1A5IA

Catalytic domain of vampire bat (desmodus rotundus) saliva plasminogen activator in complex with egr-cmk (glu-gly-arg chloromethyl ketone)
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
265
structure length
265
Chain Sequence
TCGLRKYKEPQLHSTGGLFTDITSHPWQAAIFAQNRRSSGERFLCGGILISSCWVLTAAHCFQESYLPDQLKVVLGRTYRVKPGEEEQTFKVKKYIVHKEFDDDTYNNDIALLQLKSDSPQCAQESDSVRAICLPEANLQLPDWTECELSGYGKHKSSSPFYSEQLKEGHVRLYPSSRCAPKFLFNKTVTNNMLCAGDTRSGEIYPNVHDACQGDSGGPLVCMNDNHMTLLGIISWGVGCGEKDVPGVYTKVTNYLGWIRDNMHL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Catalytic domain structure of vampire bat plasminogen activator: a molecular paradigm for proteolysis without activation cleavage.
pubmed doi rcsb
source organism Desmodus rotundus
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords PLASMINOGEN ACTIVATOR
total genus 58
structure length 265
sequence length 265
ec nomenclature ec 3.4.21.68: T-plasminogen activator.
pdb deposition date 1998-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1a5iA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1a5iA01
3D62A 1A1RA 1S0QA 8GCHG 3OX7U 1T4UH 2GCHF 3E16B 4GCHF 1MTNB 1NESE 4ZKOU 5FX5A 2Y5FA 4H6TA 4B71A 1C5QA 2BLVA 5C2ZA 1MMJN 1DT2A 5PTPA 1EAXA 4YOJA 3DD2H 8LPRA 4KTCA 1EZUC 1G30B 1J17T 2XYAA 3QLPH 5JYIA 1XUIA 4I8KA 3Q00A 1W10U 2VH6A 4X2VA 5DP9A 1XXFA 2SGFE 4MDSA 1G36A 3ZV8A 1SFIA 3MU5A 3OTJE 4ABFA 1ZJKA 1FLEE 3ATMA 1YCPM 4XSKU 7GCHF 2ZU3A 3K65B 1C5XB 1AVGH 1WOFA 4X6NA 3L6PA 2Y7ZA 2FYQA 1GHXH 1P2KA 4IS5A 1GBJA 3GY8A 1MZAA 3ESTA 1GL1A 1AKSA 1P10A 4ISLA 2ZGHA 5EU8A 1EAWA 2ZC9H 3BEUA 1HDTH 3A85A 3UIRA 4H42U 2XNIA 2EI6A 4K3JA 1NM6A 3H7TA 1E37B 3TGKE 3T25A 1Y3VA 1GHAG 4MNWA 1QHRB 1DOJA 1SQTA 1RD3B 1TA2A 1CT2E 1AVWA 2PWXA 3VFEA 1EXFA 5J4SA 3OY6U 3LKWA 1C5RA 4LOYH 1CQQA 1TRYA 2P59A 2VWNA 3KIDU 1L4ZA 3OU0A 3ZZ8A 1B7XB 1K22H 2ZEBA 4AX9H 4BXSA 2ZHEH 4MPVA 4MLFB 2Z9LA 1YLDA 2FESH 1AN1E 1WTHD 3TH2H 1Z8GA 4AFQA 1BITA 4BNRA 2A2QH 1NY22 2HNTF 1WAYB 5C1YA 1SGCA 2Q6GA 2C8XB 4VGCB 5HM2A 2BD4A 3RUOA 3I78A 3ZZBA 2R2WU 2G51A 1MD8A 2QF3A 2ZF0H 2AMQA 2P8OB 1BTWA 2O8MA 1FDPA 1YGCH 2QXHA 5C5OA 1ELAA 1G3CA 1Q31A 3MO6A 2ZU4A 2XW9A 1BZXE 3TK5A 2PKAB 3KHVA 3KN2A 1O3HA 2HPPH 1UCYE 1LHCH 5ESBA 1QURH 1XX9A 4D9RA 1BBRH 3UWIA 1XUHA 2XRCA 1MAXA 2A4QA 2O9QA 1NU7B 1GWAA 4MNXA 3VPKA 1GI2A 2ZNKH 3EGKH 5LPFA 3F9FA 3SOSA 1OWIA 3HK6B 5GIBA 4IW4E 1L1JA 1OPHB 2F91A 1TRMA 3PWBA 3FP6E 3RXBA 2SGDE 2GCTB 1D9IA 1QGFA 3P8NA 2BDGA 3ZVEA 1O2MA 2GMTB 5EQRA 3BIUH 3BF6H 5A0BA 1ID5H 3A7YA 1L2EA 2FIRH 2G81E 2AYWA 1NRNH 3SORA 3TPIZ 5T6DA 4FVDA 2DE9A 2HVXA 3EE0B 2CN0H 1F7ZA 4ZUHA 1UMAH 2BZAA 3SU3A 4A1VA 3LGUA 1GBCA 2F9PA 4O3TA 4B76A 4ZXXH 1SHHB 1Y59T 2AMDA 2OTVA 5JBAS 2ZTYA 3ZZDA 1E0FD 4NIWA 1QR3E 4X6OA 1C5ZB 2B8OH 1P11E 4HGCA 5E0GA 1SSXA 1ABIH 1MKWH 2FMJA 1C5SA 3U8OH 3KNXA 1GI0A 2UWPA 1QA0A 3K2UA 4Q7XA 4BTTB 2ZTXA 1QRZA 1V2QT 1Y8TA 1SQOA 5ESTE 2VWOA 4Y6DA 2RA0A 1E36B 3HKJB 2PTCE 2XCNA 3LGWA 1DWBH 3QGNB 2OLGA 3P92A 1O5CB 3URCA 3S9CA 9ESTA 4B75A 3PMBB 4NA9H 1CHOG 1JOUB 2QN5T 3QWCH 1C2MA 1YKTA 3A82A 2WPHS 1FY8E 1Z1JA 3MWIU 5GDSH 3UR6A 3ZVBA 1V2KT 1PQ8A 2CF9H 1TPPA 2G4UA 2GVFA 4Y7BA 6CHAC 1PQ5A 1RXPA 3E0NB 1HIAB 3H5CB 1GMDG 2RCEA 1KLJH 3B9FH 4CRCA 2ZKSA 4XBCA 1Z7KA 5DPAA 2CGAA 1TWXB 1QL8A 1CA0B 2NU1E 1P12E 2D26C 7ESTE 1GI7B 3KQDA 1PYTC 2OC1A 1Z6EA 1YCPH 1P01A 1AWFH 1SFQB 3LDXH 3T2NA 2FXRA 1YPEH 3VXEH 1UTMA 4DGJA 1SGFG 1O33A 2FLRH 2C8WB 2FOEA 2VINA 1O2OA 3SU5A 3IWMA 4Y76A 3RU4E 1O3FA 2H6MA 1JRSA 5AFZH 4ABJA 3BG4B 1MTSA 2PV9B 1JXPA 4MQAA 1C2IA 1TMBH 2OBOA 2FX6A 3DA9B 2PUXB 5AVDA 4FUJA 4B2CA 4NGAH 3ZYEA 1UVSH 3PMJA 4AORA 3ATWA 1VITH 1JIMA 1UO6A 1TPAE 2H5DA 4I7YH 2LPRA 3ZZ7A 2ZQ2A 2G8TA 1YC0A 2BOHB 2SGEE 1YPKH 2ZA5A 1X7AC 2BDIA 3EAJA 5HYOA 3A8AA 4YTAA 2A31A 4XBBA 1GBIA 1SGYE 1C1WH 1V3XA 5FX6A 3I77A 3SI4H 2WINI 2P16A 1KXDA 3RXHA 1SGNE 4CH2B 3F1SB 1DY9A 4R8TB 1O3DA 2RG3A 1V2ST 2FOMB 4DVAU 2ULLA 1C5TA 1C1UH 5ETXA 3A86A 5FXLA 1ZHMA 4DW2U 4XE4A 1C5UA 1BQYA 2XBVA 4I33A 2FOAA 4GVUA 4YOIA 1GCTB 2GCTC 4AGJA 1BHXF 2ZFTA 3GCTG 2HNTC 2ZO3H 5EXLA 1AKSB 1GHZA 2SGAA 3M5OA 2Y80A 1H1BA 2LNCA 2ZU2A 1BJVA 3ATKA 1SGPE 2ANWA 3A89A 1O5EH 1PFXC 1CE5A 4D76A 4ISNA 1O5GH 2A45B 1HJAB 1MKXH 9LPRA 1O2NA 3M3VA 3AW0A 1UHBA 2HPQH 3SU1A 2WV4A 1S0RA 1EPTC 2BVRH 1UTOA 4THNH 1UCYK 2XWBI 1BMMH 4Z0KA 5JB8S 3R3GB 4K1EA 1JIRA 2TRMA 2F3CE 1GI1A 3GY6A 1ELFA 5AF9H 2O8LA 5K0HA 1A3EH 2TGPZ 1C9TA 1G9IE 2OC8A 1MCTA 2WYJA 1EAUA 3TJVA 5AHGH 1UK4A 1GMDF 1Y5UT 1UTNA 1FUJA 2BX3A 3ZV9A 3GY7A 2KAIB 3T26A 1KLTA 1QRWA 1IQNA 2BXTH 1HRTH 3UR9A 1EB2A 3SJ9A 1LQEA 4FUBA 1PYTD 1XUKA 2XBXA 4X1QU 1C2GA 3A83A 3M7TA 3VB4A 1HIAA 5A0AE 1A3BH 1G2LA 1WCZA 3QGJA 4JK5A 3RXCA 1ARCA 3RMOH 6CHAB 4KTSA 1DS2E 1WBGB 1UVOA 2CMYA 2PSXA 5A0CA 1F5RA 4MPUA 2VB0A 4WVPE 5F03A 5GCHG 2G52A 2C4FH 3O8DA 1C4Y2 2ZGXH 5ABWA 1FN8A 4F49A 3C27B 5BRRE 1GJ7B 4KKDA 2P94A 1ZHRA 3S69A 4CRGA 2A4GA 4NWLA 2BD7A 2VIWA 2W3IA 1LVOA 3ZYDA 3SNAA 3M5NA 4WH8A 1D3QB 2WUBA 8ESTE 1C5WB 5DJ7A 3RM0H 2XCFA 3A8DA 2Z3EA 3RXKA 1GMCF 3SGAE 2ZHWH 1LVYA 2B0FA 4GLYA 1TIOA 4TPIZ 1SGRE 2J34A 4HZHA 3MU8A 1OYQA 1W0YH 2JH5D 2PTNA 3N7OA 1O3AA 3QX5H 3BTME 4LXBH 2PUQH 2AFQB 1SGEE 2GGVB 2XC5A 4ABIA 1GMHG 1RRKA 5SGAE 1TAWA 4I32A 5GPIB 1YLCA 3BTHE 2VWMA 1CO7E 2ZWLH 3SNDA 3MMGA 5L30H 1ZZZA 2BD8A 1RS0A 4ZKSU 1AO5A 4Y7AA 1C9PA 1TB6H 2WPJS 2Z9GA 1NZQH 2QGRA 4K8BA 1S85A 2IJOB 1UCYH 3ATIA 3UPEA 4CRBA 2R0KA 2BYAX 1GBBA 1YPHE 1OX1A 1YPMH 2UUFB 4CR9A 4MPWA 4GHQA 1W2KH 2BDAA 2VVUA 1ZOMA 4IBLH 3NKKA 1BTYA 4AYVB 1BMAA 1Q3XA 3G01A 1HNEE 4ZHMU 4LZ4B 4O3UA 3T5FH 2OXSA 3NXPA 1YPLH 2JKHA 4A1XA 5JB9S 2W3KA 3GY4A 1C2JA 4X6MA 4B1TA 4TWYA 1G37A 1LPZB 4Y71A 1NRQH 1SC8U 1OWJA 1QB1A 4IMZA 2ZFFH 4NSYA 4X1PU 1GBTA 1UK2A 5L6NH 3RXIA 5DGJA 1N8OC 1ZPCA 2ZPRA 1ETSH 1K1OA 1C1OA 1T31A 1DUEA 1YYY1 2ZGBH 5EPNA 1T7CA 1BRCE 1DM4B 3RXMA 1ACBE 4FU8A 4JZ1A 2ZFPH 4KGAA 2ZCHP 4K60A 2ILNA 1TNKA 2VU8E 2KAIA 1AB9B 1OOKB 1EJAA 4O97A 1FAKH 3UQVA 3SNBA 1CA0C 3BTDE 1QTFA 1TNJA 2HOBA 4YLQH 1ESBA 2NU3E 1AFQB 3V13A 3ITIA 3EA9A 3WY8A 3RXAA 2BX4A 2ZGCA 3AVZA 3SNEA 3LIWA 3U9AH 3ZVAA 3QDZB 1CVWH 4ZKRU 4AN7A 3P95A 2HGTH 3M7UA 1SLVB 5GXPA 1CGHA 1VGCC 3STIA 3W94A 1HAGE 3L33A 3P6ZB 1D3TB 2CV3A 4GCHG 5DK1A 1WTGH 1G3EA 4NCYA 3TK9A 3GYMA 1GI8B 1QB9A 1A0LA 1C1RA 1VGCB 1C2KA 1NROH 1AGJA 1P2JA 4Y11E 3ZZ6A 3B8JA 4FUFA 1MQ5A 3HKIB 2Z3DA 4NA7A 1DWDH 1HGTH 4Y0YE 1DWCH 1CBWB 2D1JA 4BAMB 4NFEA 5C1UA 2ZDAH 4ZAEA 2UUYA 2BY6X 2OC0A 1C2LA 1GJ8B 3O8CA 3EA7A 1S84A 1A2CH 3CENA 4DIHH 3RXSA 4IN2A 2QXIA 4ZH8A 1VR1H 1ANBA 2Y7XA 3GOVB 2GMTC 4GUXA 5BPEA 5EOKA 1G2MA 4ABAA 1ZGVA 1WQVH 1VZQH 3LJOA 1C5NH 3Q3KA 4Q7YA 1SL3A 1GJAB 1BT7A 4X8VH 2FLBH 5LPEA 4U30A 1T8MA 3A88A 4MPXA 1H9LB 4UD9H 5C1XA 4OS2A 1FZZA 3Q76A 1O3NA 2DUCA 3SQHE 1QNJA 1ESTA 1O2SA 4WMDA 3BTTE 1J16A 1K28D 1NT1A 3MNXA 1FY5A 3KL6A 4B2AA 1GMHF 2Q6FA 1W8BH 1V2OT 1O37A 1NTPA 3FZZA 1IQLA 1LPGB 1DPOA 1EJNA 2AS9A 2A1DB 1C2FA 4UE7H 3U69H 1G32B 2O8TA 2VIOA 1KDQB 1OKXA 1TRNA 5FCKA 1WU1A 2FI5E 1KYNA 1TBZH 4ISIH 3Q77A 3RM2H 1GVZA 3Q3XA 2FOHA 4U2WA 1TPOA 2ZTZA 1AMHA 4J1YA 2G4TA 2YNBA 3PTBA 3UOUA 4ZROA 4Q80A 1DLKB 1U6QA 1HAVA 1GBMA 1GHYH 3NUMA 1HYLA 2Z7FE 4X1NU 1E38B 1SOTA 5DO4H 1XM1A 3GISB 1O3MA 3M35A 4JZEH 1O2RA 3A7XA 2H9HA 1V2RT 3SHAH 4NIVA 3T27A 1SBWA 1AFQC 4CREA 1BBRK 1OWHA 2PFEA 2SGPE 1XKAC 2Z9IA 1DVAH 2FS9A 3UNRA 2ZU5A 1MAYA 2GT7A 1GG6C 2BTCE 4BAHB 2R2MB 1HAXB 3A7VA 3M3TA 2GZ9A 2WV5A 4K69A 2P3TB 1P2NA 1SGTA 3BEIB 3SV6A 2BD2A 4ISHH 2ZIQH 4KTUA 4X2YA 1HJ8A 2FTLE 2P93A 3JZ2B 3GDVA 2BY7X 2C8YB 4JK6A 2AGEX 3LC3A 1TBQH 2VNTA 1ELTA 1O3OA 2TGDA 2AERH 1PPHE 3SV8A 3FANA 5L2YH 4I31A 4CHAC 1QBVH 1HUTH 1Y5BT 1SGDE 4A1TA 4BAOB 4RKOB 1Y5AT 2A4RA 1TLDA 1HAPH 1O34A 2R3UA 1SLWB 3M5LA 1EZQA 1F0TA 1C5YB 4CHAB 1XKBC 1DE7H 3PLKA 2RA3A 3NK8A 1T8LA 3STJA 1PPCE 1FAXA 3AW1A 2FOGA 1C1QA 1ZSJA 4FU7A 1GJ5H 1A5HA 3ZVCA 4ZHLU 1EQ9A 2VGCC 3RC6A 1AWHB 1HXEH 2O8UA 3DFLA 3EA8A 3VB6A 2PKAA 2WYGA 5IYTA 1GDUA 1AQ7A 2ZHFH 1TFXA 4B2BA 2NU0E 3F9HA 2ZDKA 3O8RA 1PPGE 1NFUA 4NZQA 3FP7E 1IHSH 2VWLA 2NU2E 4U32A 3PWCA 1G3DA 1XUGA 2XBWA 4F4OC 2ALPA 1DLEA 4ZMAH 1MCVA 3UUZA 2ZHQH 5EG4A 1HAZB 5EXMA 5TCAA 1GHWH 4CRDA 1NRRH 4MVNA 3SBKA 1QJ1B 1L4DA 3BTFE 3AAUA 3SU2A 5JBCS 1NFYA 2V0BA 3QZRA 1TGBA 1BMLA 1IOEA 1P3EA 4FU9A 2J9NA 1MKXK 4WY3A 1ETTH 1GJBB 1PPEE 3BN9A 1ZSKA 3E90B 1Y3UA 2JH6D 3NWUA 2ZECA 3MH7A 1QIXB 4QT8C 1O2TA 3RLWH 5DKMA 4AFUA 3RMLH 1HJ9A 2ZCKP 4A92A 4A7IB 5AFYH 3LH3A 1LMWB 2P3FH 1RGQA 1NO9H 3ODDA 3GY3A 2G5NA 4NA8A 1AIXH 1AUJA 1SPJA 1Q2WA 3M37A 1TALA 3MO3A 1SLXB 1O3KA 3VGCC 1MTWA 2GKVE 1FY4A 3E1XB 2FEQH 4R0IA 1MTUA 3LGTA 1E35B 4BXWA 1K1LA 7LPRA 1Z8JB 3PTNA 1PPBH 4INLA 2OP9A 1OWDA 4UEHH 2C3SA 2D2DA 2EA3A 3VGCB 1EP5A 1BDAA 3TU7H 1F92A 1EOJA 1GBLA 3PB1E 1V2JT 4YESB 2H1UA 2ZG0H 1LVMA 1AVXA 1P0SH 1DSUA 2QV1A 1MUEB 1QQ4A 1P3CA 4ISOA 1NFXA 1O3CA 3P8GA 3D23A 1VITF 1YPJH 2G00A 2ALVA 1OS8A 1JBUH 2ZFSA 3H7OA 1O32A 3SN8A 3A8CA 3E6PH 2FM2A 1B0EA 6GCHF 1LHGH 2AIQA 2FDAA 1HAHH 1GBDA 3A81A 5IDKA 2FI4E 3BTKE 3MNSA 1KTSB 4D7GA 2BLQA 2G55A 2ZDLA 3GCOA 4BTUB 1SHYA 4XBDA 4VGCC 5T3HA 1ELVA 1O2IA 3FFGA 1UTJA 1RIWB 2VIPA 2ZCLP 1Y3XA 4AZ2B 1K9OE 5DP4A 1DXPA 1KY9A 4CR5A 3AASA 4I8GA 1OWEA 2BY8X 4E7RG 3MU4A 1N6XA 2RDLA 1GBFA 4OS6A 5DP7A 1W7GH 1LPKB 1WV7H 3D49H 3RXQA 1INCA 1TYNA 1UTKA 2EC9H 4FUIA 3RC4A 3SNCA 1D6RA 1OWKA 3JZ1B 1SLUB 1V2NT 1O2LA 3AAVA 1GJ4H 3SZNA 3DUXH 1CA8B 1FY3A 1PPZA 1GHAF 3PMAB 1ZRBA 5EW1H 5GWZA 2PLXA 1BRAA 1ELBA 4K1SA 3RDZA 1B0FA 2DE8A 1DX5M 2JH0D 2V3OH 1S81A 1AFEH 1FPCH 4O03A 1A7SA 2BD3A 3LJJA 3HK3B 3ZZ5A 1EPTA 4WXVA 1P03A 2ZFQH 3TLOA 2FO9A 3LOXA 2VVCA 2JETC 6GCHG 2QC2A 4DCDA 1P2IA 3R0FA 2ODQA 4YO9A 1O35A 3V0XA 3SW2B 1BMNH 4GPGA 1LCYA 3EQ0H 1O3BA 1YF4A 3TJUA 1NN6A 1ELEE 1BTUA 4NSVA 3MU1A 1H8IH 3SHCH 2FP7B 3E91A 1F0SA 1H9HE 1Y3YA 1MBMA 1EAIA 1WUNH 1XVMA 3CS0A 2O8WA 1EX3A 3GYLB 1O5AB 2FI3E 1EASA 1O31A 4E06H 1IQEA 3UQOA 2GZ8A 1DITH 4X8TH 1DSTA 3ENSB 1F0RA 2A2XH 3NCLA 1C4V2 1BRBE 2BM2A 3RMNH 5E0HA 3ZZAA 2VIQA 3ZZCA 3UNSA 5CHAC 1MQ6A 4CRFA 2VIDA 3MFJA 1GDNA 3TGJE 1ZMJA 1ZSLA 2F9VA 3RXVA 4AG2A 3ZZ9A 1OXGA 1TA6A 5LH8A 2FOFA 2XTTB 1GHVH 4JZFH 1P06A 1QA7A 3QZQA 2J95A 1CGIE 1GVKB 1O3LA 1O5BB 4BOHA 5HXFA 2YNAA 1LHEH 4O9VA 1UK3A 1DY8A 1HFDA 4JMYA 4UFFH 1KXCA 1IAUA 1AB9C 3PROA 4X1RU 3P8OA 2Z6BD 5FCRA 2FWWA 3K6ZA 1V2PT 2BDCA 4XOJA 3SGQE 2BDYA 3VEQB 2CHAB 1A46H 1AE5A 1P2QA 1GBKA 1TMUH 1K1MA 3E0PB 1NPMA 3PO1C 1ANDA 3OY5U 3VB7A 4JCNA 2V6NA 1O2GH 4AYYB 5T6GA 3U8TH 1GI6A 3LGVA 1IQKA 3GCTF 2HNTE 4OS7A 2W5EA 2BHGA 2GV6A 2BVXH 2B9LA 4GSOA 3EYDA 2P3UB 4XFQA 1TQ0B 3VB5A 3KQEA 1G3BA 2V35A 1F0UA 1A5IA 2A7HA 2B5TB 3P8FA 3A7WA 3S0NA 1ZJDA 3T28A 3U98H 4HTCH 1L1NA 1GL0E 4YM9A 3MNBA 4AOQA 1ESAA 4XDEA 3ATLA 1NS3A 1ZPBA 3TH3H 1LO6A 3BG4C 4KELA 1BBRE 2I6QA 1FV9A 2PSYA 4X8UH 3URDA 4LK4A 1FIZA 3BTQE 2PR3A 2R3YA 4PROA 3KCGH 3GY2A 3GCHB 1LHFH 1GBHA 1H9IE 1D6WA 5HGGA 1THSH 2OD3B 3F9EA 1SGQE 3MI4A 3TIUA 3TK6A 1A61H 1O36A 4UFGH 4UFDH 1Z8IB 1LDTT 1O2VA 4ABBA 4FVBA 5HM9A 2GV7A 3U8RH 1T32A 3SU0A 1BB0B 1VCWA 2BMGB 5F6MA 3UREA 2BZ6H 1GBAA 4WWYA 3VXFH 3CP7A 1MBQA 2FZZA 2ZGJA 4NG9H 1O2ZA 4AB8A 2PGBB 3SJOA 1GJDB 3F9GA 2ESTE 5LPRA 1D3DB 2XC0A 1IQGA 4D9QA 4JZDH 1W14U 5EGMA 2ZQ1A 2HRVA 2Z94A 3MH6A 1GJ9B 4Q7ZA 2OCVB 1UHBB 1GPZA 3FVFB 1C1TA 1HB0B 4AG1A 1ZMNA 1QRXA 1KLIH 1TBRH 1V2VT 1EP6A 3TGIE 1AY6H 1CSOE 1KXBA 2F9NA 1PPFE 1TNIA 5F8TA 5C67A 2EI7A 2J38A 3GY5A 1CHOF 4ABEA 1K1JA 3K6YA 1FXYA 1GBEA 1SOZA 1ZHPA 3P70B 3TH4H 1EUFA 2VIVA 1SGIB 1V6DA 1FMGA 5E2PA 1NC6A 4FUDA 2OQUA 4ZXYH 1S6HA 1A4WH 2STBE 2J4IA 1O2PA 2ANKH 1HCGA 1AI8H 2Z9KA 1GJ6A 1ELDE 1CGJE 1GI4A 1VJAU 4JYUH 5C5NA 1DDJA 4DURA 4HI3A 4Z6AH 3S9AA 1FY1A 1O2WA 3BTEE 1P04A 3A7TA 3KGPA 2TBSA 3NPSA 4Y79A 5T6FA 1GJCB 5A8ZA 2OC7A 3TJOA 1TNGA 2IN2A 4WMEA 1EB1H 1C5LH 2I6SA 4MNVA 1BTHH 1L0ZA 1UTLM 5A8XA 4TYDA 1ZLRA 3UFAA 2TGTA 1ZTKA 3B23B 1T8NA 1ZPZA 3GDSA 5HMAA 1K1NA 4NWKA 1QB6A 1RTKA 1C1SA 1C2EA 1HBTH 4ZKNU 1BCUH 3RP2A 4NZLA 1W3CA 3V12A 3QTOH 4BAQB 3LH1A 4RKJB 4NIXA 2W7SA 2C90B 1XUFA 1TONA 1O5DH 3LT3A 2FPZA 2FS8A 5C20A 5A09A 3SJ8A 3M36A 1P05A 4H6SB 2QY0B 1SVPA 2PGQB 4IMQA 5FPTA 6LPRA 4CBNA 3VB3A 4DG4A 4IC5A 2ZP0H 3RXRA 2FYRA 1S5SA 4WH6A 4FUCA 2AIPA 3QTVH 5CE1A 2P95A 1LQDB 1C5OH 1DWEH 1GHBF 1IHTH 2SNWA 4OS4A 1MD7A 2SGQE 5TCCA 2BQWB 4ABGA 3TVJB 1XXDA 1TGTA 2XC4A 2NWNA 3PLBA 3PV4A 4D8NA 2G5VA 2A4OA 2Y6TA 4WMFA 3LGIA 1GGDB 1ETRH 4DJZB 1CT4E 3HGNA 5A8YA 1THRH 4AFSA 1FIWA 1H4WA 4K8YA 1K1IA 1LVBA 4M7GA 4Y8XA 1RTLA 1AE8H 3A87A 4X2WA 1W7XH 1CT0E 4GAWA 5DP3A 2ZI2H 1PQAA 2K1QA 1HPGA 5FPSA 1C2DA 4TPYA 4GHTA 1O3JA 1D3PB 5EPYA 1KXAA 1W0ZU 2PW8H 3LPRA 5EODA 2UUJB 4Y8YA 3ZZ3A 3MO9A 2ANYA 5JBBS 1HXFH 3W95A 3P17H 3SJKA 1UVTH 2R0LA 1HAOH 2BDBA 1Y3WA 1XVOA 4X0WU 4YZUA 1YPHC 3UTUH 3MU0A 2UWLA 3PLPA 1F5LA 1VJ9U 1O39A 2BQ6B 1VCPA 1J9CH 1K21H 2UWOA 3QK1A 5JBTA 1O3IA 6ESTA 5CHAB 4Y8ZA 3I29A 2NU4E 3A8BA 4ABDA 2B7DH 1NFWA 3TITA 1HV7A 4ABHA 3RLYH 3RMMH 1SR5C 4CH8B 1HLTH 1DICA 2GP9B 2QF0A 4FUEA 2TIOA 4UONA 3BEFB 1DFPA 3RXJA 1P2MA 2OINA 2A5KA 5FPYA 1O2KA 1EATA 4MG3A 1IQJA 2IPHA 1ELCA 2AGIX 2AMPA 3UWJH 3F6UH 2SNVA 2ZHDA 1ARBA 1CHGA 3V7TA 1J8AA 1T4VH 1HAYB 1C1NA 1QL9A 1QJ6B 3QO6A 1P9SA 3DHKH 4Y10E 4CBOA 1PJPA 3RXGA 4K5ZA 2ZZUH 2EEKA 1M9UA 3S7KB 1A0HB 2CJIA 1DANH 1TOCB 2ZDMA 1ANEA 2GZ7A 3QUMP 2HALA 2P8OC 1QY6A 5E8EH 1BUIA 1ELGA 4BTIB 1TGNA 2BY5X 3ZVDA 1UVUH 4WJG2 1RTFB 2Y82A 1GMCG 1MTVA 3BIVH 5DP6A 1E34B 3LGYA 1BA8B 2J94A 2WPKS 4RN6A 5DG6A 1AUTC 2H9TH 2PHBA 1S83A 3UNQA 1FJSA 3FZDA 3DFJA 1EZSC 2Q6DA 1QJ7B 4I8HA 3SO3A 3SQEE 2GDEH 3V3MA 1KSNA 1EZXC 2FX4A 1ZMLA 1QL7A 3BTGE 3T29A 3MHWU 4H4FA 3M61U 3RXUA 1GVLA 4IN1A 1P2OA 5FHTA 2V3HH 2ZPQA 2HLCA 2FTMA 2Y5GA 3SU6A 1TOMH 2QIQA 2OQ5A 2YOLA 4IC6A 1J14A 4FXGH 2XXLA 3SI3H 3ELAH 4FUGA 5F8ZA 1OP8A 3RXOA 1ANCA 5L2ZH 3UOPA 3RXLA 3LU9B 4K2YA 2BQ7B 3SV2H 2H9EH 1YCPK 1WSSH 3A84A 5F8XA 1GCTC 2SFAA 2STAE 1JWTA 1O2YA 1SMFE 4OGXA 5DP5A 4X2XA 1P02A 4J2YB 2J92A 1FQ3A 5FBEA 1V2UT 1TGCA 1BTXA 1YBWA 1J15A 2AGGX 4DT7B 3RXEA 7KMEH 4SGAE 2THFB 2ZU1A 1C1MA 1LKBA 2CF8H 3SV9A 4INHA 4X1SU 3EDXB 2F9BH 1TX7A 3SGBE 5FAHA 4BANB 1IQHA 1MH0A 1W11U 2BLOA 1O38A 1W13U 3UY9A 4JZIA 1FPHH 5B6OA 1ZTLA 4OGYA 1BHXB 4IGDA 2GCHG 3MNCA 1V2MT 2W26A 5EQSA 1TQ7B 4CRAA 1KXEA 3IITA 2EI8A 5E0JA 1VCQA 4TY7A 3F68H 3SUGA 5C3NA 3ZVGA 1C2HA 2Z9JA 4K1TA 1O0DH 3M5MA 1N8OB 5EXNA 1OYTH 4A6LA 2A7JA 1XUJA 1Z8RA 1NU9A 1UVPA 3RC5A 1XMNB 3A7ZA 1ZR0A 2FODA 1A5GH 2H2ZA 1A0JA 5LGOA 2QYIA 1WQSA 1TNLA 1FONA 2ZDNA 2TPIZ 4LZ1H 5G4BA 1KTTB 3GDUA 4YOGA 2H5CA 1GG6B 2ANMH 1Z1IA 1H8DH 3SU4A 2BB4A 1HAIH 3T62A 3M3SA 2WPLS 3PMHB 1LTOA 2GD4B 1SI5H 3GICB 1K1PA 3LC5A 1Z71A 4NIYA 1C1PA 1NRPH 4Q2KA 1KIGH 1KDQA 2CHAC 5A2MH 1MU8B 1ZYOA 2A5IA 1IQIA 3PO1B 3IG6B 3OYPA 3M7QA 3K9XB 1AZZA 3E8LA 4JYVH 1EKBB 1V2WT 1TX6A 4WXIA 2WPMS 1GI9B 1QBOA 3SUFA 1SGFA 3MOCA 1TABE 1FNIA 1GCDA 3ZZ4A 2FOCA 2Z3CA 3Q3YA 4RSPA 2UUKB 3A80A 2M5TA 1YPGH 3MYWA 1FI8A 3KF2A 4TY6A 4UFEH 1L1GA 2F9OA 3OSYA 2R9PA 1OP2A 4I8LA 1UJ1A 1O3EA 1DXWA 1MZDA 2J2UA 1CBWC 3RXDA 4U01A 3TNSA 4DY7B 1TGSZ 3FAOA 2GT8A 5H4IB 3KQCA 3TJNA 1C5MD 2GX4A 5CMXH 2OUAA 5JDUB 1PQ7A 3RXPA 1YM0A 1TPSA 3QN7A 4E05H 4A5TS 4AB9A 2BVSH 3TNTA 1BOQA 4Y0ZE 4I8JA 2TGAA 2BDHA 4ZHAA 1GI5A 3RXTA 1N6YA 4OS5A 5EW2H 5I25A 1N1LA 1V2LT 2XWAA 5E2OA 2A7CA 3PYHA 2Q1JA 7GCHG 3NZIA 1BTPA 1GHBG 2Y81A 2BOKA 2ODYB 5DP8A 2OBQA 1S6FA 1C5VA 1GGDC 2VH0A 2WUCA 5I46H 1O2QA 1DUAA 2C8ZB 5TJXA 1MTNC 2ODPA 2QA9E 8GCHF 1GDQA 3C1KA 2JETB 3LONA 4MTBA 3L3TA 3S7HB 1MU6B 3CS7A 4ASHA 1ZTJA 1UTQA 2HWLB 1QFKH 1RJXB 4YT6H 1EOLA 1NRSH 4AFZA 3GCNA 3SUEA 3U1JB 1JRTA 1WYKA 1HJAC 1OSSA 3ZVFA 3S9BA 3FP8E 2A0QB 1VITG 5GCHF 3BV9B 3U1IB 1O2JA 4OS1A 2IOTA 1IQMA 1ZRKA 2WPIS 1O2HA 1F2SE 1K2I1 3O8BA 2FOBA 1EPTB 2D8WA 1EJMA 4DIIH 1ORFA 2F83A 1ABJH 4YLUA 2BLWA 1IQFA 3SJIA 1KXFA 1V2TT 1D4PB 4D7FA 4B74A 1QCPA 4WF8A 4AGKA 5K7RA 1W12U 2A5AA 4TWWA 2CXVA 1C5PA 4HFPB 3RXFA 1LKAA 1THPB 3KQBA 2ZDVH 1CU1A 1MKWK 1SQAA 1Z6JH 4INKA 1QQUA 1AZ8A 4JYTA 8KME2 1P9UA 2QCYA 1B5GH 1BJUA 3PM3A 4NFFA 5J4QA 1HAVB 1OP0A 2QXJA 4B73A 3RU4D 3SUDA 5FBIA 2VVVA 2GDDA 2Y5HA 2GTBA 2ZFRH 4UDWH 1O5FH 2W7UA 4ESTE 1BTZA 4X6PA 2BD9A 2A32A 3KEEA 4KP0A 1C1VH 2VJ1A 1P57B 2AEIH 3DT0H 5EQQA 2PKSC 1O3PB 2C93B 4BAKB 1AHTH 2AH4X 3E3TA 1S82A 2XBYA 1TMTH 2ASUB 1AU8A 2ZPSA 3BSQA 1TE0A 2PKSB 3MH4A 3MH5A 4DOQA 3SV7A 2QXGA 3BTWE 1BIOA 3HGPA 1O3GA 1F5KU 1TNHA 4MNYA 1SG8B 1GI3A 1SB1H 3HPTB 5JPMH 1T8OA 1UTPA 2BD5A 4X8SH 1O30A 1LHDH 4E7NA 3BG8A 1FN6A 2F9UA 1RIWC 3ODFA 1P09A 2BXUH 4SGBE 2BY9X 3D65E 3RU4T 3HATH 4YT7H 2QAAA 1O2UA 1RFNA 1BRUP 1C4U2 1AD8H 1QBNA 5GJ4B 1YP9A 2VGCB 1P8VC 1O2XA 4FUHA 1JMOH 1TX8A 3GCHC 3MTYA 1ZGIA
chains in the Genus database with same CATH superfamily
3D62A 1A1RA 1S0QA 8GCHG 3OX7U 1T4UH 2GCHF 3E16B 4GCHF 3F2FA 1MTNB 1NESE 4ZKOU 3OTPA 2Y5FA 5FX5A 4B6EA 4H6TA 4B71A 1C5QA 3N99A 2BLVA 5C2ZA 1MMJN 1DT2A 5PTPA 1EAXA 4YOJA 3DD2H 8LPRA 3F3BA 4KTCA 1EZUC 1G30B 1J17T 2XYAA 3QLPH 5JYIA 1XUIA 4I8KA 3Q00A 1W10U 2VH6A 4X2VA 5DP9A 1XXFA 2SGFE 4MDSA 1G36A 3ZV8A 1SFIA 3MU5A 3OTJE 4ABFA 1ZJKA 1FLEE 3ATMA 1YCPM 4XSKU 7GCHF 2ZU3A 3K65B 1C5XB 1AVGH 1WOFA 4X6NA 3L6PA 2Y7ZA 2FYQA 1GHXH 1P2KA 4IS5A 1GBJA 3GY8A 1MZAA 3ESTA 1GL1A 1AKSA 2QF4A 1P10A 4ISLA 2ZGHA 5EU8A 1EAWA 2ZC9H 3BEUA 1HDTH 3A85A 3UIRA 4H42U 2XNIA 2EI6A 4K3JA 1NM6A 3H7TA 1E37B 3TGKE 3T25A 2QF5A 1Y3VA 1GHAG 4MNWA 1QHRB 1DOJA 1SQTA 1RD3B 2J98A 1TA2A 1CT2E 1AVWA 2PWXA 3VFEA 1EXFA 5J4SA 3OY6U 3LKWA 1C5RA 4LOYH 1CQQA 1TRYA 2P59A 2VWNA 3KIDU 1L4ZA 3OU0A 2F4LA 3ZZ8A 1B7XB 1K22H 2ZEBA 4AX9H 4BXSA 2ZHEH 4MPVA 4MLFB 2Z9LA 5EIYA 1YLDA 2FESH 1AN1E 3WW7A 3W1EA 1WTHD 3TH2H 1Z8GA 4AFQA 1BITA 1SQRA 4BNRA 2A2QH 1NY22 2HNTF 1WAYB 5C1YA 1SGCA 2Q6GA 2C8XB 4VGCB 5HM2A 2BD4A 3RUOA 3I78A 3ZZBA 2R2WU 2G51A 1MD8A 2QF3A 2ZF0H 2AMQA 3PRBA 2P8OB 1BTWA 2O8MA 2VBCA 1FDPA 1YGCH 2QXHA 5C5OA 3OEHD 1ELAA 1G3CA 1Q31A 3MO6A 2ZU4A 2XW9A 1BZXE 3TK5A 2PKAB 3KHVA 3KN2A 1O3HA 3FO8D 2HPPH 1UCYE 1LHCH 5ESBA 1QURH 1XX9A 4D9RA 1BBRH 3UWIA 1XUHA 2XRCA 1MAXA 2A4QA 2O9QA 1NU7B 1GWAA 4MNXA 3VPKA 1GI2A 2ZNKH 3EGKH 5LPFA 3F9FA 3SOSA 1OWIA 3HK6B 5GIBA 4IW4E 1L1JA 1OPHB 2F91A 1TRMA 3PWBA 3FP6E 3RXBA 2SGDE 2GCTB 1D9IA 1QGFA 3P8NA 2BDGA 3ZVEA 1O2MA 2GMTB 5EQRA 3BIUH 3BF6H 5A0BA 1ID5H 3A7YA 1L2EA 2FIRH 2G81E 2AYWA 1NRNH 3SORA 3TPIZ 5T6DA 4FVDA 2DE9A 2HVXA 3EE0B 2CN0H 1F7ZA 4ZUHA 1UMAH 2BZAA 3SU3A 4A1VA 3LGUA 1GBCA 2F9PA 4O3TA 4B76A 4ZXXH 1SHHB 1Y59T 2AMDA 2OTVA 5JBAS 2ZTYA 3ZZDA 1E0FD 4NIWA 1QR3E 4X6OA 1C5ZB 5EJZA 2B8OH 3SZEA 1P11E 4HGCA 5E0GA 1SSXA 1ABIH 1MKWH 2FMJA 1C5SA 3U8OH 3KNXA 1GI0A 2UWPA 3KYGA 1QA0A 3K2UA 4Q7XA 4BTTB 2ZTXA 1QRZA 1V2QT 1Y8TA 1SQOA 5ESTE 2VWOA 4Y6DA 2RA0A 1E36B 3HKJB 2PTCE 2XCNA 3LGWA 1DWBH 3QGNB 2OLGA 3P92A 1O5CB 3URCA 3S9CA 9ESTA 4B75A 3PMBB 4NA9H 1CHOG 1JOUB 1MABB 2QN5T 3QWCH 1C2MA 1YKTA 3A82A 2WPHS 1FY8E 1Z1JA 3MWIU 5GDSH 3UR6A 3ZVBA 2KCAA 1V2KT 1PQ8A 2CF9H 1TPPA 2G4UA 2GVFA 4Y7BA 6CHAC 1PQ5A 1RXPA 3E0NB 1HIAB 3H5CB 1GMDG 2RCEA 1KLJH 3B9FH 4CRCA 2ZKSA 4XBCA 1Z7KA 5DPAA 2CGAA 1TWXB 1QL8A 3EE7A 1CA0B 2NU1E 1P12E 1YWUA 2D26C 7ESTE 3CNRA 1GI7B 3KQDA 1PYTC 2OC1A 1Z6EA 1YCPH 1P01A 1AWFH 1SFQB 3LDXH 3T2NA 2FXRA 1YPEH 3VXEH 1UTMA 4FETA 2HVYB 3PV2A 4DGJA 1SGFG 1O33A 3FOAA 2FLRH 2C8WB 2FOEA 2VINA 1O2OA 3SU5A 3IWMA 4Y76A 3RU4E 1O3FA 2H6MA 1JRSA 5AFZH 4ABJA 3BG4B 1MTSA 2PV9B 2KR7A 5FL7D 1JXPA 4MQAA 1C2IA 1TMBH 2KCOA 2FX6A 2OBOA 3DA9B 2PUXB 5AVDA 4FUJA 4B2CA 4NGAH 3ZYEA 5DN6D 1UVSH 3PMJA 4AORA 3ATWA 1VITH 1JIMA 1UO6A 1TPAE 2H5DA 4I7YH 2LPRA 3ZZ7A 2ZQ2A 2G8TA 1YC0A 2BOHB 2SGEE 1YPKH 2ZA5A 1X7AC 2BDIA 3EAJA 5HYOA 3A8AA 4YTAA 2A31A 4RT1A 4XBBA 1GBIA 1SGYE 1C1WH 1V3XA 5FX6A 3I77A 3SI4H 2WINI 2P16A 1KXDA 3RXHA 1SGNE 4CH2B 3F1SB 1DY9A 4R8TB 1O3DA 2RG3A 1V2ST 2FOMB 4DVAU 2ULLA 1C5TA 1C1UH 3F0OA 5ETXA 3A86A 5FXLA 1ZHMA 4DW2U 4XE4A 1C5UA 1BQYA 2XBVA 4I33A 2FOAA 4GVUA 4YOIA 1GCTB 5KEDA 2GCTC 4AGJA 1BHXF 2ZFTA 3GCTG 2HNTC 2ZO3H 5EXLA 1AKSB 1GHZA 2SGAA 3M5OA 2Y80A 1H1BA 2LNCA 2ZU2A 1BJVA 3ATKA 1SGPE 2ANWA 3A89A 1O5EH 1PFXC 1CE5A 4D76A 3DCLA 3KYFA 4ISNA 1O5GH 2A45B 1HJAB 1MKXH 9LPRA 1O2NA 3M3VA 3FN8A 3AW0A 2M2AA 1UHBA 2HPQH 3SU1A 2WV4A 1S0RA 1EPTC 2BVRH 1UTOA 4THNH 1UCYK 2XWBI 1BMMH 4Z0KA 5JB8S 3R3GB 4K1EA 1JIRA 2TRMA 2F3CE 1GI1A 3GY6A 1ELFA 5AF9H 2O8LA 5K0HA 1A3EH 2TGPZ 1C9TA 1G9IE 2OC8A 1MCTA 2WYJA 1EAUA 3TJVA 5AHGH 1UK4A 2EY4C 1GMDF 1Y5UT 1UTNA 1FUJA 2BX3A 3ZV9A 3GY7A 2KAIB 3T26A 1KLTA 1QRWA 1IQNA 2BXTH 1HRTH 3UR9A 1EB2A 3SJ9A 1LQEA 4FUBA 1PYTD 1XUKA 2XBXA 4X1QU 1C2GA 3A83A 3M7TA 3VB4A 3VG8A 1HIAA 5A0AE 1A3BH 1G2LA 1WCZA 3QGJA 4JK5A 3RXCA 1ARCA 3RMOH 6CHAB 4KTSA 2KX4A 1DS2E 1WBGB 1UVOA 2CMYA 2PSXA 5A0CA 1F5RA 4MPUA 2VB0A 4WVPE 5F03A 5GCHG 2G52A 3DSOA 2C4FH 3O8DA 1C4Y2 2ZGXH 5ABWA 1FN8A 4F49A 3C27B 5BRRE 1GJ7B 4KKDA 2P94A 1ZHRA 3S69A 4CRGA 2A4GA 4NWLA 2BD7A 2VIWA 2W3IA 1LVOA 3ZYDA 3SNAA 3M5NA 4WH8A 1D3QB 2WUBA 8ESTE 1C5WB 5DJ7A 3RM0H 2XCFA 3A8DA 2Z3EA 3RXKA 1GMCF 3SGAE 2ZHWH 1LVYA 2B0FA 4GLYA 1TIOA 4TPIZ 1SGRE 2J34A 4HZHA 3MU8A 2F43B 1OYQA 1W0YH 2JH5D 2PTNA 3N7OA 1O3AA 3QX5H 3BTME 4LXBH 2PUQH 2AFQB 1SGEE 2GGVB 2XC5A 4ABIA 1GMHG 1RRKA 5SGAE 1TAWA 4I32A 5GPIB 1YLCA 3BTHE 2VWMA 1CO7E 2ZWLH 3SNDA 3MMGA 5L30H 1ZZZA 2BD8A 1RS0A 4ZKSU 1AO5A 4Y7AA 4XRNA 1C9PA 1TB6H 5HIYA 2WPJS 2Z9GA 1NZQH 2QGRA 4K8BA 1S85A 2IJOB 1UCYH 3ATIA 3UPEA 4CRBA 2R0KA 2BYAX 1GBBA 1YPHE 1OX1A 1YPMH 2UUFB 4CR9A 4MPWA 4GHQA 1W2KH 2BDAA 2VVUA 3MQKC 1ZOMA 4IBLH 3NKKA 1BTYA 4AYVB 1BMAA 1Q3XA 3G01A 1HNEE 2J98B 4ZHMU 4LZ4B 4O3UA 2K8IA 3T5FH 2OXSA 3NXPA 1YPLH 2JKHA 4A1XA 5JB9S 2W3KA 3GY4A 4M9FA 1C2JA 4X6MA 4B1TA 4TWYA 1G37A 1LPZB 4Y71A 1NRQH 1SC8U 1OWJA 1QB1A 4IMZA 2ZFFH 1WDIA 4NSYA 4X1PU 1GBTA 1UK2A 5L6NH 3RXIA 5DGJA 1N8OC 1ZPCA 2ZPRA 5HIZA 1ETSH 4AC9A 1K1OA 1C1OA 1T31A 1DUEA 1YYY1 2ZGBH 5EPNA 1T7CA 1BRCE 1NBME 1DM4B 3RXMA 1ACBE 4FU8A 4JZ1A 2ZFPH 4DT4A 4KGAA 2ZCHP 4K60A 2ILNA 1TNKA 2VU8E 2KAIA 1AB9B 1OOKB 1EJAA 4O97A 1FAKH 3UQVA 3SNBA 1CA0C 3BTDE 2YMSC 1QTFA 3SYJA 1TNJA 2HOBA 4YLQH 1ESBA 2NU3E 1AFQB 3V13A 3ITIA 3EA9A 3WY8A 3RXAA 2BX4A 2ZGCA 3AVZA 3SNEA 3LIWA 3U9AH 3ZVAA 3QDZB 1CVWH 4ZKRU 4AN7A 3P95A 2HGTH 3M7UA 1SLVB 5GXPA 1CGHA 1VGCC 3STIA 3W94A 1HAGE 3L33A 3P6ZB 1D3TB 2CV3A 4GCHG 5DK1A 1WTGH 1G3EA 4NCYA 3TK9A 3GYMA 1GI8B 1QB9A 1A0LA 1C1RA 1VGCB 5C0TA 1C2KA 1NROH 1AGJA 1P2JA 2GJGA 3N7EA 4Y11E 3ZZ6A 3B8JA 4FUFA 1MQ5A 3HKIB 2Z3DA 4NA7A 1DWDH 1HGTH 4Y0YE 1DWCH 1CBWB 2D1JA 1W0JD 4NFEA 4BAMB 5C1UA 2ZDAH 4ZAEA 2UUYA 2BY6X 2OC0A 1C2LA 1GJ8B 3O8CA 3EA7A 1S84A 1A2CH 3CENA 4DIHH 3RXSA 4IN2A 2QXIA 4ZH8A 1VR1H 1ANBA 2Y7XA 3GOVB 2GMTC 4GUXA 5BPEA 5EOKA 1G2MA 4ABAA 1ZGVA 2XNDD 1WQVH 5C17A 1VZQH 3LJOA 1C5NH 3Q3KA 4Q7YA 1SL3A 1GJAB 1BT7A 4X8VH 2KFWA 2FLBH 5LPEA 4U30A 2IJD1 1T8MA 3A88A 4MPXA 1H9LB 4UD9H 5C1XA 4OS2A 1FZZA 3Q76A 1O3NA 2DUCA 3SQHE 1QNJA 1ESTA 1O2SA 2WZQA 3BTTE 4WMDA 1J16A 1K28D 2J5UA 1NT1A 3MNXA 1FY5A 3KL6A 4B2AA 1GMHF 2Q6FA 1W8BH 1V2OT 1O37A 1NTPA 3FZZA 1IQLA 1LPGB 1DPOA 1EJNA 2AS9A 2A1DB 1C2FA 4UE7H 3U69H 1G32B 2O8TA 2VIOA 1KDQB 1OKXA 3GS9A 1TRNA 5FCKA 1WU1A 2FI5E 1KYNA 1TBZH 4ISIH 3Q77A 3RM2H 1GVZA 3Q3XA 2FOHA 4U2WA 1TPOA 2ZTZA 1AMHA 4J1YA 2G4TA 2YNBA 3PTBA 3UOUA 1WXRA 4ZROA 4Q80A 1DLKB 4ACAA 1U6QA 1HAVA 1GBMA 1GHYH 3NUMA 1HYLA 2Z7FE 4X1NU 1E38B 1SOTA 5DO4H 1XM1A 3GISB 1O3MA 3M35A 4JZEH 1O2RA 3A7XA 2H9HA 1V2RT 3SHAH 4NIVA 3T27A 1SBWA 1AFQC 4CREA 1BBRK 1OWHA 2PFEA 2SGPE 1XKAC 2Z9IA 3UAIC 1DVAH 2FS9A 3UNRA 2ZU5A 1MAYA 2GT7A 1GG6C 2BTCE 3ZIAD 4BAHB 2R2MB 1HAXB 3A7VA 3M3TA 2GZ9A 2WV5A 4K69A 2P3TB 1P2NA 1SGTA 3BEIB 3SV6A 2BD2A 4ISHH 2ZIQH 4KTUA 4X2YA 1HJ8A 2FTLE 2P93A 3JZ2B 3GDVA 2BY7X 2C8YB 4JK6A 2AGEX 3LC3A 1TBQH 2VNTA 1ELTA 1O3OA 2TGDA 2AERH 1PPHE 3SV8A 3FANA 5L2YH 4I31A 4CHAC 1QBVH 1HUTH 1Y5BT 1SGDE 4A1TA 4BAOB 4RKOB 1Y5AT 2A4RA 1TLDA 1HAPH 1O34A 2R3UA 1SLWB 3M5LA 1EZQA 1F0TA 1C5YB 4CHAB 2KM0A 1XKBC 1DE7H 3PLKA 2RA3A 3NK8A 1T8LA 3STJA 1PPCE 1FAXA 3AW1A 2FOGA 1C1QA 1K0HA 1ZSJA 4FU7A 1GJ5H 1A5HA 3ZVCA 4ZHLU 1EQ9A 2VGCC 1QZ8A 2JIZD 1AWHB 1HXEH 3RC6A 2O8UA 3DFLA 3EA8A 3VB6A 2PKAA 2WYGA 5IYTA 1GDUA 1AQ7A 2ZHFH 1TFXA 4B2BA 2NU0E 3F9HA 2ZDKA 3O8RA 1PPGE 1NFUA 4NZQA 1FX0B 3FP7E 1IHSH 2VWLA 2NU2E 4U32A 3PWCA 3H09A 1G3DA 1XUGA 2XBWA 4F4OC 2ALPA 1DLEA 5C94A 3FKSD 4ZMAH 1MCVA 3UUZA 2ZHQH 5EG4A 1HAZB 5EXMA 5TCAA 1GHWH 4CRDA 1NRRH 4MVNA 3SBKA 1QJ1B 1L4DA 3BTFE 3AAUA 3SU2A 5JBCS 1NFYA 2V0BA 3QZRA 1TGBA 1BMLA 1IOEA 1P3EA 4FU9A 2J9NA 1MKXK 4WY3A 1ETTH 1GJBB 1PPEE 3BN9A 1ZSKA 1H8HD 3E90B 1Y3UA 2JH6D 3NWUA 2ZECA 3MH7A 1QIXB 4QT8C 1O2TA 3RLWH 5DKMA 4AFUA 3RMLH 1HJ9A 2ZCKP 4A92A 4A7IB 5AFYH 3LH3A 1LMWB 1S6LA 2P3FH 1RGQA 1NO9H 3ODDA 3GY3A 2G5NA 4NA8A 1AIXH 1AUJA 1SPJA 1Q2WA 3M37A 1TALA 3MO3A 1SLXB 1O3KA 3VGCC 1MTWA 2GKVE 1FY4A 3E1XB 2FEQH 4R0IA 1MTUA 3LGTA 1E35B 4BXWA 1K1LA 7LPRA 1Z8JB 3PTNA 1PPBH 4INLA 2OP9A 1OWDA 4UEHH 2C3SA 2D2DA 2EA3A 3VGCB 4P02A 1EP5A 1BDAA 4XD7D 3TU7H 1F92A 1EOJA 1GBLA 3PB1E 2AHME 1V2JT 4YESB 2H1UA 2ZG0H 1LVMA 1AVXA 1P0SH 1DSUA 2QV1A 4ZCNA 1MUEB 4OM9A 1QQ4A 1P3CA 4ISOA 1NFXA 1O3CA 3P8GA 4F48B 3D23A 1VITF 1YPJH 2G00A 2ALVA 1OS8A 1JBUH 2ZFSA 3H7OA 1O32A 3SN8A 3A8CA 3E6PH 2FM2A 1B0EA 6GCHF 1LHGH 2AIQA 2FDAA 1HAHH 1GBDA 3A81A 5IDKA 2FI4E 3BTKE 3MNSA 1KTSB 4D7GA 2BLQA 2G55A 2ZDLA 3GCOA 4BTUB 1SHYA 3PRDA 4XBDA 4VGCC 5T3HA 1ELVA 1O2IA 3FFGA 1UTJA 1RIWB 2VIPA 2ZCLP 1Y3XA 2KZ4A 4AZ2B 1K9OE 5DP4A 1DXPA 1KY9A 2QE7D 3AASA 4CR5A 4I8GA 1OWEA 2BY8X 4E7RG 3MU4A 1N6XA 2RDLA 1GBFA 4OS6A 5DP7A 1W7GH 1LPKB 1WV7H 3D49H 3RXQA 1INCA 1TYNA 1UTKA 2L74A 2EC9H 4FUIA 3RC4A 3SNCA 1D6RA 1OWKA 3JZ1B 1SLUB 1V2NT 1O2LA 3AAVA 1GJ4H 3SZNA 3DUXH 1CA8B 1FY3A 1PPZA 1GHAF 3PMAB 1ZRBA 5EW1H 5GWZA 2PLXA 1BRAA 1ELBA 4K1SA 3RDZA 1B0FA 2DE8A 1DX5M 2JH0D 2V3OH 1S81A 1AFEH 3F2GA 1FPCH 4O03A 1A7SA 2BD3A 3LJJA 3HK3B 3ZZ5A 1EPTA 4WXVA 1P03A 2ZFQH 3TLOA 2FO9A 3LOXA 2VVCA 2JETC 3N7DA 6GCHG 2QC2A 4DCDA 1P2IA 3R0FA 2ODQA 4YO9A 2W6ID 2WSSD 1O35A 3V0XA 3SW2B 2J97A 1BMNH 4GPGA 1LCYA 3EQ0H 1O3BA 1YF4A 3TJUA 1NN6A 1ELEE 1BTUA 4NSVA 4P00A 3MU1A 1H8IH 3SHCH 2FP7B 3E91A 1F0SA 1H9HE 1Y3YA 1MBMA 1EAIA 1WUNH 1XVMA 3CS0A 2CK3D 2O8WA 1EX3A 2K0QA 3GYLB 1O5AB 2FI3E 1EASA 1O31A 4E06H 1IQEA 3UQOA 2GZ8A 1DITH 5EJLA 4X8TH 1DSTA 3ENSB 1F0RA 2A2XH 3NCLA 1C4V2 1BRBE 2BM2A 3RMNH 5E0HA 3ZZAA 2VIQA 3ZZCA 3UNSA 5CHAC 1MQ6A 4CRFA 2VIDA 3MFJA 1GDNA 4RI0A 3TGJE 1ZMJA 1ZSLA 2F9VA 3RXVA 4AG2A 3F0PA 3ZZ9A 1OXGA 1TA6A 5LH8A 2FOFA 2XTTB 1GHVH 4JZFH 1P06A 1QA7A 3QZQA 2J95A 1CGIE 1GVKB 1O3LA 1O5BB 4BOHA 5HXFA 2YNAA 1LHEH 4O9VA 1UK3A 1DY8A 1HFDA 4JMYA 4UFFH 1VKYA 1KXCA 1IAUA 1AB9C 3PROA 3OAAD 4X1RU 3P8OA 2Z6BD 5FCRA 2FWWA 3K6ZA 1V2PT 2BDCA 4XOJA 3SGQE 2BDYA 3VEQB 2CHAB 1A46H 1AE5A 1P2QA 1GBKA 1TMUH 1K1MA 3E0PB 1NPMA 2XOKD 3PO1C 1ANDA 3OY5U 3VB7A 4JCNA 2V6NA 1O2GH 4AYYB 5T6GA 3U8TH 1GI6A 3LGVA 1IQKA 3GCTF 2HNTE 4OS7A 2W5EA 2BHGA 2GV6A 2BVXH 2B9LA 4GSOA 3EYDA 2P3UB 2KCPA 4XFQA 1TQ0B 3VB5A 3KQEA 1G3BA 2V35A 1F0UA 1E79D 1A5IA 2A7HA 2B5TB 3P8FA 3A7WA 3S0NA 2EQNA 1ZJDA 3T28A 3U98H 4HTCH 1L1NA 1GL0E 4YM9A 3MNBA 3OE7D 4AOQA 1ESAA 4XDEA 3ATLA 1NS3A 1ZPBA 1KMHB 3TH3H 1LO6A 3BG4C 4KELA 1BBRE 2I6QA 1FV9A 2PSYA 4X8UH 3URDA 4LK4A 4Z1MD 1FIZA 3BTQE 3OEED 2PR3A 2R3YA 4PROA 3KCGH 3GY2A 3GCHB 1LHFH 1GBHA 1H9IE 1D6WA 5HGGA 1THSH 2OD3B 3F9EA 1SGQE 3MI4A 3TIUA 3TK6A 1A61H 1O36A 4UFGH 4UFDH 1Z8IB 1LDTT 1O2VA 4ABBA 3WWFA 4FVBA 5HM9A 2GV7A 3U8RH 1T32A 3SU0A 1BB0B 1VCWA 2BMGB 2HLDD 5F6MA 3UREA 2BZ6H 1GBAA 4WWYA 3VXFH 3CP7A 1MBQA 2FZZA 2ZGJA 4NG9H 1O2ZA 5DSFA 2PGBB 4AB8A 3SJOA 1GJDB 3F9GA 2ESTE 5LPRA 3F2HA 1D3DB 2XC0A 1IQGA 4D9QA 4JZDH 1W14U 5EGMA 2ZQ1A 2HRVA 2Z94A 3MH6A 1GJ9B 4Q7ZA 2OCVB 1UHBB 1GPZA 3FVFB 1C1TA 1HB0B 4AG1A 1ZMNA 1QRXA 1KLIH 1TBRH 1V2VT 1EP6A 3TGIE 1AY6H 1CSOE 1KXBA 2F9NA 1PPFE 1TNIA 4FOUC 5F8TA 5C67A 2EI7A 2J38A 3GY5A 1CHOF 4ABEA 1K1JA 3K6YA 1FXYA 4F55A 1GBEA 1SOZA 1ZHPA 3P70B 3TH4H 2JDID 1EUFA 1SGIB 1V6DA 1FMGA 2VIVA 5E2PA 1NC6A 4FUDA 2OQUA 4ZXYH 1S6HA 1A4WH 4HG6A 2STBE 2J4IA 1O2PA 2ANKH 1HCGA 1AI8H 2Z9KA 1NBMD 1GJ6A 1ELDE 2OK5A 1CGJE 1GI4A 1VJAU 4JYUH 5C5NA 1DDJA 4DURA 4HI3A 4Z6AH 3S9AA 1FY1A 1O2WA 3BTEE 1P04A 3A7TA 1E1RD 3KGPA 2TBSA 3NPSA 4Y79A 5T1VA 5T6FA 2RDEA 1GJCB 5A8ZA 2OC7A 3TJOA 1TNGA 2IN2A 4WMEA 1EB1H 1C5LH 2I6SA 4MNVA 1BTHH 1L0ZA 1UTLM 5A8XA 4TYDA 1ZLRA 3UFAA 2TGTA 1BMFD 1ZTKA 3B23B 1T8NA 1ZPZA 3GDSA 5HMAA 1K1NA 4NWKA 1QB6A 1RTKA 2JJ2D 1C1SA 5KECA 1C2EA 1HBTH 4ZKNU 1BCUH 3RP2A 4NZLA 1W3CA 3V12A 3QTOH 4BAQB 3LH1A 4RKJB 4NIXA 2W7SA 1UW7A 5KGOA 2C90B 1XUFA 1TONA 1O5DH 3LT3A 2FPZA 3UB0A 2FS8A 5C20A 5A09A 3SJ8A 3M36A 1P05A 4H6SB 4RT0A 2QY0B 1SVPA 2PGQB 4IMQA 5FPTA 6LPRA 4CBNA 3VB3A 4DG4A 4IC5A 2ZP0H 3RXRA 1H8ED 1S5SA 2FYRA 4WH6A 4FUCA 4Q63A 2AIPA 3QTVH 5CE1A 2P95A 1LQDB 1C5OH 1DWEH 1GHBF 1IHTH 2RFKC 1E1QD 2SNWA 4OS4A 1MD7A 2SGQE 5TCCA 2BQWB 4ABGA 3TVJB 1XXDA 1TGTA 2XC4A 2NWNA 3PLBA 3PV4A 4D8NA 2WV9A 2G5VA 2A4OA 2Y6TA 4WMFA 3LGIA 1GGDB 1ETRH 4DJZB 1CT4E 3HGNA 5A8YA 1THRH 4AFSA 1FIWA 1H4WA 4K8YA 1K1IA 1LVBA 4M7GA 4Y8XA 1RTLA 1AE8H 3A87A 4X2WA 1W7XH 1CT0E 4GAWA 4ASUD 5DP3A 2ZI2H 1PQAA 2K1QA 1HPGA 2PP6A 5FPSA 1C2DA 4TPYA 4GHTA 1O3JA 1D3PB 5EPYA 1KXAA 1W0ZU 2PW8H 3LPRA 5EODA 2UUJB 4Y8YA 3ZZ3A 3MO9A 2ANYA 5JBBS 1HXFH 3W95A 3P17H 3SJKA 1UVTH 2R0LA 1HAOH 2BDBA 2WPDD 1Y3WA 1XVOA 4X0WU 4YZUA 1YPHC 3UTUH 3WWBA 4ACBA 3MU0A 2UWLA 3PLPA 1F5LA 1VJ9U 1O39A 2BQ6B 1VCPA 1J9CH 1K21H 2UWOA 3QK1A 5JBTA 1O3IA 6ESTA 5CHAB 4YXWD 4Y8ZA 3I29A 2NU4E 3A8BA 4ABDA 2B7DH 1NFWA 3TITA 1HV7A 2V3MA 4ABHA 3RLYH 3RMMH 1SR5C 4CH8B 1HLTH 5IK2D 1DICA 2GP9B 2QF0A 4FUEA 2TIOA 4UONA 3BEFB 1DFPA 3RXJA 1P2MA 2OINA 2A5KA 5FPYA 1O2KA 1EATA 4MG3A 1IQJA 2WHXA 2IPHA 1ELCA 2AGIX 2AMPA 3OFND 3F6UH 3UWJH 2SNVA 2ZHDA 1ARBA 1CHGA 3V7TA 1J8AA 1T4VH 1HAYB 1C1NA 1QL9A 1QJ6B 3QO6A 1YY3A 1P9SA 3DHKH 4Y10E 4CBOA 1PJPA 5F53A 3RXGA 3PV5A 4K5ZA 2ZZUH 2EEKA 1M9UA 3S7KB 1A0HB 2CJIA 1DANH 1TOCB 2ZDMA 1ANEA 2GZ7A 3QUMP 2HALA 2P8OC 1QY6A 5E8EH 1BUIA 5GNDA 1ELGA 4BTIB 1TGNA 2BY5X 3ZVDA 1UVUH 4WJG2 1RTFB 2Y82A 1GMCG 1MTVA 1EFRD 1YLNA 3BIVH 5DP6A 1E34B 3LGYA 1BA8B 2J94A 2WPKS 4RN6A 5DG6A 1AUTC 5C0UA 2H9TH 2PHBA 1S83A 3UNQA 1FJSA 3FZDA 3DFJA 1EZSC 2Q6DA 1QJ7B 4I8HA 3SO3A 3SQEE 2GDEH 3V3MA 1KSNA 1EZXC 2FX4A 1ZMLA 1QL7A 3BTGE 3T29A 3MHWU 4H4FA 3M61U 3RXUA 1GVLA 4IN1A 1P2OA 3AK5A 5FHTA 2V3HH 2ZPQA 2HLCA 2FTMA 2Y5GA 3SU6A 1TOMH 2QIQA 2OQ5A 2L6OA 2YOLA 4IC6A 1J14A 4FXGH 2W6JD 2XXLA 3SI3H 3ELAH 4FUGA 5F8ZA 1OP8A 3RXOA 1ANCA 5L2ZH 3UOPA 3RXLA 5CHBA 3LU9B 4K2YA 2BQ7B 3SV2H 2H9EH 1YCPK 1WSSH 3A84A 5F8XA 1GCTC 2SFAA 2STAE 1JWTA 1O2YA 1SMFE 4OGXA 5DP5A 4X2XA 2V7QD 1P02A 4J2YB 2J92A 1FQ3A 5FBEA 1V2UT 1TGCA 1BTXA 1YBWA 1J15A 2AGGX 4DT7B 3RXEA 7KMEH 4SGAE 2THFB 2ZU1A 1C1MA 1LKBA 2CF8H 3SV9A 4INHA 4X1SU 3EDXB 2F9BH 1TX7A 3SGBE 5FAHA 4BANB 1IQHA 1MH0A 1W11U 2BLOA 1O38A 1W13U 3UY9A 4JZIA 1FPHH 5B6OA 1ZTLA 4OGYA 1BHXB 4IGDA 2GCHG 3MNCA 1V2MT 2W26A 5EQSA 1TQ7B 4CRAA 1KXEA 3IITA 2EI8A 5E0JA 1VCQA 4TY7A 3F68H 3SUGA 5C3NA 3ZVGA 1C2HA 2Z9JA 4K1TA 1O0DH 3M5MA 1N8OB 5EXNA 5CDFE 1OYTH 4A6LA 2A7JA 1XUJA 1Z8RA 1NU9A 2IPQX 1UVPA 3RC5A 1XMNB 3A7ZA 1ZR0A 1OHHD 2FODA 1A5GH 2H2ZA 1A0JA 5LGOA 2QYIA 1WQSA 1TNLA 1FONA 2ZDNA 2TPIZ 4LZ1H 5G4BA 1KTTB 3GDUA 4YOGA 2H5CA 1GG6B 2ANMH 1Z1IA 1H8DH 3SU4A 2BB4A 1HAIH 3T62A 3M3SA 2WPLS 3PMHB 5B6LA 1LTOA 2GD4B 4TT3D 1SI5H 3GICB 1K1PA 3LC5A 1Z71A 4NIYA 1C1PA 1NRPH 4Q2KA 1KIGH 1KDQA 2CHAC 5A2MH 1MU8B 1ZYOA 2A5IA 1IQIA 3PO1B 3IG6B 3OYPA 3M7QA 3K9XB 1AZZA 3E8LA 4JYVH 1EKBB 1V2WT 1TX6A 4WXIA 2WPMS 1GI9B 1COWD 1QBOA 3SUFA 1SGFA 3MOCA 1TABE 1FNIA 1GCDA 3ZZ4A 1W0KD 2FOCA 2Z3CA 3Q3YA 4RSPA 2UUKB 3A80A 2M5TA 1YPGH 3MYWA 3NRLA 1FI8A 3KF2A 4TY6A 4UFEH 1L1GA 2F9OA 3OSYA 2R9PA 1OP2A 4I8LA 1UJ1A 1O3EA 1DXWA 1MZDA 2J2UA 1CBWC 3RXDA 4U01A 3TNSA 4DY7B 1TGSZ 3FAOA 2GT8A 5H4IB 3KQCA 3TJNA 1C5MD 2GX4A 5CMXH 2OUAA 5JDUB 1PQ7A 3RXPA 1YM0A 1TPSA 3QN7A 4E05H 4A5TS 4AB9A 2BVSH 2LP6A 3TNTA 1BOQA 4Y0ZE 4I8JA 1SKYE 2TGAA 2BDHA 4ZHAA 1GI5A 3RXTA 1N6YA 4OS5A 5EW2H 5I25A 1N1LA 1V2LT 2XWAA 5E2OA 2A7CA 3PYHA 2Q1JA 7GCHG 3NZIA 1BTPA 1GHBG 2Y81A 2BOKA 2ODYB 5DP8A 2OBQA 1S6FA 1C5VA 1GGDC 2VH0A 2WUCA 5I46H 1O2QA 1DUAA 2C8ZB 5TJXA 1MTNC 2ODPA 2QA9E 8GCHF 1GDQA 3C1KA 2JETB 3LONA 4MTBA 3L3TA 3S7HB 1MU6B 3CS7A 4ASHA 1ZTJA 1UTQA 2HWLB 1QFKH 1RJXB 4YT6H 1EOLA 1NRSH 4AFZA 3GCNA 3SUEA 3U1JB 1JRTA 2LELA 1WYKA 5HKKD 1HJAC 1OSSA 4TSFD 3ZVFA 3S9BA 3FP8E 2A0QB 2YMSD 1VITG 5GCHF 3BV9B 3U1IB 1O2JA 4OS1A 2IOTA 1IQMA 1ZRKA 1O2HA 1F2SE 2WPIS 1K2I1 3O8BA 2FOBA 1EPTB 2D8WA 1EJMA 4DIIH 1ORFA 2F83A 1ABJH 4YLUA 2BLWA 1IQFA 3SJIA 1KXFA 1V2TT 1D4PB 4D7FA 4B74A 1QCPA 4WF8A 4AGKA 5K7RA 1W12U 2A5AA 4TWWA 2CXVA 1C5PA 4HFPB 3RXFA 1LKAA 1THPB 3KQBA 2ZDVH 1CU1A 1MKWK 1SQAA 1Z6JH 4INKA 1QQUA 1AZ8A 4JYTA 8KME2 1P9UA 2QCYA 4I86A 1B5GH 1BJUA 3PM3A 4NFFA 5J4QA 1HAVB 1OP0A 2QXJA 4B73A 3RU4D 3SUDA 5FBIA 2YMSB 2VVVA 2GDDA 2Y5HA 2GTBA 2ZFRH 4UDWH 3DSGA 1O5FH 2W7UA 4ESTE 1BTZA 3DSPA 4X6PA 2BD9A 2A32A 3KEEA 4KP0A 1C1VH 2VJ1A 1P57B 2AEIH 3DT0H 5EQQA 2PKSC 1O3PB 2C93B 4BAKB 1AHTH 2AH4X 3E3TA 1S82A 2XBYA 1TMTH 4B6FA 2ASUB 3KQ5A 1AU8A 2ZPSA 3BSQA 4Q4LA 1TE0A 2JJ1D 2PKSB 3MH4A 3MH5A 4DOQA 3SV7A 2QXGA 3BTWE 1BIOA 3HGPA 1O3GA 1F5KU 1TNHA 4MNYA 1SG8B 1GI3A 1SB1H 3HPTB 5JPMH 1T8OA 1UTPA 2KCYA 5EJ1A 2BD5A 4X8SH 1O30A 1LHDH 4E7NA 3BG8A 3U28C 1FN6A 2F9UA 1RIWC 3ODFA 1P09A 2BXUH 4SGBE 2BY9X 3D65E 3RU4T 3HATH 4YT7H 2QAAA 1O2UA 1RFNA 1BRUP 1C4U2 1AD8H 1QBNA 5GJ4B 1YP9A 2VGCB 1P8VC 1O2XA 4FUHA 1JMOH 1TX8A 3GCHC 3MTYA 1ZGIA
chains in the Genus database with same CATH topology
3D62A 1A1RA 1S0QA 8GCHG 3OX7U 1T4UH 2GCHF 3E16B 4GCHF 1MTNB 1NESE 4ZKOU 5FX5A 2Y5FA 4H6TA 4B71A 1C5QA 2BLVA 5C2ZA 1MMJN 1DT2A 5PTPA 1EAXA 4YOJA 3DD2H 8LPRA 4KTCA 1EZUC 1G30B 1J17T 2XYAA 3QLPH 5JYIA 1XUIA 4I8KA 3Q00A 1W10U 2VH6A 4X2VA 5DP9A 1XXFA 2SGFE 4MDSA 1G36A 3ZV8A 1SFIA 3MU5A 3OTJE 4ABFA 1ZJKA 1FLEE 3ATMA 1YCPM 4XSKU 7GCHF 2ZU3A 3K65B 1C5XB 1AVGH 1WOFA 4X6NA 3L6PA 2Y7ZA 2FYQA 1GHXH 1P2KA 4IS5A 1GBJA 3GY8A 1MZAA 3ESTA 1GL1A 1AKSA 1P10A 4ISLA 2ZGHA 5EU8A 1EAWA 2ZC9H 3BEUA 1HDTH 3A85A 3UIRA 4H42U 2XNIA 2EI6A 4K3JA 1NM6A 3H7TA 1E37B 3TGKE 3T25A 1Y3VA 1GHAG 4MNWA 1QHRB 1DOJA 1SQTA 1RD3B 1TA2A 1CT2E 1AVWA 2PWXA 3VFEA 1EXFA 5J4SA 3OY6U 3LKWA 1C5RA 4LOYH 1CQQA 1TRYA 2P59A 2VWNA 3KIDU 1L4ZA 3OU0A 3ZZ8A 1B7XB 1K22H 2ZEBA 4AX9H 4BXSA 2ZHEH 4MPVA 4MLFB 2Z9LA 1YLDA 2FESH 1AN1E 1WTHD 3TH2H 1Z8GA 4AFQA 1BITA 4BNRA 2A2QH 1NY22 2HNTF 1WAYB 5C1YA 1SGCA 2Q6GA 2C8XB 4VGCB 5HM2A 2BD4A 3RUOA 3I78A 3ZZBA 2R2WU 2G51A 1MD8A 2QF3A 2ZF0H 2AMQA 2P8OB 1BTWA 2O8MA 1FDPA 1YGCH 2QXHA 5C5OA 1ELAA 1G3CA 1Q31A 3MO6A 2ZU4A 2XW9A 1BZXE 3TK5A 2PKAB 3KHVA 3KN2A 1O3HA 2HPPH 1UCYE 1LHCH 5ESBA 1QURH 1XX9A 4D9RA 1BBRH 3UWIA 1XUHA 2XRCA 1MAXA 2A4QA 2O9QA 1NU7B 1GWAA 4MNXA 3VPKA 1GI2A 2ZNKH 3EGKH 5LPFA 3F9FA 3SOSA 1OWIA 3HK6B 5GIBA 4IW4E 1L1JA 1OPHB 2F91A 1TRMA 3PWBA 3FP6E 3RXBA 2SGDE 2GCTB 1D9IA 1QGFA 3P8NA 2BDGA 3ZVEA 1O2MA 2GMTB 5EQRA 3BIUH 3BF6H 5A0BA 1ID5H 3A7YA 1L2EA 2FIRH 2G81E 2AYWA 1NRNH 3SORA 3TPIZ 5T6DA 4FVDA 2DE9A 2HVXA 3EE0B 2CN0H 1F7ZA 4ZUHA 1UMAH 2BZAA 3SU3A 4A1VA 3LGUA 1GBCA 2F9PA 4O3TA 4B76A 4ZXXH 1SHHB 1Y59T 2AMDA 2OTVA 5JBAS 2ZTYA 3ZZDA 1E0FD 4NIWA 1QR3E 4X6OA 1C5ZB 2B8OH 1P11E 4HGCA 5E0GA 1SSXA 1ABIH 1MKWH 2FMJA 1C5SA 3U8OH 3KNXA 1GI0A 2UWPA 1QA0A 3K2UA 4Q7XA 4BTTB 2ZTXA 1QRZA 1V2QT 1Y8TA 1SQOA 5ESTE 2VWOA 4Y6DA 2RA0A 1E36B 3HKJB 2PTCE 2XCNA 3LGWA 1DWBH 3QGNB 2OLGA 3P92A 1O5CB 3URCA 3S9CA 9ESTA 4B75A 3PMBB 4NA9H 1CHOG 1JOUB 2QN5T 3QWCH 1C2MA 1YKTA 3A82A 2WPHS 1FY8E 1Z1JA 3MWIU 5GDSH 3UR6A 3ZVBA 1V2KT 1PQ8A 2CF9H 1TPPA 2G4UA 2GVFA 4Y7BA 6CHAC 1PQ5A 1RXPA 3E0NB 1HIAB 3H5CB 1GMDG 2RCEA 1KLJH 3B9FH 4CRCA 2ZKSA 4XBCA 1Z7KA 5DPAA 2CGAA 1TWXB 1QL8A 1CA0B 2NU1E 1P12E 2D26C 7ESTE 1GI7B 3KQDA 1PYTC 2OC1A 1Z6EA 1YCPH 1P01A 1AWFH 1SFQB 3LDXH 3T2NA 2FXRA 1YPEH 3VXEH 1UTMA 4DGJA 1SGFG 1O33A 2FLRH 2C8WB 2FOEA 2VINA 1O2OA 3SU5A 3IWMA 4Y76A 3RU4E 1O3FA 2H6MA 1JRSA 5AFZH 4ABJA 3BG4B 1MTSA 2PV9B 1JXPA 4MQAA 1C2IA 1TMBH 2OBOA 2FX6A 3DA9B 2PUXB 5AVDA 4FUJA 4B2CA 4NGAH 3ZYEA 1UVSH 3PMJA 4AORA 3ATWA 1VITH 1JIMA 1UO6A 1TPAE 2H5DA 4I7YH 2LPRA 3ZZ7A 2ZQ2A 2G8TA 1YC0A 2BOHB 2SGEE 1YPKH 2ZA5A 1X7AC 2BDIA 3EAJA 5HYOA 3A8AA 4YTAA 2A31A 4XBBA 1GBIA 1SGYE 1C1WH 1V3XA 5FX6A 3I77A 3SI4H 2WINI 2P16A 1KXDA 3RXHA 1SGNE 4CH2B 3F1SB 1DY9A 4R8TB 1O3DA 2RG3A 1V2ST 2FOMB 4DVAU 2ULLA 1C5TA 1C1UH 5ETXA 3A86A 5FXLA 1ZHMA 4DW2U 4XE4A 1C5UA 1BQYA 2XBVA 4I33A 2FOAA 4GVUA 4YOIA 1GCTB 2GCTC 4AGJA 1BHXF 2ZFTA 3GCTG 2HNTC 2ZO3H 5EXLA 1AKSB 1GHZA 2SGAA 3M5OA 2Y80A 1H1BA 2LNCA 2ZU2A 1BJVA 3ATKA 1SGPE 2ANWA 3A89A 1O5EH 1PFXC 1CE5A 4D76A 4ISNA 1O5GH 2A45B 1HJAB 1MKXH 9LPRA 1O2NA 3M3VA 3AW0A 1UHBA 2HPQH 3SU1A 2WV4A 1S0RA 1EPTC 2BVRH 1UTOA 4THNH 1UCYK 2XWBI 1BMMH 4Z0KA 5JB8S 3R3GB 4K1EA 1JIRA 2TRMA 2F3CE 1GI1A 3GY6A 1ELFA 5AF9H 2O8LA 5K0HA 1A3EH 2TGPZ 1C9TA 1G9IE 2OC8A 1MCTA 2WYJA 1EAUA 3TJVA 5AHGH 1UK4A 1GMDF 1Y5UT 1UTNA 1FUJA 2BX3A 3ZV9A 3GY7A 2KAIB 3T26A 1KLTA 1QRWA 1IQNA 2BXTH 1HRTH 3UR9A 1EB2A 3SJ9A 1LQEA 4FUBA 1PYTD 1XUKA 2XBXA 4X1QU 1C2GA 3A83A 3M7TA 3VB4A 1HIAA 5A0AE 1A3BH 1G2LA 1WCZA 3QGJA 4JK5A 3RXCA 1ARCA 3RMOH 6CHAB 4KTSA 1DS2E 1WBGB 1UVOA 2CMYA 2PSXA 5A0CA 1F5RA 4MPUA 2VB0A 4WVPE 5F03A 5GCHG 2G52A 2C4FH 3O8DA 1C4Y2 2ZGXH 5ABWA 1FN8A 4F49A 3C27B 5BRRE 1GJ7B 4KKDA 2P94A 1ZHRA 3S69A 4CRGA 2A4GA 4NWLA 2BD7A 2VIWA 2W3IA 1LVOA 3ZYDA 3SNAA 3M5NA 4WH8A 1D3QB 2WUBA 8ESTE 1C5WB 5DJ7A 3RM0H 2XCFA 3A8DA 2Z3EA 3RXKA 1GMCF 3SGAE 2ZHWH 1LVYA 2B0FA 4GLYA 1TIOA 4TPIZ 1SGRE 2J34A 4HZHA 3MU8A 1OYQA 1W0YH 2JH5D 2PTNA 3N7OA 1O3AA 3QX5H 3BTME 4LXBH 2PUQH 2AFQB 1SGEE 2GGVB 2XC5A 4ABIA 1GMHG 1RRKA 5SGAE 1TAWA 4I32A 5GPIB 1YLCA 3BTHE 2VWMA 1CO7E 2ZWLH 3SNDA 3MMGA 5L30H 1ZZZA 2BD8A 1RS0A 4ZKSU 1AO5A 4Y7AA 1C9PA 1TB6H 2WPJS 2Z9GA 1NZQH 2QGRA 4K8BA 1S85A 2IJOB 1UCYH 3ATIA 3UPEA 4CRBA 2R0KA 2BYAX 1GBBA 1YPHE 1OX1A 1YPMH 2UUFB 4CR9A 4MPWA 4GHQA 1W2KH 2BDAA 2VVUA 1ZOMA 4IBLH 3NKKA 1BTYA 4AYVB 1BMAA 1Q3XA 3G01A 1HNEE 4ZHMU 4LZ4B 4O3UA 3T5FH 2OXSA 3NXPA 1YPLH 2JKHA 4A1XA 5JB9S 2W3KA 3GY4A 1C2JA 4X6MA 4B1TA 4TWYA 1G37A 1LPZB 4Y71A 1NRQH 1SC8U 1OWJA 1QB1A 4IMZA 2ZFFH 4NSYA 4X1PU 1GBTA 1UK2A 5L6NH 3RXIA 5DGJA 1N8OC 1ZPCA 2ZPRA 1ETSH 1K1OA 1C1OA 1T31A 1DUEA 1YYY1 2ZGBH 5EPNA 1T7CA 1BRCE 1DM4B 3RXMA 1ACBE 4FU8A 4JZ1A 2ZFPH 4KGAA 2ZCHP 4K60A 2ILNA 1TNKA 2VU8E 2KAIA 1AB9B 1OOKB 1EJAA 4O97A 1FAKH 3UQVA 3SNBA 1CA0C 3BTDE 1QTFA 1TNJA 2HOBA 4YLQH 1ESBA 2NU3E 1AFQB 3V13A 3ITIA 3EA9A 3WY8A 3RXAA 2BX4A 2ZGCA 3AVZA 3SNEA 3LIWA 3U9AH 3ZVAA 3QDZB 1CVWH 4ZKRU 4AN7A 3P95A 2HGTH 3M7UA 1SLVB 5GXPA 1CGHA 1VGCC 3STIA 3W94A 1HAGE 3L33A 3P6ZB 1D3TB 2CV3A 4GCHG 5DK1A 1WTGH 1G3EA 4NCYA 3TK9A 3GYMA 1GI8B 1QB9A 1A0LA 1C1RA 1VGCB 1C2KA 1NROH 1AGJA 1P2JA 4Y11E 3ZZ6A 3B8JA 4FUFA 1MQ5A 3HKIB 2Z3DA 4NA7A 1DWDH 1HGTH 4Y0YE 1DWCH 1CBWB 2D1JA 4BAMB 4NFEA 5C1UA 2ZDAH 4ZAEA 2UUYA 2BY6X 2OC0A 1C2LA 1GJ8B 3O8CA 3EA7A 1S84A 1A2CH 3CENA 4DIHH 3RXSA 4IN2A 2QXIA 4ZH8A 1VR1H 1ANBA 2Y7XA 3GOVB 2GMTC 4GUXA 5BPEA 5EOKA 1G2MA 4ABAA 1ZGVA 1WQVH 1VZQH 3LJOA 1C5NH 3Q3KA 4Q7YA 1SL3A 1GJAB 1BT7A 4X8VH 2FLBH 5LPEA 4U30A 1T8MA 3A88A 4MPXA 1H9LB 4UD9H 5C1XA 4OS2A 1FZZA 3Q76A 1O3NA 2DUCA 3SQHE 1QNJA 1ESTA 1O2SA 4WMDA 3BTTE 1J16A 1K28D 1NT1A 3MNXA 1FY5A 3KL6A 4B2AA 1GMHF 2Q6FA 1W8BH 1V2OT 1O37A 1NTPA 3FZZA 1IQLA 1LPGB 1DPOA 1EJNA 2AS9A 2A1DB 1C2FA 4UE7H 3U69H 1G32B 2O8TA 2VIOA 1KDQB 1OKXA 1TRNA 5FCKA 1WU1A 2FI5E 1KYNA 1TBZH 4ISIH 3Q77A 3RM2H 1GVZA 3Q3XA 2FOHA 4U2WA 1TPOA 2ZTZA 1AMHA 4J1YA 2G4TA 2YNBA 3PTBA 3UOUA 4ZROA 4Q80A 1DLKB 1U6QA 1HAVA 1GBMA 1GHYH 3NUMA 1HYLA 2Z7FE 4X1NU 1E38B 1SOTA 5DO4H 1XM1A 3GISB 1O3MA 3M35A 4JZEH 1O2RA 3A7XA 2H9HA 1V2RT 3SHAH 4NIVA 3T27A 1SBWA 1AFQC 4CREA 1BBRK 1OWHA 2PFEA 2SGPE 1XKAC 2Z9IA 1DVAH 2FS9A 3UNRA 2ZU5A 1MAYA 2GT7A 1GG6C 2BTCE 4BAHB 2R2MB 1HAXB 3A7VA 3M3TA 2GZ9A 2WV5A 4K69A 2P3TB 1P2NA 1SGTA 3BEIB 3SV6A 2BD2A 4ISHH 2ZIQH 4KTUA 4X2YA 1HJ8A 2FTLE 2P93A 3JZ2B 3GDVA 2BY7X 2C8YB 4JK6A 2AGEX 3LC3A 1TBQH 2VNTA 1ELTA 1O3OA 2TGDA 2AERH 1PPHE 3SV8A 3FANA 5L2YH 4I31A 4CHAC 1QBVH 1HUTH 1Y5BT 1SGDE 4A1TA 4BAOB 4RKOB 1Y5AT 2A4RA 1TLDA 1HAPH 1O34A 2R3UA 1SLWB 3M5LA 1EZQA 1F0TA 1C5YB 4CHAB 1XKBC 1DE7H 3PLKA 2RA3A 3NK8A 1T8LA 3STJA 1PPCE 1FAXA 3AW1A 2FOGA 1C1QA 1ZSJA 4FU7A 1GJ5H 1A5HA 3ZVCA 4ZHLU 1EQ9A 2VGCC 3RC6A 1AWHB 1HXEH 2O8UA 3DFLA 3EA8A 3VB6A 2PKAA 2WYGA 5IYTA 1GDUA 1AQ7A 2ZHFH 1TFXA 4B2BA 2NU0E 3F9HA 2ZDKA 3O8RA 1PPGE 1NFUA 4NZQA 3FP7E 1IHSH 2VWLA 2NU2E 4U32A 3PWCA 1G3DA 1XUGA 2XBWA 4F4OC 2ALPA 1DLEA 4ZMAH 1MCVA 3UUZA 2ZHQH 5EG4A 1HAZB 5EXMA 5TCAA 1GHWH 4CRDA 1NRRH 4MVNA 3SBKA 1QJ1B 1L4DA 3BTFE 3AAUA 3SU2A 5JBCS 1NFYA 2V0BA 3QZRA 1TGBA 1BMLA 1IOEA 1P3EA 4FU9A 2J9NA 1MKXK 4WY3A 1ETTH 1GJBB 1PPEE 3BN9A 1ZSKA 3E90B 1Y3UA 2JH6D 3NWUA 2ZECA 3MH7A 1QIXB 4QT8C 1O2TA 3RLWH 5DKMA 4AFUA 3RMLH 1HJ9A 2ZCKP 4A92A 4A7IB 5AFYH 3LH3A 1LMWB 2P3FH 1RGQA 1NO9H 3ODDA 3GY3A 2G5NA 4NA8A 1AIXH 1AUJA 1SPJA 1Q2WA 3M37A 1TALA 3MO3A 1SLXB 1O3KA 3VGCC 1MTWA 2GKVE 1FY4A 3E1XB 2FEQH 4R0IA 1MTUA 3LGTA 1E35B 4BXWA 1K1LA 7LPRA 1Z8JB 3PTNA 1PPBH 4INLA 2OP9A 1OWDA 4UEHH 2C3SA 2D2DA 2EA3A 3VGCB 1EP5A 1BDAA 3TU7H 1F92A 1EOJA 1GBLA 3PB1E 1V2JT 4YESB 2H1UA 2ZG0H 1LVMA 1AVXA 1P0SH 1DSUA 2QV1A 1MUEB 1QQ4A 1P3CA 4ISOA 1NFXA 1O3CA 3P8GA 3D23A 1VITF 1YPJH 2G00A 2ALVA 1OS8A 1JBUH 2ZFSA 3H7OA 1O32A 3SN8A 3A8CA 3E6PH 2FM2A 1B0EA 6GCHF 1LHGH 2AIQA 2FDAA 1HAHH 1GBDA 3A81A 5IDKA 2FI4E 3BTKE 3MNSA 1KTSB 4D7GA 2BLQA 2G55A