2BY9X

Is radiation damage dependent on the dose-rate used during macromolecular crystallography data collection
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords CATIONIC TRYPSIN
publication title Is Radiation Damage Dependent on the Dose-Rate Used During Macromolecular Crystallography Data Collection?
pubmed doi rcsb
total genus 55
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2005-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2by9X01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2by9X02
4B75A 1TQ0B 4JZEH 1O35A 7KMEH 3SN8A 1G9IE 2GMTC 6CHAB 2XBWA 1TPAE 4D9RA 2XCFA 3B23B 5DP3A 3RMNH 2ZNKH 1MTUA 1UTPA 8KME2 1QQ4A 1ETTH 4ZKRU 1DITH 1BRUP 1O2GH 1PPFE 2GTBA 4NCYA 1GL0E 3E1XB 1Y5UT 4HGCA 1FIWA 1O3FA 2Y80A 1GDUA 1VCPA 1BCUH 3TH3H 1VITH 2ASUB 1F2SE 3NK8A 5BPEA 3VB6A 1QR3E 3TVJB 3E8LA 2FLBH 3PLKA 4FU9A 1NT1A 3BTGE 1SQTA 2ZU3A 5E2OA 3TNSA 1UK3A 3UOPA 2Z6BD 3SU5A 1SL3A 4U30A 2AERH 3VFEA 2RCEA 1RIWB 1N8OB 1PQ5A 1RD3B 3LPRA 3PWBA 1BRCE 1CGHA 1OWIA 1G30B 3A7WA 2HNTC 2A31A 1FI8A 4WWYA 1O3NA 4BANB 5FX5A 2THFB 5TCAA 1MCVA 1G36A 2HOBA 2NWNA 4XBDA 1K21H 1TE0A 1ZHRA 3M3SA 5EQRA 3PROA 3QDZB 4CHAB 4BAOB 2FWWA 3RXMA 2AEIH 2BVXH 5ESTE 1SGDE 4BOHA 5A8XA 1F0RA 1G3BA 3MH4A 3TPIZ 2GZ9A 3MOCA 3EAJA 1SBWA 1ZHMA 1BJVA 1W12U 2BB4A 1K2I1 2J2UA 1Y3VA 1MTNC 1UTJA 3OYPA 4IN1A 1CVWH 4UFDH 4DJZB 3GYMA 3MO3A 5EPYA 1TONA 2BY5X 2W3IA 1MD7A 1CA0C 3BEUA 1C2JA 1GMHF 2EA3A 1THSH 4Y71A 2GGVB 3BTFE 3T29A 1ZSKA 2Z3CA 3O8CA 1UK4A 1INCA 2BQ6B 3H7OA 1W8BH 2BVRH 2F9PA 2AGIX 3LONA 1D4PB 4MNVA 4CRAA 3GY2A 4JYVH 1NM6A 3ZZ5A 5TCCA 2ZIQH 2GX4A 3VPKA 4TWWA 2P95A 4GSOA 1AKSB 2AGGX 3SGBE 2P8OC 2Y7XA 3P8FA 1AY6H 3SNEA 2FIRH 1TGSZ 4ABHA 1KXAA 1P2OA 1P9SA 1GBJA 3M37A 1TBQH 1A5GH 1YGCH 5CMXH 1AD8H 4NFFA 1PYTD 2QXJA 4I33A 5E0JA 1C2KA 3AAUA 4FUHA 2R0KA 3KNXA 4X8SH 1XVOA 4ZHAA 1A5IA 2VIDA 4IMQA 5E2PA 4A7IB 1Y3XA 1HUTH 1V2LT 2FODA 1O5EH 3DFLA 2P16A 1GBBA 1PQAA 2W7UA 3P17H 1IQHA 2Y5GA 2FOHA 1ANBA 1F5KU 3A83A 3C1KA 1UMAH 4YT6H 2HNTE 3BF6H 2Z9LA 1LMWB 1EB1H 2A4GA 3PO1B 1C5YB 1ZJDA 3M61U 1WU1A 2WUBA 4K5ZA 1DUEA 8GCHF 3MMGA 1C2DA 1O2NA 4CH8B 4VGCC 1FMGA 2GDDA 3TK6A 1NPMA 2B0FA 5T6DA 1UCYH 1GJ4H 2XW9A 2OUAA 1C5OH 1ANEA 1TNHA 3L6PA 3RU4D 4GPGA 1H4WA 4Q7ZA 1HDTH 1K1JA 1O2OA 3SUFA 1ARCA 4K60A 4B1TA 1Z8JB 1X7AC 1KTTB 5LPEA 1P2JA 3LGVA 2FEQH 3ZV9A 1P11E 2D1JA 3KQDA 4ZHMU 4Y7BA 5E0HA 3O8RA 4IC5A 4FXGH 3RXOA 1QGFA 2XC5A 1J15A 4X1PU 4NZQA 4UFGH 1F5LA 4X2XA 2QV1A 4SGAE 5J4SA 4OS1A 4U2WA 1P2MA 1E37B 1Y5BT 4TPIZ 3KIDU 1KY9A 5BRRE 1G37A 4NA7A 3LGYA 1J14A 1SR5C 2QIQA 3HATH 1UVUH 4K2YA 2B5TB 1A3BH 3ATWA 2JH5D 1YPJH 3RXFA 3SNAA 1OXGA 3Q77A 2O8UA 4XDEA 1AUJA 3LDXH 4H6TA 3M5MA 2VJ1A 2FM2A 5C67A 1O5GH 1OP8A 2VNTA 3U69H 1XXFA 1O2RA 4ZKOU 2F3CE 3RXSA 3SJOA 3ZZBA 4WF8A 1KXDA 1GBEA 2DE8A 4IMZA 3RXPA 1RJXB 3U8OH 4CH2B 1DFPA 4DURA 1NS3A 1YLCA 4NWKA 1P02A 1UHBA 1SLUB 2GDEH 2FS9A 3ZZ8A 3VGCB 3BG4B 1ZRBA 2Q6FA 1AFQB 2STAE 5B6OA 3VXEH 3W94A 1H9HE 2RA0A 4AFQA 4CBNA 2XTTB 4DY7B 4K3JA 1GVZA 1LKAA 2BX4A 2FI4E 1S83A 3RM0H 3SV9A 2ZDLA 2BD3A 4I32A 5EW2H 1P05A 2GV7A 3PTNA 1GHAF 2ZA5A 1QFKH 2A2QH 3CP7A 1HAXB 3SOSA 2FI5E 4DGJA 1THPB 1SVPA 1BBRH 1A0HB 1TNIA 2W7SA 5JBBS 1DUAA 2UWOA 1DWBH 1N1LA 1GI7B 4TPYA 4TWYA 1AQ7A 2EEKA 3E16B 5CHAB 1Y8TA 1SOTA 3EE0B 2V35A 1O3GA 4FUFA 4I7YH 1T31A 2Z9IA 2VIQA 2J4IA 1HNEE 1TRNA 1WQSA 1TOMH 3T26A 3ZYDA 1IQNA 4NA9H 1V2MT 2ZU5A 1IOEA 1E38B 1UCYK 1EXFA 1JOUB 1ELVA 1O5FH 1QBOA 3MU0A 1KXBA 3UNRA 2NU3E 5A0AE 1BUIA 1YLDA 4MPUA 3GY3A 4ESTE 4ZUHA 1HIAB 1O2QA 1NO9H 1RTFB 1XUIA 2ZPQA 3ZZ7A 2BDGA 1Q3XA 3TJVA 5LPRA 3HK3B 1FY4A 2Z3DA 3RXKA 1YYY1 3AAVA 3SGAE 1T4VH 1IQKA 2Z7FE 3F9GA 3A8CA 4ABDA 1VCWA 2ZTYA 1W11U 2XWAA 5DP9A 1FQ3A 5LGOA 2VB0A 4HI3A 5C1XA 1VGCB 2Z94A 2QF0A 3K9XB 4YO9A 5CE1A 1C5UA 1J8AA 4CBOA 1T8MA 1SPJA 1C1QA 1BRAA 1TQ7B 2ZDAH 3I29A 2FOFA 4FUBA 2QCYA 3E6PH 2ZFSA 3SV6A 3A7XA 4B2CA 5C3NA 1WTGH 1ESAA 2PW8H 1EAWA 3HPTB 3P92A 4GAWA 2D2DA 4CR9A 4KKDA 1K1LA 4XFQA 2XRCA 1JMOH 2FTLE 1C1WH 3DFJA 2VVUA 2XBVA 4XSKU 1BTUA 1MZDA 3NWUA 4JCNA 4NIYA 3BSQA 3DA9B 5K7RA 1Y59T 2WV5A 1UTQA 4R0IA 1AB9B 1WTHD 1RXPA 5DG6A 1PYTC 1QQUA 1F5RA 3IITA 1C1PA 1SGEE 3Q00A 2P3UB 2VWMA 1QJ6B 3RXCA 3RXLA 3KQEA 1O3IA 1Q31A 1XM1A 2PUXB 3QLPH 1BBRK 1ZGVA 5LPFA 1V2OT 2ALVA 3L3TA 2HALA 1A0JA 4UE7H 3STJA 1D9IA 3EA9A 1OYQA 1W10U 3RXIA 1XUGA 2ODPA 4FUGA 5AFYH 5L30H 1CBWC 1JWTA 1G32B 4D7GA 2GD4B 1A46H 1LO6A 5EQQA 2FTMA 2P93A 4X2WA 2XBYA 4YOGA 5HM2A 4YTAA 1BHXB 1SMFE 1C5WB 1GCTB 3MU8A 5SGAE 4X1SU 1O31A 1GI6A 3EYDA 1BTZA 1K22H 5C1YA 3TK5A 2HGTH 3LJOA 3FP7E 1EZXC 4NIXA 1NFYA 4X6PA 1C2EA 3HGPA 1E0FD 2WYJA 3ZVAA 1AWFH 1YC0A 1LCYA 1QRWA 1SGIB 1SGPE 6GCHF 4DCDA 4K1EA 4XBCA 2A32A 1HIAA 5ETXA 5ABWA 4MG3A 1HJAB 4LZ4B 2WYGA 1GBIA 3SU4A 1SLXB 2ZDVH 4PROA 3R3GB 1S6FA 4I8HA 2OQ5A 1GMDG 1GMHG 3DD2H 1PPGE 2FYRA 4ABJA 1HAPH 1EX3A 1BOQA 4ZMAH 2Q6DA 4AB8A 3K6ZA 5FPTA 3UNSA 2W3KA 3UPEA 5AHGH 1EPTB 1QBVH 1PPEE 4X8VH 2M5TA 8ESTE 3SU6A 2H6MA 2ULLA 5A0BA 1IAUA 1F0SA 4UD9H 1C5QA 2ZCLP 2ODYB 1D3TB 1QB1A 4DOQA 2BLQA 1C5RA 2F83A 4E05H 2R2WU 2GT7A 4F49A 1GHBF 1QCPA 2FMJA 3BTDE 1AU8A 1G2MA 3TJNA 1XMNB 3BN9A 1DWEH 2QAAA 1WV7H 3M35A 1VITF 3A86A 2WV4A 3RXGA 1O3JA 1YPEH 3S69A 2BLWA 5T6FA 3TJUA 6CHAC 2NU0E 1O5AB 4ZKNU 1ELEE 1GDQA 4K69A 1FUJA 4AYYB 2FZZA 4UONA 1UVPA 1HBTH 1B0FA 1EJNA 1LKBA 2Y7ZA 3D65E 4H4FA 3EA8A 1C1NA 4THNH 3TIUA 4HFPB 3PV4A 1ID5H 1LQEA 4NIWA 2FOMB 2XWBI 2ZC9H 3SV7A 4D9QA 1ZSLA 1KLTA 8LPRA 8GCHG 3UY9A 2J38A 1P03A 1G3CA 1O2TA 3MH7A 2CN0H 3ZVCA 1GI4A 1WSSH 1Y3UA 1QB9A 4IBLH 1SGTA 1EAIA 1NRPH 4CRFA 4A1VA 3BG8A 1HCGA 3CS0A 3GCOA 4Q7YA 5JDUB 2FLRH 1RIWC 1ELDE 1N8OC 3BIUH 4K8BA 3RU4E 2ZP0H 5A8YA 1K9OE 4LOYH 3E3TA 4HTCH 1EKBB 3D62A 3M5NA 1GI5A 1T7CA 1RRKA 3F6UH 2PTCE 2NU1E 3SJ8A 4UFEH 2Y6TA 5EODA 3V3MA 5I25A 3MNXA 3LC3A 1IQGA 1B0EA 2BM2A 4OGYA 1XX9A 1CGIE 1AVWA 2G00A 4MQAA 4CHAC 5E8EH 1TABE 2HPPH 1PPCE 2CGAA 1O5BB 1DLKB 1GJAB 2A1DB 3KCGH 5HYOA 4ZXXH 1KYNA 3T5FH 3ZZCA 4H6SB 2ESTE 3T2NA 1F7ZA 2QY0B 2UWPA 2J94A 1C5MD 3RP2A 1FPHH 2VVVA 3RXDA 3LKWA 2ZO3H 4ABAA 5AF9H 2TPIZ 1O3OA 1TALA 1JRTA 4UFFH 3U1JB 2PGBB 1AZZA 5JB8S 3SHCH 3RMLH 1FPCH 3AW0A 1BHXF 3ZZ3A 4GUXA 2ZTZA 2BD9A 1GPZA 3SUEA 3KL6A 1QL7A 4Y76A 1LVYA 1O2XA 2A4OA 1A61H 1Q2WA 2IOTA 1ZZZA 1FIZA 3S0NA 1CT2E 3MO6A 2R9PA 1BTYA 1MMJN 2F9UA 3SU0A 3LGWA 3LH1A 4MTBA 3TH4H 1EPTA 3TK9A 1V2UT 1FJSA 1SGRE 2V3HH 4ZAEA 1L1NA 2PKSB 2QXGA 1Z8IB 3CS7A 1O3PB 1HJ8A 1IHSH 1G3DA 2WPJS 2GV6A 1W13U 2PKAB 2BY6X 2LPRA 4ZKSU 1TX6A 3OSYA 3RXEA 1GHAG 1TNKA 1EZUC 2BD7A 1GMDF 2BX3A 1RTLA 3FAOA 1EZSC 1QY6A 4H42U 2BDYA 3LH3A 1HXFH 1AZ8A 3D23A 7GCHG 2FOEA 1O2PA 1OP0A 4B76A 1AHTH 1O3AA 3EA7A 1H9IE 5DPAA 1DOJA 1PQ8A 1S6HA 2R0LA 3GCHB 1GCDA 4FUIA 5FAHA 3G01A 2ODQA 1FY5A 5DJ7A 2FP7B 1BQYA 1P04A 2BY8X 3ZZ4A 5JPMH 3SV8A 3RU4T 1EB2A 2JKHA 4J2YB 2ZU1A 2J9NA 3P95A 3PO1C 2O8MA 4OS6A 2ILNA 5DK1A 4ABBA 1MTSA 2EI6A 2A5KA 1TRYA 3QTVH 3F68H 1P10A 4X6OA 1DS2E 2PGQB 2PUQH 2HVXA 4ZXYH 1C5XB 2AIPA 2G5NA 3HGNA 4MPXA 3UREA 1LHCH 3A80A 2FDAA 2ZFQH 1LVMA 3MH5A 1GI8B 2GCHG 2VWOA 1OWJA 1UTOA 2H5DA 2OC0A 1EAXA 1EP6A 1V2NT 4GLYA 1C5VA 1O0DH 1TIOA 4BXWA 1O30A 4B2BA 1VZQH 1GL1A 4BAHB 1FV9A 1QBNA 1S0QA 4FUJA 2C8YB 5LH8A 2O9QA 1SGNE 5JBTA 4Y11E 4AORA 4IW4E 1SOZA 3BTQE 1MU8B 1OYTH 2BDIA 3RUOA 3RXQA 2ANKH 1IQEA 3BTWE 2Z9GA 1HV7A 4J1YA 2Y5FA 3EQ0H 2BQ7B 2FS8A 1IHTH 1OOKB 3ITIA 3A7TA 1GBMA 2CF8H 1ZYOA 1MAYA 2ZFFH 4CRCA 4UEHH 5AVDA 1QRXA 1CQQA 2BOKA 1V2QT 2ZF0H 2H9HA 1AFEH 2TGAA 4O3TA 1GJ9B 2FX4A 1SQAA 5L2ZH 4AX9H 1O5DH 4OS4A 2OBOA 1GJ7B 3T25A 1S5SA 3UR9A 2BD5A 1S84A 1AVXA 1ZHPA 2F91A 2ZQ2A 1OP2A 1ZMLA 1NRRH 4X1QU 1NU7B 1AO5A 1SSXA 1QIXB 1MBQA 1QRZA 4D76A 3GY5A 9LPRA 5DGJA 4MNXA 4A1XA 3ZZAA 1U6QA 1EOLA 2GCTB 3QZRA 1SHYA 1TB6H 2H1UA 3BEIB 4ABEA 3VGCC 3BG4C 5EOKA 1AFQC 1D3DB 3FP8E 4B2AA 4M7GA 1Y5AT 1C1RA 1V2VT 1FONA 2BMGB 2SGFE 5HXFA 1AGJA 1TX7A 2PKAA 1C2MA 1ZRKA 2YOLA 1V6DA 5FCRA 1V2TT 3UOUA 2HRVA 1RGQA 2A7JA 4TYDA 2OCVB 1H8DH 2O8WA 1HYLA 1WBGB 4DVAU 4DIIH 1QB6A 1L2EA 3F9EA 4ASHA 2TIOA 1BT7A 4DIHH 2NU2E 4NG9H 2GZ7A 3TITA 2VWNA 1BIOA 3SV2H 3M36A 1O2VA 1ZLRA 3SQEE 1O2SA 4NSYA 1T32A 4Y0ZE 1NRQH 4Y0YE 3JZ1B 5CHAC 1FLEE 1HAGE 1NZQH 4JMYA 1GVKB 1ETSH 2V3OH 1DDJA 1AKSA 3OU0A 5T3HA 5A2MH 3SUDA 4Y8YA 3GOVB 1AIXH 1AVGH 4MLFB 1HAIH 3S9AA 1NFUA 6GCHG 2PR3A 4NFEA 1DX5M 3SU1A 4HZHA 1YBWA 1IQIA 1Z8RA 3KEEA 1MKXK 4Y10E 4A92A 2ZDMA 1GJCB 1ESTA 1ACBE 1NRNH 2HLCA 1AMHA 4JZ1A 7GCHF 4BAMB 2AS9A 5JBAS 3NXPA 3UFAA 1YPHC 1VJAU 1SGQE 4ISLA 1GBAA 1C2LA 1EATA 1MAXA 1O38A 1WQVH 2ZFRH 3SORA 3H5CB 1EASA 1ZJKA 3ZYEA 1TNLA 1BDAA 1TX8A 1VGCC 3GY7A 3BTTE 6LPRA 3SO3A 1FDPA 3V13A 3PMAB 5J4QA 1GJ5H 4WH6A 1V2KT 4YLUA 1NN6A 1EQ9A 1D6WA 1O2UA 3ATLA 2O8TA 1GHBG 2H9TH 3QN7A 5JYIA 1LVOA 2IJOB 3ZZDA 2ANYA 2BHGA 2J34A 1ARBA 5F8XA 1CGJE 4AGJA 1C2HA 2ZZUH 4JK5A 4FUEA 4Y8ZA 2R2MB 1W7XH 1P12E 5HGGA 3UNQA 1QNJA 1VITG 2GCHF 5C2ZA 1GGDB 1SGFG 1MH0A 1HPGA 1UVSH 1B7XB 2XYAA 4K1TA 1EOJA 3QGNB 1ORFA 3UWIA 1GI9B 1EAUA 1C1UH 1UK2A 1O32A 4GCHG 4XBBA 3VB5A 4DW2U 5GWZA 1A5HA 1CHOF 3KQBA 3KQCA 3A85A 1DWCH 4KTCA 2BDHA 2DE9A 2TBSA 4RN6A 4INLA 3ATIA 1O3LA 1EJAA 1Z8GA 2F9BH 2XXLA 1AB9C 4TY6A 4MDSA 4O9VA 5FX6A 2STBE 5PTPA 2G81E 1CE5A 1HLTH 4IC6A 2CHAB 5GDSH 4Z0KA 3HKJB 1DT2A 1CT0E 1QTFA 3A7VA 3Q3KA 4DT7B 5C5NA 1GJBB 2VIOA 4A6LA 1TGTA 1BMNH 1KTSB 1CSOE 2KAIB 1MQ6A 2XNIA 2AMQA 2OC8A 3ZVBA 3K65B 3URDA 1FY8E 1YPLH 2NU4E 3S9CA 2FO9A 1MZAA 3S7KB 2A5IA 2BD2A 1YPMH 1C1VH 2VGCB 4YOJA 4NIVA 2F9OA 3A89A 2BY7X 3FFGA 1GCTC 2C90B 1RTKA 1S82A 2ALPA 4KELA 1YPHE 3KF2A 2VIPA 4YOIA 1Z1IA 2G4UA 1FZZA 2RDLA 2Z9KA 4WXVA 1L1JA 1WYKA 3N7OA 1YM0A 1QL9A 4OS2A 4U01A 2PWXA 3PLBA 4MPWA 2W26A 3W95A 2ZTXA 3TGJE 1C5TA 3KGPA 1QHRB 4JZDH 1BITA 1HJAC 4JZIA 4Q2KA 1FN8A 1QL8A 1TMUH 2AMDA 1HJ9A 4AOQA 1O3HA 2WPHS 2G4TA 4YZUA 1MTVA 1PJPA 2TGTA 1HB0B 3RXRA 4Q80A 4JYTA 1TNGA 1C1OA 2D26C 4A5TS 5G4BA 4WXIA 3EDXB 1TBRH 4D7FA 3ODDA 3ELAH 2WUCA 1FY1A 1J9CH 3UTUH 3R0FA 1PFXC 2CF9H 1NC6A 1EPTC 1NFWA 2VH0A 3NZIA 2Q1JA 4X8UH 1HAYB 4BAQB 3E0NB 1GBTA 4X0WU 4X1NU 1G3EA 1GHWH 2OQUA 3BTKE 3IWMA 4BXSA 3RLYH 4BAKB 3QK1A 2VIVA 3A87A 1L4DA 1UTMA 3LGUA 1TA2A 1XUFA 2VWLA 3B9FH 2H2ZA 2HPQH 1BTWA 3ATKA 2OD3B 4AYVB 1DSUA 1BTPA 4CRBA 5JB9S 2ZECA 1T8LA 2A5AA 4WJG2 1NROH 1ZPBA 1O2MA 1O3CA 3HK6B 1RS0A 1SGFA 2SFAA 1K1MA 1O2ZA 3AW1A 3SJ9A 4I8JA 1P0SH 5EW1H 1XUKA 1BMMH 3GYLB 1TPSA 2ZG0H 3MNSA 3SNBA 2LNCA 3GCNA 1SQOA 1THRH 1QJ1B 4ISOA 2XBXA 4I8KA 7LPRA 3MFJA 1C5PA 3BTME 1MKWH 5L6NH 4X8TH 1C2IA 1JIRA 3T28A 1LTOA 4YM9A 3V12A 3LC5A 1UO6A 1Z1JA 1L4ZA 1GI0A 4AZ2B 3OTJE 1A3EH 1GJ6A 1KIGH 1BRBE 1MQ5A 3VB4A 4ZHLU 1S85A 1XUHA 3RXTA 1ELFA 2OLGA 3STIA 4GCHF 1LVBA 5DP5A 4B73A 1TMTH 1KXCA 2OINA 3RXVA 1TLDA 1EP5A 1CU1A 3TJOA 3P6ZB 3Q76A 1F92A 3VB7A 4WMFA 3K6YA 3UUZA 1ZGIA 4MNWA 4Y6DA 1TWXB 2AIQA 3ZVGA 1ZTJA 1GI3A 4R8TB 3EGKH 4X6MA 4ISHH 2UUKB 3DT0H 3F1SB 1FN6A 4JYUH 4O97A 3A81A 3PLPA 3IG6B 1HFDA 3FZDA 2C8WB 3LJJA 1UCYE 3VXFH 1F0TA 1SC8U 1TGCA 1KDQB 1H9LB 2EC9H 5FPYA 1UTKA 6ESTA 3QWCH 3V0XA 2G55A 1HAOH 2WPMS 1UJ1A 2TGPZ 2ZHWH 5EU8A 3TH2H 4WVPE 1GHYH 1GHVH 3P8NA 4X1RU 1L0ZA 1FY3A 5K0HA 3QO6A 1O3MA 2QXIA 4IN2A 4KTUA 5EXLA 4BTIB 3LGIA 3PMBB 1NFXA 1G2LA 1ELAA 2G5VA 4X2VA 1LDTT 3GDSA 1NTPA 4SGBE 2EI8A 3ZV8A 2OXSA 1MTWA 3A7YA 4GHTA 1UTLM 2FOBA 4LK4A 1LQDB 2PKSC 3A8AA 2OBQA 3MHWU 2SGEE 3GDVA 5FCKA 3M3TA 1SFIA 2FOGA 1NU9A 4KP0A 2JETB 4F4OC 1K1IA 2WPLS 1GG6B 2Z9JA 5A8ZA 2PSYA 5JBCS 4BTTB 1TBZH 1RFNA 2W5EA 1IQMA 1JXPA 2A7HA 1DICA 2QXHA 5GCHG 1DY8A 3NKKA 1GMCF 2GMTB 1GDNA 1DXWA 2UUJB 3NUMA 1PQ7A 5F8ZA 3O8BA 2XC0A 2V6NA 3U8TH 5E0GA 3GCTF 3UIRA 1ZOMA 2ZCHP 1CO7E 3PM3A 2UUFB 2UWLA 1WCZA 3GCHC 5DO4H 1SI5H 5A0CA 1TYNA 1K1NA 5C5OA 1MKWK 1O2JA 4RKJB 4I31A 4GVUA 2BYAX 1QURH 3RMMH 3VEQB 5FBEA 4LXBH 1P06A 1DVAH 2FXRA 1ZMJA 3CENA 3RC5A 5C1UA 2R3UA 1W3CA 1KLJH 1V2PT 3F9HA 1WAYB 1N6YA 1Y3YA 4Z6AH 1SG8B 3P8OA 2A4RA 1O5CB 1ESBA 3SHAH 1SLWB 1O3KA 1SB1H 5A09A 2ZHDA 2TGDA 2A7CA 1S81A 1ELCA 3QZQA 1BBRE 1NY22 1YP9A 1TMBH 4JK6A 3I77A 1C4U2 1JIMA 3SZNA 2FX6A 1IQJA 2ZCKP 1GBCA 3P8GA 3QUMP 1GBLA 2J95A 5C20A 2SGQE 3LGTA 3RC6A 1PPHE 1UHBB 3RXBA 4BNRA 1OKXA 2A2XH 4FVBA 4KGAA 4FUDA 2GVFA 1EJMA 1AE5A 5AFZH 4CRGA 1DXPA 1GBDA 1O33A 3U98H 3S7HB 2BZ6H 1MTNB 1DM4B 1P2QA 1MKXH 3U9AH 2FOAA 2YNAA 5TJXA 1KDQA 1IQFA 1CA0B 3FP6E 1VR1H 4YLQH 4DG4A 3BIVH 2ZPRA 1AN1E 4AG1A 2CMYA 1P8VC 1WOFA 2ZFTA 1GI2A 4XOJA 1QA7A 3BEFB 1KXFA 2C8ZB 2ZQ1A 2C3SA 2G51A 2ZGJA 1WUNH 3PB1E 2ZGCA 4A1TA 4E06H 1CHOG 1W14U 3M5LA 1XVMA 2AYWA 2GCTC 4AB9A 1IQLA 1YCPM 5DP4A 1PPBH 2ZI2H 3NPSA 3GICB 2P94A 1W7GH 3P70B 1KLIH 3PWCA 1P2KA 1SGCA 3DHKH 2ANMH 2BLOA 1DLEA 1K1OA 1EUFA 1C5ZB 2P8OB 1C1TA 1LPKB 3MTYA 3A88A 4FVDA 3LT3A 2I6SA 4X6NA 2ZGHA 4INKA 1TFXA 1Z6EA 2BY9X 1GJDB 1P2NA 4XE4A 9ESTA 1P9UA 1SLVB 1C9PA 5F8TA 1LHEH 3MI4A 1OSSA 1Z6JH 1DWDH 4OGXA 2VH6A 1YPKH 5GXPA 2ZHFH 5FBIA 3BTEE 2J92A 1A1RA 1H8IH 1YCPH 1UTNA 3SI3H 1ZTKA 4FU7A 2G52A 2GKVE 2RA3A 2UUYA 1VJ9U 2AH4X 1L1GA 2AMPA 1OS8A 2B9LA 1O2HA 4X2YA 1HRTH 3RXJA 5HM9A 2Q6GA 2ANWA 3ATMA 2B7DH 2OC7A 3WY8A 2FPZA 5EGMA 2SGDE 3UQOA 4VGCB 5EXNA 3UQVA 1HGTH 1HAZB 4AN7A 3LU9B 1MD8A 3OX7U 3S9BA 2ZHQH 3SNCA 5DP8A 1C1MA 1YKTA 1ZMNA 1MBMA 1A4WH 1O2YA 3GY6A 2G8TA 1C4V2 3MO9A 3MU1A 5GCHF 4AGKA 5F6MA 2H5CA 1C4Y2 1ZR0A 1V2ST 2BD8A 2ZGBH 1V3XA 4B71A 3E90B 4QT8C 2DUCA 1ZPZA 1MU6B 2HWLB 1CHGA 1BTXA 2IPHA 4ZROA 1ELBA 2C93B 2GP9B 3F9FA 3C27B 4AG2A 1C5LH 2AGEX 3M3VA 3VB3A 1TGNA 1ZSJA 2BTCE 1TAWA 4B74A 2ZU2A 3Q3YA 3ZVDA 1W0ZU 4IS5A 2ZDNA 1A7SA 1W0YH 1O2KA 1VCQA 2XC4A 3U8RH 4MPVA 1D3QB 1DPOA 1TOCB 5DKMA 1O37A 4UDWH 1CT4E 2PLXA 3B8JA 2HNTF 3KN2A 3TNTA 4D8NA 2I6QA 3MWIU 3ENSB 5F03A 3AASA 2QGRA 4NGAH 3ZZ9A 4GHQA 7ESTE 1GGDC 2FI3E 1C5NH 1GVLA 4CR5A 2Y81A 2P59A 1V2JT 1O2WA 1XXDA 2P3TB 1TRMA 2CV3A 1V2WT 1Z71A 2QA9E 3SJKA 4Y8XA 1Z7KA 3T27A 2YNBA 1J17T 3E0PB 1AWHB 3NCLA 2A0QB 3A7ZA 1BB0B 4Y7AA 3QGJA 3RC4A 4AFSA 2OP9A 1TNJA 2WINI 2PV9B 2VVCA 2ZGXH 4TY7A 3E91A 2CHAC 2VINA 1BTHH 5FPSA 3A8BA 3OY5U 2QN5T 3PMJA 3RXAA 1F0UA 1AUTC 3TLOA 1O34A 2R3YA 1YCPK 1ETRH 1ZTLA 4RKOB 1HAVB 1SFQB 1O3BA 1T8NA 2XCNA 3BTHE 1FAKH 1KXEA 3M5OA 3UWJH 3RXHA 2QC2A 2BDCA 4JZFH 3QX5H 1K1PA 2ZHEH 3T62A 1P01A 2A4QA 3PMHB 4YESB 5L2YH 2VGCC 1OWEA 2WPKS 4ISIH 4E7RG 4KTSA 1UVTH 3TGIE 1MUEB 1E35B 2H9EH 2A45B 1P2IA 1OPHB 3V7TA 3TU7H 3MNCA 2VU8E 3MYWA 1GJ8B 4CRDA 4AFUA 4ZH8A 1S0RA 3SUGA 2RG3A 1GBHA 3ZVFA 1GHZA 1LHGH 2TRMA 2F9VA 2FYQA 3QTOH 1TPPA 1A2CH 1P3CA 1P57B 4K1SA 2K1QA 3MU4A 5I46H 1K28D 1XUJA 3SI4H 1DANH 2CXVA 3SNDA 2B8OH 2IN2A 1P3EA 4O03A 5DP6A 3JZ2B 5DP7A 2FESH 3Q3XA 1XKAC 3M7TA 2BD4A 1BA8B 2SNWA 1DE7H 1GBFA 2Z3EA 1KSNA 4LZ1H 3RXUA 1SHHB 4AFZA 5HMAA 4U32A 4INHA 2JH0D 3SBKA 1TGBA 4FU8A 5GJ4B 2BXTH 1D6RA 1O3EA 2ZKSA 2SGAA 2VIWA 4OS7A 1H1BA 1O39A 5H4IB 1J16A 2PHBA 2WPIS 2V0BA 5GIBA 3K2UA 5IDKA 3TGKE 3M7UA 1B5GH 5EG4A 1T4UH 2BXUH 2ZU4A 1UVOA 4YT7H 1TA6A 2SNVA 2JH6D 5T6GA 1O36A 3U1IB 1GMCG 1OX1A 2GT8A 4OS5A 1PPZA 2OC1A 2PSXA 1QA0A 3KHVA 4K8YA 3GY8A 1T8OA 1GI1A 4NSVA 3GCTG 2Y82A 1C9TA 3FANA 3SW2B 3SGQE 5FXLA 4WY3A 2FOCA 4Q7XA 1V2RT 1YPGH 1ELGA 4WMDA 3URCA 2SGPE 2CJIA 4I8GA 1BZXE 3FVFB 5FHTA 3O8DA 1CA8B 1NESE 2PFEA 2QYIA 4E7NA 1A0LA 1FXYA 4MNYA 5EQSA 2BZAA 3GDUA 3RLWH 1O2IA 1AE8H 1ZPCA 3AVZA 4BTUB 3MH6A 2BVSH 2BLVA 2ZDKA 4I8LA 1NRSH 4NA8A 2GZ8A 1HXEH 1O3DA 2BQWB 1EZQA 1CBWB 1HAVA 4Y79A 2ZEBA 1JBUH 4NZLA 2ZPSA 1ABIH 1OWDA 3D49H 3ESTA 1LPGB 1LHDH 2AFQB 3SU2A 3RDZA 1QJ7B 1C2GA 3SJIA 1C5SA 1O2LA 3SU3A 1M9UA 1XKBC 2BDBA 1N6XA 3OY6U 3RMOH 3ODFA 1AI8H 1DSTA 4ABIA 1JRSA 1MCTA 4ABFA 3ZVEA 2PTNA 3M7QA 2C4FH 1E36B 3L33A 4NWLA 3ZZ6A 2C8XB 1TPOA 2KAIA 3UR6A 1Y3WA 3GISB 2EI7A 3RM2H 4CREA 1FAXA 3BV9B 3A8DA 1BJUA 3A84A 1BMAA 3LIWA 3HKIB 3LOXA 3GY4A 4ABGA 2Y5HA 3MU5A 4O3UA 3DUXH 1ANCA 1ABJH 1E34B 1OWHA 5GPIB 3A82A 1C1SA 3PYHA 1BMLA 2OTVA 4WH8A 1ANDA 1C2FA 1GBKA 2O8LA 1LHFH 1W2KH 1GWAA 5ESBA 4RSPA 4ISNA 5EPNA 2F9NA 3I78A 3MNBA 4MVNA 1LPZB 5EXMA 1GHXH 3H7TA 1P09A 2ZFPH 1ELTA 4IGDA 1HAHH 5IYTA 1DY9A 3FZZA 1D3PB 2QF3A 1OWKA 1YF4A 2D8WA 1SGYE 3SQHE 2JETC 2ZWLH 2BOHB 1GG6C 2BDAA 4FUCA 4WMEA 2P3FH 3PTBA 1FNIA
chains in the Genus database with same CATH superfamily
4B75A 1TQ0B 4JZEH 1O35A 7KMEH 3SN8A 1G9IE 2GMTC 3FOAA 3PV5A 6CHAB 2XBWA 1TPAE 4D9RA 2XCFA 3B23B 5DP3A 3RMNH 2ZNKH 1MTUA 1UTPA 8KME2 1QQ4A 1ETTH 4ZKRU 1DITH 1BRUP 1O2GH 1PPFE 2GTBA 4NCYA 1GL0E 3E1XB 1Y5UT 4HGCA 1FIWA 1O3FA 2Y80A 1GDUA 1VCPA 1BCUH 3TH3H 1VITH 2ASUB 1F2SE 3NK8A 5BPEA 3VB6A 1QR3E 3TVJB 3E8LA 4HG6A 2FLBH 3PLKA 4FU9A 1NT1A 3BTGE 1SQTA 2ZU3A 5E2OA 3TNSA 1UK3A 3UOPA 2Z6BD 3SU5A 1SL3A 4U30A 2AERH 3VFEA 2RCEA 1RIWB 1N8OB 1PQ5A 1RD3B 3LPRA 3PWBA 1BRCE 1CGHA 1OWIA 1G30B 2W6ID 3A7WA 2HNTC 2A31A 1H8ED 1FI8A 4WWYA 1O3NA 4BANB 5FX5A 2KM0A 2THFB 5TCAA 1MCVA 1G36A 2HOBA 2NWNA 4XBDA 1K21H 1TE0A 1ZHRA 3M3SA 5EQRA 3PROA 3QDZB 4CHAB 4M9FA 4BAOB 2FWWA 3RXMA 2AEIH 2BVXH 5ESTE 1SGDE 4BOHA 5A8XA 1F0RA 1G3BA 3MH4A 3TPIZ 2GZ9A 3MOCA 3EAJA 1SBWA 1ZHMA 1BJVA 1W12U 2BB4A 1K2I1 2J2UA 3W1EA 1Y3VA 1MTNC 1UTJA 3OYPA 4IN1A 1CVWH 4UFDH 4DJZB 3GYMA 3MO3A 5EPYA 1TONA 2BY5X 2W3IA 1MD7A 1CA0C 3BEUA 1C2JA 1GMHF 2EA3A 1THSH 4Y71A 2GGVB 3BTFE 3T29A 1ZSKA 2VBCA 2Z3CA 3O8CA 1UK4A 1INCA 2BQ6B 3H7OA 1W8BH 2BVRH 2F9PA 3F2HA 2AGIX 3LONA 1D4PB 4MNVA 4CRAA 3GY2A 4JYVH 1NM6A 3ZZ5A 5TCCA 2ZIQH 2GX4A 3VPKA 4TWWA 1W0JD 2P95A 4GSOA 1AKSB 2AGGX 3SGBE 2P8OC 2Y7XA 3P8FA 2WHXA 1AY6H 3SNEA 2FIRH 1TGSZ 4ABHA 4XRNA 1KXAA 1P2OA 1P9SA 1GBJA 3M37A 1TBQH 1A5GH 1YGCH 5CMXH 1AD8H 4NFFA 1PYTD 2QXJA 1FX0B 4I33A 5E0JA 2KR7A 1C2KA 3AAUA 4FUHA 2R0KA 3KNXA 4X8SH 1XVOA 4ZHAA 1A5IA 2VIDA 4IMQA 5E2PA 4A7IB 4FETA 1Y3XA 1HUTH 1V2LT 2YMSD 2FODA 1O5EH 3DFLA 2P16A 1GBBA 1PQAA 2W7UA 3P17H 1IQHA 2Y5GA 2FOHA 1ANBA 1F5KU 1E1RD 3A83A 3C1KA 1UMAH 4YT6H 2HNTE 3BF6H 2Z9LA 1LMWB 1EB1H 2A4GA 3PO1B 1C5YB 1ZJDA 3M61U 1WU1A 2WUBA 4K5ZA 1DUEA 8GCHF 3MMGA 1C2DA 1O2NA 4CH8B 4VGCC 4Q4LA 1FMGA 2GDDA 3TK6A 1NPMA 2B0FA 5T6DA 1UCYH 1GJ4H 2XW9A 2OUAA 1C5OH 1ANEA 1TNHA 3L6PA 3RU4D 4GPGA 1H4WA 4Q7ZA 1HDTH 1K1JA 1O2OA 3SUFA 1ARCA 4K60A 4B1TA 1Z8JB 1X7AC 1KTTB 5LPEA 1P2JA 3LGVA 2FEQH 3ZV9A 1P11E 2D1JA 3KQDA 4ZHMU 4Y7BA 5E0HA 3O8RA 4IC5A 5B6LA 4FXGH 3RXOA 1QGFA 2XC5A 4RT1A 1J15A 4X1PU 4NZQA 4UFGH 1F5LA 4X2XA 2QV1A 4SGAE 5J4SA 4OS1A 4U2WA 1P2MA 1E37B 1Y5BT 4TPIZ 3KIDU 1KY9A 5BRRE 1G37A 4NA7A 3LGYA 1J14A 1SR5C 2QIQA 3HATH 1UVUH 4K2YA 2B5TB 1A3BH 3ATWA 2JH5D 1YPJH 3RXFA 3SNAA 1OXGA 3Q77A 2O8UA 4XDEA 1AUJA 3LDXH 4H6TA 3M5MA 2VJ1A 2FM2A 5C67A 1O5GH 1OP8A 2VNTA 3U69H 1XXFA 1O2RA 4ZKOU 2F3CE 3N99A 2J5UA 3RXSA 3SJOA 3ZZBA 4WF8A 1S6LA 1KXDA 1GBEA 2DE8A 4IMZA 3RXPA 1RJXB 3U8OH 4CH2B 1DFPA 4DURA 1NS3A 1YLCA 4NWKA 1P02A 1UHBA 1SLUB 2GDEH 2FS9A 3ZZ8A 3VGCB 3BG4B 1ZRBA 2Q6FA 1AFQB 2STAE 5B6OA 3DSOA 3VXEH 3W94A 1H9HE 2RA0A 4AFQA 4CBNA 2XTTB 4DY7B 4K3JA 1GVZA 1LKAA 2BX4A 2FI4E 1S83A 3RM0H 3SV9A 2ZDLA 2BD3A 4I32A 4Z1MD 5EW2H 1UW7A 1P05A 2GV7A 3PTNA 4DT4A 1GHAF 2ZA5A 1QFKH 2A2QH 3CP7A 1HAXB 3SOSA 2FI5E 4DGJA 1THPB 1SVPA 1BBRH 1A0HB 1TNIA 2W7SA 5JBBS 1DUAA 2UWOA 1DWBH 1N1LA 1GI7B 4TPYA 4TWYA 1AQ7A 2EEKA 3E16B 5CHAB 1Y8TA 1SOTA 3EE0B 2V35A 1O3GA 4FUFA 4I7YH 1T31A 2Z9IA 2VIQA 2J4IA 1HNEE 1TRNA 1WQSA 1TOMH 3T26A 3ZYDA 1IQNA 4NA9H 1V2MT 2ZU5A 1IOEA 1E38B 1UCYK 1EXFA 1JOUB 1ELVA 1O5FH 1QBOA 3MU0A 1KXBA 3UNRA 2NU3E 5A0AE 1BUIA 1YLDA 4MPUA 3GY3A 4ESTE 4ZUHA 1HIAB 1O2QA 5C94A 1NO9H 1RTFB 1XUIA 2ZPQA 3ZZ7A 2BDGA 1Q3XA 3TJVA 5LPRA 3HK3B 1FY4A 2Z3DA 3RXKA 1YYY1 3AAVA 3SGAE 1T4VH 1IQKA 2Z7FE 3F9GA 3A8CA 4ABDA 1VCWA 2ZTYA 1W11U 2XWAA 5DP9A 1FQ3A 5LGOA 2VB0A 4HI3A 5C1XA 1VGCB 2Z94A 2QF0A 3WW7A 3K9XB 4YO9A 5CE1A 1C5UA 1J8AA 4CBOA 3F0PA 1T8MA 1SPJA 1C1QA 1BRAA 1TQ7B 2ZDAH 3I29A 2FOFA 4FUBA 2QCYA 3E6PH 2KCPA 5IK2D 2ZFSA 3SV6A 3A7XA 4B2CA 5C3NA 1WTGH 1ESAA 2PW8H 3UB0A 1EAWA 3HPTB 3P92A 4GAWA 2D2DA 4CR9A 4KKDA 1K1LA 4XFQA 2XRCA 1JMOH 2FTLE 1C1WH 3DFJA 2OK5A 2VVUA 2IPQX 2XBVA 4XSKU 1BTUA 1MZDA 4I86A 3NWUA 4JCNA 4NIYA 3BSQA 3DA9B 5K7RA 1Y59T 2WV5A 1UTQA 3PRBA 4R0IA 1AB9B 1WTHD 1WXRA 1RXPA 5DG6A 1PYTC 1QQUA 1F5RA 3IITA 3AK5A 1C1PA 1SGEE 3Q00A 2P3UB 2VWMA 1QJ6B 3RXCA 2L6OA 3RXLA 5EIYA 3KQEA 1O3IA 1Q31A 1XM1A 2PUXB 3QLPH 1BBRK 1ZGVA 5LPFA 1V2OT 2ALVA 3L3TA 2HALA 1A0JA 4UE7H 5EJ1A 3STJA 1D9IA 3EA9A 1OYQA 1W10U 3RXIA 1XUGA 2ODPA 4FUGA 5AFYH 5L30H 1CBWC 1JWTA 1G32B 4D7GA 2GD4B 1A46H 1LO6A 5EQQA 2FTMA 2P93A 4X2WA 2XBYA 4YOGA 5HM2A 4YTAA 1BHXB 1SMFE 3F2FA 1C5WB 1GCTB 3MU8A 5SGAE 4X1SU 1O31A 1GI6A 3EYDA 1BTZA 1K22H 5C1YA 3TK5A 2HGTH 3LJOA 3OFND 3FP7E 1EZXC 4NIXA 1NFYA 4X6PA 1C2EA 3HGPA 1E0FD 2WYJA 3ZVAA 2YMSB 1AWFH 1YC0A 1LCYA 1QRWA 1SGIB 1SGPE 6GCHF 4DCDA 4K1EA 4XBCA 2A32A 1HIAA 5ETXA 5ABWA 4MG3A 1HJAB 4LZ4B 2WYGA 1GBIA 3SU4A 1SLXB 2ZDVH 4PROA 3R3GB 1S6FA 4I8HA 2OQ5A 1GMDG 1GMHG 3DD2H 1PPGE 2FYRA 4ABJA 2LELA 1HAPH 1EX3A 1BOQA 4ZMAH 2Q6DA 4AB8A 3K6ZA 5FPTA 3UNSA 2W3KA 3UPEA 5AHGH 1EPTB 1QBVH 1PPEE 4X8VH 2M5TA 8ESTE 3SU6A 2H6MA 2ULLA 5A0BA 1IAUA 1F0SA 4UD9H 2XOKD 1C5QA 2ZCLP 2ODYB 1D3TB 1QB1A 4DOQA 2BLQA 1C5RA 2F83A 4E05H 2R2WU 2GT7A 4F49A 1GHBF 1NBMD 1QCPA 2FMJA 3BTDE 1AU8A 1G2MA 3TJNA 1XMNB 3BN9A 1DWEH 2QAAA 1WV7H 3M35A 1VITF 3A86A 2WV4A 3RXGA 1O3JA 1YPEH 3S69A 2BLWA 5T6FA 3TJUA 6CHAC 2NU0E 1O5AB 4ZKNU 1ELEE 1GDQA 4K69A 1FUJA 4AYYB 2FZZA 4UONA 1UVPA 1HBTH 1B0FA 1EJNA 1LKBA 2Y7ZA 3D65E 4H4FA 3EA8A 1C1NA 4THNH 3TIUA 4HFPB 3PV4A 1ID5H 1LQEA 4NIWA 2FOMB 2XWBI 4B6FA 2ZC9H 3SV7A 2V7QD 4D9QA 1ZSLA 1KLTA 8LPRA 8GCHG 3UY9A 2J38A 1P03A 1G3CA 1O2TA 3MH7A 2CN0H 3ZVCA 1GI4A 1WSSH 1Y3UA 1QB9A 4IBLH 1SGTA 1EAIA 1NRPH 4CRFA 4A1VA 3BG8A 1HCGA 3CS0A 3GCOA 4Q7YA 5JDUB 2FLRH 1RIWC 1ELDE 1N8OC 3BIUH 4K8BA 3RU4E 2ZP0H 5A8YA 1K9OE 4LOYH 3E3TA 4HTCH 1EKBB 3D62A 5GNDA 3M5NA 1GI5A 1T7CA 5KECA 1RRKA 3F6UH 2PTCE 2NU1E 3SJ8A 4UFEH 2Y6TA 5EODA 3V3MA 5I25A 3MNXA 3LC3A 1IQGA 1B0EA 2BM2A 4OGYA 1XX9A 1CGIE 1AVWA 2G00A 4MQAA 4CHAC 5E8EH 1TABE 2HPPH 1PPCE 2CGAA 1O5BB 1DLKB 2JJ2D 1GJAB 2A1DB 3KCGH 5HYOA 4ZXXH 1KYNA 3T5FH 3ZZCA 4H6SB 2ESTE 3T2NA 1F7ZA 2QY0B 2UWPA 2J94A 1C5MD 3RP2A 1FPHH 2VVVA 4F55A 3RXDA 3LKWA 2ZO3H 4ABAA 5AF9H 2PP6A 2TPIZ 1O3OA 1TALA 1JRTA 4UFFH 3U1JB 2PGBB 1AZZA 5JB8S 3SHCH 3RMLH 1FPCH 3OEED 1BMFD 3AW0A 1BHXF 3ZZ3A 4GUXA 2ZTZA 2BD9A 1GPZA 3SUEA 3KL6A 1QL7A 4Y76A 1LVYA 1O2XA 2A4OA 1A61H 1Q2WA 2IOTA 1ZZZA 1FIZA 2K8IA 3S0NA 1CT2E 3MO6A 2R9PA 1BTYA 1MMJN 2F9UA 3SU0A 3LGWA 3LH1A 4MTBA 3TH4H 1EPTA 3TK9A 1YLNA 1V2UT 1FJSA 1SGRE 2V3HH 4ZAEA 1L1NA 2PKSB 2QXGA 1Z8IB 3CS7A 3OEHD 1O3PB 1HJ8A 1IHSH 4F48B 1G3DA 2WPJS 2GV6A 1W13U 2PKAB 2BY6X 2LPRA 4ZKSU 1TX6A 3OSYA 3RXEA 3H09A 1GHAG 1TNKA 1EZUC 2BD7A 1GMDF 2BX3A 1RTLA 3FAOA 1EZSC 1QY6A 4H42U 5HIYA 2BDYA 3LH3A 1HXFH 1AZ8A 3D23A 7GCHG 1MABB 2FOEA 1O2PA 1OP0A 4B76A 1AHTH 1O3AA 3EA7A 1H9IE 5DPAA 1DOJA 1PQ8A 1S6HA 2R0LA 3GCHB 1GCDA 4FUIA 5FAHA 3G01A 3KYGA 2ODQA 1FY5A 5DJ7A 2FP7B 1BQYA 1P04A 2BY8X 3ZZ4A 5JPMH 3SV8A 3RU4T 1EB2A 2JKHA 4J2YB 2ZU1A 2J9NA 3P95A 3PO1C 2O8MA 4OS6A 2ILNA 5DK1A 4ABBA 1MTSA 2EI6A 2A5KA 1TRYA 3QTVH 3F68H 1P10A 4X6OA 1DS2E 2PGQB 2PUQH 2HVXA 4ZXYH 1C5XB 2AIPA 2G5NA 3HGNA 4MPXA 3UREA 1LHCH 3A80A 1SKYE 2FDAA 3U28C 2ZFQH 1LVMA 3MH5A 1GI8B 2GCHG 2VWOA 1OWJA 1UTOA 2H5DA 2OC0A 1EAXA 1EP6A 1V2NT 1SQRA 4GLYA 1C5VA 1O0DH 1TIOA 4BXWA 1O30A 2F43B 4B2BA 1VZQH 1GL1A 4BAHB 1FV9A 1QBNA 1S0QA 3F3BA 4FUJA 5EJLA 2C8YB 5LH8A 2O9QA 1SGNE 5JBTA 4Y11E 4AORA 4IW4E 1SOZA 3BTQE 1MU8B 1OYTH 2BDIA 3RUOA 3RXQA 2ANKH 1IQEA 3BTWE 2Z9GA 1HV7A 4J1YA 2Y5FA 3EQ0H 2BQ7B 2FS8A 3WWFA 1IHTH 1OOKB 1YY3A 3ITIA 3A7TA 1GBMA 2KZ4A 2CF8H 1ZYOA 1MAYA 2ZFFH 4CRCA 4UEHH 5AVDA 1QRXA 1CQQA 2BOKA 1V2QT 2ZF0H 2H9HA 1AFEH 2TGAA 4O3TA 1GJ9B 2FX4A 1SQAA 5L2ZH 4AX9H 1O5DH 4OS4A 2OBOA 1GJ7B 3T25A 1S5SA 3UR9A 2BD5A 1S84A 1AVXA 1ZHPA 2F91A 2ZQ2A 1OP2A 1ZMLA 1NRRH 4X1QU 1NU7B 1AO5A 1SSXA 1QIXB 1MBQA 1QRZA 4D76A 3OE7D 3GY5A 9LPRA 5DGJA 4MNXA 4A1XA 3ZZAA 1U6QA 2AHME 1EOLA 2GCTB 3QZRA 1SHYA 1TB6H 2H1UA 3BEIB 4ABEA 3VGCC 3BG4C 5EOKA 1AFQC 1D3DB 3FP8E 3F2GA 4B2AA 4M7GA 1Y5AT 1C1RA 1V2VT 1FONA 2BMGB 2SGFE 5HXFA 1AGJA 1COWD 1TX7A 1C2MA 2PKAA 2RDEA 1ZRKA 4ASUD 2YOLA 1V6DA 5FCRA 1V2TT 3UOUA 2HRVA 1RGQA 2A7JA 4TYDA 2OCVB 1H8DH 2O8WA 1HYLA 1WBGB 4DVAU 4DIIH 1QB6A 1L2EA 3F9EA 4ASHA 2TIOA 1BT7A 2QF5A 4DIHH 2NU2E 4NG9H 2GZ7A 3TITA 2VWNA 1BIOA 3SV2H 3WWBA 3M36A 1O2VA 1ZLRA 3SQEE 1O2SA 2IJD1 4NSYA 1T32A 4Y0ZE 1NRQH 4Y0YE 3JZ1B 5CHAC 1FLEE 1HAGE 1NZQH 4JMYA 1GVKB 1ETSH 2V3OH 1H8HD 1DDJA 1AKSA 3OU0A 5T3HA 5A2MH 3SUDA 4Y8YA 3GOVB 1AIXH 1AVGH 4MLFB 1HAIH 3S9AA 1NFUA 6GCHG 2PR3A 4NFEA 1DX5M 3SU1A 4HZHA 1YBWA 1IQIA 1Z8RA 3KEEA 1MKXK 3OAAD 4Y10E 4A92A 2ZDMA 1GJCB 1ESTA 1ACBE 1NRNH 2HLCA 5C0TA 4XD7D 1AMHA 4JZ1A 7GCHF 4BAMB 2AS9A 3F0OA 5JBAS 3NXPA 3UFAA 1YPHC 1VJAU 1SGQE 4ISLA 1GBAA 1C2LA 1EATA 1E1QD 1MAXA 1O38A 5EJZA 1WQVH 2ZFRH 3SORA 3H5CB 1EASA 3PV2A 5CHBA 3SZEA 1ZJKA 3ZYEA 1TNLA 1BDAA 1TX8A 4TT3D 1VGCC 3GY7A 3BTTE 6LPRA 3SO3A 1FDPA 3V13A 3PMAB 5J4QA 1GJ5H 4WH6A 4FOUC 1V2KT 4YLUA 1NN6A 1EQ9A 2KCOA 1D6WA 1O2UA 3ATLA 2O8TA 1GHBG 3FKSD 2H9TH 3QN7A 5JYIA 1LVOA 2IJOB 3ZZDA 2ANYA 2BHGA 2J34A 1ARBA 5F8XA 1CGJE 4AGJA 1C2HA 2ZZUH 4JK5A 4FUEA 4Y8ZA 2R2MB 1W7XH 1P12E 5HGGA 3UNQA 1QNJA 1VITG 2GCHF 5C2ZA 1GGDB 1SGFG 1MH0A 1HPGA 1UVSH 1B7XB 2XYAA 4ZCNA 4K1TA 1EOJA 3QGNB 1ORFA 3UWIA 1GI9B 1EAUA 1C1UH 1UK2A 1O32A 4GCHG 4XBBA 3VB5A 4DW2U 5GWZA 1A5HA 1CHOF 3KQBA 3KQCA 3A85A 1DWCH 4KTCA 2BDHA 2DE9A 2TBSA 4RN6A 4INLA 3ATIA 1O3LA 1EJAA 2XNDD 3SYJA 1Z8GA 2F9BH 2XXLA 1AB9C 4TY6A 4MDSA 4O9VA 5FX6A 2STBE 5PTPA 2G81E 1CE5A 1HLTH 4IC6A 2CHAB 1OHHD 5GDSH 4Z0KA 1VKYA 3HKJB 1DT2A 1CT0E 1QTFA 3A7VA 3Q3KA 4DT7B 5C5NA 1GJBB 2VIOA 4A6LA 1TGTA 1BMNH 1KTSB 2KCYA 1CSOE 4AC9A 2KAIB 1MQ6A 2XNIA 2AMQA 2OC8A 3DSGA 3ZVBA 3K65B 3URDA 1FY8E 1YPLH 2J98B 2NU4E 3S9CA 2FO9A 1MZAA 3S7KB 2A5IA 2BD2A 1YPMH 1C1VH 2VGCB 4YOJA 4NIVA 2F9OA 3A89A 2BY7X 3FFGA 1GCTC 2C90B 1RTKA 1S82A 2ALPA 4KELA 1YPHE 3KF2A 2VIPA 4YOIA 1Z1IA 2G4UA 1FZZA 2RDLA 2Z9KA 4WXVA 1L1JA 1WYKA 3N7OA 1YM0A 1QL9A 4OS2A 4U01A 2PWXA 2YMSC 3PLBA 4MPWA 2QE7D 2W26A 3W95A 2ZTXA 3TGJE 1C5TA 3KGPA 1QHRB 4JZDH 1BITA 1HJAC 4JZIA 4Q2KA 1FN8A 1QL8A 1TMUH 2AMDA 1HJ9A 4AOQA 1O3HA 2WPHS 2G4TA 4YZUA 1MTVA 1PJPA 2TGTA 1HB0B 3RXRA 4Q80A 4JYTA 1TNGA 1C1OA 2D26C 4A5TS 5G4BA 4WXIA 3EDXB 1TBRH 4D7FA 3ODDA 3ELAH 2WUCA 1FY1A 1J9CH 3UTUH 3R0FA 1PFXC 2CF9H 1NC6A 1EPTC 1NFWA 2VH0A 3NZIA 2Q1JA 4X8UH 1HAYB 4BAQB 3E0NB 1GBTA 4X0WU 4X1NU 4OM9A 1G3EA 1GHWH 2OQUA 2W6JD 3BTKE 3IWMA 1E79D 4RT0A 4BXSA 3RLYH 4BAKB 3QK1A 2VIVA 3A87A 1L4DA 1UTMA 3LGUA 1TA2A 1XUFA 2VWLA 3B9FH 2H2ZA 2HPQH 1BTWA 3ATKA 2OD3B 3NRLA 4AYVB 1DSUA 1BTPA 4CRBA 5JB9S 2ZECA 1T8LA 2A5AA 4WJG2 2QF4A 1NROH 1ZPBA 1O2MA 3VG8A 1O3CA 3HK6B 1RS0A 1SGFA 2SFAA 1K1MA 2JDID 1O2ZA 3AW1A 3SJ9A 4I8JA 1P0SH 4B6EA 5EW1H 1EFRD 1XUKA 1BMMH 3GYLB 1TPSA 2ZG0H 3MNSA 3SNBA 2LNCA 3GCNA 1SQOA 1THRH 1QJ1B 4ISOA 2XBXA 4I8KA 7LPRA 3MFJA 1C5PA 1W0KD 3BTME 1MKWH 5L6NH 4X8TH 1C2IA 1JIRA 3T28A 1LTOA 4RI0A 4YM9A 3V12A 3LC5A 1UO6A 1Z1JA 1L4ZA 1GI0A 1YWUA 4AZ2B 3OTJE 1A3EH 1GJ6A 1KIGH 1BRBE 1MQ5A 3VB4A 4ZHLU 1S85A 1XUHA 3RXTA 1ELFA 2OLGA 2J98A 3STIA 4GCHF 1LVBA 5DP5A 4B73A 1TMTH 1KXCA 2OINA 3RXVA 1TLDA 1EP5A 1CU1A 3TJOA 3P6ZB 3Q76A 1F92A 3VB7A 4WMFA 3K6YA 3UUZA 1ZGIA 4MNWA 4Y6DA 1TWXB 2AIQA 3ZVGA 1ZTJA 1GI3A 4R8TB 3EGKH 4X6MA 4ISHH 2UUKB 3DT0H 3F1SB 1FN6A 4JYUH 4O97A 3A81A 3PLPA 3IG6B 1HFDA 3FZDA 2C8WB 3LJJA 1UCYE 3VXFH 1F0TA 1SC8U 1TGCA 1KDQB 1H9LB 2EC9H 5FPYA 1UTKA 6ESTA 3QWCH 3V0XA 2G55A 1HAOH 2WPMS 1UJ1A 2TGPZ 2ZHWH 5EU8A 3TH2H 4WVPE 5C17A 1GHYH 1GHVH 3P8NA 4X1RU 1L0ZA 1FY3A 5K0HA 3QO6A 1O3MA 2QXIA 4IN2A 4KTUA 2LP6A 5EXLA 3ZIAD 4BTIB 3LGIA 3PMBB 1NFXA 1G2LA 1ELAA 2G5VA 4X2VA 1LDTT 3GDSA 1NTPA 4SGBE 2EI8A 5DN6D 3ZV8A 2OXSA 1MTWA 3A7YA 4GHTA 1UTLM 2FOBA 4LK4A 1LQDB 2PKSC 3A8AA 2OBQA 3MHWU 2SGEE 3GDVA 5FCKA 3M3TA 1SFIA 2FOGA 1NU9A 4KP0A 2JETB 4F4OC 1K1IA 2WPLS 1GG6B 2JJ1D 2Z9JA 5A8ZA 2PSYA 5JBCS 4BTTB 1TBZH 1RFNA 2W5EA 1IQMA 5T1VA 1JXPA 2A7HA 1DICA 2QXHA 5GCHG 1DY8A 3NKKA 1GMCF 2GMTB 1GDNA 1DXWA 2UUJB 3NUMA 1PQ7A 5F8ZA 3O8BA 2XC0A 2V6NA 3U8TH 5E0GA 2M2AA 3GCTF 3UIRA 2V3MA 1ZOMA 2ZCHP 1CO7E 3PM3A 2UUFB 2UWLA 1WCZA 3GCHC 5DO4H 1SI5H 5A0CA 1TYNA 1K1NA 5C5OA 1MKWK 1O2JA 4RKJB 4I31A 4GVUA 2BYAX 1QURH 4P02A 3RMMH 3VEQB 5FBEA 4LXBH 1P06A 1DVAH 2FXRA 1ZMJA 3CENA 3RC5A 5C1UA 2R3UA 1W3CA 1KLJH 1V2PT 3F9HA 1WAYB 1N6YA 1Y3YA 4Z6AH 1SG8B 3P8OA 2A4RA 1WDIA 1O5CB 1ESBA 3SHAH 1SLWB 1O3KA 1SB1H 5A09A 2ZHDA 2TGDA 2A7CA 1S81A 1ELCA 3QZQA 1BBRE 1NY22 1YP9A 2GJGA 1TMBH 4JK6A 3I77A 1C4U2 1JIMA 3SZNA 2FX6A 1IQJA 2ZCKP 1GBCA 3P8GA 3QUMP 1GBLA 2J95A 5C20A 2SGQE 3LGTA 3RC6A 1PPHE 1UHBB 3RXBA 4BNRA 2WPDD 1OKXA 2A2XH 4FVBA 4KGAA 4FUDA 2GVFA 1EJMA 1AE5A 2EY4C 5AFZH 4CRGA 1DXPA 1GBDA 1O33A 3U98H 3S7HB 2BZ6H 3DSPA 1MTNB 1DM4B 1P2QA 1MKXH 3U9AH 2FOAA 2YNAA 5TJXA 1KDQA 1IQFA 1CA0B 2K0QA 3FP6E 5F53A 1VR1H 4YLQH 4DG4A 3BIVH 2ZPRA 1AN1E 4AG1A 2CMYA 1P8VC 1WOFA 2ZFTA 1GI2A 4XOJA 1QA7A 3BEFB 1KXFA 2C8ZB 2KCAA 2ZQ1A 2C3SA 2G51A 2ZGJA 1WUNH 3PB1E 2ZGCA 4A1TA 4E06H 1CHOG 1W14U 3M5LA 1XVMA 2AYWA 2GCTC 4AB9A 1IQLA 1YCPM 5DP4A 1PPBH 3EE7A 2ZI2H 3NPSA 3GICB 2P94A 1W7GH 2CK3D 3P70B 2KX4A 1KLIH 3PWCA 1P2KA 1SGCA 3DHKH 2ANMH 2BLOA 1DLEA 1K1OA 2HLDD 1EUFA 1C5ZB 2P8OB 1C1TA 1LPKB 3MTYA 3A88A 4FVDA 3LT3A 2I6SA 4X6NA 2ZGHA 4INKA 1TFXA 1Z6EA 2BY9X 1GJDB 1P2NA 4XE4A 9ESTA 1P9UA 1SLVB 1C9PA 5F8TA 5KGOA 1LHEH 3MI4A 1OSSA 1Z6JH 1DWDH 4OGXA 2VH6A 1YPKH 5GXPA 2ZHFH 5FBIA 3BTEE 2J92A 1A1RA 1H8IH 1YCPH 1UTNA 3OTPA 2HVYB 3SI3H 1ZTKA 4FU7A 2G52A 2GKVE 2RA3A 2UUYA 1VJ9U 2AH4X 1L1GA 2AMPA 1OS8A 2B9LA 1O2HA 4X2YA 1HRTH 3RXJA 5HM9A 2Q6GA 2ANWA 3ATMA 2B7DH 2OC7A 3WY8A 2FPZA 5EGMA 2SGDE 3UQOA 4VGCB 5EXNA 3UQVA 1HGTH 1HAZB 4AN7A 3LU9B 1MD8A 3OX7U 3S9BA 2ZHQH 3KQ5A 5DP8A 3SNCA 1C1MA 1YKTA 1ZMNA 1MBMA 1A4WH 1O2YA 3GY6A 2G8TA 1C4V2 3MO9A 3MU1A 5GCHF 4AGKA 5F6MA 2H5CA 1C4Y2 1ZR0A 1V2ST 2BD8A 2ZGBH 1V3XA 4B71A 3E90B 4QT8C 2DUCA 1ZPZA 1MU6B 3DCLA 2HWLB 1CHGA 1BTXA 2IPHA 4ZROA 1ELBA 2C93B 2GP9B 3F9FA 3C27B 4AG2A 1C5LH 2AGEX 3M3VA 3VB3A 1TGNA 1ZSJA 2BTCE 1TAWA 4B74A 2ZU2A 3Q3YA 3ZVDA 1W0ZU 4IS5A 2ZDNA 1A7SA 1W0YH 4ACBA 1O2KA 1QZ8A 1VCQA 2XC4A 3U8RH 4MPVA 1D3QB 1DPOA 1TOCB 3FO8D 5DKMA 1O37A 4UDWH 1CT4E 2PLXA 3B8JA 2HNTF 3KN2A 3TNTA 4D8NA 2I6QA 3MWIU 3ENSB 5F03A 3AASA 2QGRA 4NGAH 3ZZ9A 4GHQA 7ESTE 1GGDC 2FI3E 1C5NH 1GVLA 4CR5A 2Y81A 2P59A 1V2JT 1O2WA 1XXDA 2P3TB 1TRMA 2CV3A 1V2WT 1Z71A 2QA9E 3SJKA 4Y8XA 1Z7KA 3T27A 2YNBA 1J17T 3E0PB 1AWHB 3NCLA 2A0QB 3A7ZA 1BB0B 4Y7AA 3QGJA 3RC4A 4AFSA 2OP9A 1TNJA 2WINI 2PV9B 2VVCA 2ZGXH 4TY7A 3MQKC 1NBME 3E91A 2CHAC 2VINA 1BTHH 5FPSA 2L74A 3A8BA 3OY5U 2QN5T 3PMJA 3RXAA 1F0UA 1AUTC 3TLOA 1O34A 2R3YA 3GS9A 3N7DA 1YCPK 1ETRH 1ZTLA 4RKOB 1HAVB 1SFQB 1O3BA 1T8NA 2XCNA 3BTHE 1FAKH 1KXEA 3M5OA 3UWJH 3RXHA 2QC2A 2BDCA 4JZFH 3QX5H 1K1PA 2ZHEH 3T62A 1P01A 2A4QA 3PMHB 4YESB 5L2YH 2VGCC 1OWEA 4Q63A 2WPKS 4ISIH 4E7RG 4KTSA 1UVTH 3TGIE 3UAIC 5HKKD 1MUEB 1E35B 2H9EH 5FL7D 2A45B 1P2IA 1OPHB 2J97A 3V7TA 3TU7H 4ACAA 3MNCA 2VU8E 3MYWA 1GJ8B 4CRDA 4AFUA 4ZH8A 1S0RA 3SUGA 2RG3A 1GBHA 3ZVFA 1GHZA 5KEDA 1LHGH 2TRMA 2F9VA 2FYQA 3QTOH 1TPPA 1A2CH 1P3CA 1P57B 4K1SA 2K1QA 3MU4A 5I46H 1K28D 2WSSD 1XUJA 3SI4H 1DANH 2CXVA 3SNDA 2B8OH 2IN2A 1P3EA 4O03A 5DP6A 3JZ2B 5DP7A 2FESH 3Q3XA 1XKAC 3M7TA 2BD4A 1BA8B 2SNWA 1DE7H 1GBFA 2Z3EA 1KSNA 4LZ1H 3RXUA 1SHHB 2JIZD 4AFZA 5HIZA 5HMAA 4U32A 4INHA 2JH0D 3SBKA 1TGBA 4FU8A 5GJ4B 2BXTH 1D6RA 1O3EA 2ZKSA 2SGAA 2VIWA 4OS7A 1H1BA 1O39A 5H4IB 1J16A 2PHBA 2WPIS 2V0BA 5GIBA 3K2UA 5IDKA 3TGKE 3M7UA 1B5GH 5EG4A 1T4UH 5C0UA 2BXUH 2ZU4A 1UVOA 4YT7H 1TA6A 2SNVA 2RFKC 2JH6D 5T6GA 1O36A 3U1IB 1GMCG 1OX1A 2GT8A 4OS5A 1PPZA 2OC1A 2PSXA 1QA0A 3KHVA 4K8YA 3GY8A 1T8OA 1GI1A 4NSVA 3GCTG 2Y82A 1C9TA 3FANA 3SW2B 3SGQE 5FXLA 4WY3A 2FOCA 4Q7XA 1V2RT 1YPGH 1ELGA 4TSFD 4WMDA 3URCA 2SGPE 2CJIA 4I8GA 1BZXE 2WZQA 3FVFB 5FHTA 3O8DA 1CA8B 1NESE 2PFEA 2EQNA 2QYIA 4E7NA 1A0LA 1FXYA 4MNYA 5EQSA 2BZAA 3GDUA 3RLWH 1O2IA 1AE8H 1ZPCA 3AVZA 4BTUB 3MH6A 2BVSH 2BLVA 2ZDKA 4I8LA 1NRSH 4NA8A 2GZ8A 1HXEH 1O3DA 2BQWB 1EZQA 3PRDA 2WV9A 1CBWB 1HAVA 4Y79A 2ZEBA 1JBUH 4NZLA 2ZPSA 1ABIH 1OWDA 3D49H 3ESTA 4YXWD 1LPGB 1LHDH 2AFQB 3SU2A 3RDZA 1QJ7B 1C2GA 3SJIA 1C5SA 2F4LA 1O2LA 3SU3A 1M9UA 1XKBC 2BDBA 1N6XA 3OY6U 3RMOH 3ODFA 1AI8H 1DSTA 4ABIA 1JRSA 1MCTA 4ABFA 4P00A 3ZVEA 2PTNA 3M7QA 2C4FH 1E36B 3L33A 4NWLA 3ZZ6A 1KMHB 2C8XB 1TPOA 2KAIA 3UR6A 5CDFE 1Y3WA 3GISB 2EI7A 3RM2H 4CREA 1FAXA 3BV9B 5DSFA 3A8DA 1BJUA 3A84A 1BMAA 3LIWA 3HKIB 3KYFA 3LOXA 3GY4A 4ABGA 2Y5HA 3FN8A 3MU5A 4O3UA 3DUXH 1ANCA 3CNRA 1ABJH 1E34B 1OWHA 5GPIB 3A82A 2KFWA 1C1SA 3PYHA 1BMLA 2OTVA 4WH8A 1ANDA 1C2FA 1GBKA 3N7EA 2O8LA 1LHFH 1W2KH 1GWAA 5ESBA 4RSPA 4ISNA 5EPNA 2F9NA 3I78A 3MNBA 4MVNA 1LPZB 5EXMA 1GHXH 3H7TA 1P09A 2ZFPH 1ELTA 4IGDA 1HAHH 5IYTA 1DY9A 3FZZA 1D3PB 2QF3A 1OWKA 1YF4A 2D8WA 1SGYE 3SQHE 2JETC 2ZWLH 2BOHB 1GG6C 2BDAA 4FUCA 4WMEA 2P3FH 3PTBA 1FNIA 1K0HA
chains in the Genus database with same CATH topology
4B75A 1TQ0B 4JZEH 1O35A 7KMEH 3SN8A 1G9IE 2GMTC 6CHAB 2XBWA 1TPAE 4D9RA 2XCFA 3B23B 5DP3A 3RMNH 2ZNKH 1MTUA 1UTPA 8KME2 1QQ4A 1ETTH 4ZKRU 1DITH 1BRUP 1O2GH 1PPFE 2GTBA 4NCYA 1GL0E 3E1XB 1Y5UT 4HGCA 1FIWA 1O3FA 2Y80A 1GDUA 1VCPA 1BCUH 3TH3H 1VITH 2ASUB 1F2SE 3NK8A 5BPEA 3VB6A 1QR3E 3TVJB 3E8LA 2FLBH 3PLKA 4FU9A 1NT1A 3BTGE 1SQTA 2ZU3A 5E2OA 3TNSA 1UK3A 3UOPA 2Z6BD 3SU5A 1SL3A 4U30A 2AERH 3VFEA 2RCEA 1RIWB 1N8OB 1PQ5A 1RD3B 3LPRA 3PWBA 1BRCE 1CGHA 1OWIA 1G30B 3A7WA 2HNTC 2A31A 1FI8A 4WWYA 1O3NA 4BANB 5FX5A 2THFB 5TCAA 1MCVA 1G36A 2HOBA 2NWNA 4XBDA 1K21H 1TE0A 1ZHRA 3M3SA 5EQRA 3PROA 3QDZB 4CHAB 4BAOB 2FWWA 3RXMA 2AEIH 2BVXH 5ESTE 1SGDE 4BOHA 5A8XA 1F0RA 1G3BA 3MH4A 3TPIZ 2GZ9A 3MOCA 3EAJA 1SBWA 1ZHMA 1BJVA 1W12U 2BB4A 1K2I1 2J2UA 1Y3VA 1MTNC 1UTJA 3OYPA 4IN1A 1CVWH 4UFDH 4DJZB 3GYMA 3MO3A 5EPYA 1TONA 2BY5X 2W3IA 1MD7A 1CA0C 3BEUA 1C2JA 1GMHF 2EA3A 1THSH 4Y71A 2GGVB 3BTFE 3T29A 1ZSKA 2Z3CA 3O8CA 1UK4A 1INCA 2BQ6B 3H7OA 1W8BH 2BVRH 2F9PA 2AGIX 3LONA 1D4PB 4MNVA 4CRAA 3GY2A 4JYVH 1NM6A 3ZZ5A 5TCCA 2ZIQH 2GX4A 3VPKA 4TWWA 2P95A 4GSOA 1AKSB 2AGGX 3SGBE 2P8OC 2Y7XA 3P8FA 1AY6H 3SNEA 2FIRH 1TGSZ 4ABHA 1KXAA 1P2OA 1P9SA 1GBJA 3M37A 1TBQH 1A5GH 1YGCH 5CMXH 1AD8H 4NFFA 1PYTD 2QXJA 4I33A 5E0JA 1C2KA 3AAUA 4FUHA 2R0KA 3KNXA 4X8SH 1XVOA 4ZHAA 1A5IA 2VIDA 4IMQA 5E2PA 4A7IB 1Y3XA 1HUTH 1V2LT 2FODA 1O5EH 3DFLA 2P16A 1GBBA 1PQAA 2W7UA 3P17H 1IQHA 2Y5GA 2FOHA 1ANBA 1F5KU 3A83A 3C1KA 1UMAH 4YT6H 2HNTE 3BF6H 2Z9LA 1LMWB 1EB1H 2A4GA 3PO1B 1C5YB 1ZJDA 3M61U 1WU1A 2WUBA 4K5ZA 1DUEA 8GCHF 3MMGA 1C2DA 1O2NA 4CH8B 4VGCC 1FMGA 2GDDA 3TK6A 1NPMA 2B0FA 5T6DA 1UCYH 1GJ4H 2XW9A 2OUAA 1C5OH 1ANEA 1TNHA 3L6PA 3RU4D 4GPGA 1H4WA 4Q7ZA 1HDTH 1K1JA 1O2OA 3SUFA 1ARCA 4K60A 4B1TA 1Z8JB 1X7AC 1KTTB 5LPEA 1P2JA 3LGVA 2FEQH 3ZV9A 1P11E 2D1JA 3KQDA 4ZHMU 4Y7BA 5E0HA 3O8RA 4IC5A 4FXGH 3RXOA 1QGFA 2XC5A 1J15A 4X1PU 4NZQA 4UFGH 1F5LA 4X2XA 2QV1A 4SGAE 5J4SA 4OS1A 4U2WA 1P2MA 1E37B 1Y5BT 4TPIZ 3KIDU 1KY9A 5BRRE 1G37A 4NA7A 3LGYA 1J14A 1SR5C 2QIQA 3HATH 1UVUH 4K2YA 2B5TB 1A3BH 3ATWA 2JH5D 1YPJH 3RXFA 3SNAA 1OXGA 3Q77A 2O8UA 4XDEA 1AUJA 3LDXH 4H6TA 3M5MA 2VJ1A 2FM2A 5C67A 1O5GH 1OP8A 2VNTA 3U69H 1XXFA 1O2RA 4ZKOU 2F3CE 3RXSA 3SJOA 3ZZBA 4WF8A 1KXDA 1GBEA 2DE8A 4IMZA 3RXPA 1RJXB 3U8OH 4CH2B 1DFPA 4DURA 1NS3A 1YLCA 4NWKA 1P02A 1UHBA 1SLUB 2GDEH 2FS9A 3ZZ8A 3VGCB 3BG4B 1ZRBA 2Q6FA 1AFQB 2STAE 5B6OA 3VXEH 3W94A 1H9HE 2RA0A 4AFQA 4CBNA 2XTTB 4DY7B 4K3JA 1GVZA 1LKAA 2BX4A 2FI4E 1S83A 3RM0H 3SV9A 2ZDLA 2BD3A 4I32A 5EW2H 1P05A 2GV7A 3PTNA 1GHAF 2ZA5A 1QFKH 2A2QH 3CP7A 1HAXB 3SOSA 2FI5E 4DGJA 1THPB 1SVPA 1BBRH 1A0HB 1TNIA 2W7SA 5JBBS 1DUAA 2UWOA 1DWBH 1N1LA 1GI7B 4TPYA 4TWYA 1AQ7A 2EEKA 3E16B 5CHAB 1Y8TA 1SOTA 3EE0B 2V35A 1O3GA 4FUFA 4I7YH 1T31A 2Z9IA 2VIQA 2J4IA 1HNEE 1TRNA 1WQSA 1TOMH 3T26A 3ZYDA 1IQNA 4NA9H 1V2MT 2ZU5A 1IOEA 1E38B 1UCYK 1EXFA 1JOUB 1ELVA 1O5FH 1QBOA 3MU0A 1KXBA 3UNRA 2NU3E 5A0AE 1BUIA 1YLDA 4MPUA 3GY3A 4ESTE 4ZUHA 1HIAB 1O2QA 1NO9H 1RTFB 1XUIA 2ZPQA 3ZZ7A 2BDGA 1Q3XA 3TJVA 5LPRA 3HK3B 1FY4A 2Z3DA 3RXKA 1YYY1 3AAVA 3SGAE 1T4VH 1IQKA 2Z7FE 3F9GA 3A8CA 4ABDA 1VCWA 2ZTYA 1W11U 2XWAA 5DP9A 1FQ3A 5LGOA 2VB0A 4HI3A 5C1XA 1VGCB 2Z94A 2QF0A 3K9XB 4YO9A 5CE1A 1C5UA 1J8AA 4CBOA 1T8MA 1SPJA 1C1QA 1BRAA 1TQ7B 2ZDAH 3I29A 2FOFA 4FUBA 2QCYA 3E6PH 2ZFSA 3SV6A 3A7XA 4B2CA 5C3NA 1WTGH 1ESAA 2PW8H 1EAWA 3HPTB 3P92A 4GAWA 2D2DA 4CR9A 4KKDA 1K1LA 4XFQA 2XRCA 1JMOH 2FTLE 1C1WH 3DFJA 2VVUA 2XBVA 4XSKU 1BTUA 1MZDA 3NWUA 4JCNA 4NIYA 3BSQA 3DA9B 5K7RA 1Y59T 2WV5A 1UTQA 4R0IA 1AB9B 1WTHD 1RXPA 5DG6A 1PYTC 1QQUA 1F5RA 3IITA 1C1PA 1SGEE 3Q00A 2P3UB 2VWMA 1QJ6B 3RXCA 3RXLA 3KQEA 1O3IA 1Q31A 1XM1A 2PUXB 3QLPH 1BBRK 1ZGVA 5LPFA 1V2OT 2ALVA 3L3TA 2HALA 1A0JA 4UE7H 3STJA 1D9IA 3EA9A 1OYQA 1W10U 3RXIA 1XUGA 2ODPA 4FUGA 5AFYH 5L30H 1CBWC 1JWTA 1G32B 4D7GA 2GD4B 1A46H 1LO6A 5EQQA 2FTMA 2P93A 4X2WA 2XBYA 4YOGA 5HM2A 4YTAA 1BHXB 1SMFE 1C5WB 1GCTB 3MU8A 5SGAE 4X1SU 1O31A 1GI6A 3EYDA 1BTZA 1K22H 5C1YA 3TK5A 2HGTH 3LJOA 3FP7E 1EZXC 4NIXA 1NFYA 4X6PA 1C2EA 3HGPA 1E0FD 2WYJA 3ZVAA 1AWFH 1YC0A 1LCYA 1QRWA 1SGIB 1SGPE 6GCHF 4DCDA 4K1EA 4XBCA 2A32A 1HIAA 5ETXA 5ABWA 4MG3A 1HJAB 4LZ4B 2WYGA 1GBIA 3SU4A 1SLXB 2ZDVH 4PROA 3R3GB 1S6FA 4I8HA 2OQ5A 1GMDG 1GMHG 3DD2H 1PPGE 2FYRA 4ABJA 1HAPH 1EX3A 1BOQA 4ZMAH 2Q6DA 4AB8A 3K6ZA 5FPTA 3UNSA 2W3KA 3UPEA 5AHGH 1EPTB 1QBVH 1PPEE 4X8VH 2M5TA 8ESTE 3SU6A 2H6MA 2ULLA 5A0BA 1IAUA 1F0SA 4UD9H 1C5QA 2ZCLP 2ODYB 1D3TB 1QB1A 4DOQA 2BLQA 1C5RA 2F83A 4E05H 2R2WU 2GT7A 4F49A 1GHBF 1QCPA 2FMJA 3BTDE 1AU8A 1G2MA 3TJNA 1XMNB 3BN9A 1DWEH 2QAAA 1WV7H 3M35A 1VITF 3A86A 2WV4A 3RXGA 1O3JA 1YPEH 3S69A 2BLWA 5T6FA 3TJUA 6CHAC 2NU0E 1O5AB 4ZKNU 1ELEE 1GDQA 4K69A 1FUJA 4AYYB 2FZZA 4UONA 1UVPA 1HBTH 1B0FA 1EJNA 1LKBA 2Y7ZA 3D65E 4H4FA 3EA8A 1C1NA 4THNH 3TIUA 4HFPB 3PV4A 1ID5H 1LQEA 4NIWA 2FOMB 2XWBI 2ZC9H 3SV7A 4D9QA 1ZSLA 1KLTA 8LPRA 8GCHG 3UY9A 2J38A 1P03A 1G3CA 1O2TA 3MH7A 2CN0H 3ZVCA 1GI4A 1WSSH 1Y3UA 1QB9A 4IBLH 1SGTA 1EAIA 1NRPH 4CRFA 4A1VA 3BG8A 1HCGA 3CS0A 3GCOA 4Q7YA 5JDUB 2FLRH 1RIWC 1ELDE 1N8OC 3BIUH 4K8BA 3RU4E 2ZP0H 5A8YA 1K9OE 4LOYH 3E3TA 4HTCH 1EKBB 3D62A 3M5NA 1GI5A 1T7CA 1RRKA 3F6UH 2PTCE 2NU1E 3SJ8A 4UFEH 2Y6TA 5EODA 3V3MA 5I25A 3MNXA 3LC3A 1IQGA 1B0EA 2BM2A 4OGYA 1XX9A 1CGIE 1AVWA 2G00A 4MQAA 4CHAC 5E8EH 1TABE 2HPPH 1PPCE 2CGAA 1O5BB 1DLKB 1GJAB 2A1DB 3KCGH 5HYOA 4ZXXH 1KYNA 3T5FH 3ZZCA 4H6SB 2ESTE 3T2NA 1F7ZA 2QY0B 2UWPA 2J94A 1C5MD 3RP2A 1FPHH 2VVVA 3RXDA 3LKWA 2ZO3H 4ABAA 5AF9H 2TPIZ 1O3OA 1TALA 1JRTA 4UFFH 3U1JB 2PGBB 1AZZA 5JB8S 3SHCH 3RMLH 1FPCH 3AW0A 1BHXF 3ZZ3A 4GUXA 2ZTZA 2BD9A 1GPZA 3SUEA 3KL6A 1QL7A 4Y76A 1LVYA 1O2XA 2A4OA 1A61H 1Q2WA 2IOTA 1ZZZA 1FIZA 3S0NA 1CT2E 3MO6A 2R9PA 1BTYA 1MMJN 2F9UA 3SU0A 3LGWA 3LH1A 4MTBA 3TH4H 1EPTA 3TK9A 1V2UT 1FJSA 1SGRE 2V3HH 4ZAEA 1L1NA 2PKSB 2QXGA 1Z8IB 3CS7A 1O3PB 1HJ8A 1IHSH 1G3DA 2WPJS 2GV6A 1W13U 2PKAB 2BY6X 2LPRA 4ZKSU 1TX6A 3OSYA 3RXEA 1GHAG 1TNKA 1EZUC 2BD7A 1GMDF 2BX3A 1RTLA 3FAOA 1EZSC 1QY6A 4H42U 2BDYA 3LH3A 1HXFH 1AZ8A 3D23A 7GCHG 2FOEA 1O2PA 1OP0A 4B76A 1AHTH 1O3AA 3EA7A 1H9IE 5DPAA 1DOJA 1PQ8A 1S6HA 2R0LA 3GCHB 1GCDA 4FUIA 5FAHA 3G01A 2ODQA 1FY5A 5DJ7A 2FP7B 1BQYA 1P04A 2BY8X 3ZZ4A 5JPMH 3SV8A 3RU4T 1EB2A 2JKHA 4J2YB 2ZU1A 2J9NA 3P95A 3PO1C 2O8MA 4OS6A 2ILNA 5DK1A 4ABBA 1MTSA 2EI6A 2A5KA 1TRYA 3QTVH 3F68H 1P10A 4X6OA 1DS2E 2PGQB 2PUQH 2HVXA 4ZXYH 1C5XB 2AIPA 2G5NA 3HGNA 4MPXA 3UREA 1LHCH 3A80A 2FDAA 2ZFQH 1LVMA 3MH5A 1GI8B 2GCHG 2VWOA 1OWJA 1UTOA 2H5DA 2OC0A 1EAXA 1EP6A 1V2NT 4GLYA 1C5VA 1O0DH 1TIOA 4BXWA 1O30A 4B2BA 1VZQH 1GL1A 4BAHB 1FV9A 1QBNA 1S0QA 4FUJA 2C8YB 5LH8A 2O9QA 1SGNE 5JBTA 4Y11E 4AORA 4IW4E 1SOZA 3BTQE 1MU8B 1OYTH 2BDIA 3RUOA 3RXQA 2ANKH 1IQEA 3BTWE 2Z9GA 1HV7A 4J1YA 2Y5FA 3EQ0H 2BQ7B 2FS8A 1IHTH 1OOKB 3ITIA 3A7TA 1GBMA 2CF8H 1ZYOA 1MAYA 2ZFFH 4CRCA 4UEHH 5AVDA 1QRXA 1CQQA 2BOKA 1V2QT 2ZF0H 2H9HA 1AFEH 2TGAA 4O3TA 1GJ9B 2FX4A 1SQAA 5L2ZH 4AX9H 1O5DH 4OS4A 2OBOA 1GJ7B 3T25A 1S5SA 3UR9A 2BD5A 1S84A 1AVXA 1ZHPA 2F91A 2ZQ2A 1OP2A 1ZMLA 1NRRH 4X1QU 1NU7B 1AO5A 1SSXA 1QIXB 1MBQA 1QRZA 4D76A 3GY5A 9LPRA 5DGJA 4MNXA 4A1XA 3ZZAA 1U6QA 1EOLA 2GCTB 3QZRA 1SHYA 1TB6H 2H1UA 3BEIB 4ABEA 3VGCC 3BG4C 5EOKA 1AFQC 1D3DB 3FP8E 4B2AA 4M7GA 1Y5AT 1C1RA 1V2VT 1FONA 2BMGB 2SGFE 5HXFA 1AGJA 1TX7A 2PKAA 1C2MA 1ZRKA 2YOLA 1V6DA 5FCRA 1V2TT 3UOUA 2HRVA 1RGQA 2A7JA 4TYDA 2OCVB 1H8DH 2O8WA 1HYLA 1WBGB 4DVAU 4DIIH 1QB6A 1L2EA 3F9EA 4ASHA 2TIOA 1BT7A 4DIHH 2NU2E 4NG9H 2GZ7A 3TITA 2VWNA 1BIOA 3SV2H 3M36A 1O2VA 1ZLRA 3SQEE 1O2SA 4NSYA 1T32A 4Y0ZE 1NRQH 4Y0YE 3JZ1B 5CHAC 1FLEE 1HAGE 1NZQH 4JMYA 1GVKB 1ETSH 2V3OH 1DDJA 1AKSA 3OU0A 5T3HA 5A2MH 3SUDA 4Y8YA 3GOVB 1AIXH 1AVGH 4MLFB 1HAIH 3S9AA 1NFUA 6GCHG 2PR3A 4NFEA 1DX5M 3SU1A 4HZHA 1YBWA 1IQIA 1Z8RA 3KEEA 1MKXK 4Y10E 4A92A 2ZDMA 1GJCB 1ESTA 1ACBE 1NRNH 2HLCA 1AMHA 4JZ1A 7GCHF 4BAMB 2AS9A 5JBAS 3NXPA 3UFAA 1YPHC 1VJAU 1SGQE 4ISLA