YNAA 2VWOA 3MI4A 4K3JA 4FUJA 1CGJE 4NZQA 1H8DH 1KDQA 1C2KA 1P9UA 4X2XA 1QTFA 2AYWA 1KXAA 1GL0E 1SOZA 2BVXH 1ELTA 3GY2A 4K1SA 1AUJA 1LVOA 1AB9C 2BVSH 5JDUB 1OYQA 2VWLA 2Y6TA 3CENA 1O2PA 4QT8C 2GV7A 3A8CA 2BZ6H 3RMLH 2HGTH 5DG6A 1Y3UA 5GCHG 1TOMH 1SLVB 2J9NA 1AUTC 3O8CA 1GJ5H 2OD3B 1VGCB 1G2LA 4GCHG 3P8FA 4MG3A 2PTCE 1RXPA 1HIAA 1CA0C 3B23B 3ODDA 3F9FA 1A5IA 3SW2B 1ELGA 2ALPA 1TPAE 1QJ1B 3PMAB 1GI7B 6GCHF 1KY9A 3IG6B 2O8LA 1GJ6A 4TY6A 1A3EH 4Y8YA 1IQKA 1KXDA 2QYIA 1AKSA 1S81A 1PJPA 1UK3A 2VIOA 2Z94A 4JZEH 1UJ1A 2P59A 3UR9A 2VIPA 1MU8B 1LHGH 1T4UH 4WMEA 1HFDA 4JZDH 3TJUA 4SGAE 2G5NA 1BMMH 1M9UA 2A1DB 3AW0A 1AO5A 1BZXE 2Z9JA 3KQEA 1DX5M 5TCAA 1DWEH 1SGFG 1NU9A 4X6MA 3ZZ8A 3A89A 4I8JA 4FVDA 4BAQB 2QV1A 1BHXB 2ALVA 4AFSA 1S82A 4NA9H 2ANYA 3ATMA 1D3QB 2BD8A 1SG8B 1PQAA 2HOBA 1AMHA 1C1VH 1W10U 2EI7A 2FOBA 1V2PT 4KELA 2B5TB 2GZ9A 1NFXA 4I7YH 1HAZB 2FO9A 1O3GA 1C2IA 4OS2A 4ZROA 4U30A 2WYJA 3LJJA 2G8TA 2V3OH 4WH6A 3M3VA 1YF4A 1NROH 1TGCA 2FZZA 4Q2KA 1SR5C 1Y5BT 2QXHA 3BTQE 2ZPRA 3PB1E 2A0QB 1UTOA 4AN7A 1PPHE 2FWWA 1TWXB 2VWMA 1TAWA 1JRSA 1BJUA 1O5EH 2Q6GA 1A0HB 4NIYA 3SO3A 1P2JA 1AFQB 3OY5U 2AMDA 1WUNH 2XC0A 4HTCH 4Y10E 3PROA 3FP6E 4ZAEA 2NU1E 4X6NA 5F8ZA 3SU3A 1BTHH 4KTSA 1MCTA 1PPBH 2ZHEH 2BY9X 3KGPA 2HRVA 1TRMA 3SJOA 4DCDA 4FUFA 3GCTG 3RLYH 2SGDE 2YOLA 1C5YB 3RU4E 1BTYA 1PPCE 2ZFSA 3ENSB 3TK5A 1ABIH 2BMGB 1C5XB 1FY8E 3KF2A 7ESTE 1ESTA 1GBMA 2HPQH 2ZHFH 2PKSC 3E91A 3UR6A 1F92A 4DOQA 1C9TA 2H9EH 1NRNH 1PPZA 2GV6A 3PTBA 1H9IE 4HGCA 3VB4A 4CBNA 4M7GA 4Y71A 1SOTA 2FXRA 3BF6H 2PFEA 1A5HA 1J17T 1SHHB 3FFGA 4B2BA 2WUCA 4K69A 2XC4A 8GCHG 5GWZA 1F0TA 1ZMLA 1J8AA 2AFQB 2BD3A 2SGPE 3AASA 3PMHB 3WY8A 1G36A 1O38A 2TGAA 1FN6A 3TIUA 3VPKA 3TK6A 2F91A 4RKJB 3ZV9A 1P57B 2Q6FA 3O8RA 1JMOH 4WY3A 2PW8H 2GTBA 2JETC 1VR1H 9LPRA 1W12U 2FEQH 1PQ7A 5TCCA 3A7TA 4ZKNU 1O2TA 1ZMNA 3STIA 5I25A 3A7YA 2AEIH 1CT2E 3MH5A 5DK1A 3E16B 3ZVEA 5K7RA 4D9QA 2OUAA 2VB0A 2BQ6B 5FPTA 1GI2A 2A5KA 4X2WA 3ZYEA 4DGJA 5C2ZA 4AFUA 4DW2U 3BG4C 1UTQA 3E0PB 3LONA 1ELBA 2V35A 3EAJA 1ESBA 4JZIA 3SQEE 3BEIB 5FPYA 1GDUA 4O97A 4MNXA 1F2SE 1ZR0A 4ZKSU 2VVUA 4BAHB 2TBSA 3UNSA 3BV9B 3GDVA 1C2HA 1AB9B 2AGEX 3BIVH 1GMCG 1THSH 2OBQA 1CHOG 1XUKA 1IQHA 2ZTZA 1C1WH 2G00A 1DSUA 1H9LB 1EJNA 2O8MA 1KXCA 1ESAA 3U1JB 1XVOA 1BHXF 5E0GA 2OP9A 2IJOB 1VITG 3VFEA 1GBCA 1EAXA 2UWPA 1CA0B 4UONA 5JB9S 2PSYA 4YESB 1HXEH 3BTKE 2P3TB 3SI3H 3HK6B 1BMNH 1AU8A 1S84A 1CT4E 4H42U 1L1GA 1NRRH 1O30A 1HAHH 3VB6A 1YPGH 2AMQA 4ISHH 1DM4B 4K5ZA 1OWHA 2CMYA 3BIUH 1GJ9B 1MQ6A 1QR3E 3QZQA 3QDZB 1BITA 5JBAS 1HDTH 1MKWH 1FIZA 3A85A 4CRCA 1FPCH 4HI3A 4TY7A 1YPKH 5EW1H 1HUTH 1B0EA 1ZHMA 1GJ7B 1T8OA 1DLKB 1QBVH 1GMHF 1A3BH 2XBWA 2K1QA 1C5TA 2OC7A 1C1RA 3SU6A 1YPJH 1NC6A 3M35A 5GDSH 3Q3XA 2ZQ2A 3UUZA 3ZVFA 3H7TA 1O2WA 3RM0H 5CMXH 1BBRH 1HAPH 1HB0B 1AVWA 3RC4A 1BBRE 2FI3E 5AF9H 3KN2A 2VH0A 1EOJA 3QTOH 1XVMA 1SFQB 1C1PA 1O2UA 1Y5UT 2GCHG 2ZPSA 1DXWA 1YM0A 2ZI2H 3S9BA 4INLA 2BLQA 3A82A 2W3KA 1ZZZA 3MYWA 2NU0E 2JH6D 1EATA 4Y79A 1C1TA 1T8LA 1SGRE 5I46H 3HPTB 1JIRA 1T7CA 3M37A 3TGKE 2UUKB 1SBWA 2LPRA 1EJMA 3S9CA 1ZRKA 1UTNA 3PMBB 3A80A 2FYRA 1C5OH 5SGAE 1O36A 4Z0KA 4B2CA 3MO9A 2R2MB 1MCVA 4Q7YA 3T27A 2FDAA 2ZHDA 3D65E 4NCYA 1MBMA 1N6YA 4E7NA 1XUIA 4UE7H 1GDQA 3JZ1B 2D8WA 3EA9A 3KEEA 4YO9A 2ZCHP 3KL6A 2VINA 1GBIA 2SNVA 3QX5H 2O8UA 5TJXA 2XBXA 5DJ7A 1TQ0B 3RXOA 3UNRA 1AY6H 3ZZAA 1W0YH 1Z6JH 3LC3A 1BIOA 2OXSA 1CO7E 4CH8B 1YCPM 2PLXA 1Y3XA 1NN6A 5B6OA 1WTGH 5DP8A 3OX7U 2WPIS 3GISB 4K60A 1HXFH 1QRXA 2PSXA 2ZA5A 1P2KA 1GJ8B 4WMDA 2Z3DA 4WWYA 2THFB 3A87A 2JETB 3CS7A 4FUCA 3VGCB 1ZHRA 1ZJDA 4UEHH 5EGMA 1FY3A 1WAYB 1XKAC 1GBLA 1ZTJA 4J1YA 1MH0A 4X1PU 2BY5X 1SGYE 3KHVA 2WUBA 3NCLA 3TH3H 1ZOMA 2AIQA 1KXEA 2BD9A 2BY6X 1ZGIA 3BEUA 1QFKH 2NU3E 2C8YB 1GBHA 3TJVA 4NSVA 2HWLB 3BG4B 2C8ZB 4NSYA 4BTUB 3Q3KA 3SUDA 2BTCE 1QJ6B 2ZEBA 1S0RA 1BDAA 2C93B 3F9GA 3SUFA 3LGIA 1D4PB 1GI4A 2FTLE 1OXGA 1GHAF 2OQ5A 2VNTA 2A31A 2ODPA 3P17H 1O2GH 5ABWA 3PLPA 1C1QA 1GJDB 1ZTKA 2BD2A 1GMDG 4F49A 1RS0A 3UREA 1IAUA 2P3UB 2HLCA 6ESTA 4IN2A 1P2MA 1ZHPA 2JH0D 1RRKA 1EPTC 1LHDH 1OSSA 4YOIA 1E36B 3MOCA 5JBBS 3CP7A 5ESBA 1F5KU 1TFXA 1W7XH 1YKTA 3LH3A 1C2DA 1E35B 1OKXA 3OSYA 3SHAH 2W26A 1GBDA 5EODA 2Y5GA 4FU8A 3STJA 1EKBB 2ZC9H 5C1UA 1HAYB 5EQRA 2G4TA 1HYLA 5FPSA 1O3DA 1O5FH 3RXGA 2O8TA 1ANEA 4LOYH 1W7GH 4AB8A 2JH5D 2SNWA 3M7QA 5GIBA 1IQFA 1YPEH 2Z3EA 4RSPA 3S7KB 3RXLA 4FUHA 1UTPA 2TIOA 1UCYK 1O32A 1MTNC 2QXJA 1RJXB 1YPHC 2A4OA 1P01A 1Z8GA 1UTKA 5EU8A 2ASUB 5CHAC 2DE8A 3M61U 4WVPE 1C5WB 1HAIH 3M3SA 4JCNA 1GL1A 1C5MD 4Y7BA 1C5PA 1SSXA 3SV9A 5JYIA 3DA9B 1GHBF 4J2YB 4GUXA 3T29A 1V3XA 3E8LA 3P8NA 5C1XA 3FANA 2ZFPH 5LPEA 4A92A 3C27B 4ZKRU 4AGJA 2G52A 1SGDE 4O03A 1Y59T 2ZDMA 1ETTH 1Z8RA 1QQUA 1HV7A 1HAXB 1PFXC 4UD9H 5DPAA 1IQJA 1O2XA 3TK9A 4BTTB 4BAOB 1MZAA 1A7SA 1TABE 3S69A 2QXGA 4XDEA 5FCRA 2ODYB 4A1TA 1C5VA 2JKHA 3LGTA 1Z1JA 1EP6A 4FUDA 4A7IB 8LPRA 1ELDE 4XOJA 1PYTD 3B9FH 1WTHD 1DITH 1JRTA 1GHYH 4MPVA 1YP9A 6CHAC 1EB1H 1NFYA 2FS8A 3KNXA 2CXVA 1OWIA 4GHTA 1HAVB 3DFLA 2WPLS 3L33A 3SI4H 1OPHB 5FBEA 1V2QT 3MH7A 1S6HA 4TWWA 1QCPA 2GMTB 1P2QA 2ZIQH 2F9PA 5AFYH 4HZHA 2ZU2A 1V2WT 3ZVGA 2J92A 1K1LA 1RIWC 1O5BB 4CH2B 3M5LA 4FU9A 1CGIE 4OS1A 1CVWH 2CF8H 1Q2WA 3BG8A 4MNYA 1LTOA 4Y76A 1QL9A 4DT7B 1GJ4H 4FUGA 1YPMH 3F9EA 1FUJA 1QJ7B 1BMAA 1TNHA 4D9RA 5HM9A 1C2GA 2H9HA 1GJAB 1SVPA 3C1KA 3VB3A 3UNQA 1OWEA 5FBIA 3SUGA 3RU4T 3TGIE 3GY8A 4OGYA 1C4U2 2G81E 1H1BA 2XW9A 2BDYA 4THNH 1OWDA 1SL3A 2BB4A 1DS2E 1O0DH 2G4UA 4AX9H 1A61H 1D6WA 1GI0A 2ZO3H 2BOHB 5ESTE 1SGQE 3MU8A 3SGAE 1YLCA 1KXFA 4NZLA 5DP7A 1FNIA 2BD4A 3LDXH 1OX1A 4XSKU 2EC9H 1Z6EA 1C5UA 1TNKA 1HRTH 1QIXB 2BDIA 2STBE 5GPIB 5DKMA 3RXQA 4BAMB 1UMAH 1H4WA 2RCEA 4NIXA 2BDCA 2D2DA 2PKAB 2IPHA 4B71A 1MKXK 4I32A 1D3TB 1RTKA 4F4OC 1GCTC 3AVZA 4FXGH 4NFFA 2A7CA 5HYOA 4HFPB 1FAXA 2PR3A 4JK6A 3RXMA 8KME2 1GI8B 3M7TA 4ASHA 1TX6A 3KQCA 1V6DA 4IC6A 3BTGE 1AFEH 1HAOH 3E6PH 4LXBH 5IDKA 5L30H 1VITF 1BA8B 3SNBA 3GY6A 3ZZ6A 4KP0A 1DOJA 1B7XB 2GD4B 2AH4X 3RC6A 1YGCH 5F8XA 1TRNA 1BQYA 3E1XB 3JZ2B 3GDUA 3DT0H 3NZIA 3U9AH 2XYAA 1TNIA 2IOTA 5K0HA 2WPJS 2BY8X 3D23A 2WINI 2ZHWH 1TPOA 5A8XA 9ESTA 4MNVA 3SBKA 1JIMA 2FOMB 3GY4A 1P03A 1KSNA 1TNJA 1GI6A 2FX4A 1DDJA 1BUIA 1XXFA 2BDHA 4FUEA 4XBDA 7GCHG 4B74A 1F5LA 1UVPA 4DIHH 1A0JA 5EOKA 1D9IA 1DUEA 3ZYDA 4UFFH 3RXJA 5EW2H 5DP4A 3ZVAA 2BXUH 1B5GH 1LCYA 1O3PB 1FMGA 3OY6U 1YCPH 3RXAA 1MAYA 2H5CA 3RXVA 2VGCC 5DP3A 2FI4E 4AFZA 3TLOA 1RTLA 3KCGH 3UOPA 2AIPA 2B9LA 5EG4A 4ABIA 3RXPA 1MTNB 2ZDVH 3RP2A 1G32B 1OP0A 1O2VA 1K1MA
chains in the Genus database with same CATH superfamily
5CHAB 3BTFE 2QF0A 3UQOA 1Q31A 3MNSA 3UPEA 1SB1H 2ZGJA 2Z9GA 1H9HE 1GJCB 3SNEA 2XRCA 3MU4A 1O2ZA 2R2WU 3SNDA 2RA3A 4MPWA 1TYNA 1C5RA 1HAVA 3R3GB 3FP8E 1S6FA 2FOFA 3GCNA 4DVAU 1DT2A 2EEKA 1NS3A 1KLJH 3ATLA 5DP5A 5KGOA 2QY0B 1O2QA 1C1UH 4UDWH 2WV9A 1IQGA 2ZP0H 2KAIB 4K8BA 5L6NH 1MQ5A 1GVKB 4IW4E 2FTMA 2D1JA 3RU4D 1TX7A 3NUMA 1S85A 3K6YA 4ZMAH 2ZDAH 5EXNA 3VB7A 4LK4A 2BX4A 1JOUB 3SZNA 1EX3A 3F2GA 2ZCLP 5HMAA 4DY7B 3E3TA 2Z6BD 2TGPZ 1GI9B 4R0IA 3LU9B 3ZZBA 1ETRH 3A83A 4FUIA 1HPGA 1CGHA 1WU1A 1RGQA 2F3CE 3O8DA 1Z71A 2XBYA 1TB6H 3RMMH 2ZECA 1L2EA 1UCYH 1KIGH 3BTTE 5GNDA 3K65B 4D7FA 1ZTLA 2GVFA 1JWTA 3ITIA 1RIWB 1ZYOA 4BTIB 2ZCKP 1SQRA 1AIXH 2ZKSA 5BRRE 1BTPA 6GCHG 1OOKB 1XUJA 1KLTA 4FOUC 1XUHA 3P6ZB 4KKDA 1GVLA 2F9BH 3N7EA 2PKAA 3TH2H 4Q4LA 5DO4H 2ZF0H 1ZSKA 1FAKH 1EP5A 1WQSA 3NPSA 1SGEE 3ATWA 1C5LH 3ZZ3A 1C1NA 1HCGA 4K1TA 4ABGA 1ZGVA 5JBTA 3PM3A 1V2NT 1HJ9A 1GGDC 1TBZH 4IBLH 1BRUP 1DVAH 1L4DA 1EZQA 2HNTF 2P95A 2UUYA 4A1VA 2LNCA 3LGUA 3F6UH 4VGCC 1X7AC 1MMJN 2QN5T 2Y82A 5DSFA 2A7HA 3ZZ5A 1AVGH 3V3MA 1XX9A 1TBRH 3A7ZA 4ZHLU 3RXCA 2Y80A 3SNAA 2QF5A 1C5ZB 2QA9E 4YLUA 4Y8ZA 4CRAA 1Y8TA 3RDZA 1TGBA 1GCTB 1AZZA 1F0SA 2P93A 1SGTA 3SU1A 3MWIU 1D3PB 1TMBH 4TSFD 1Z8IB 1G3DA 1QHRB 1VITH 3DFJA 1WYKA 4IMZA 1GHXH 2CN0H 1TONA 5T6GA 4X1SU 2Z9LA 2FESH 2UUFB 2AERH 1O2MA 1LMWB 2EI6A 3GYMA 1NRQH 1B0FA 2M5TA 3ZV8A 1ZSLA 2ZGHA 3A8DA 2SGFE 3EA8A 1T8MA 3K6ZA 2FS9A 4IMQA 1Y3VA 3BTHE 1UTJA 1VZQH 1OWKA 1DLEA 1SLWB 5JB8S 4I31A 1V2ST 1UO6A 1BTWA 3R0FA 5LH8A 4B2AA 1SGNE 3GCHC 4X6PA 4AOQA 1OP2A 5HGGA 1E34B 1P9SA 5EXMA 1GCDA 5F03A 1SGCA 2HVXA 3ELAH 1JXPA 4XE4A 2UUJB 2W7UA 3GICB 3DCLA 1C1SA 5FHTA 1S0QA 4BXWA 5LPRA 3FP7E 3SU2A 1T31A 1YLNA 2CK3D 3S7HB 1AHTH 1LKBA 1UVTH 3EA7A 1O3NA 1HLTH 1YYY1 3V0XA 2VIDA 2VGCB 5EQSA 4B73A 3MO3A 1SHYA 4JMYA 1ZRBA 4XBCA 2KAIA 1BRCE 1DICA 3M3TA 3MFJA 2V3HH 2ZFRH 3ZZ9A 1AWHB 1PQ5A 1O2KA 2RA0A 2PKSB 2ILNA 1MTSA 1K1PA 3SV7A 4ZXXH 1DY8A 2PTNA 1MTWA 2Y7ZA 3FAOA 3LOXA 4MVNA 1ARCA 2WV4A 1FZZA 4DG4A 1KYNA 3ZZDA 3WWFA 1BRAA 1DSTA 4YTAA 5C94A 1EZXC 3RLWH 5EQQA 1WCZA 3PLBA 1FJSA 1GJBB 1GBBA 2C8WB 3A86A 3W94A 2JJ2D 2QF3A 3ATIA 4K2YA 1NRSH 2IPQX 1LQEA 2ZQ1A 1MUEB 2H2ZA 1EOLA 2WYGA 2H5DA 3SN8A 1NO9H 3H7OA 5C3NA 1QNJA 4WJG2 2BQ7B 4ABJA 4ZHAA 1BT7A 1TPSA 8ESTE 3MTYA 3GY3A 1A2CH 3GY7A 1ELFA 3WWBA 1QZ8A 1TGSZ 4ISNA 3P92A 3RC5A 3OEED 2VBCA 2AHME 4ZHMU 4D8NA 4I8HA 5E0JA 3W95A 2RDLA 3P95A 2R9PA 1BJVA 1N8OC 1O34A 1BRBE 3U28C 5T6FA 1AGJA 2WHXA 3PTNA 5FAHA 2HPPH 4BANB 1ABJH 1BTUA 3T26A 1L0ZA 3KYGA 1EQ9A 5KECA 1C1OA 5GCHF 3RXSA 3VXFH 1FY5A 1XXDA 1E1RD 1MD8A 4LZ4B 3RUOA 2P94A 2BLWA 3M5OA 5HM2A 1O5DH 2FLRH 2GT7A 4GCHF 2FYQA 2A45B 4FVBA 1Z8JB 3B8JA 3ODFA 4ISOA 4ACBA 1ANBA 1XUFA 4ABEA 1EZSC 1GWAA 1O2LA 4ZKOU 5A8YA 1EASA 5EPYA 3LKWA 3EYDA 2HLDD 1P2NA 2HNTC 1W0ZU 1CBWC 1DXPA 2W6JD 1OP8A 2PV9B 4GAWA 4ISIH 1TIOA 5F53A 2KX4A 1BTXA 1ZMJA 3Q76A 2QF4A 5A0BA 3IWMA 1EUFA 1DANH 2BLOA 4GHQA 5CE1A 1QURH 3FVFB 3W1EA 2RG3A 1XMNB 1DWCH 1GBAA 1LO6A 1O2JA 1YLDA 1ZJKA 4Q7ZA 3F2FA 3SORA 3QWCH 5T1VA 4CR9A 1GGDB 4K1EA 1NY22 3SJ8A 1FXYA 3IITA 2XOKD 3MNBA 2A4RA 2P3FH 1V2UT 3V12A 4ABFA 1SGFA 1SQAA 5A8ZA 1O2RA 4VGCB 4OS7A 3SU5A 1DY9A 2FI5E 4Y7AA 5H4IB 5LPFA 1O2HA 4AGKA 3UB0A 1C9PA 1ARBA 1RFNA 3EDXB 1TX8A 3MU1A 4O3UA 1G3BA 1O2YA 1PYTC 1SQTA 4X2VA 1MU6B 4NA8A 1VJ9U 2PHBA 1CHGA 1A1RA 3VB5A 1OYTH 1O3IA 3GS9A 3TVJB 1EAUA 4WXVA 1UVOA 2Z9IA 2OCVB 5HXFA 1SGIB 4MQAA 1Z7KA 3QO6A 3A7VA 2FM2A 4XBBA 3URDA 3SV8A 1N6XA 1F7ZA 1O3BA 3DHKH 4KTUA 1QA7A 1PPGE 1K28D 1FONA 1ACBE 1O2SA 1YPHE 2ZDKA 5HIZA 1L1NA 2R3UA 3A81A 1V2OT 3UY9A 1JBUH 1C1MA 2VVVA 1TGNA 1PQ8A 1LKAA 2BLVA 2BQWB 3GCTF 3GCHB 3TJNA 5E8EH 4I8KA 1O39A 3BTEE 2SGAA 1J16A 2XWBI 1J9CH 1LDTT 1WBGB 1QA0A 2FOGA 4KTCA 3QUMP 3LH1A 1WOFA 1UW7A 1ELEE 4INHA 4WXIA 6LPRA 5FXLA 1THPB 1KLIH 3M36A 1OWJA 4MLFB 2VJ1A 1E37B 5ETXA 3RXEA 2FIRH 5C5NA 5F6MA 3RXTA 1NESE 2ZPQA 4X8VH 2TGTA 3SJIA 3SHCH 1TQ7B 2GP9B 4Y6DA 1GPZA 2XC5A 2OTVA 3Q77A 1ZSJA 4R8TB 3UWJH 5DP9A 8GCHF 1AWFH 1OS8A 2ZTYA 2J97A 3D49H 2GDEH 3AW1A 4WMFA 1FN8A 5IYTA 1ZPBA 2PGQB 2GCTC 3QLPH 4CRGA 1O2OA 1MKWK 3AAVA 3RMOH 4AYVB 3PRBA 4LZ1H 3S0NA 1O3LA 4CRDA 1K22H 2XTTB 3TH4H 1P0SH 3F1SB 1HGTH 3LGVA 5FX6A 1BB0B 2C4FH 3KIDU 2B8OH 1CU1A 4X0WU 3P8GA 1A4WH 1SLXB 2OBOA 4IC5A 2ZG0H 1C2FA 2R3YA 1UVUH 4X8UH 2OC8A 1BBRK 1RTFB 1C4Y2 1VCPA 3A8AA 1YWUA 4E06H 2O9QA 1A46H 4NFEA 2ZHQH 3KQ5A 2VIWA 1BCUH 1NRPH 3TU7H 3RXRA 3BTWE 1NZQH 4H4FA 2WPDD 3FKSD 3VEQB 4ZUHA 1SC8U 1GHAG 1MTUA 1AQ7A 1GBKA 4O9VA 3DUXH 5A0CA 1EFRD 2I6SA 4MPUA 1MBQA 1UTMA 2VIQA 1VJAU 3RM2H 5E2OA 1BTZA 2ZZUH 1CSOE 1N8OB 2FOAA 3OTJE 2D26C 1P09A 1W0KD 2L6OA 1TMUH 3BN9A 4TWYA 3SQHE 4A6LA 4HG6A 4CBOA 1P05A 1GMCF 1HJAC 1MTVA 1EB2A 2XBVA 1CHOF 3LT3A 3BEFB 4CRBA 1EXFA 5EJLA 2DUCA 2Z9KA 2GDDA 2GZ7A 2Q1JA 1O37A 2YMSC 1C2LA 2XWAA 1V2RT 2TRMA 3QGNB 1O2NA 2Y7XA 5L2ZH 2SGQE 1EAIA 1WDIA 3MU5A 1O5CB 1YC0A 4Y0ZE 2W3IA 1MD7A 4AORA 3AK5A 1IQNA 2PUXB 2ZGCA 1KTSB 1P2OA 4A5TS 1CBWB 3PV5A 2BYAX 1AN1E 1IHTH 2O8WA 2ZFTA 2ZU4A 3V13A 2V0BA 3KQBA 1EPTB 1O5AB 1P3CA 5G4BA 2A7JA 1FV9A 3GOVB 3HKIB 3N7OA 4A1XA 2ZFQH 1LPGB 1O3FA 1S5SA 1K1IA 4AB9A 2FMJA 1EZUC 3V7TA 1LVYA 1AZ8A 1G9IE 3EGKH 2FPZA 4ZH8A 1GHBG 2FOHA 5GJ4B 3UOUA 1TGTA 3DD2H 1A0LA 2OINA 1FI8A 1GI3A 1FQ3A 4CREA 1O3JA 1XM1A 2VVCA 3OU0A 2BDAA 3L3TA 1TOCB 1V2MT 3OYPA 1GI1A 2ZDNA 4Y0YE 1AVXA 1IQMA 5E0HA 5J4SA 4CHAC 3T2NA 2TGDA 2WPHS 2ZFFH 3U98H 7KMEH 1P04A 4B6EA 2NU4E 2GCHF 1NPMA 4Z1MD 2C8XB 4MPXA 3RXIA 1J14A 2BY7X 2A4QA 3A7XA 4AG2A 3M7UA 1GG6C 1O35A 3BTME 3OAAD 3HK3B 3MMGA 2BX3A 4E7RG 4IS5A 2UWOA 2ANMH 4JYTA 1D3DB 1QQ4A 1O5GH 3LIWA 2CF9H 2NU2E 2AGIX 1GHVH 1KXBA 1GDNA 1QY6A 2PUQH 2GZ8A 1C4V2 3SV2H 1C2MA 1Q3XA 3HKJB 2W6ID 1O2IA 2ZU1A 3KYFA 3T25A 3UIRA 4U01A 2BZAA 1ANDA 5E2PA 1CE5A 1G2MA 3ZVCA 3DSOA 3ZVBA 1K2I1 2BDBA 2A32A 3EE0B 1D6RA 3K2UA 3RXKA 1O3EA 2QC2A 2CHAC 2VH6A 4M9FA 2ULLA 5C20A 3TNSA 3MNXA 2XNIA 4XD7D 4YOGA 6CHAB 1O3AA 3PV4A 3ZZ7A 1GHWH 5T3HA 1WQVH 1O3CA 2P8OC 3SV6A 1TA2A 4PROA 3VGCC 3GY5A 1O3MA 2ZGXH 1GBTA 1SQOA 4UFEH 4JK5A 4OGXA 1QB1A 4XFQA 1TALA 1UCYE 2SFAA 3N7DA 3UTUH 1IQLA 4Z6AH 1F0UA 1RD3B 4U2WA 2GCTB 4YT6H 3MU0A 1GHZA 2ZU5A 3ZZ4A 5FCKA 1GI5A 3TITA 2XCNA 1O3OA 3HGPA 2SGEE 2I6QA 1WV7H 3UQVA 4CR5A 3NKKA 2BVRH 4H6TA 4I8LA 3SJKA 5JBCS 3PMJA 1U6QA 3CNRA 1K0HA 3GCOA 3I77A 3PLKA 1O33A 5A0AE 1DWDH 3NWUA 1IQEA 1P10A 3U8OH 5IK2D 1PPEE 3A88A 1G30B 3DSGA 3MO6A 1DFPA 2M2AA 4YOJA 5BPEA 3UFAA 1QB6A 1MABB 1P2IA 4YM9A 2EQNA 3U69H 1TPPA 1LPKB 1O3HA 2F9OA 5LGOA 4RT1A 3ZZCA 1T8NA 4X6OA 1LHFH 1QL8A 2V6NA 4O3TA 1LQDB 1ID5H 5J4QA 3U8TH 2PGBB 2P16A 1EPTA 3SUEA 4WH8A 3U8RH 4ABBA 3GDSA 2F9VA 4AYYB 1QRWA 1T4VH 3PO1C 3FZDA 3Q3YA 4NG9H 1ELCA 2GGVB 1GMDF 2EA3A 1HJAB 5L2YH 3URCA 2FX6A 2J5UA 4AG1A 2ZNKH 3MH4A 3TNTA 3RXBA 2FOCA 4D76A 2R0KA 3SU0A 4GPGA 2YMSB 2J95A 2OC0A 2R0LA 3CS0A 1GVZA 2ANKH 2AS9A 4BXSA 2VIVA 1PPFE 2QGRA 1GBEA 1T32A 4ABDA 1Y3WA 2H6MA 4ISLA 1ETSH 4X1RU 1QB9A 4BNRA 4DURA 3RXUA 1K1NA 1DPOA 4E05H 1ANCA 1XKBC 4X2YA 4H6SB 3D62A 1W8BH 3VXEH 3OEHD 2H1UA 3UAIC 1C5QA 2OLGA 7LPRA 4DIIH 3GYLB 4GSOA 2YNBA 3LPRA 5JPMH 1UK2A 1NM6A 1QBNA 2F9NA 4XRNA 5C5OA 1TE0A 1TA6A 2W7SA 2WSSD 1ELAA 2CV3A 2QE7D 4YT7H 4RN6A 1P06A 4BOHA 4Y11E 3RXHA 3SU4A 1SMFE 4IGDA 1KTTB 2FLBH 4MTBA 5AHGH 5DGJA 1YPLH 4MDSA 2FOEA 2FODA 2ZDLA 1LHEH 1MAXA 1P12E 1NU7B 1YBWA 2A4GA 3K9XB 1MKXH 4JYVH 1K1OA 2TPIZ 4Q7XA 1TRYA 1W14U 1SPJA 4WF8A 4NA7A 2BXTH 4FUBA 1K21H 3NK8A 4CHAB 2F83A 1UHBB 3T5FH 1N1LA 4RI0A 2RFKC 1DUAA 4IN1A 5CHBA 1SFIA 3F9HA 1HBTH 1Y5AT 2J94A 1ZPZA 1EAWA 1J15A 1GG6B 2GMTC 1E0FD 1WSSH 1H8IH 2GT8A 4KGAA 1IOEA 3TGJE 4SGBE 4TYDA 1TNLA 4BAKB 2FP7B 4NIVA 5A2MH 4B1TA 1FPHH 1AE8H 2H9TH 3ESTA 4YZUA 1W2KH 2VU8E 3F3BA 1IHSH 3QTVH 4AZ2B 1O3KA 3PV2A 1AI8H 5GXPA 2IN2A 2EI8A 4I8GA 1SKYE 1QBOA 2AMPA 3E0NB 1FY1A 4DJZB 2CJIA 3QK1A 4TPIZ 2ZGBH 3PWCA 3A84A 4Y8XA 2ODQA 1VGCC 1G3EA 2JJ1D 3RMNH 1NFWA 1P8VC 1UK4A 2F9UA 4X1NU 4ABHA 1P02A 2A2QH 2ZU3A 2CHAB 3P70B 2BM2A 4INKA 2Q6DA 3U1IB 2B7DH 1C2EA 1TBQH 1W13U 3QN7A 3FZZA 4DT4A 2G5VA 2P8OB 1G3CA 1KDQB 3H09A 4I86A 4NIWA 2GKVE 4OS4A 2PWXA 3H5CB 1W11U 1NT1A 4OS5A 1ZLRA 2ZTXA 4F55A 3F0OA 3MHWU 1VCQA 3LC5A 1L4ZA 2PP6A 4UFGH 2G51A 2HALA 1YCPK 2UWLA 2QXIA 1F5RA 3HGNA 2XCFA 1FY4A 4TPYA 3SNCA 4TT3D 2C90B 3M5MA 4MNWA 1LVMA 1E79D 4AFQA 5T6DA 3MH6A 1C2JA 2Y5HA 2ZWLH 1HIAB 3BSQA 2A2XH 1HNEE 1W3CA 2NWNA 1DWBH 5A09A 1ORFA 5C0TA 1AD8H 2GX4A 4GVUA 2STAE 3QZRA 1P3EA 1GMHG 4FU7A 1AKSB 2QCYA 2AGGX 3F0PA 1OHHD 4ZXYH 1UVSH 1FX0B 5EXLA 2BOKA 1SI5H 3I29A 5PTPA 4NWLA 2KZ4A 4B75A 1V2VT 3A7WA 2HNTE 2XXLA 4GLYA 2V3MA 1CA8B 3MNCA 2J38A 2OQUA 3EQ0H 3TJOA 1GBJA 4D7GA 1AFQC 1DE7H 1LPZB 1ELVA 1ZPCA 1TLDA 3ZVDA 2A5AA 4K8YA 2BHGA 1QRZA 5AFZH 3PO1B 4ESTE 1C5NH 2F43B 2HVYB 3SOSA 2J98B 1EJAA 2J2UA 1L1JA 3SYJA 5DP6A 1Y3YA 1BMLA 1F0RA 1HJ8A 2VWNA 1E38B 1C5SA 2WPKS 5C1YA 2J34A 4X8TH 2XNDD 3LJOA 3O8BA 1AE5A 2JDID 5AVDA 3RXDA 1INCA 3T28A 2BD5A 2WPMS 4NWKA 4X1QU 7GCHF 1V2KT 2Y5FA 4B76A 2OC1A 1TNGA 1QGFA 1SLUB 3LGWA 1FLEE 3G01A 3HATH 3FO8D 3I78A 3NXPA 3S9AA 1G37A 3TPIZ 1VCWA 1UHBA 2BD7A 3Q00A 1FIWA 1LVBA 1CT0E 1UTLM 1GBFA 3SJ9A 3ATKA 1BOQA 3F68H 4X8SH 1MZDA 4ABAA 2G55A 2B0FA 4JZFH 1NFUA 1LHCH 4YXWD 1NTPA 1TMTH 3P8OA 4ZCNA 1V2LT 1H8HD 2Y81A 2Z3CA 2ESTE 1SGPE 4U32A 1FDPA 1S83A 3PWBA 4RKOB 3KQDA 3RXFA 1V2TT 5EPNA 3BTDE 1CQQA 1K9OE 5HKKD 1K1JA 3L6PA 2Z7FE 1A5GH 3AAUA 4I33A 1HAGE 2QAAA 2C3SA 2J4IA 4JYUH 3LGYA 3QGJA 5F8TA 1V2JT 2CGAA 2BDGA 5FX5A 4RT0A 3SGBE 5C67A 4CRFA 2A5IA 4OS6A 4NGAH 4UFDH 1THRH 1O31A 1XUGA 4JZ1A 3SGQE 1IQIA 3A8BA 3E90B 1QL7A 2DE9A 2ANWA 2WV5A 3M5NA 1P11E 3PYHA 1Z1IA 2QIQA 4Q80A 3UWIA 2W5EA 4YLQH 3T62A 2YNAA 2VWOA 3MI4A 2EY4C 4FUJA 4K3JA 1CGJE 4NZQA 1H8DH 1KDQA 1C2KA 1P9UA 4X2XA 1QTFA 2RDEA 2AYWA 2GJGA 1KXAA 1GL0E 1SOZA 2KM0A 2JIZD 2BVXH 1ELTA 3GY2A 4K1SA 1AUJA 1LVOA 1AB9C 2BVSH 5JDUB 1OYQA 2VWLA 2Y6TA 3CENA 1O2PA 4QT8C 2GV7A 3A8CA 2BZ6H 3RMLH 2HGTH 2OK5A 5DG6A 1Y3UA 5GCHG 1TOMH 1SLVB 2J9NA 1AUTC 3O8CA 1GJ5H 2OD3B 1VGCB 1G2LA 4GCHG 3P8FA 4MG3A 2PTCE 1RXPA 1HIAA 1CA0C 3B23B 3ODDA 3F9FA 1A5IA 3SW2B 1ELGA 2ALPA 1TPAE 1QJ1B 3PMAB 1GI7B 6GCHF 2LP6A 1KY9A 3IG6B 2O8LA 1GJ6A 4TY6A 1A3EH 4Y8YA 1IQKA 1KXDA 2QYIA 1AKSA 1S81A 1PJPA 1UK3A 2VIOA 2Z94A 4JZEH 1UJ1A 4AC9A 2P59A 4P00A 2LELA 3UR9A 2VIPA 1MU8B 1LHGH 1T4UH 4WMEA 1HFDA 4JZDH 3TJUA 4SGAE 2G5NA 1BMMH 1M9UA 2A1DB 3AW0A 1AO5A 1BZXE 2Z9JA 3KQEA 1DX5M 3OFND 5TCAA 3WW7A 1DWEH 1SGFG 1NU9A 4X6MA 3ZZ8A 3A89A 4I8JA 4FVDA 4BAQB 2QV1A 1BHXB 2ALVA 4AFSA 1S82A 4NA9H 2ANYA 3ATMA 1D3QB 2BD8A 1SG8B 1PQAA 2J98A 2HOBA 1AMHA 1C1VH 1W10U 2EI7A 2FOBA 1V2PT 4KELA 2B5TB 2GZ9A 1NFXA 4I7YH 1HAZB 2FO9A 1O3GA 1C2IA 4OS2A 4ZROA 4U30A 4B6FA 2WYJA 3LJJA 2G8TA 2V3OH 4WH6A 3M3VA 1YF4A 1NROH 1TGCA 2FZZA 4Q2KA 1SR5C 1Y5BT 2QXHA 3BTQE 2ZPRA 3PB1E 2A0QB 1UTOA 4AN7A 1PPHE 2FWWA 1TWXB 2VWMA 1TAWA 1JRSA 1BJUA 1O5EH 2Q6GA 1A0HB 4NIYA 3SO3A 1P2JA 1AFQB 3OY5U 2AMDA 1WUNH 2XC0A 4HTCH 4Y10E 3PROA 3FP6E 4ZAEA 2NU1E 4X6NA 5F8ZA 3SU3A 1BTHH 4KTSA 1MCTA 1PPBH 2ZHEH 1S6LA 2BY9X 3KGPA 4P02A 2HRVA 5KEDA 1TRMA 3SJOA 3F2HA 4DCDA 4FUFA 3GCTG 3RLYH 2SGDE 2YOLA 1C5YB 3FN8A 3RU4E 1BTYA 1PPCE 2ZFSA 3ENSB 5EJZA 3TK5A 1ABIH 1H8ED 2BMGB 1C5XB 2YMSD 1FY8E 3NRLA 2L74A 3KF2A 7ESTE 1ESTA 1GBMA 2HPQH 2ZHFH 2PKSC 3E91A 3UR6A 1F92A 4DOQA 1C9TA 2H9EH 2GV6A 1NRNH 1PPZA 3PTBA 1H9IE 4HGCA 1W0JD 3VB4A 4CBNA 4M7GA 4Y71A 1SOTA 2FXRA 3EE7A 3BF6H 2PFEA 1A5HA 1J17T 1SHHB 3FFGA 4B2BA 2WUCA 4K69A 2XC4A 8GCHG 5GWZA 1F0TA 1ZMLA 1J8AA 2AFQB 2BD3A 2SGPE 3AASA 3PMHB 3WY8A 3PRDA 1G36A 1O38A 2TGAA 1FN6A 3TIUA 3DSPA 2F4LA 3VPKA 3TK6A 2F91A 4RKJB 3ZV9A 1P57B 2Q6FA 3O8RA 1JMOH 4WY3A 2PW8H 2GTBA 2JETC 1VR1H 9LPRA 1W12U 2FEQH 1PQ7A 5TCCA 3A7TA 4ZKNU 1O2TA 1ZMNA 3STIA 5I25A 3A7YA 2AEIH 1CT2E 3MH5A 5DK1A 3E16B 3ZVEA 5K7RA 4D9QA 2OUAA 2VB0A 2BQ6B 5FPTA 1GI2A 2A5KA 4X2WA 3ZYEA 3N99A 4DGJA 5C2ZA 4AFUA 4DW2U 4F48B 3BG4C 1UTQA 3E0PB 3LONA 5C0UA 1ELBA 2V35A 3EAJA 1ESBA 4JZIA 3SQEE 5DN6D 3BEIB 5FPYA 1GDUA 4O97A 4MNXA 1F2SE 1ZR0A 4ZKSU 2VVUA 4BAHB 2TBSA 3UNSA 3BV9B 3GDVA 1C2HA 1AB9B 2AGEX 3BIVH 1GMCG 1THSH 2OBQA 1CHOG 1XUKA 1IQHA 2ZTZA 1C1WH 2G00A 1DSUA 1H9LB 1EJNA 2O8MA 1KXCA 1ESAA 3U1JB 1XVOA 1BHXF 5E0GA 2OP9A 2K0QA 2IJOB 1VITG 3VFEA 1GBCA 1EAXA 2UWPA 1CA0B 4Q63A 4UONA 5JB9S 2PSYA 4YESB 5EJ1A 1HXEH 3BTKE 2P3TB 3SI3H 3HK6B 1BMNH 1AU8A 1S84A 1CT4E 4H42U 1L1GA 1NRRH 1O30A 1HAHH 3VB6A 1YPGH 2AMQA 4ISHH 1DM4B 4K5ZA 1OWHA 2CMYA 3BIUH 1GJ9B 1MQ6A 1QR3E 3QZQA 3QDZB 1BITA 5JBAS 1HDTH 1MKWH 1FIZA 3A85A 4CRCA 1FPCH 4HI3A 4TY7A 1YPKH 5EW1H 1HUTH 1B0EA 1ZHMA 1GJ7B 1T8OA 1DLKB 1QBVH 1GMHF 1A3BH 2XBWA 2K1QA 1C5TA 2KCPA 2OC7A 1C1RA 3SU6A 1YPJH 1NC6A 3M35A 5GDSH 2V7QD 3Q3XA 2ZQ2A 3UUZA 3ZVFA 1BMFD 3H7TA 1O2WA 3RM0H 5CMXH 1BBRH 1HAPH 1HB0B 1AVWA 3RC4A 1BBRE 2FI3E 5AF9H 3FOAA 3KN2A 2VH0A 1EOJA 3QTOH 1XVMA 1SFQB 1C1PA 1O2UA 1Y5UT 2GCHG 2ZPSA 1DXWA 1YM0A 2ZI2H 3S9BA 4INLA 2BLQA 3A82A 2W3KA 1ZZZA 3MYWA 2NU0E 3OE7D 2JH6D 1EATA 4Y79A 1C1TA 1T8LA 1SGRE 5I46H 3HPTB 3OTPA 1KMHB 1JIRA 1T7CA 3M37A 3TGKE 2UUKB 1SBWA 2LPRA 1EJMA 3S9CA 1ZRKA 1UTNA 4ACAA 3PMBB 3A80A 2FYRA 4FETA 1C5OH 5SGAE 1O36A 4Z0KA 4B2CA 3MO9A 2R2MB 1MCVA 1E1QD 4Q7YA 3T27A 2FDAA 2ZHDA 3D65E 1NBME 4NCYA 1MBMA 3MQKC 1N6YA 4E7NA 1XUIA 4UE7H 1GDQA 3JZ1B 2D8WA 3EA9A 3ZIAD 3KEEA 4YO9A 2ZCHP 3KL6A 2VINA 1GBIA 2SNVA 3QX5H 2O8UA 5TJXA 2XBXA 5DJ7A 1TQ0B 3RXOA 3UNRA 1AY6H 3ZZAA 1W0YH 2WZQA 1Z6JH 3LC3A 1BIOA 2OXSA 1CO7E 4CH8B 1YCPM 2PLXA 1Y3XA 3VG8A 1NN6A 5B6OA 1WTGH 5DP8A 3OX7U 2WPIS 3GISB 4K60A 1HXFH 1QRXA 2PSXA 2ZA5A 1P2KA 1GJ8B 4WMDA 2Z3DA 4WWYA 2THFB 3A87A 2JETB 3CS7A 4FUCA 3VGCB 1ZHRA 1ZJDA 4UEHH 5EGMA 1FY3A 1WAYB 1XKAC 1GBLA 1ZTJA 5CDFE 4J1YA 1NBMD 1MH0A 4X1PU 2BY5X 5EIYA 1SGYE 3KHVA 2WUBA 3NCLA 3TH3H 1ZOMA 2AIQA 1KXEA 2BD9A 2BY6X 1ZGIA 3BEUA 1QFKH 2NU3E 2C8YB 1GBHA 3TJVA 4NSVA 2HWLB 3BG4B 2C8ZB 4NSYA 4BTUB 3Q3KA 3SUDA 2BTCE 1QJ6B 2ZEBA 1S0RA 1BDAA 2C93B 3F9GA 3SUFA 3LGIA 1D4PB 1GI4A 2FTLE 2KFWA 1OXGA 1GHAF 2KR7A 2OQ5A 2VNTA 2A31A 2ODPA 3P17H 1O2GH 2K8IA 5ABWA 3PLPA 1C1QA 1GJDB 1ZTKA 2BD2A 1GMDG 4F49A 1RS0A 3UREA 1IAUA 2P3UB 2HLCA 6ESTA 4IN2A 1P2MA 1WXRA 1ZHPA 2JH0D 1RRKA 1EPTC 1LHDH 1OSSA 4YOIA 1E36B 3MOCA 5JBBS 3CP7A 5ESBA 1F5KU 1TFXA 1W7XH 1YKTA 3LH3A 1C2DA 1E35B 1OKXA 3OSYA 3SHAH 2W26A 1GBDA 5EODA 2Y5GA 4FU8A 3STJA 1EKBB 2ZC9H 5C1UA 1HAYB 5EQRA 5C17A 2G4TA 1HYLA 5FPSA 1O3DA 1O5FH 3RXGA 2O8TA 1ANEA 4LOYH 1W7GH 4AB8A 2JH5D 2SNWA 3M7QA 5GIBA 1IQFA 1YPEH 2Z3EA 4RSPA 5B6LA 3S7KB 1YY3A 3RXLA 4FUHA 1UTPA 2TIOA 1UCYK 1O32A 1MTNC 2QXJA 1RJXB 1YPHC 2A4OA 1P01A 1Z8GA 1UTKA 5EU8A 2ASUB 5CHAC 2DE8A 3M61U 4WVPE 1C5WB 1HAIH 3M3SA 4JCNA 1GL1A 1C5MD 4Y7BA 1C5PA 1SSXA 3SV9A 5JYIA 2IJD1 1GHBF 3DA9B 4J2YB 4GUXA 3T29A 1V3XA 3E8LA 3P8NA 5C1XA 3FANA 2ZFPH 5LPEA 4A92A 3C27B 4ZKRU 4AGJA 2G52A 1SGDE 4O03A 1Y59T 2ZDMA 1ETTH 1Z8RA 1QQUA 1HV7A 1HAXB 1PFXC 4UD9H 5DPAA 1IQJA 1O2XA 3TK9A 4BTTB 4BAOB 1MZAA 1A7SA 1TABE 3S69A 1VKYA 2QXGA 4XDEA 5FCRA 2ODYB 4A1TA 1C5VA 2JKHA 3LGTA 1Z1JA 1EP6A 4FUDA 4A7IB 8LPRA 1ELDE 4XOJA 5FL7D 1PYTD 3B9FH 1WTHD 1DITH 1JRTA 1GHYH 4MPVA 1YP9A 6CHAC 1EB1H 1NFYA 2FS8A 3KNXA 2CXVA 1OWIA 4GHTA 1HAVB 2KCAA 3DFLA 2WPLS 3L33A 3SI4H 1OPHB 5FBEA 1V2QT 3MH7A 1S6HA 4TWWA 1QCPA 2GMTB 1P2QA 2ZIQH 2F9PA 5AFYH 4HZHA 2ZU2A 1V2WT 3ZVGA 2J92A 1K1LA 1RIWC 1O5BB 4CH2B 4ASUD 3M5LA 4FU9A 1CGIE 4OS1A 1CVWH 2CF8H 1Q2WA 3BG8A 4MNYA 1LTOA 4Y76A 1QL9A 4DT7B 1GJ4H 4FUGA 1YPMH 3F9EA 1FUJA 1QJ7B 1BMAA 1TNHA 4D9RA 5HM9A 1C2GA 2H9HA 1GJAB 1SVPA 3C1KA 1COWD 3VB3A 3UNQA 1OWEA 5FBIA 3SUGA 3RU4T 3TGIE 3GY8A 4OGYA 1C4U2 2G81E 1H1BA 2XW9A 2BDYA 4THNH 1OWDA 1SL3A 2BB4A 1DS2E 1O0DH 2G4UA 4AX9H 1A61H 1D6WA 1GI0A 2ZO3H 2BOHB 5ESTE 1SGQE 3MU8A 3SGAE 1YLCA 1KXFA 4NZLA 5DP7A 1FNIA 2BD4A 3LDXH 1OX1A 4XSKU 2EC9H 1Z6EA 1C5UA 1TNKA 1HRTH 1QIXB 2BDIA 2STBE 5GPIB 5DKMA 3RXQA 4BAMB 1UMAH 1H4WA 2RCEA 4NIXA 2BDCA 2D2DA 2PKAB 2IPHA 4OM9A 4B71A 1MKXK 4I32A 1D3TB 1RTKA 4F4OC 1GCTC 3AVZA 4FXGH 4NFFA 2A7CA 5HYOA 2KCOA 4HFPB 1FAXA 2PR3A 4JK6A 3RXMA 8KME2 1GI8B 3M7TA 4ASHA 1TX6A 3KQCA 1V6DA 4IC6A 3BTGE 1AFEH 1HAOH 3E6PH 4LXBH 5IDKA 5L30H 1VITF 1BA8B 3SNBA 3GY6A 3ZZ6A 4KP0A 2KCYA 1DOJA 1B7XB 2GD4B 2AH4X 3RC6A 1YGCH 5F8XA 1TRNA 1BQYA 3E1XB 3JZ2B 3GDUA 3DT0H 3NZIA 3U9AH 2XYAA 1TNIA 2IOTA 5K0HA 2WPJS 2BY8X 3D23A 2WINI 2ZHWH 1TPOA 5A8XA 9ESTA 4MNVA 3SBKA 1JIMA 2FOMB 3GY4A 1P03A 1KSNA 1TNJA 1GI6A 2FX4A 1DDJA 1BUIA 1XXFA 2BDHA 4FUEA 4XBDA 7GCHG 4B74A 1F5LA 1UVPA 4DIHH 1A0JA 5EOKA 1D9IA 1DUEA 3ZYDA 4UFFH 5HIYA 3RXJA 3SZEA 5EW2H 5DP4A 3ZVAA 2BXUH 1B5GH 1LCYA 1O3PB 1FMGA 3OY6U 1YCPH 3RXAA 1MAYA 2H5CA 3RXVA 2VGCC 5DP3A 2FI4E 4AFZA 3TLOA 1RTLA 3KCGH 3UOPA 2AIPA 2B9LA 5EG4A 4ABIA 3RXPA 1MTNB 2ZDVH 3RP2A 1G32B 1OP0A 1O2VA 1K1MA
chains in the Genus database with same CATH topology
5CHAB 3BTFE 2QF0A 3UQOA 1Q31A 3MNSA 3UPEA 1SB1H 2ZGJA 2Z9GA 1H9HE 1GJCB 3SNEA 2XRCA 3MU4A 1O2ZA 2R2WU 3SNDA 2RA3A 4MPWA 1TYNA 1C5RA 1HAVA 3R3GB 3FP8E 1S6FA 2FOFA 3GCNA 4DVAU 1DT2A 2EEKA 1NS3A 1KLJH 3ATLA 5DP5A 2QY0B 1O2QA 1C1UH 4UDWH 1IQGA 2ZP0H 2KAIB 4K8BA 5L6NH 1MQ5A 1GVKB 4IW4E 2FTMA 2D1JA 3RU4D 1TX7A 3NUMA 1S85A 3K6YA 4ZMAH 2ZDAH 5EXNA 3VB7A 4LK4A 2BX4A 1JOUB 3SZNA 1EX3A 2ZCLP 5HMAA 4DY7B 3E3TA 2Z6BD 2TGPZ 1GI9B 4R0IA 3LU9B 3ZZBA 1ETRH 3A83A 4FUIA 1HPGA 1CGHA 1WU1A 1RGQA 2F3CE 3O8DA 1Z71A 2XBYA 1TB6H 3RMMH 2ZECA 1L2EA 1UCYH 1KIGH 3BTTE 3K65B 4D7FA 1ZTLA 2GVFA 1JWTA 3ITIA 1RIWB 1ZYOA 4BTIB 2ZCKP 5BRRE 1AIXH 2ZKSA 6GCHG 1BTPA 1OOKB 1XUJA 1KLTA 1XUHA 3P6ZB 4KKDA 1GVLA 2F9BH 2PKAA 3TH2H 5DO4H 2ZF0H 1ZSKA 1FAKH 1EP5A 1WQSA 3NPSA 1SGEE 3ATWA 1C5LH 3ZZ3A 1C1NA 1HCGA 4K1TA 4ABGA 1ZGVA 5JBTA 3PM3A 1V2NT 1HJ9A 1GGDC 1TBZH 4IBLH 1BRUP 1DVAH 1L4DA 1EZQA 2HNTF 2P95A 2UUYA 4A1VA 2LNCA 3LGUA 3F6UH 4VGCC 1X7AC 1MMJN 2QN5T 2Y82A 2A7HA 3ZZ5A 1AVGH 3V3MA 1XX9A 1TBRH 3A7ZA 4ZHLU 3RXCA 2Y80A 3SNAA 1C5ZB 2QA9E 4YLUA 4Y8ZA 4CRAA 1Y8TA 3RDZA 1TGBA 1GCTB 1AZZA 1F0SA 2P93A 1SGTA 3SU1A 3MWIU 1D3PB 1TMBH 1Z8IB 1G3DA 1QHRB 1VITH 3DFJA 1WYKA 4IMZA 1GHXH 2CN0H 1TONA 5T6GA 4X1SU 2Z9LA 2FESH 2UUFB 2AERH 1O2MA 1LMWB 2EI6A 3GYMA 1NRQH 1B0FA 2M5TA 3ZV8A 1ZSLA 2ZGHA 3A8DA 2SGFE 3EA8A 1T8MA 3K6ZA 2FS9A 4IMQA 1Y3VA 3BTHE 1UTJA 1VZQH 1OWKA 1DLEA 1SLWB 5JB8S 4I31A 1V2ST 1UO6A 1BTWA 3R0FA 5LH8A 4B2AA 1SGNE 3GCHC 4X6PA 4AOQA 1OP2A 5HGGA 1E34B 1P9SA 5EXMA 1GCDA 5F03A 1SGCA 2HVXA 3ELAH 1JXPA 4XE4A 2UUJB 2W7UA 3GICB 1C1SA 5FHTA 1S0QA 4BXWA 5LPRA 3FP7E 3SU2A 1T31A 3S7HB 1AHTH 1LKBA 1UVTH 3EA7A 1O3NA 1HLTH 1YYY1 3V0XA 2VIDA 2VGCB 5EQSA 4B73A 3MO3A 1SHYA 4JMYA 1ZRBA 4XBCA 2KAIA 1BRCE 1DICA 3M3TA 3MFJA 2V3HH 2ZFRH 3ZZ9A 1AWHB 1PQ5A 1O2KA 2RA0A 2PKSB 2ILNA 1MTSA 1K1PA 3SV7A 4ZXXH 1DY8A 2PTNA 1MTWA 2Y7ZA 3FAOA 3LOXA 4MVNA 1ARCA 2WV4A 1FZZA 4DG4A 1KYNA 3ZZDA 1BRAA 1DSTA 4YTAA 1EZXC 3RLWH 5EQQA 1WCZA 3PLBA 1FJSA 1GJBB 1GBBA 2C8WB 3A86A 3W94A 2QF3A 3ATIA 4K2YA 1NRSH 1LQEA 2ZQ1A 1MUEB 2H2ZA 1EOLA 2WYGA 2H5DA 3SN8A 1NO9H 3H7OA 5C3NA 1QNJA 4WJG2 2BQ7B 4ABJA 4ZHAA 1BT7A 1TPSA 8ESTE 3MTYA 3GY3A 1A2CH 3GY7A 1ELFA 1TGSZ 4ISNA 3P92A 3RC5A 4ZHMU 4D8NA 4I8HA 5E0JA 3W95A 2RDLA 3P95A 2R9PA 1BJVA 1N8OC 1O34A 1BRBE 5T6FA 1AGJA 3PTNA 5FAHA 2HPPH 4BANB 1ABJH 1BTUA 3T26A 1L0ZA 1EQ9A 1C1OA 5GCHF 3RXSA 3VXFH 1FY5A 1XXDA 1MD8A 4LZ4B 3RUOA 2P94A 2BLWA 3M5OA 5HM2A 1O5DH 2FLRH 2GT7A 4GCHF 2FYQA 2A45B 4FVBA 1Z8JB 3B8JA 3ODFA 4ISOA 1ANBA 1XUFA 4ABEA 1EZSC 1GWAA 1O2LA 4ZKOU 5A8YA 1EASA 5EPYA 3LKWA 3EYDA 1P2NA 2HNTC 1W0ZU 1CBWC 1DXPA 1OP8A 2PV9B 4GAWA 4ISIH 1TIOA 1BTXA 1ZMJA 3Q76A 5A0BA 3IWMA 1EUFA 1DANH 2BLOA 4GHQA 5CE1A 1QURH 3FVFB 2RG3A 1XMNB 1DWCH 1GBAA 1LO6A 1O2JA 1YLDA 1ZJKA 4Q7ZA 3SORA 3QWCH 4CR9A 1GGDB 4K1EA 1NY22 3SJ8A 1FXYA 3IITA 3MNBA 2A4RA 2P3FH 1V2UT 3V12A 4ABFA 1SGFA 1SQAA 5A8ZA 1O2RA 4VGCB 4OS7A 3SU5A 1DY9A 2FI5E 4Y7AA 5H4IB 5LPFA 1O2HA 4AGKA 1C9PA 1ARBA 1RFNA 3EDXB 1TX8A 3MU1A 4O3UA 1G3BA 1O2YA 1PYTC 1SQTA 4X2VA 1MU6B 4NA8A 1VJ9U 2PHBA 1CHGA 1A1RA 3VB5A 1OYTH 1O3IA 3TVJB 1EAUA 4WXVA 1UVOA 2Z9IA 2OCVB 5HXFA 1SGIB 4MQAA 1Z7KA 3QO6A 3A7VA 2FM2A 4XBBA 3URDA 3SV8A 1N6XA 1F7ZA 1O3BA 3DHKH 4KTUA 1QA7A 1PPGE 1K28D 1FONA 1ACBE 1O2SA 1YPHE 2ZDKA 1L1NA 2R3UA 3A81A 1V2OT 3UY9A 1JBUH 1C1MA 2VVVA 1TGNA 1PQ8A 1LKAA 2BLVA 2BQWB 3GCTF 3GCHB 3TJNA 5E8EH 4I8KA 1O39A 3BTEE 2SGAA 1J16A 2XWBI 1J9CH 1LDTT 1WBGB 1QA0A 2FOGA 4KTCA 3QUMP 3LH1A 1WOFA 1ELEE 4INHA 4WXIA 6LPRA 5FXLA 1THPB 1KLIH 3M36A 1OWJA 4MLFB 2VJ1A 1E37B 5ETXA 3RXEA 2FIRH 5C5NA 5F6MA 3RXTA 1NESE 2ZPQA 4X8VH 2TGTA 3SJIA 3SHCH 1TQ7B 2GP9B 4Y6DA 1GPZA 2XC5A 2OTVA 3Q77A 1ZSJA 4R8TB 3UWJH 5DP9A 8GCHF 1AWFH 1OS8A 2ZTYA 3D49H 2GDEH 3AW1A 4WMFA 1FN8A 5IYTA 2PGQB 1ZPBA 2GCTC 3QLPH 4CRGA 1O2OA 1MKWK 3AAVA 3RMOH 4AYVB 4LZ1H 3S0NA 1O3LA 4CRDA 1K22H 2XTTB 3TH4H 1P0SH 3F1SB 1HGTH 3LGVA 5FX6A 1BB0B 2C4FH 3KIDU 2B8OH 1CU1A 4X0WU 3P8GA 1A4WH 1SLXB 2OBOA 4IC5A 2ZG0H 1C2FA 2R3YA 1UVUH 4X8UH 2OC8A 1BBRK 1RTFB 1C4Y2 1VCPA 3A8AA 4E06H 2O9QA 1A46H 4NFEA 2ZHQH 2VIWA 1BCUH 1NRPH 3TU7H 3RXRA 3BTWE 1NZQH 4H4FA 3VEQB 4ZUHA 1SC8U 1GHAG 1MTUA 1AQ7A 1GBKA 4O9VA 3DUXH 5A0CA 2I6SA 4MPUA 1MBQA 1UTMA 2VIQA 1VJAU 3RM2H 5E2OA 1BTZA 2ZZUH 1CSOE 1N8OB 2FOAA 3OTJE 2D26C 1P09A 1TMUH 3BN9A 4TWYA 3SQHE 4A6LA 4CBOA 1P05A 1GMCF 1HJAC 1MTVA 1EB2A 2XBVA 1CHOF 3LT3A 3BEFB 4CRBA 1EXFA 2DUCA 2Z9KA 2GDDA 2GZ7A 2Q1JA 1O37A 1C2LA 2XWAA 1V2RT 2TRMA 3QGNB 1O2NA 2Y7XA 5L2ZH 2SGQE 1EAIA 3MU5A 1O5CB 1YC0A 4Y0ZE 2W3IA 1MD7A 4AORA 1IQNA 2PUXB 2ZGCA 1KTSB 1P2OA 4A5TS 1CBWB 2BYAX 1AN1E 1IHTH 2O8WA 2ZFTA 2ZU4A 3V13A 2V0BA 3KQBA 1EPTB 1O5AB 1P3CA 5G4BA 2A7JA 1FV9A 3GOVB 3HKIB 3N7OA 4A1XA 2ZFQH 1LPGB 1O3FA 1S5SA 1K1IA 4AB9A 2FMJA 1EZUC 3V7TA 1LVYA 1AZ8A 1G9IE 3EGKH 2FPZA 4ZH8A 1GHBG 2FOHA 5GJ4B 3UOUA 1TGTA 3DD2H 1A0LA 2OINA 1FI8A 1GI3A 1FQ3A 4CREA 1O3JA 1XM1A 2VVCA 3OU0A 2BDAA 3L3TA 1TOCB 1V2MT 3OYPA 1GI1A 2ZDNA 4Y0YE 1AVXA 1IQMA 5E0HA 5J4SA 4CHAC 3T2NA 2TGDA 2WPHS 2ZFFH 3U98H 7KMEH 1P04A 2NU4E 2GCHF 1NPMA 2C8XB 4MPXA 3RXIA 1J14A 2BY7X 2A4QA 3A7XA 4AG2A 3M7UA 1GG6C 1O35A 3BTME 3HK3B 3MMGA 2BX3A 4E7RG 4IS5A 2UWOA 2ANMH 4JYTA 1D3DB 1QQ4A 1O5GH 3LIWA 2CF9H 2NU2E 2AGIX 1GHVH 1KXBA 1GDNA 1QY6A 2PUQH 2GZ8A 1C4V2 3SV2H 1C2MA 1Q3XA 3HKJB 1O2IA 2ZU1A 3T25A 3UIRA 4U01A 2BZAA 1ANDA 5E2PA 1CE5A 1G2MA 3ZVCA 3ZVBA 1K2I1 2BDBA 2A32A 3EE0B 1D6RA 3K2UA 3RXKA 1O3EA 2QC2A 2CHAC 2VH6A 2ULLA 5C20A 3TNSA 3MNXA 2XNIA 6CHAB 4YOGA 1O3AA 3PV4A 3ZZ7A 1GHWH 5T3HA 1WQVH 1O3CA 2P8OC 3SV6A 1TA2A 4PROA 3VGCC 3GY5A 1O3MA 2ZGXH 1GBTA 1SQOA 4UFEH 4JK5A 4OGXA 1QB1A 4XFQA 1TALA 1UCYE 2SFAA 3UTUH 1IQLA 4Z6AH 1F0UA 1RD3B 4U2WA 2GCTB 4YT6H 3MU0A 1GHZA 2ZU5A 3ZZ4A 5FCKA 1GI5A 3TITA 2XCNA 1O3OA 3HGPA 2SGEE 2I6QA 1WV7H 3UQVA 4CR5A 3NKKA 2BVRH 4H6TA 4I8LA 3SJKA 5JBCS 3PMJA 1U6QA 3GCOA 3I77A 3PLKA 1O33A 5A0AE 1DWDH 3NWUA 1IQEA 1P10A 3U8OH 1PPEE 3A88A 1G30B 3MO6A 1DFPA 4YOJA 5BPEA 3UFAA 1QB6A 1P2IA 4YM9A 3U69H 1TPPA 1LPKB 1O3HA 2F9OA 5LGOA 3ZZCA 1T8NA 4X6OA 1LHFH 1QL8A 2V6NA 4O3TA 1LQDB 1ID5H 5J4QA 3U8TH 2PGBB 2P16A 1EPTA 3SUEA 4WH8A 3U8RH 4ABBA 3GDSA 2F9VA 4AYYB 1QRWA 1T4VH 3PO1C 3FZDA 3Q3YA 4NG9H 1ELCA 2GGVB 1GMDF 2EA3A 1HJAB 5L2YH 3URCA 2FX6A 4AG1A 2ZNKH 3MH4A 3TNTA 3RXBA 2FOCA 4D76A 2R0KA 3SU0A 4GPGA 2J95A 2OC0A 2R0LA 3CS0A 1GVZA 2ANKH 2AS9A 4BXSA 2VIVA 1PPFE 2QGRA 1GBEA 1T32A 4ABDA 1Y3WA 2H6MA 4ISLA 1ETSH 4X1RU 1QB9A 4BNRA 4DURA 3RXUA 1K1NA 1DPOA 4E05H 1ANCA 1XKBC 4X2YA 4H6SB 3D62A 1W8BH 3VXEH 2H1UA 1C5QA 2OLGA 7LPRA 4DIIH 3GYLB 4GSOA 2YNBA 3LPRA 5JPMH 1UK2A 1NM6A 1QBNA 2F9NA 5C5OA 1TE0A 1TA6A 2W7SA 1ELAA 2CV3A 4YT7H 4RN6A 1P06A 4BOHA 4Y11E 3RXHA 3SU4A 1SMFE 4IGDA 1KTTB 2FLBH 4MTBA 5AHGH 5DGJA 1YPLH 4MDSA 2FOEA 2FODA 2ZDLA 1LHEH 1MAXA 1P12E 1NU7B 1YBWA 2A4GA 3K9XB 1MKXH 4JYVH 1K1OA 2TPIZ 4Q7XA 1TRYA 1W14U 1SPJA 4WF8A 4NA7A 2BXTH 4FUBA 1K21H 3NK8A 4CHAB 2F83A 1UHBB 3T5FH 1N1LA 1DUAA 4IN1A 1SFIA 3F9HA 1HBTH 1Y5AT 2J94A 1ZPZA 1EAWA 1J15A 1GG6B 2GMTC 1E0FD 1WSSH 1H8IH 2GT8A 4KGAA 1IOEA 3TGJE 4SGBE 4TYDA 1TNLA 4BAKB 2FP7B 4NIVA 5A2MH 4B1TA 1FPHH 1AE8H 2H9TH 3ESTA 4YZUA 1W2KH 2VU8E 1IHSH 3QTVH 4AZ2B 1O3KA 5GXPA 1AI8H 2IN2A 2EI8A 4I8GA 2AMPA 1QBOA 3E0NB 1FY1A 4DJZB 2CJIA 3QK1A 4TPIZ 2ZGBH 3PWCA 3A84A 4Y8XA 2ODQA 1VGCC 1G3EA 3RMNH 1NFWA 1P8VC 1UK4A 2F9UA 4X1NU 4ABHA 1P02A 2A2QH 2ZU3A 2CHAB 3P70B 2BM2A 4INKA 2Q6DA 3U1IB 2B7DH 1C2EA 1TBQH 1W13U 3QN7A 3FZZA 2G5VA 2P8OB 1G3CA 1KDQB 4NIWA 2GKVE 4OS4A 2PWXA 3H5CB 1W11U 1NT1A 4OS5A 1ZLRA 2ZTXA 3MHWU 1VCQA 3LC5A 1L4ZA 4UFGH 2G51A 2HALA 1YCPK 2UWLA 2QXIA 1F5RA 3HGNA 2XCFA 1FY4A 4TPYA 3SNCA 2C90B 3M5MA 4MNWA 1LVMA 4AFQA 5T6DA 3MH6A 1C2JA 2Y5HA 2ZWLH 1HIAB 3BSQA 2A2XH 1HNEE 1W3CA 2NWNA 1DWBH 5A09A 1ORFA 1AD8H 2GX4A 4GVUA 2STAE 3QZRA 1P3EA 1GMHG 4FU7A 1AKSB 2QCYA 2AGGX 4ZXYH 1UVSH 5EXLA 2BOKA 1SI5H 3I29A 5PTPA 4NWLA 4B75A 1V2VT 3A7WA