2ZFSA

Exploring trypsin s3 pocket
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cationic trypsin
publication title Congeneric but still distinct: how closely related trypsin ligands exhibit different thermodynamic and structural properties
pubmed doi rcsb
molecule tags Hydrolase/hydrolase inhibitor
total genus 54
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2008-01-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2zfsA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2zfsA02
3UOPA 3U69H 2ZEBA 4BAQB 1TX7A 3SO3A 2B7DH 1XKAC 3AVZA 3P8GA 2PTCE 4MPXA 1YPMH 2IPHA 1KLTA 4Y0YE 1V2NT 1BTWA 1O0DH 1THPB 1P04A 4B2BA 3A89A 1IQNA 3U98H 2TGPZ 1O3HA 4DG4A 1O2NA 1PQAA 5HMAA 1CA0C 4UDWH 1TALA 1SLVB 3BEUA 1BRBE 1CQQA 2G8TA 1SGDE 4UEHH 2VIPA 2FOBA 3M3SA 3UQVA 1TMBH 4UFDH 3ZVAA 4BXWA 1SGEE 2VWNA 3E8LA 3NZIA 2VH0A 1C9TA 3ZYDA 1T7CA 1PQ5A 4B76A 2RA0A 1BMNH 1SR5C 1XX9A 1O3MA 3BTWE 1QL8A 4X2XA 4DCDA 1SPJA 1XKBC 2TIOA 1YPKH 2Z7FE 1C1MA 3G01A 1ZJKA 2FP7B 2BM2A 1YF4A 5EQQA 4Y8XA 4ABIA 3ZVDA 1V2OT 3SU3A 1OWHA 1LHEH 4ZXYH 3SUFA 1HAIH 3O8CA 1G30B 1C2LA 2BDBA 4K69A 1GMCG 1TPPA 2XBWA 2TGAA 1A7SA 3OTJE 3U8OH 5CHAB 1GI3A 1MD8A 4YLUA 1VCQA 3VGCC 4K1TA 2AIPA 2VINA 3MH7A 4HTCH 1SI5H 3SJ8A 2HWLB 4WMDA 4YM9A 2C8XB 2Z6BD 3AW0A 3T62A 4Y8YA 4XOJA 3V7TA 4H42U 2TRMA 3BG8A 2PTNA 5C1XA 2J34A 5LPFA 3A80A 3MYWA 4AORA 2FS8A 2Q6DA 4K5ZA 1UHBB 2RA3A 2XCFA 1SGFA 3BG4C 2BD8A 1QRZA 1KDQB 3P6ZB 1Q31A 3M35A 5C1YA 2PUXB 1NRRH 3C1KA 1O3LA 1AGJA 1ZGIA 1W10U 2W26A 2ZKSA 1P09A 1P05A 2STAE 4UONA 3V13A 2XC0A 2QXGA 5FHTA 2HOBA 1FN8A 2ZC9H 3GY5A 2Z9LA 2BQ7B 3RXFA 3R3GB 1C9PA 1HBTH 6LPRA 1T8NA 2A5AA 2AERH 1LHGH 1P01A 2P59A 5F6MA 5K7RA 4I8GA 1YM0A 4FUBA 1GBMA 1OP8A 3PMHB 1TNKA 2G5VA 3OYPA 2QY0B 1K22H 1O37A 2QF3A 1TOMH 1HPGA 3DFLA 4F49A 2B8OH 2AFQB 2RG3A 1W8BH 2FXRA 1GCDA 1OOKB 5FCKA 2A45B 2GT8A 1DT2A 2XBYA 4Z6AH 1GBAA 5JBBS 1FI8A 1X7AC 1IQLA 1BBRE 1RGQA 2BDYA 2H5DA 4OS1A 6ESTA 1UVTH 1FNIA 1GBKA 1TNIA 5DJ7A 3ZZ3A 3LIWA 1KXCA 3HATH 1IQKA 2BQWB 1ANDA 4Y6DA 2W7SA 2ZFSA 1MTWA 3LPRA 1PYTD 3ELAH 4H6TA 1C2GA 1O3JA 3LGWA 3VB5A 1H8IH 1HIAB 1NFYA 1GGDC 2FTMA 3H5CB 4X6NA 1O2HA 3RXIA 1C1SA 3RXDA 2BMGB 4ZUHA 1KLJH 4OGYA 3KL6A 1ABIH 1O39A 4FUCA 5TCCA 3BN9A 1GI2A 2XWBI 4IC6A 1G2MA 2EA3A 2FOGA 1CBWC 5DKMA 5BPEA 1ZPBA 4MLFB 3U1IB 3A83A 1V2UT 1VGCC 4FU8A 3HK3B 4WY3A 1MTNB 1ZZZA 1ETRH 1C2JA 1ZHMA 1ETSH 3RXGA 1A46H 1C5UA 4FUDA 3UY9A 4AB8A 2FX6A 4GSOA 2ZTXA 4FVBA 3PLPA 1HYLA 1ZHPA 4YTAA 1AI8H 1DDJA 3BSQA 1G2LA 5B6OA 3M5LA 1AU8A 1VJ9U 3M7UA 1SLXB 1WU1A 1FY4A 1OWKA 2OC8A 3MHWU 4D7GA 1FJSA 1QRXA 1A1RA 2Z3DA 1AFEH 1KXDA 1THSH 2VIWA 1MKWH 1GI5A 3F9GA 3IITA 3SBKA 4JZDH 1PPEE 2YNAA 1MCTA 3CS7A 3MU5A 2WUCA 3QDZB 4INKA 3TH4H 2NU4E 2P94A 2ZGCA 5F8TA 2F83A 4Y11E 3VFEA 5C67A 1F0UA 3VEQB 1V2JT 1T8LA 1CHOF 4NIVA 1K1PA 3ODFA 2YNBA 1SGYE 1C1QA 2J92A 1O3FA 3NXPA 1QRWA 3GISB 3RDZA 4ZKOU 4I8KA 3FAOA 4X1PU 1EPTC 2JH5D 1SLUB 1Y3UA 5A09A 1O3AA 1LPZB 1SHYA 1SQOA 1BJUA 5DP3A 3SI4H 2FTLE 3U9AH 1D3QB 1YPEH 1BBRK 2GCTC 3T2NA 1KY9A 2F9UA 2VH6A 2GZ9A 1TFXA 1O2RA 2BY5X 1C5NH 2AMPA 2Z3CA 2TBSA 2BD4A 1DWEH 1BTHH 2OBOA 4NSYA 1CE5A 3FANA 2WPHS 1TGSZ 2O8MA 1Q3XA 2OQUA 1HCGA 3HKJB 4UE7H 3A7TA 3KN2A 2OP9A 2XRCA 1GBTA 4UD9H 2OUAA 1SG8B 4UFEH 3TJOA 1IHSH 2M5TA 2FOHA 3RP2A 1A4WH 1J14A 2LPRA 2BX3A 3PWBA 1JIRA 4RKOB 1WYKA 1UTPA 5C5OA 1DANH 4CR9A 1H1BA 2FS9A 5I25A 2BD2A 3GY3A 1EX3A 1YCPH 1AO5A 5C2ZA 2FYQA 1MTUA 1Z1IA 1KTTB 1GHAG 1GHAF 1NFXA 3ZZ7A 1EP5A 1GCTC 1WCZA 1WBGB 4DIHH 1BRAA 2SGFE 2Z9IA 2XXLA 3FVFB 3HGNA 3QUMP 2D26C 4AGKA 4X1QU 1HJ8A 1LMWB 2D2DA 3WY8A 2BTCE 3U8TH 1LVBA 1UJ1A 1QL9A 2FX4A 5GXPA 4E06H 5T6DA 3I29A 4O97A 3SUGA 1ACBE 1CGJE 3PMJA 1AD8H 1ARCA 3D23A 1C5RA 1P12E 4KP0A 4NGAH 1P9SA 4NIXA 1O2MA 2G81E 3M7QA 2HGTH 1E37B 2A2XH 1RIWC 3ZZAA 1F0TA 2C8WB 3EA9A 2ASUB 1F0SA 4TY6A 1AKSA 3M3TA 1O2GH 1Z6EA 1NTPA 3GCTG 1FQ3A 1N6XA 3GCTF 1IQIA 1SGNE 4ZKSU 3LGUA 2G51A 4LOYH 3ZVBA 1O30A 3PMBB 3GYLB 1BZXE 1BRCE 4H6SB 1T8OA 4KGAA 3MNSA 3RU4E 2I6SA 5E2OA 1Z8RA 1CVWH 1MBQA 3A7YA 5DP7A 4A92A 1UK4A 1SVPA 4B71A 2VIOA 2PKAB 1GL0E 1AUJA 1C5VA 1LKBA 1GHBG 5E8EH 4ZAEA 3QZRA 2NU1E 4IN2A 1Z8IB 2AGEX 5L30H 4TY7A 3I77A 1ELVA 2Q1JA 1HFDA 1C4U2 3E0NB 2AYWA 4JMYA 1A3EH 1BMLA 3LGVA 3ODDA 1MKXK 1QB1A 1O32A 2BD5A 2AEIH 1NRSH 1CA8B 2G5NA 3IG6B 4JYVH 2WPIS 3N7OA 1O5DH 3EA7A 4O03A 5GPIB 1GJ8B 1WSSH 5E0GA 1V2KT 4BAMB 1EZQA 3RXHA 1GDUA 1GPZA 3F1SB 5ETXA 7GCHF 1EKBB 1EAUA 2FOMB 4NG9H 5AF9H 1L0ZA 3LH3A 1SBWA 4BOHA 3GYMA 2D8WA 1PPGE 2OQ5A 5A0AE 1O3EA 2SGAA 1GBCA 1OP0A 2AGGX 1P2IA 2BB4A 2ANYA 4JZIA 1CU1A 1YPLH 1J16A 4K2YA 3L33A 1DITH 3MNBA 4DIIH 4D9RA 1FN6A 1LVOA 2GMTC 1S5SA 3W94A 2A4RA 5DP6A 4X8SH 3UUZA 1G9IE 5FBIA 5GCHG 1Z1JA 1H9HE 4JZ1A 1GJ6A 1HXEH 1C5ZB 4AG2A 1AFQC 3KQBA 1PFXC 2P3UB 1WUNH 4CRBA 4X1RU 1C1VH 2UWLA 2WUBA 1TGCA 1SGRE 1C2EA 1O5BB 2VWMA 1AUTC 1L4ZA 3M37A 3BG4B 2FPZA 3KNXA 3UNRA 3T27A 4IW4E 2WPLS 1XXDA 1LHFH 1ZR0A 1UCYK 1YC0A 5AHGH 4I32A 3P92A 4PROA 9ESTA 1T8MA 2WYJA 2IOTA 2P95A 3DHKH 1G36A 1GJ9B 5TCAA 3UWJH 1V2TT 1V6DA 2TPIZ 2ZU4A 4JK5A 3KF2A 3RXMA 1EOLA 2ZGXH 4JK6A 1F5KU 3R0FA 3MH4A 4OS2A 4ZHAA 1EXFA 2ZQ2A 1KXBA 4MNXA 4ISHH 1HXFH 2VIVA 2RDLA 1NM6A 4Q7XA 1GI6A 2ZGJA 1GJDB 1LVYA 2A5IA 3GCHC 1IQMA 1P10A 1TPAE 4AFQA 2A4QA 4JZEH 1P9UA 3UR9A 1DWCH 1PQ7A 2QA9E 2PGBB 1DPOA 1GL1A 1ZPCA 4B2AA 5GIBA 4YZUA 3JZ1B 1UTQA 1NU9A 2C8YB 3QO6A 4WMFA 2BOHB 5PTPA 1HGTH 4CRCA 1NC6A 1ZTJA 4LZ4B 1ZSJA 3D62A 2B5TB 2F9VA 1BTYA 3RC6A 4LZ1H 3MOCA 4INLA 3SHAH 1GGDB 3RU4D 1S6HA 1TNHA 8LPRA 1FPCH 1O2JA 1MCVA 4LXBH 1DWBH 1SGIB 2VGCC 1NS3A 1HAXB 1XVOA 3OY6U 2ODPA 4B73A 1AHTH 9LPRA 3RXEA 1LHCH 1Z8JB 2SGDE 1TQ7B 1MUEB 1S0QA 2SNWA 2JETC 1PPCE 1YKTA 4XFQA 4Y8ZA 3HK6B 1CBWB 1GBLA 1FPHH 4Y7BA 4X6OA 1FIWA 1TGTA 3SJOA 1O2PA 4Y76A 3SNDA 3NKKA 3SOSA 4CHAC 3SGAE 4X8UH 3NPSA 1OXGA 5E2PA 2A7JA 5E0JA 3BEIB 1CGIE 3SV9A 1ZMNA 1BT7A 2J95A 1G3BA 2QGRA 1E36B 2BDAA 4CREA 2YOLA 3MMGA 1JRSA 1C1RA 4XBCA 3U8RH 5HM9A 3LJOA 4K3JA 2R0LA 4Y10E 1DFPA 4D76A 1BHXF 1OWEA 1QURH 2JH0D 1QIXB 2CHAB 3Q3XA 1O2OA 2KAIA 3A82A 1JIMA 4IGDA 2EC9H 3RXQA 2C4FH 2ANKH 1ZMJA 3BTQE 5EXLA 1GMDG 3TGJE 2V0BA 2F9OA 1C1UH 3SUDA 2ZPSA 4BTIB 2KAIB 1YPHE 1ID5H 5HM2A 2ZU2A 1DS2E 4J1YA 1ESBA 1KXEA 1WTHD 1ANBA 5LPEA 1O2IA 1P3CA 2OINA 3MO9A 5JPMH 3A7ZA 5AVDA 4BXSA 4ABFA 8KME2 2ZG0H 4I33A 4E7RG 1OPHB 1O38A 1ZMLA 3ZV8A 1O2LA 1SFQB 1XMNB 1EPTA 1T32A 3VB4A 3E0PB 2P3TB 1GMCF 3A7VA 2FESH 4RN6A 2ESTE 5HXFA 1P2KA 1JRTA 2VJ1A 4GHTA 5K0HA 2VVUA 4WMEA 5ESTE 3TLOA 1BITA 2HNTF 3PMAB 1AVWA 5IYTA 1S83A 4ABHA 1DVAH 1SSXA 2GP9B 2ILNA 1NN6A 1YPHC 4CRFA 3TH3H 2HPQH 1SQTA 1XUFA 4VGCC 2ZGBH 1O2QA 1K28D 1P2NA 1BTPA 2THFB 3PLBA 2ZDKA 2XNIA 1T4VH 3GY7A 5CMXH 3GOVB 1E38B 2XBXA 2ZDAH 4AN7A 2ZDMA 1O5EH 4CBNA 5TJXA 4U30A 3V0XA 2QYIA 1SGTA 2PV9B 2J9NA 3BF6H 1MAXA 2FM2A 3D49H 3MO6A 1UVOA 2ALVA 1JMOH 1XUHA 2CMYA 4LK4A 3HGPA 5FPSA 1UO6A 1TNJA 3V12A 2A5KA 2R0KA 5L2ZH 1O3GA 2ZCLP 1MU8B 7ESTE 3TNTA 2OXSA 1W0ZU 1NU7B 1K1LA 4E7NA 1OS8A 3A8DA 3QLPH 1TA6A 3ZZ6A 2QCYA 4A1TA 5ABWA 3GDUA 2D1JA 1YLCA 1XUJA 1NO9H 1GJ4H 1GCTB 4TYDA 1TIOA 2W5EA 1EJNA 5EQRA 1VCPA 1DSUA 4MPVA 1OYTH 2NU2E 4NSVA 4YLQH 1B5GH 4NWKA 4ABBA 6GCHG 1VITH 3P8FA 6GCHF 1O2KA 1SGQE 1QJ1B 4DW2U 1C4V2 2AMQA 1NRQH 2ZHWH 4NFFA 1IAUA 3URDA 1TONA 2VVCA 1AQ7A 5SGAE 2PSXA 3F68H 4MVNA 1GMHG 4GHQA 3M5NA 1QB9A 1C5QA 3TNSA 1LQDB 4K8YA 1VZQH 1V2PT 1CSOE 8GCHG 2Y80A 8GCHF 4K1EA 2HNTE 1GBIA 1V2ST 3ESTA 1TAWA 1TGBA 1DY9A 1SL3A 2FZZA 1HV7A 2VVVA 2ZHFH 1NROH 1O3KA 1V2WT 1W12U 2IJOB 3LDXH 1MMJN 1AE8H 1BDAA 1Y8TA 2K1QA 4YOJA 1HAVA 2BD9A 3BEFB 5A8YA 1GVZA 2ZDNA 3RXJA 3TVJB 3UFAA 3GICB 4MPWA 4CRDA 2ZDVH 1AVXA 1QB6A 1CT0E 2GVFA 3E16B 1NT1A 1HAVB 4FUHA 4K60A 2A32A 1MAYA 2HNTC 1KXAA 2F9PA 2GKVE 3ATIA 2BXTH 1HAGE 5FCRA 2BY9X 1O3PB 2FOAA 3QGNB 2LNCA 1YLDA 2ZQ1A 2FOEA 4RKJB 3TJUA 4JYUH 3RXUA 1GI0A 1MZDA 5C1UA 1FV9A 1N6YA 3SV6A 1Y3WA 2WPMS 3SHCH 3SJKA 3GDVA 3SORA 1A2CH 3ZZ5A 3M3VA 2GCHG 2GCHF 3UTUH 2ZCHP 4X2YA 3SQHE 3SW2B 5DG6A 4FUFA 1SOZA 1G32B 2Q6FA 2GZ7A 1K2I1 1THRH 3PROA 1AVGH 4ISOA 5DK1A 1KLIH 3PTNA 1Y5BT 4O9VA 2GMTB 2ZU5A 2GDDA 3KEEA 1YCPK 2R3YA 5BRRE 4NZLA 4OS6A 5EU8A 3P8OA 4UFGH 1GI4A 4M7GA 3HKIB 2EI8A 1GBBA 3V3MA 5JBCS 2BDCA 1UTMA 3SV7A 3ZVEA 1OWJA 5F03A 2QXIA 1U6QA 1HAOH 1C2FA 3KHVA 5JBAS 5IDKA 1J17T 1P2OA 1QHRB 2FWWA 4AB9A 2IN2A 2ZF0H 4FUEA 2EI6A 2DE8A 2V35A 3PYHA 2HVXA 3L6PA 5FXLA 4OS7A 5A0CA 1O2TA 1J15A 1B0EA 1FY3A 4CBOA 3KCGH 2H6MA 4MG3A 4O3UA 1A5HA 5C5NA 1O3IA 1ELTA 5JYIA 4GCHG 4XBDA 3RXRA 4HFPB 2UUYA 1IQHA 2FO9A 1K9OE 2WPJS 2J2UA 1TNGA 1P02A 3GY2A 3RXPA 4FUJA 1LKAA 4ISNA 1EUFA 3RXVA 4K1SA 3MH5A 1P2QA 3BTHE 3GCHB 1C5WB 5EXNA 5GDSH 1GI7B 1AY6H 1L2EA 1FIZA 1P03A 2ZA5A 2J38A 4IC5A 2A7CA 1ELBA 3SU0A 1EOJA 1T31A 4NIYA 3UOUA 1WAYB 1O5CB 4MNYA 1O3CA 1DM4B 1UTNA 5FPYA 1AB9B 2CJIA 1BCUH 4MDSA 1D6WA 4INHA 5ESBA 1ELFA 2XYAA 4CRGA 3SJ9A 1EASA 2BZ6H 4NFEA 2F9NA 1TYNA 2P93A 5EQSA 2UUFB 2O9QA 4GVUA 1TB6H 4Q7ZA 2EI7A 2BYAX 1O3DA 1ELCA 5HYOA 2CF9H 4KELA 2GT7A 1UTJA 2VGCB 4IS5A 1XXFA 1S0RA 2FLBH 4O3TA 1HRTH 2XCNA 3O8RA 2J4IA 2FEQH 1BB0B 1GBEA 2JETB 5DP8A 3M5MA 1AKSB 2VWLA 3RXBA 3RXLA 3K6YA 1A0LA 1C1TA 3BTKE 4Y71A 5DO4H 3A87A 3BTEE 2OC0A 3A81A 4X6MA 1UVPA 2Z94A 1V2VT 4I8HA 1GHBF 1M9UA 3M36A 1E34B 2Q6GA 3SU5A 1Y5UT 4I8LA 3E1XB 2ZDLA 1MTNC 3PWCA 2FLRH 3PLKA 2V6NA 1CA0B 1NRNH 1O2VA 4NIWA 1MZAA 1K1MA 3Q76A 2VWOA 2GTBA 2G52A 3T26A 3K2UA 3RM0H 1C5XB 5F8ZA 3T5FH 4D9QA 4IBLH 4Q2KA 3S9CA 3RXTA 3BTME 4X0WU 1ELAA 4Q7YA 2XC5A 1MH0A 1RS0A 1IOEA 3RMNH 3Q00A 1WTGH 3TGKE 1AMHA 1BTUA 3D65E 1KXFA 5E0HA 1QFKH 4F4OC 1TPSA 4X2VA 3PTBA 3UIRA 2AMDA 3MU4A 5LH8A 2ZTYA 1LDTT 2BVSH 4FU9A 1PQ8A 3LJJA 1VITG 1VITF 1RFNA 2G4TA 1W13U 5JDUB 1TGNA 4YO9A 2CV3A 4DOQA 3ZZCA 2OD3B 4Y7AA 3MTYA 4KTSA 1OWIA 3VGCB 4DURA 1Z6JH 4X2WA 1PPHE 3LOXA 2Y7XA 2UUKB 6CHAC 1DX5M 1SQAA 2R2MB 1BMMH 1NY22 5GCHF 4BTTB 1F5LA 1EB2A 1C4Y2 4U2WA 1QL7A 1EJAA 2A0QB 3EAJA 1AZ8A 1Y5AT 7KMEH 4I7YH 1K21H 4YESB 1NFUA 1H9LB 1O2YA 1UTLM 1ZTKA 2QN5T 2ZFFH 3E6PH 1RJXB 1Z71A 2F91A 4B75A 5T6FA 4BAOB 1G3CA 2VIDA 3SNEA 1ZSLA 1GHVH 1TX6A 2P16A 1Y3XA 1H9IE 2AH4X 3NCLA 1VR1H 2Y5GA 1GG6C 1A3BH 1EZSC 1QR3E 3VB6A 2QXJA 1K1JA 2ODYB 2SGQE 5CE1A 1EZXC 3KIDU 1RXPA 5EW2H 4ZKRU 2R9PA 1C5MD 1IQGA 4GPGA 1A0JA 1BJVA 1TOCB 1W7XH 5FPTA 4IMZA 2OBQA 2NWNA 5DP5A 3SNAA 1KYNA 2AS9A 3ZZ8A 1ABJH 1TLDA 2ANMH 2CF8H 4JCNA 5EOKA 2PLXA 2A7HA 1LQEA 4QT8C 1GHYH 1SC8U 1BA8B 3JZ2B 1WQSA 5C3NA 1PPZA 1P3EA 4ISLA 3BV9B 4ASHA 3ZVFA 1TMTH 4GUXA 5T3HA 2DUCA 2B0FA 1QA7A 1UK3A 1FXYA 1V2RT 2ZO3H 2O8LA 2WYGA 1UMAH 3TU7H 1QQ4A 2ZWLH 4AYVB 1ANCA 2Y81A 2VNTA 2ZU3A 1GDNA 1QQUA 4Y0ZE 1BHXB 3S0NA 2QAAA 1DY8A 2PFEA 1FAXA 1O35A 1G37A 1GI1A 4A1XA 4KKDA 3BTDE 4AZ2B 1UCYH 4A5TS 2STBE 2UUJB 4ABDA 1O2ZA 1UTOA 1IQFA 1DSTA 1AWFH 4NA7A 2NU0E 1GBFA 1FY5A 3SJIA 1ZLRA 1C2IA 3ZZ9A 1VGCB 1SLWB 4R0IA 1XM1A 3UNSA 4DVAU 2CN0H 2SGEE 3TH2H 2UWPA 1MD7A 2H2ZA 1FAKH 1HJAC 1V2LT 4JZFH 2BVRH 3A84A 3UREA 1DUEA 4WWYA 1N1LA 1ELEE 1J9CH 5JB8S 1ETTH 2HLCA 4ZMAH 3GY8A 4ESTE 2OC1A 3S7KB 1V2MT 2PR3A 1RD3B 1YPJH 2V3OH 3ATKA 3AW1A 1FY1A 2HALA 3NWUA 3UPEA 1EAXA 3S69A 3KGPA 1BQYA 3O8DA 1GMDF 3PB1E 1QCPA 1TBRH 2ZHQH 3LGIA 1ANEA 2ZPRA 4ZXXH 2GV6A 5A8XA 4B1TA 1F5RA 2VU8E 3P17H 5F8XA 1WQVH 1BRUP 2FI4E 1G3EA 3S9BA 1BMAA 5AFYH 1FMGA 1PYTC 3B9FH 3MH6A 3EA8A 3RXCA 1HNEE 3LGYA 2FDAA 4YOIA 3A88A 3Q3YA 3SU1A 4YT6H 2ZNKH 3SU4A 3PO1C 4B2CA 5JBTA 1EPTB 1GHZA 4WVPE 3ZVCA 1P0SH 2DE9A 1MTSA 3QK1A 1AZZA 2PKSC 1GJCB 2Y6TA 4Y79A 4AFSA 1A61H 2GX4A 3EYDA 1D4PB 1GJ5H 3BTGE 2O8WA 1RTFB 2GCTB 3A86A 2PGQB 4XE4A 4X8VH 1DXWA 1C1PA 3LU9B 2BLWA 3LGTA 3MO3A 1TWXB 3RU4T 1HAYB 3LKWA 4KTCA 4A7IB 3QTOH 3E91A 3ZVGA 1UHBA 4FUIA 1TNLA 1JXPA 1UK2A 1UTKA 4DJZB 2W3IA 4THNH 1KDQA 1QA0A 2C3SA 1HDTH 4XSKU 1P2JA 2XW9A 1MQ5A 1MU6B 1W7GH 4H4FA 4TWWA 2OCVB 1SGCA 1ZOMA 1JOUB 3MWIU 2A1DB 1O3NA 2ZFRH 1S84A 2ZZUH 3QN7A 3RXOA 4IMQA 1D3DB 4WXIA 1C5OH 5FX6A 1RTKA 1SHHB 2BOKA 1HLTH 3GY6A 1ARBA 3AAUA 4MQAA 5FX5A 1W0YH 2OC7A 2ZCKP 3MNXA 1BTXA 3OSYA 1EZUC 1GVLA 1C1WH 2Y5HA 1L1NA 3A7XA 1A5GH 3RLYH 4HGCA 1TE0A 4RSPA 2C93B 3M61U 4BANB 1EATA 2ZHDA 3EQ0H 1NESE 5C20A 3T28A 2O8UA 3P70B 5EW1H 4I8JA 2PW8H 3RUOA 1QTFA 4DT7B 3BIVH 1XVMA 5LPRA 1FLEE 2TGDA 3SQEE 1C5LH 4ABGA 1INCA 2BVXH 2H9HA 2H9EH 4K8BA 2XWAA 3KQDA 1GMHF 2BQ6B 3E90B 2BD7A 3KQEA 3Q77A 2Y5FA 2GDEH 1HIAA 2P8OC 3O8BA 1SGFG 1ELGA 1P2MA 2ZPQA 1LPKB 1RIWB 1N8OC 1S81A 3TK5A 1MKWK 1WV7H 1W14U 3SGBE 1L4DA 3CENA 1TABE 1UVUH 4OS5A 1W11U 2HRVA 2SGPE 3STJA 4TPIZ 2BHGA 2HPPH 2ZFTA 2A2QH 3ATMA 2H9TH 1W2KH 1F7ZA 3F6UH 2UWOA 4DGJA 1Z8GA 4ABJA 2R3UA 3K65B 2BLQA 3EE0B 2BLVA 1P8VC 3ZZ4A 4BNRA 2FOFA 3ATWA 1QBVH 3RM2H 1EQ9A 1K1OA 3RC4A 1YCPM 3MU1A 1C5TA 2Z9GA 1J8AA 1O31A 4OS4A 4I31A 3SNCA 1TRYA 3MU0A 1DXPA 1C5PA 4XBBA 1RTLA 1JWTA 1HAHH 4TPYA 1E0FD 4ZKNU 1IQJA 2CHAC 2XC4A 2ODQA 3C27B 3FP7E 3MNCA 2OLGA 5EXMA 5EG4A 3VB3A 2FOCA 5FAHA 1KSNA 3TJNA 1O5AB 3AAVA 1SOTA 4AX9H 1Q2WA 1QBNA 2I6QA 2XTTB 3L3TA 5EODA 4WH8A 2GV7A 1NFWA 3PV4A 4WH6A 3HPTB 3OX7U 2WINI 3TK9A 1TQ0B 1HJ9A 1O5FH 1D6RA 2Z3EA 4YOGA 4KTUA 4WF8A 4E05H 1QGFA 3F9EA 1VCWA 2PHBA 1C2KA 2XBVA 1YP9A 5GWZA 3ZV9A 5EPYA 2FI5E 3TIUA 2BX4A 2H1UA 2GZ8A 1PJPA 1CHOG 4U32A 4SGAE 3LC5A 6CHAB 5CHAC 3AASA 2BY8X 3RC5A 1YYY1 1AFQB 1LVMA 2WV5A 2VIQA 1O2SA 4A1VA 1FDPA 5EPNA 1HB0B 1L1GA 4FU7A 3W95A 2JH6D 2SFAA 4X6PA 4CR5A 2NU3E 4MNWA 1OSSA 1V2QT 1EP6A 3SU2A 2PUQH 2G4UA 4YT7H 1O2UA 5A8ZA 4UFFH 3DD2H 1P11E 3B23B 1QJ6B 4D8NA 1ZRBA 2AGIX 5G4BA 2A4GA 4GCHF 1ZPZA 1AN1E 1H8DH 1KIGH 1P57B 3A8CA 4WXVA 3SV2H 1GG6B 3TITA 3RMOH 1CT2E 4ABEA 5L2YH 2C8ZB 2BDHA 1NPMA 3UQOA 1S6FA 1BIOA 2GGVB 3K6ZA 3A8AA 1DWDH 3A85A 1PPBH 3LH1A 3NK8A 5AFZH 2GD4B 3QTVH 1O36A 3RXSA 1TRNA 1YGCH 3KQCA 3LC3A 4ISIH 1D3PB 3ZZBA 1TRMA 3B8JA 1TX8A 3SNBA 2ZFQH 1SGPE 1MQ6A 1NRPH 1XUIA 1CT4E 2ZTZA 4GLYA 1FY8E 1ZHRA 1C2MA 1EB1H 5HGGA 4ZHLU 1S82A 4BTUB 1BBRH 3SGQE 3M5OA 4ZROA 1B7XB 2SNVA 3ATLA 3MI4A 4HI3A 3SV8A 1C5SA 3EDXB 3TGIE 1GJ7B 1VJAU 5J4QA 4XDEA 1ZTLA 2BZAA 5JB9S 1F2SE 3T29A 2ANWA 1QY6A 2FMJA 1T4UH 4FXGH 3ZZDA 3QGJA 3NUMA 4MNVA 1ZJDA 5I46H 1C1NA 3DUXH 1PPFE 4AFZA 5GJ4B 2R2WU 1O2XA 1SMFE 4CRAA 1B0FA 3VB7A 1JBUH 1Y3VA 3LT3A 2CXVA 3DA9B 4TWYA 2FYRA 3S9AA 3GY4A 3ITIA 8ESTE 2F3CE 1GBHA 3P95A 1V3XA 1QJ7B 1FZZA 5FBEA 4CHAB 1UCYE 1CO7E 1YBWA 3QZQA 3IWMA 3BIUH 4BAHB 1QNJA 3URCA 1TBQH 4NCYA 1KTSB 1HJAB 3SZNA 1OKXA 1Z7KA 1ESAA 3F9HA 4CH8B 2PKAA 1HAPH 1D3TB 3P8NA 4CH2B 1UVSH 4JYTA 3T25A 2QXHA 1ZRKA 3ENSB 2QIQA 1TMUH 4MPUA 3BTFE 1GHXH 1HAZB 1K1IA 1W3CA 1GBJA 1S85A 2OTVA 3MU8A 4Z0KA 3RMMH 2W3KA 1TPOA 2RCEA 2WV4A 1F0RA 1E35B 1GI9B 1SFIA 3EGKH 5H4IB 1C2HA 2ZI2H 4R8TB 4IN1A 2FI3E 1OX1A 2ZIQH 3A7WA 4AOQA 1NZQH 4FVDA 4U01A 3FP6E 1EJMA 1ELDE 2V3HH 2BDGA 3E3TA 4J2YB 3UNQA 4AFUA 1GJBB 1IQEA 3K9XB 3SI3H 5T6GA 3TJVA 1DLEA 1GJAB 3RLWH 4HZHA 7GCHG 2EEKA 3TPIZ 2P3FH 1CGHA 2CGAA 1C5YB 4A6LA 1BOQA 1ZYOA 3PO1B 2ALPA 2JKHA 2PSYA 3DT0H 5LGOA 4NA8A 2AIQA 2Z9KA 3FZZA 2WPKS 2BD3A 2PKSB 1GBDA 2QC2A 2QF0A 4VGCB 3BTTE 3RXKA 1O3BA 2QV1A 3I78A 1EAWA 2J94A 3VXFH 2F9BH 4ABAA 1LTOA 1ESTA 3FZDA 3DFJA 1AWHB 3FP8E 1MKXH 1ORFA 4WJG2 1C1OA 2VB0A 1SB1H 2BDIA 5EGMA 1C2DA 3CS0A 1DE7H 3MFJA 1OYQA 1MTVA 5DPAA 3SU6A 2C90B 2Z9JA 4NWLA 1LO6A 1ZSKA 1O5GH 2Y7ZA 3RMLH 4NZQA 3GCOA 4GAWA 4Q80A 4X1SU 1O33A 3A8BA 1Y3YA 1P06A 1GI8B 4AYYB 1YPGH 3UWIA 2BLOA 1LCYA 1XUKA 1L1JA 1FUJA 7LPRA 2ZFPH 3TK6A 3VPKA 1LHDH 2A4OA 1K1NA 5DP9A 2ZU1A 2FIRH 4X1NU 1G3DA 3VXEH 1GHWH 2BY6X 3OY5U 1WOFA 4B74A 3RXAA 1XUGA 2G00A 3Q3KA 4OGXA 3SN8A 4NA9H 1DLKB 1OP2A 4ZHMU 4MTBA 1TBZH 3UR6A 2W7UA 1H4WA 2BY7X 3H7OA 1GVKB 3M7TA 2FODA 2B9LA 2A31A 4AGJA 1AE5A 1HUTH 1IHTH 2ZECA 1QBOA 4BAKB 1BUIA 1GWAA 5L6NH 1Y59T 3H7TA 1DOJA 5A0BA 1MBMA 2BXUH 2P8OB 2ZGHA 4ZH8A 3STIA 1A5IA 5J4SA 1AB9C 2H5CA 4X8TH 3U1JB 2ZHEH 1TA2A 2PWXA 1N8OB 2TGTA 4D7FA 1ZGVA 1LPGB 3CP7A 4SGBE 1O3OA 1O34A 1DICA 1FONA 1CHGA 2G55A 1A0HB 1OWDA 5DGJA 3SUEA 2ZP0H 3OU0A 3ZYEA 1BTZA 1D9IA 3F9FA 5DP4A 1GDQA 1EAIA 1RRKA 2Y82A 4FUGA 2ULLA 3GCNA 1DUAA 4AG1A 1AIXH 5A2MH 2O8TA 1O2WA 4DY7B 3S7HB 3PM3A 1F92A 3LONA 3GDSA 3QWCH 3FFGA 3QX5H
chains in the Genus database with same CATH superfamily
3UOPA 3U69H 2ZEBA 4BAQB 1TX7A 3SO3A 1WDIA 2B7DH 1XKAC 3AVZA 1SKYE 3W1EA 3P8GA 2PTCE 2KCOA 4FETA 4MPXA 1YPMH 2IPHA 2WZQA 1KLTA 4Y0YE 1V2NT 1BTWA 1O0DH 1THPB 1P04A 4B2BA 3A89A 2VBCA 1IQNA 3U98H 2TGPZ 1O3HA 4DG4A 1O2NA 1PQAA 5HMAA 1CA0C 4UDWH 1TALA 1SLVB 3BEUA 1BRBE 1CQQA 2G8TA 1SGDE 4UEHH 2HLDD 2VIPA 2FOBA 3M3SA 3UQVA 1TMBH 4UFDH 3ZVAA 4BXWA 1SGEE 2VWNA 3E8LA 3NZIA 2VH0A 1C9TA 3ZYDA 1T7CA 1PQ5A 4B76A 2RA0A 1BMNH 1SR5C 1XX9A 1O3MA 3BTWE 1QL8A 4X2XA 4DCDA 1SPJA 1XKBC 2TIOA 1YPKH 2Z7FE 1C1MA 3G01A 1ZJKA 2FP7B 2BM2A 1YF4A 5EQQA 4Y8XA 4ABIA 3ZVDA 1V2OT 5DN6D 3SU3A 1OWHA 1LHEH 4ZXYH 2J5UA 3SUFA 1HAIH 3O8CA 1G30B 1C2LA 2BDBA 4K69A 1GMCG 1TPPA 2XBWA 3OE7D 4F55A 2TGAA 1A7SA 3OTJE 3U8OH 5CHAB 1GI3A 1MD8A 2W6ID 4YLUA 1VCQA 3VGCC 4K1TA 2AIPA 2VINA 3MH7A 4HTCH 1SI5H 3SJ8A 2HWLB 4WMDA 4YM9A 2C8XB 2Z6BD 3AW0A 3T62A 4Y8YA 4XOJA 3V7TA 4H42U 2TRMA 3BG8A 2PTNA 5C1XA 2J34A 5LPFA 3A80A 3MYWA 4AORA 2FS8A 2Q6DA 4K5ZA 1UHBB 2RA3A 3N99A 2XCFA 1SGFA 3BG4C 2BD8A 1QRZA 1KDQB 3P6ZB 1Q31A 3M35A 3KYFA 5C1YA 2PUXB 1NRRH 3C1KA 1O3LA 1AGJA 1ZGIA 1W10U 2W26A 2ZKSA 1P09A 1P05A 2STAE 4UONA 3V13A 2XC0A 2QXGA 5FHTA 4FOUC 2HOBA 1FN8A 2ZC9H 3GY5A 2Z9LA 2BQ7B 3RXFA 3R3GB 1C9PA 1HBTH 6LPRA 1T8NA 2A5AA 2AERH 1LHGH 1P01A 2P59A 5F6MA 5K7RA 4I8GA 1YM0A 4FUBA 1K0HA 1GBMA 1OP8A 3PMHB 1TNKA 2G5VA 3OYPA 2EY4C 2QY0B 1K22H 1O37A 2QF3A 1TOMH 1HPGA 3DFLA 4F49A 2B8OH 2AFQB 2RG3A 3PV2A 1W8BH 2FXRA 1GCDA 1OOKB 5FCKA 2A45B 2GT8A 1DT2A 3N7EA 2XBYA 4Z6AH 1GBAA 5JBBS 1FI8A 1X7AC 1IQLA 1BBRE 1RGQA 2BDYA 2H5DA 4OS1A 6ESTA 1UVTH 1FNIA 1GBKA 1TNIA 5DJ7A 3ZZ3A 3LIWA 1KXCA 3HATH 1IQKA 2BQWB 4XD7D 1ANDA 4Y6DA 2W7SA 2ZFSA 1MTWA 3LPRA 1PYTD 3ELAH 4H6TA 1C2GA 1O3JA 3LGWA 3VB5A 1H8IH 1HIAB 1NFYA 1GGDC 2FTMA 3H5CB 4X6NA 1O2HA 3RXIA 1C1SA 3RXDA 5KEDA 2BMGB 4ZUHA 1KLJH 4OGYA 2L6OA 3KL6A 1ABIH 1O39A 4FUCA 5TCCA 3BN9A 1GI2A 2XWBI 4IC6A 1G2MA 2EA3A 2FOGA 1CBWC 5DKMA 5BPEA 1ZPBA 4MLFB 3U1IB 3A83A 1V2UT 1VGCC 4FU8A 3HK3B 4WY3A 1MTNB 1ZZZA 1ETRH 1C2JA 1ZHMA 1ETSH 3RXGA 1A46H 1C5UA 4FUDA 3UY9A 4AB8A 2FX6A 4GSOA 2ZTXA 4FVBA 3PLPA 1HYLA 1ZHPA 4YTAA 1AI8H 1DDJA 3BSQA 1G2LA 5B6OA 3M5LA 1AU8A 1VJ9U 2QF4A 3M7UA 1SLXB 1WU1A 1FY4A 1OWKA 2OC8A 3MHWU 4D7GA 1FJSA 1QRXA 1A1RA 2Z3DA 1AFEH 1KXDA 1THSH 2VIWA 1MKWH 1GI5A 3F9GA 3IITA 3SBKA 4JZDH 1PPEE 2YNAA 1MCTA 3CS7A 3MU5A 2WUCA 3QDZB 4INKA 3TH4H 2NU4E 2P94A 2ZGCA 3CNRA 5F8TA 2F83A 4Y11E 3VFEA 5C67A 1F0UA 3VEQB 1V2JT 1T8LA 1CHOF 4NIVA 1K1PA 3ODFA 2YNBA 1SGYE 1C1QA 2J92A 1O3FA 3NXPA 1QRWA 3GISB 3RDZA 4ZKOU 4I8KA 3FAOA 4X1PU 1EPTC 2JH5D 1SLUB 1Y3UA 5DSFA 5A09A 1O3AA 1FX0B 1LPZB 1SHYA 1SQOA 1BJUA 5DP3A 3SI4H 2FTLE 3U9AH 1D3QB 1YPEH 1BBRK 2GCTC 3T2NA 1KY9A 2F9UA 4RT0A 2VH6A 2GZ9A 1TFXA 1O2RA 2BY5X 1C5NH 2AMPA 2OK5A 2Z3CA 2TBSA 2BD4A 1DWEH 1BTHH 2OBOA 4NSYA 1CE5A 3FANA 2WPHS 1TGSZ 2O8MA 1Q3XA 2OQUA 1HCGA 3HKJB 4UE7H 3A7TA 3KN2A 2OP9A 2XRCA 1GBTA 4UD9H 2OUAA 1SG8B 4UFEH 3TJOA 1IHSH 2M5TA 2FOHA 3RP2A 1A4WH 1J14A 2LPRA 2BX3A 3PWBA 1JIRA 4RKOB 1WYKA 1UTPA 5C5OA 1DANH 4CR9A 1H1BA 2FS9A 5EJLA 1H8HD 5I25A 2BD2A 3GY3A 1EX3A 1YCPH 1AO5A 5C2ZA 3PRBA 2FYQA 1MTUA 1Z1IA 2RDEA 1KTTB 1GHAG 1GHAF 5CHBA 1NFXA 3ZZ7A 1EP5A 1GCTC 1WCZA 1WBGB 4DIHH 1BRAA 2SGFE 2Z9IA 3EE7A 2XXLA 3FVFB 3HGNA 3QUMP 2D26C 2WSSD 4AGKA 4X1QU 1HJ8A 1LMWB 2D2DA 3WY8A 2BTCE 3U8TH 1LVBA 1UJ1A 1QL9A 3DCLA 2FX4A 5GXPA 4E06H 5T6DA 3I29A 4O97A 3SUGA 1ACBE 1CGJE 3PMJA 1AD8H 1ARCA 3D23A 1C5RA 1P12E 4KP0A 4NGAH 1P9SA 4NIXA 1O2MA 2G81E 3M7QA 2HGTH 1E37B 2A2XH 1RIWC 3ZZAA 1F0TA 2C8WB 3EA9A 2ASUB 1F0SA 4TY6A 1AKSA 3M3TA 1O2GH 1Z6EA 1NTPA 3GCTG 1FQ3A 1N6XA 3GCTF 1E1RD 1IQIA 1SGNE 4ZKSU 3LGUA 2G51A 4LOYH 3ZVBA 1O30A 3PMBB 3GYLB 1BZXE 1BRCE 4H6SB 1T8OA 4KGAA 3MNSA 3RU4E 2I6SA 5E2OA 1Z8RA 1CVWH 1MBQA 3A7YA 5DP7A 4A92A 1UK4A 1SVPA 4B71A 2VIOA 2PKAB 1GL0E 1AUJA 1C5VA 1LKBA 1GHBG 5E8EH 4ZAEA 3QZRA 2NU1E 4IN2A 1Z8IB 2AGEX 5L30H 4TY7A 3I77A 1ELVA 2Q1JA 1HFDA 1C4U2 3E0NB 2AYWA 4JMYA 1A3EH 1BMLA 3LGVA 3ODDA 1MKXK 1QB1A 1O32A 2BD5A 2AEIH 1NRSH 1CA8B 2G5NA 3IG6B 4JYVH 2WPIS 3N7OA 1O5DH 3EA7A 4O03A 5GPIB 1GJ8B 1WSSH 5E0GA 1V2KT 4BAMB 1EZQA 3RXHA 1GDUA 1GPZA 3F1SB 5ETXA 5F53A 7GCHF 5HIYA 1EKBB 1EAUA 2FOMB 4NG9H 5AF9H 1L0ZA 3LH3A 1SBWA 4BOHA 3GYMA 2D8WA 3FO8D 1PPGE 2OQ5A 5A0AE 1O3EA 5C94A 2SGAA 1GBCA 1OP0A 2AGGX 1P2IA 2BB4A 2ANYA 4JZIA 1CU1A 1YPLH 1J16A 4K2YA 3L33A 1DITH 3MNBA 5B6LA 4D9RA 1FN6A 1LVOA 4DIIH 2GMTC 1S5SA 3W94A 2A4RA 4ASUD 5DP6A 4X8SH 3UUZA 1G9IE 2W6JD 5FBIA 5GCHG 1Z1JA 1H9HE 4JZ1A 1GJ6A 1HXEH 1C5ZB 4AG2A 1AFQC 3KQBA 1PFXC 2P3UB 1VKYA 1WUNH 4CRBA 4X1RU 1C1VH 2UWLA 2WUBA 1TGCA 1SGRE 1C2EA 1O5BB 2VWMA 1AUTC 1L4ZA 3M37A 3BG4B 2FPZA 3KNXA 3UNRA 3T27A 4IW4E 2WPLS 1XXDA 1LHFH 1ZR0A 1UCYK 1YC0A 5AHGH 4I32A 2KCAA 3P92A 4PROA 9ESTA 1S6LA 1T8MA 2WYJA 2IOTA 2P95A 3DHKH 1G36A 1GJ9B 5TCAA 3UWJH 1V2TT 1V6DA 2TPIZ 2ZU4A 4JK5A 3WWBA 3KF2A 3RXMA 1EOLA 2ZGXH 4JK6A 1F5KU 3R0FA 3MH4A 4OS2A 4ZHAA 1EXFA 2ZQ2A 1KXBA 4MNXA 4ISHH 1HXFH 2VIVA 2RDLA 1NM6A 4Q7XA 1GI6A 2ZGJA 1GJDB 1LVYA 2A5IA 3GCHC 1IQMA 1P10A 1TPAE 4AFQA 2A4QA 4JZEH 1P9UA 3UR9A 1DWCH 2GJGA 1PQ7A 2QA9E 2PGBB 1DPOA 1GL1A 1ZPCA 4B2AA 5GIBA 4YZUA 3JZ1B 1UTQA 1NU9A 2C8YB 3QO6A 4WMFA 2BOHB 5PTPA 1HGTH 4CRCA 1NC6A 1ZTJA 4LZ4B 1ZSJA 3D62A 2B5TB 2F9VA 1BTYA 3RC6A 4LZ1H 3MOCA 4INLA 3SHAH 1GGDB 3RU4D 1S6HA 4ZCNA 1TNHA 8LPRA 1FPCH 1O2JA 1MCVA 4LXBH 1DWBH 1SGIB 2VGCC 1NS3A 1HAXB 1XVOA 3OY6U 2ODPA 4B73A 1AHTH 9LPRA 3RXEA 1LHCH 1Z8JB 2SGDE 1TQ7B 1MUEB 1S0QA 2SNWA 2JETC 1PPCE 1YKTA 4XFQA 4Y8ZA 3HK6B 1CBWB 1GBLA 1FPHH 4Y7BA 4RT1A 1FIWA 4X6OA 1TGTA 3SJOA 1O2PA 4Y76A 3SNDA 3NKKA 3SOSA 4CHAC 3SGAE 4X8UH 3NPSA 1OXGA 5E2PA 2A7JA 5E0JA 3BEIB 1CGIE 3SV9A 1ZMNA 1BT7A 2J95A 1G3BA 2QGRA 1E36B 2BDAA 4CREA 2YOLA 3MMGA 1JRSA 1C1RA 4XBCA 3U8RH 5HM9A 3LJOA 4K3JA 2R0LA 4Y10E 1DFPA 4D76A 1BHXF 1OWEA 1QURH 2JH0D 1QIXB 2CHAB 3Q3XA 1O2OA 2KAIA 3A82A 1JIMA 4IGDA 2EC9H 3RXQA 2C4FH 2ANKH 2EQNA 1ZMJA 3BTQE 5EXLA 3ZIAD 1GMDG 1YLNA 2K0QA 3TGJE 2V0BA 2F9OA 1C1UH 3SUDA 2ZPSA 4BTIB 2KAIB 1YPHE 1ID5H 5HM2A 2ZU2A 1DS2E 4J1YA 1ESBA 1KXEA 1WTHD 1ANBA 5LPEA 1O2IA 1P3CA 2OINA 3MO9A 5JPMH 3A7ZA 5AVDA 4BXSA 4Q4LA 4ABFA 8KME2 2ZG0H 4I33A 4E7RG 1OPHB 1O38A 1ZMLA 3ZV8A 1O2LA 1SFQB 1XMNB 1EPTA 1T32A 3VB4A 3E0PB 2P3TB 1GMCF 3A7VA 2J98A 2FESH 4RN6A 2ESTE 5HXFA 1P2KA 1JRTA 3OFND 2VJ1A 4GHTA 5K0HA 2VVUA 3PRDA 4WMEA 5ESTE 3TLOA 1BITA 2HNTF 3PMAB 1AVWA 5IYTA 1S83A 4ABHA 1DVAH 1SSXA 2GP9B 2ILNA 1NN6A 1YPHC 4CRFA 5KECA 1E79D 3TH3H 2HPQH 1SQTA 1XUFA 4VGCC 2ZGBH 3F3BA 4YXWD 1O2QA 1K28D 1P2NA 1BTPA 2THFB 3PLBA 2ZDKA 2XNIA 1T4VH 3PV5A 3GY7A 5CMXH 3GOVB 1E38B 2XBXA 2ZDAH 4AN7A 2ZDMA 1O5EH 4CBNA 5TJXA 4U30A 3V0XA 2QYIA 3WWFA 1SGTA 2F4LA 2PV9B 2J9NA 3BF6H 1MAXA 5C0TA 1MABB 2FM2A 3D49H 3MO6A 1UVOA 2ALVA 1JMOH 1XUHA 2CMYA 4LK4A 3HGPA 5FPSA 1UO6A 1TNJA 3V12A 2A5KA 2R0KA 2HVYB 5L2ZH 1O3GA 2ZCLP 1MU8B 3VG8A 7ESTE 3TNTA 2OXSA 1W0ZU 1NU7B 1K1LA 4E7NA 1OS8A 3A8DA 4F48B 3QLPH 1TA6A 3ZZ6A 2QCYA 4A1TA 3KYGA 5ABWA 1NBME 3GDUA 2D1JA 1YLCA 1XUJA 1NO9H 1GJ4H 1GCTB 4TYDA 1TIOA 2W5EA 1EJNA 5EQRA 1VCPA 1DSUA 4MPVA 1OYTH 2NU2E 4NSVA 4YLQH 1B5GH 4NWKA 4ABBA 6GCHG 1VITH 3P8FA 6GCHF 1O2KA 1SGQE 1QJ1B 3U28C 4DW2U 1C4V2 2AMQA 1NRQH 2ZHWH 1UW7A 4NFFA 1IAUA 3URDA 1TONA 2VVCA 1AQ7A 5SGAE 2PSXA 3F68H 4MVNA 1GMHG 4GHQA 3M5NA 1QB9A 1C5QA 3TNSA 1LQDB 4K8YA 1VZQH 1V2PT 2KFWA 3SZEA 1CSOE 8GCHG 2Y80A 8GCHF 4Q63A 2YMSC 2HNTE 4K1EA 1GBIA 1V2ST 3ESTA 1TAWA 1TGBA 1DY9A 1SL3A 2FZZA 1HV7A 1W0KD 2VVVA 2ZHFH 1NROH 1O3KA 1V2WT 1W12U 2IJOB 3LDXH 1MMJN 1AE8H 1BDAA 1Y8TA 2K1QA 4YOJA 1HAVA 2BD9A 3BEFB 5A8YA 1GVZA 2ZDNA 3RXJA 3TVJB 3UFAA 3GICB 4MPWA 4CRDA 2IPQX 2ZDVH 1AVXA 1QB6A 1CT0E 2GVFA 3E16B 1NT1A 1HAVB 4FUHA 4K60A 2A32A 1MAYA 2HNTC 5EIYA 1KXAA 2F9PA 2GKVE 3ATIA 2BXTH 1HAGE 5FCRA 2BY9X 1O3PB 2FOAA 3QGNB 2LNCA 1YLDA 2ZQ1A 2FOEA 4RKJB 3TJUA 4JYUH 3RXUA 1GI0A 1MZDA 5C1UA 1FV9A 1N6YA 3SV6A 1Y3WA 2WPMS 3SHCH 3F2GA 3SJKA 3GDVA 3SORA 1A2CH 3ZZ5A 3M3VA 2GCHG 2GCHF 3UTUH 2ZCHP 4X2YA 3SQHE 3SW2B 5DG6A 4FUFA 1SOZA 1G32B 2Q6FA 2GZ7A 1K2I1 1THRH 3PROA 1AVGH 4ISOA 5DK1A 1KLIH 3FKSD 3PTNA 1Y5BT 4O9VA 2KCPA 2GMTB 2ZU5A 2GDDA 3KEEA 1YCPK 2R3YA 5BRRE 4NZLA 4OS6A 5EU8A 3P8OA 4UFGH 1GI4A 4M7GA 2QE7D 3HKIB 2EI8A 1GBBA 3AK5A 3V3MA 5JBCS 2BDCA 1UTMA 3SV7A 3ZVEA 1OWJA 5F03A 2QXIA 1U6QA 4HG6A 1HAOH 1C2FA 3KHVA 5JBAS 5IDKA 1J17T 1P2OA 1QHRB 2FWWA 4AB9A 2IN2A 2ZF0H 4FUEA 2EI6A 2DE8A 2V35A 3PYHA 1NBMD 2HVXA 3L6PA 5FXLA 2WV9A 4OS7A 5A0CA 2V3MA 1O2TA 1J15A 1B0EA 4TT3D 1FY3A 4CBOA 3KCGH 2H6MA 4MG3A 4O3UA 1A5HA 2QF5A 5C5NA 1O3IA 1ELTA 2F43B 5JYIA 4GCHG 4XBDA 3RXRA 4HFPB 2UUYA 1IQHA 2FO9A 1K9OE 2WPJS 2J2UA 1TNGA 1P02A 3GY2A 3RXPA 4FUJA 1LKAA 4ISNA 1EUFA 3RXVA 4K1SA 3MH5A 1P2QA 3BTHE 3GCHB 1C5WB 5EXNA 5GDSH 1GI7B 1AY6H 1L2EA 1FIZA 1P03A 2ZA5A 2J38A 4IC5A 2A7CA 1ELBA 3SU0A 1EOJA 1T31A 4NIYA 3UOUA 1WAYB 1O5CB 4MNYA 1O3CA 1DM4B 1UTNA 5FPYA 1AB9B 2CJIA 1BCUH 4MDSA 1D6WA 4INHA 5ESBA 1ELFA 2XYAA 4CRGA 3SJ9A 1EASA 2BZ6H 4NFEA 2M2AA 2F9NA 1TYNA 2P93A 4AC9A 5EQSA 2UUFB 2O9QA 4GVUA 1TB6H 4Q7ZA 2EI7A 2BYAX 1O3DA 1ELCA 5HYOA 2CF9H 4KELA 1WXRA 2GT7A 1UTJA 2VGCB 4IS5A 1XXFA 1S0RA 2FLBH 4O3TA 1HRTH 2XCNA 3O8RA 2J4IA 3UAIC 2AHME 2FEQH 1BB0B 1GBEA 2JETB 5DP8A 2J97A 3M5MA 1AKSB 2VWLA 3RXBA 3RXLA 3K6YA 1A0LA 1C1TA 3BTKE 4Y71A 5DO4H 3A87A 3BTEE 2OC0A 3A81A 4X6MA 1UVPA 2Z94A 1V2VT 4I8HA 2RFKC 1GHBF 1M9UA 3M36A 1E34B 2Q6GA 3SU5A 1Y5UT 4I8LA 3E1XB 2ZDLA 1MTNC 3PWCA 2FLRH 3PLKA 2V6NA 1CA0B 1NRNH 1O2VA 4NIWA 3H09A 1MZAA 1K1MA 3Q76A 2VWOA 2GTBA 2G52A 3T26A 3K2UA 3RM0H 1C5XB 5F8ZA 3T5FH 4D9QA 4IBLH 4Q2KA 3S9CA 3RXTA 3OEED 3BTME 4X0WU 1ELAA 1E1QD 4Q7YA 2XC5A 1MH0A 1RS0A 1IOEA 3RMNH 3Q00A 1WTGH 3TGKE 1AMHA 1BTUA 3D65E 1KXFA 5E0HA 4ACAA 1QFKH 4F4OC 1TPSA 4X2VA 3PTBA 3UIRA 4P02A 2AMDA 3MU4A 5LH8A 2ZTYA 4B6EA 1LDTT 2BVSH 4FU9A 1PQ8A 5KGOA 3LJJA 1VITG 1VITF 1RFNA 2G4TA 1W13U 5JDUB 1TGNA 4YO9A 2CV3A 4DOQA 3ZZCA 2OD3B 4Y7AA 3MTYA 4KTSA 1OWIA 3VGCB 4DURA 1Z6JH 4X2WA 1PPHE 3LOXA 2Y7XA 2UUKB 6CHAC 1DX5M 1SQAA 2R2MB 1BMMH 1NY22 5GCHF 4BTTB 1F5LA 1EB2A 1C4Y2 4U2WA 1QL7A 1EJAA 2A0QB 3EAJA 1AZ8A 1Y5AT 7KMEH 4I7YH 3OEHD 1K21H 4YESB 3F2FA 1NFUA 1H9LB 1O2YA 1UTLM 1ZTKA 2QN5T 2ZFFH 3E6PH 1RJXB 1Z71A 2F91A 4B75A 5T6FA 4BAOB 1G3CA 2VIDA 5GNDA 3SNEA 1ZSLA 1GHVH 1TX6A 2P16A 1Y3XA 1H9IE 2AH4X 3NCLA 1VR1H 2Y5GA 1GG6C 1A3BH 1EZSC 1QR3E 3VB6A 2QXJA 1K1JA 2ODYB 2SGQE 5CE1A 1EZXC 1SQRA 1RXPA 3KIDU 5EW2H 4ZKRU 2R9PA 1C5MD 1IQGA 4GPGA 1A0JA 1BJVA 1TOCB 1W7XH 2WHXA 5FPTA 4IMZA 2OBQA 2NWNA 5DP5A 3SNAA 1KYNA 2AS9A 3ZZ8A 1ABJH 1TLDA 2ANMH 2CF8H 4JCNA 5EOKA 2PLXA 2A7HA 1LQEA 4QT8C 1GHYH 1SC8U 1BA8B 3JZ2B 1WQSA 5C3NA 1PPZA 1P3EA 4ISLA 3BV9B 4ASHA 3ZVFA 1TMTH 4GUXA 3OTPA 5T3HA 2DUCA 2B0FA 1QA7A 1UK3A 1FXYA 1V2RT 2ZO3H 2O8LA 2WYGA 1UMAH 2XOKD 3TU7H 1QQ4A 2ZWLH 4AYVB 1ANCA 2Y81A 2VNTA 2ZU3A 1GDNA 1QQUA 4Y0ZE 1BHXB 3S0NA 2QAAA 1DY8A 2PFEA 3FOAA 1FAXA 1O35A 1G37A 2KZ4A 1GI1A 4A1XA 4KKDA 3BTDE 4AZ2B 1UCYH 4A5TS 2STBE 2UUJB 4ABDA 1O2ZA 1UTOA 1IQFA 1DSTA 1AWFH 4NA7A 2NU0E 1GBFA 1FY5A 3SJIA 1ZLRA 1C2IA 3ZZ9A 1VGCB 1SLWB 4R0IA 1XM1A 3UNSA 4DVAU 2CN0H 2SGEE 3TH2H 2UWPA 1MD7A 2H2ZA 1FAKH 1HJAC 1V2LT 4JZFH 2BVRH 5IK2D 3A84A 3UREA 1DUEA 4WWYA 1N1LA 1ELEE 1J9CH 5JB8S 1ETTH 2HLCA 4ZMAH 3GY8A 4ESTE 2OC1A 3S7KB 1EFRD 1V2MT 2PR3A 1RD3B 1YPJH 2V3OH 3ATKA 3AW1A 1FY1A 2KCYA 3F0PA 2HALA 3NWUA 3UPEA 1EAXA 3S69A 4RI0A 3KGPA 1BQYA 3O8DA 1GMDF 3PB1E 1QCPA 1TBRH 2ZHQH 3LGIA 1ANEA 2ZPRA 4ZXXH 2GV6A 5A8XA 4B1TA 1F5RA 2JJ2D 2VU8E 3P17H 5F8XA 1WQVH 1BRUP 2FI4E 1G3EA 3SYJA 3S9BA 1BMAA 5AFYH 1FMGA 1KMHB 1PYTC 3B9FH 3MH6A 3N7DA 5FL7D 3EA8A 3RXCA 1HNEE 3LGYA 2FDAA 4YOIA 3A88A 3Q3YA 3SU1A 4YT6H 2ZNKH 3SU4A 3PO1C 4B2CA 5JBTA 1EPTB 1GHZA 4WVPE 3MQKC 3ZVCA 1P0SH 2J98B 2DE9A 1MTSA 3QK1A 1AZZA 2PKSC 1GJCB 2Y6TA 4Y79A 4AFSA 1A61H 2GX4A 3EYDA 3F2HA 1D4PB 1GJ5H 3BTGE 2O8WA 1RTFB 2GCTB 3A86A 2PGQB 4XE4A 4X8VH 1DXWA 1C1PA 3LU9B 2BLWA 3LGTA 3MO3A 2PP6A 3OAAD 1TWXB 3RU4T 1HAYB 3LKWA 4KTCA 4A7IB 3QTOH 3E91A 3ZVGA 1UHBA 4FUIA 1TNLA 1JXPA 1UK2A 1UTKA 4DJZB 2W3IA 4THNH 1KDQA 1QA0A 2C3SA 1HDTH 4XSKU 1P2JA 2XW9A 1MQ5A 1MU6B 1W7GH 4H4FA 4TWWA 2OCVB 1SGCA 1ZOMA 1JOUB 3MWIU 2A1DB 1O3NA 2ZFRH 1S84A 2JJ1D 2ZZUH 3QN7A 3RXOA 4IMQA 1D3DB 4WXIA 1C5OH 5FX6A 1RTKA 1SHHB 1H8ED 2BOKA 1HLTH 3GY6A 1ARBA 3AAUA 4MQAA 5FX5A 1W0YH 2OC7A 2ZCKP 3MNXA 1BTXA 3OSYA 1EZUC 1GVLA 1C1WH 2Y5HA 1L1NA 3A7XA 1A5GH 2V7QD 3RLYH 4HGCA 3F0OA 1TE0A 4RSPA 2C93B 3M61U 4BANB 1EATA 2ZHDA 3EQ0H 1NESE 5C20A 3T28A 2O8UA 3P70B 5EW1H 2XNDD 4I8JA 2PW8H 3RUOA 1QTFA 4DT7B 3BIVH 1XVMA 5LPRA 1FLEE 2TGDA 3SQEE 1C5LH 3GS9A 4ABGA 1INCA 2BVXH 2H9HA 2H9EH 4K8BA 3DSOA 2XWAA 3KQDA 1GMHF 2BQ6B 3E90B 2BD7A 3KQEA 3Q77A 2Y5FA 2GDEH 1HIAA 2P8OC 3O8BA 1SGFG 1ELGA 1P2MA 2ZPQA 2JDID 1LPKB 1RIWB 1N8OC 1S81A 3TK5A 1MKWK 1WV7H 1W14U 3SGBE 1L4DA 3CENA 1TABE 1UVUH 4OS5A 1W11U 2HRVA 2SGPE 3STJA 3UB0A 4TPIZ 2BHGA 2HPPH 2ZFTA 2A2QH 3ATMA 2H9TH 1W2KH 1F7ZA 3F6UH 2UWOA 2LELA 4DGJA 1Z8GA 4ABJA 2R3UA 3K65B 2BLQA 3EE0B 2BLVA 1P8VC 3ZZ4A 4BNRA 2FOFA 3ATWA 1QBVH 3RM2H 1EQ9A 1K1OA 3RC4A 1YCPM 3MU1A 1C5TA 2Z9GA 1J8AA 1O31A 4OS4A 4I31A 3SNCA 1TRYA 3MU0A 1DXPA 1C5PA 4XBBA 1RTLA 1JWTA 1HAHH 4TPYA 1E0FD 4ZKNU 1IQJA 2CHAC 2XC4A 2ODQA 3C27B 3FP7E 3MNCA 2OLGA 5EXMA 5EG4A 3VB3A 2FOCA 5FAHA 1KSNA 1COWD 3TJNA 1O5AB 3AAVA 1SOTA 4AX9H 1Q2WA 1W0JD 1QBNA 2I6QA 2XTTB 5EJ1A 3L3TA 5EODA 4WH8A 2GV7A 1NFWA 3PV4A 4WH6A 3HPTB 3OX7U 2WINI 4Z1MD 3TK9A 1TQ0B 1HJ9A 1O5FH 1D6RA 2Z3EA 4YOGA 4KTUA 4WF8A 3WW7A 4E05H 1QGFA 3F9EA 3DSPA 1VCWA 2PHBA 1C2KA 2XBVA 1YP9A 5GWZA 3ZV9A 5EPYA 2FI5E 3TIUA 2BX4A 2H1UA 2GZ8A 1PJPA 1CHOG 4U32A 4SGAE 3LC5A 6CHAB 5CHAC 3AASA 2L74A 2KR7A 2BY8X 3RC5A 1YYY1 1AFQB 1LVMA 2WV5A 2VIQA 1O2SA 4B6FA 4A1VA 4ACBA 1FDPA 5EPNA 1HB0B 1L1GA 4FU7A 3W95A 2JH6D 2SFAA 4X6PA 4CR5A 2NU3E 2WPDD 4MNWA 1OSSA 1V2QT 1EP6A 3SU2A 2PUQH 2YMSD 2G4UA 4YT7H 1O2UA 5A8ZA 4UFFH 3DD2H 1P11E 3B23B 1QJ6B 4D8NA 1ZRBA 2AGIX 5G4BA 2A4GA 4GCHF 1ZPZA 1AN1E 1H8DH 1KIGH 1P57B 3A8CA 4WXVA 3SV2H 1GG6B 3TITA 1OHHD 3RMOH 1CT2E 4ABEA 5L2YH 2C8ZB 4I86A 2BDHA 1NPMA 3UQOA 1S6FA 4P00A 1BIOA 2GGVB 3K6ZA 3A8AA 1DWDH 3A85A 1PPBH 3LH1A 3NK8A 5AFZH 2GD4B 3QTVH 1O36A 2K8IA 3RXSA 1TRNA 1YGCH 3KQCA 3LC3A 4ISIH 1D3PB 3ZZBA 1TRMA 3B8JA 1TX8A 3SNBA 2ZFQH 1SGPE 1MQ6A 1NRPH 1XUIA 1CT4E 2ZTZA 4GLYA 1FY8E 1ZHRA 1C2MA 1EB1H 5HGGA 4ZHLU 1S82A 4BTUB 1BBRH 3SGQE 3M5OA 4ZROA 1B7XB 2SNVA 3ATLA 3MI4A 4HI3A 3SV8A 1C5SA 3EDXB 3TGIE 1GJ7B 1VJAU 5J4QA 4XDEA 1ZTLA 2BZAA 5JB9S 1F2SE 3T29A 2ANWA 1QY6A 2FMJA 1T4UH 4FXGH 3ZZDA 3QGJA 3NUMA 4MNVA 1ZJDA 5I46H 1C1NA 3DUXH 1PPFE 4AFZA 5GJ4B 2R2WU 4DT4A 1O2XA 1SMFE 4CRAA 1B0FA 3VB7A 1JBUH 1Y3VA 3LT3A 2CXVA 3DA9B 4TWYA 2FYRA 3S9AA 3GY4A 3ITIA 8ESTE 2F3CE 1GBHA 3P95A 1V3XA 1QJ7B 1FZZA 5FBEA 4CHAB 1UCYE 1CO7E 1YBWA 3QZQA 5C0UA 3IWMA 3BIUH 4BAHB 1QNJA 3URCA 1TBQH 4NCYA 1KTSB 1HJAB 3SZNA 1OKXA 1Z7KA 1ESAA 3F9HA 4CH8B 2PKAA 5HIZA 1HAPH 1D3TB 3P8NA 5T1VA 4CH2B 1UVSH 4JYTA 4XRNA 3T25A 2QXHA 1ZRKA 3ENSB 2QIQA 1TMUH 4MPUA 3BTFE 2KX4A 1GHXH 1HAZB 1K1IA 1W3CA 1YY3A 1GBJA 1S85A 2OTVA 3MU8A 4Z0KA 3RMMH 2W3KA 1TPOA 2RCEA 1QZ8A 2WV4A 1F0RA 1E35B 1GI9B 1SFIA 3EGKH 5H4IB 1C2HA 2ZI2H 4R8TB 4IN1A 2FI3E 1OX1A 2ZIQH 3A7WA 4AOQA 1NZQH 2KM0A 4FVDA 4U01A 1YWUA 3FP6E 1EJMA 1ELDE 2V3HH 2BDGA 3E3TA 4J2YB 3UNQA 4AFUA 1GJBB 1IQEA 3K9XB 3SI3H 5T6GA 3TJVA 1DLEA 1GJAB 3RLWH 4HZHA 7GCHG 2EEKA 3TPIZ 2P3FH 4M9FA 1CGHA 2CGAA 1C5YB 4A6LA 1BOQA 1ZYOA 3PO1B 2ALPA 2JKHA 2PSYA 3DT0H 5LGOA 4NA8A 2AIQA 2Z9KA 3FZZA 2WPKS 2BD3A 2PKSB 1GBDA 2QC2A 2QF0A 4VGCB 3BTTE 3RXKA 1O3BA 2QV1A 3I78A 1EAWA 2J94A 3VXFH 2F9BH 4ABAA 1LTOA 1ESTA 3FZDA 3DFJA 1AWHB 3FP8E 1MKXH 1ORFA 3FN8A 1BMFD 4WJG2 3KQ5A 1C1OA 2VB0A 1SB1H 2BDIA 5EGMA 1C2DA 3CS0A 1DE7H 3MFJA 1OYQA 1MTVA 5DPAA 3SU6A 2C90B 2Z9JA 4NWLA 1LO6A 5CDFE 1ZSKA 1O5GH 2Y7ZA 4OM9A 3RMLH 4NZQA 2JIZD 3GCOA 4GAWA 4Q80A 4X1SU 1O33A 3A8BA 1Y3YA 1P06A 1GI8B 4AYYB 1YPGH 3UWIA 2BLOA 2CK3D 1LCYA 5EJZA 1XUKA 1L1JA 1FUJA 7LPRA 2ZFPH 3TK6A 3VPKA 1LHDH 2A4OA 1K1NA 5DP9A 2ZU1A 2FIRH 4X1NU 1G3DA 3VXEH 1GHWH 2BY6X 3OY5U 1WOFA 4B74A 3RXAA 1XUGA 2G00A 3Q3KA 2LP6A 4OGXA 3SN8A 3DSGA 4NA9H 1DLKB 1OP2A 4ZHMU 4MTBA 1TBZH 3UR6A 2W7UA 3NRLA 1H4WA 2BY7X 3H7OA 1GVKB 3M7TA 2FODA 2B9LA 2A31A 4AGJA 1AE5A 1HUTH 1IHTH 2ZECA 1QBOA 4BAKB 1BUIA 1GWAA 5L6NH 1Y59T 3H7TA 1DOJA 5A0BA 1MBMA 2BXUH 2P8OB 2ZGHA 4ZH8A 3STIA 1A5IA 5J4SA 1AB9C 2H5CA 4X8TH 3U1JB 2ZHEH 1TA2A 2PWXA 1N8OB 2YMSB 2TGTA 4D7FA 1ZGVA 1LPGB 3CP7A 4SGBE 1O3OA 1O34A 1DICA 1FONA 1CHGA 2G55A 1A0HB 1OWDA 5DGJA 3SUEA 2ZP0H 3OU0A 3ZYEA 1BTZA 1D9IA 5C17A 3F9FA 5DP4A 1GDQA 1EAIA 5HKKD 1RRKA 2Y82A 4FUGA 2ULLA 3GCNA 2IJD1 1DUAA 4AG1A 4TSFD 1AIXH 5A2MH 2O8TA 1O2WA 4DY7B 3S7HB 3PM3A 1F92A 3LONA 3GDSA 3QWCH 3FFGA 3QX5H
chains in the Genus database with same CATH topology
3UOPA 3U69H 2ZEBA 4BAQB 1TX7A 3SO3A 2B7DH 1XKAC 3AVZA 3P8GA 2PTCE 4MPXA 1YPMH 2IPHA 1KLTA 4Y0YE 1V2NT 1BTWA 1O0DH 1THPB 1P04A 4B2BA 3A89A 1IQNA 3U98H 2TGPZ 1O3HA 4DG4A 1O2NA 1PQAA 5HMAA 1CA0C 4UDWH 1TALA 1SLVB 3BEUA 1BRBE 1CQQA 2G8TA 1SGDE 4UEHH 2VIPA 2FOBA 3M3SA 3UQVA 1TMBH 4UFDH 3ZVAA 4BXWA 1SGEE 2VWNA 3E8LA 3NZIA 2VH0A 1C9TA 3ZYDA 1T7CA 1PQ5A 4B76A 2RA0A 1BMNH 1SR5C 1XX9A 1O3MA 3BTWE 1QL8A 4X2XA 4DCDA 1SPJA 1XKBC 2TIOA 1YPKH 2Z7FE 1C1MA 3G01A 1ZJKA 2FP7B 2BM2A 1YF4A 5EQQA 4Y8XA 4ABIA 3ZVDA 1V2OT 3SU3A 1OWHA 1LHEH 4ZXYH 3SUFA 1HAIH 3O8CA 1G30B 1C2LA 2BDBA 4K69A 1GMCG 1TPPA 2XBWA 2TGAA 1A7SA 3OTJE 3U8OH 5CHAB 1GI3A 1MD8A 4YLUA 1VCQA 3VGCC 4K1TA 2AIPA 2VINA 3MH7A 4HTCH 1SI5H 3SJ8A 2HWLB 4WMDA 4YM9A 2C8XB 2Z6BD 3AW0A 3T62A 4Y8YA 4XOJA 3V7TA 4H42U 2TRMA 3BG8A 2PTNA 5C1XA 2J34A 5LPFA 3A80A 3MYWA 4AORA 2FS8A 2Q6DA 4K5ZA 1UHBB 2RA3A 2XCFA 1SGFA 3BG4C 2BD8A 1QRZA 1KDQB 3P6ZB 1Q31A 3M35A 5C1YA 2PUXB 1NRRH 3C1KA 1O3LA 1AGJA 1ZGIA 1W10U 2W26A 2ZKSA 1P09A 1P05A 2STAE 4UONA 3V13A 2XC0A 2QXGA 5FHTA 2HOBA 1FN8A 2ZC9H 3GY5A 2Z9LA 2BQ7B 3RXFA 3R3GB 1C9PA 1HBTH 6LPRA 1T8NA 2A5AA 2AERH 1LHGH 1P01A 2P59A 5F6MA 5K7RA 4I8GA 1YM0A 4FUBA 1GBMA 1OP8A 3PMHB 1TNKA 2G5VA 3OYPA 2QY0B 1K22H 1O37A 2QF3A 1TOMH 1HPGA 3DFLA 4F49A 2B8OH 2AFQB 2RG3A 1W8BH 2FXRA 1GCDA 1OOKB 5FCKA 2A45B 2GT8A 1DT2A 2XBYA 4Z6AH 1GBAA 5JBBS 1FI8A 1X7AC 1IQLA 1BBRE 1RGQA 2BDYA 2H5DA 4OS1A 6ESTA 1UVTH 1FNIA 1GBKA 1TNIA 5DJ7A 3ZZ3A 3LIWA 1KXCA 3HATH 1IQKA 2BQWB 1ANDA 4Y6DA 2W7SA 2ZFSA 1MTWA 3LPRA 1PYTD 3ELAH 4H6TA 1C2GA 1O3JA 3LGWA 3VB5A 1H8IH 1HIAB 1NFYA 1GGDC 2FTMA 3H5CB 4X6NA 1O2HA 3RXIA 1C1SA 3RXDA 2BMGB 4ZUHA 1KLJH 4OGYA 3KL6A 1ABIH 1O39A 4FUCA 5TCCA 3BN9A 1GI2A 2XWBI 4IC6A 1G2MA 2EA3A 2FOGA 1CBWC 5DKMA 5BPEA 1ZPBA 4MLFB 3U1IB 3A83A 1V2UT 1VGCC 4FU8A 3HK3B 4WY3A 1MTNB 1ZZZA 1ETRH 1C2JA 1ZHMA 1ETSH 3RXGA 1A46H 1C5UA 4FUDA 3UY9A 4AB8A 2FX6A 4GSOA 2ZTXA 4FVBA 3PLPA 1HYLA 1ZHPA 4YTAA 1AI8H 1DDJA 3BSQA 1G2LA 5B6OA 3M5LA 1AU8A 1VJ9U 3M7UA 1SLXB 1WU1A 1FY4A 1OWKA 2OC8A 3MHWU 4D7GA 1FJSA 1QRXA 1A1RA 2Z3DA 1AFEH 1KXDA 1THSH 2VIWA 1MKWH 1GI5A 3F9GA 3IITA 3SBKA 4JZDH 1PPEE 2YNAA 1MCTA 3CS7A 3MU5A 2WUCA 3QDZB 4INKA 3TH4H 2NU4E 2P94A 2ZGCA 5F8TA 2F83A 4Y11E 3VFEA 5C67A 1F0UA 3VEQB 1V2JT 1T8LA 1CHOF 4NIVA 1K1PA 3ODFA 2YNBA 1SGYE 1C1QA 2J92A 1O3FA 3NXPA 1QRWA 3GISB 3RDZA 4ZKOU 4I8KA 3FAOA 4X1PU 1EPTC 2JH5D 1SLUB 1Y3UA 5A09A 1O3AA 1LPZB 1SHYA 1SQOA 1BJUA 5DP3A 3SI4H 2FTLE 3U9AH 1D3QB 1YPEH 1BBRK 2GCTC 3T2NA 1KY9A 2F9UA 2VH6A 2GZ9A 1TFXA 1O2RA 2BY5X 1C5NH 2AMPA 2Z3CA 2TBSA 2BD4A 1DWEH 1BTHH 2OBOA 4NSYA 1CE5A 3FANA 2WPHS 1TGSZ 2O8MA 1Q3XA 2OQUA 1HCGA 3HKJB 4UE7H 3A7TA 3KN2A 2OP9A 2XRCA 1GBTA 4UD9H 2OUAA 1SG8B 4UFEH 3TJOA 1IHSH 2M5TA 2FOHA 3RP2A 1A4WH 1J14A 2LPRA 2BX3A 3PWBA 1JIRA 4RKOB 1WYKA 1UTPA 5C5OA 1DANH 4CR9A 1H1BA 2FS9A 5I25A 2BD2A 3GY3A 1EX3A 1YCPH 1AO5A 5C2ZA 2FYQA 1MTUA 1Z1IA 1KTTB 1GHAG 1GHAF 1NFXA 3ZZ7A 1EP5A 1GCTC 1WCZA 1WBGB 4DIHH 1BRAA 2SGFE 2Z9IA 2XXLA 3FVFB 3HGNA 3QUMP 2D26C 4AGKA 4X1QU 1HJ8A 1LMWB 2D2DA 3WY8A 2BTCE 3U8TH 1LVBA 1UJ1A 1QL9A 2FX4A 5GXPA 4E06H 5T6DA 3I29A 4O97A 3SUGA 1ACBE 1CGJE 3PMJA 1AD8H 1ARCA 3D23A 1C5RA 1P12E 4KP0A 4NGAH 1P9SA 4NIXA 1O2MA 2G81E 3M7QA 2HGTH 1E37B 2A2XH 1RIWC 3ZZAA 1F0TA 2C8WB 3EA9A 2ASUB 1F0SA 4TY6A 1AKSA 3M3TA 1O2GH 1Z6EA 1NTPA 3GCTG 1FQ3A 1N6XA 3GCTF 1IQIA 1SGNE 4ZKSU 3LGUA 2G51A 4LOYH 3ZVBA 1O30A 3PMBB 3GYLB 1BZXE 1BRCE 4H6SB 1T8OA 4KGAA 3MNSA 3RU4E 2I6SA 5E2OA 1Z8RA 1CVWH 1MBQA 3A7YA 5DP7A 4A92A 1UK4A 1SVPA 4B71A 2VIOA 2PKAB 1GL0E 1AUJA 1C5VA 1LKBA 1GHBG 5E8EH 4ZAEA 3QZRA 2NU1E 4IN2A 1Z8IB 2AGEX 5L30H 4TY7A 3I77A 1ELVA 2Q1JA 1HFDA 1C4U2 3E0NB 2AYWA 4JMYA 1A3EH 1BMLA 3LGVA 3ODDA 1MKXK 1QB1A 1O32A 2BD5A 2AEIH 1NRSH 1CA8B 2G5NA 3IG6B 4JYVH 2WPIS 3N7OA 1O5DH 3EA7A 4O03A 5GPIB 1GJ8B 1WSSH 5E0GA 1V2KT 4BAMB 1EZQA 3RXHA 1GDUA 1GPZA 3F1SB 5ETXA 7GCHF 1EKBB 1EAUA 2FOMB 4NG9H 5AF9H 1L0ZA 3LH3A 1SBWA 4BOHA 3GYMA 2D8WA 1PPGE 2OQ5A 5A0AE 1O3EA 2SGAA 1GBCA 1OP0A 2AGGX 1P2IA 2BB4A 2ANYA 4JZIA 1CU1A 1YPLH 1J16A 4K2YA 3L33A 1DITH 3MNBA 4DIIH 4D9RA 1FN6A 1LVOA 2GMTC 1S5SA 3W94A 2A4RA 5DP6A 4X8SH 3UUZA 1G9IE 5FBIA 5GCHG 1Z1JA 1H9HE 4JZ1A 1GJ6A 1HXEH 1C5ZB 4AG2A 1AFQC 3KQBA 1PFXC 2P3UB 1WUNH 4CRBA 4X1RU 1C1VH 2UWLA 2WUBA 1TGCA 1SGRE 1C2EA 1O5BB 2VWMA 1AUTC 1L4ZA 3M37A 3BG4B 2FPZA 3KNXA 3UNRA 3T27A 4IW4E 2WPLS 1XXDA 1LHFH 1ZR0A 1UCYK 1YC0A 5AHGH 4I32A 3P92A 4PROA 9ESTA 1T8MA 2WYJA 2IOTA 2P95A 3DHKH 1G36A 1GJ9B 5TCAA 3UWJH 1V2TT 1V6DA 2TPIZ 2ZU4A 4JK5A 3KF2A 3RXMA 1EOLA 2ZGXH 4JK6A 1F5KU 3R0FA 3MH4A 4OS2A 4ZHAA 1EXFA 2ZQ2A 1KXBA 4MNXA 4ISHH 1HXFH 2VIVA 2RDLA 1NM6A 4Q7XA 1GI6A 2ZGJA 1GJDB 1LVYA 2A5IA 3GCHC 1IQMA 1P10A 1TPAE 4AFQA 2A4QA 4JZEH 1P9UA 3UR9A 1DWCH 1PQ7A 2QA9E 2PGBB 1DPOA 1GL1A 1ZPCA 4B2AA 5GIBA 4YZUA 3JZ1B 1UTQA 1NU9A 2C8YB 3QO6A 4WMFA 2BOHB 5PTPA 1HGTH 4CRCA 1NC6A 1ZTJA 4LZ4B 1ZSJA 3D62A 2B5TB 2F9VA 1BTYA 3RC6A 4LZ1H 3MOCA 4INLA 3SHAH 1GGDB 3RU4D 1S6HA 1TNHA 8LPRA 1FPCH 1O2JA 1MCVA 4LXBH 1DWBH 1SGIB 2VGCC 1NS3A 1HAXB 1XVOA 3OY6U 2ODPA 4B73A 1AHTH 9LPRA 3RXEA 1LHCH 1Z8JB 2SGDE 1TQ7B 1MUEB 1S0QA 2SNWA 2JETC 1PPCE 1YKTA 4XFQA 4Y8ZA 3HK6B 1CBWB 1GBLA 1FPHH 4Y7BA 4X6OA 1FIWA 1TGTA 3SJOA 1O2PA 4Y76A 3SNDA 3NKKA 3SOSA 4CHAC 3SGAE 4X8UH 3NPSA 1OXGA 5E2PA 2A7JA 5E0JA 3BEIB 1CGIE 3SV9A 1ZMNA 1BT7A 2J95A 1G3BA 2QGRA 1E36B 2BDAA 4CREA 2YOLA 3MMGA 1JRSA 1C1RA 4XBCA 3U8RH 5HM9A 3LJOA 4K3JA 2R0LA 4Y10E 1DFPA 4D76A 1BHXF 1OWEA 1QURH 2JH0D 1QIXB 2CHAB 3Q3XA 1O2OA 2KAIA 3A82A 1JIMA 4IGDA 2EC9H 3RXQA 2C4FH 2ANKH 1ZMJA 3BTQE 5EXLA 1GMDG 3TGJE 2V0BA 2F9OA 1C1UH 3SUDA 2ZPSA 4BTIB 2KAIB 1YPHE 1ID5H 5HM2A 2ZU2A 1DS2E 4J1YA 1ESBA 1KXEA 1WTHD 1ANBA 5LPEA 1O2IA 1P3CA 2OINA 3MO9A 5JPMH 3A7ZA 5AVDA 4BXSA 4ABFA 8KME2 2ZG0H 4I33A 4E7RG 1OPHB 1O38A 1ZMLA 3ZV8A 1O2LA 1SFQB 1XMNB 1EPTA 1T32A 3VB4A 3E0PB 2P3TB 1GMCF 3A7VA 2FESH 4RN6A 2ESTE 5HXFA 1P2KA 1JRTA 2VJ1A 4GHTA 5K0HA 2VVUA 4WMEA 5ESTE 3TLOA 1BITA 2HNTF 3PMAB 1AVWA 5IYTA 1S83A 4ABHA 1DVAH 1SSXA 2GP9B 2ILNA 1NN6A 1YPHC 4CRFA 3TH3H 2HPQH 1SQTA 1XUFA 4VGCC 2ZGBH 1O2QA 1K28D 1P2NA 1BTPA 2THFB 3PLBA 2ZDKA 2XNIA 1T4VH 3GY7A 5CMXH 3GOVB 1E38B 2XBXA 2ZDAH 4AN7A 2ZDMA 1O5EH 4CBNA 5TJXA 4U30A 3V0XA 2QYIA 1SGTA 2PV9B 2J9NA 3BF6H 1MAXA 2FM2A 3D49H 3MO6A 1UVOA 2ALVA 1JMOH 1XUHA 2CMYA 4LK4A 3HGPA 5FPSA 1UO6A 1TNJA 3V12A 2A5KA 2R0KA 5L2ZH 1O3GA 2ZCLP 1MU8B 7ESTE 3TNTA 2OXSA 1W0ZU 1NU7B 1K1LA 4E7NA 1OS8A 3A8DA 3QLPH 1TA6A 3ZZ6A 2QCYA 4A1TA 5ABWA 3GDUA 2D1JA 1YLCA 1XUJA 1NO9H 1GJ4H 1GCTB 4TYDA 1TIOA 2W5EA 1EJNA 5EQRA 1VCPA 1DSUA 4MPVA 1OYTH 2NU2E 4NSVA 4YLQH 1B5GH 4NWKA 4ABBA 6GCHG 1VITH 3P8FA 6GCHF 1O2KA 1SGQE 1QJ1B 4DW2U 1C4V2 2AMQA 1NRQH 2ZHWH 4NFFA 1IAUA 3URDA 1TONA 2VVCA 1AQ7A 5SGAE 2PSXA 3F68H 4MVNA 1GMHG 4GHQA 3M5NA 1QB9A 1C5QA 3TNSA 1LQDB 4K8YA 1VZQH 1V2PT 1CSOE 8GCHG 2Y80A 8GCHF 4K1EA 2HNTE 1GBIA 1V2ST 3ESTA 1TAWA 1TGBA 1DY9A 1SL3A 2FZZA 1HV7A 2VVVA 2ZHFH 1NROH 1O3KA 1V2WT 1W12U 2IJOB 3LDXH 1MMJN 1AE8H 1BDAA 1Y8TA 2K1QA 4YOJA 1HAVA 2BD9A 3BEFB 5A8YA 1GVZA 2ZDNA 3RXJA 3TVJB 3UFAA 3GICB 4MPWA 4CRDA 2ZDVH 1AVXA 1QB6A 1CT0E 2GVFA 3E16B 1NT1A 1HAVB 4FUHA 4K60A 2A32A 1MAYA 2HNTC 1KXAA 2F9PA 2GKVE 3ATIA 2BXTH 1HAGE 5FCRA 2BY9X 1O3PB 2FOAA 3QGNB 2LNCA 1YLDA 2ZQ1A 2FOEA 4RKJB 3TJUA 4JYUH 3RXUA 1GI0A 1MZDA 5C1UA 1FV9A 1N6YA 3SV6A 1Y3WA 2WPMS 3SHCH 3SJKA 3GDVA 3SORA 1A2CH 3ZZ5A 3M3VA 2GCHG 2GCHF 3UTUH 2ZCHP 4X2YA 3SQHE 3SW2B 5DG6A 4FUFA 1SOZA 1G32B 2Q6FA 2GZ7A 1K2I1 1THRH 3PROA 1AVGH 4ISOA 5DK1A 1KLIH 3PTNA 1Y5BT 4O9VA 2GMTB 2ZU5A 2GDDA 3KEEA 1YCPK 2R3YA 5BRRE 4NZLA 4OS6A 5EU8A 3P8OA 4UFGH 1GI4A 4M7GA 3HKIB 2EI8A 1GBBA 3V3MA 5JBCS 2BDCA 1UTMA 3SV7A 3ZVEA 1OWJA 5F03A 2QXIA 1U6QA 1HAOH 1C2FA 3KHVA 5JBAS 5IDKA 1J17T 1P2OA 1QHRB 2FWWA 4AB9A 2IN2A 2ZF0H 4FUEA 2EI6A 2DE8A 2V35A 3PYHA 2HVXA 3L6PA 5FXLA 4OS7A 5A0CA 1O2TA 1J15A 1B0EA 1FY3A 4CBOA 3KCGH 2H6MA 4MG3A 4O3UA 1A5HA 5C5NA 1O3IA 1ELTA