2ZFSA

Exploring trypsin s3 pocket
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cationic trypsin
publication title Congeneric but still distinct: how closely related trypsin ligands exhibit different thermodynamic and structural properties
pubmed doi rcsb
molecule tags Hydrolase/hydrolase inhibitor
total genus 54
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2008-01-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2zfsA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2zfsA02
1EUFA 1DANH 1XVOA 1O5CB 4YESB 3AAVA 3R0FA 3LT3A 4Y0ZE 2CHAB 3OY6U 2C8XB 1DXWA 1GG6C 1FY5A 1FPCH 2FODA 1GHAF 5A0CA 1MMJN 1MH0A 4HTCH 4ABIA 3ZVGA 4NFFA 1LMWB 1JBUH 3GDVA 4ABGA 5K7RA 1CA8B 4ISNA 2BQ7B 2FXRA 1C1VH 2W26A 2Z94A 1MCTA 1GJ5H 1TA2A 1A0JA 3DD2H 2VWMA 4X1SU 2WPLS 3KQDA 4AFUA 4CREA 1ZOMA 1ABIH 2ZGBH 3SO3A 2PKSC 4DOQA 2GCHG 4YM9A 3EE0B 4Y7BA 3M5OA 3SGBE 3ZVBA 4CRGA 1SLUB 2ZPQA 3NUMA 2OLGA 1ELTA 4U2WA 1SVPA 2ZQ1A 1UVPA 7KMEH 1BTHH 1EASA 5ABWA 1O2OA 4D8NA 2ZI2H 2XW9A 4YLQH 1HAVB 2Z3EA 1GHBF 4BTUB 4NA8A 2QXIA 3K65B 1C1PA 5GCHF 4MVNA 2Z7FE 2VIQA 4AG2A 1V2LT 3EYDA 1SMFE 3K2UA 4RSPA 4YT6H 3A7YA 3P8NA 4THNH 2EEKA 1DWEH 2GD4B 5A0AE 3BEFB 4ISHH 1BMMH 1TX8A 4TYDA 1Y5UT 1T8MA 1EZXC 2ZFFH 2D26C 3GCTF 1GBKA 3PLBA 1E35B 1GMCG 2XTTB 4ZMAH 1XKBC 2BDAA 1BTUA 2ZDLA 1V2OT 1QR3E 1TGSZ 4ESTE 3V3MA 5JBTA 1SHYA 1C1SA 1QFKH 4GHTA 1P12E 1GCTC 1QGFA 1K1NA 3RMMH 3AW0A 3LIWA 1DSTA 1W3CA 1G3EA 1MUEB 1SGDE 1NRPH 3LGUA 1O3BA 3UREA 2PKAA 1JMOH 3G01A 1XUKA 1ESBA 2BX4A 1TIOA 1SGFA 1EPTB 1QBOA 1GBEA 2ZDMA 3SU4A 1O37A 2FYRA 3BTDE 1O3IA 2GTBA 3GDUA 2UWLA 4I8KA 4K60A 1GHAG 3BV9B 1MBMA 4I7YH 1O33A 1UTQA 1BUIA 1BJVA 3PM3A 3SJIA 1MAXA 1GL1A 1HAZB 5E0GA 1H8IH 1HJ8A 8ESTE 1GGDC 1EOLA 3TNSA 1KXFA 2R0KA 3PLPA 4E7NA 2GKVE 4INKA 4AN7A 2P3FH 2BVRH 1VITH 4ZAEA 1F0TA 4HI3A 5CHAC 1FY4A 4AFSA 3MNCA 2FLRH 4X2WA 1XXDA 1ELAA 2BTCE 3A8BA 3O8BA 4XOJA 4K2YA 1AMHA 2FI3E 2ILNA 1SQOA 3BTEE 2GGVB 3VPKA 1S5SA 1RXPA 3GYLB 5DP4A 1UCYH 1DWCH 3UUZA 1C5MD 1J15A 3BTTE 1GI1A 1UTMA 3KNXA 5BPEA 3EDXB 1UJ1A 3V0XA 1EKBB 1TMUH 1K21H 4GCHF 4CRCA 1FN8A 5GCHG 2W3IA 6LPRA 3DFJA 2QXGA 1SSXA 3MNXA 1G37A 5EXLA 2OQUA 1O34A 2UUYA 1KXBA 3TH4H 1ZGVA 1P2KA 4WJG2 3RC6A 1PQAA 3ESTA 4AYVB 2BDGA 2ZFRH 1QBVH 3BTME 4B71A 1AO5A 2J94A 1W14U 2XWBI 1K1PA 1PPBH 3KF2A 1BTXA 4GPGA 1EZSC 5LPRA 1ZTKA 2BDBA 3GCTG 4AOQA 2CHAC 1OP8A 1O5GH 1XX9A 2V0BA 1FDPA 3T26A 3FP8E 3LC5A 1MU6B 1RRKA 2AFQB 2B8OH 4ZHAA 4AB8A 3RP2A 1ZPZA 1FIZA 2RA0A 1PYTC 1SFIA 1TOMH 2BY9X 3ZZAA 2BDYA 1ETSH 4AORA 4CBOA 2JH0D 5JBBS 3TJOA 1ESAA 5GPIB 2ZP0H 5A09A 2ANKH 3SUDA 2G4UA 2Y5GA 1C1TA 1SGIB 1TQ0B 8LPRA 1KLTA 2UUFB 4VGCB 3BG4B 1NPMA 2C8WB 1EX3A 2A4RA 4JYTA 3UIRA 5AVDA 2BZ6H 2Q1JA 2XWAA 3LU9B 4AB9A 4UE7H 1O3NA 2BYAX 1GVLA 4X8SH 3T25A 1CHGA 2A31A 3SV6A 3QTOH 2G51A 2V3OH 1ZSKA 1ARBA 1HPGA 1GBDA 1IQEA 3TH3H 2OC1A 5JDUB 1GBBA 1FV9A 1HIAB 1VITG 2Z9JA 1W0YH 1BMAA 1S82A 4NZQA 1ZHMA 3CS0A 4AG1A 1GI4A 1DOJA 2TGDA 5E2OA 3SHAH 3BTFE 1AUTC 1GHYH 1B5GH 9ESTA 3SV7A 1RJXB 2I6SA 1N6YA 3RXQA 1AGJA 1TLDA 2BB4A 2QF3A 5TCAA 2CJIA 3TPIZ 1D3PB 5JBAS 3LPRA 4MNVA 2FTLE 1PPFE 1GBAA 1YLCA 4XBBA 2QXHA 2PW8H 1V2NT 1DY8A 4NIWA 2F83A 5L2ZH 1C4Y2 3MMGA 1V2QT 2VIVA 4HFPB 3QTVH 2AYWA 4K1TA 4I33A 2OC0A 3KGPA 1YKTA 1W12U 3PLKA 1C1RA 1C9TA 1EOJA 3NXPA 1F7ZA 4TWWA 2BD3A 1RGQA 1VGCC 1SLXB 2Y6TA 1AKSA 3BN9A 1KDQA 1H9IE 4H42U 3RU4T 1DSUA 2EI8A 4U32A 2QIQA 2EI6A 1UTKA 1TMBH 2J92A 2TIOA 4K69A 1V2ST 1BITA 1MZDA 5J4QA 1QURH 1XUJA 4AYYB 1GHZA 4DIIH 1JRTA 5HYOA 3LDXH 4KTUA 1GBCA 1W13U 1NROH 3OYPA 1IQMA 3FZDA 5EOKA 5EW1H 1FLEE 1G3BA 3LGTA 2A7JA 3GYMA 1UTLM 2BD2A 1TNGA 2P3TB 4B2AA 2B7DH 1BOQA 3KQBA 1OP0A 1K2I1 1V2PT 3UOPA 5L2YH 1QJ7B 2B0FA 2AERH 1PQ8A 2F9PA 3QWCH 2Z3CA 3TH2H 4CRAA 3HKIB 3C1KA 1RS0A 1O38A 3U1JB 4X2VA 1QB9A 1AZ8A 3MU1A 2OQ5A 3MU5A 4MNXA 1OWHA 3GCHC 3VB5A 1HYLA 4TY6A 1Z6JH 2FOCA 2A1DB 2ZU2A 3Q76A 4SGAE 2BDHA 2FOMB 1C2EA 2H9EH 5I46H 4IN2A 3ATKA 3RXUA 3F9HA 5LGOA 1LPGB 3LJOA 1ANEA 3TLOA 1AE8H 2Y82A 3BEUA 3KHVA 1TALA 2H2ZA 3VXFH 1AE5A 1TFXA 2AIPA 2AMPA 3U1IB 4H6TA 1O2TA 1TX7A 4Y8XA 2V6NA 3ATIA 2JKHA 2O9QA 5T6GA 4X0WU 1ETTH 3S69A 3SNAA 3ZZCA 2GCTC 2PKSB 2BY6X 2XC0A 2PSYA 1LQDB 4NIYA 1NU9A 1CHOG 2Y80A 3M3TA 1G9IE 3PYHA 1P02A 1MD7A 1S85A 3TITA 4CH8B 1C1OA 4Q7XA 4YOGA 3B23B 2A5KA 4VGCC 3BG4C 2GP9B 2SGEE 4MNWA 3H7TA 1SQTA 4RN6A 1P2MA 4R8TB 3PV4A 1BDAA 3GY4A 3QGJA 1O2LA 1GI7B 2TPIZ 3M36A 2FP7B 3LGVA 1O2SA 5DP5A 1TOCB 2D8WA 2FEQH 2Z9IA 3GY6A 1Y3XA 2AMDA 2QN5T 3E8LA 5ETXA 1T8LA 1PQ7A 2BXTH 1GMHF 1A3BH 2OUAA 1XXFA 5FCRA 1N1LA 2FDAA 3T27A 1O3FA 4SGBE 2Z6BD 1P10A 3LC3A 2D2DA 2NU3E 1O3GA 1P2NA 3E3TA 1C2FA 1DVAH 1AFQC 5FPSA 3QDZB 3ZZBA 1KTTB 1C1WH 2HRVA 1GCTB 1NFUA 3A7WA 1LVYA 1FIWA 1YPEH 1HAYB 3SN8A 3EA7A 3S7KB 5AF9H 3U8OH 4FUBA 1EB1H 1ZYOA 4NWLA 1GHXH 5EQQA 2OTVA 1Y59T 3RM2H 1ZPCA 1NRSH 4NSYA 3SGQE 3STIA 1EJMA 2WPIS 5GWZA 2NU4E 4Y10E 4BAKB 1FN6A 4KTCA 2XBYA 1H9LB 3ZZ3A 3GY3A 3P8OA 1OX1A 4BTTB 1Y3YA 2YNBA 4O03A 1Z7KA 3ODFA 4YTAA 1GI9B 1OYTH 5G4BA 2ZHFH 4GSOA 3Q3YA 1GGDB 2XC5A 1UHBB 4MTBA 1NU7B 1AB9C 1ZHPA 1L2EA 3TGJE 1W0ZU 2XCFA 1VJ9U 1BMNH 1YYY1 1YCPM 4FUJA 1AWFH 3SI3H 3T28A 2H6MA 5CHAB 1O2IA 2BY8X 2EA3A 2PWXA 1TGBA 1TX6A 2BLWA 1AZZA 1C2KA 2ZWLH 7LPRA 4CRFA 3QLPH 3SV8A 4XE4A 1PPCE 5F03A 2OBQA 1O5DH 3ZV9A 2AMQA 1AQ7A 2QV1A 1W11U 1FY3A 1S83A 2H1UA 1OS8A 1TONA 3O8RA 2H9TH 3RXCA 2BOHB 1GMCF 2C3SA 2VH6A 3HPTB 3TK9A 5DKMA 1CVWH 4JCNA 2VWNA 2Z9GA 4DJZB 2SGPE 3VGCC 2V35A 3LONA 2JETC 3RMLH 5E0JA 4ZKOU 2ALVA 3ZVCA 5DJ7A 1Z8IB 2AS9A 2TGPZ 4IMZA 2FOAA 3FZZA 4HZHA 1O2MA 1SLVB 2G5VA 2GDDA 3E16B 3STJA 2UWOA 3SUGA 4Q2KA 4NGAH 1OWKA 1Z8GA 3KN2A 4UDWH 3AAUA 4BAQB 1AY6H 1YPJH 1IAUA 1C5WB 1FNIA 1UK2A 5AFZH 1C5TA 2Y7XA 2YOLA 4ISIH 3LJJA 1HAGE 4IGDA 2FMJA 1QTFA 3TGKE 5LH8A 1A0LA 3RXKA 2EC9H 1OOKB 4WMDA 1TABE 3GY7A 2VIOA 4UFEH 2JH5D 1EZUC 2ZFSA 3BIVH 2O8UA 5FBEA 3RXDA 2G4TA 3S0NA 4LOYH 4UFDH 1KTSB 2YNAA 1WTHD 3P17H 1G32B 1GBHA 4GHQA 2GMTC 2QC2A 3KEEA 2O8LA 5FPYA 3U98H 1C5ZB 4K1EA 1OWDA 1WUNH 2HNTC 1OYQA 1O3CA 2O8WA 2ZECA 1DS2E 3M37A 2ZC9H 1HAHH 5EXNA 1O3EA 2FS9A 3MH4A 4BXSA 3E0PB 6GCHG 1GCDA 3BEIB 5FX6A 4J2YB 2OC7A 2FPZA 1SGYE 1IQFA 1QRXA 1OWIA 5GIBA 4WXIA 1TGTA 1BCUH 5AHGH 3SQHE 3TJUA 1K22H 1SI5H 2B5TB 3HKJB 2A5IA 3M5MA 1ZRKA 2RG3A 3VB6A 1GMDF 4ZUHA 4I32A 4Z6AH 1IHTH 2CN0H 1P2IA 1G36A 1V3XA 2P8OC 1C4V2 1O2PA 1EP6A 2SNWA 2ZDKA 4FU9A 4MNYA 3ZZDA 3QUMP 3MWIU 3ITIA 5DP9A 1GI6A 1S6HA 3LH3A 2P94A 4NCYA 1DXPA 3ATWA 5HXFA 1O3OA 3UPEA 3CENA 3MO3A 1ANCA 2ZTYA 4ZROA 2ZU4A 1VGCB 1YM0A 1DDJA 1TRYA 2BDCA 2ZDVH 4F49A 1E38B 3PO1C 3I29A 2BQ6B 1J14A 2Y5FA 2BDIA 3GY2A 1LO6A 1OKXA 4B1TA 3D23A 3RLYH 2R3YA 3Q3KA 1XUFA 4A1TA 4CRDA 3ZZ8A 2C93B 3S9BA 5H4IB 5HM9A 4QT8C 2DE8A 1MAYA 2ZDNA 3TNTA 2C8ZB 1KLJH 2ZHWH 5A0BA 3SU1A 2WV5A 1FY1A 1O5FH 5EQRA 1SB1H 1VITF 1BIOA 4ISLA 4KKDA 3ZZ6A 1F0RA 2SGDE 1WYKA 3RDZA 1B7XB 4NWKA 4TWYA 4LK4A 1MKWH 2HOBA 4Y7AA 1C5NH 1GBIA 5DG6A 4X2XA 1V2RT 4OGYA 4FUIA 3A8DA 1EZQA 2RCEA 1IQKA 2DE9A 3RXHA 3QO6A 1ZSLA 2XXLA 3A87A 4FUFA 2UUKB 4NIVA 2PKAB 1WCZA 2ZEBA 3GICB 1PPEE 4BNRA 1LHGH 3GCHB 2AIQA 4DT7B 3BTWE 3DHKH 3DA9B 3UQVA 4ASHA 3A83A 1GDQA 1ELFA 1O2XA 1MQ6A 3K6ZA 3KQEA 3M7TA 3FVFB 2BD8A 3SI4H 1GMDG 3W94A 2VJ1A 3T29A 3LGIA 3RXAA 1SGNE 3SJKA 3KL6A 1ZPBA 1A5HA 3UWIA 1ZHRA 1HGTH 1F2SE 5FPTA 3UR9A 1AUJA 1GDUA 3BF6H 1O2GH 2ODPA 1WV7H 2ZGHA 2G5NA 2GCTB 4UONA 4INLA 2Q6FA 3TK6A 4CRBA 5DO4H 3MO6A 1O31A 1F5RA 1NTPA 5CMXH 1LHEH 1BBRH 1C2JA 2C8YB 4X1QU 2BXUH 2QAAA 2BOKA 2VVCA 1FXYA 3S7HB 2XC4A 2VVVA 2BD4A 1QQUA 1XUIA 4Y71A 4GUXA 2A5AA 3GDSA 2STBE 1P2OA 1L1NA 1SHHB 1SGQE 3P95A 1SGPE 3QGNB 3H7OA 4ZHLU 1GJBB 4XBCA 1DWDH 3V7TA 4AX9H 2HVXA 2G55A 2VIPA 3ZZ5A 1BTYA 4FUEA 1JOUB 4XSKU 4U30A 4IC5A 4A92A 1GBFA 1SC8U 3MNSA 5DP3A 3P8GA 1JRSA 1GHWH 1YPGH 3D65E 3OX7U 3M5LA 5LPFA 4J1YA 2FYQA 3TVJB 1PPHE 5EQSA 2NU0E 4KTSA 1AFQB 1B0FA 4UFFH 2ZZUH 3HGPA 4BXWA 4IS5A 1IHSH 1K1IA 5AFYH 1O2ZA 3LKWA 4KELA 2QXJA 1FJSA 2ZGXH 1EAUA 1P3EA 2ZFTA 1DE7H 1WSSH 2ZCLP 3NWUA 1ELVA 3BTHE 1CA0B 1L1JA 1O3DA 3QX5H 1LKBA 2BM2A 3RXEA 2NU2E 1XMNB 1P03A 2HGTH 6ESTA 7GCHG 5C67A 3H5CB 3SOSA 2ASUB 3F9GA 2J95A 1QL7A 4AGKA 3MO9A 1TBQH 2BY5X 1CHOF 5E8EH 1GWAA 2ZCKP 1LHFH 1FAXA 3L6PA 1HXEH 4GVUA 2J4IA 5FCKA 3ZVAA 1GBTA 4I8HA 3A86A 1MTUA 3PWCA 2J34A 3SNDA 2VIWA 1A3EH 1ORFA 2F9BH 1AB9B 2A0QB 2ZA5A 1YPHC 2ESTE 2PR3A 4O97A 3Q3XA 3ZZ4A 1AI8H 2W7UA 1VZQH 2R2MB 1BA8B 4IW4E 1TPSA 1F92A 1ELDE 3UWJH 1A5GH 1ZJDA 3NZIA 3EA8A 5EODA 1T8NA 1BTWA 5IYTA 1C5LH 3QN7A 3SU5A 2ZFPH 1P11E 1BHXB 1BRCE 5DPAA 4GLYA 2A4GA 1O5EH 4B73A 1NFYA 3MH6A 5EG4A 3TIUA 4H4FA 4UD9H 2THFB 2UWPA 1UVTH 1VCWA 2IPHA 1HRTH 3NPSA 2FIRH 5ESTE 1GJCB 4FVDA 1BZXE 1W2KH 5J4SA 2HPQH 2F3CE 4MPVA 1SOZA 3M61U 4A1VA 1AHTH 1MU8B 1QBNA 1Y3UA 1K1JA 1UMAH 2ZTZA 3VGCB 1TYNA 2JETB 1F0SA 4XBDA 1ZMJA 4BANB 1DUEA 1QA0A 5DGJA 1C5OH 2UUJB 1GI2A 1O2KA 4Y6DA 1O3MA 2A4QA 1AKSB 1C4U2 1KDQB 2J9NA 1V6DA 3RXVA 4OS1A 4ZXYH 4BAMB 1P04A 2FESH 2Y81A 3S9CA 2GVFA 4ABFA 3EGKH 1GI3A 1ID5H 1MZAA 2ZG0H 4MPXA 2TBSA 1L4ZA 1SLWB 1T4UH 5C1XA 3A7VA 3T5FH 1CBWC 3ENSB 4FUGA 4X1NU 3VFEA 1XVMA 3IITA 2FX6A 1C1UH 1GJDB 2VIDA 4BOHA 3ATMA 5C1UA 3VXEH 1UVOA 2FM2A 2LNCA 1DT2A 4OS2A 1TMTH 1FI8A 1ZSJA 1A61H 1KXDA 1BRBE 1EXFA 4YOIA 1MKWK 1AD8H 1C5SA 1V2JT 1CT2E 3RXJA 3HGNA 4ZXXH 4ISOA 2GMTB 2A45B 1UCYK 1TA6A 2Y5HA 3PWBA 4WH8A 1OPHB 5C3NA 1BTZA 1TNKA 2W5EA 1O0DH 3RC4A 3MTYA 1TBRH 2AGGX 1RTFB 1WQVH 4LZ1H 1TBZH 3A8AA 1GVZA 2SGQE 3SNCA 4MPWA 3MHWU 1DICA 3M5NA 5DP7A 6CHAC 5GDSH 1Z6EA 1OP2A 4B74A 1DLKB 1EP5A 1M9UA 4LZ4B 3ELAH 3ZVFA 3SU3A 1ZMNA 1NRQH 1NT1A 1SGTA 4YLUA 3SJOA 1AVGH 1Z71A 1CGHA 3U8TH 1ZR0A 2P8OB 9LPRA 5DP6A 3TGIE 1JIMA 1MQ5A 1UO6A 5A2MH 3HATH 1A46H 3PB1E 1DX5M 4CBNA 1BBRK 1XM1A 1QHRB 4X8UH 3PROA 1A5IA 2ZTXA 1GBMA 2ZIQH 2WPHS 1CA0C 4WY3A 1VCQA 5F6MA 1FUJA 1NRNH 3B8JA 3ODDA 4B2CA 2F9UA 1HAPH 1C5PA 1HNEE 5JYIA 3A88A 1QJ6B 4OS6A 2HNTE 5A8YA 2PUQH 3VEQB 1HUTH 2BLQA 3GY5A 1RTKA 3PO1B 5FHTA 3F6UH 2ZO3H 1D3DB 1HCGA 1CT4E 8KME2 2FOFA 2G8TA 1AN1E 1P09A 3I77A 4OS4A 3BIUH 1SFQB 2BY7X 3VB4A 1IQLA 2STAE 3RXGA 3CP7A 1C1MA 3RXIA 4UEHH 1SQAA 1T7CA 1ELCA 1IQGA 6GCHF 4IC6A 1NFWA 4PROA 2G00A 2QF0A 1OWJA 1UCYE 5C20A 2G52A 3RM0H 1GVKB 2A2QH 2PGBB 1TGCA 3NKKA 1HBTH 3LH1A 4K5ZA 2SGFE 1KY9A 1MTVA 1SPJA 5EW2H 1O3LA 2GZ9A 2GZ7A 1S0QA 1NS3A 1ANBA 2P16A 2XNIA 1H1BA 4Y76A 2A4OA 1P9SA 1IQHA 3M3VA 4ZH8A 4DGJA 1H9HE 1O39A 5A8XA 3P8FA 1ZRBA 1QCPA 1Y5AT 3RXFA 3T2NA 4CH2B 1AVXA 1YPLH 1F5LA 1FY8E 3C27B 3T62A 3GOVB 1GJ7B 1ZMLA 2SGAA 2J38A 1QB6A 2VWLA 4FUCA 2GZ8A 3OU0A 3RU4D 4AZ2B 1O2UA 1CGIE 1THPB 1D3QB 1TNHA 1SGFG 2IJOB 4CR5A 4FUDA 1CSOE 3B9FH 4E05H 1T32A 1IQIA 4TPIZ 5EPNA 3SU0A 1O2NA 1T8OA 4NA9H 1FONA 1BBRE 1NESE 2ZPRA 5GJ4B 4ZKRU 2WV4A 2AGIX 5FAHA 1GJ8B 3A80A 4DG4A 1C2LA 4FUHA 3UR6A 1HAVA 5IDKA 4A5TS 1LVMA 2OCVB 4U01A 2M5TA 1FZZA 3ATLA 4YOJA 4DURA 2WYJA 1G30B 1MCVA 4IMQA 2CXVA 1HJAC 1GJ9B 1P9UA 3SJ9A 2ODYB 1ABJH 2W7SA 3RMOH 1AWHB 2GX4A 2ZHQH 2R2WU 4Z0KA 4XFQA 2H5DA 1C5VA 1LDTT 2PSXA 3SV2H 2OBOA 1BHXF 1H8DH 1SGEE 1GJAB 2QCYA 3E1XB 4ABBA 4FU7A 1O2YA 3ZYEA 2A2XH 5PTPA 1K9OE 4NSVA 1MKXH 1QIXB 2PGQB 2FTMA 1CT0E 4AFQA 1C1NA 3HK3B 3A7ZA 3R3GB 1KIGH 2CGAA 2FI4E 3O8CA 4ABDA 4MDSA 3A85A 1NM6A 1EPTA 2ZFQH 4KP0A 4DVAU 4D9RA 4NZLA 3QZQA 2VNTA 3N7OA 1LCYA 1NRRH 1KSNA 1XUHA 5K0HA 5EU8A 3BTGE 3UTUH 2Y7ZA 1SGCA 5GXPA 3DT0H 4CHAC 1XUGA 2P93A 4XDEA 3M7UA 3MU4A 1K1OA 3SBKA 5JPMH 1TE0A 1UK3A 1DLEA 2P3UB 1C2IA 1O3JA 1O2WA 3FP6E 2K1QA 2C4FH 4O9VA 1A7SA 4Y0YE 5FX5A 5DK1A 4ZHMU 3UNRA 1EJAA 2ODQA 1GJ4H 3FFGA 1MTNB 1W10U 2AEIH 3IWMA 4X6NA 2HPPH 4MQAA 2GDEH 1FAKH 3RXSA 5C5OA 2ZU3A 4YT7H 2IN2A 1Q31A 1C5RA 1Z8JB 5E2PA 4KGAA 1DY9A 4WXVA 4DIHH 3ZZ7A 4RKJB 1VCPA 2RDLA 3V13A 1YF4A 1B0EA 3SGAE 2ZHEH 4X1PU 2CV3A 3M3SA 3DUXH 1E34B 3TJVA 4FU8A 4DY7B 2D1JA 4WF8A 1C2GA 2ZU1A 1HDTH 1Z1IA 3JZ2B 2HNTF 2TRMA 4A7IB 1PFXC 2VGCB 2HWLB 4D76A 4YO9A 4MG3A 3EAJA 4AFZA 1F0UA 3F9EA 2VH0A 2FWWA 1BT7A 1O30A 5CE1A 1MD8A 1QNJA 5F8XA 5B6OA 1WOFA 1TGNA 3FANA 2BHGA 2F9VA 3SQEE 1P05A 1W7XH 2TGTA 1YP9A 1P2QA 1LHDH 1SG8B 1SBWA 2HALA 1BJUA 3S9AA 4IN1A 5EGMA 3V12A 2PTNA 2PHBA 1J8AA 1YLDA 1D6WA 1TRMA 4X6MA 1GI8B 2SNVA 2Z9LA 2FOHA 1QRZA 3LGYA 1GJ6A 1GL0E 1KYNA 3D62A 4X8TH 3L3TA 3PMBB 1YPMH 7GCHF 1CU1A 2FLBH 3SHCH 3URCA 1HAOH 4JK6A 1O3KA 2BLVA 1YPHE 1TQ7B 1YCPH 2O8MA 2ZF0H 1V2KT 1GHBG 1O3PB 1CBWB 3BSQA 1NFXA 4WVPE 4H6SB 2ZU5A 3E0NB 1L1GA 1GDNA 5FBIA 1NN6A 3VB7A 1LPZB 2VWOA 4INHA 2QA9E 3PTBA 1TPPA 4MPUA 5JB8S 1N8OC 1GBLA 1TNLA 4OS7A 1EATA 1C2DA 1GI0A 2TGAA 3UY9A 1QJ1B 4JZDH 1O5BB 1U6QA 4ABEA 2H9HA 2ZGJA 1UTNA 1KXEA 4TPYA 4M7GA 1HIAA 2F9OA 1BMLA 3OSYA 2ULLA 4I8JA 4JZEH 3AASA 4DCDA 1OSSA 1NZQH 1QL9A 5L6NH 1DITH 1P01A 3ZZ9A 3MU0A 5JB9S 1Y3WA 2NU1E 4BAHB 1O5AB 1C2MA 3E6PH 3UFAA 1Y3VA 1UTJA 2C90B 1WAYB 1D3TB 3U9AH 2R0LA 4I8GA 2B9LA 3FAOA 6CHAB 4F4OC 4Y11E 5HM2A 2BLOA 1W7GH 4NA7A 4B76A 2VB0A 1L4DA 2DUCA 1IOEA 3AW1A 1D6RA 4JYUH 2PFEA 1O32A 1NO9H 1S81A 1S84A 2Z3DA 3SNBA 1A1RA 3URDA 1TWXB 1PJPA 3MFJA 4YZUA 1LVBA 1NC6A 1YPKH 4JMYA 3MOCA 3NK8A 2PV9B 3OTJE 3E90B 2F9NA 3UOUA 3U8RH 1O3HA 5C5NA 1EAIA 1P06A 5I25A 1J16A 1G2LA 1XKAC 2ANWA 2GT7A 1CO7E 1TNIA 2G81E 2PTCE 1UVUH 3M7QA 5DP8A 2I6QA 1PPZA 3EQ0H 3A81A 1KXCA 4IBLH 1ZTJA 1V2VT 1HAXB 1PQ5A 1WTGH 4Q80A 3LGWA 2WINI 1MTNC 1GI5A 1AIXH 2BVXH 1CGJE 2A7CA 1T31A 2XBVA 2Q6GA 4A6LA 1ELEE 2O8TA 1Q2WA 2XCNA 3GCOA 2A32A 2IOTA 3M35A 3RU4E 4GCHG 1T4VH 1K1LA 2BQWB 5JBCS 1KXAA 1JXPA 1RIWB 2PLXA 1MKXK 1F5KU 1HV7A 2V3HH 4Q7YA 5C1YA 1DWBH 1PPGE 1TAWA 2LPRA 1OWEA 1SR5C 1GBJA 1HJ9A 4R0IA 2QYIA 1ZTLA 1MBQA 4K8YA 3RXTA 2A7HA 2WUCA 1V2TT 4B75A 3CS7A 2J2UA 1EPTC 2VGCC 1RFNA 2WPKS 4X2YA 2BD7A 1MTWA 2ANYA 1HFDA 5FXLA 1ETRH 4ABHA 2R9PA 2W3KA 1X7AC 3MYWA 4O3TA 1EB2A 1QA7A 2OD3B 1LVOA 1O2HA 2GV6A 4ZKNU 4O3UA 2ZPSA 4K1SA 3SJ8A 2PUXB 3RC5A 2ZDAH 2ALPA 1O2RA 2WYGA 1V2WT 2BZAA 4RKOB 1UVSH 2XBXA 1SOTA 1VR1H 2ANMH 2OP9A 1V2MT 1E37B 1PYTD 4ABJA 2VINA 4ABAA 1JIRA 1TPAE 4TY7A 1O3AA 1UTOA 5HMAA 1QB1A 4JYVH 2Z9KA 5ESBA 1Z1JA 1HAIH 4JZFH 1EAWA 1NY22 1THSH 3EA9A 4WMFA 1YGCH 1D9IA 4WWYA 2QGRA 1MTSA 2XYAA 1D4PB 3A89A 1ZLRA 3O8DA 3SW2B 2XBWA 1K1MA 1Z8RA 3BG8A 1P0SH 3SV9A 1CE5A 1UTPA 2H5CA 4LXBH 5L30H 1LQEA 1P57B 3BTKE 3HK6B 1A4WH 4X1RU 1YC0A 1G3DA 3RXOA 1J9CH 2FOGA 3MNBA 2BX3A 1OXGA 1C9PA 3F9FA 3OY5U 3ZVDA 3RXBA 1HJAB 1Y5BT 1GG6B 2FX4A 1TNJA 1L0ZA 1CQQA 1WBGB 2FOBA 1J17T 3UNQA 8GCHF 1DM4B 4K8BA 1ZZZA 1A0HB 4Y8YA 1C5UA 1ESTA 2QY0B 4WH6A 3A7TA 3SU6A 3TK5A 4BTIB 1P2JA 2RA3A 1C5YB 1QRWA 1H4WA 1TB6H 3LOXA 4FVBA 4NG9H 3RMNH 4OGXA 2ZGCA 4JZIA 4FXGH 3K9XB 1YBWA 3RLWH 1C5XB 2SFAA 3KIDU 3L33A 2HLCA 1EJNA 4A1XA 3PTNA 3A84A 2P95A 3IG6B 3RXPA 2JH6D 2EI7A 3FP7E 2BD9A 3MH5A 1BRAA 2ZCHP 3NCLA 4NIXA 4Q7ZA 1YCPK 3E91A 5T6DA 2FOEA 3UNSA 3A7XA 4DW2U 1ZGIA 4GAWA 5F8ZA 2GT8A 1LPKB 1THRH 5HGGA 4BAOB 1EQ9A 5TJXA 1AFEH 3ZVEA 1N6XA 2FZZA 3Q00A 3P70B 4CHAB 3BTQE 3KCGH 1IQJA 4X6OA 4D7FA 3MI4A 4AGJA 3U69H 1GHVH 1EAXA 3SU2A 2Q6DA 1UHBA 3D49H 4CR9A 1TRNA 3A82A 1E36B 1TPOA 5LPEA 4ZKSU 1O35A 2OINA 3WY8A 1C1QA 4E06H 2BD5A 1IQNA 2AH4X 1C5QA 1QL8A 1Q3XA 1ARCA 1QY6A 2XRCA 3F68H 3PMAB 3QZRA 1Y8TA 2R3UA 3GY8A 4I8LA 1SGRE 1K28D 2OC8A 3ZYDA 4Y79A 1O36A 1HB0B 3SORA 3AVZA 3Q77A 4JZ1A 1WQSA 1RD3B 3GCNA 1BRUP 4I31A 4D9QA 7ESTE 5F8TA 3VB3A 3RXRA 2WPMS 1S6FA 3F1SB 5A8ZA 1RIWC 2ZHDA 4X6PA 2WPJS 4MLFB 3K6YA 1LHCH 3QK1A 3RUOA 2GCHF 1DPOA 1AVWA 5EPYA 3SUEA 1UK4A 3JZ1B 5TCCA 1FMGA 1P3CA 4OS5A 1GPZA 2FI5E 3SNEA 3TJNA 8GCHG 3MH7A 4K3JA 2ZNKH 1O2JA 2KAIA 1BB0B 5SGAE 1FQ3A 2NWNA 2F91A 2FO9A 5C2ZA 1ELGA 1C2HA 2ZQ2A 4UFGH 4NFEA 3TU7H 2AGEX 5BRRE 1V2UT 1ELBA 3UQOA 4X8VH 3W95A 2FS8A 1RTLA 4HGCA 1O2QA 1INCA 3DFLA 1WU1A 4D7GA 3I78A 3SZNA 3GISB 1G3CA 3PMHB 2VVUA 1LKAA 4WMEA 3ZV8A 1BTPA 5E0HA 1ZJKA 1DUAA 1DFPA 1HLTH 1KLIH 3P92A 1LTOA 3RXLA 5T6FA 1JWTA 2GV7A 1G2MA 1S0RA 1HXFH 2CF9H 2WUBA 1W8BH 3P6ZB 3SUFA 3RXMA 2P59A 1O2VA 1QQ4A 1FPHH 1P8VC 5T3HA 1VJAU 1SL3A 3KQCA 4Y8ZA 2OXSA 3A8CA 1ACBE 1E0FD 1N8OB 2BVSH 3MU8A 1BQYA 2CF8H 1ANDA 5EXMA 2VU8E 2BMGB 1AU8A 3PMJA 1A2CH 4B2BA 4E7RG 2CMYA 2KAIB 4JK5A 1GMHG 2ZKSA
chains in the Genus database with same CATH superfamily
1EUFA 1DANH 1XVOA 1O5CB 4YESB 3AAVA 3R0FA 3LT3A 4Y0ZE 2CHAB 3OY6U 2C8XB 1DXWA 1GG6C 3KQ5A 4Q4LA 1FY5A 1FPCH 2FODA 1GHAF 5A0CA 1MMJN 1MH0A 4HTCH 4ABIA 3ZVGA 4NFFA 1LMWB 1JBUH 3GDVA 4ABGA 5K7RA 1CA8B 4ISNA 2BQ7B 2FXRA 1C1VH 1NBMD 2W26A 2Z94A 1MCTA 1GJ5H 1TA2A 1A0JA 3DD2H 2VWMA 4X1SU 2WPLS 3KQDA 4AFUA 4CREA 1ZOMA 1ABIH 2ZGBH 3SO3A 2W6JD 2PKSC 4DOQA 2GCHG 4YM9A 3EE0B 4Y7BA 3M5OA 3SGBE 3ZVBA 4CRGA 1SLUB 2ZPQA 2JDID 3NUMA 2OLGA 1ELTA 4U2WA 1SVPA 2ZQ1A 1UVPA 7KMEH 1BTHH 1EASA 5ABWA 1O2OA 4D8NA 2ZI2H 2XW9A 4YLQH 1HAVB 2Z3EA 1GHBF 4BTUB 4NA8A 5C17A 2QXIA 3K65B 1C1PA 5GCHF 2KX4A 4MVNA 2Z7FE 2VIQA 4AG2A 1V2LT 3EYDA 1SMFE 3K2UA 4RSPA 4YT6H 3A7YA 3P8NA 4THNH 2EEKA 1DWEH 2GD4B 5A0AE 3BEFB 1SKYE 4ISHH 1BMMH 1TX8A 4TYDA 1Y5UT 1T8MA 1EZXC 2ZFFH 2D26C 3GCTF 1GBKA 3PLBA 1E35B 1GMCG 2XTTB 4ZMAH 1XKBC 2BDAA 1BTUA 2ZDLA 1V2OT 1QR3E 1TGSZ 4ESTE 3V3MA 5JBTA 1SHYA 1C1SA 1QFKH 4GHTA 1P12E 1GCTC 1QGFA 1K1NA 3RMMH 3AW0A 3LIWA 1DSTA 1W3CA 1G3EA 1MUEB 1SGDE 1NRPH 3LGUA 1O3BA 2L6OA 2PKAA 1JMOH 3UREA 3G01A 1XUKA 1ESBA 2BX4A 1TIOA 1SGFA 1EPTB 1QBOA 1GBEA 4TT3D 5CHBA 2ZDMA 3SU4A 1O37A 2FYRA 3BTDE 1O3IA 2GTBA 3GDUA 2WV9A 2UWLA 4I8KA 4K60A 1GHAG 3BV9B 1MBMA 4I7YH 1O33A 1UTQA 1BUIA 1BJVA 2F4LA 3PM3A 3SJIA 1MAXA 1GL1A 3U28C 1HAZB 5E0GA 1H8IH 1HJ8A 8ESTE 1GGDC 1EOLA 3TNSA 1KXFA 1OHHD 2R0KA 3PLPA 4E7NA 2GKVE 4INKA 4AN7A 2P3FH 2BVRH 1VITH 4ZAEA 1F0TA 4HI3A 5CHAC 1FY4A 4AFSA 3MNCA 2FLRH 4X2WA 1XXDA 1ELAA 2BTCE 3A8BA 3O8BA 4XOJA 4K2YA 1AMHA 2CK3D 2FI3E 2ILNA 1SQOA 3BTEE 2GGVB 3FN8A 3VPKA 1S5SA 1RXPA 3GYLB 5DP4A 1UCYH 1DWCH 3UUZA 1C5MD 1J15A 3BTTE 1GI1A 1UTMA 3KNXA 5BPEA 3EDXB 1UJ1A 3V0XA 1EKBB 1TMUH 1K21H 4GCHF 4CRCA 1FN8A 5GCHG 2W3IA 6LPRA 3DFJA 2QXGA 1SSXA 3MNXA 1G37A 5EXLA 5KGOA 3H09A 2OQUA 1O34A 2UUYA 1KXBA 3TH4H 1ZGVA 1P2KA 4WJG2 3RC6A 1PQAA 3ESTA 4AYVB 2BDGA 2ZFRH 1QBVH 3BTME 4B71A 1AO5A 2J94A 1W14U 2XWBI 1K1PA 1PPBH 3KF2A 3UAIC 1BTXA 4GPGA 1EZSC 5LPRA 1ZTKA 2BDBA 1H8ED 3GCTG 2JIZD 4AOQA 2CHAC 1OP8A 1O5GH 1XX9A 5C94A 2V0BA 1FDPA 3T26A 3FP8E 3LC5A 1MU6B 1RRKA 2AFQB 2B8OH 4ZHAA 4AB8A 3RP2A 1ZPZA 1FIZA 2RA0A 1PYTC 1SFIA 1TOMH 4P00A 2BY9X 3ZZAA 2BDYA 1ETSH 4AORA 4CBOA 2JH0D 5JBBS 3TJOA 2J97A 3OTPA 1ESAA 5GPIB 2ZP0H 5A09A 2ANKH 3SUDA 2G4UA 2WZQA 2Y5GA 1C1TA 1SGIB 1TQ0B 8LPRA 1KLTA 2UUFB 4VGCB 3BG4B 1NPMA 2C8WB 1EX3A 2A4RA 4JYTA 3UIRA 5AVDA 2BZ6H 2Q1JA 2XWAA 3LU9B 2LELA 1WDIA 4AB9A 4UE7H 1O3NA 2BYAX 1GVLA 4X8SH 3T25A 1CHGA 2A31A 3SV6A 3QTOH 2G51A 2V3OH 1MABB 1ZSKA 3N7DA 1ARBA 1HPGA 1GBDA 1IQEA 3TH3H 2OC1A 2W6ID 5JDUB 1GBBA 1FV9A 1HIAB 1VITG 2Z9JA 1W0YH 1BMAA 1S82A 4NZQA 1ZHMA 3CS0A 4AG1A 1GI4A 1DOJA 2TGDA 5E2OA 3SHAH 3BTFE 1AUTC 1GHYH 3PV5A 1B5GH 9ESTA 3SV7A 1RJXB 2I6SA 1N6YA 3RXQA 1AGJA 1TLDA 2BB4A 2QE7D 2QF3A 5TCAA 2CJIA 3TPIZ 1D3PB 5JBAS 4RT1A 3LPRA 4MNVA 2FTLE 1PPFE 2OK5A 1GBAA 1YLCA 5KEDA 4XBBA 2QXHA 2PW8H 1V2NT 1DY8A 4NIWA 2JJ2D 2F83A 5L2ZH 1C4Y2 3MMGA 1V2QT 2VIVA 4HFPB 3QTVH 2AYWA 4K1TA 4I33A 2OC0A 3FOAA 3KGPA 1YKTA 1W12U 3PLKA 1C1RA 1C9TA 1EOJA 3NXPA 1F7ZA 4TWWA 2BD3A 1RGQA 1VGCC 1SLXB 2Y6TA 1AKSA 3BN9A 1KDQA 1H9IE 4H42U 3RU4T 1DSUA 2EI8A 4U32A 2QIQA 2EI6A 1UTKA 1TMBH 2J92A 2TIOA 4K69A 1V2ST 1BITA 1MZDA 5J4QA 1QURH 1XUJA 4AYYB 1GHZA 4DIIH 1JRTA 5HYOA 3LDXH 4KTUA 1GBCA 1W13U 3FO8D 1NROH 3OYPA 3UB0A 1IQMA 3FZDA 5EOKA 5EW1H 1FLEE 1G3BA 3LGTA 2L74A 2A7JA 3GYMA 1UTLM 2BD2A 1TNGA 2P3TB 4B2AA 2B7DH 1BOQA 3KQBA 1OP0A 1K2I1 1V2PT 1COWD 3UOPA 5L2YH 2RDEA 3F0OA 1QJ7B 2B0FA 2AERH 5HIZA 1PQ8A 2F9PA 3QWCH 2Z3CA 3TH2H 4CRAA 3HKIB 3C1KA 1RS0A 1O38A 3U1JB 4X2VA 1QB9A 1AZ8A 3MU1A 2OQ5A 3MU5A 4MNXA 1OWHA 3GCHC 3VB5A 1HYLA 4TY6A 1Z6JH 2FOCA 1E1RD 2A1DB 2ZU2A 3Q76A 4SGAE 2BDHA 2FOMB 1C2EA 2H9EH 5I46H 4IN2A 3ATKA 3RXUA 3F9HA 5LGOA 1LPGB 3LJOA 1ANEA 3TLOA 2J98A 1AE8H 2Y82A 3BEUA 2YMSD 3KHVA 1TALA 2H2ZA 3VXFH 1AE5A 1TFXA 2AIPA 2AMPA 3U1IB 4H6TA 1O2TA 1TX7A 4Y8XA 2V6NA 3ATIA 2JKHA 2O9QA 5T6GA 2F43B 1ETTH 4X0WU 3S69A 3SNAA 3ZZCA 2GCTC 2BY6X 2PKSB 2XC0A 2PSYA 1LQDB 4NIYA 5EJ1A 1NU9A 1CHOG 2Y80A 2PP6A 1G9IE 3M3TA 3PYHA 1P02A 1MD7A 1S85A 3TITA 4CH8B 1C1OA 4Q7XA 4YOGA 3B23B 2A5KA 4VGCC 3BG4C 2GP9B 2SGEE 4MNWA 1H8HD 1SQTA 3H7TA 4RN6A 1P2MA 4R8TB 3PV4A 1BDAA 3GY4A 3QGJA 1O2LA 1GI7B 3DSOA 2TPIZ 3M36A 2FP7B 3LGVA 1O2SA 5DP5A 1TOCB 2D8WA 2FEQH 2Z9IA 3GY6A 1Y3XA 2AMDA 2QN5T 3E8LA 1YWUA 5ETXA 1T8LA 1PQ7A 2BXTH 1GMHF 1A3BH 2OUAA 1XXFA 5FCRA 1N1LA 2FDAA 3T27A 4FOUC 1O3FA 4SGBE 2Z6BD 1P10A 3LC3A 2D2DA 2NU3E 1O3GA 1P2NA 3E3TA 1C2FA 1DVAH 1AFQC 5FPSA 3QDZB 3ZZBA 3VG8A 1KTTB 1C1WH 2HRVA 1GCTB 1NFUA 3A7WA 1LVYA 1FIWA 1YPEH 1HAYB 3SN8A 3EA7A 3S7KB 5AF9H 3U8OH 4FUBA 1EB1H 1ZYOA 4NWLA 1GHXH 5EQQA 2OTVA 1Y59T 3RM2H 1ZPCA 1NRSH 4NSYA 3SGQE 3STIA 1EJMA 2WPIS 5GWZA 1EFRD 2NU4E 4Y10E 4BAKB 3N99A 1FN6A 4KTCA 2XBYA 1H9LB 3ZZ3A 3GY3A 3P8OA 1OX1A 4BTTB 1Y3YA 2YNBA 4O03A 1Z7KA 3ODFA 4YTAA 1GI9B 1OYTH 5G4BA 2ZHFH 1WXRA 4GSOA 3Q3YA 1GGDB 2XC5A 1UHBB 4MTBA 1NU7B 1AB9C 1ZHPA 1L2EA 3TGJE 1W0ZU 2XCFA 1VJ9U 1BMNH 1YYY1 1YCPM 4FUJA 1AWFH 3SI3H 3T28A 2H6MA 5CHAB 4P02A 2IPQX 1O2IA 2BY8X 2EA3A 2PWXA 1TGBA 1TX6A 2BLWA 1AZZA 1C2KA 2ZWLH 7LPRA 4CRFA 3QLPH 3SV8A 4XE4A 1PPCE 5F03A 2OBQA 1O5DH 3ZV9A 2AMQA 1AQ7A 2QV1A 1W11U 1FY3A 1S83A 2H1UA 1OS8A 1TONA 3O8RA 2KCAA 2H9TH 3RXCA 2BOHB 1GMCF 2C3SA 2VH6A 3HPTB 3TK9A 5DKMA 1CVWH 4ACBA 4JCNA 2VWNA 2WSSD 2Z9GA 3DSPA 2SGPE 4DJZB 3VGCC 4FETA 2V35A 3LONA 2JETC 3RMLH 5E0JA 4ZKOU 2ALVA 2XNDD 5DJ7A 3ZVCA 1Z8IB 2AS9A 2TGPZ 4IMZA 2FOAA 3FZZA 4HZHA 1O2MA 1SLVB 2G5VA 2GDDA 3E16B 3STJA 2UWOA 3SUGA 4Q2KA 4YXWD 2KCOA 4NGAH 1OWKA 1Z8GA 4XD7D 3KN2A 4UDWH 3AAUA 4BAQB 1AY6H 1YPJH 1IAUA 1C5WB 1FNIA 1UK2A 5AFZH 1C5TA 2Y7XA 2YOLA 4ISIH 3LJJA 1HAGE 4IGDA 2FMJA 1QTFA 3TGKE 5LH8A 1A0LA 3RXKA 2EC9H 1OOKB 4WMDA 1TABE 3GY7A 3PRBA 2VIOA 4UFEH 2JH5D 1EZUC 2ZFSA 3BIVH 2O8UA 5FBEA 3RXDA 2G4TA 3S0NA 4LOYH 4UFDH 1KTSB 2YNAA 1WTHD 3P17H 4F48B 1G32B 2K0QA 1GBHA 4GHQA 2GMTC 2QC2A 3KEEA 2O8LA 5FPYA 3U98H 5C0UA 1C5ZB 4K1EA 1OWDA 1WUNH 2HNTC 1OYQA 1O3CA 4TSFD 2O8WA 2ZECA 1DS2E 3M37A 2ZC9H 1HAHH 5EXNA 3ZIAD 1O3EA 2FS9A 3MH4A 4BXSA 3E0PB 6GCHG 1GCDA 3BEIB 5FX6A 4J2YB 2OC7A 2FPZA 1SGYE 1IQFA 1QRXA 1OWIA 5GIBA 4WXIA 1TGTA 1BCUH 3PV2A 5AHGH 3SQHE 3TJUA 1K22H 1SI5H 2B5TB 3HKJB 2A5IA 3M5MA 1ZRKA 2RG3A 3VB6A 1GMDF 4ZUHA 4I32A 4Z6AH 1IHTH 2CN0H 1P2IA 1G36A 1V3XA 2P8OC 1C4V2 1O2PA 1EP6A 2SNWA 2ZDKA 4FU9A 4MNYA 3ZZDA 3QUMP 3MWIU 3ITIA 5DP9A 1GI6A 1S6HA 3LH3A 2P94A 4NCYA 1DXPA 3ATWA 5HXFA 1O3OA 3UPEA 3CENA 3MO3A 1ANCA 2ZTYA 4ZROA 2ZU4A 1VGCB 1YM0A 1DDJA 1TRYA 2BDCA 2ZDVH 4F49A 1E38B 3PO1C 3I29A 2BQ6B 1J14A 2Y5FA 2BDIA 3GY2A 1LO6A 1OKXA 4B1TA 3D23A 3RLYH 2R3YA 3Q3KA 1XUFA 4A1TA 4CRDA 3ZZ8A 2C93B 3S9BA 5H4IB 5HM9A 4QT8C 2DE8A 1MAYA 2ZDNA 3TNTA 2C8ZB 1KLJH 2ZHWH 5A0BA 1BMFD 3SU1A 2WV5A 1FY1A 1O5FH 5EQRA 1SB1H 1VITF 1BIOA 4ISLA 4KKDA 3ZZ6A 1F0RA 2SGDE 1WYKA 3RDZA 1B7XB 5FL7D 4NWKA 5HIYA 4TWYA 4LK4A 1MKWH 2HOBA 4Y7AA 1C5NH 1GBIA 5DG6A 4X2XA 1V2RT 4OGYA 4FUIA 3WWBA 3A8DA 1EZQA 2RCEA 1IQKA 2DE9A 1VKYA 3RXHA 3QO6A 1ZSLA 2XXLA 3A87A 4FUFA 2UUKB 4NIVA 2PKAB 1WCZA 4RT0A 2ZEBA 3GICB 1PPEE 4BNRA 1LHGH 3GCHB 5IK2D 2AIQA 4DT7B 3BTWE 3DHKH 3DA9B 4Z1MD 3UQVA 4ASHA 3A83A 1GDQA 1ELFA 1O2XA 1MQ6A 3K6ZA 3KQEA 3M7TA 3FVFB 2BD8A 3SI4H 1GMDG 3W94A 2VJ1A 3T29A 3LGIA 3RXAA 1SGNE 3SJKA 3KL6A 1ZPBA 1A5HA 3UWIA 1ZHRA 3OEED 1HGTH 1F2SE 5FPTA 3UR9A 1AUJA 1GDUA 3BF6H 1O2GH 2ODPA 1WV7H 2ZGHA 2G5NA 2GCTB 4UONA 4INLA 2Q6FA 3TK6A 4CRBA 5DO4H 3MO6A 1O31A 1F5RA 1NTPA 5CMXH 1LHEH 1BBRH 1C2JA 2C8YB 4X1QU 2BXUH 2QAAA 2BOKA 2VVCA 1FXYA 3S7HB 2XC4A 2VVVA 2BD4A 1QQUA 4HG6A 1XUIA 4Y71A 4GUXA 2A5AA 3GDSA 2STBE 3PRDA 1P2OA 1L1NA 1SHHB 1SGQE 3P95A 5DSFA 1SGPE 2KZ4A 3QGNB 3H7OA 4ZHLU 1GJBB 4XBCA 2WHXA 1DWDH 3V7TA 4AX9H 2HVXA 2G55A 2VIPA 3ZZ5A 1BTYA 4FUEA 1JOUB 4XSKU 4U30A 4IC5A 4A92A 1GBFA 1SC8U 3MNSA 5DP3A 3P8GA 1JRSA 1GHWH 1YPGH 3D65E 3OX7U 4M9FA 3M5LA 5LPFA 4J1YA 2FYQA 2YMSC 3TVJB 1PPHE 5EQSA 2NU0E 4KTSA 1AFQB 1B0FA 4UFFH 2ZZUH 3HGPA 4BXWA 4IS5A 1IHSH 1K1IA 5AFYH 1O2ZA 3LKWA 4KELA 2QXJA 1FJSA 2ZGXH 1EAUA 1P3EA 2ZFTA 1DE7H 1WSSH 3F2FA 2ZCLP 3NWUA 1ELVA 3BTHE 1CA0B 1L1JA 1O3DA 3QX5H 1LKBA 2BM2A 3RXEA 2NU2E 1XMNB 1P03A 2HGTH 6ESTA 7GCHG 5C67A 3H5CB 3SOSA 2ASUB 3F9GA 2J95A 1QL7A 4AGKA 3MO9A 1TBQH 2BY5X 1CHOF 5E8EH 1GWAA 2EY4C 2ZCKP 1LHFH 1FAXA 3L6PA 1HXEH 4GVUA 1YY3A 2J4IA 5FCKA 3ZVAA 1GBTA 4I8HA 3A86A 3OEHD 1MTUA 3PWCA 2J34A 3SNDA 2VIWA 1A3EH 1ORFA 2F9BH 1AB9B 2A0QB 2ZA5A 1YPHC 2ESTE 2PR3A 4O97A 3Q3XA 3ZZ4A 1AI8H 2W7UA 1VZQH 2R2MB 1BA8B 4IW4E 1TPSA 4F55A 1F92A 1ELDE 3UWJH 1A5GH 1ZJDA 3NZIA 3EA8A 5EODA 1T8NA 1BTWA 3F2GA 5IYTA 1C5LH 3QN7A 3SU5A 2ZFPH 1P11E 1BHXB 1BRCE 5DPAA 4GLYA 2A4GA 1O5EH 4B73A 1NBME 1NFYA 3MH6A 5EG4A 3TIUA 4H4FA 4UD9H 2THFB 2UWPA 1UVTH 2QF4A 1VCWA 2IPHA 5B6LA 1HRTH 4ZCNA 3NPSA 2FIRH 5ESTE 1GJCB 4FVDA 1BZXE 1W2KH 3F0PA 5J4SA 2HPQH 2F3CE 4MPVA 1SOZA 3M61U 4A1VA 1AHTH 1MU8B 1QBNA 1Y3UA 1K1JA 1UMAH 2ZTZA 3VGCB 1TYNA 2JETB 1F0SA 4XBDA 1ZMJA 4BANB 3W1EA 1DUEA 5C0TA 1QA0A 5DGJA 1C5OH 2UUJB 1GI2A 1O2KA 4Y6DA 1O3MA 2A4QA 1AKSB 1C4U2 1KDQB 2J9NA 1V6DA 3RXVA 4OS1A 4ZXYH 4BAMB 1P04A 2FESH 2Y81A 3S9CA 2GVFA 4ABFA 3EGKH 1GI3A 1ID5H 1MZAA 2ZG0H 4MPXA 2TBSA 3OFND 1L4ZA 1SLWB 1T4UH 5C1XA 3A7VA 3T5FH 1CBWC 3ENSB 4FUGA 4X1NU 3VFEA 1XVMA 3IITA 2FX6A 1C1UH 1GJDB 2VIDA 4BOHA 3ATMA 5C1UA 3VXEH 1UVOA 2FM2A 2LNCA 1DT2A 4OS2A 1TMTH 1FI8A 1ZSJA 1A61H 1KXDA 1BRBE 1EXFA 4YOIA 1MKWK 1AD8H 1C5SA 1V2JT 1CT2E 3RXJA 3HGNA 4ZXXH 4ISOA 2GMTB 2A45B 1UCYK 1TA6A 2Y5HA 3PWBA 4WH8A 1OPHB 5C3NA 1BTZA 1TNKA 2W5EA 1O0DH 2GJGA 3RC4A 3MTYA 1TBRH 2AGGX 1RTFB 1WQVH 4LZ1H 1TBZH 2V3MA 3A8AA 1GVZA 2SGQE 2WPDD 3SNCA 4MPWA 3MHWU 1DICA 3M5NA 5DP7A 6CHAC 1FX0B 5GDSH 1Z6EA 1OP2A 4B74A 1DLKB 1EP5A 1M9UA 4LZ4B 3ELAH 3ZVFA 3SU3A 1ZMNA 1NRQH 3KYGA 1NT1A 1SGTA 2J98B 2K8IA 4YLUA 3SJOA 1AVGH 1Z71A 1CGHA 3U8TH 1ZR0A 2P8OB 9LPRA 4AC9A 5DP6A 3TGIE 1JIMA 5EIYA 1MQ5A 1UO6A 5A2MH 3HATH 1A46H 3PB1E 4RI0A 1DX5M 4CBNA 1BBRK 1XM1A 1QHRB 4X8UH 3PROA 1A5IA 2ZTXA 1GBMA 2ZIQH 2WPHS 1CA0C 4WY3A 1VCQA 5F6MA 1FUJA 1NRNH 3B8JA 2IJD1 3ODDA 4B2CA 2F9UA 1HAPH 4ACAA 1C5PA 1HNEE 5JYIA 3A88A 1QJ6B 4OS6A 2HNTE 5A8YA 2PUQH 3VEQB 5EJZA 1HUTH 2BLQA 3GY5A 1RTKA 3PO1B 5FHTA 3F6UH 2ZO3H 1D3DB 1HCGA 1CT4E 8KME2 2FOFA 2G8TA 1AN1E 1P09A 3I77A 4OS4A 3BIUH 1SFQB 2BY7X 3VB4A 1IQLA 2STAE 3RXGA 3CP7A 1C1MA 3RXIA 4UEHH 1SQAA 1T7CA 2XOKD 1ELCA 1IQGA 6GCHF 4IC6A 1NFWA 4PROA 2G00A 2QF0A 3DSGA 1OWJA 1UCYE 5C20A 2G52A 3RM0H 1GVKB 2A2QH 2PGBB 1TGCA 3NKKA 1HBTH 3LH1A 4K5ZA 2SGFE 1KY9A 1MTVA 1SPJA 5EW2H 1O3LA 2GZ9A 2GZ7A 1S0QA 1NS3A 1ANBA 2P16A 2XNIA 1H1BA 4Y76A 2A4OA 1P9SA 1IQHA 3M3VA 4ZH8A 4DGJA 1H9HE 1O39A 5A8XA 3P8FA 1ZRBA 3EE7A 1QCPA 1Y5AT 3RXFA 3T2NA 4CH2B 1AVXA 1YPLH 2HLDD 1F5LA 1FY8E 3C27B 3T62A 3GOVB 1GJ7B 1ZMLA 2SGAA 2J38A 1QB6A 2VWLA 4FUCA 2GZ8A 3OU0A 3RU4D 4AZ2B 1O2UA 1CGIE 1THPB 1D3QB 1TNHA 1SGFG 2IJOB 4CR5A 4FUDA 1CSOE 3B9FH 4E05H 1T32A 3F3BA 1IQIA 4TPIZ 5GNDA 5EPNA 3SU0A 1O2NA 1T8OA 4NA9H 1FONA 1BBRE 1NESE 2ZPRA 5GJ4B 4ZKRU 2WV4A 2AGIX 5FAHA 1GJ8B 3A80A 4DG4A 1C2LA 4FUHA 3UR6A 1HAVA 5IDKA 4A5TS 1LVMA 2OCVB 4U01A 2M5TA 1FZZA 3ATLA 4YOJA 4DURA 2WYJA 3NRLA 1G30B 1MCVA 4IMQA 2CXVA 1HJAC 1GJ9B 1P9UA 3SJ9A 2ODYB 1ABJH 1UW7A 2W7SA 3RMOH 1AWHB 2GX4A 2ZHQH 2R2WU 4Z0KA 4XFQA 2H5DA 1C5VA 1LDTT 2PSXA 2KR7A 3SV2H 2OBOA 1BHXF 1SQRA 1H8DH 1SGEE 1GJAB 2QCYA 3E1XB 4ABBA 4FU7A 2HVYB 1O2YA 3ZYEA 2A2XH 5PTPA 1K9OE 4NSVA 1MKXH 1QIXB 2PGQB 2FTMA 1CT0E 4AFQA 1C1NA 3HK3B 3A7ZA 3R3GB 1KIGH 2CGAA 2FI4E 3O8CA 4ABDA 3F2HA 4MDSA 3A85A 1NM6A 2YMSB 1EPTA 2ZFQH 4KP0A 4DVAU 4D9RA 4NZLA 3QZQA 2VNTA 3N7OA 1LCYA 1NRRH 1KSNA 1W0JD 1XUHA 5K0HA 5EU8A 3BTGE 3UTUH 2Y7ZA 1SGCA 5GXPA 3DT0H 4CHAC 1XUGA 2KFWA 2P93A 4XDEA 3M7UA 3MU4A 1K1OA 3SBKA 5JPMH 1TE0A 1UK3A 1DLEA 2P3UB 1C2IA 1O3JA 1O2WA 3FP6E 2K1QA 2C4FH 4O9VA 1A7SA 4Y0YE 5FX5A 5DK1A 4ZHMU 3UNRA 1EJAA 2ODQA 1GJ4H 3FFGA 1MTNB 1W10U 2AEIH 3IWMA 4X6NA 2HPPH 4MQAA 2GDEH 1FAKH 1KMHB 3RXSA 5C5OA 2ZU3A 4YT7H 2IN2A 1Q31A 1C5RA 1Z8JB 5E2PA 4KGAA 1DY9A 4WXVA 4DIHH 3ZZ7A 4RKJB 1VCPA 2LP6A 3SYJA 2RDLA 3V13A 1YF4A 1B0EA 3SGAE 2ZHEH 4X1PU 2CV3A 3M3SA 3DUXH 1E34B 3TJVA 4FU8A 4DY7B 2D1JA 4WF8A 1C2GA 2ZU1A 1HDTH 1Z1IA 3JZ2B 2HNTF 2TRMA 4A7IB 1PFXC 2VGCB 2HWLB 5EJLA 4D76A 4YO9A 4MG3A 3EAJA 4AFZA 1F0UA 3F9EA 3GS9A 2VH0A 2FWWA 1BT7A 1O30A 5CE1A 1MD8A 1QNJA 5F8XA 5B6OA 1WOFA 1TGNA 3FANA 2BHGA 2F9VA 3SQEE 1E1QD 1P05A 1W7XH 2TGTA 1YP9A 1P2QA 1LHDH 1SG8B 1SBWA 2HALA 1BJUA 3S9AA 4IN1A 5EGMA 3V12A 2PTNA 2PHBA 4ASUD 1J8AA 1YLDA 1D6WA 1TRMA 4X6MA 1GI8B 2SNVA 2Z9LA 2FOHA 1QRZA 3LGYA 1GJ6A 1GL0E 1KYNA 3D62A 4X8TH 3L3TA 3PMBB 1YPMH 7GCHF 1CU1A 2FLBH 3SHCH 3URCA 1HAOH 4JK6A 1O3KA 2BLVA 1YPHE 1TQ7B 1YCPH 2O8MA 2ZF0H 1V2KT 1GHBG 1O3PB 1CBWB 3BSQA 1NFXA 4WVPE 4H6SB 2ZU5A 3E0NB 1L1GA 1GDNA 5FBIA 1NN6A 3VB7A 1LPZB 2VWOA 4INHA 2QA9E 3PTBA 1TPPA 4MPUA 5JB8S 1N8OC 1GBLA 1TNLA 4OS7A 1EATA 1C2DA 1GI0A 2TGAA 3UY9A 1QJ1B 4JZDH 1O5BB 2RFKC 1U6QA 4ABEA 2H9HA 2ZGJA 1UTNA 1KXEA 4TPYA 1W0KD 4M7GA 1HIAA 2F9OA 1BMLA 3OSYA 2ULLA 4I8JA 4JZEH 3AASA 4DCDA 1OSSA 1NZQH 1QL9A 5L6NH 1DITH 1P01A 3FKSD 3ZZ9A 3MU0A 5JB9S 1Y3WA 2NU1E 4BAHB 1O5AB 1C2MA 3E6PH 3UFAA 1Y3VA 1UTJA 3OAAD 2C90B 1WAYB 1D3TB 1E79D 3U9AH 2JJ1D 2R0LA 4I8GA 2B9LA 3FAOA 6CHAB 4F4OC 4Y11E 5HM2A 2BLOA 5T1VA 1W7GH 4NA7A 4B76A 2VB0A 1L4DA 2DUCA 1IOEA 3AW1A 1D6RA 4JYUH 2PFEA 4B6EA 1O32A 1NO9H 1S81A 1S84A 2Z3DA 3SNBA 1A1RA 3N7EA 3URDA 1TWXB 1PJPA 3MFJA 4YZUA 1LVBA 1NC6A 1YPKH 4JMYA 3MOCA 3NK8A 2PV9B 3OTJE 3E90B 2F9NA 3UOUA 3U8RH 1O3HA 5C5NA 1EAIA 1P06A 5I25A 1J16A 1G2LA 1XKAC 2ANWA 2GT7A 1CO7E 1TNIA 2G81E 2PTCE 1UVUH 3M7QA 1K0HA 5DP8A 2I6QA 1PPZA 3EQ0H 3A81A 1KXCA 4IBLH 1ZTJA 1V2VT 1HAXB 1PQ5A 1WTGH 4Q80A 3LGWA 2WINI 1MTNC 1GI5A 1AIXH 2BVXH 2KM0A 1CGJE 2A7CA 1T31A 2XBVA 2Q6GA 4A6LA 1ELEE 2O8TA 1Q2WA 2XCNA 3GCOA 2A32A 2IOTA 3M35A 3RU4E 4GCHG 1T4VH 1K1LA 2BQWB 5JBCS 1KXAA 1JXPA 5DN6D 1RIWB 2PLXA 1MKXK 1F5KU 1HV7A 2V3HH 4Q7YA 4DT4A 5C1YA 1DWBH 1PPGE 1TAWA 2LPRA 1OWEA 1SR5C 1GBJA 1HJ9A 1S6LA 4R0IA 2QYIA 1ZTLA 1MBQA 4K8YA 3RXTA 2A7HA 2WUCA 1V2TT 4B75A 3CS7A 2J2UA 1EPTC 2VGCC 1RFNA 2WPKS 4X2YA 2BD7A 1MTWA 2ANYA 1HFDA 5FXLA 1ETRH 4ABHA 2R9PA 2W3KA 1X7AC 3MYWA 4O3TA 5HKKD 1EB2A 1QA7A 2OD3B 1LVOA 1O2HA 2GV6A 4ZKNU 4O3UA 4I86A 2ZPSA 4K1SA 3SJ8A 2PUXB 3RC5A 2ZDAH 2ALPA 1O2RA 2WYGA 1V2WT 2BZAA 4RKOB 1UVSH 2XBXA 4Q63A 1SOTA 1VR1H 2ANMH 2OP9A 1V2MT 1E37B 1PYTD 4ABJA 2VINA 4ABAA 1JIRA 1TPAE 4TY7A 1O3AA 1UTOA 5HMAA 1QB1A 4JYVH 2AHME 2Z9KA 5ESBA 3WW7A 1Z1JA 1HAIH 4JZFH 1EAWA 1NY22 1THSH 3EA9A 4WMFA 1YGCH 1D9IA 4WWYA 2QGRA 1MTSA 2XYAA 1D4PB 3A89A 1ZLRA 3O8DA 3SW2B 2XBWA 1K1MA 4B6FA 1Z8RA 3BG8A 1P0SH 3SV9A 1CE5A 1UTPA 2H5CA 4LXBH 5L30H 1LQEA 1P57B 3BTKE 3HK6B 1A4WH 2KCYA 4X1RU 1YC0A 1G3DA 3RXOA 1J9CH 2FOGA 3MNBA 2BX3A 1OXGA 1C9PA 3F9FA 3OY5U 3ZVDA 3RXBA 1HJAB 1Y5BT 1GG6B 1QZ8A 2FX4A 1TNJA 1L0ZA 1CQQA 1WBGB 2FOBA 3MQKC 1J17T 2VBCA 3UNQA 1DM4B 3OE7D 8GCHF 4K8BA 1ZZZA 1A0HB 1YLNA 4Y8YA 1C5UA 1ESTA 2QY0B 4WH6A 3A7TA 3SU6A 3TK5A 4BTIB 1P2JA 2RA3A 1C5YB 1QRWA 1H4WA 1TB6H 3DCLA 3LOXA 4FVBA 4NG9H 3RMNH 4OGXA 2ZGCA 4JZIA 4FXGH 3K9XB 1YBWA 3RLWH 1C5XB 2SFAA 3KIDU 3L33A 2HLCA 1EJNA 4A1XA 3PTNA 3A84A 2M2AA 2P95A 3IG6B 3RXPA 2JH6D 2EI7A 3FP7E 2BD9A 3MH5A 3CNRA 1BRAA 2ZCHP 3NCLA 4NIXA 4Q7ZA 1YCPK 3E91A 5T6DA 2FOEA 3UNSA 3A7XA 4DW2U 1ZGIA 4GAWA 5F8ZA 2GT8A 1LPKB 1THRH 5HGGA 4BAOB 1EQ9A 5TJXA 1AFEH 3ZVEA 1N6XA 2FZZA 3Q00A 5KECA 3P70B 4CHAB 3BTQE 3KCGH 1IQJA 4X6OA 4D7FA 3MI4A 4AGJA 3U69H 3WWFA 1GHVH 1EAXA 3SU2A 2Q6DA 1UHBA 3D49H 3KYFA 4CR9A 1TRNA 3A82A 1E36B 1TPOA 5LPEA 4ZKSU 1O35A 2OINA 3WY8A 1C1QA 4E06H 2BD5A 1IQNA 2AH4X 1C5QA 1QL8A 1Q3XA 1ARCA 1QY6A 2XRCA 3F68H 3PMAB 3QZRA 1Y8TA 2R3UA 3GY8A 4I8LA 1SGRE 1K28D 2OC8A 3ZYDA 4Y79A 1O36A 1HB0B 3SORA 3AVZA 3Q77A 4JZ1A 1WQSA 1RD3B 3GCNA 2EQNA 1BRUP 4I31A 4D9QA 7ESTE 5F8TA 3VB3A 3RXRA 2WPMS 2J5UA 1S6FA 3F1SB 5A8ZA 1RIWC 2ZHDA 4X6PA 2WPJS 4MLFB 3K6YA 1LHCH 3QK1A 3RUOA 2GCHF 1DPOA 1AVWA 5EPYA 3SUEA 1UK4A 3JZ1B 5TCCA 1FMGA 1P3CA 4OS5A 1GPZA 2FI5E 3SNEA 3TJNA 8GCHG 3MH7A 4K3JA 2ZNKH 1O2JA 2KAIA 4OM9A 1BB0B 5SGAE 3AK5A 4XRNA 1FQ3A 2NWNA 2F91A 2FO9A 5C2ZA 1ELGA 5F53A 1C2HA 2ZQ2A 4UFGH 4NFEA 3TU7H 5CDFE 2AGEX 5BRRE 1V2UT 1ELBA 3UQOA 4X8VH 3W95A 2FS8A 1RTLA 4HGCA 1O2QA 1INCA 3DFLA 1WU1A 4D7GA 3I78A 3SZNA 3GISB 1G3CA 3PMHB 2VVUA 1LKAA 4WMEA 3ZV8A 1BTPA 2QF5A 5E0HA 1ZJKA 1DUAA 1DFPA 2KCPA 1HLTH 1KLIH 3P92A 1LTOA 3RXLA 5T6FA 1JWTA 2GV7A 1G2MA 1S0RA 1HXFH 2CF9H 2WUBA 1W8BH 3P6ZB 3SUFA 3RXMA 2P59A 1O2VA 1QQ4A 1FPHH 1P8VC 5T3HA 1VJAU 1SL3A 3KQCA 4Y8ZA 2OXSA 3A8CA 1ACBE 1E0FD 1N8OB 2BVSH 3MU8A 1BQYA 2CF8H 1ANDA 3SZEA 5EXMA 2VU8E 2BMGB 1AU8A 3PMJA 1A2CH 2V7QD 4B2BA 4E7RG 2CMYA 2KAIB 4JK5A 1GMHG 2ZKSA
chains in the Genus database with same CATH topology
1EUFA 1DANH 1XVOA 1O5CB 4YESB 3AAVA 3R0FA 3LT3A 4Y0ZE 2CHAB 3OY6U 2C8XB 1DXWA 1GG6C 1FY5A 1FPCH 2FODA 1GHAF 5A0CA 1MMJN 1MH0A 4HTCH 4ABIA 3ZVGA 4NFFA 1LMWB 1JBUH 3GDVA 4ABGA 5K7RA 1CA8B 4ISNA 2BQ7B 2FXRA 1C1VH 2W26A 2Z94A 1MCTA 1GJ5H 1TA2A 1A0JA 3DD2H 2VWMA 4X1SU 2WPLS 3KQDA 4AFUA 4CREA 1ZOMA 1ABIH 2ZGBH 3SO3A 2PKSC 4DOQA 2GCHG 4YM9A 3EE0B 4Y7BA 3M5OA 3SGBE 3ZVBA 4CRGA 1SLUB 2ZPQA 3NUMA 2OLGA 1ELTA 4U2WA 1SVPA 2ZQ1A 1UVPA 7KMEH 1BTHH 1EASA 5ABWA 1O2OA 4D8NA 2ZI2H 2XW9A 4YLQH 1HAVB 2Z3EA 1GHBF 4BTUB 4NA8A 2QXIA 3K65B 1C1PA 5GCHF 4MVNA 2Z7FE 2VIQA 4AG2A 1V2LT 3EYDA 1SMFE 3K2UA 4RSPA 4YT6H 3A7YA 3P8NA 4THNH 2EEKA 1DWEH 2GD4B 5A0AE 3BEFB 4ISHH 1BMMH 1TX8A 4TYDA 1Y5UT 1T8MA 1EZXC 2ZFFH 2D26C 3GCTF 1GBKA 3PLBA 1E35B 1GMCG 2XTTB 4ZMAH 1XKBC 2BDAA 1BTUA 2ZDLA 1V2OT 1QR3E 1TGSZ 4ESTE 3V3MA 5JBTA 1SHYA 1C1SA 1QFKH 4GHTA 1P12E 1GCTC 1QGFA 1K1NA 3RMMH 3AW0A 3LIWA 1DSTA 1W3CA 1G3EA 1MUEB 1SGDE 1NRPH 3LGUA 1O3BA 3UREA 2PKAA 1JMOH 3G01A 1XUKA 1ESBA 2BX4A 1TIOA 1SGFA 1EPTB 1QBOA 1GBEA 2ZDMA 3SU4A 1O37A 2FYRA 3BTDE 1O3IA 2GTBA 3GDUA 2UWLA 4I8KA 4K60A 1GHAG 3BV9B 1MBMA 4I7YH 1O33A 1UTQA 1BUIA 1BJVA 3PM3A 3SJIA 1MAXA 1GL1A 1HAZB 5E0GA 1H8IH 1HJ8A 8ESTE 1GGDC 1EOLA 3TNSA 1KXFA 2R0KA 3PLPA 4E7NA 2GKVE 4INKA 4AN7A 2P3FH 2BVRH 1VITH 4ZAEA 1F0TA 4HI3A 5CHAC 1FY4A 4AFSA 3MNCA 2FLRH 4X2WA 1XXDA 1ELAA 2BTCE 3A8BA 3O8BA 4XOJA 4K2YA 1AMHA 2FI3E 2ILNA 1SQOA 3BTEE 2GGVB 3VPKA 1S5SA 1RXPA 3GYLB 5DP4A 1UCYH 1DWCH 3UUZA 1C5MD 1J15A 3BTTE 1GI1A 1UTMA 3KNXA 5BPEA 3EDXB 1UJ1A 3V0XA 1EKBB 1TMUH 1K21H 4GCHF 4CRCA 1FN8A 5GCHG 2W3IA 6LPRA 3DFJA 2QXGA 1SSXA 3MNXA 1G37A 5EXLA 2OQUA 1O34A 2UUYA 1KXBA 3TH4H 1ZGVA 1P2KA 4WJG2 3RC6A 1PQAA 3ESTA 4AYVB 2BDGA 2ZFRH 1QBVH 3BTME 4B71A 1AO5A 2J94A 1W14U 2XWBI 1K1PA 1PPBH 3KF2A 1BTXA 4GPGA 1EZSC 5LPRA 1ZTKA 2BDBA 3GCTG 4AOQA 2CHAC 1OP8A 1O5GH 1XX9A 2V0BA 1FDPA 3T26A 3FP8E 3LC5A 1MU6B 1RRKA 2AFQB 2B8OH 4ZHAA 4AB8A 3RP2A 1ZPZA 1FIZA 2RA0A 1PYTC 1SFIA 1TOMH 2BY9X 3ZZAA 2BDYA 1ETSH 4AORA 4CBOA 2JH0D 5JBBS 3TJOA 1ESAA 5GPIB 2ZP0H 5A09A 2ANKH 3SUDA 2G4UA 2Y5GA 1C1TA 1SGIB 1TQ0B 8LPRA 1KLTA 2UUFB 4VGCB 3BG4B 1NPMA 2C8WB 1EX3A 2A4RA 4JYTA 3UIRA 5AVDA 2BZ6H 2Q1JA 2XWAA 3LU9B 4AB9A 4UE7H 1O3NA 2BYAX 1GVLA 4X8SH 3T25A 1CHGA 2A31A 3SV6A 3QTOH 2G51A 2V3OH 1ZSKA 1ARBA 1HPGA 1GBDA 1IQEA 3TH3H 2OC1A 5JDUB 1GBBA 1FV9A 1HIAB 1VITG 2Z9JA 1W0YH 1BMAA 1S82A 4NZQA 1ZHMA 3CS0A 4AG1A 1GI4A 1DOJA 2TGDA 5E2OA 3SHAH 3BTFE 1AUTC 1GHYH 1B5GH 9ESTA 3SV7A 1RJXB 2I6SA 1N6YA 3RXQA 1AGJA 1TLDA 2BB4A 2QF3A 5TCAA 2CJIA 3TPIZ 1D3PB 5JBAS 3LPRA 4MNVA 2FTLE 1PPFE 1GBAA 1YLCA 4XBBA 2QXHA 2PW8H 1V2NT 1DY8A 4NIWA 2F83A 5L2ZH 1C4Y2 3MMGA 1V2QT 2VIVA 4HFPB 3QTVH 2AYWA 4K1TA 4I33A 2OC0A 3KGPA 1YKTA 1W12U 3PLKA 1C1RA 1C9TA 1EOJA 3NXPA 1F7ZA 4TWWA 2BD3A 1RGQA 1VGCC 1SLXB 2Y6TA 1AKSA 3BN9A 1KDQA 1H9IE 4H42U 3RU4T 1DSUA 2EI8A 4U32A 2QIQA 2EI6A 1UTKA 1TMBH 2J92A 2TIOA 4K69A 1V2ST 1BITA 1MZDA 5J4QA 1QURH 1XUJA 4AYYB 1GHZA 4DIIH 1JRTA 5HYOA 3LDXH 4KTUA 1GBCA 1W13U 1NROH 3OYPA 1IQMA 3FZDA 5EOKA 5EW1H 1FLEE 1G3BA 3LGTA 2A7JA 3GYMA 1UTLM 2BD2A 1TNGA 2P3TB 4B2AA 2B7DH 1BOQA 3KQBA 1OP0A 1K2I1 1V2PT 3UOPA 5L2YH 1QJ7B 2B0FA 2AERH 1PQ8A 2F9PA 3QWCH 2Z3CA 3TH2H 4CRAA 3HKIB 3C1KA 1RS0A 1O38A 3U1JB 4X2VA 1QB9A 1AZ8A 3MU1A 2OQ5A 3MU5A 4MNXA 1OWHA 3GCHC 3VB5A 1HYLA 4TY6A 1Z6JH 2FOCA 2A1DB 2ZU2A 3Q76A 4SGAE 2BDHA 2FOMB 1C2EA 2H9EH 5I46H 4IN2A 3ATKA 3RXUA 3F9HA 5LGOA 1LPGB 3LJOA 1ANEA 3TLOA 1AE8H 2Y82A 3BEUA 3KHVA 1TALA 2H2ZA 3VXFH 1AE5A 1TFXA 2AIPA 2AMPA 3U1IB 4H6TA 1O2TA 1TX7A 4Y8XA 2V6NA 3ATIA 2JKHA 2O9QA 5T6GA 4X0WU 1ETTH 3S69A 3SNAA 3ZZCA 2GCTC 2PKSB 2BY6X 2XC0A 2PSYA 1LQDB 4NIYA 1NU9A 1CHOG 2Y80A 3M3TA 1G9IE 3PYHA 1P02A 1MD7A 1S85A 3TITA 4CH8B 1C1OA 4Q7XA 4YOGA 3B23B 2A5KA 4VGCC 3BG4C 2GP9B 2SGEE 4MNWA 3H7TA 1SQTA 4RN6A 1P2MA 4R8TB 3PV4A 1BDAA 3GY4A 3QGJA 1O2LA 1GI7B 2TPIZ 3M36A 2FP7B 3LGVA 1O2SA 5DP5A 1TOCB 2D8WA 2FEQH 2Z9IA 3GY6A 1Y3XA 2AMDA 2QN5T 3E8LA 5ETXA 1T8LA 1PQ7A 2BXTH 1GMHF 1A3BH 2OUAA 1XXFA 5FCRA 1N1LA 2FDAA 3T27A 1O3FA 4SGBE 2Z6BD 1P10A 3LC3A 2D2DA 2NU3E 1O3GA 1P2NA 3E3TA 1C2FA 1DVAH 1AFQC 5FPSA 3QDZB 3ZZBA 1KTTB 1C1WH 2HRVA 1GCTB 1NFUA 3A7WA 1LVYA 1FIWA 1YPEH 1HAYB 3SN8A 3EA7A 3S7KB 5AF9H 3U8OH 4FUBA 1EB1H 1ZYOA 4NWLA 1GHXH 5EQQA 2OTVA 1Y59T 3RM2H 1ZPCA 1NRSH 4NSYA 3SGQE 3STIA 1EJMA 2WPIS 5GWZA 2NU4E 4Y10E 4BAKB 1FN6A 4KTCA 2XBYA 1H9LB 3ZZ3A 3GY3A 3P8OA 1OX1A 4BTTB 1Y3YA 2YNBA 4O03A 1Z7KA 3ODFA 4YTAA 1GI9B 1OYTH 5G4BA 2ZHFH 4GSOA 3Q3YA 1GGDB 2XC5A 1UHBB 4MTBA 1NU7B 1AB9C 1ZHPA 1L2EA 3TGJE 1W0ZU 2XCFA 1VJ9U 1BMNH 1YYY1 1YCPM 4FUJA 1AWFH 3SI3H 3T28A 2H6MA 5CHAB 1O2IA 2BY8X 2EA3A 2PWXA 1TGBA 1TX6A 2BLWA 1AZZA 1C2KA 2ZWLH 7LPRA 4CRFA 3QLPH 3SV8A 4XE4A 1PPCE 5F03A 2OBQA 1O5DH 3ZV9A 2AMQA 1AQ7A 2QV1A 1W11U 1FY3A 1S83A 2H1UA 1OS8A 1TONA 3O8RA 2H9TH 3RXCA 2BOHB 1GMCF 2C3SA 2VH6A 3HPTB 3TK9A 5DKMA 1CVWH 4JCNA 2VWNA 2Z9GA 4DJZB 2SGPE 3VGCC 2V35A 3LONA 2JETC 3RMLH 5E0JA 4ZKOU 2ALVA 3ZVCA 5DJ7A 1Z8IB 2AS9A 2TGPZ 4IMZA 2FOAA 3FZZA 4HZHA 1O2MA 1SLVB 2G5VA 2GDDA 3E16B 3STJA 2UWOA 3SUGA 4Q2KA 4NGAH 1OWKA 1Z8GA 3KN2A 4UDWH 3AAUA 4BAQB 1AY6H 1YPJH 1IAUA 1C5WB 1FNIA 1UK2A 5AFZH 1C5TA 2Y7XA 2YOLA 4ISIH 3LJJA 1HAGE 4IGDA 2FMJA 1QTFA 3TGKE 5LH8A 1A0LA 3RXKA 2EC9H 1OOKB 4WMDA 1TABE 3GY7A 2VIOA 4UFEH 2JH5D 1EZUC 2ZFSA 3BIVH 2O8UA 5FBEA 3RXDA 2G4TA 3S0NA 4LOYH 4UFDH 1KTSB 2YNAA 1WTHD 3P17H 1G32B 1GBHA 4GHQA 2GMTC 2QC2A 3KEEA 2O8LA 5FPYA 3U98H 1C5ZB 4K1EA 1OWDA 1WUNH 2HNTC 1OYQA 1O3CA 2O8WA 2ZECA 1DS2E 3M37A 2ZC9H 1HAHH 5EXNA 1O3EA 2FS9A 3MH4A 4BXSA 3E0PB 6GCHG 1GCDA 3BEIB 5FX6A 4J2YB 2OC7A 2FPZA 1SGYE 1IQFA 1QRXA 1OWIA 5GIBA 4WXIA 1TGTA 1BCUH 5AHGH 3SQHE 3TJUA 1K22H 1SI5H 2B5TB 3HKJB 2A5IA 3M5MA 1ZRKA 2RG3A 3VB6A 1GMDF 4ZUHA 4I32A 4Z6AH 1IHTH 2CN0H 1P2IA 1G36A 1V3XA 2P8OC 1C4V2 1O2PA 1EP6A 2SNWA 2ZDKA 4FU9A 4MNYA 3ZZDA 3QUMP 3MWIU 3ITIA 5DP9A 1GI6A 1S6HA 3LH3A 2P94A 4NCYA 1DXPA 3ATWA 5HXFA 1O3OA 3UPEA 3CENA 3MO3A 1ANCA 2ZTYA 4ZROA 2ZU4A 1VGCB 1YM0A 1DDJA 1TRYA 2BDCA 2ZDVH 4F49A 1E38B 3PO1C 3I29A 2BQ6B 1J14A 2Y5FA 2BDIA 3GY2A 1LO6A 1OKXA 4B1TA 3D23A 3RLYH 2R3YA 3Q3KA 1XUFA 4A1TA 4CRDA 3ZZ8A 2C93B 3S9BA 5H4IB 5HM9A 4QT8C 2DE8A 1MAYA 2ZDNA 3TNTA 2C8ZB 1KLJH 2ZHWH 5A0BA 3SU1A 2WV5A 1FY1A 1O5FH 5EQRA 1SB1H 1VITF 1BIOA 4ISLA 4KKDA 3ZZ6A 1F0RA 2SGDE 1WYKA 3RDZA 1B7XB 4NWKA 4TWYA 4LK4A 1MKWH 2HOBA 4Y7AA 1C5NH 1GBIA 5DG6A 4X2XA 1V2RT 4OGYA 4FUIA 3A8DA 1EZQA 2RCEA 1IQKA 2DE9A 3RXHA 3QO6A 1ZSLA 2XXLA 3A87A 4FUFA 2UUKB 4NIVA 2PKAB 1WCZA 2ZEBA 3GICB 1PPEE 4BNRA 1LHGH 3GCHB 2AIQA 4DT7B 3BTWE 3DHKH 3DA9B 3UQVA 4ASHA 3A83A 1GDQA 1ELFA 1O2XA 1MQ6A 3K6ZA 3KQEA 3M7TA 3FVFB 2BD8A 3SI4H 1GMDG 3W94A 2VJ1A 3T29A 3LGIA 3RXAA 1SGNE 3SJKA 3KL6A 1ZPBA 1A5HA 3UWIA 1ZHRA 1HGTH 1F2SE 5FPTA 3UR9A 1AUJA 1GDUA 3BF6H 1O2GH 2ODPA 1WV7H 2ZGHA 2G5NA 2GCTB 4UONA 4INLA 2Q6FA 3TK6A 4CRBA 5DO4H 3MO6A 1O31A 1F5RA 1NTPA 5CMXH 1LHEH 1BBRH 1C2JA 2C8YB 4X1QU 2BXUH 2QAAA 2BOKA 2VVCA 1FXYA 3S7HB 2XC4A 2VVVA 2BD4A 1QQUA 1XUIA 4Y71A 4GUXA 2A5AA 3GDSA 2STBE 1P2OA 1L1NA 1SHHB 1SGQE 3P95A 1SGPE 3QGNB 3H7OA 4ZHLU 1GJBB 4XBCA 1DWDH 3V7TA 4AX9H 2HVXA 2G55A 2VIPA 3ZZ5A 1BTYA 4FUEA 1JOUB 4XSKU 4U30A 4IC5A 4A92A 1GBFA 1SC8U 3MNSA 5DP3A 3P8GA 1JRSA 1GHWH 1YPGH 3D65E 3OX7U 3M5LA 5LPFA 4J1YA 2FYQA 3TVJB 1PPHE 5EQSA 2NU0E 4KTSA 1AFQB 1B0FA 4UFFH 2ZZUH 3HGPA 4BXWA 4IS5A 1IHSH 1K1IA 5AFYH 1O2ZA 3LKWA 4KELA 2QXJA 1FJSA 2ZGXH 1EAUA 1P3EA 2ZFTA 1DE7H 1WSSH 2ZCLP 3NWUA 1ELVA 3BTHE 1CA0B 1L1JA 1O3DA 3QX5H 1LKBA 2BM2A 3RXEA 2NU2E 1XMNB 1P03A 2HGTH 6ESTA 7GCHG 5C67A 3H5CB 3SOSA 2ASUB 3F9GA 2J95A 1QL7A 4AGKA 3MO9A 1TBQH 2BY5X 1CHOF 5E8EH 1GWAA 2ZCKP 1LHFH 1FAXA 3L6PA 1HXEH 4GVUA 2J4IA 5FCKA 3ZVAA 1GBTA 4I8HA 3A86A 1MTUA 3PWCA 2J34A 3SNDA 2VIWA 1A3EH 1ORFA 2F9BH 1AB9B 2A0QB 2ZA5A 1YPHC 2ESTE 2PR3A 4O97A 3Q3XA 3ZZ4A 1AI8H 2W7UA 1VZQH 2R2MB 1BA8B 4IW4E 1TPSA 1F92A 1ELDE 3UWJH 1A5GH 1ZJDA 3NZIA 3EA8A 5EODA 1T8NA