1A5IA

Catalytic domain of vampire bat (desmodus rotundus) saliva plasminogen activator in complex with egr-cmk (glu-gly-arg chloromethyl ketone)
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
265
structure length
265
Chain Sequence
TCGLRKYKEPQLHSTGGLFTDITSHPWQAAIFAQNRRSSGERFLCGGILISSCWVLTAAHCFQESYLPDQLKVVLGRTYRVKPGEEEQTFKVKKYIVHKEFDDDTYNNDIALLQLKSDSPQCAQESDSVRAICLPEANLQLPDWTECELSGYGKHKSSSPFYSEQLKEGHVRLYPSSRCAPKFLFNKTVTNNMLCAGDTRSGEIYPNVHDACQGDSGGPLVCMNDNHMTLLGIISWGVGCGEKDVPGVYTKVTNYLGWIRDNMHL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords PLASMINOGEN ACTIVATOR
publication title Catalytic domain structure of vampire bat plasminogen activator: a molecular paradigm for proteolysis without activation cleavage.
pubmed doi rcsb
source organism Desmodus rotundus
total genus 58
structure length 265
sequence length 265
ec nomenclature ec 3.4.21.68: T-plasminogen activator.
pdb deposition date 1998-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1a5iA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1a5iA01
2OQ5A 3SU2A 2ZDKA 1SVPA 2GDEH 4HTCH 2HNTF 5AFZH 4IW4E 2FO9A 3E91A 2C8ZB 4FUGA 4RKJB 3SUFA 3Q77A 4IC6A 1GI6A 2BM2A 5C67A 3I77A 2EEKA 1ANCA 1P8VC 3ELAH 3MNBA 1TNJA 1SOZA 1K1IA 1YBWA 1LPGB 3MI4A 5DP4A 2A4OA 3UY9A 1GBCA 1N1LA 1O3MA 3SU1A 4ZHLU 5BPEA 2ZU2A 3MNCA 4OS7A 4D7GA 4JZ1A 5JYIA 2NU0E 1F5LA 1Y3YA 7ESTE 1GBLA 5A8ZA 2BDCA 2BD8A 3GY3A 1IQFA 3P8NA 3M5LA 1AE5A 1LKAA 1X7AC 4GPGA 3Q3KA 2FS9A 1LHDH 3ODFA 2STAE 1ESTA 1GPZA 1O5GH 3VB7A 4J2YB 1W7GH 4NWLA 1QJ1B 3STIA 4E7RG 3H7TA 1SSXA 2BY7X 3QK1A 1K1NA 3AAVA 2A0QB 3T28A 4B2CA 5A8YA 1EKBB 2ZHWH 1TRYA 3LDXH 5C5NA 3MU1A 3RXLA 4OS5A 3RMOH 4AGKA 3FZDA 2VVVA 3P95A 5FBIA 5CE1A 3GY6A 2Y7ZA 4H6SB 3HPTB 2CN0H 3O8BA 4A1TA 4ISHH 1GCTC 4U01A 4Y6DA 1RFNA 3SQHE 1GGDB 3HGNA 3SUDA 3OSYA 1HAVB 3FP7E 1SGYE 1NS3A 4B76A 3M7QA 1RGQA 1VITF 3FP8E 2F9PA 2ZP0H 5SGAE 2JETC 4UFEH 2IN2A 4IS5A 1DWCH 2ZFSA 2QAAA 1Z1JA 2TIOA 4ZKRU 5E0JA 4K1SA 2XNIA 3NUMA 1KLTA 4XBDA 5EU8A 1QY6A 2CF9H 4X8UH 1XMNB 1TX7A 1ZYOA 1CA0B 3M5MA 1AFQB 1MTVA 4A92A 1H8IH 4DGJA 2WINI 3KQBA 4B73A 4CHAC 4THNH 1DY8A 1QL9A 3Q00A 4Y10E 1E38B 2GX4A 3SOSA 2BDAA 2AYWA 3ZYDA 3LT3A 1L4ZA 4NIVA 2F9BH 2O8LA 3F9FA 3ZZ7A 4I7YH 1KTSB 2BMGB 3ZZ6A 4CRGA 2STBE 3L3TA 5GCHF 3VFEA 2VWNA 1GI8B 1B7XB 3UREA 1UK3A 1ORFA 2CF8H 3SO3A 1SLUB 3UPEA 1ESAA 5GCHG 5EPYA 3URCA 3F9EA 3SGAE 2GT7A 3ATLA 4Z6AH 1DPOA 2C8YB 2BLVA 2OBOA 3SJOA 3KL6A 1ZHPA 3E16B 1O2ZA 1O2GH 1C9PA 1SHHB 2OXSA 3TNTA 1EZSC 1BRBE 2HPPH 3UR6A 3OY6U 1FIWA 4Q7XA 3D49H 1O30A 4I8GA 2O8MA 1YLDA 3PLPA 1SG8B 1G32B 1BRUP 3MU8A 3A84A 4BAOB 1HBTH 1OYTH 4INKA 1V2MT 4ABBA 3I29A 1NZQH 1XUIA 3GDUA 2LPRA 2EA3A 1VGCC 1HUTH 1T4VH 1TPOA 1C5ZB 4YZUA 4WH8A 4MLFB 2P93A 2XC0A 4JZDH 4X6OA 2OBQA 1VCPA 1SB1H 4MG3A 1PPBH 1MD8A 3KHVA 2OC1A 1PPZA 1FI8A 1CQQA 2VIPA 3A8CA 1HAOH 1SFQB 1A5GH 1WCZA 1A4WH 2BY6X 2V0BA 1OYQA 1YPGH 1TGNA 1GJCB 1O3HA 1LKBA 4TWYA 1GMHF 3PTBA 2QF3A 1QBVH 2WPKS 3F1SB 3RM2H 2BZAA 4K60A 1XM1A 2ZECA 2FOFA 4ISIH 1O2MA 1D3PB 3PO1C 2HNTC 3MHWU 1BIOA 5GJ4B 5E0HA 5EQSA 1L1GA 3QUMP 3FP6E 1BTWA 2BD2A 2BQ7B 3ATMA 2HPQH 1A3EH 1EZUC 2Q1JA 2TRMA 2DUCA 2NU4E 1EPTB 4MPXA 1UVOA 5DP6A 1V2NT 1SGQE 1N8OB 2FTLE 2ULLA 1LHCH 1Z8GA 3MO6A 1P2IA 1D6WA 4ABGA 2HVXA 3V0XA 1O3CA 4Y71A 4H6TA 3RXSA 1ELGA 2P59A 2BD5A 1HLTH 4YTAA 2BY8X 5F03A 4KP0A 5F8XA 3TK5A 3EYDA 3SJKA 4TY6A 3RU4E 5BRRE 3G01A 1W0YH 2R0LA 1AIXH 1GJBB 3GYLB 1OWIA 4FXGH 1Z7KA 1GL1A 4LZ4B 4I8KA 2W3IA 1O2LA 2KAIA 4A5TS 3ZVAA 3ZV9A 3FAOA 2AGEX 5IDKA 1P9SA 1W11U 1NY22 4X2YA 5CHAC 7GCHG 2ZWLH 3RXVA 3K2UA 2F3CE 2FEQH 3PLBA 1DANH 1O39A 2A2XH 4YLUA 3TH2H 3LKWA 1CHGA 1AO5A 1C5UA 3MU4A 4Y8ZA 2OC0A 2TGPZ 1MAYA 1BA8B 1LCYA 4WF8A 4RN6A 3SBKA 3TVJB 2VIDA 5AHGH 2RCEA 1TNIA 3A8BA 3RMLH 2ZFPH 3VPKA 2RG3A 1UCYE 2Z94A 1ZGVA 1NPMA 2CJIA 3K65B 4X2WA 1XUJA 1W14U 4OS6A 1CT2E 1GL0E 4UFDH 1F2SE 1B0EA 1ZTLA 2BDGA 1KXCA 1DITH 1YPHE 1YPLH 1Q31A 1GBMA 2F9NA 1HFDA 2FMJA 3K9XB 3P8OA 4UFGH 4D8NA 1Z71A 1TLDA 3ZZCA 3FVFB 1BB0B 6GCHF 1UCYK 1GJ9B 1O3BA 3SU3A 1IQJA 1EX3A 1BHXF 1WYKA 3S9AA 1O2XA 2G5VA 5L30H 1E0FD 1P02A 2FOGA 6GCHG 2ZDMA 5E0GA 2FOAA 1OWHA 3GY2A 2I6SA 2ANWA 1QB6A 2FWWA 1GBIA 1ZMLA 1AB9C 1J16A 1RTKA 1ELCA 1GBFA 4OS1A 4CRAA 2OINA 1AQ7A 4ZAEA 4NCYA 4U2WA 4GLYA 1GJ8B 3BG4B 1QRZA 4DIHH 1O3OA 3ATKA 2UWOA 1NFWA 2XBVA 2P8OB 1ZSJA 4ABHA 4IN2A 1V2UT 1MQ5A 1O5EH 4DVAU 1W2KH 4BXSA 3U98H 1AKSA 3URDA 1KSNA 1Y3VA 3B8JA 4FUCA 3TJNA 3AW1A 1DUAA 1UMAH 1CT0E 1GMCG 1MCVA 5A09A 3TGJE 2ANMH 1Y59T 2VWLA 1TPAE 5EGMA 4BAKB 1P2JA 4GCHF 3TJUA 2BHGA 4XSKU 3SV6A 5EQQA 2FLRH 1V2WT 6ESTA 4GCHG 4YM9A 3BEFB 3M3SA 4YLQH 3BG8A 1UO6A 2VNTA 1BRCE 1CSOE 3OX7U 1CHOF 2ODQA 2BQ6B 1DT2A 3BTHE 3E3TA 3QGJA 3PM3A 4B2BA 5DP5A 4B75A 3ESTA 1MKXK 1CHOG 2BLWA 1LHEH 3GCTG 1BCUH 4I8HA 4B2AA 2ODYB 2THFB 1TNHA 4E7NA 1SQOA 1IQGA 1RXPA 2CGAA 3RXMA 1S6HA 1YC0A 1GHXH 3QO6A 8KME2 1NC6A 1RIWB 1GJ7B 5EPNA 5L2ZH 3ZZ5A 4WH6A 1L0ZA 2IOTA 3ZVBA 1EB1H 1O3FA 3VB5A 2H9EH 2B8OH 2Z3EA 1CE5A 1K21H 1P2QA 1BJUA 2BVRH 3BTTE 3UOPA 1Z8RA 3IG6B 4I8LA 5TCCA 1BTHH 4ABJA 6CHAB 1NFUA 2FLBH 1WU1A 3TPIZ 1C1VH 1HV7A 4AYVB 1C1PA 1EZQA 1TB6H 1IHSH 1UHBA 1P04A 2ZEBA 2O8UA 1GDQA 1TQ0B 4JZIA 4BNRA 1SGIB 5DP9A 2H5CA 3A7ZA 4WMDA 1EZXC 1V2VT 2BOKA 1TMUH 1SOTA 2BVXH 3LH1A 4ZROA 2CXVA 2ZFFH 3VGCB 1MUEB 3SV8A 2YNBA 2GVFA 2BDIA 3MH5A 3OYPA 3TITA 1ESBA 2GZ8A 1TOMH 1DDJA 5EG4A 1GJDB 1P09A 4A1XA 3UR9A 4FUFA 2Q6FA 2GV6A 3SU6A 1GI3A 1T4UH 4AB8A 3LJOA 2FESH 1H9IE 1MKWH 4X6NA 1VCWA 2D8WA 1WQVH 1ELBA 2JKHA 5EQRA 1FN8A 1DM4B 2W7SA 2QF0A 1UVUH 4BTTB 3BEIB 2H9HA 4GUXA 1FJSA 4WY3A 1CGJE 1XVOA 3E8LA 4CH2B 2ZDNA 3KQCA 3VXEH 1GHVH 4B1TA 1GHBF 4ZHAA 1ZMJA 4K8YA 3BF6H 3LGTA 3U1JB 1PQ5A 1QA0A 1VJ9U 4NG9H 4HGCA 3U8TH 1GDUA 1FV9A 3S9BA 3M37A 4KTCA 3A82A 4NIWA 1RTFB 1FDPA 1AI8H 3JZ1B 1O5DH 1GBAA 3ZZ8A 1VJAU 2FPZA 3RC5A 1BBRE 5FAHA 4XFQA 1IQHA 5DKMA 2RA0A 3GCOA 4INHA 1FPHH 2M5TA 4CRDA 1CGIE 1O3EA 2FOHA 3T5FH 3SI3H 2HOBA 1O2UA 3A81A 1F5RA 1J14A 1O2TA 1FY3A 4K1EA 2UUJB 2UWPA 1GVLA 3GY8A 3TK6A 5G4BA 1BBRK 3EA7A 1EAWA 5T6GA 1C1SA 2OCVB 1PPGE 2SFAA 5FX6A 1C5XB 2FOCA 3BIUH 1O5FH 1DVAH 5DGJA 4XBCA 1C1RA 1DY9A 4YOJA 2BQWB 1QB1A 4CBNA 1SQTA 2C93B 4CR9A 1AFQC 3UUZA 3M5OA 1FXYA 4AN7A 2ODPA 3K6ZA 4TWWA 1AE8H 1BZXE 1N6XA 4JYTA 4MPVA 1K28D 2OLGA 5PTPA 1AZZA 4Q7ZA 1GVZA 1AZ8A 4ISNA 1UVPA 3AVZA 1ZHRA 2D26C 1O2VA 4NIXA 4X1QU 2JH0D 3UNRA 1YPMH 3DFLA 4DW2U 1O35A 1T8LA 1ANDA 1C5NH 2KAIB 3SV9A 3E6PH 1T32A 2D1JA 1F92A 2BY9X 1GHAF 2G00A 1KXEA 2J38A 5C1UA 1T7CA 1SGDE 2R0KA 2ZFRH 1FY8E 2PHBA 1C5QA 3PMHB 3A8AA 1Y8TA 3RLYH 1SGFA 2A7HA 4NA8A 1PQAA 1JOUB 2ZCLP 3A86A 1NT1A 1GHZA 5FBEA 1ELFA 5FPSA 4FUIA 4R8TB 3GOVB 5FHTA 3LU9B 1QJ6B 4X8SH 1JRTA 2UUKB 3RXPA 2GCTB 1NFYA 1EP5A 2O8WA 1ZSKA 1GBJA 1SGRE 1TGTA 5B6OA 3P17H 4NWKA 1O2WA 3ZVEA 1SGTA 3T25A 4FVBA 4ESTE 2GV7A 3OY5U 1F7ZA 1GI5A 1TONA 4X0WU 5HYOA 4RKOB 2ZGJA 2HNTE 1QTFA 4YOGA 3MO3A 2J94A 1TPSA 4BXWA 3LGVA 4DURA 1P03A 3A80A 1MTNB 3HKJB 1JRSA 5K7RA 5LPRA 2ZHFH 1C9TA 1A0LA 1GI7B 5JBBS 1INCA 3SUGA 3IITA 4INLA 1LVBA 8GCHF 2R2WU 1L1NA 3RXGA 2XCFA 1ELAA 1OX1A 2ZNKH 2J9NA 1TGCA 4AB9A 8GCHG 1V2KT 3HK3B 5FPYA 1AD8H 3A7TA 3BEUA 1L1JA 2DE8A 3BTEE 4WJG2 1OXGA 1H8DH 1VITG 2GTBA 1P05A 2JH5D 1FUJA 3SUEA 4X6PA 3TGIE 4M7GA 2BD7A 5IYTA 1AKSB 4DT7B 4FU7A 5HMAA 2XRCA 1ZTKA 1TGSZ 2FX6A 2XC5A 1P57B 2GMTB 1TNGA 1S0RA 4O97A 2F83A 1EPTC 2B7DH 3N7OA 3MMGA 2BTCE 3ZZ3A 3GCHC 1ID5H 1HAGE 1FMGA 1BTXA 1UTPA 2QXGA 1A0JA 1RS0A 2FI5E 1WTHD 3VEQB 1GJ6A 1O2PA 1TX8A 2Z6BD 2Z7FE 1UVSH 3PTNA 3BTQE 5ESBA 1RJXB 2ASUB 3T26A 4B74A 1O2RA 1QJ7B 1YKTA 3E0PB 2VIVA 1A5HA 3RDZA 1WUNH 1HAPH 2VWOA 3EA9A 2G4TA 1V2ST 4ZUHA 1JIMA 4A1VA 1TWXB 2XYAA 1KLIH 5GIBA 4DOQA 5K0HA 3BTME 3VB6A 5J4SA 2G4UA 3P8GA 2ZG0H 2ZU1A 2Y80A 1ARCA 2V3HH 1YGCH 4UONA 1A2CH 3SGQE 1QL8A 3VXFH 3GDVA 4AORA 1O34A 1Y5BT 2C90B 4MNXA 1U6QA 1C5PA 1CBWC 3BTGE 2QC2A 2AMQA 2Y82A 8LPRA 2VWMA 4NZQA 3TH4H 5DJ7A 3P92A 1K22H 3ZVCA 1CT4E 1S85A 5H4IB 3S7HB 2ZI2H 4K3JA 2ZPSA 1LPZB 3E0NB 1IAUA 3I78A 1BTPA 3JZ2B 1LHFH 1LO6A 3BSQA 4O9VA 4Y8XA 4AGJA 3A83A 2LNCA 2XWAA 1YCPK 1SBWA 3CS0A 1ZJDA 4AFSA 1UHBB 2XTTB 2WUCA 3MU5A 2QXIA 2Y7XA 1T8MA 2VVCA 5F8TA 1MTSA 5A8XA 1C2GA 1C2IA 1NFXA 4UD9H 2NU2E 4CRBA 1O3KA 2C3SA 3GDSA 1LVYA 1K1PA 1C2EA 1V2JT 1YM0A 4ZKOU 1C2FA 4WVPE 4Q7YA 2R2MB 1O3AA 1Y5AT 5FX5A 4I32A 5A0CA 1H9HE 1HAZB 3MFJA 2VINA 3PLKA 4GSOA 2R3UA 2ZQ1A 2Q6GA 4ABDA 1C1QA 3O8CA 2CHAC 3VB4A 1NRSH 1SI5H 1ZPCA 5E2PA 2ZC9H 5JB8S 1W12U 1P2NA 2QV1A 4CH8B 1AUJA 1C4V2 2SGAA 3T2NA 5A0BA 1BRAA 1A46H 3OTJE 3RMNH 3RXHA 1AU8A 3A7VA 2WYJA 3BV9B 1GMHG 1SQAA 4ABAA 4LZ1H 1HAHH 2P8OC 4Y11E 2FXRA 1TBRH 1EJAA 5DP8A 1HPGA 1W7XH 1XKBC 3STJA 1AVXA 2PUQH 1C1TA 5ETXA 1NROH 2ZIQH 1FY4A 1PYTD 2EI7A 3ZZAA 2ZDAH 1Y5UT 2Z9KA 1YF4A 2BX3A 1IOEA 2JETB 3HKIB 4OGXA 3SHAH 1UCYH 2ZPQA 4YESB 1PQ7A 3W94A 2CMYA 3PMBB 2WUBA 2Y5GA 3UFAA 3LGWA 1SLXB 4BAHB 1C2DA 5EW1H 4AFZA 1GMDF 1SGEE 2B0FA 1QA7A 2G51A 1T8OA 2VIWA 1Q2WA 4FVDA 1GMDG 3ZZBA 1KIGH 4U32A 4CHAB 1PPCE 2WV5A 3W95A 1JIRA 2GZ9A 1D4PB 2QGRA 4AYYB 2SGPE 5DO4H 1RIWC 3C27B 3OU0A 2PKSB 1O36A 1QRWA 4ZHMU 1DICA 5EXLA 3RXJA 1CO7E 3SN8A 3FANA 4OS4A 3U8OH 1K2I1 5FPTA 4MQAA 1C5OH 1FPCH 1HGTH 4MNWA 4IBLH 1BITA 5C3NA 1RRKA 4JZFH 1Q3XA 4Y8YA 3AW0A 3LGUA 7LPRA 1SHYA 4O3TA 1W10U 1HJAC 3BTWE 1SGPE 4KTSA 3QLPH 2PTCE 1MKXH 1SLWB 3M7TA 1FAXA 4K8BA 2JH6D 1P10A 3VGCC 1TIOA 1D9IA 1ZOMA 4Z0KA 3ZYEA 4WMEA 1C5RA 2SGDE 2B5TB 2ZPRA 2VGCB 3QX5H 5GPIB 1TQ7B 3UTUH 4NIYA 2FOMB 2AFQB 3U69H 1EQ9A 4VGCB 1O2QA 1UTKA 2Z9GA 4K2YA 3PYHA 4Q2KA 5C1YA 2G8TA 2A5AA 1QRXA 1XUKA 3MU0A 1YYY1 2WPJS 1YPEH 1T31A 1OWEA 3F9GA 1XUGA 2J2UA 4CRCA 5JBCS 2YNAA 3TNSA 1GG6B 1TA2A 2XC4A 1F0TA 3V3MA 2V35A 3RXTA 3HK6B 1PPEE 3MH7A 1P01A 2P95A 2SNVA 2VJ1A 2W5EA 3LC5A 3WY8A 1KLJH 4GAWA 4YT7H 2FS8A 2FP7B 1N6YA 3KF2A 5DPAA 1HDTH 1QHRB 2PKAA 3EAJA 4A6LA 3PO1B 3A89A 5JBAS 2UUFB 2YOLA 4O03A 4FUEA 3RXFA 1EOLA 3V12A 1HJ8A 1JMOH 1NTPA 2WYGA 4LOYH 1IQNA 3NZIA 1QQUA 5T6DA 1C1UH 1W8BH 1T8NA 5E2OA 1FAKH 2Y81A 2GT8A 2PSYA 1GJAB 2FM2A 1O38A 1L4DA 1IQMA 4X1NU 1GI0A 1ZPZA 2WPHS 1HAXB 3SI4H 2OC7A 1GI9B 2BDHA 1F0SA 1UTQA 1XX9A 2QXHA 2ILNA 1HIAA 1ZGIA 1ELVA 3V13A 3LH3A 2SGFE 4DCDA 4UEHH 4MNYA 2FI4E 2GD4B 2ZDLA 1ZPBA 1O31A 1IQKA 3TK9A 4GHQA 1TFXA 3TIUA 6LPRA 1A1RA 2EI8A 1LVOA 1C2KA 4E05H 3AAUA 1O3JA 1OSSA 1IQLA 1G36A 4SGBE 1C5MD 9LPRA 1K9OE 4JMYA 3M7UA 2FIRH 4I8JA 1UJ1A 1WOFA 1O2HA 1V2RT 1JXPA 1BBRH 1C5WB 2NWNA 1TBQH 1GI4A 1EAIA 5A0AE 3RM0H 1BTZA 2XCNA 3MO9A 1OP8A 2TGDA 2Y6TA 3DHKH 1YPJH 3RXIA 3SNAA 4X6MA 1ZJKA 1GVKB 1WBGB 4J1YA 1FNIA 3DFJA 1THSH 2AMDA 1YCPM 2BLOA 2HWLB 2ZFTA 2PW8H 4X1SU 3U8RH 4KGAA 1GBEA 2TGTA 2A1DB 4KELA 3DA9B 1O3DA 3EGKH 2FTMA 1BTYA 4Y0YE 2TBSA 2BX4A 2Z9JA 1GI2A 2VIQA 3S69A 5DP3A 4KTUA 1TALA 4XBBA 4JYVH 5C20A 1G3EA 1AB9B 2ZGHA 1GHBG 3NWUA 1TNLA 2ZU5A 1S81A 3KIDU 4D9RA 2B9LA 3SJ9A 3ATWA 1C5LH 1SMFE 3F68H 3A8DA 2C8WB 4F49A 4XOJA 1ZLRA 1CGHA 1BMAA 1BTUA 1GGDC 4NFEA 3SHCH 1GBTA 1A61H 1EJMA 1HCGA 3KGPA 3RXOA 5L6NH 1C4U2 2AIQA 2QY0B 1C5YB 3QZRA 4PROA 2GZ7A 1OS8A 1OWKA 1VR1H 4X8VH 1EPTA 2VH6A 4IN1A 1QURH 1MCTA 4X8TH 2FI3E 5I46H 1Y3UA 4BAQB 5L2YH 1O3GA 2G5NA 3GICB 1IQEA 1GWAA 8ESTE 5F8ZA 2FZZA 1GBBA 2H1UA 1CA0C 4AX9H 1HXFH 3M3VA 1PJPA 2A4GA 2ALPA 1G9IE 4Y7BA 1DSTA 1S6FA 1Y3WA 1JBUH 4JZEH 2ZHEH 1Z8JB 3MH6A 1W13U 1C2MA 1XUFA 3F9HA 1XKAC 5T6FA 3SU5A 1QQ4A 4H4FA 4AG1A 4IC5A 3FFGA 3M3TA 3M36A 2AGGX 1FN6A 5C2ZA 1NRRH 3FZZA 3RXRA 3T27A 5DG6A 2VH0A 2GCHF 2WV4A 1H1BA 4AFUA 4CRFA 3A85A 1TAWA 4LK4A 1LMWB 2PUXB 4MDSA 2Z9IA 3B23B 2GCHG 3KN2A 1LQEA 1TMBH 5EODA 2ANKH 3VB3A 1A7SA 1PYTC 3S0NA 1MBQA 3ATIA 3LJJA 1E35B 4BANB 1D3DB 2F9OA 1GHAG 3NXPA 1KDQA 2A4RA 3M5NA 1DLKB 1BJVA 1EXFA 4JK5A 1C5VA 3MWIU 4HFPB 4KKDA 2A5IA 1FLEE 2XWBI 3ZVDA 3SNDA 1BMNH 3PWCA 1TRNA 4NSYA 3KQEA 1V2QT 4JCNA 3U1IB 1DWBH 2AGIX 2SGQE 1D3QB 4I33A 4OS2A 1GDNA 1HXEH 2NU3E 1ZZZA 3Q76A 2XBYA 5AVDA 2R9PA 1PFXC 4ABIA 1BDAA 1ZSLA 1M9UA 2BDBA 3NPSA 1BMLA 1S82A 1E36B 1S83A 2ZGCA 1Z1IA 3MNSA 1V3XA 3UWIA 1XXDA 1SLVB 3E90B 2VIOA 4K69A 1MTUA 4YOIA 1AGJA 2Z9LA 3RXEA 3UQVA 5C5OA 1V2OT 1VITH 1AMHA 1THRH 5T3HA 2ZKSA 1GHYH 3QDZB 1A3BH 4UFFH 1MU8B 1O3IA 1LQDB 1THPB 1YPKH 2A7CA 1BT7A 1O0DH 1ZRKA 5I25A 3KCGH 1G3DA 1BMMH 1AVWA 1K1OA 1ETSH 1YCPH 4GHTA 2A7JA 2OQUA 1SR5C 2BD4A 4JYUH 1CVWH 4X2XA 3SU4A 4TPYA 4BTIB 3A7XA 5EXMA 2ZTXA 3LC3A 4TPIZ 5ABWA 1EJNA 1S0QA 3TLOA 1BUIA 2Y5HA 1OWJA 2PLXA 3B9FH 3RU4D 3PROA 1UTJA 2WPLS 3C1KA 4ZH8A 1PPHE 1N8OC 2R3YA 2XBWA 2PKAB 1BQYA 4AZ2B 1WAYB 1EAXA 1W3CA 3EDXB 1O37A 4X2VA 4ASHA 5LPEA 2HRVA 3S9CA 1DSUA 3A7YA 1UK2A 5GXPA 4R0IA 2ZGXH 3NCLA 5LGOA 3ZV8A 1DUEA 2XBXA 3MNXA 1C5TA 3SNBA 1GBKA 1P2MA 1H9LB 1BHXB 1MAXA 1E34B 1G30B 2AEIH 1V6DA 1WV7H 1EB2A 2VVUA 2C8XB 3QTOH 4NFFA 1FZZA 4CBOA 1O2IA 1DOJA 1UTNA 1HIAB 1ZHMA 1NU9A 2PKSC 2FYRA 1QIXB 3CS7A 1B5GH 2PWXA 3UOUA 2K1QA 1G2MA 4AOQA 1TX6A 1F5KU 2ZU3A 3TU7H 2IJOB 3UNSA 4ISLA 3EA8A 4WMFA 1FY1A 4D7FA 1TPPA 2W7UA 5DP7A 1MH0A 4NZLA 2EC9H 2ZO3H 3BTKE 2RA3A 1BOQA 2BD3A 3RXDA 5HM9A 4FUBA 4LXBH 3RXKA 1SFIA 1TBZH 2H2ZA 3ODDA 1WQSA 1ACBE 2H9TH 3RLWH 3GY7A 4RSPA 1C2HA 4ABEA 1UTOA 2PTNA 1ABIH 2O8TA 1P12E 3M35A 1PQ8A 2P16A 3BTFE 1AWFH 1G3CA 1P2KA 3O8RA 3ENSB 4NA9H 5A2MH 4NGAH 4IMQA 4MVNA 3E1XB 1RD3B 1L2EA 3UQOA 3F6UH 1FY5A 3KEEA 1KXAA 2VGCC 4OGYA 1ABJH 2UWLA 5JBTA 4K5ZA 4MTBA 1YLCA 1AVGH 1DLEA 4IMZA 5TCAA 3DD2H 4VGCC 2ZFQH 1QGFA 5JB9S 1QNJA 3ITIA 1KTTB 2Y5FA 3BG4C 4A7IB 2ESTE 3M61U 5FCKA 1FQ3A 4HI3A 2PGBB 4UDWH 5EOKA 2TPIZ 2J95A 5J4QA 2HGTH 3SJIA 1O5AB 3RC4A 2GDDA 1XUHA 3L6PA 3PV4A 3O8DA 1GCTB 1Z6EA 1GG6C 2ZU4A 3SORA 4Y0ZE 2ZHQH 4I31A 1GBHA 2QCYA 3A88A 2AS9A 1C4Y2 3L33A 3SQEE 4BAMB 4F4OC 3TGKE 1QBNA 1J9CH 1D3TB 5F6MA 4DIIH 1K1JA 1DFPA 2H6MA 5CMXH 2BXUH 4ZKSU 3GISB 3T62A 3GCHB 3S7KB 1A0HB 1Z8IB 1A5IA 1F0RA 1KXBA 1LTOA 1HAIH 3RU4T 1ANBA 1NO9H 4O3UA 3H5CB 2DE9A 1O33A 4HZHA 1G2LA 1MQ6A 1HB0B 1ZRBA 1J15A 2TGAA 1C1WH 1NESE 2H5DA 4YO9A 3QWCH 1S5SA 2A2QH 3PB1E 1QL7A 7KMEH 1LPKB 1WSSH 4CR5A 4D76A 2FDAA 6CHAC 7GCHF 1J8AA 2FYQA 3Q3XA 4AG2A 4XDEA 1OWDA 1MBMA 3RMMH 4ABFA 2SNWA 5EXNA 2CV3A 1DX5M 1WTGH 5FCRA 3TJVA 1DXPA 1P3CA 2GGVB 3PMJA 5GDSH 3PMAB 1CBWB 1MZAA 3ZZ4A 1B0FA 1OKXA 5JPMH 2SGEE 2J92A 3SNCA 1ANEA 1CA8B 3UNQA 5E8EH 3MOCA 3SV2H 1LHGH 1O2YA 5HGGA 3HATH 1KDQB 1OP0A 1O5BB 3GYMA 4FUJA 1LVMA 2EI6A 1GJ4H 4U30A 3A7WA 1VGCB 1NRNH 3R0FA 4JK6A 4K1TA 2O9QA 1TABE 4ZMAH 2P3FH 1RTLA 3BIVH 1TYNA 1C1MA 2OUAA 3BTDE 3GCNA 3U9AH 2AIPA 4SGAE 3T29A 1JWTA 2ZCKP 3P8FA 4Q80A 4ZXXH 1V2PT 1ELEE 1O2JA 2ZA5A 2ALVA 2A31A 4BOHA 4Y7AA 1O5CB 1D6RA 3UWJH 3IWMA 1GBDA 1OPHB 5LH8A 4CREA 1S84A 1OOKB 2A5KA 2CHAB 3P70B 1H4WA 3NK8A 2A45B 2XXLA 3KQDA 1HAVA 4D9QA 1G37A 2ZTZA 2ANYA 3LOXA 5HXFA 5JDUB 1ETRH 4WXVA 4UE7H 1DWDH 1KXDA 1O32A 2QA9E 1SPJA 1ZMNA 1O3NA 1AY6H 1GMCF 1G3BA 1PPFE 2D2DA 4B71A 1AN1E 1YP9A 4ISOA 4XE4A 3TH3H 1O2SA 1MMJN 1FIZA 3SZNA 3V7TA 4FU9A 3RC6A 3BN9A 2ZCHP 4E06H 4NSVA 2BDYA 1NRPH 2ZQ2A 2XW9A 1C1OA 1NM6A 1O2KA 3SV7A 1MU6B 2BXTH 2F9UA 4H42U 1Z6JH 5GWZA 3ZVGA 1TA6A 3QGNB 5FXLA 1QCPA 1O3PB 2QIQA 3GCTF 1GCDA 2BZ6H 1UK4A 3SGBE 2OP9A 1QB9A 1C2JA 3KNXA 1V2LT 1NU7B 1KYNA 3RXCA 3ZZ9A 2A32A 1ZTJA 1TE0A 3GY5A 1HNEE 1NRQH 2RDLA 2J4IA 1C5SA 5CHAB 3MH4A 1ARBA 2W3KA 1AFEH 4TY7A 2ZDVH 3LPRA 1QR3E 2HALA 2FX4A 2HLCA 1XVMA 1C2LA 3GY4A 1HYLA 3RUOA 4FU8A 1UTMA 3RXQA 2Q6DA 1W0ZU 4DY7B 4DJZB 2V3OH 1HRTH 2QN5T 1DXWA 1O2NA 1HJ9A 1TRMA 1QBOA 3D62A 3DUXH 2P3TB 1ETTH 4TYDA 1IHTH 2Z3CA 2BY5X 3SW2B 1P06A 3R3GB 1HJAB 1GHWH 1EUFA 1J17T 5HM2A 1K1MA 2BD9A 2WPIS 1ELDE 1SGNE 2PV9B 1UTLM 3QN7A 3Q3YA 3RP2A 1OP2A 1XXFA 3K6YA 1P3EA 3LGYA 4ZXYH 2GCTC 1VZQH 2GKVE 3QZQA 1O2OA 1GJ5H 3DT0H 2OC8A 5ESTE 4MPWA 1LDTT 2GP9B 2BLQA 2F91A 2J34A 1DE7H 3EQ0H 9ESTA 1SGCA 2G81E 1P11E 1KXFA 3A87A 3D65E 2QYIA 5TJXA 5C1XA 4AFQA 2BB4A 4FUHA 4MNVA 1MTNC 4GVUA 1EATA 1P0SH 2NU1E 3EE0B 1FONA 3CENA 3H7OA 2F9VA 1IQIA 1YPHC 4Y76A 2PGQB 5LPFA 1QFKH 4WWYA 2OD3B 1K1LA 1EOJA 1EAUA 5EW2H 3AASA 2WPMS 4DG4A 4ZKNU 1ELTA 3LONA 2W26A 2PSXA 2C4FH 3P6ZB 1E37B 2ZTYA 3HGPA 3SU0A 1NN6A 1TMTH 4MPUA 1VCQA 4BTUB 2P3UB 3SJ8A 4X1RU 3D23A 2FOEA 2GMTC 3CP7A 2BYAX 2QXJA 1Y3XA 4FUDA 2AERH 4IGDA 3ZZDA 1TNKA 2AH4X 2BVSH 2G52A 4YT6H 3QTVH 5AF9H 2VB0A 1SGFG 1ZR0A 4Y79A 1F0UA 4NA7A 2FODA 2A4QA 1HAYB 1EASA 1O3LA 3LIWA 4QT8C 3MYWA 1EP6A 2PFEA 4WXIA 2ZHDA 3LGIA 3NKKA 1DS2E 1SC8U 2IPHA 3PWBA 2V6NA 2I6QA 2ZGBH 2PR3A 1GI1A 1MKWK 3MTYA 1AUTC 1TOCB 2BOHB 3RXAA 2Z3DA 1C1NA 2VU8E 3ZVFA 3UIRA 1UVTH 1CU1A 1DWEH 1AHTH 1P2OA 1AWHB 1P9UA 2P94A 1MD7A 1MTWA 1SL3A 2AMPA 2OTVA 2ZF0H 2ZZUH 5AFYH 2G55A 3TJOA 1V2TT 5DK1A 1MZDA 3RXBA 3RXUA 4X1PU 1KY9A 2FOBA 1TGBA 2UUYA 3SNEA
chains in the Genus database with same CATH superfamily
2OQ5A 3SU2A 2ZDKA 1SVPA 2GDEH 4HTCH 2HNTF 5AFZH 4IW4E 4M9FA 2FO9A 3E91A 2C8ZB 4FUGA 4RKJB 3SUFA 5EJLA 3Q77A 4IC6A 1GI6A 2BM2A 5C67A 3I77A 2EEKA 1ANCA 1P8VC 3ELAH 3MNBA 1TNJA 1SOZA 1K1IA 1YBWA 1LPGB 2KZ4A 3MI4A 5DP4A 2A4OA 3UY9A 1GBCA 1N1LA 1O3MA 3SU1A 4ZHLU 5BPEA 2ZU2A 3MNCA 4OS7A 4D7GA 4JZ1A 5JYIA 2NU0E 1F5LA 1Y3YA 7ESTE 1GBLA 3EE7A 2M2AA 5A8ZA 2BDCA 2BD8A 3GY3A 1IQFA 3P8NA 3M5LA 1AE5A 1LKAA 1X7AC 4GPGA 3Q3KA 2FS9A 1LHDH 3ODFA 2STAE 1ESTA 1GPZA 1O5GH 4RT0A 3VB7A 4J2YB 1W7GH 4NWLA 1QJ1B 3STIA 4E7RG 3H7TA 1SSXA 2BY7X 3QK1A 1K1NA 3AAVA 2A0QB 3T28A 4B2CA 2QF4A 5A8YA 1EKBB 2ZHWH 3DCLA 1TRYA 3LDXH 5C5NA 3MU1A 3RXLA 4OS5A 5C0TA 3RMOH 4AGKA 3FZDA 2VVVA 3P95A 5FBIA 5CE1A 3GY6A 2Y7ZA 4H6SB 3HPTB 2CN0H 3O8BA 4A1TA 4ISHH 1GCTC 4U01A 4Y6DA 1RFNA 3SQHE 1GGDB 3HGNA 5FL7D 3SUDA 3OSYA 1HAVB 3FP7E 1SGYE 1NS3A 4B76A 3M7QA 1RGQA 1VITF 2KCAA 3FP8E 2F9PA 2ZP0H 5SGAE 2JETC 4UFEH 2IN2A 4IS5A 1DWCH 2ZFSA 2WV9A 2QAAA 1Z1JA 2TIOA 4ZKRU 5E0JA 4K1SA 2XNIA 3NUMA 4XD7D 1KLTA 4XBDA 5EU8A 1QY6A 2CF9H 4X8UH 1XMNB 1TX7A 1ZYOA 1CA0B 3M5MA 4F48B 1AFQB 1W0KD 1MTVA 4A92A 2XNDD 1H8IH 4DGJA 2WINI 3KQBA 4B73A 4CHAC 4THNH 1DY8A 1QL9A 3Q00A 4Y10E 1E38B 2GX4A 3SOSA 2BDAA 3OAAD 2AYWA 3ZYDA 3FO8D 3LT3A 1L4ZA 4NIVA 2F9BH 2O8LA 3F9FA 3ZZ7A 4I7YH 1KTSB 2BMGB 3ZZ6A 4CRGA 2STBE 3L3TA 5GCHF 3VFEA 2VWNA 1GI8B 1B7XB 3UREA 1UK3A 1ORFA 2CF8H 3SO3A 1SLUB 3UPEA 1ESAA 5GCHG 5EPYA 3URCA 5C17A 2JJ2D 3F9EA 3SGAE 2GT7A 3ATLA 4Z6AH 1DPOA 2C8YB 2BLVA 3WWBA 2OBOA 3SJOA 3KL6A 1ZHPA 3E16B 1O2ZA 1O2GH 1C9PA 1SHHB 2OXSA 3TNTA 1EZSC 1BRBE 2HPPH 3UR6A 3OY6U 3PRDA 1FIWA 4Q7XA 3D49H 1O30A 4I8GA 2O8MA 1YLDA 3PLPA 1SG8B 1G32B 1BRUP 3MU8A 3A84A 4BAOB 1HBTH 1OYTH 3H09A 4INKA 1V2MT 4ABBA 3I29A 1NZQH 1XUIA 3GDUA 4TSFD 2LPRA 2EA3A 1VGCC 1HUTH 1T4VH 1TPOA 1C5ZB 4YZUA 4WH8A 4MLFB 2P93A 2XC0A 4JZDH 4X6OA 2OBQA 1VCPA 1SB1H 4MG3A 1PPBH 1MD8A 3KHVA 2OC1A 1PPZA 1FI8A 1CQQA 2EQNA 2VIPA 3A8CA 1HAOH 1SFQB 1A5GH 1WCZA 1A4WH 2BY6X 2V0BA 1OYQA 1YPGH 1TGNA 1GJCB 1O3HA 2HVYB 1LKBA 4TWYA 1GMHF 3PTBA 2QF3A 1QBVH 2WPKS 3F1SB 3RM2H 2BZAA 4K60A 1XM1A 2ZECA 2FOFA 4ISIH 1O2MA 1D3PB 3PO1C 2HNTC 3MHWU 1BIOA 5GJ4B 5E0HA 1UW7A 5EQSA 1L1GA 3QUMP 3FP6E 1BTWA 2BD2A 2BQ7B 3ATMA 2HPQH 1A3EH 1EZUC 2Q1JA 2TRMA 2DUCA 2NU4E 1EPTB 4MPXA 1UVOA 5DP6A 1V2NT 1SGQE 1N8OB 2FTLE 2ULLA 1LHCH 1Z8GA 3MO6A 1P2IA 1D6WA 4ABGA 2HVXA 3V0XA 1O3CA 2K0QA 4H6TA 4Y71A 3RXSA 1ELGA 2P59A 2BD5A 1HLTH 4YTAA 2BY8X 5F03A 2JJ1D 4KP0A 5F8XA 3TK5A 3EYDA 3SJKA 4TY6A 3RU4E 5BRRE 3G01A 1W0YH 2R0LA 1AIXH 1GJBB 2V3MA 3GYLB 1OWIA 2HLDD 4FXGH 1Z7KA 1GL1A 4LZ4B 4I8KA 2W3IA 1O2LA 2KAIA 4A5TS 3ZVAA 3ZV9A 3FAOA 2AGEX 5IDKA 1P9SA 1W11U 1NY22 4X2YA 5CHAC 7GCHG 2ZWLH 3RXVA 3K2UA 2F3CE 2FEQH 3PLBA 1DANH 1O39A 2A2XH 4P02A 4YLUA 3TH2H 3LKWA 1CHGA 1AO5A 1C5UA 3MU4A 4Y8ZA 2OC0A 2TGPZ 1MAYA 1BA8B 1LCYA 4WF8A 4RN6A 3SBKA 3TVJB 2VIDA 5F53A 5AHGH 2RCEA 1TNIA 3A8BA 2IJD1 3RMLH 2ZFPH 3VPKA 2RG3A 1UCYE 2Z94A 1ZGVA 1NPMA 2CJIA 3K65B 1YWUA 4X2WA 1XUJA 1FX0B 1W14U 4OS6A 1CT2E 1GL0E 4UFDH 1F2SE 1B0EA 1ZTLA 2BDGA 1KXCA 1DITH 1YPHE 1YPLH 1Q31A 1GBMA 2F9NA 1HFDA 2FMJA 3K9XB 3P8OA 4UFGH 4D8NA 1Z71A 1TLDA 3ZZCA 3FVFB 1BB0B 6GCHF 1UCYK 1GJ9B 1O3BA 3SU3A 1IQJA 1EX3A 1BHXF 1WYKA 3S9AA 1O2XA 2G5VA 5L30H 1E0FD 1P02A 2FOGA 6GCHG 2ZDMA 5E0GA 2FOAA 1OWHA 2QF5A 3GY2A 2I6SA 2ANWA 1QB6A 2FWWA 1GBIA 1ZMLA 1AB9C 1J16A 1RTKA 1ELCA 1GBFA 4OS1A 4CRAA 1WDIA 2OINA 1AQ7A 4ZAEA 4NCYA 4U2WA 4GLYA 1GJ8B 3BG4B 3N99A 1QRZA 4DIHH 1O3OA 3ATKA 2UWOA 1NFWA 2XBVA 2P8OB 1ZSJA 4ABHA 4IN2A 1V2UT 1MQ5A 1O5EH 4DVAU 1W2KH 4BXSA 3U98H 1AKSA 3URDA 1KSNA 1Y3VA 3B8JA 4FUCA 3TJNA 3AW1A 1DUAA 1UMAH 3VG8A 1CT0E 1GMCG 1MCVA 5A09A 3TGJE 2ANMH 1Y59T 2VWLA 1TPAE 5EGMA 4BAKB 1P2JA 4GCHF 3TJUA 2BHGA 4XSKU 3SV6A 5EQQA 5DN6D 2FLRH 1V2WT 6ESTA 4GCHG 4YM9A 3BEFB 3M3SA 4YLQH 3BG8A 1UO6A 2VNTA 1BRCE 2OK5A 1CSOE 3OX7U 1CHOF 2ODQA 2BQ6B 1DT2A 3BTHE 3E3TA 3QGJA 3PM3A 4B2BA 3FKSD 5DP5A 4B75A 3ESTA 1MKXK 1CHOG 2BLWA 1LHEH 3GCTG 1BCUH 4I8HA 4B2AA 2ODYB 2THFB 1TNHA 4E7NA 1SQOA 1IQGA 1RXPA 2CGAA 3RXMA 1S6HA 1YC0A 1GHXH 3QO6A 8KME2 1NC6A 1RIWB 2CK3D 1GJ7B 5EPNA 5L2ZH 3ZZ5A 4WH6A 1L0ZA 2IOTA 3ZVBA 1EB1H 1O3FA 3VB5A 2H9EH 2B8OH 2Z3EA 1CE5A 1K21H 1P2QA 1BJUA 2BVRH 3BTTE 3UOPA 1Z8RA 3IG6B 4I8LA 5TCCA 1BTHH 4ABJA 6CHAB 1NFUA 2FLBH 1WU1A 3TPIZ 1C1VH 1HV7A 4AYVB 2GJGA 4TT3D 1C1PA 5T1VA 1EZQA 5IK2D 1TB6H 1EFRD 1IHSH 1UHBA 1P04A 5KECA 2ZEBA 2O8UA 1GDQA 1TQ0B 4JZIA 4BNRA 1SGIB 5DP9A 2H5CA 3A7ZA 4WMDA 1EZXC 1V2VT 2BOKA 1TMUH 1SOTA 2BVXH 3LH1A 4ZROA 2CXVA 2ZFFH 3VGCB 5CHBA 1MUEB 3SV8A 2YNBA 2GVFA 4YXWD 2BDIA 3MH5A 3OYPA 3TITA 1ESBA 2GZ8A 1TOMH 1DDJA 5EG4A 1GJDB 1P09A 4A1XA 3UR9A 3OTPA 4FUFA 2Q6FA 2GV6A 3SU6A 1GI3A 1T4UH 1S6LA 4AB8A 3LJOA 2FESH 1H9IE 1MKWH 4X6NA 1VCWA 2D8WA 1WQVH 5HIZA 3UAIC 1ELBA 2JKHA 5EQRA 1FN8A 1DM4B 2W7SA 2QF0A 1UVUH 4BTTB 3BEIB 2H9HA 4GUXA 1FJSA 4WY3A 2V7QD 1CGJE 1XVOA 3E8LA 4CH2B 2ZDNA 3KQCA 3VXEH 1GHVH 4B1TA 1GHBF 1H8HD 4ZHAA 1ZMJA 4K8YA 3BF6H 3LGTA 3U1JB 1PQ5A 1QA0A 1VJ9U 4NG9H 4HGCA 3U8TH 1GDUA 1FV9A 4Q4LA 3S9BA 3M37A 4KTCA 3A82A 4NIWA 1RTFB 1FDPA 1AI8H 2YMSC 3JZ1B 1O5DH 4RT1A 1GBAA 3ZZ8A 1VJAU 2FPZA 4HG6A 3RC5A 1BBRE 1SQRA 4XFQA 5FAHA 1IQHA 5DKMA 1WXRA 2RA0A 3GCOA 4INHA 1FPHH 2M5TA 4CRDA 1CGIE 1O3EA 2FOHA 3T5FH 3SI3H 2KFWA 2HOBA 1O2UA 3A81A 1F5RA 1YY3A 1J14A 1O2TA 1FY3A 4K1EA 2UUJB 2UWPA 1GVLA 3GY8A 3TK6A 5G4BA 1BBRK 3EA7A 1EAWA 5T6GA 1C1SA 2OCVB 1PPGE 2SFAA 5FX6A 1C5XB 2FOCA 3BIUH 1O5FH 1DVAH 5DGJA 4XBCA 1C1RA 1DY9A 4YOJA 2BQWB 1QB1A 2QE7D 1SQTA 4CBNA 3CNRA 2C93B 4CR9A 1AFQC 3UUZA 3NRLA 3M5OA 1FXYA 4AN7A 2ODPA 3K6ZA 4TWWA 1AE8H 1BZXE 1N6XA 4JYTA 4MPVA 1K28D 2OLGA 5PTPA 1AZZA 4Q7ZA 1GVZA 1AZ8A 4ISNA 1UVPA 3AVZA 1ZHRA 2D26C 1O2VA 4NIXA 4X1QU 3DSPA 2JH0D 2JDID 3UNRA 1YPMH 3DFLA 4DW2U 1O35A 1T8LA 1ANDA 1C5NH 2KAIB 3SV9A 3E6PH 1T32A 2D1JA 1F92A 2BY9X 1GHAF 2G00A 1KXEA 2J38A 5C1UA 1T7CA 1SGDE 2R0KA 1NBMD 2ZFRH 1FY8E 2PHBA 1C5QA 3PMHB 3A8AA 1Y8TA 3RLYH 1SGFA 2A7HA 4NA8A 1PQAA 1JOUB 2ZCLP 3A86A 1NT1A 1GHZA 5FBEA 1ELFA 5FPSA 4FUIA 4R8TB 3GOVB 5FHTA 3LU9B 1QJ6B 4X8SH 1JRTA 2UUKB 3RXPA 2GCTB 1NFYA 1EP5A 2O8WA 1ZSKA 1GBJA 1SGRE 1TGTA 5B6OA 3P17H 3PRBA 4NWKA 1O2WA 3ZVEA 1SGTA 3T25A 4FVBA 4ESTE 2W6JD 2GV7A 3OY5U 1F7ZA 1GI5A 1TONA 4X0WU 4OM9A 5HYOA 4RKOB 2ZGJA 2HNTE 1QTFA 4YOGA 3MO3A 2J94A 1TPSA 4BXWA 3LGVA 4DURA 1P03A 1YLNA 1MTNB 3A80A 1JRSA 3HKJB 5K7RA 5LPRA 2ZHFH 1C9TA 1A0LA 1GI7B 5JBBS 1INCA 3SUGA 3IITA 4INLA 1LVBA 8GCHF 2R2WU 1L1NA 3RXGA 2XCFA 1ELAA 1OX1A 2ZNKH 2J9NA 1TGCA 4AB9A 8GCHG 1V2KT 3HK3B 5FPYA 1AD8H 3A7TA 3BEUA 1L1JA 2DE8A 3BTEE 4WJG2 1OXGA 1H8DH 2VBCA 1VITG 2GTBA 1P05A 2JH5D 1FUJA 3SUEA 4X6PA 3TGIE 4M7GA 2BD7A 5IYTA 2J97A 1AKSB 4DT7B 4FU7A 5HMAA 2XRCA 1ZTKA 1TGSZ 2FX6A 2XC5A 1P57B 2GMTB 1TNGA 1S0RA 4O97A 2F83A 1EPTC 2B7DH 3N7OA 3MMGA 2BTCE 3ZZ3A 3GCHC 1ID5H 1HAGE 1FMGA 1BTXA 1UTPA 2QXGA 1A0JA 1RS0A 2FI5E 1WTHD 3VEQB 1GJ6A 1O2PA 1TX8A 2Z6BD 2Z7FE 1UVSH 3PTNA 3F0PA 3BTQE 5ESBA 1RJXB 2ASUB 3T26A 4B74A 1O2RA 1QJ7B 1YKTA 3E0PB 2VIVA 1A5HA 3RDZA 1WUNH 1HAPH 2VWOA 3EA9A 2G4TA 1V2ST 4ZUHA 1JIMA 4A1VA 1TWXB 2XYAA 1KLIH 5GIBA 4DOQA 5K0HA 3BTME 3VB6A 5J4SA 2G4UA 3P8GA 2ZG0H 2ZU1A 1VKYA 2Y80A 4B6EA 1ARCA 2V3HH 1YGCH 4UONA 1A2CH 3SGQE 1QL8A 3VXFH 3GDVA 4AORA 1O34A 1Y5BT 2C90B 2WHXA 4MNXA 2KCOA 1U6QA 1C5PA 1CBWC 3BTGE 2QC2A 2AMQA 2Y82A 8LPRA 2VWMA 2YMSD 4NZQA 3TH4H 5EJ1A 5DJ7A 3P92A 1K22H 3ZVCA 1CT4E 1S85A 5H4IB 3S7HB 2ZI2H 4K3JA 2AHME 5KGOA 2ZPSA 1LPZB 3E0NB 1IAUA 3I78A 1BTPA 3JZ2B 1LHFH 1LO6A 3BSQA 4O9VA 4Y8XA 4AGJA 3A83A 2LNCA 2XWAA 1YCPK 1SBWA 3CS0A 1ZJDA 4AFSA 1UHBB 2XTTB 2WUCA 3MU5A 2QXIA 2Y7XA 1T8MA 2VVCA 5F8TA 1MTSA 5A8XA 1C2GA 1C2IA 1NFXA 4UD9H 2NU2E 4CRBA 1O3KA 2C3SA 3GDSA 1LVYA 1K1PA 1C2EA 1V2JT 1YM0A 4ZKOU 1C2FA 4WVPE 4Q7YA 2R2MB 1O3AA 1Y5AT 5FX5A 4I32A 5A0CA 1H9HE 1HAZB 3MFJA 2VINA 3PLKA 4GSOA 5EJZA 2R3UA 2ZQ1A 2Q6GA 4ABDA 1C1QA 3O8CA 2LELA 2CHAC 3VB4A 1NRSH 1SI5H 1ZPCA 5E2PA 2ZC9H 5JB8S 1W12U 1P2NA 2QV1A 4CH8B 1AUJA 1C4V2 2SGAA 3T2NA 5A0BA 4Z1MD 1BRAA 1A46H 3OTJE 3RMNH 4DT4A 3RXHA 1AU8A 3A7VA 2WYJA 3BV9B 1GMHG 1SQAA 4ABAA 4LZ1H 1HAHH 2P8OC 4Y11E 2FXRA 1TBRH 1EJAA 5DP8A 1HPGA 1W7XH 1XKBC 3STJA 1AVXA 4P00A 1SKYE 2PUQH 2KCPA 1C1TA 5ETXA 1NROH 2ZIQH 1FY4A 1PYTD 2EI7A 3ZZAA 2ZDAH 2L6OA 1Y5UT 2Z9KA 1YF4A 2BX3A 1IOEA 2JETB 3HKIB 4OGXA 3SHAH 1UCYH 2ZPQA 4YESB 1PQ7A 3W94A 2CMYA 3PMBB 2WUBA 2Y5GA 3UFAA 3LGWA 1SLXB 3OE7D 4BAHB 1C2DA 5EW1H 4AFZA 1GMDF 1SGEE 2B0FA 1QA7A 2G51A 1T8OA 2VIWA 1Q2WA 4FVDA 3OEHD 1GMDG 3ZZBA 1KIGH 4U32A 4CHAB 1PPCE 2WV5A 3W95A 1JIRA 2GZ9A 1D4PB 2QGRA 4AYYB 2SGPE 5DO4H 1RIWC 3C27B 3OU0A 2PKSB 1O36A 1QRWA 4ZHMU 1DICA 5EXLA 3RXJA 1CO7E 3SN8A 3FANA 4OS4A 3U8OH 1K2I1 5FPTA 4MQAA 1C5OH 1FPCH 1HGTH 4MNWA 4IBLH 1BITA 5C3NA 1RRKA 4JZFH 1Q3XA 4Y8YA 3AW0A 5C0UA 3LGUA 2KCYA 7LPRA 1SHYA 4O3TA 1W10U 3WW7A 1HJAC 3BTWE 1SGPE 4KTSA 3QLPH 2PTCE 1MKXH 1SLWB 3SZEA 3M7TA 1FAXA 4K8BA 2JH6D 1P10A 3SYJA 3VGCC 1TIOA 2W6ID 1D9IA 1ZOMA 4Z0KA 2KX4A 3ZYEA 1H8ED 4WMEA 1C5RA 2SGDE 2B5TB 2ZPRA 2VGCB 3QX5H 5GPIB 1TQ7B 3UTUH 4NIYA 2FOMB 2AFQB 3U69H 1EQ9A 4VGCB 1O2QA 1UTKA 2Z9GA 4K2YA 3PYHA 3OEED 4Q2KA 5C1YA 2G8TA 2A5AA 1QRXA 1XUKA 3MU0A 1YYY1 2WPJS 1YPEH 1T31A 1OWEA 3F9GA 1XUGA 2J2UA 4CRCA 5JBCS 2YNAA 3TNSA 1GG6B 1TA2A 2XC4A 1F0TA 3V3MA 2V35A 3RXTA 3HK6B 1PPEE 3MH7A 1P01A 2P95A 2SNVA 2VJ1A 2W5EA 3LC5A 3WY8A 1KLJH 4GAWA 4YT7H 2FS8A 2FP7B 1N6YA 3KF2A 5DPAA 1HDTH 1QHRB 2PKAA 3EAJA 4A6LA 3PO1B 3A89A 5JBAS 2UUFB 2YOLA 4O03A 4FUEA 3RXFA 1EOLA 3V12A 1HJ8A 1JMOH 1NTPA 2WYGA 4LOYH 1IQNA 3NZIA 1OHHD 1QQUA 5T6DA 1C1UH 1W8BH 1T8NA 5E2OA 1FAKH 2Y81A 2GT8A 2PSYA 1GJAB 2FM2A 1O38A 3W1EA 1L4DA 1IQMA 4X1NU 1GI0A 1ZPZA 2WPHS 1HAXB 3SI4H 2OC7A 1GI9B 2BDHA 1F0SA 1UTQA 1XX9A 2QXHA 2ILNA 1HIAA 1ZGIA 1ELVA 3V13A 1K0HA 3LH3A 2SGFE 4DCDA 4UEHH 4MNYA 2FI4E 2GD4B 4I86A 2ZDLA 3AK5A 1ZPBA 1O31A 1IQKA 3TK9A 4GHQA 1TFXA 3TIUA 6LPRA 1A1RA 2EI8A 1LVOA 1C2KA 4E05H 3AAUA 1O3JA 1OSSA 1IQLA 1G36A 4SGBE 1C5MD 9LPRA 1K9OE 4JMYA 3M7UA 2FIRH 4I8JA 1UJ1A 1WOFA 1O2HA 1V2RT 1JXPA 1BBRH 1C5WB 2NWNA 1TBQH 1GI4A 1EAIA 3UB0A 5A0AE 3RM0H 1BTZA 2XCNA 5GNDA 3MO9A 1OP8A 2TGDA 2Y6TA 3DHKH 1YPJH 3RXIA 3SNAA 3N7EA 4X6MA 1ZJKA 1GVKB 1WBGB 4J1YA 1FNIA 3DFJA 1THSH 2AMDA 1YCPM 2BLOA 3MQKC 2HWLB 2ZFTA 2PW8H 4X1SU 3U8RH 4KGAA 1GBEA 2TGTA 2A1DB 4KELA 3DA9B 1O3DA 3EGKH 2FTMA 1BTYA 4Y0YE 2TBSA 2BX4A 2Z9JA 1GI2A 2VIQA 1COWD 3S69A 5DP3A 4KTUA 4Q63A 1TALA 2PP6A 4XBBA 4JYVH 5C20A 1G3EA 1AB9B 2ZGHA 1GHBG 3NWUA 1TNLA 2ZU5A 1S81A 3KIDU 3PV2A 4D9RA 2B9LA 3SJ9A 3ATWA 1C5LH 1SMFE 3F68H 3A8DA 2C8WB 4F49A 4XOJA 1ZLRA 1CGHA 1BMAA 1BTUA 4ASUD 1GGDC 4NFEA 3SHCH 1GBTA 1A61H 1EJMA 1HCGA 3F2GA 3KGPA 3RXOA 5L6NH 1C4U2 2AIQA 2QY0B 1C5YB 3QZRA 4PROA 2GZ7A 1OS8A 1OWKA 1VR1H 4X8VH 1EPTA 2VH6A 4IN1A 1QURH 1MCTA 4X8TH 2FI3E 5I46H 1Y3UA 4BAQB 5L2YH 1O3GA 2G5NA 3GICB 1IQEA 1GWAA 8ESTE 5F8ZA 2FZZA 1GBBA 2H1UA 1CA0C 4AX9H 1HXFH 3M3VA 1PJPA 2A4GA 2ALPA 1G9IE 4Y7BA 1DSTA 1S6FA 1Y3WA 1JBUH 4JZEH 2ZHEH 1Z8JB 3MH6A 1W13U 1C2MA 1XUFA 3F9HA 3N7DA 1XKAC 5T6FA 3SU5A 1QQ4A 4H4FA 4AG1A 4IC5A 3FFGA 3M3TA 3M36A 2AGGX 1FN6A 5C2ZA 1NRRH 3FZZA 3RXRA 3T27A 5DG6A 2VH0A 2GCHF 2WV4A 1H1BA 4AFUA 4CRFA 3A85A 1TAWA 4LK4A 3KYGA 1LMWB 2PUXB 4MDSA 2Z9IA 3B23B 2GCHG 3KN2A 1LQEA 1TMBH 5EODA 2ANKH 3VB3A 1A7SA 1PYTC 3S0NA 1MBQA 3ATIA 3LJJA 1E35B 3F2FA 4BANB 1D3DB 2F9OA 1GHAG 2F43B 1KDQA 2A4RA 3M5NA 3NXPA 1DLKB 1BJVA 1EXFA 4JK5A 1C5VA 3MWIU 4HFPB 4KKDA 2A5IA 1FLEE 2XWBI 3ZVDA 3FN8A 3SNDA 1BMNH 3PWCA 1TRNA 1E1QD 4NSYA 3KQEA 5B6LA 1V2QT 4JCNA 3U1IB 1DWBH 2AGIX 2SGQE 1D3QB 4I33A 4OS2A 1GDNA 1HXEH 4ACBA 2NU3E 1ZZZA 3Q76A 2XBYA 5AVDA 2R9PA 1PFXC 4ABIA 1BDAA 1ZSLA 1M9UA 2BDBA 3NPSA 1BMLA 1S82A 1E36B 1S83A 2ZGCA 1Z1IA 3MNSA 1V3XA 3UWIA 2WPDD 1XXDA 3GS9A 1SLVB 3E90B 2VIOA 4K69A 1MTUA 4YOIA 1AGJA 2Z9LA 3RXEA 4F55A 3UQVA 5C5OA 1V2OT 1VITH 1AMHA 1THRH 4AC9A 5T3HA 2ZKSA 1GHYH 3QDZB 1A3BH 4UFFH 1MU8B 1O3IA 1LQDB 1THPB 1YPKH 1QZ8A 2A7CA 1BT7A 1O0DH 1ZRKA 5I25A 3KCGH 1G3DA 2YMSB 1BMMH 1AVWA 1K1OA 1ETSH 1YCPH 4GHTA 2A7JA 2OQUA 1SR5C 2BD4A 4JYUH 1CVWH 4X2XA 3KQ5A 4TPYA 3SU4A 4BTIB 3A7XA 5EXMA 2ZTXA 3LC3A 4TPIZ 5ABWA 1EJNA 1S0QA 3TLOA 1BUIA 2Y5HA 1OWJA 2PLXA 3B9FH 3RU4D 3PROA 1UTJA 2WPLS 3C1KA 4ZH8A 1PPHE 1N8OC 2R3YA 2XBWA 2PKAB 1BQYA 4AZ2B 1WAYB 1EAXA 1W3CA 3EDXB 1O37A 4X2VA 4ASHA 5LPEA 2HRVA 3S9CA 1DSUA 3A7YA 1UK2A 5GXPA 4R0IA 2ZGXH 3NCLA 5LGOA 3ZV8A 1DUEA 2XBXA 3MNXA 1C5TA 3SNBA 1GBKA 1P2MA 1H9LB 2XOKD 1BHXB 1MAXA 1E34B 1G30B 2AEIH 1V6DA 1WV7H 1EB2A 2VVUA 2C8XB 3QTOH 4NFFA 1FZZA 4CBOA 1O2IA 1DOJA 1UTNA 1HIAB 1ZHMA 1NU9A 3WWFA 2PKSC 2FYRA 2F4LA 1QIXB 3CS7A 1B5GH 2PWXA 3UOUA 2K1QA 1G2MA 4AOQA 1TX6A 1F5KU 2ZU3A 3TU7H 2IJOB 3UNSA 4ISLA 3EA8A 4WMFA 1FY1A 4D7FA 1TPPA 2W7UA 5DP7A 1MH0A 4NZLA 2EC9H 2ZO3H 3BTKE 2RA3A 1BOQA 2BD3A 3RXDA 5HM9A 4FUBA 4LXBH 3RXKA 1SFIA 1TBZH 2H2ZA 3ODDA 4RI0A 1WQSA 1ACBE 2H9TH 3RLWH 3GY7A 4RSPA 1C2HA 4ABEA 1UTOA 2PTNA 3DSOA 1ABIH 2O8TA 1P12E 3M35A 1PQ8A 2P16A 3BTFE 1AWFH 1G3CA 1P2KA 3O8RA 2K8IA 3ENSB 4NA9H 2J98A 5A2MH 5KEDA 4NGAH 4IMQA 4MVNA 3E1XB 1RD3B 1L2EA 1NBME 3UQOA 3F6UH 1FY5A 3KEEA 1KXAA 2VGCC 4OGYA 3OFND 1ABJH 2UWLA 5JBTA 4K5ZA 4MTBA 1YLCA 1AVGH 1DLEA 4IMZA 5TCAA 3DD2H 4VGCC 2ZFQH 1QGFA 5JB9S 1QNJA 3ITIA 1KTTB 2Y5FA 3BG4C 4A7IB 2ESTE 2WZQA 3M61U 5FCKA 1FQ3A 4HI3A 2PGBB 4UDWH 5EOKA 2TPIZ 2J95A 5J4QA 2HGTH 3SJIA 2EY4C 2LP6A 1O5AB 3RC4A 2GDDA 1XUHA 3L6PA 3PV4A 3O8DA 1GCTB 1Z6EA 1GG6C 4FETA 2ZU4A 3SORA 4Y0ZE 2ZHQH 4I31A 1GBHA 2QCYA 3A88A 2AS9A 5HIYA 1C4Y2 3L33A 3SQEE 4BAMB 4F4OC 3TGKE 1QBNA 1J9CH 3ZIAD 1D3TB 5F6MA 1KMHB 4DIIH 1K1JA 1DFPA 2H6MA 5CMXH 2BXUH 4ZKSU 3GISB 3T62A 3GCHB 3S7KB 1A0HB 1Z8IB 5EIYA 1A5IA 1F0RA 1KXBA 1LTOA 1HAIH 3RU4T 1ANBA 1NO9H 4O3UA 3H5CB 2DE9A 4FOUC 1O33A 4HZHA 1G2LA 5DSFA 1MQ6A 1HB0B 1ZRBA 1J15A 2TGAA 1C1WH 1NESE 2H5DA 4YO9A 3QWCH 1S5SA 2A2QH 3PB1E 1QL7A 7KMEH 1LPKB 1WSSH 4CR5A 4D76A 2FDAA 6CHAC 7GCHF 1J8AA 2FYQA 3Q3XA 4AG2A 4XDEA 1OWDA 1MBMA 3RMMH 4ABFA 2SNWA 5EXNA 2CV3A 1DX5M 1WTGH 5FCRA 3TJVA 1DXPA 1P3CA 2GGVB 3PMJA 5GDSH 3PMAB 1CBWB 1MZAA 3ZZ4A 1B0FA 1OKXA 5JPMH 2SGEE 2J92A 3SNCA 1ANEA 1CA8B 3UNQA 5E8EH 3MOCA 3SV2H 1LHGH 1O2YA 5HGGA 3HATH 1KDQB 1E1RD 1OP0A 1O5BB 3GYMA 4FUJA 1LVMA 2EI6A 1GJ4H 4U30A 3A7WA 1VGCB 1NRNH 3R0FA 4JK6A 4K1TA 2O9QA 1TABE 4ZMAH 2P3FH 1RTLA 3BIVH 1TYNA 1C1MA 2OUAA 3BTDE 3GCNA 3U9AH 2AIPA 4SGAE 4XRNA 3T29A 5C94A 1JWTA 2ZCKP 3P8FA 4Q80A 4ZXXH 3F0OA 1V2PT 1ELEE 1O2JA 2ZA5A 2ALVA 2A31A 4BOHA 4Y7AA 1O5CB 1D6RA 3UWJH 3IWMA 1GBDA 1OPHB 5LH8A 4CREA 1S84A 1OOKB 2A5KA 2CHAB 3P70B 1H4WA 3NK8A 2A45B 2XXLA 3KQDA 4ACAA 1HAVA 4D9QA 1G37A 2ZTZA 3KYFA 2ANYA 3LOXA 5HXFA 5JDUB 1ETRH 4WXVA 4UE7H 1DWDH 1KXDA 1O32A 2QA9E 1SPJA 1ZMNA 1O3NA 1AY6H 1GMCF 1G3BA 1PPFE 2D2DA 4B71A 1AN1E 1YP9A 4ISOA 4XE4A 3TH3H 1O2SA 1MMJN 1FIZA 3SZNA 3V7TA 4FU9A 3RC6A 3BN9A 2KR7A 2ZCHP 4E06H 4NSVA 2BDYA 1NRPH 2ZQ2A 2XW9A 1C1OA 1NM6A 1O2KA 3SV7A 1MU6B 2BXTH 2F9UA 4H42U 1Z6JH 5GWZA 3ZVGA 1TA6A 3QGNB 5FXLA 1QCPA 1O3PB 2QIQA 3GCTF 1GCDA 2BZ6H 1UK4A 3SGBE 2OP9A 2RFKC 1E79D 1QB9A 1C2JA 1BMFD 3KNXA 1V2LT 1NU7B 1KYNA 3RXCA 3ZZ9A 2A32A 1ZTJA 1TE0A 3GY5A 1HNEE 1NRQH 2RDLA 2J4IA 1C5SA 5CHAB 3MH4A 1ARBA 2W3KA 1AFEH 4TY7A 2ZDVH 3LPRA 1QR3E 2HALA 2FX4A 2HLCA 1XVMA 1C2LA 3GY4A 1HYLA 3RUOA 2IPQX 4FU8A 1UTMA 3RXQA 2J5UA 2Q6DA 1W0ZU 4DY7B 4DJZB 2V3OH 1HRTH 2L74A 2QN5T 1DXWA 1O2NA 1HJ9A 1TRMA 1QBOA 3D62A 3DUXH 2P3TB 1ETTH 4TYDA 1IHTH 2Z3CA 2BY5X 3SW2B 1P06A 3R3GB 1HJAB 1GHWH 1EUFA 1J17T 5HM2A 1K1MA 2BD9A 2WPIS 1ELDE 1SGNE 3F3BA 2PV9B 1UTLM 3QN7A 3Q3YA 3RP2A 1OP2A 1XXFA 3FOAA 3K6YA 1P3EA 3LGYA 4ZXYH 2GCTC 1VZQH 2GKVE 3QZQA 1O2OA 1GJ5H 3DT0H 2OC8A 5ESTE 4MPWA 5HKKD 1LDTT 2GP9B 2BLQA 2F91A 2J34A 1DE7H 3EQ0H 9ESTA 1SGCA 2G81E 2J98B 1P11E 1KXFA 3A87A 3D65E 2QYIA 5TJXA 3PV5A 5C1XA 4AFQA 2BB4A 4FUHA 1MABB 4MNVA 1MTNC 4GVUA 1EATA 1P0SH 4B6FA 2RDEA 2NU1E 3EE0B 1FONA 3CENA 3H7OA 3U28C 2F9VA 1IQIA 1YPHC 4Y76A 2PGQB 5LPFA 1QFKH 4WWYA 2OD3B 1K1LA 1EOJA 1EAUA 5EW2H 3AASA 2WPMS 4DG4A 4ZKNU 1ELTA 3LONA 2W26A 2PSXA 3DSGA 2C4FH 3P6ZB 2JIZD 1E37B 2ZTYA 3HGPA 3SU0A 1NN6A 1TMTH 4MPUA 1VCQA 4BTUB 2P3UB 3SJ8A 4X1RU 3D23A 2FOEA 2GMTC 3CP7A 2BYAX 2QXJA 1Y3XA 4FUDA 2AERH 4IGDA 3ZZDA 1TNKA 2AH4X 2BVSH 2G52A 4YT6H 3QTVH 5AF9H 2VB0A 1SGFG 1ZR0A 4Y79A 1F0UA 4NA7A 2FODA 2KM0A 2A4QA 1HAYB 1EASA 1O3LA 3LIWA 4QT8C 3MYWA 1EP6A 2PFEA 4WXIA 2ZHDA 3LGIA 3NKKA 1DS2E 1SC8U 2IPHA 3PWBA 2V6NA 2I6QA 2ZGBH 2PR3A 1GI1A 1W0JD 1MKWK 3MTYA 1AUTC 3F2HA 1TOCB 2BOHB 3RXAA 2Z3DA 1C1NA 2VU8E 3ZVFA 3UIRA 1UVTH 1CU1A 1DWEH 4ZCNA 1AHTH 1P2OA 5CDFE 1AWHB 1P9UA 2P94A 1MD7A 1MTWA 1SL3A 2AMPA 2OTVA 2ZF0H 2ZZUH 5AFYH 2G55A 3TJOA 1V2TT 5DK1A 1MZDA 3RXBA 3RXUA 4X1PU 1KY9A 2FOBA 2WSSD 1TGBA 2UUYA 3SNEA
chains in the Genus database with same CATH topology
2OQ5A 3SU2A 2ZDKA 1SVPA 2GDEH 4HTCH 2HNTF 5AFZH 4IW4E 2FO9A 3E91A 2C8ZB 4FUGA 4RKJB 3SUFA 3Q77A 4IC6A 1GI6A 2BM2A 5C67A 3I77A 2EEKA 1ANCA 1P8VC 3ELAH 3MNBA 1TNJA 1SOZA 1K1IA 1YBWA 1LPGB 3MI4A 5DP4A 2A4OA 3UY9A 1GBCA 1N1LA 1O3MA 3SU1A 4ZHLU 5BPEA 2ZU2A 3MNCA 4OS7A 4D7GA 4JZ1A 5JYIA 2NU0E 1F5LA 1Y3YA 7ESTE 1GBLA 5A8ZA 2BDCA 2BD8A 3GY3A 1IQFA 3P8NA 3M5LA 1AE5A 1LKAA 1X7AC 4GPGA 3Q3KA 2FS9A 1LHDH 3ODFA 2STAE 1ESTA 1GPZA 1O5GH 3VB7A 4J2YB 1W7GH 4NWLA 1QJ1B 3STIA 4E7RG 3H7TA 1SSXA 2BY7X 3QK1A 1K1NA 3AAVA 2A0QB 3T28A 4B2CA 5A8YA 1EKBB 2ZHWH 1TRYA 3LDXH 5C5NA 3MU1A 3RXLA 4OS5A 3RMOH 4AGKA 3FZDA 2VVVA 3P95A 5FBIA 5CE1A 3GY6A 2Y7ZA 4H6SB 3HPTB 2CN0H 3O8BA 4A1TA 4ISHH 1GCTC 4U01A 4Y6DA 1RFNA 3SQHE 1GGDB 3HGNA 3SUDA 3OSYA 1HAVB 3FP7E 1SGYE 1NS3A 4B76A 3M7QA 1RGQA 1VITF 3FP8E 2F9PA 2ZP0H 5SGAE 2JETC 4UFEH 2IN2A 4IS5A 1DWCH 2ZFSA 2QAAA 1Z1JA 2TIOA 4ZKRU 5E0JA 4K1SA 2XNIA 3NUMA 1KLTA 4XBDA 5EU8A 1QY6A 2CF9H 4X8UH 1XMNB 1TX7A 1ZYOA 1CA0B 3M5MA 1AFQB 1MTVA 4A92A 1H8IH 4DGJA 2WINI 3KQBA 4B73A 4CHAC 4THNH 1DY8A 1QL9A 3Q00A 4Y10E 1E38B 2GX4A 3SOSA 2BDAA 2AYWA 3ZYDA 3LT3A 1L4ZA 4NIVA 2F9BH 2O8LA 3F9FA 3ZZ7A 4I7YH 1KTSB 2BMGB 3ZZ6A 4CRGA 2STBE 3L3TA 5GCHF 3VFEA 2VWNA 1GI8B 1B7XB 3UREA 1UK3A 1ORFA 2CF8H 3SO3A 1SLUB 3UPEA 1ESAA 5GCHG 5EPYA 3URCA 3F9EA 3SGAE 2GT7A 3ATLA 4Z6AH 1DPOA 2C8YB 2BLVA 2OBOA 3SJOA 3KL6A 1ZHPA 3E16B 1O2ZA 1O2GH 1C9PA 1SHHB 2OXSA 3TNTA 1EZSC 1BRBE 2HPPH 3UR6A 3OY6U 1FIWA 4Q7XA 3D49H 1O30A 4I8GA 2O8MA 1YLDA 3PLPA 1SG8B 1G32B 1BRUP 3MU8A 3A84A 4BAOB 1HBTH 1OYTH 4INKA 1V2MT 4ABBA 3I29A 1NZQH 1XUIA 3GDUA 2LPRA 2EA3A 1VGCC 1HUTH 1T4VH 1TPOA 1C5ZB 4YZUA 4WH8A 4MLFB 2P93A 2XC0A 4JZDH 4X6OA 2OBQA 1VCPA 1SB1H 4MG3A 1PPBH 1MD8A 3KHVA 2OC1A 1PPZA 1FI8A 1CQQA 2VIPA 3A8CA 1HAOH 1SFQB 1A5GH 1WCZA 1A4WH 2BY6X 2V0BA 1OYQA 1YPGH 1TGNA 1GJCB 1O3HA 1LKBA 4TWYA 1GMHF 3PTBA 2QF3A 1QBVH 2WPKS 3F1SB 3RM2H 2BZAA 4K60A 1XM1A 2ZECA 2FOFA 4ISIH 1O2MA 1D3PB 3PO1C 2HNTC 3MHWU 1BIOA 5GJ4B 5E0HA 5EQSA 1L1GA 3QUMP 3FP6E 1BTWA 2BD2A 2BQ7B 3ATMA 2HPQH 1A3EH 1EZUC 2Q1JA 2TRMA 2DUCA 2NU4E 1EPTB 4MPXA 1UVOA 5DP6A 1V2NT 1SGQE 1N8OB 2FTLE 2ULLA 1LHCH 1Z8GA 3MO6A 1P2IA 1D6WA 4ABGA 2HVXA 3V0XA 1O3CA 4Y71A 4H6TA 3RXSA 1ELGA 2P59A 2BD5A 1HLTH 4YTAA 2BY8X 5F03A 4KP0A 5F8XA 3TK5A 3EYDA 3SJKA 4TY6A 3RU4E 5BRRE 3G01A 1W0YH 2R0LA 1AIXH 1GJBB 3GYLB 1OWIA 4FXGH 1Z7KA 1GL1A 4LZ4B 4I8KA 2W3IA 1O2LA 2KAIA 4A5TS 3ZVAA 3ZV9A 3FAOA 2AGEX 5IDKA 1P9SA 1W11U 1NY22 4X2YA 5CHAC 7GCHG 2ZWLH 3RXVA 3K2UA 2F3CE 2FEQH 3PLBA 1DANH 1O39A 2A2XH 4YLUA 3TH2H 3LKWA 1CHGA 1AO5A 1C5UA 3MU4A 4Y8ZA 2OC0A 2TGPZ 1MAYA 1BA8B 1LCYA 4WF8A 4RN6A 3SBKA 3TVJB 2VIDA 5AHGH 2RCEA 1TNIA 3A8BA 3RMLH 2ZFPH 3VPKA 2RG3A 1UCYE 2Z94A 1ZGVA 1NPMA 2CJIA 3K65B 4X2WA 1XUJA 1W14U 4OS6A 1CT2E 1GL0E 4UFDH 1F2SE 1B0EA 1ZTLA 2BDGA 1KXCA 1DITH 1YPHE 1YPLH 1Q31A 1GBMA 2F9NA 1HFDA 2FMJA 3K9XB 3P8OA 4UFGH 4D8NA 1Z71A 1TLDA 3ZZCA 3FVFB 1BB0B 6GCHF 1UCYK 1GJ9B 1O3BA 3SU3A 1IQJA 1EX3A 1BHXF 1WYKA 3S9AA 1O2XA 2G5VA 5L30H 1E0FD 1P02A 2FOGA 6GCHG 2ZDMA 5E0GA 2FOAA 1OWHA 3GY2A 2I6SA 2ANWA 1QB6A 2FWWA 1GBIA 1ZMLA 1AB9C 1J16A 1RTKA 1ELCA 1GBFA 4OS1A 4CRAA 2OINA 1AQ7A 4ZAEA 4NCYA 4U2WA 4GLYA 1GJ8B 3BG4B 1QRZA 4DIHH 1O3OA 3ATKA 2UWOA 1NFWA 2XBVA 2P8OB 1ZSJA 4ABHA 4IN2A 1V2UT 1MQ5A 1O5EH 4DVAU 1W2KH 4BXSA 3U98H 1AKSA 3URDA 1KSNA 1Y3VA 3B8JA 4FUCA 3TJNA 3AW1A 1DUAA 1UMAH 1CT0E 1GMCG 1MCVA 5A09A 3TGJE 2ANMH 1Y59T 2VWLA 1TPAE 5EGMA 4BAKB 1P2JA 4GCHF 3TJUA 2BHGA 4XSKU 3SV6A 5EQQA 2FLRH 1V2WT 6ESTA 4GCHG 4YM9A 3BEFB 3M3SA 4YLQH 3BG8A 1UO6A 2VNTA 1BRCE 1CSOE 3OX7U 1CHOF 2ODQA 2BQ6B 1DT2A 3BTHE 3E3TA 3QGJA 3PM3A 4B2BA 5DP5A 4B75A 3ESTA 1MKXK 1CHOG 2BLWA 1LHEH 3GCTG 1BCUH 4I8HA 4B2AA 2ODYB 2THFB 1TNHA 4E7NA 1SQOA 1IQGA 1RXPA 2CGAA 3RXMA 1S6HA 1YC0A 1GHXH 3QO6A 8KME2 1NC6A 1RIWB 1GJ7B 5EPNA 5L2ZH 3ZZ5A 4WH6A 1L0ZA 2IOTA 3ZVBA 1EB1H 1O3FA 3VB5A 2H9EH 2B8OH 2Z3EA 1CE5A 1K21H 1P2QA 1BJUA 2BVRH 3BTTE 3UOPA 1Z8RA 3IG6B 4I8LA 5TCCA 1BTHH 4ABJA 6CHAB 1NFUA 2FLBH 1WU1A 3TPIZ 1C1VH 1HV7A 4AYVB 1C1PA 1EZQA 1TB6H 1IHSH 1UHBA 1P04A 2ZEBA 2O8UA 1GDQA 1TQ0B 4JZIA 4BNRA 1SGIB 5DP9A 2H5CA 3A7ZA 4WMDA 1EZXC 1V2VT 2BOKA 1TMUH 1SOTA 2BVXH 3LH1A 4ZROA 2CXVA 2ZFFH 3VGCB 1MUEB 3SV8A 2YNBA 2GVFA 2BDIA 3MH5A 3OYPA 3TITA 1ESBA 2GZ8A 1TOMH 1DDJA 5EG4A 1GJDB 1P09A 4A1XA 3UR9A 4FUFA 2Q6FA 2GV6A 3SU6A 1GI3A 1T4UH 4AB8A 3LJOA 2FESH 1H9IE 1MKWH 4X6NA 1VCWA 2D8WA 1WQVH 1ELBA 2JKHA 5EQRA 1FN8A 1DM4B 2W7SA 2QF0A 1UVUH 4BTTB 3BEIB 2H9HA 4GUXA 1FJSA 4WY3A 1CGJE 1XVOA 3E8LA 4CH2B 2ZDNA 3KQCA 3VXEH 1GHVH 4B1TA 1GHBF 4ZHAA 1ZMJA 4K8YA 3BF6H 3LGTA 3U1JB 1PQ5A 1QA0A 1VJ9U 4NG9H 4HGCA 3U8TH 1GDUA 1FV9A 3S9BA 3M37A 4KTCA 3A82A 4NIWA 1RTFB 1FDPA 1AI8H 3JZ1B 1O5DH 1GBAA 3ZZ8A 1VJAU 2FPZA 3RC5A 1BBRE 5FAHA 4XFQA 1IQHA 5DKMA 2RA0A 3GCOA 4INHA 1FPHH 2M5TA 4CRDA 1CGIE 1O3EA 2FOHA 3T5FH 3SI3H 2HOBA 1O2UA 3A81A 1F5RA 1J14A 1O2TA 1FY3A 4K1EA 2UUJB 2UWPA 1GVLA 3GY8A 3TK6A 5G4BA 1BBRK 3EA7A 1EAWA 5T6GA 1C1SA 2OCVB 1PPGE 2SFAA 5FX6A 1C5XB 2FOCA 3BIUH 1O5FH 1DVAH 5DGJA 4XBCA 1C1RA 1DY9A 4YOJA 2BQWB 1QB1A 4CBNA 1SQTA 2C93B 4CR9A 1AFQC 3UUZA 3M5OA 1FXYA 4AN7A 2ODPA 3K6ZA 4TWWA 1AE8H 1BZXE 1N6XA 4JYTA 4MPVA 1K28D 2OLGA 5PTPA 1AZZA 4Q7ZA 1GVZA 1AZ8A 4ISNA 1UVPA 3AVZA 1ZHRA 2D26C 1O2VA 4NIXA 4X1QU 2JH0D 3UNRA 1YPMH 3DFLA 4DW2U 1O35A 1T8LA 1ANDA 1C5NH 2KAIB 3SV9A 3E6PH 1T32A 2D1JA 1F92A 2BY9X 1GHAF 2G00A 1KXEA 2J38A 5C1UA 1T7CA 1SGDE 2R0KA 2ZFRH 1FY8E 2PHBA 1C5QA 3PMHB 3A8AA 1Y8TA 3RLYH 1SGFA 2A7HA 4NA8A 1PQAA 1JOUB 2ZCLP 3A86A 1NT1A 1GHZA 5FBEA 1ELFA 5FPSA 4FUIA 4R8TB 3GOVB 5FHTA 3LU9B 1QJ6B 4X8SH 1JRTA 2UUKB 3RXPA 2GCTB 1NFYA 1EP5A 2O8WA 1ZSKA 1GBJA 1SGRE 1TGTA 5B6OA 3P17H 4NWKA 1O2WA 3ZVEA 1SGTA 3T25A 4FVBA 4ESTE 2GV7A 3OY5U 1F7ZA 1GI5A 1TONA 4X0WU 5HYOA 4RKOB 2ZGJA 2HNTE 1QTFA 4YOGA 3MO3A 2J94A 1TPSA 4BXWA 3LGVA 4DURA 1P03A 3A80A 1MTNB 3HKJB 1JRSA 5K7RA 5LPRA 2ZHFH 1C9TA 1A0LA 1GI7B 5JBBS 1INCA 3SUGA 3IITA 4INLA 1LVBA 8GCHF 2R2WU 1L1NA 3RXGA 2XCFA 1ELAA 1OX1A 2ZNKH 2J9NA 1TGCA 4AB9A 8GCHG 1V2KT 3HK3B 5FPYA 1AD8H 3A7TA 3BEUA 1L1JA 2DE8A 3BTEE 4WJG2 1OXGA 1H8DH 1VITG 2GTBA 1P05A 2JH5D 1FUJA 3SUEA 4X6PA 3TGIE 4M7GA 2BD7A 5IYTA 1AKSB 4DT7B 4FU7A 5HMAA 2XRCA 1ZTKA 1TGSZ 2FX6A 2XC5A 1P57B 2GMTB 1TNGA 1S0RA 4O97A 2F83A 1EPTC 2B7DH 3N7OA 3MMGA 2BTCE 3ZZ3A 3GCHC 1ID5H 1HAGE 1FMGA 1BTXA 1UTPA 2QXGA 1A0JA 1RS0A 2FI5E 1WTHD 3VEQB 1GJ6A 1O2PA 1TX8A 2Z6BD 2Z7FE 1UVSH 3PTNA 3BTQE 5ESBA 1RJXB 2ASUB 3T26A 4B74A 1O2RA 1QJ7B 1YKTA 3E0PB 2VIVA 1A5HA 3RDZA 1WUNH 1HAPH 2VWOA 3EA9A 2G4TA 1V2ST 4ZUHA 1JIMA 4A1VA 1TWXB 2XYAA 1KLIH 5GIBA 4DOQA 5K0HA 3BTME 3VB6A 5J4SA 2G4UA 3P8GA 2ZG0H 2ZU1A 2Y80A 1ARCA 2V3HH 1YGCH 4UONA 1A2CH 3SGQE 1QL8A 3VXFH 3GDVA 4AORA 1O34A 1Y5BT 2C90B 4MNXA 1U6QA 1C5PA 1CBWC 3BTGE 2QC2A 2AMQA 2Y82A 8LPRA 2VWMA 4NZQA 3TH4H 5DJ7A 3P92A 1K22H 3ZVCA 1CT4E 1S85A 5H4IB 3S7HB 2ZI2H 4K3JA 2ZPSA 1LPZB 3E0NB 1IAUA 3I78A 1BTPA 3JZ2B 1LHFH 1LO6A 3BSQA 4O9VA 4Y8XA 4AGJA 3A83A 2LNCA 2XWAA 1YCPK 1SBWA 3CS0A 1ZJDA 4AFSA 1UHBB 2XTTB 2WUCA 3MU5A 2QXIA 2Y7XA 1T8MA 2VVCA 5F8TA 1MTSA 5A8XA 1C2GA 1C2IA 1NFXA 4UD9H 2NU2E 4CRBA 1O3KA 2C3SA 3GDSA 1LVYA 1K1PA 1C2EA 1V2JT 1YM0A 4ZKOU 1C2FA 4WVPE 4Q7YA 2R2MB 1O3AA 1Y5AT 5FX5A 4I32A 5A0CA 1H9HE 1HAZB 3MFJA 2VINA 3PLKA 4GSOA 2R3UA 2ZQ1A 2Q6GA 4ABDA 1C1QA 3O8CA 2CHAC 3VB4A 1NRSH 1SI5H 1ZPCA 5E2PA 2ZC9H 5JB8S 1W12U 1P2NA 2QV1A 4CH8B 1AUJA 1C4V2 2SGAA 3T2NA 5A0BA 1BRAA 1A46H 3OTJE 3RMNH 3RXHA 1AU8A 3A7VA 2WYJA 3BV9B 1GMHG 1SQAA 4ABAA 4LZ1H 1HAHH 2P8OC 4Y11E 2FXRA 1TBRH 1EJAA 5DP8A 1HPGA 1W7XH 1XKBC 3STJA 1AVXA 2PUQH 1C1TA 5ETXA 1NROH 2ZIQH 1FY4A 1PYTD 2EI7A 3ZZAA 2ZDAH 1Y5UT 2Z9KA 1YF4A 2BX3A 1IOEA 2JETB 3HKIB 4OGXA 3SHAH 1UCYH 2ZPQA 4YESB 1PQ7A 3W94A 2CMYA 3PMBB 2WUBA 2Y5GA 3UFAA 3LGWA 1SLXB 4BAHB 1C2DA 5EW1H 4AFZA 1GMDF 1SGEE 2B0FA 1QA7A 2G51A 1T8OA 2VIWA 1Q2WA 4FVDA 1GMDG 3ZZBA 1KIGH 4U32A 4CHAB 1PPCE 2WV5A