3M3VA

Sars-cov main protease triple mutant sti/a with two n-terminal additional residue (gly-ser)
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
306
structure length
306
Chain Sequence
SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRKSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKFYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGAAALEDEFTPFDVVRQCSGVTFQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords 3C-like proteinase
publication title SARS-CoV main protease with N-terminal extension regulated by mutations on the C-terminal domain
rcsb
source organism Sars coronavirus
total genus 78
structure length 306
sequence length 306
chains with identical sequence B
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2010-03-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1840.10 Mainly Alpha Orthogonal Bundle main proteinase (3clpro) structure, domain 3 main proteinase (3clpro) structure, domain 3 3m3vA03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3m3vA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3m3vA02
2R2MB 1CU1A 1ZPCA 3RC4A 5GCHG 3TJUA 3FP7E 2R0KA 3SUFA 2P95A 1GJ6A 4X8VH 4BAMB 1MU8B 4NG9H 5AHGH 1FMGA 1Z6EA 1KXBA 2QXHA 6CHAC 2P59A 3E90B 2FOBA 4K1TA 2JH0D 5FCRA 3M5LA 2FI3E 4NSYA 3SUEA 1K22H 4Z6AH 1O3FA 1KXDA 1FONA 1MU6B 2OCVB 3A88A 1V2PT 3GDUA 3A86A 1AI8H 2PKAB 5ESBA 1LHDH 1ZR0A 3L3TA 3TJOA 4Q7XA 1T4VH 2V0BA 3MH7A 4DIHH 2ZQ1A 1HCGA 3GY7A 3F9FA 2BLWA 2PKSB 2J38A 4FUDA 1P3CA 1NRNH 1HIAB 1UK4A 1LDTT 3SGAE 1OWHA 1GWAA 1MZDA 3O8DA 3SN8A 4NA8A 1DM4B 1YPLH 3C27B 1LVMA 2PHBA 2A5KA 1HXFH 1AD8H 1O3CA 4XFQA 2JETB 1VITF 3U98H 3MFJA 1SLUB 3LJOA 3MU8A 3VB7A 1TA2A 1C4V2 1V2UT 1ACBE 2H1UA 2P3FH 1BB0B 1GJ4H 2AERH 1X7AC 2PGBB 1GVKB 3M61U 2GV6A 1ESBA 2H2ZA 4BTTB 2Z9JA 1TX6A 3FFGA 3S9AA 4B1TA 1AFQC 4X6OA 1VCPA 1BJUA 2SNVA 1ELCA 4X1SU 1DT2A 2WPIS 1NFUA 3RXTA 4CBNA 3KQBA 4D9RA 2ZHEH 1YGCH 3E1XB 2WPKS 3F68H 4JK6A 1JWTA 1P0SH 1AWFH 1LPKB 4X2VA 2J2UA 1P06A 2BYAX 1N6XA 3T26A 1KLJH 1AIXH 3P95A 1D3TB 3RXGA 2KAIB 4AFSA 1ELEE 3VGCB 3EDXB 1QRXA 1C1UH 2ZDAH 3D49H 1HAHH 1IQLA 1ETTH 2TBSA 1GI0A 1OPHB 1XX9A 1SLWB 2TRMA 2R2WU 1XXDA 1O2IA 3JZ1B 2BDYA 1C9PA 2AIPA 3TK6A 5E0HA 1IQMA 4RSPA 4OS7A 1GHAG 2HOBA 2VH0A 1GBHA 5F8XA 4GHTA 2OC0A 3A7TA 4I8JA 1TLDA 2J9NA 5GIBA 4AYYB 4MPVA 3QZRA 1INCA 1YCPH 1GI3A 4O3UA 1C1WH 4LOYH 2HPPH 3Q76A 3SI4H 3Q3XA 1T8MA 3U8TH 1BRCE 1TPPA 4TY6A 3RXDA 4YOJA 1C2KA 1YPEH 5IDKA 3LJJA 4D9QA 5E2OA 1BTZA 3HKIB 1QCPA 1AVXA 1XM1A 2A0QB 1MCVA 3ZV8A 1BJVA 2UWLA 1P02A 1O32A 4DVAU 1SQTA 5AFZH 4BAQB 3A7VA 3RUOA 2J94A 6CHAB 2VWLA 4DGJA 1P10A 2OC1A 3NPSA 8ESTE 5DKMA 1MAYA 1QBOA 3PB1E 4H6TA 1OWDA 1T8NA 2ZA5A 9ESTA 4HI3A 1KLIH 1XKBC 5EG4A 3BTME 1SSXA 1UVUH 4HZHA 1O2WA 1PPBH 1SI5H 3W94A 2C90B 1O2ZA 4ZKSU 2JH5D 3DHKH 4H42U 3LOXA 2TGPZ 3E16B 1OS8A 1TGBA 1AKSB 2EI7A 1GJBB 4Y8YA 5E8EH 4AFUA 4BXWA 1QA7A 3SBKA 1UK2A 1O33A 1RD3B 3LGTA 2BY8X 1YCPK 3P8OA 4JYTA 1MAXA 3UTUH 1FQ3A 2ZP0H 3M35A 3A8AA 4K8BA 3VEQB 1CT2E 1RS0A 1VCWA 2PUQH 2BD9A 2I6SA 1NY22 2ZGHA 2ZKSA 3KN2A 1YPJH 5GPIB 4FU9A 5JDUB 1SHHB 4X8SH 3UNSA 4JYUH 3BTEE 2AMDA 1YKTA 4I32A 4NZQA 4ISNA 3QO6A 4ABDA 5F6MA 1AFQB 3KCGH 3CENA 1KXAA 3DFLA 1L1JA 2WPJS 1RJXB 1U6QA 1IAUA 1O34A 1UTNA 3A7WA 4I8LA 4CBOA 2ODQA 3VFEA 4DOQA 1DVAH 1QBNA 1EJAA 1GI9B 1QRWA 1JMOH 1DLKB 2GCHG 1GCTB 2QGRA 2R0LA 5A0CA 4A1VA 1N8OC 1QGFA 1GBIA 1GBKA 1QIXB 2PR3A 2WYGA 1BT7A 4CR5A 2GKVE 4GHQA 1ZRKA 4O97A 1AUJA 1KTSB 4X6MA 5CHAB 1ELAA 5LPFA 3Q77A 1TALA 1P3EA 4K2YA 1HLTH 2VWMA 4ABBA 1AO5A 3S0NA 1P2QA 4ABIA 2ZDVH 5ESTE 1OWEA 4UEHH 5I46H 2Q6DA 2QYIA 1NRSH 3SV9A 2ZO3H 3SNDA 3LGUA 5ABWA 1UTPA 3LGVA 3RXPA 3ZZAA 1P2IA 1SGIB 3RXIA 4B75A 4ISOA 1K28D 3EE0B 3KNXA 1MCTA 3ZVEA 2AMQA 3LKWA 4MDSA 1C1MA 1PPHE 1SLVB 2UUJB 1UTOA 2ALPA 5LPRA 4I8KA 2OD3B 2C8ZB 5A8YA 1J17T 1C5MD 1K1LA 1S85A 2F9NA 2C8YB 3OSYA 3ZVGA 3LT3A 4AG1A 3RXJA 2ZU5A 1O5CB 2BVRH 4JMYA 1V2KT 4AZ2B 5E0JA 2YOLA 4HTCH 2G5VA 2EC9H 3HATH 1W11U 1Z1JA 1ORFA 2BOKA 1O3DA 3PLKA 2Z7FE 1ABJH 2P94A 1EZXC 1SFQB 2B8OH 4ISHH 4B73A 3P92A 1RFNA 1O2JA 3TNTA 2G51A 3A83A 3SU0A 1YPMH 2PWXA 1Z8JB 1EAIA 3PLPA 1VCQA 1FY8E 1AN1E 2ZZUH 4U32A 1TNKA 1RTFB 2ESTE 1OX1A 2QF0A 3GY4A 4AB9A 1WTGH 2GDDA 3VB5A 2XBWA 1AZZA 2G00A 4FUCA 2TPIZ 1W12U 1A1RA 2R9PA 1C1NA 4Y76A 1C5WB 1HBTH 2BDHA 4NFFA 2RDLA 4ABHA 4CRBA 1O36A 4ASHA 1GHWH 2P16A 1C5NH 3GCTG 1Y59T 1QA0A 2AS9A 4K60A 1ELBA 1QQ4A 1YPHC 2C8XB 1AHTH 1Z8IB 7LPRA 1W13U 3CS7A 5FBEA 4ZKOU 1PQ7A 3TPIZ 3SU3A 2Q1JA 3NCLA 1MUEB 4LZ1H 1XUGA 1DDJA 4ABGA 2GCTB 2BD3A 2BDAA 3KQCA 1O2HA 4I31A 1S83A 4D8NA 2ZGCA 1ZHPA 1JRSA 3V0XA 4ZHMU 3GY6A 4ZHAA 2B5TB 3LONA 9LPRA 1TMTH 2A5AA 2VGCB 5GDSH 1T7CA 5SGAE 5EPYA 1ELVA 1G30B 5JPMH 1SGEE 3ATWA 4Y11E 1HAIH 2BZAA 1Y3XA 3LH1A 3RMMH 1EOJA 2AGEX 2ZHQH 4MNYA 3TGIE 4LXBH 3ZVDA 1C5RA 1EXFA 3A85A 2BY6X 2FEQH 2BOHB 5DP7A 4AORA 1OWJA 4BTUB 3PMHB 5EXNA 3DFJA 3NK8A 1C5SA 4H6SB 3SJ9A 3TU7H 4X8TH 2PV9B 3PWBA 2EI8A 1SBWA 2PSXA 2ANKH 4TWWA 1DWDH 2VIDA 1SOTA 2XC0A 1SVPA 1Y3VA 2HRVA 1O2GH 4ZKRU 1SOZA 4FUBA 1BHXF 4AFZA 1ZSJA 3GY3A 3TITA 4R8TB 3P8NA 3TH2H 1QRZA 3E6PH 1JIRA 1G3BA 3GYMA 1GMCG 1GBDA 2Y80A 1O3JA 3BEIB 4AYVB 1A0JA 3U8OH 2QIQA 1PJPA 2H9HA 2OINA 4Y8ZA 4UD9H 1J15A 1BMAA 2SNWA 3MU1A 1S6FA 1UVOA 3A7YA 3LGYA 2A4QA 3MU5A 1PPFE 3UFAA 1W14U 1DOJA 3TH3H 2OUAA 3FAOA 1WUNH 3ZZ5A 1GBTA 2BLOA 1ELTA 4NIYA 1O3HA 4A6LA 4K3JA 1ZTJA 1AFEH 1HAVA 3PMBB 2ZFTA 2FPZA 4ZXYH 7GCHG 4ZXXH 1QL9A 1TNIA 1ELGA 2WYJA 2M5TA 2FM2A 4KTUA 4MPWA 3HK3B 1WQVH 4E05H 1TX7A 2ULLA 5DP8A 1GHBF 2V6NA 2Y5GA 2ZHFH 1AUTC 1ZLRA 2BX3A 4ZH8A 1GBCA 1K1PA 1RTKA 1O5BB 3RMOH 1TRMA 2XBXA 1L2EA 1HV7A 2QC2A 3GY2A 2XC4A 3ATKA 4Z0KA 1DWBH 2RA3A 3A81A 4HFPB 1O0DH 2ZCLP 3VGCC 1FAXA 2BY7X 1SG8B 1IQNA 1S82A 4DW2U 1C1SA 1Q31A 2PKAA 3B9FH 1D4PB 1P04A 1H8DH 1H9LB 2AFQB 1ARCA 1FUJA 1PPCE 3ZVAA 4K8YA 1C4U2 2Y81A 3RXCA 1DSUA 2ZFPH 2GGVB 8KME2 3VB6A 1C2DA 1GDQA 1SGTA 2BXUH 2H9EH 6GCHG 3RLYH 4WMEA 3LGIA 4VGCC 5C20A 5DP9A 1GJ9B 4JZDH 4FU8A 4OGYA 4K1SA 3KEEA 1A0HB 2GP9B 1DUAA 4YLQH 1MQ5A 1G36A 3M7QA 2BHGA 4NWLA 5C1YA 1THSH 2Z3DA 1EJMA 4R0IA 1LQEA 5ETXA 5L6NH 2FMJA 2RCEA 2J92A 3KQDA 3ZYEA 2BD7A 3RXVA 2R3YA 2TIOA 2ZIQH 4MLFB 1GJCB 3A87A 1CO7E 2ZDKA 3A84A 4IGDA 3ZZ3A 1OP0A 1E35B 2BD5A 3RMLH 4B2BA 8GCHF 1FIWA 2V35A 2XWAA 3QGJA 5HXFA 2A7HA 5TCAA 1FN6A 4YOGA 1HAVB 1WOFA 2FZZA 1GI6A 3RU4E 3RP2A 1WYKA 4XBDA 3SW2B 4Y7BA 4K1EA 3M5NA 1A3BH 1WV7H 2FOCA 5EW1H 3ZZ6A 2VIWA 3E0PB 1RXPA 2KAIA 4FUJA 1CBWC 4U2WA 2B9LA 2ZECA 4FU7A 1NT1A 1LHEH 1SGCA 3C1KA 2F9VA 1LHGH 2O8UA 1F0RA 1HJ9A 3K2UA 4MPXA 4B76A 1GI7B 4X1NU 1J16A 2K1QA 4UFEH 1AY6H 1AU8A 1QY6A 4KELA 1SGPE 1TGNA 2FLRH 5G4BA 1EATA 1VITG 1O2MA 4OGXA 3RXQA 5GCHF 1SQOA 3MMGA 1QJ1B 4NZLA 2HWLB 1D3PB 2BY5X 2O8TA 1LPZB 1AMHA 3SORA 1O3GA 4ABJA 1C5QA 3ODDA 4INHA 4IC5A 3ELAH 1D9IA 3A82A 5F8TA 5EW2H 1ZSLA 4Q2KA 4TPYA 1LPGB 2P3UB 4I8HA 3SNBA 3EYDA 7ESTE 3ZZ4A 3ZVBA 1WAYB 1W2KH 3UNRA 2YNAA 2PLXA 3RDZA 1QTFA 3F6UH 1V2ST 3BG4B 4X6PA 4ABFA 2FS8A 3G01A 5HM2A 2A5IA 5DPAA 4I7YH 2VNTA 2BDCA 5T3HA 3UQOA 3PMAB 3S69A 1EP6A 4MNVA 3TVJB 1K1JA 1FIZA 1GCTC 1FY3A 1YYY1 1SL3A 5JB9S 2O8WA 4GCHG 1B0FA 4Q7YA 3E0NB 2P3TB 4XE4A 1TMBH 3M7TA 1M9UA 3F9HA 3SU2A 3EA9A 1B7XB 5A0BA 1FY1A 2J4IA 1IQKA 1P11E 1UJ1A 1F2SE 1GI4A 3QN7A 3EGKH 5CHAC 2V3HH 4U30A 3T5FH 5C2ZA 1AKSA 1ZPBA 2BB4A 4CHAC 3ZZCA 2PUXB 4BXSA 2PW8H 5A0AE 2NU4E 2NWNA 2ZCKP 3SNAA 3GCNA 4VGCB 1XUJA 2F3CE 1V2RT 2O8MA 2VIOA 3W95A 4MPUA 3S9CA 1O3MA 3TLOA 3VB4A 3ZZ8A 1ZZZA 1C2HA 4DY7B 2ZC9H 1GI5A 1MBMA 3OTJE 1O37A 4NIXA 4Q7ZA 1AE8H 4IBLH 2Y6TA 1O31A 4OS1A 2B7DH 2PTNA 1TB6H 1J9CH 1T31A 1IOEA 3SJOA 3QDZB 4IN1A 1BBRH 1J8AA 5B6OA 1C1OA 1VGCB 3BG8A 3FVFB 3UIRA 1P03A 2HALA 3M3SA 2ZGXH 1V2WT 3SU5A 4LZ4B 1MQ6A 1T8OA 1W0ZU 1FV9A 1P12E 4MNWA 3OU0A 4TY7A 1T32A 1OSSA 1PPEE 3UR6A 1LVBA 3O8CA 2A1DB 2ANWA 2ANMH 1MTUA 1V2VT 2BLQA 1MD8A 3LC3A 1LVYA 3AVZA 2XXLA 4IMZA 5AFYH 6LPRA 2GZ7A 1CT0E 1Z6JH 1BOQA 1CBWB 1FDPA 4GVUA 1TX8A 4XSKU 1E38B 1IQIA 1TMUH 1ZHRA 3AW1A 2SGDE 3RXUA 1A2CH 3M3VA 3SZNA 4WF8A 4A1TA 2UWOA 2W7SA 1Z8GA 4FUIA 4BOHA 1ZOMA 3SOSA 2H5CA 1GVZA 1XKAC 2ZTXA 4INKA 1UTMA 1O2OA 1BBRK 1O5GH 2ILNA 3FZZA 3MYWA 5JBCS 2XWBI 1MD7A 1O2PA 3RXMA 4WXIA 3EA8A 3UR9A 2ZTZA 1HXEH 3BIUH 4CRGA 1C2IA 2VIVA 1TGCA 2FP7B 3GOVB 4PROA 5EXLA 3LIWA 2GCTC 3MH5A 1P9SA 1C2EA 3GDSA 3ZVCA 3RXOA 1OOKB 4DJZB 2AGIX 3RU4T 2FOAA 2OLGA 3TJNA 1HJ8A 5HM9A 1E34B 3MTYA 4XDEA 2ZCHP 2VGCC 1HPGA 1K2I1 2CMYA 2O9QA 1GBMA 2R3UA 4THNH 1QJ6B 4X2WA 1P2KA 4ZROA 1GJ8B 3QLPH 1QBVH 1S0QA 3BTGE 2BMGB 2OQ5A 1HAPH 4KP0A 1CGHA 4AG2A 2Y7XA 3HK6B 1CA8B 4UFDH 1GVLA 3TJVA 1AVWA 1TRYA 4ZMAH 1TNJA 4JCNA 1O2QA 1XVMA 4YTAA 2BQ6B 3ATIA 5K0HA 1GBBA 1ZPZA 1PYTD 1YM0A 1E0FD 1TOMH 2ZFRH 3MNCA 3PTNA 2LIZA 5DO4H 3PO1B 1OP2A 4K69A 4BTIB 4D7FA 4ISLA 1RRKA 5DGJA 4MNXA 5TCCA 1Y3YA 4UFFH 1GBLA 1AWHB 5BPEA 4CHAB 4SGAE 4BNRA 2XBYA 3FP6E 4TPIZ 1MTNC 3RXLA 1E36B 1G3CA 3MI4A 2Z9KA 1SGFG 1V2QT 2FTMA 5IYTA 4INLA 1O39A 4YT6H 2ZFFH 2W3IA 1HUTH 1L4ZA 3RMNH 2Z9IA 3SQEE 4F4OC 1A5IA 1O3NA 2D1JA 4X2YA 1YCPM 4JK5A 1BTHH 1ZGVA 2WV5A 2GCHF 1CGIE 4OS4A 3KF2A 4KGAA 3HKJB 3FZDA 1GMDF 2ZGJA 4XBBA 1GG6C 2C4FH 1FAKH 3OY5U 3VXFH 1O5FH 2A4RA 1O2YA 3PYHA 3SV8A 2AGGX 3BV9B 4FVBA 4DURA 1GBEA 3KIDU 2HPQH 2FI4E 5FX6A 4X1RU 5J4SA 4WMFA 2G81E 3I29A 1GI8B 3OY6U 1T8LA 1K9OE 1A3EH 1Q2WA 1W3CA 1TFXA 3MU0A 2C8WB 1SFIA 2OXSA 2BM2A 5C3NA 1IQHA 2BZ6H 1TNLA 3SUGA 1P01A 1NFWA 1SQAA 1FLEE 1K1IA 2VVVA 3I78A 2BDBA 2G5NA 3S7KB 1F0UA 1AGJA 1G3DA 1QB1A 1O5EH 2OP9A 3EA7A 2A45B 1SGFA 3MH6A 2Z3CA 4OS5A 2QV1A 1DANH 3VPKA 1C5LH 3SQHE 1A7SA 4Y6DA 3PM3A 1G9IE 5FX5A 5FBIA 1GL1A 1O3BA 3V3MA 3GYLB 1SGYE 1F5RA 2GZ8A 1YP9A 1DITH 3TH4H 4NCYA 2OC8A 4IC6A 3NUMA 1Z71A 1GDNA 4ZUHA 2CHAC 3SUDA 1FI8A 2VWNA 3ITIA 2CF8H 3SNCA 1NFYA 2YNBA 1EJNA 4DIIH 3E3TA 6ESTA 3ZZ7A 2WPMS 2WUCA 1QL8A 1EAWA 2FOGA 1CVWH 1CHOG 2CGAA 1C5TA 2F9PA 2G8TA 1ETSH 1THRH 1F92A 4O3TA 5T6FA 3WY8A 1DLEA 2A31A 2BDIA 3UNQA 2VB0A 1F0SA 4X2XA 3RXSA 4E7RG 1C9TA 2GMTC 2VVCA 3M36A 1GBAA 5L30H 2ZDNA 3STJA 3GICB 3U8RH 3GY5A 1XUHA 2QY0B 1C5XB 1L1GA 1BTPA 5CMXH 2F91A 3GCTF 2BLVA 2PTCE 4Y0YE 1KSNA 2QCYA 1DY9A 4XOJA 5FPSA 3O8BA 4LK4A 3ZZBA 1KDQB 2A32A 3ZV9A 1O2TA 1ZMJA 1P9UA 1EB2A 3MNSA 1GCDA 1BTYA 3M7UA 4HGCA 1IQFA 5GXPA 2G52A 1AE5A 2EEKA 1SPJA 5EQQA 3M37A 3SHAH 3S7HB 2FS9A 1HJAB 3MH4A 3T25A 3AW0A 4U01A 3SU4A 1C2JA 1CA0B 1XVOA 3RC6A 1A5GH 1HAOH 1IHSH 5JBBS 1FJSA 5FXLA 3DD2H 3SHCH 1MTNB 1GGDB 1O5AB 2HNTC 2VU8E 3MNXA 3U1IB 4NGAH 5E0GA 1DX5M 1BITA 3I77A 3P8FA 1W0YH 2D26C 1P57B 1BRAA 4YOIA 4WWYA 1IHTH 1H4WA 1BMLA 2C93B 1C5UA 1PYTC 3GCOA 1GG6B 3TNSA 2XBVA 4GUXA 3R0FA 1THPB 1QJ7B 1UHBA 3PMJA 1S81A 3D65E 1TIOA 2FOEA 1BBRE 1P09A 2VVUA 1AZ8A 3UOPA 1MKWH 1JXPA 3BG4C 3SI3H 1TABE 3MO3A 2QXGA 2RG3A 4O9VA 2GX4A 4YLUA 2PGQB 1O3OA 1ZMNA 3QTVH 1BTUA 1GMCF 1UTLM 4BAHB 2Y5HA 1ZSKA 3ZYDA 5JBTA 2ZU4A 1TBZH 3P6ZB 3UOUA 3RU4D 3T62A 1A61H 3U1JB 1A4WH 2Z9LA 2GV7A 3M5OA 1B0EA 2WV4A 2F83A 1FZZA 3BSQA 2QXIA 1OKXA 4FUFA 1AB9B 2FOFA 2IPHA 4FXGH 1O2KA 2QAAA 2ALVA 1JOUB 2BD4A 3M5MA 4ABAA 1NC6A 1EUFA 7GCHF 3GCHC 3F9GA 3L33A 3A8CA 1DWEH 3VB3A 7KMEH 1W7GH 3LDXH 1TNGA 5C5OA 4JZIA 2Z3EA 1O2RA 1XXFA 2STAE 1ANDA 1GMHG 2ZHWH 1DPOA 1O2SA 3GISB 2CHAB 3VXEH 5A8XA 1MKWK 1C5YB 2A2QH 2ODYB 2SGAA 2FO9A 4KKDA 1VGCC 1NS3A 4AGJA 1SR5C 1V3XA 4Y71A 1P8VC 1UCYH 2QA9E 1GHYH 1KYNA 1P2MA 1FY5A 2ZPQA 4K5ZA 1GHVH 1EZSC 4DT7B 4BANB 1O3IA 2OQUA 3PWCA 1O2XA 1UHBB 2A7JA 4YESB 1YBWA 1S0RA 1MZAA 6GCHF 1CHGA 2FI5E 3LU9B 1GHZA 2HVXA 1BHXB 2GMTB 1C2FA 2ZG0H 2ZPRA 1UTQA 2FTLE 2FOHA 3QGNB 1UVPA 1YF4A 1EKBB 3MOCA 1VJAU 1D3DB 3ATLA 2FDAA 1LTOA 1S84A 2BVXH 5DP5A 3BF6H 3TGJE 3HGPA 2DE8A 5L2ZH 1QL7A 4WMDA 3SV2H 1EAUA 1LHCH 4CREA 1C5ZB 1HDTH 2G4UA 4AN7A 1YC0A 3LC5A 1QB6A 1FPCH 2CXVA 3F9EA 3OYPA 4H4FA 1UVSH 1WCZA 3MHWU 5GWZA 1JBUH 3HPTB 1HAYB 3V12A 3BN9A 2IOTA 1EOLA 4X8UH 1W7XH 1PQ5A 3RM2H 5EQRA 2ZF0H 2NU1E 3QTOH 1IQJA 1UCYK 1NO9H 2Y5FA 1O35A 1P2OA 1Y5BT 1H9IE 1SGNE 1LO6A 2ZTYA 3MO9A 4KTCA 1ID5H 1V2NT 1A5HA 1C1VH 4ZAEA 2F9BH 3DUXH 2P93A 5FPYA 3URCA 4MVNA 4IW4E 2WPLS 3RXRA 3MU4A 2VWOA 1KTTB 1N6YA 1MH0A 4NWKA 5EU8A 2XRCA 3U69H 1GL0E 4SGBE 3TIUA 4RN6A 2HLCA 2QN5T 4Y7AA 4Q80A 1WTHD 5AF9H 2BQWB 3DA9B 3D62A 2ZDMA 1NZQH 2GD4B 2OTVA 3PV4A 2AH4X 2W7UA 1BQYA 4FUHA 2VIQA 4BAKB 1NU9A 2F9OA 5F8ZA 3ZZDA 2TGAA 3U9AH 1OP8A 3SV6A 2ASUB 2FIRH 1K1OA 1EP5A 2BDGA 2PSYA 5A8ZA 2WPHS 3A8DA 2IJOB 2Z94A 5GJ4B 4X1PU 2LPRA 2TGTA 4KTSA 3RC5A 3PTBA 3RM0H 2PFEA 4Y0ZE 1GJ5H 3PO1C 2JKHA 5C5NA 1C2GA 1NESE 3QK1A 1S6HA 3A80A 2ZDLA 1OWIA 4NSVA 3ZZ9A 1F5LA 2FX4A 4AX9H 5JYIA 4JZ1A 3Q3KA 5TJXA 8LPRA 4A1XA 5DP3A 4ESTE 1BTXA 3RLWH 4YZUA 3GCHB 4X0WU 1K1NA 3Q00A 2I6QA 3SU1A 3BIVH 2ZI2H 5J4QA 5C1XA 4Y8XA 4NA9H 3FP8E 4RKOB 5EOKA 3RXHA 1F0TA 1BRBE 1FN8A 1HYLA 1VITH 5DG6A 3LPRA 4UFGH 3P8GA 4D76A 4GCHF 1V2TT 2B0FA 1O2UA 5A2MH 3KL6A 1BIOA 1MKXH 1C1QA 3PLBA 2UWPA 2AIQA 1CQQA 1KXEA 3V13A 3KHVA 5T6DA 4UE7H 1FXYA 5BRRE 5EPNA 2FESH 1GPZA 2XNIA 1G2LA 3BEFB 2W3KA 2XCFA 3UUZA 3ENSB 1L0ZA 1XUFA 2P8OC 4JZEH 3T29A 4WY3A 1SB1H 1ZMLA 2ZEBA 2IN2A 1UVTH 2LNCA 4WH6A 1GHAF 3QWCH 1RIWB 3MO6A 2BD2A 2BTCE 3QX5H 1DSTA 1NROH 1GBFA 1NRQH 4OS6A 1TPOA 4A92A 4GSOA 5EXMA 1LHFH 2Q6FA 4CRDA 4D7GA 3MNBA 5AVDA 2Z9GA 1ZYOA 5LPEA 2DUCA 1TGTA 4X1QU 4X6NA 3F1SB 5HYOA 1CE5A 4GAWA 1TYNA 3BTWE 1KXFA 1HFDA 1AQ7A 5T6GA 3IWMA 1TQ0B 3L6PA 1MKXK 5EGMA 2A4OA 4WJG2 3Q3YA 1BRUP 1DE7H 3M3TA 1O2NA 2NU0E 1TNHA 1SGDE 3UPEA 1KY9A 1ZRBA 4E7NA 3T28A 1TA6A 1F7ZA 3NXPA 1TRNA 5H4IB 1P05A 1DXWA 1O3PB 3HGNA 1ZJKA 1CGJE 3STIA 1N1LA 5JB8S 1SGQE 2FYQA 5HGGA 5JBAS 4Y10E 1O2VA 1TWXB 2SFAA 4YM9A 3UQVA 2CV3A 4NIWA 1V2OT 1MTWA 1PPZA 1OYTH 1E37B 5HMAA 3E8LA 4WH8A 2WUBA 3KQEA 2ODPA 2D8WA 3SV7A 1OWKA 1GHXH 1Y5AT 1EX3A 2H5DA 3A8BA 3K6ZA 1QR3E 1P2JA 1BTWA 1ELDE 4M7GA 1BMMH 2FWWA 3FANA 1Y8TA 1HAXB 4Y79A 2A4GA 1YPHE 4XBCA 4IMQA 4J2YB 1UK3A 1DXPA 1TONA 2ZPSA 1RGQA 1FY4A 3KGPA 5FHTA 4CR9A 4TYDA 1PPGE 2F9UA 2FLBH 1WQSA 1ABIH 1HJAC 3ESTA 1KXCA 3T27A 1TE0A 1ZHMA 1CA0C 1DWCH 1TPSA 2FX6A 1C1PA 2ZQ2A 1BUIA 1MTVA 2GZ9A 1PQAA 3NKKA 2EI6A 3R3GB 5L2YH 1GGDC 1UO6A 1W8BH 1TPAE 3BTQE 1O38A 3ATMA 1GMDG 5F03A 4WXVA 1NRRH 3RXKA 4CRCA 3H7OA 1G32B 1G2MA 2BD8A 5FAHA 2C3SA 1DFPA 1P2NA 1K1MA 1EB1H 2BVSH 1HGTH 4JYVH 4MG3A 1V2LT 4IN2A 3V7TA 2QF3A 1NN6A 3AAVA 2VIPA 4CRAA 3BTKE 1Z7KA 2SGFE 1O5DH 3UWIA 1UTKA 2O8LA 3CS0A 3A7ZA 2NU3E 4UDWH 1O2LA 2VJ1A 3IITA 5EODA 2HGTH 1UCYE 1Y3WA 4B2AA 2WINI 1SLXB 2P8OB 4QT8C 3QUMP 3RXBA 2HNTE 4CH2B 1EQ9A 4GLYA 3EQ0H 3SJIA 2XYAA 1KDQA 3PROA 3A7XA 1EPTC 3T2NA 4JZFH 4NIVA 1OYQA 1JIMA 1G3EA 1J14A 1LKAA 2VINA 2JH6D 2OC7A 1KLTA 3RXAA 1BMNH 1HB0B 2H6MA 1S5SA 2UUFB 3LH3A 1C5OH 1C5VA 2BXTH 1ESTA 3SU6A 1V2JT 1AB9C 2BY9X 3NZIA 1WSSH 3D23A 3ZVFA 3O8RA 1FNIA 2ANYA 1NTPA 1IQGA 4AB8A 2STBE 2ZGBH 1DICA 1HRTH 2OBQA 2Z6BD 5DP6A 1TGSZ 1D6RA 1DUEA 1ARBA 1HAGE 4ISIH 3N7OA 1KIGH 4OS2A 1BDAA 1EASA 3TGKE 3SJKA 2XCNA 2GT7A 1IQEA 1NPMA 5DP4A 1EZQA 2H9TH 1L4DA 3UY9A 3IG6B 5DJ7A 5K7RA 1O3AA 1NFXA 1CT4E 4J1YA 4ZKNU 3S9BA 1JRTA 1T4UH 5E2PA 2TGDA 5C67A 1MMJN 2CF9H 1XMNB 4B2CA 1O3EA 2SGQE 4NFEA 1QB9A 2Q6GA 2SGEE 1B5GH 4IS5A 2UUYA 5DK1A 1ANEA 1EZUC 1GI2A 2EA3A 2UUKB 3P17H 1DS2E 4AOQA 1D6WA 1PQ8A 1Y3UA 4TWYA 1WBGB 1EPTA 1EAXA 2FYRA 3AASA 5CE1A 1GJAB 1UTJA 1TBQH 3E91A 4I33A 3RXEA 1SGRE 3CP7A 2BX4A 2ZU1A 2THFB 1YPKH 3MWIU 1TBRH 5I25A 1K21H 2BQ7B 2NU2E 4AFQA 3SGBE 1QQUA 2V3OH 1Q3XA 1UMAH 3UREA 1CHOF 3JZ2B 1H1BA 4ZHLU 3BTHE 2J34A 1MBQA 1V2MT 1SMFE 2D2DA 2CJIA 1F5KU 2FODA 1A46H 3TK5A 1ZTLA 3BTFE 3QZQA 1ANBA 3BTTE 1N8OB 1QNJA 1YPGH 2CN0H 4GPGA 1AVGH 1LMWB 1GI1A 4FVDA 2GVFA 4CRFA 4AGKA 1C4Y2 3SGQE 3ODFA 1RTLA 1MTSA 2ZFSA 4CH8B 1C2MA 1NRPH 2RA0A 1SC8U 2Y82A 1SHYA 4DCDA 1HAZB 1H9HE 2ZNKH 3K6YA 2ZHDA 2PKSC 4I8GA 1GJ7B 2XTTB 4YO9A 2OBOA 1GHBG 4A7IB 1C1TA 2SGPE 1L1NA 1PFXC 2ZU2A 1XUKA 5FPTA 5C1UA 1GBJA 1H8IH 1C5PA 1ZGIA 1FPHH 3UWJH 1CSOE 2JETC 1Z1IA 1QFKH 2GDEH 3P70B 3URDA 3K9XB 1ETRH 2G4TA 4UONA 2QXJA 1O3KA 4MTBA 2ZFQH 5PTPA 1EPTB 1BZXE 3RXFA 1C1RA 3SO3A 1Z8RA 2DE9A 4DG4A 1C2LA 2HNTF 1ZJDA 1O30A 2G55A 1GJDB 2AYWA 1DY8A 1LCYA 3TK9A 1XUIA 3A89A 1LVOA 4FUGA 2FXRA 3BEUA 3K65B 3SJ8A 2A7CA 2GTBA 1O3LA 2ZU3A 3BTDE 2W5EA 5EQSA 1VZQH 2XW9A 4ABEA 2VH6A 5A09A 3NWUA 1YLDA 3DT0H 1GDUA 1A0LA 3H5CB 4BAOB 1YLCA 1G37A 5FCKA 4FUEA 4A5TS 3B8JA 2ZWLH 2A2XH 3OX7U 1WU1A 3LGWA 2AEIH 8GCHG 1W10U 1V6DA 4E06H 5LGOA 1VR1H 1BA8B 1HIAA 4RKJB 3GDVA 3EBNA 1Y5UT 4WVPE 2GT8A 1ESAA 4B71A 1QURH 1D3QB 1LQDB 2Y7ZA 3H7TA 1TAWA 4MQAA 2FOMB 5LH8A 1NU7B 3EAJA 1VJ9U 1TQ7B 1OXGA 4O03A 4NA7A 2AMPA 4B74A 4YT7H 2W26A 1NM6A 1BCUH 1QHRB 1TOCB 1RIWC 3GY8A 3SNEA 1ANCA 1HNEE 2K7XA 2XC5A 3AAUA 3B23B 1GMHF 1ELFA 4F49A 1ZTKA 2J95A 1LKBA
chains in the Genus database with same CATH superfamily
2R2MB 1CU1A 5C0TA 1ZPCA 3RC4A 5GCHG 3TJUA 3FP7E 2R0KA 3SUFA 2P95A 1GJ6A 4X8VH 4BAMB 1MU8B 4NG9H 5AHGH 1FMGA 1Z6EA 1KXBA 2QXHA 6CHAC 2P59A 3E90B 2FOBA 3F2FA 4K1TA 2JH0D 5FCRA 3M5LA 2FI3E 4NSYA 3SUEA 1K22H 4Z6AH 1O3FA 3F3BA 1KXDA 2LP6A 1FONA 1MU6B 2OCVB 3A88A 1V2PT 3GDUA 3A86A 1AI8H 2PKAB 5ESBA 1LHDH 1ZR0A 3L3TA 3TJOA 4Q7XA 1T4VH 2V0BA 3MH7A 4DIHH 2ZQ1A 1HCGA 3GY7A 4Z1MD 3F9FA 2BLWA 2PKSB 2J38A 4FUDA 1P3CA 5C0UA 3MQKC 1NRNH 1HIAB 1UK4A 1LDTT 3SGAE 1OWHA 1GWAA 1MZDA 3O8DA 3SN8A 4NA8A 1DM4B 1YPLH 3C27B 1LVMA 2PHBA 2A5KA 1HXFH 1AD8H 1O3CA 4XFQA 2JETB 1VITF 3U98H 3MFJA 1SLUB 3LJOA 3MU8A 3VB7A 1TA2A 1C4V2 1V2UT 1ACBE 2H1UA 2P3FH 1BB0B 1GJ4H 2AERH 1X7AC 2PGBB 1GVKB 3M61U 2GV6A 1ESBA 2H2ZA 4BTTB 2Z9JA 1TX6A 3FFGA 3S9AA 4B1TA 1AFQC 4X6OA 1VCPA 1BJUA 2SNVA 1ELCA 4X1SU 1DT2A 2WPIS 1NFUA 3RXTA 4CBNA 3KQBA 4D9RA 2ZHEH 1YGCH 3E1XB 2WPKS 3F68H 4JK6A 1JWTA 1P0SH 1AWFH 1LPKB 2WV9A 4X2VA 2J2UA 1P06A 2BYAX 1N6XA 3T26A 1KLJH 1AIXH 3P95A 2YMSC 3NRLA 1D3TB 3RXGA 2KAIB 4AFSA 1ELEE 3VGCB 3H09A 3EDXB 1QRXA 1C1UH 2ZDAH 3D49H 1HAHH 1IQLA 1ETTH 2TBSA 1GI0A 1OPHB 1XX9A 4Q4LA 1SLWB 2TRMA 2R2WU 1XXDA 1O2IA 3JZ1B 2BDYA 1C9PA 2AIPA 3TK6A 5E0HA 1IQMA 4RSPA 3PRDA 4OS7A 1GHAG 2HOBA 2VH0A 1GBHA 5F8XA 4GHTA 2OC0A 3A7TA 4I8JA 1TLDA 2J9NA 5GIBA 4AYYB 4MPVA 3QZRA 1INCA 5KEDA 1YCPH 2JIZD 1GI3A 4O3UA 1C1WH 4LOYH 2HPPH 3Q76A 3SI4H 3Q3XA 1T8MA 4FOUC 3U8TH 1BRCE 1TPPA 4TY6A 3RXDA 4YOJA 1C2KA 1YPEH 5IDKA 3LJJA 4D9QA 5E2OA 1YWUA 1BTZA 3HKIB 3F0OA 1QCPA 1AVXA 2XNDD 1XM1A 2A0QB 1MCVA 3ZV8A 1BJVA 2UWLA 1P02A 1O32A 4DVAU 1SQTA 5AFZH 4BAQB 3A7VA 3RUOA 2J94A 6CHAB 2VWLA 4DGJA 1P10A 2OC1A 3NPSA 8ESTE 1BMFD 5DKMA 1MAYA 1QBOA 3PB1E 4H6TA 1OWDA 1T8NA 2ZA5A 9ESTA 4HI3A 1KLIH 1XKBC 5EG4A 3BTME 1SSXA 1UVUH 4HZHA 1O2WA 1PPBH 1SI5H 3W94A 2C90B 1O2ZA 4ZKSU 2JH5D 3DHKH 4H42U 3LOXA 2TGPZ 3E16B 1OS8A 2JJ2D 1TGBA 3PRBA 1AKSB 2EI7A 1GJBB 4Y8YA 5E8EH 4AFUA 4BXWA 1QA7A 3SBKA 1UK2A 1O33A 1RD3B 3LGTA 2BY8X 1YCPK 3P8OA 4JYTA 1MAXA 3UTUH 1FQ3A 2ZP0H 3M35A 3A8AA 4K8BA 3VEQB 1CT2E 1RS0A 1VCWA 5HKKD 2PUQH 2BD9A 2I6SA 1NY22 2ZGHA 2ZKSA 3KN2A 1YPJH 5GPIB 4FU9A 5JDUB 5C94A 1SHHB 4X8SH 3UNSA 4JYUH 3BTEE 2AMDA 1YKTA 4I32A 4NZQA 4ISNA 3QO6A 4ABDA 5F6MA 1AFQB 3KCGH 3CENA 1KXAA 3DFLA 1L1JA 2WPJS 1RJXB 1U6QA 1IAUA 1O34A 1UTNA 3A7WA 4I8LA 4CBOA 2ODQA 3VFEA 2KCOA 4DOQA 1DVAH 1QBNA 1EJAA 1GI9B 1QRWA 1JMOH 1DLKB 2GCHG 1GCTB 2QGRA 2R0LA 5A0CA 4A1VA 1N8OC 1QGFA 1GBIA 1GBKA 1QIXB 2YMSB 2PR3A 2WYGA 1BT7A 4CR5A 2GKVE 4GHQA 1ZRKA 4O97A 1AUJA 1KTSB 4X6MA 5CHAB 1ELAA 5LPFA 3Q77A 1TALA 1P3EA 2LELA 4K2YA 1HLTH 2KFWA 2VWMA 4ABBA 1AO5A 3S0NA 1P2QA 4ABIA 2ZDVH 3KYGA 5ESTE 1OWEA 4UEHH 5I46H 2Q6DA 2QYIA 1NRSH 3SV9A 2ZO3H 1E79D 3SNDA 3LGUA 5ABWA 1UTPA 3LGVA 3RXPA 3ZZAA 1P2IA 1SGIB 3RXIA 4B75A 4ISOA 1K28D 3EE0B 3KNXA 1MCTA 3ZVEA 2AMQA 3LKWA 4MDSA 1C1MA 1PPHE 1SLVB 2UUJB 1UTOA 2ALPA 5LPRA 3EE7A 4I8KA 1FX0B 2OD3B 2C8ZB 5A8YA 1J17T 5KECA 1C5MD 1K1LA 1S85A 2F9NA 2C8YB 3OSYA 3ZVGA 3LT3A 4AG1A 3RXJA 2ZU5A 1O5CB 2BVRH 4JMYA 1V2KT 4AZ2B 5E0JA 2YOLA 4HTCH 2G5VA 2EC9H 3HATH 1W11U 1Z1JA 1ORFA 2BOKA 1O3DA 3PLKA 2Z7FE 1ABJH 2P94A 1EZXC 1SFQB 2B8OH 4ISHH 1S6LA 4B73A 4I86A 3P92A 3N7DA 1RFNA 1O2JA 3TNTA 2G51A 3A83A 3SU0A 1YPMH 2PWXA 1Z8JB 1EAIA 3PLPA 1VCQA 1FY8E 1AN1E 2ZZUH 4U32A 1TNKA 1RTFB 2ESTE 1OX1A 2QF0A 3GY4A 4AB9A 1WTGH 2GDDA 3VB5A 2XBWA 1AZZA 2G00A 4FUCA 2TPIZ 4TT3D 1W12U 1A1RA 2R9PA 1C1NA 4Y76A 3N99A 1C5WB 1HBTH 2BDHA 4NFFA 2RDLA 2V3MA 4ABHA 4CRBA 1NBMD 1O36A 4ASHA 1VKYA 1GHWH 2P16A 1C5NH 3GCTG 1Y59T 1QA0A 2AS9A 5CDFE 4K60A 1ELBA 1QQ4A 1YPHC 2C8XB 1AHTH 1Z8IB 7LPRA 1W13U 3CS7A 5FBEA 4ZKOU 1PQ7A 3TPIZ 3SU3A 2Q1JA 3NCLA 1WXRA 1MUEB 4LZ1H 1XUGA 1DDJA 4ABGA 2GCTB 2BD3A 3W1EA 2BDAA 3KQCA 1O2HA 4I31A 1S83A 4D8NA 2ZGCA 1ZHPA 1JRSA 3V0XA 4ZHMU 3GY6A 1H8HD 4ZHAA 2B5TB 3LONA 9LPRA 1TMTH 2A5AA 2VGCB 5GDSH 1T7CA 5SGAE 5EPYA 1ELVA 1G30B 5JPMH 1SGEE 3ATWA 4Y11E 1HAIH 2BZAA 1Y3XA 3LH1A 3RMMH 1EOJA 2AGEX 2ZHQH 4MNYA 3TGIE 4LXBH 3ZVDA 1C5RA 1EXFA 3A85A 2BY6X 5F53A 2FEQH 2BOHB 5DP7A 4AORA 1OWJA 4BTUB 3PMHB 5EXNA 3DFJA 3NK8A 1C5SA 4H6SB 3SJ9A 3TU7H 4X8TH 2PV9B 3PWBA 2F4LA 2EI8A 1SBWA 2PSXA 2ANKH 4TWWA 1DWDH 2QE7D 2VIDA 1SOTA 2XC0A 1SVPA 1Y3VA 2HRVA 1O2GH 4ZKRU 1SOZA 4FUBA 1BHXF 4AFZA 1ZSJA 3GY3A 3TITA 4R8TB 3P8NA 3TH2H 1QRZA 3E6PH 1JIRA 1G3BA 3GYMA 1GMCG 1GBDA 2Y80A 1O3JA 3BEIB 4AYVB 2YMSD 1A0JA 3U8OH 2QIQA 1PJPA 2H9HA 2OINA 4Y8ZA 1KMHB 4UD9H 1J15A 1BMAA 2SNWA 3MU1A 1S6FA 1UVOA 3A7YA 3LGYA 2A4QA 3MU5A 1PPFE 3UFAA 1W14U 1DOJA 3TH3H 2OUAA 3FAOA 1WUNH 3ZZ5A 1GBTA 2BLOA 1ELTA 4NIYA 1O3HA 4A6LA 4K3JA 1ZTJA 3WWFA 1AFEH 1HAVA 3FOAA 2ZFTA 3PMBB 2FPZA 4ZXYH 7GCHG 4ZXXH 1QL9A 1TNIA 1ELGA 2WYJA 2M5TA 2FM2A 2XOKD 4KTUA 4MPWA 1E1QD 3HK3B 1WQVH 4E05H 1TX7A 2ULLA 5DP8A 1GHBF 2V6NA 2Y5GA 2ZHFH 1AUTC 1ZLRA 2BX3A 4ZH8A 1GBCA 1K1PA 1RTKA 1O5BB 2RFKC 3RMOH 1TRMA 2XBXA 1L2EA 1HV7A 2QC2A 3GY2A 2XC4A 3ATKA 4Z0KA 1DWBH 2RA3A 3A81A 4HFPB 1O0DH 2ZCLP 3VGCC 1FAXA 2BY7X 1SG8B 1IQNA 1S82A 4DW2U 1C1SA 1Q31A 2PKAA 3B9FH 1D4PB 1P04A 1H8DH 1H9LB 2AFQB 1ARCA 1FUJA 1PPCE 3ZVAA 4K8YA 1C4U2 3OAAD 2Y81A 3RXCA 1DSUA 2ZFPH 2GGVB 8KME2 3VB6A 1C2DA 1GDQA 1SGTA 2BXUH 2H9EH 6GCHG 5DSFA 4WMEA 3LGIA 3RLYH 4VGCC 3PV2A 5C20A 5DP9A 1GJ9B 4JZDH 4FU8A 4OGYA 4B6FA 4K1SA 3KEEA 1A0HB 2GP9B 1DUAA 4YLQH 1MQ5A 3OE7D 1G36A 3M7QA 2BHGA 4NWLA 5C1YA 1THSH 2Z3DA 1EJMA 4R0IA 1LQEA 5ETXA 5L6NH 2FMJA 2RCEA 2J92A 3KQDA 3ZYEA 2BD7A 3RXVA 2R3YA 2TIOA 2ZIQH 1UW7A 4MLFB 1GJCB 3A87A 1CO7E 2ZDKA 3A84A 4IGDA 3ZZ3A 1OP0A 1E35B 2BD5A 3RMLH 4B2BA 2K8IA 8GCHF 1FIWA 2V35A 2XWAA 3QGJA 5HXFA 2A7HA 5TCAA 1FN6A 4YOGA 1HAVB 1WOFA 2FZZA 1GI6A 3RU4E 3RP2A 1WYKA 4XBDA 3SW2B 4Y7BA 4K1EA 3M5NA 1A3BH 5GNDA 1WV7H 2FOCA 5EW1H 3ZZ6A 2VIWA 3E0PB 1RXPA 2KAIA 4FUJA 1CBWC 4U2WA 2B9LA 2ZECA 4FU7A 1NT1A 1LHEH 1SGCA 3C1KA 2F9VA 1LHGH 1YY3A 1F0RA 1HJ9A 2O8UA 3K2UA 4MPXA 4B76A 1GI7B 4X1NU 1J16A 2K1QA 4UFEH 1AY6H 1AU8A 1QY6A 4KELA 1SGPE 1TGNA 2FLRH 5G4BA 5CHBA 1EATA 1VITG 4XRNA 1O2MA 4OGXA 3RXQA 5GCHF 1SQOA 3MMGA 2WZQA 1QJ1B 4NZLA 2HWLB 1D3PB 2BY5X 2O8TA 1LPZB 1AMHA 2VBCA 3SORA 1O3GA 4ABJA 1C5QA 3ODDA 4INHA 4IC5A 3ELAH 1D9IA 3A82A 5F8TA 5EW2H 1ZSLA 4Q2KA 4TPYA 1LPGB 2P3UB 2IJD1 4I8HA 3SNBA 4RT0A 3EYDA 7ESTE 3ZZ4A 3ZVBA 1WAYB 1W2KH 3UNRA 2YNAA 2PLXA 3RDZA 1QTFA 3F6UH 4B6EA 1V2ST 3BG4B 4X6PA 4ABFA 2FS8A 3G01A 5HM2A 2A5IA 5DPAA 4I7YH 2VNTA 2BDCA 5T3HA 3UQOA 3PMAB 3S69A 1EP6A 4MNVA 3TVJB 1K1JA 1FIZA 1GCTC 1FY3A 1YYY1 1SL3A 5JB9S 2O8WA 4GCHG 1B0FA 4Q7YA 3E0NB 2P3TB 4XE4A 1TMBH 3M7TA 1M9UA 3F9HA 5HIZA 3SU2A 3EA9A 1B7XB 5A0BA 1FY1A 2J4IA 1IQKA 1P11E 1UJ1A 1F2SE 1GI4A 3QN7A 3EGKH 5CHAC 2V3HH 4U30A 3T5FH 5C2ZA 4P00A 1AKSA 1ZPBA 2BB4A 4CHAC 3ZZCA 2PUXB 4BXSA 2PW8H 5A0AE 2NU4E 2NWNA 2ZCKP 3SNAA 3GCNA 4VGCB 1XUJA 2F3CE 1V2RT 2O8MA 2VIOA 3W95A 4MPUA 3S9CA 1O3MA 3TLOA 3VB4A 2KCPA 3ZZ8A 1ZZZA 1C2HA 4DY7B 2ZC9H 1GI5A 1MBMA 3OTJE 1O37A 4NIXA 4Q7ZA 1AE8H 4IBLH 2Y6TA 1O31A 4OS1A 2B7DH 2PTNA 1TB6H 1J9CH 1T31A 1IOEA 3SJOA 3QDZB 2WPDD 4IN1A 1BBRH 1J8AA 5B6OA 5HIYA 1C1OA 1VGCB 3BG8A 3FVFB 3UIRA 5C17A 1P03A 2HALA 3M3SA 2ZGXH 1V2WT 1OHHD 3SU5A 4LZ4B 1MQ6A 1T8OA 1W0ZU 1FV9A 1P12E 4MNWA 3OU0A 4TY7A 1T32A 1OSSA 1PPEE 3UR6A 1LVBA 3O8CA 2A1DB 2ANWA 2ANMH 1MTUA 1V2VT 2BLQA 1MD8A 3LC3A 1LVYA 3AVZA 2XXLA 4IMZA 5AFYH 6LPRA 2GZ7A 1CT0E 1Z6JH 1BOQA 1CBWB 1FDPA 4GVUA 1TX8A 4XSKU 1E38B 1IQIA 3CNRA 4HG6A 1TMUH 1ZHRA 3AW1A 2SGDE 3RXUA 1A2CH 3M3VA 3SZNA 4WF8A 4A1TA 2UWOA 2W7SA 1Z8GA 4FUIA 4BOHA 1ZOMA 5EJLA 3SOSA 3VG8A 2H5CA 1GVZA 1XKAC 2ZTXA 4INKA 2KCYA 1UTMA 1O2OA 1BBRK 1O5GH 4ACAA 2ILNA 3FZZA 3MYWA 5JBCS 2XWBI 1MD7A 1O2PA 3RXMA 4WXIA 3EA8A 3UR9A 2ZTZA 1HXEH 3BIUH 4CRGA 1C2IA 2VIVA 1TGCA 2FP7B 3GOVB 4PROA 5EXLA 2GJGA 3LIWA 2GCTC 3MH5A 1P9SA 1C2EA 3GDSA 3ZVCA 3RXOA 1OOKB 4DJZB 2AGIX 3RU4T 2FOAA 2OLGA 3TJNA 1HJ8A 5HM9A 1E34B 3MTYA 4XDEA 2ZCHP 2VGCC 1HPGA 1K2I1 3FN8A 2CMYA 2O9QA 2V7QD 1GBMA 2R3UA 4THNH 1QJ6B 4X2WA 1P2KA 4ZROA 1GJ8B 1WDIA 1QBVH 5KGOA 1S0QA 3BTGE 2BMGB 2OQ5A 3SYJA 1HAPH 4KP0A 1CGHA 2HLDD 2Y7XA 4AG2A 3HK6B 1CA8B 4UFDH 1GVLA 3TJVA 1AVWA 1TRYA 4ZMAH 1TNJA 4JCNA 1O2QA 1XVMA 4YTAA 2BQ6B 3ATIA 5K0HA 1GBBA 1ZPZA 1PYTD 1YM0A 1E0FD 1TOMH 2ZFRH 3MNCA 3PTNA 2LIZA 3AK5A 5DO4H 3PO1B 1OP2A 4K69A 4BTIB 4D7FA 4ISLA 1RRKA 5DGJA 4MNXA 5TCCA 1Y3YA 4UFFH 1GBLA 1AWHB 5BPEA 4CHAB 4SGAE 4BNRA 2XBYA 3FP6E 4TPIZ 1MTNC 3RXLA 1E36B 4YXWD 1G3CA 3MI4A 2Z9KA 1SGFG 1V2QT 2FTMA 5IYTA 4INLA 1O39A 4YT6H 2ZFFH 2W3IA 2KCAA 1HUTH 1L4ZA 2CK3D 2Z9IA 3RMNH 3SQEE 4F4OC 1A5IA 1O3NA 2D1JA 4X2YA 1YCPM 4JK5A 1BTHH 1ZGVA 2WV5A 2GCHF 1CGIE 2J5UA 4OS4A 3KF2A 4KGAA 3HKJB 3FZDA 2IPQX 1GMDF 2ZGJA 4XBBA 1GG6C 2C4FH 2KR7A 1FAKH 3OY5U 3VXFH 1O5FH 2A4RA 1O2YA 3PYHA 3SV8A 2AGGX 3BV9B 4FVBA 4DURA 1GBEA 3KIDU 2HPQH 2FI4E 5FX6A 4X1RU 5J4SA 4WMFA 2G81E 3I29A 1GI8B 3OY6U 2PP6A 1T8LA 1K9OE 1A3EH 1Q2WA 1W3CA 1TFXA 3MU0A 2C8WB 1SFIA 2OXSA 2BM2A 5C3NA 1IQHA 2BZ6H 1TNLA 3SUGA 1P01A 1NFWA 1SQAA 1FLEE 1K1IA 2VVVA 3I78A 2BDBA 2WHXA 2G5NA 3S7KB 1F0UA 1AGJA 1G3DA 1QB1A 1O5EH 2OP9A 3EA7A 2A45B 1SGFA 3OEHD 3MH6A 2Z3CA 4OS5A 2QV1A 1DANH 3VPKA 1C5LH 1SQRA 3SQHE 1A7SA 4Y6DA 3PM3A 1G9IE 5FX5A 5FBIA 1GL1A 1O3BA 3V3MA 3GYLB 1SGYE 1F5RA 2GZ8A 1YP9A 1DITH 3TH4H 4NCYA 2OC8A 4IC6A 3NUMA 1Z71A 1GDNA 4ZUHA 2CHAC 3SUDA 1FI8A 2VWNA 3ITIA 2CF8H 3SNCA 1NFYA 2YNBA 1EJNA 2W6ID 4DIIH 3E3TA 6ESTA 3ZZ7A 2WPMS 2WUCA 1QL8A 1EAWA 2FOGA 1CVWH 1CHOG 2CGAA 1C5TA 2F9PA 2G8TA 1ETSH 1THRH 1F92A 4O3TA 2JDID 5T6FA 3WY8A 1DLEA 2A31A 2BDIA 3UNQA 2J97A 1SKYE 1F0SA 2VB0A 4X2XA 3RXSA 4E7RG 1C9TA 2GMTC 2VVCA 3M36A 4P02A 1GBAA 5L30H 2ZDNA 3STJA 3GICB 3U8RH 1W0KD 1XUHA 2QY0B 3GY5A 1C5XB 1L1GA 1BTPA 5CMXH 2F91A 3GCTF 2BLVA 2PTCE 4Y0YE 1KSNA 2QCYA 1DY9A 4XOJA 5FPSA 3O8BA 4LK4A 3ZZBA 1KDQB 2A32A 3ZV9A 1O2TA 1ZMJA 1P9UA 1EB2A 3MNSA 1GCDA 1BTYA 4M9FA 3M7UA 4HGCA 1IQFA 5GXPA 2G52A 1AE5A 2EEKA 1SPJA 5EQQA 3M37A 3SHAH 3S7HB 2FS9A 4F48B 1HJAB 2L6OA 3MH4A 3T25A 3AW0A 4U01A 3SZEA 3SU4A 1C2JA 1CA0B 1XVOA 3RC6A 2W6JD 1A5GH 1HAOH 1IHSH 5JBBS 1FJSA 5FXLA 3DD2H 3SHCH 1MTNB 1GGDB 1O5AB 2HNTC 1EFRD 2VU8E 1H8ED 3MNXA 3U1IB 4NGAH 3DSGA 5E0GA 1DX5M 1BITA 3I77A 1NBME 3P8FA 1W0YH 2D26C 1P57B 1BRAA 4YOIA 4WWYA 1IHTH 2KZ4A 1H4WA 1BMLA 2C93B 1C5UA 1PYTC 3GCOA 1GG6B 3TNSA 2XBVA 4GUXA 3R0FA 1THPB 1QJ7B 1UHBA 3PMJA 1S81A 3D65E 1TIOA 2FOEA 1BBRE 1P09A 2VVUA 1AZ8A 3UOPA 1MKWH 1JXPA 3BG4C 3SI3H 1TABE 3MO3A 2QXGA 2RG3A 3DSOA 4O9VA 4RI0A 2GX4A 4YLUA 2PGQB 1O3OA 1ZMNA 3QTVH 1BTUA 1GMCF 1UTLM 4BAHB 2Y5HA 1ZSKA 3ZYDA 2QF4A 5JBTA 2ZU4A 1TBZH 3P6ZB 3UOUA 3WW7A 3RU4D 3T62A 1A61H 3U1JB 1A4WH 2Z9LA 2GV7A 3M5OA 1B0EA 2WV4A 2F83A 2J98B 1FZZA 3BSQA 2QXIA 2HVYB 1OKXA 4FUFA 1AB9B 2FOFA 2IPHA 4FXGH 1O2KA 2QAAA 2ALVA 1JOUB 2BD4A 3M5MA 4ABAA 1NC6A 1EUFA 7GCHF 3GCHC 3F9GA 3L33A 3A8CA 1DWEH 3VB3A 7KMEH 1W7GH 3LDXH 1TNGA 5C5OA 4JZIA 2Z3EA 1O2RA 1XXFA 2K0QA 2STAE 1ANDA 1GMHG 2ZHWH 1DPOA 1O2SA 3GISB 2CHAB 3VXEH 5A8XA 1MKWK 1C5YB 2A2QH 2ODYB 2SGAA 2FO9A 4KKDA 1VGCC 1NS3A 4AGJA 1SR5C 1V3XA 4Y71A 1P8VC 1UCYH 2QA9E 1GHYH 1KYNA 1P2MA 1FY5A 2ZPQA 4K5ZA 1GHVH 1EZSC 4DT7B 4BANB 1O3IA 2OQUA 3PWCA 1O2XA 1UHBB 2A7JA 4YESB 1YBWA 4DT4A 1S0RA 1MZAA 6GCHF 1CHGA 2FI5E 3LU9B 1GHZA 2HVXA 1BHXB 2GMTB 1C2FA 2ZG0H 2ZPRA 1UTQA 2FTLE 2FOHA 3QGNB 1UVPA 1YF4A 1EKBB 3MOCA 1VJAU 1D3DB 3ATLA 2FDAA 3KQ5A 1LTOA 1S84A 2BVXH 5DP5A 3BF6H 3TGJE 3HGPA 3FO8D 2DE8A 3KYFA 3ZIAD 5L2ZH 1QL7A 4WMDA 3SV2H 1EAUA 1LHCH 4CREA 1C5ZB 1HDTH 2G4UA 4AN7A 1YC0A 3LC5A 1QB6A 1FPCH 2CXVA 3F9EA 5EIYA 3OYPA 4H4FA 1UVSH 1WCZA 3MHWU 5GWZA 1JBUH 3HPTB 1HAYB 3V12A 3BN9A 2IOTA 1EOLA 4X8UH 1W7XH 1PQ5A 3GS9A 3RM2H 5EQRA 2ZF0H 2NU1E 3QTOH 1IQJA 1UCYK 1NO9H 2Y5FA 1O35A 1P2OA 1Y5BT 1H9IE 1SGNE 1LO6A 4ASUD 2ZTYA 3MO9A 4KTCA 1ID5H 1V2NT 1A5HA 1C1VH 4ZAEA 2F9BH 3DUXH 2P93A 5FPYA 3URCA 4MVNA 4IW4E 2WPLS 3RXRA 3MU4A 2VWOA 1KTTB 1N6YA 1MH0A 4NWKA 5EU8A 2XRCA 3U69H 1GL0E 4SGBE 3TIUA 4RN6A 2HLCA 2QN5T 4Y7AA 4Q80A 1WTHD 5AF9H 2BQWB 3DA9B 3D62A 2ZDMA 1NZQH 2GD4B 2OTVA 3PV4A 2AH4X 2W7UA 1BQYA 4FUHA 2AHME 2VIQA 4BAKB 1NU9A 2F9OA 5F8ZA 3ZZDA 2TGAA 2EQNA 3U9AH 1OP8A 3SV6A 2ASUB 2FIRH 1K1OA 1EP5A 2BDGA 2PSYA 5A8ZA 2WPHS 3A8DA 2IJOB 2Z94A 5GJ4B 4X1PU 2LPRA 2TGTA 4KTSA 3RC5A 3PTBA 3RM0H 5EJZA 2PFEA 4Y0ZE 1GJ5H 3WWBA 3PO1C 2JKHA 5C5NA 1C2GA 1NESE 3QK1A 5FL7D 1S6HA 3A80A 2ZDLA 1OWIA 4NSVA 3ZZ9A 1F5LA 2FX4A 4AX9H 5JYIA 4JZ1A 3DSPA 3Q3KA 5TJXA 8LPRA 4A1XA 5DP3A 4ESTE 1BTXA 2JJ1D 3RLWH 4YZUA 3GCHB 4X0WU 1K1NA 3Q00A 2I6QA 3SU1A 3BIVH 2ZI2H 5J4QA 5C1XA 4Y8XA 4NA9H 3FP8E 4RKOB 5EOKA 3RXHA 3PV5A 1F0TA 1BRBE 1FN8A 1HYLA 1VITH 5DG6A 3LPRA 4UFGH 3P8GA 4D76A 4GCHF 1V2TT 2B0FA 1O2UA 5A2MH 1E1RD 3KL6A 1BIOA 1MKXH 1C1QA 3PLBA 2UWPA 2AIQA 1CQQA 1KXEA 3V13A 3KHVA 5T6DA 4UE7H 1FXYA 5BRRE 5EPNA 2FESH 1GPZA 2XNIA 1G2LA 3BEFB 2W3KA 2XCFA 3UUZA 3ENSB 1L0ZA 1XUFA 2P8OC 4JZEH 3T29A 4WY3A 1SB1H 1K0HA 4ZCNA 1ZMLA 2ZEBA 2IN2A 1UVTH 2LNCA 4WH6A 1GHAF 3QWCH 1RIWB 3MO6A 2BD2A 2BTCE 3QX5H 1DSTA 1NROH 1GBFA 5EJ1A 1NRQH 4OS6A 1TPOA 4A92A 4GSOA 5EXMA 1LHFH 2Q6FA 4CRDA 4D7GA 3MNBA 5AVDA 3F2HA 2Z9GA 1ZYOA 5LPEA 2DUCA 1TGTA 4X1QU 4X6NA 3F1SB 5HYOA 1CE5A 4GAWA 1TYNA 3BTWE 1KXFA 1HFDA 1AQ7A 5T6GA 3IWMA 1TQ0B 3L6PA 1MKXK 5EGMA 2A4OA 4WJG2 5IK2D 3Q3YA 1BRUP 1DE7H 3M3TA 1O2NA 2NU0E 1TNHA 1SGDE 3UPEA 1KY9A 1ZRBA 4E7NA 3T28A 1TA6A 1F7ZA 4OM9A 3NXPA 1TRNA 5H4IB 1P05A 1DXWA 1O3PB 3HGNA 1ZJKA 1CGJE 3STIA 1N1LA 5JB8S 1SGQE 2FYQA 5HGGA 5JBAS 4Y10E 1O2VA 1TWXB 2SFAA 3QLPH 4YM9A 3UQVA 2CV3A 2KM0A 1V2OT 4NIWA 1MTWA 1PPZA 1OYTH 1E37B 5HMAA 3E8LA 4WH8A 2WUBA 3KQEA 2ODPA 2D8WA 3SV7A 1OWKA 1GHXH 1Y5AT 1EX3A 2H5DA 3A8BA 3K6ZA 1QR3E 1P2JA 1BTWA 1ELDE 4M7GA 1BMMH 2FWWA 3FANA 1Y8TA 2F43B 1HAXB 3FKSD 4Y79A 2A4GA 1YPHE 4XBCA 4IMQA 4J2YB 1UK3A 1DXPA 1TONA 2ZPSA 1RGQA 1FY4A 2M2AA 3KGPA 5FHTA 4CR9A 4TYDA 1PPGE 2F9UA 2FLBH 1WQSA 1ABIH 1HJAC 3ESTA 1KXCA 3T27A 1TE0A 1ZHMA 1CA0C 1DWCH 1TPSA 2FX6A 1C1PA 2ZQ2A 1BUIA 1MTVA 2GZ9A 1PQAA 3NKKA 2EI6A 3R3GB 2OK5A 5L2YH 1GGDC 1UO6A 1W8BH 1TPAE 3BTQE 1O38A 3ATMA 1GMDG 5F03A 3OEED 4WXVA 1NRRH 3RXKA 4CRCA 3H7OA 1G32B 1G2MA 2BD8A 5FAHA 2C3SA 1DFPA 1P2NA 1K1MA 1EB1H 2QF5A 2BVSH 1HGTH 4JYVH 4MG3A 1V2LT 4IN2A 3V7TA 2QF3A 1NN6A 3AAVA 2VIPA 4CRAA 3BTKE 1Z7KA 4AC9A 2SGFE 1O5DH 3UWIA 1UTKA 3UAIC 2O8LA 5T1VA 4Q63A 3CS0A 3A7ZA 2NU3E 4UDWH 1O2LA 2VJ1A 3IITA 5EODA 4F55A 3N7EA 2HGTH 1UCYE 1Y3WA 4B2AA 2WINI 1SLXB 2P8OB 4QT8C 1W0JD 3QUMP 3RXBA 2HNTE 4CH2B 1EQ9A 4GLYA 3EQ0H 3SJIA 2XYAA 1KDQA 3PROA 3A7XA 1EPTC 3T2NA 4JZFH 4NIVA 1YLNA 2WSSD 1OYQA 1JIMA 1G3EA 1J14A 1LKAA 2VINA 2JH6D 2OC7A 1KLTA 3RXAA 1BMNH 1HB0B 2H6MA 1S5SA 2UUFB 3LH3A 1C5OH 1C5VA 1COWD 2BXTH 1ESTA 3SU6A 1V2JT 1AB9C 2BY9X 3NZIA 1WSSH 3D23A 3ZVFA 3O8RA 1FNIA 2ANYA 1NTPA 1IQGA 4AB8A 2STBE 2ZGBH 1DICA 1HRTH 2OBQA 2Z6BD 5DP6A 1TGSZ 1D6RA 1DUEA 1ARBA 1HAGE 4ISIH 3N7OA 1KIGH 4OS2A 1BDAA 1EASA 3TGKE 3SJKA 2XCNA 2GT7A 1IQEA 1NPMA 5DP4A 1EZQA 2H9TH 1L4DA 3UY9A 3IG6B 5DJ7A 5K7RA 1O3AA 1NFXA 1CT4E 4J1YA 4ZKNU 3S9BA 1JRTA 1T4UH 5E2PA 2TGDA 5C67A 1MMJN 2CF9H 1XMNB 4B2CA 1O3EA 3F0PA 2SGQE 4NFEA 1QB9A 2Q6GA 2SGEE 1B5GH 4IS5A 2UUYA 5DK1A 1ANEA 1EZUC 1GI2A 2EA3A 2UUKB 3P17H 1DS2E 4AOQA 1D6WA 1PQ8A 1Y3UA 4TWYA 1WBGB 1EPTA 1EAXA 2L74A 2FYRA 3AASA 3U28C 5CE1A 1GJAB 1UTJA 1TBQH 3E91A 4I33A 3RXEA 1SGRE 3CP7A 2BX4A 2J98A 2ZU1A 2THFB 1YPKH 3MWIU 1TBRH 5I25A 1K21H 2EY4C 2BQ7B 2NU2E 4AFQA 3SGBE 1QQUA 2V3OH 1Q3XA 1UMAH 3UREA 4TSFD 1CHOF 3JZ2B 1H1BA 4ZHLU 3BTHE 2J34A 1MBQA 1V2MT 2RDEA 1SMFE 2D2DA 2CJIA 1F5KU 2FODA 1A46H 3TK5A 1ZTLA 3BTFE 3QZQA 1ANBA 3BTTE 1N8OB 1QNJA 1YPGH 2CN0H 4GPGA 1AVGH 1LMWB 1GI1A 4FVDA 2GVFA 4CRFA 4AGKA 1C4Y2 3SGQE 3ODFA 1RTLA 1MTSA 2ZFSA 4CH8B 1C2MA 1NRPH 2RA0A 1SC8U 2Y82A 4ACBA 1SHYA 4DCDA 1HAZB 1H9HE 2ZNKH 3K6YA 2ZHDA 2PKSC 4I8GA 1GJ7B 2XTTB 4YO9A 2OBOA 1GHBG 4A7IB 1C1TA 2SGPE 1L1NA 1PFXC 2ZU2A 1XUKA 5FPTA 4FETA 5C1UA 1GBJA 2KX4A 1H8IH 1C5PA 1ZGIA 1FPHH 3UWJH 1CSOE 2JETC 1Z1IA 1QFKH 2GDEH 3P70B 3URDA 3DCLA 1ETRH 2G4TA 3K9XB 2QXJA 4UONA 1O3KA 4MTBA 2ZFQH 3OTPA 5PTPA 1EPTB 1BZXE 3RXFA 1C1RA 3SO3A 1Z8RA 2DE9A 4DG4A 1C2LA 2HNTF 1ZJDA 1O30A 2G55A 1GJDB 2AYWA 1DY8A 1LCYA 3TK9A 1XUIA 3A89A 1LVOA 4FUGA 2FXRA 3BEUA 3K65B 3SJ8A 2A7CA 4XD7D 2GTBA 1O3LA 2ZU3A 3BTDE 2W5EA 5EQSA 4RT1A 1VZQH 2XW9A 4ABEA 2VH6A 5A09A 3NWUA 1YLDA 3DT0H 1GDUA 1A0LA 3H5CB 4BAOB 1YLCA 1G37A 5FCKA 1QZ8A 4FUEA 4A5TS 5DN6D 3B8JA 2ZWLH 3OFND 2A2XH 1MABB 3OX7U 1WU1A 3UB0A 3LGWA 2AEIH 8GCHG 1W10U 1V6DA 4E06H 5LGOA 1VR1H 1BA8B 1HIAA 4RKJB 3GDVA 3EBNA 1Y5UT 4WVPE 2GT8A 1ESAA 4B71A 1QURH 1D3QB 1LQDB 2Y7ZA 3H7TA 1TAWA 4MQAA 2FOMB 5LH8A 1NU7B 3EAJA 1VJ9U 1TQ7B 1OXGA 4O03A 4NA7A 2AMPA 5B6LA 4B74A 4YT7H 2W26A 1NM6A 3F2GA 1BCUH 1QHRB 1TOCB 1RIWC 3GY8A 3SNEA 1ANCA 1HNEE 2K7XA 2XC5A 3AAUA 3B23B 1GMHF 1ELFA 4F49A 1ZTKA 2J95A 1LKBA
chains in the Genus database with same CATH topology
2R2MB 1CU1A 1ZPCA 3RC4A 5GCHG 3TJUA 3FP7E 2R0KA 3SUFA 2P95A 1GJ6A 4X8VH 4BAMB 1MU8B 4NG9H 5AHGH 1FMGA 1Z6EA 1KXBA 2QXHA 6CHAC 2P59A 3E90B 2FOBA 4K1TA 2JH0D 5FCRA 3M5LA 2FI3E 4NSYA 3SUEA 1K22H 4Z6AH 1O3FA 1KXDA 1FONA 1MU6B 2OCVB 3A88A 1V2PT 3GDUA 3A86A 1AI8H 2PKAB 5ESBA 1LHDH 1ZR0A 3L3TA 3TJOA 4Q7XA 1T4VH 2V0BA 3MH7A 4DIHH 2ZQ1A 1HCGA 3GY7A 3F9FA 2BLWA 2PKSB 2J38A 4FUDA 1P3CA 1NRNH 1HIAB 1UK4A 1LDTT 3SGAE 1OWHA 1GWAA 1MZDA 3O8DA 3SN8A 4NA8A 1DM4B 1YPLH 3C27B 1LVMA 2PHBA 2A5KA 1HXFH 1AD8H 1O3CA 4XFQA 2JETB 1VITF 3U98H 3MFJA 1SLUB 3LJOA 3MU8A 3VB7A 1TA2A 1C4V2 1V2UT 1ACBE 2H1UA 2P3FH 1BB0B 1GJ4H 2AERH 1X7AC 2PGBB 1GVKB 3M61U 2GV6A 1ESBA 2H2ZA 4BTTB 2Z9JA 1TX6A 3FFGA 3S9AA 4B1TA 1AFQC 4X6OA 1VCPA 1BJUA 2SNVA 1ELCA 4X1SU 1DT2A 2WPIS 1NFUA 3RXTA 4CBNA 3KQBA 4D9RA 2ZHEH 1YGCH 3E1XB 2WPKS 3F68H 4JK6A 1JWTA 1P0SH 1AWFH 1LPKB 4X2VA 2J2UA 1P06A 2BYAX 1N6XA 3T26A 1KLJH 1AIXH 3P95A 1D3TB 3RXGA 2KAIB 4AFSA 1ELEE 3VGCB 3EDXB 1QRXA 1C1UH 2ZDAH 3D49H 1HAHH 1IQLA 1ETTH 2TBSA 1GI0A 1OPHB 1XX9A 1SLWB 2TRMA 2R2WU 1XXDA 1O2IA 3JZ1B 2BDYA 1C9PA 2AIPA 3TK6A 5E0HA 1IQMA 4RSPA 4OS7A 1GHAG 2HOBA 2VH0A 1GBHA 5F8XA 4GHTA 2OC0A 3A7TA 4I8JA 1TLDA 2J9NA 5GIBA 4AYYB 4MPVA 3QZRA 1INCA 1YCPH 1GI3A 4O3UA 1C1WH 4LOYH 2HPPH 3Q76A 3SI4H 3Q3XA 1T8MA 3U8TH 1BRCE 1TPPA 4TY6A 3RXDA 4YOJA 1C2KA 1YPEH 5IDKA 3LJJA 4D9QA 5E2OA 1BTZA 3HKIB 1QCPA 1AVXA 1XM1A 2A0QB 1MCVA 3ZV8A 1BJVA 2UWLA 1P02A 1O32A 4DVAU 1SQTA 5AFZH 4BAQB 3A7VA 3RUOA 2J94A 6CHAB 2VWLA 4DGJA 1P10A 2OC1A 3NPSA 8ESTE 5DKMA 1MAYA 1QBOA 3PB1E 4H6TA 1OWDA 1T8NA 2ZA5A 9ESTA 4HI3A 1KLIH 1XKBC 5EG4A 3BTME 1SSXA 1UVUH 4HZHA 1O2WA 1PPBH 1SI5H 3W94A 2C90B 1O2ZA 4ZKSU 2JH5D 3DHKH 4H42U 3LOXA 2TGPZ 3E16B 1OS8A 1TGBA 1AKSB 2EI7A 1GJBB 4Y8YA 5E8EH 4AFUA 4BXWA 1QA7A 3SBKA 1UK2A 1O33A 1RD3B 3LGTA 2BY8X 1YCPK 3P8OA 4JYTA 1MAXA 3UTUH 1FQ3A 2ZP0H 3M35A 3A8AA 4K8BA 3VEQB 1CT2E 1RS0A 1VCWA 2PUQH 2BD9A 2I6SA 1NY22 2ZGHA 2ZKSA 3KN2A 1YPJH 5GPIB 4FU9A 5JDUB 1SHHB 4X8SH 3UNSA 4JYUH 3BTEE 2AMDA 1YKTA 4I32A 4NZQA 4ISNA 3QO6A 4ABDA 5F6MA 1AFQB 3KCGH 3CENA 1KXAA 3DFLA 1L1JA 2WPJS 1RJXB 1U6QA 1IAUA 1O34A 1UTNA 3A7WA 4I8LA 4CBOA 2ODQA 3VFEA 4DOQA 1DVAH 1QBNA 1EJAA 1GI9B 1QRWA 1JMOH 1DLKB 2GCHG 1GCTB 2QGRA 2R0LA 5A0CA 4A1VA 1N8OC 1QGFA 1GBIA 1GBKA 1QIXB 2PR3A 2WYGA 1BT7A 4CR5A 2GKVE 4GHQA 1ZRKA 4O97A 1AUJA 1KTSB 4X6MA 5CHAB 1ELAA 5LPFA 3Q77A 1TALA 1P3EA 4K2YA 1HLTH 2VWMA 4ABBA 1AO5A 3S0NA 1P2QA 4ABIA 2ZDVH 5ESTE 1OWEA 4UEHH 5I46H 2Q6DA 2QYIA 1NRSH 3SV9A 2ZO3H 3SNDA 3LGUA 5ABWA 1UTPA 3LGVA 3RXPA 3ZZAA 1P2IA 1SGIB 3RXIA 4B75A 4ISOA 1K28D 3EE0B 3KNXA 1MCTA 3ZVEA 2AMQA 3LKWA 4MDSA 1C1MA 1PPHE 1SLVB 2UUJB 1UTOA 2ALPA 5LPRA 4I8KA 2OD3B 2C8ZB 5A8YA 1J17T 1C5MD 1K1LA 1S85A 2F9NA 2C8YB 3OSYA 3ZVGA 3LT3A 4AG1A 3RXJA 2ZU5A 1O5CB 2BVRH 4JMYA 1V2KT 4AZ2B 5E0JA 2YOLA 4HTCH 2G5VA 2EC9H 3HATH 1W11U 1Z1JA 1ORFA 2BOKA 1O3DA 3PLKA 2Z7FE 1ABJH 2P94A 1EZXC 1SFQB 2B8OH 4ISHH 4B73A 3P92A 1RFNA 1O2JA 3TNTA 2G51A 3A83A 3SU0A 1YPMH 2PWXA 1Z8JB 1EAIA 3PLPA 1VCQA 1FY8E 1AN1E 2ZZUH 4U32A 1TNKA 1RTFB 2ESTE 1OX1A 2QF0A 3GY4A 4AB9A 1WTGH 2GDDA 3VB5A 2XBWA 1AZZA 2G00A 4FUCA 2TPIZ 1W12U 1A1RA 2R9PA 1C1NA 4Y76A 1C5WB 1HBTH 2BDHA 4NFFA 2RDLA 4ABHA 4CRBA 1O36A 4ASHA 1GHWH 2P16A 1C5NH 3GCTG 1Y59T 1QA0A 2AS9A 4K60A 1ELBA 1QQ4A 1YPHC 2C8XB 1AHTH 1Z8IB 7LPRA 1W13U 3CS7A 5FBEA 4ZKOU 1PQ7A 3TPIZ 3SU3A 2Q1JA 3NCLA 1MUEB 4LZ1H 1XUGA 1DDJA 4ABGA 2GCTB 2BD3A 2BDAA 3KQCA 1O2HA 4I31A 1S83A 4D8NA 2ZGCA 1ZHPA 1JRSA 3V0XA 4ZHMU 3GY6A 4ZHAA 2B5TB 3LONA 9LPRA 1TMTH 2A5AA 2VGCB 5GDSH 1T7CA 5SGAE 5EPYA 1ELVA 1G30B 5JPMH 1SGEE 3ATWA 4Y11E 1HAIH 2BZAA 1Y3XA 3LH1A 3RMMH 1EOJA 2AGEX 2ZHQH 4MNYA 3TGIE 4LXBH 3ZVDA 1C5RA 1EXFA 3A85A 2BY6X 2FEQH 2BOHB 5DP7A 4AORA 1OWJA 4BTUB 3PMHB 5EXNA 3DFJA 3NK8A 1C5SA 4H6SB 3SJ9A 3TU7H 4X8TH 2PV9B 3PWBA 2EI8A 1SBWA 2PSXA 2ANKH 4TWWA 1DWDH 2VIDA 1SOTA 2XC0A 1SVPA 1Y3VA 2HRVA 1O2GH 4ZKRU 1SOZA 4FUBA 1BHXF 4AFZA 1ZSJA 3GY3A 3TITA 4R8TB 3P8NA 3TH2H 1QRZA 3E6PH 1JIRA 1G3BA 3GYMA 1GMCG 1GBDA 2Y80A 1O3JA 3BEIB 4AYVB 1A0JA 3U8OH 2QIQA 1PJPA 2H9HA 2OINA 4Y8ZA 4UD9H 1J15A 1BMAA 2SNWA 3MU1A 1S6FA 1UVOA 3A7YA 3LGYA 2A4QA 3MU5A 1PPFE 3UFAA 1W14U 1DOJA 3TH3H 2OUAA 3FAOA 1WUNH 3ZZ5A 1GBTA 2BLOA 1ELTA 4NIYA 1O3HA 4A6LA 4K3JA 1ZTJA 1AFEH 1HAVA 3PMBB 2ZFTA 2FPZA 4ZXYH 7GCHG 4ZXXH 1QL9A 1TNIA 1ELGA 2WYJA 2M5TA 2FM2A 4KTUA 4MPWA 3HK3B 1WQVH 4E05H 1TX7A 2ULLA 5DP8A 1GHBF 2V6NA 2Y5GA 2ZHFH 1AUTC 1ZLRA 2BX3A 4ZH8A 1GBCA 1K1PA 1RTKA 1O5BB 3RMOH 1TRMA 2XBXA 1L2EA 1HV7A 2QC2A 3GY2A 2XC4A 3ATKA 4Z0KA 1DWBH 2RA3A 3A81A 4HFPB 1O0DH 2ZCLP 3VGCC 1FAXA 2BY7X 1SG8B 1IQNA 1S82A 4DW2U 1C1SA 1Q31A 2PKAA 3B9FH 1D4PB 1P04A 1H8DH 1H9LB 2AFQB 1ARCA 1FUJA 1PPCE 3ZVAA 4K8YA 1C4U2 2Y81A 3RXCA 1DSUA 2ZFPH 2GGVB 8KME2 3VB6A 1C2DA 1GDQA 1SGTA 2BXUH 2H9EH 6GCHG 3RLYH 4WMEA 3LGIA 4VGCC 5C20A 5DP9A 1GJ9B 4JZDH 4FU8A 4OGYA 4K1SA 3KEEA 1A0HB 2GP9B 1DUAA 4YLQH 1MQ5A 1G36A 3M7QA 2BHGA 4NWLA 5C1YA 1THSH 2Z3DA 1EJMA 4R0IA 1LQEA 5ETXA 5L6NH 2FMJA 2RCEA 2J92A 3KQDA 3ZYEA 2BD7A 3RXVA 2R3YA 2TIOA 2ZIQH 4MLFB 1GJCB 3A87A 1CO7E 2ZDKA 3A84A 4IGDA 3ZZ3A 1OP0A 1E35B 2BD5A 3RMLH 4B2BA 8GCHF 1FIWA 2V35A 2XWAA 3QGJA 5HXFA 2A7HA 5TCAA 1FN6A 4YOGA 1HAVB 1WOFA 2FZZA 1GI6A 3RU4E 3RP2A 1WYKA 4XBDA 3SW2B 4Y7BA 4K1EA 3M5NA 1A3BH 1WV7H 2FOCA 5EW1H 3ZZ6A 2VIWA 3E0PB 1RXPA 2KAIA 4FUJA 1CBWC 4U2WA 2B9LA 2ZECA 4FU7A 1NT1A 1LHEH 1SGCA 3C1KA 2F9VA 1LHGH 2O8UA 1F0RA 1HJ9A 3K2UA 4MPXA 4B76A 1GI7B 4X1NU 1J16A 2K1QA 4UFEH 1AY6H 1AU8A 1QY6A 4KELA 1SGPE 1TGNA 2FLRH 5G4BA 1EATA 1VITG 1O2MA 4OGXA 3RXQA 5GCHF 1SQOA 3MMGA 1QJ1B 4NZLA 2HWLB 1D3PB 2BY5X 2O8TA 1LPZB 1AMHA 3SORA 1O3GA 4ABJA 1C5QA 3ODDA 4INHA 4IC5A 3ELAH 1D9IA 3A82A 5F8TA 5EW2H 1ZSLA 4Q2KA 4TPYA 1LPGB 2P3UB 4I8HA 3SNBA 3EYDA 7ESTE 3ZZ4A 3ZVBA 1WAYB 1W2KH 3UNRA 2YNAA 2PLXA 3RDZA 1QTFA 3F6UH 1V2ST 3BG4B 4X6PA 4ABFA 2FS8A 3G01A 5HM2A 2A5IA 5DPAA 4I7YH 2VNTA 2BDCA 5T3HA 3UQOA 3PMAB 3S69A 1EP6A 4MNVA 3TVJB 1K1JA 1FIZA 1GCTC 1FY3A 1YYY1 1SL3A 5JB9S 2O8WA 4GCHG 1B0FA 4Q7YA 3E0NB 2P3TB 4XE4A 1TMBH 3M7TA 1M9UA 3F9HA 3SU2A 3EA9A 1B7XB 5A0BA 1FY1A 2J4IA 1IQKA 1P11E 1UJ1A 1F2SE 1GI4A 3QN7A 3EGKH 5CHAC 2V3HH 4U30A 3T5FH 5C2ZA 1AKSA 1ZPBA 2BB4A 4CHAC 3ZZCA 2PUXB 4BXSA 2PW8H 5A0AE 2NU4E 2NWNA 2ZCKP 3SNAA 3GCNA 4VGCB 1XUJA 2F3CE 1V2RT 2O8MA 2VIOA 3W95A 4MPUA 3S9CA 1O3MA 3TLOA 3VB4A 3ZZ8A 1ZZZA 1C2HA 4DY7B 2ZC9H 1GI5A 1MBMA 3OTJE 1O37A 4NIXA 4Q7ZA 1AE8H 4IBLH 2Y6TA 1O31A 4OS1A 2B7DH 2PTNA 1TB6H 1J9CH 1T31A 1IOEA 3SJOA 3QDZB 4IN1A 1BBRH 1J8AA 5B6OA 1C1OA 1VGCB 3BG8A 3FVFB 3UIRA 1P03A 2HALA 3M3SA 2ZGXH 1V2WT 3SU5A 4LZ4B 1MQ6A 1T8OA 1W0ZU 1FV9A 1P12E 4MNWA 3OU0A 4TY7A 1T32A 1OSSA 1PPEE 3UR6A 1LVBA 3O8CA 2A1DB 2ANWA 2ANMH 1MTUA 1V2VT 2BLQA 1MD8A 3LC3A 1LVYA 3AVZA 2XXLA 4IMZA 5AFYH 6LPRA 2GZ7A 1CT0E 1Z6JH 1BOQA 1CBWB 1FDPA 4GVUA 1TX8A 4XSKU 1E38B 1IQIA 1TMUH 1ZHRA 3AW1A 2SGDE 3RXUA 1A2CH 3M3VA 3SZNA 4WF8A 4A1TA 2UWOA 2W7SA 1Z8GA 4FUIA 4BOHA 1ZOMA 3SOSA 2H5CA 1GVZA 1XKAC 2ZTXA 4INKA 1UTMA 1O2OA 1BBRK 1O5GH 2ILNA 3FZZA 3MYWA 5JBCS 2XWBI 1MD7A 1O2PA 3RXMA 4WXIA 3EA8A 3UR9A 2ZTZA 1HXEH 3BIUH 4CRGA 1C2IA 2VIVA 1TGCA 2FP7B 3GOVB 4PROA 5EXLA 3LIWA 2GCTC 3MH5A 1P9SA 1C2EA 3GDSA 3ZVCA 3RXOA 1OOKB 4DJZB 2AGIX 3RU4T 2FOAA 2OLGA 3TJNA 1HJ8A 5HM9A 1E34B 3MTYA 4XDEA 2ZCHP 2VGCC 1HPGA 1K2I1 2CMYA 2O9QA 1GBMA 2R3UA 4THNH 1QJ6B 4X2WA 1P2KA 4ZROA 1GJ8B 3QLPH 1QBVH 1S0QA 3BTGE 2BMGB 2OQ5A 1HAPH 4KP0A 1CGHA 4AG2A 2Y7XA 3HK6B 1CA8B 4UFDH 1GVLA 3TJVA 1AVWA 1TRYA 4ZMAH 1TNJA 4JCNA 1O2QA 1XVMA 4YTAA 2BQ6B 3ATIA 5K0HA 1GBBA 1ZPZA 1PYTD 1YM0A 1E0FD 1TOMH 2ZFRH 3MNCA 3PTNA 2LIZA 5DO4H 3PO1B 1OP2A 4K69A 4BTIB 4D7FA 4ISLA 1RRKA 5DGJA 4MNXA 5TCCA 1Y3YA 4UFFH 1GBLA 1AWHB 5BPEA 4CHAB 4SGAE 4BNRA 2XBYA 3FP6E 4TPIZ 1MTNC 3RXLA 1E36B 1G3CA 3MI4A 2Z9KA 1SGFG 1V2QT 2FTMA 5IYTA 4INLA 1O39A 4YT6H 2ZFFH 2W3IA 1HUTH 1L4ZA 3RMNH 2Z9IA 3SQEE