2BY9X

Is radiation damage dependent on the dose-rate used during macromolecular crystallography data collection
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CATIONIC TRYPSIN
publication title Is Radiation Damage Dependent on the Dose-Rate Used During Macromolecular Crystallography Data Collection?
pubmed doi rcsb
molecule tags Hydrolase
total genus 55
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2005-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2by9X01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2by9X02
5JBBS 9ESTA 1THRH 3MU8A 1BRAA 4BXWA 1EATA 4WXIA 3M5OA 5LPEA 4JYUH 1AUTC 1HNEE 2VIVA 3DT0H 1KXDA 5IYTA 4DY7B 1PYTC 1EUFA 1C1MA 1ETTH 1Y5BT 3F6UH 1E36B 3L33A 4CRCA 3O8RA 1HIAB 1EAXA 1TNKA 1XUFA 3KGPA 1NFXA 4XBCA 1G3BA 2P59A 1BA8B 5C1YA 2I6QA 3GCTG 1C1QA 3VB6A 4I8HA 5J4QA 1YBWA 2FOMB 1THPB 6GCHF 3EDXB 3GCNA 1Y3VA 2FS8A 1Z1IA 1J17T 1GCTB 3SQEE 1MH0A 1C2FA 1C5NH 1S84A 2WPHS 2AIPA 2XBYA 4CRAA 2FTLE 1L4ZA 4ISLA 2F91A 2GVFA 1C1TA 2P93A 4J1YA 1D6WA 2SGPE 1DM4B 2Z6BD 3QX5H 2FXRA 2WUCA 3PB1E 1OWIA 2XNIA 4CBNA 2JKHA 1MU8B 2AGIX 1ABIH 1LTOA 2TGDA 4YOGA 2F9OA 1PPHE 1KIGH 1CGIE 3GYLB 3KQDA 2BZAA 1MTVA 2ZGHA 1FY3A 1ZRKA 3FZZA 2H1UA 1LPKB 1UTQA 5CMXH 1O5GH 3VB5A 2QGRA 2D26C 1A3EH 3SU2A 2HOBA 1CBWC 3LGYA 1YGCH 4IMZA 1T4VH 1OKXA 1QBVH 1V2KT 4JYVH 4JMYA 3PROA 2FX4A 1ANCA 3TNTA 1EJAA 2RDLA 4BTIB 3SV9A 1C1PA 1TGNA 4KP0A 1C2HA 2GD4B 1RXPA 8KME2 3RXTA 2BVSH 1AU8A 1B0FA 1DX5M 5T3HA 3VFEA 2OC1A 3TH2H 1Y59T 1FN6A 3AAVA 1GHYH 4NIXA 2GV7A 4A6LA 2C93B 2XBXA 3LJOA 2LPRA 2J38A 1OYQA 1WU1A 2Q6GA 4RKJB 1T8OA 1GPZA 2VU8E 1IHTH 1Y3YA 4A1XA 3A86A 3MH4A 1F0TA 3RXJA 1HXFH 1GJ7B 3S69A 1ZMNA 5K7RA 4MTBA 4U32A 1IHSH 1P57B 3UUZA 5JBAS 1HAOH 1TNHA 2FOFA 5DO4H 1BJUA 1NZQH 1GBAA 3B23B 1GGDB 1KXEA 3ODFA 2PGQB 1Q31A 1QRXA 1FI8A 2SNVA 3A8BA 1AGJA 4MLFB 3BG8A 1HV7A 2J34A 1NTPA 2PFEA 2QIQA 3RXEA 1TGTA 2BTCE 1P3EA 2GDEH 3RXPA 1YF4A 1XMNB 2XCFA 3BTGE 1KXBA 1GHAF 3M36A 4FUHA 1S85A 1X7AC 3BEIB 2PR3A 1C2EA 2A4RA 5FXLA 2FTMA 1GBTA 1VJAU 1TONA 5EOKA 2B0FA 2BY5X 1S83A 3TK6A 3RXDA 3E90B 2C8WB 3AW0A 1NY22 2WPKS 2BY8X 4JCNA 3QZQA 5AFYH 1FLEE 3I29A 5CHAC 1M9UA 1YCPK 5HM9A 4NFFA 3PTBA 4ABIA 2P16A 1YPEH 1XUJA 4A1VA 1ESTA 1EASA 4XOJA 2ZFRH 1SC8U 3V12A 3BEUA 4JZIA 3LH1A 1O3DA 1HGTH 1HB0B 1VGCB 1QR3E 1SHHB 4X2WA 1EPTC 3P70B 4BANB 4DW2U 1S5SA 1O2KA 2HPQH 3M37A 8LPRA 1GJAB 2FOGA 3NKKA 1UJ1A 1BQYA 2ZP0H 2ZWLH 2BD4A 3CP7A 3RXCA 1QJ7B 3DHKH 3U9AH 5C2ZA 3GY2A 4IBLH 1A7SA 1TNJA 2FOEA 1GI9B 3GCHC 4ZKOU 1MTNB 3MNBA 1TA2A 5LGOA 4KTUA 3D49H 3RXLA 1O33A 1LMWB 1MTWA 3SGAE 1SLXB 2BQWB 5E0GA 4U01A 1AO5A 1GWAA 1MU6B 1DFPA 1QJ6B 3FAOA 2ZI2H 1BTWA 1UVOA 2J9NA 1JOUB 2BLVA 1V2WT 2NU1E 2EC9H 1OPHB 4ABGA 1CHOG 1GJDB 1GI3A 1KTSB 2FYQA 1SFQB 1MKXH 1WQVH 4WXVA 3U8OH 2CGAA 4MNWA 1ZJDA 5FCKA 3GY4A 4I33A 2Y7XA 1AE8H 1GBFA 2R0LA 3MWIU 1EP5A 1O2OA 1WCZA 5A0AE 2GKVE 3SU3A 2WV4A 5EQSA 1ELBA 1V2VT 4FU7A 1E38B 1P02A 1H9IE 3BTFE 1PPFE 3RXHA 3HPTB 1QA0A 2VIOA 1FJSA 1O5CB 1E37B 1LKBA 2ZU5A 2BD2A 1E34B 1G2MA 1TPOA 1L2EA 1OWKA 2TGTA 3IG6B 2FLRH 1KYNA 1TRMA 4K5ZA 4NZLA 6LPRA 9LPRA 1OP8A 1UVPA 2VH0A 2A7HA 4XDEA 2Q1JA 5LPRA 2XTTB 5T6GA 2ZU4A 4NA7A 1O5EH 1O3LA 5FHTA 4J2YB 4Q80A 2TRMA 2ZDAH 3T27A 1LQEA 3DD2H 3R3GB 2Z9IA 3PYHA 4TY6A 4CRDA 1BMAA 3LU9B 1W14U 1GBDA 5B6OA 1O39A 3MMGA 3LONA 4E7NA 4ZKSU 3NZIA 3E1XB 1AB9C 2BDCA 3A89A 2ZCKP 3QGJA 3T26A 1O30A 3A81A 5EGMA 4D8NA 1F0UA 4O97A 1GHBF 4FUFA 5ESBA 1RFNA 2G00A 4INLA 3ZZ8A 4LOYH 1RIWB 3RXQA 1HLTH 3UQOA 4D7FA 1MKXK 4O3UA 1O34A 4E06H 3STIA 1C5OH 2A2XH 5GXPA 2ZDMA 1BDAA 1QL9A 3EAJA 4TPYA 2CHAB 4B76A 1YYY1 1T7CA 2GZ7A 4X6PA 1SOZA 4ABEA 1DWBH 1O36A 3PO1B 4JZFH 1KY9A 1CA0B 2BXUH 2Z3DA 3NUMA 1TQ0B 1EPTA 4AYYB 3RU4D 1C1SA 3BTTE 5C1UA 1NRPH 4CRGA 5L6NH 5E2PA 2A0QB 2TPIZ 5A2MH 1TBZH 1DWCH 1MBQA 1NU9A 3ZZ3A 1CGJE 4AG1A 1HJAC 1ETSH 1SI5H 4X0WU 4ZAEA 1V2QT 1ZGVA 3UREA 2ZDNA 2FYRA 3F68H 1SB1H 1IQEA 3U69H 1Z6JH 3SHAH 3ZVBA 5FPSA 3W94A 1K1OA 2GZ8A 1SSXA 1BB0B 2ODPA 3T2NA 4Y11E 3SI3H 2NU4E 1G32B 3O8DA 3FVFB 1H1BA 1YPJH 3UPEA 1XXDA 4FXGH 4Y0YE 2Z7FE 1PYTD 3LKWA 2WPJS 4DURA 2A5KA 2A45B 1ZOMA 1C4Y2 1MZAA 1S6HA 2ZU3A 5HGGA 1GMCF 4AGJA 2ZDVH 3ENSB 2I6SA 1JIRA 1O2QA 1QB1A 4ZXXH 1A0JA 2K1QA 2YOLA 4D9RA 4B2CA 1P09A 4THNH 3D65E 1QTFA 4KGAA 3UY9A 3TH3H 1ANDA 1RTKA 1JRSA 3S9CA 3TPIZ 5IDKA 4FVBA 3BTKE 4IC5A 1MCTA 1V2OT 1QURH 4AFUA 2BB4A 2WPMS 1AVGH 3DUXH 1N6XA 1QY6A 3FP7E 1MZDA 1NFUA 4NWLA 2STAE 2GDDA 3I78A 3Q3KA 3BF6H 1TLDA 2A4OA 3RXSA 1L0ZA 3VXEH 1TAWA 3ZZDA 5DGJA 4K8BA 1C1OA 4CHAC 2BXTH 3MI4A 1NRSH 3RXFA 1UK3A 5GCHG 2BLOA 1UTMA 2BM2A 1A61H 4VGCC 2F9BH 4OGXA 2FI4E 5I46H 1QQ4A 3QDZB 7GCHF 3VXFH 1GDQA 4CR9A 1C5RA 4YZUA 1C5LH 3NPSA 4OS2A 1QRWA 1K1NA 1TMUH 1QFKH 1C5TA 5ESTE 4DOQA 2AMQA 3K6YA 1IAUA 1UTJA 2FOHA 4NIYA 3SV6A 2JETB 3KNXA 2XBWA 2AERH 2GCHF 2UWOA 4INKA 5C20A 1O2RA 2SNWA 1C2MA 4U2WA 5F8XA 2BHGA 1UO6A 1O5AB 1LVMA 2R2WU 2NU2E 1UK4A 1NT1A 2O8UA 1BBRK 1EAIA 2HVXA 1DSUA 1QB6A 1K9OE 3EA7A 3MH6A 2ZHDA 1N8OC 2HPPH 5FX6A 2FI5E 3H7TA 3RC6A 4SGAE 4FUJA 4Q7YA 1SFIA 4NCYA 2ESTE 1LDTT 3Q3XA 3TLOA 1O31A 2HNTE 1O3CA 1O32A 2A32A 2VWLA 1TX7A 2RG3A 1DANH 4UONA 1O2GH 2ANWA 1K1MA 4FVDA 4AYVB 3D62A 2C90B 4BXSA 3HATH 4OS1A 1O2NA 1KXCA 3M5MA 3BV9B 1UVUH 3Q77A 4K69A 1LVYA 2J4IA 2QY0B 1HBTH 2OCVB 1NU7B 4PROA 4X2YA 2B9LA 5E0HA 3ZYDA 1K1LA 3BIUH 2QXGA 1BCUH 1IQGA 5T6FA 1CT4E 1KTTB 1T8NA 5E8EH 1D3PB 2PHBA 1AFQB 2BDHA 3RXBA 5EODA 5DKMA 1H4WA 1V2UT 1L1NA 3M7QA 2QC2A 5EXNA 2ZDLA 3STJA 3RU4T 1P2IA 1GVZA 3VEQB 1XUGA 2FMJA 1TOMH 1ELFA 1LVOA 1ZHMA 3ITIA 4Q7ZA 4ZKRU 1ELEE 1MBMA 3PM3A 5JB9S 2BD7A 4AZ2B 2GMTC 2O8WA 4YLQH 4DCDA 1GHZA 1VITG 3MU1A 3QO6A 4TY7A 1GMHG 3A8CA 2AYWA 4GUXA 4IMQA 3A7WA 4NSYA 3MU5A 1ZPBA 5EQRA 3T25A 5H4IB 2GT7A 2W3IA 2ZGCA 5EW1H 2R3UA 4RN6A 1TGBA 3RMNH 2O9QA 1C4V2 1KLJH 1LHGH 1Y8TA 2BY9X 5DP5A 1TBRH 4M7GA 1H9LB 4O03A 1EOJA 4OS6A 1WAYB 1ARBA 3S9AA 1P10A 3HK6B 1GJBB 1S0RA 3PMBB 3ZVCA 4AFQA 3GY5A 1YPMH 1O2SA 5FBEA 4MG3A 3F9EA 2OQUA 1GL0E 2R9PA 2FODA 2UUYA 4K1SA 3TK5A 2O8TA 2ZCLP 3DFLA 3S9BA 2FIRH 5EPNA 4ISOA 1QIXB 4I8JA 1FIWA 1C2IA 3DA9B 3UR9A 3RC5A 3SV2H 2G81E 2XBVA 1BTZA 5FX5A 5G4BA 3A84A 1C5QA 1QQUA 4WH6A 4K8YA 4X8TH 2ZPSA 4INHA 1BMMH 2PSYA 1D6RA 2GV6A 2EA3A 1INCA 1GJ4H 1QBNA 3ZZ4A 1MCVA 2R2MB 4BNRA 1B5GH 4X8VH 2ZQ1A 3W95A 1AVXA 3QTOH 2ZU1A 4NZQA 2ASUB 1AI8H 2BQ6B 2F83A 3LH3A 2HRVA 2VIWA 4DVAU 4Y8YA 1YPLH 2NWNA 3RXOA 1Z8JB 3E0NB 1F0RA 4CRBA 2W7UA 2BD3A 2KAIA 4BAKB 4Q2KA 4Q7XA 5DJ7A 3NK8A 4XFQA 3O8BA 1YC0A 1FUJA 1ELCA 1SGQE 1CA8B 3BTME 2GX4A 2HNTC 4LXBH 1C9PA 3UOPA 5CHAB 1SHYA 5F8TA 1FAKH 2BX4A 5DP8A 1O3HA 2A4QA 4E05H 4D7GA 1TX8A 3SJ9A 1DXPA 1OWHA 1IQMA 3UWJH 2F9PA 1BOQA 1EAUA 4Y8XA 1G3CA 3MYWA 4OS5A 4ZXYH 2D1JA 1ACBE 1HUTH 1TALA 1YCPH 3GYMA 4GCHF 2H2ZA 3SOSA 1C5MD 2J2UA 1GBEA 2ZHQH 1O5FH 3Q76A 4I8LA 4X1PU 1P2KA 5TJXA 4YT6H 3A7ZA 3TVJB 4LZ4B 1V2ST 3T29A 3L6PA 1L1JA 4YTAA 3DFJA 3RM2H 1C5UA 5A8XA 4AFZA 1S81A 4Z6AH 3MO3A 1IQJA 1BIOA 1ESAA 2NU0E 3TH4H 2CMYA 3SU0A 3SU4A 1FPHH 1O2IA 1O3JA 1Z7KA 1DS2E 5A8YA 1W7GH 1BZXE 2B7DH 5HMAA 3AW1A 5JB8S 4H4FA 3ZZCA 1C5XB 1DVAH 2PWXA 1UHBA 1GCTC 4AOQA 3T28A 1C1WH 1G36A 1K1PA 2Q6DA 3TITA 3KIDU 1NC6A 1E0FD 1J15A 4UFFH 4WJG2 3VGCB 1ELDE 1LO6A 1XUKA 2TGPZ 1AKSA 3FZDA 1GDNA 4ZH8A 3U8TH 3ZVGA 5A0CA 3P6ZB 4D76A 3A85A 3PLPA 3TU7H 1C5YB 4XSKU 2XW9A 1KXFA 3E0PB 2OINA 1A5IA 1HAIH 1H9HE 2FESH 2OC0A 1XVOA 2P94A 1HAZB 4Y76A 2HWLB 5GIBA 3LC5A 1OWDA 1D9IA 2GZ9A 2LNCA 3K2UA 2OBOA 2ZDKA 2ZGXH 1N6YA 3EQ0H 2WUBA 3ATWA 4X6MA 2XWAA 3A88A 1UTLM 2SGDE 2GTBA 2H6MA 1KLTA 1OSSA 1GMDF 5JDUB 1UCYH 3LPRA 1SGRE 2P3UB 2JH5D 3BSQA 1YM0A 1SGYE 1O2HA 7LPRA 4MNXA 1C1NA 1T4UH 3A8DA 3H7OA 3RXVA 1H8IH 3F9GA 1G3EA 2CJIA 1HAVA 1NRRH 4BAQB 4AX9H 1BTHH 4QT8C 3ZZBA 1IOEA 3PLKA 3SORA 1O2XA 1O3BA 2J94A 2P8OC 3RMMH 3FP8E 5DP9A 1SGDE 2ZZUH 2A7JA 2FO9A 4B75A 1GJ5H 1EB2A 3TJVA 4O9VA 3U8RH 2CXVA 2ZHFH 5EQQA 2XC5A 2BZ6H 4BAMB 3UNQA 5DPAA 2C8XB 1KDQB 3RP2A 1YLDA 4K2YA 4BTTB 1P2MA 4I8GA 1O3FA 1QHRB 3M35A 3KHVA 1XKAC 3A87A 2ZECA 1GCDA 1HJ8A 1TBQH 3GDUA 4X1SU 2IOTA 2ZEBA 1ELVA 1J9CH 1C2LA 2EI7A 3LGTA 1Y5UT 1CQQA 3BTHE 4ABAA 1ARCA 1V2MT 2OP9A 4B71A 2AEIH 6CHAC 2QAAA 1GI6A 3URCA 3SJKA 6GCHG 1VCQA 1JWTA 1U6QA 1O2UA 3A7TA 3UWIA 3MNXA 1TQ7B 1GI1A 4UFEH 2QA9E 4JZDH 2GGVB 1SR5C 4X8SH 1OOKB 1GG6B 1UMAH 1GBJA 1O2YA 3TJUA 4LZ1H 2QXHA 2TGAA 2BVXH 2G4TA 1GBLA 5ABWA 4TWWA 2OXSA 3SNEA 3P8NA 4FUDA 4IN2A 3URDA 1GI7B 1CVWH 1SMFE 1UCYK 2H9TH 2VGCB 4FUGA 2ZNKH 4R0IA 1HIAA 5TCAA 4YM9A 1JBUH 8GCHF 2EI6A 2PKAB 1UTOA 2Z3CA 1TA6A 4ZMAH 1WTHD 2WINI 2RA3A 1NS3A 3HGPA 5DK1A 3U1IB 1SGCA 1NROH 3PV4A 1GHWH 1GI4A 4ZHLU 2PKSB 5AVDA 4JZ1A 3HKIB 1GHXH 2RCEA 1DITH 4FUCA 2G55A 1AY6H 5DP4A 2A5AA 1SBWA 1NPMA 4Y0ZE 2F9NA 4Z0KA 2Y5GA 1ANEA 4X6OA 3MOCA 4FUEA 2ZG0H 4JK6A 3V0XA 3K9XB 2D8WA 1ZSKA 1AUJA 3M61U 2SFAA 4YT7H 3VPKA 1BRBE 1SLVB 2ZPQA 2EEKA 5F8ZA 1O5DH 2ZKSA 4GSOA 4DGJA 4GHQA 1GVLA 1AFEH 1VGCC 1SLUB 4X1NU 2A5IA 1HRTH 1ZTKA 1O3GA 2ZA5A 1HXEH 5GPIB 2VVCA 3T5FH 3U98H 5L2YH 2J95A 3TGKE 1GI8B 6ESTA 2JH0D 2BMGB 1RRKA 1JRTA 1ZTJA 3MU0A 2ZPRA 1MAYA 4CHAB 1Y3UA 5DP3A 1ABJH 3ELAH 1O37A 1UTKA 2W5EA 1SPJA 1DLEA 1SGIB 3QGNB 1MTNC 4BAOB 2BVRH 1TB6H 4AGKA 1MD7A 1CSOE 1LHCH 2Z94A 3SI4H 5JPMH 2V35A 1G3DA 1KXAA 3GCTF 5T6DA 1GJ8B 1SGTA 1F2SE 1L1GA 3MTYA 2H5CA 3UTUH 4CREA 2H5DA 1Z8IB 2OC7A 1QNJA 1TABE 3I77A 1LHEH 1C2JA 1OS8A 1PQAA 5JBTA 2GCTB 3GISB 1GHAG 1P05A 1IQFA 1HAGE 2A31A 1SOTA 4A5TS 1SL3A 1P2JA 4MQAA 1GBBA 3ZVDA 5JYIA 4X2XA 2BD5A 1HJ9A 2ODQA 4K1EA 1ZRBA 3O8CA 1HPGA 4HZHA 3AVZA 3SNAA 4K1TA 1XUHA 2H9HA 1H8DH 2BDGA 4GVUA 4YOIA 4UFDH 3OY5U 1G37A 1K21H 1BBRH 5CE1A 2A7CA 1DWDH 5J4SA 1A3BH 1QCPA 1Y5AT 3SBKA 1ZYOA 3SNBA 3N7OA 3BG4C 1DE7H 5HM2A 3EYDA 4FU9A 5BPEA 4ABDA 3B8JA 1O3KA 4NA9H 2ZGBH 3SN8A 2G5VA 3AASA 4CRFA 1EX3A 2R0KA 1A2CH 4FUBA 3PMAB 1TE0A 3C27B 4A7IB 1BHXF 3ODDA 3QN7A 1AZZA 1EXFA 5PTPA 3MH5A 2FEQH 1F7ZA 2QN5T 3ZZ7A 2GP9B 1C2DA 1W3CA 4MDSA 3RM0H 3TGJE 3PTNA 1C5ZB 1VJ9U 1PJPA 4OGYA 1BTXA 2FDAA 1CT2E 1OWEA 2AIQA 2W3KA 2YNAA 1SGNE 1SLWB 2P95A 1EZSC 3S7HB 4X1RU 1WTGH 7KMEH 5FBIA 2B5TB 2FLBH 1RIWC 1FXYA 1T32A 4CH8B 3SHCH 5EU8A 1P06A 3E6PH 2ZFTA 1D4PB 1P9UA 1DLKB 1Z71A 1ZR0A 1K1IA 1C2GA 2J92A 2ILNA 2BOHB 4WY3A 2ZHEH 1FPCH 3PO1C 2G8TA 1CA0C 1UTNA 4MVNA 1C5WB 4MPXA 1EJMA 1O2TA 1S6FA 3H5CB 1AN1E 3LOXA 3OU0A 5E0JA 5LPFA 3G01A 2Y82A 4ASHA 1GJ6A 1V2PT 4BTUB 1FDPA 3GCOA 4X2VA 3RXRA 5GJ4B 4IGDA 1O2MA 2BDAA 2V3OH 2W7SA 2F9VA 3SV8A 2JH6D 1WUNH 3SUEA 4Y7BA 3PLBA 1GJCB 5F6MA 3TGIE 4I7YH 1THSH 4K3JA 2SGEE 1MQ6A 2OQ5A 1DUEA 1TOCB 4IC6A 1TRNA 3P8GA 1C2KA 1O35A 2BDIA 3ATLA 1SQAA 1AHTH 1E35B 1TRYA 5JBCS 3SZNA 3GOVB 4UD9H 4X8UH 1V2NT 3E8LA 3M3SA 4ABFA 2OTVA 3FANA 3MO6A 3SUFA 3RMOH 1O2VA 3PWCA 1BHXB 1QL7A 2WYJA 3MU4A 3T62A 1CBWB 3B9FH 1TWXB 3EE0B 1AQ7A 2AMPA 2QF0A 3RLWH 2A1DB 3A7XA 1HAHH 3E91A 2G51A 5C1XA 2QF3A 1YLCA 3A82A 2XWBI 1CE5A 3OY6U 3R0FA 5DP6A 2FP7B 1GI5A 1P03A 2UWPA 2B8OH 1A5GH 3CENA 3LC3A 1WYKA 2UWLA 5EXLA 1QGFA 3GICB 3KN2A 3OYPA 1QRZA 1VCPA 1P01A 3RXGA 3KF2A 1MMJN 1F92A 1VCWA 2Z9LA 1IQLA 5C5OA 2BD9A 4B2BA 1ZPCA 4GPGA 1GHBG 2F9UA 4GLYA 1HFDA 1TIOA 5TCCA 3HK3B 3BN9A 1DSTA 3BTQE 1XKBC 3QWCH 2ZTXA 1DOJA 1C1UH 2PUXB 1C5PA 4H42U 1LCYA 3RLYH 1GBIA 2ULLA 5ETXA 3SQHE 2IPHA 3QZRA 1NESE 1J8AA 1O3IA 4HTCH 1CT0E 3UQVA 4H6SB 5GDSH 2JETC 1Y3WA 1CHOF 1K22H 3D23A 1BUIA 1KLIH 4WMDA 1V2LT 2DE9A 1ELAA 3SUDA 3UNSA 1HAXB 2ZFPH 4TWYA 3ZVAA 2ANYA 1N1LA 4I8KA 3NWUA 3ZV9A 2Y7ZA 5SGAE 1TYNA 1YPHE 1P04A 2O8MA 2VINA 3PMJA 1GMCG 3GY6A 1O3EA 1T8MA 2XYAA 3UFAA 3RXMA 3HKJB 3TJOA 1P9SA 3UIRA 3EA8A 1UVSH 3RXIA 1QA7A 3A7YA 3PMHB 3ZVFA 1EZUC 1GHVH 1S0QA 4B74A 1YPGH 2NU3E 3M5LA 2WV5A 1AFQC 1L4DA 2OLGA 4AB8A 1MKWH 4TYDA 3ESTA 3P95A 4WF8A 3ATMA 1EAWA 4HFPB 4ZUHA 1DXWA 2IN2A 3HGNA 2BX3A 3S7KB 1D3TB 2STBE 1O2JA 4X1QU 3BIVH 1NN6A 1JXPA 1AVWA 3QK1A 4E7RG 1EPTB 2P8OB 2BOKA 1C5VA 3LGIA 2Y5HA 1LQDB 3SGQE 2IJOB 2QCYA 4KKDA 2M5TA 1FN8A 2ZC9H 2ZO3H 2VIDA 3MFJA 2Y6TA 2FPZA 3SUGA 5BRRE 3A80A 3ZVEA 4D9QA 1RTFB 7GCHG 3SO3A 1ZHPA 4OS7A 2ZFQH 1ZPZA 2CV3A 3GCHB 1P2OA 3A8AA 4NG9H 3NXPA 4LK4A 1DDJA 2PW8H 2TIOA 3UR6A 1MD8A 4AFSA 1SVPA 1AMHA 2Z3EA 1LPGB 1GL1A 1EJNA 5E2OA 3K65B 1PPEE 1BRUP 3KQEA 1NO9H 1UTPA 1ZSLA 3ZZ6A 1UCYE 2GCHG 3BTWE 3Q00A 1SGPE 5FPTA 6CHAB 2HALA 4ABHA 1IQNA 4NA8A 3TIUA 1WV7H 3F1SB 5C67A 1TNGA 2XXLA 3V7TA 1A46H 2BLWA 1IQKA 3RMLH 2G4UA 1ID5H 2RA0A 4B73A 1RS0A 1ZHRA 3UOUA 1FIZA 4K60A 1PFXC 3BTEE 1EZQA 1OXGA 1GBHA 1JMOH 1CU1A 3TJNA 1MKWK 1HYLA 1NRNH 4HI3A 3V13A 2Y81A 1Q2WA 4RSPA 3OSYA 5FAHA 1O0DH 1ANBA 3C1KA 1G9IE 1CO7E 1GVKB 1PPCE 5K0HA 2Z9KA 1YCPM 4YOJA 3ATKA 1F5LA 1FY5A 2ZGJA 3IWMA 3ZYEA 1O2WA 1MTUA 3SNCA 3TK9A 1YPHC 1BTUA 5GWZA 1BTYA 1O3PB 1K2I1 2ZTZA 1J16A 2PSXA 2DUCA 4I31A 3SNDA 1ORFA 4Y7AA 1ELGA 2SGAA 2XC0A 1P2QA 2VIPA 1DY8A 1P3CA 1TPAE 4ABJA 1FNIA 2AS9A 3M7TA 2D2DA 4AORA 1AD8H 1JIMA 1Z6EA 4CBOA 1TFXA 2CF8H 4B1TA 2FX6A 2OC8A 3LJJA 3KQCA 3SJIA 4IW4E 2THFB 3A83A 1FONA 2VNTA 1MTSA 2QXIA 1AB9B 1TPPA 4MPVA 3M3TA 1PPGE 2VVVA 2PTCE 1XUIA 4DG4A 5GCHF 2ZHWH 3M7UA 4GHTA 4SGBE 5A09A 3SU1A 1OX1A 1B7XB 2CN0H 4Y8ZA 2ZFFH 3WY8A 1V2JT 4KTSA 3RXKA 1GGDC 1O3MA 4CH2B 2C8ZB 1CGHA 2VVUA 4ZHMU 1LKAA 3VB3A 5C5NA 1SQTA 5DG6A 1V2TT 1SQOA 4WVPE 5EXMA 3EA9A 1P0SH 3ZZ9A 2FS9A 1O5BB 3SW2B 1O3NA 1VZQH 1DUAA 1SGEE 1HCGA 1LVBA 3QTVH 4UFGH 1K28D 1Y3XA 1EB1H 4ISHH 3OTJE 4KTCA 2ZCHP 3QLPH 1ZMJA 3VGCC 4YESB 1O38A 1HJAB 1A4WH 1ZLRA 4MNVA 2BD8A 1QB9A 4Y10E 2YNBA 2BY6X 5FCRA 3RXUA 1HAPH 1GBKA 1V2RT 4RKOB 5L2ZH 2A2QH 3RUOA 1CHGA 1Q3XA 4KELA 4AG2A 1C4U2 1A0HB 2FI3E 4GAWA 2C3SA 2PGBB 1FQ3A 1G30B 2A4GA 1ZZZA 2GT8A 3KCGH 2HLCA 2XRCA 1C1VH 1BTPA 1TNLA 2Y80A 1OYTH 1C5SA 1A0LA 1FZZA 4Y79A 1AWHB 1WQSA 2BY7X 4WMEA 1YPKH 1T8LA 1KSNA 4ISIH 5C3NA 4UE7H 1DY9A 5F03A 3OX7U 3MNCA 4B2AA 1SGFG 2AMDA 3BG4B 1SG8B 3MNSA 1G2LA 3FP6E 1Z8GA 1XX9A 1HDTH 1LHDH 3SJOA 2ZFSA 2AGEX 1ESBA 2WPIS 1FY8E 2FOCA 2VB0A 1RTLA 4GCHG 2UUFB 1BT7A 5AF9H 2FOBA 3M3VA 3FFGA 2W26A 1TMBH 3A7VA 3GY3A 4TPIZ 4R8TB 3ZZAA 4ISNA 3BTDE 1VITF 2F3CE 2R3YA 3ATIA 4O3TA 1GMHF 3P17H 4AN7A 3PWBA 1MQ5A 3SU6A 4XE4A 4A1TA 1DT2A 2O8LA 4VGCB 4F4OC 4F49A 4DIHH 5HXFA 2AFQB 3GY7A 4YLUA 3ZV8A 3LT3A 4JZEH 2ANKH 1O2LA 3GY8A 3GDVA 1TMTH 2UUKB 3IITA 2BDBA 4MPWA 1BJVA 4Y71A 3SJ8A 4WMFA 1UK2A 1RJXB 3RC4A 1D3DB 1RGQA 1W8BH 1V6DA 1BBRE 2C8YB 1O3AA 1W12U 1J14A 1QBOA 1GI0A 2KAIB 2VWNA 2VH6A 1Z1JA 2PTNA 1GG6C 5EPYA 1ZJKA 2P3TB 4JK5A 4DJZB 1DWEH 1ELTA 1YKTA 1O2ZA 1PPZA 2Z9JA 1RD3B 4NIVA 3SV7A 4MPUA 3V3MA 2VGCC 3M5NA 5EW2H 3QUMP 1Z8RA 1IQHA 1BMNH 1MUEB 1N8OB 1WSSH 1NM6A 1EZXC 5L30H 1DICA 1AZ8A 3E16B 2WPLS 1O2PA 4ZKNU 3LGVA 3RDZA 2G52A 3P8OA 2C4FH 1UVTH 3BEFB 3Q3YA 3RU4E 4DT7B 3P92A 1B0EA 2PKSC 1FY1A 1EKBB 2FOAA 1GBMA 4H6TA 2WYGA 2CF9H 1ZMLA 3SGBE 1GMDG 5HYOA 1ETRH 8ESTE 4Y6DA 2BDYA 3LGUA 3NCLA 3MHWU 2FM2A 1PPBH 2OD3B 3GDSA 1S82A 3K6ZA 1PQ8A 1VR1H 1WOFA 3KL6A 3LDXH 2H9EH 1BITA 1O3OA 3ZZ5A 3VB4A 5DP7A 4UEHH 1XVMA 3JZ1B 1BRCE 4YO9A 1P12E 1SGFA 1FY4A 1YP9A 1W0YH 1UHBB 2PUQH 4U30A 2HNTF 2QYIA 5LH8A 4ZROA 1K1JA 1VITH 2GMTB 1TX6A 1T31A 4ABBA 2V3HH 1A1RA 2FZZA 1GBCA 1TGCA 1FAXA 1W0ZU 2PLXA 2VIQA 1MAXA 5A8ZA 1AKSB 2VJ1A 1NFWA 2G5NA 2CHAC 1D3QB 5I25A 4ESTE 1TGSZ 3VB7A 1W2KH 1FV9A 3KQBA 5FPYA 1EQ9A 4JYTA 4MNYA 4NIWA 1DPOA 3EGKH 3MH7A 4A92A 4HGCA 1XXFA 2V6NA 1P2NA 1AE5A 3L3TA 1NRQH 1LHFH 1TPSA 4WWYA 1ZSJA 3CS7A 4FU8A 2VWOA 1FMGA 2V0BA 2ODYB 5AHGH 3U1JB 1GDUA 1ZGIA 2EI8A 1PQ5A 1A5HA 2Q6FA 4NSVA 1KDQA 2GCTC 1P11E 2Y5FA 1EP6A 3F9HA 2Z9GA 2ALPA 7ESTE 1F5KU 2P3FH 2OUAA 1GJ9B 1HAVB 4OS4A 1EOLA 1W7XH 1WBGB 4XBDA 3SU5A 2TBSA 4NFEA 1P8VC 1BMLA 3JZ2B 1C9TA 8GCHG 3LIWA 4CR5A 3F9FA 4I32A 1ZTLA 4FUIA 1OP0A 2ZTYA 3TNSA 2HGTH 1AWFH 1PQ7A 1NFYA 1W13U 3KEEA 2QXJA 4NGAH 2OBQA 3P8FA 4UDWH 3MO9A 1F5RA 1QL8A 2AGGX 4BOHA 2BYAX 1F0SA 2ZIQH 5AFZH 4AB9A 2AH4X 3CS0A 2ZU2A 3LGWA 4WH8A 4IN1A 1QJ1B 2PV9B 2FWWA 4BAHB 1IQIA 2XCNA 4X6NA 2SGFE 5EG4A 2BQ7B 1OWJA 3S0NA 1TNIA 2XC4A 3E3TA 2ZQ2A 1HAYB 3UNRA 2QV1A 2SGQE 1W10U 2BLQA 2VWMA 2ZF0H 2ALVA 4NWKA 1LPZB 2ANMH 1GI2A 4XBBA 3AAUA 2PKAA 4ZHAA 2DE8A 2UUJB 4DIIH 4IS5A 1AIXH 3RXAA 5A0BA 1C1RA 1OP2A 1XM1A 1V3XA 1W11U
chains in the Genus database with same CATH superfamily
5JBBS 9ESTA 1THRH 3MU8A 5DSFA 1BRAA 4BXWA 1EATA 4WXIA 3M5OA 5LPEA 4JYUH 1AUTC 1HNEE 2VIVA 3DT0H 1KXDA 5IYTA 4DY7B 1PYTC 1EUFA 1C1MA 1NBMD 1ETTH 1Y5BT 3F6UH 1E36B 3L33A 4CRCA 3N7DA 3O8RA 1HIAB 1EAXA 1TNKA 1XUFA 3KGPA 1NFXA 4XBCA 1G3BA 3WWBA 2P59A 1BA8B 5C1YA 2I6QA 3GCTG 1C1QA 3VB6A 4I8HA 5J4QA 1YBWA 2FOMB 1THPB 6GCHF 3EDXB 3GCNA 1Y3VA 2FS8A 1Z1IA 1J17T 1GCTB 3SQEE 1MH0A 1C2FA 1C5NH 1S84A 2WPHS 2AIPA 2XBYA 4CRAA 2FTLE 1L4ZA 4ISLA 2F91A 2GVFA 4ACAA 1C1TA 2P93A 3DCLA 4J1YA 1D6WA 2SGPE 1DM4B 2Z6BD 3QX5H 2FXRA 2WUCA 3PB1E 1OWIA 2XNIA 4CBNA 2JKHA 1MU8B 2AGIX 1ABIH 1LTOA 2TGDA 4YOGA 2F9OA 1PPHE 1KIGH 1CGIE 3GYLB 3KQDA 2BZAA 1MTVA 2ZGHA 1FY3A 1ZRKA 3FZZA 2H1UA 1LPKB 1UTQA 5CMXH 1O5GH 3VB5A 2QGRA 2D26C 1A3EH 3SU2A 2HOBA 1CBWC 3LGYA 1YGCH 4IMZA 1T4VH 1OKXA 3SZEA 1QBVH 1V2KT 4JYVH 4JMYA 3PROA 2FX4A 1ANCA 3TNTA 1EJAA 2RDLA 4BTIB 3SV9A 1C1PA 1TGNA 4KP0A 1C2HA 2GD4B 1RXPA 8KME2 3RXTA 2BVSH 1AU8A 1B0FA 1DX5M 5T3HA 3VFEA 2OC1A 3TH2H 1Y59T 1FN6A 3AAVA 1GHYH 4NIXA 2GV7A 4A6LA 2C93B 2XBXA 3LJOA 2LPRA 2J38A 1OYQA 1WU1A 5C0UA 2Q6GA 4RKJB 1T8OA 1GPZA 2VU8E 1IHTH 1Y3YA 4A1XA 1H8ED 3A86A 3MH4A 1F0TA 3RXJA 1HXFH 1GJ7B 3S69A 1ZMNA 5K7RA 4MTBA 4U32A 1IHSH 1P57B 3UUZA 1YY3A 5JBAS 1HAOH 1TNHA 2FOFA 5DO4H 1BJUA 2IJD1 1NZQH 1GBAA 3B23B 1GGDB 1KXEA 3ODFA 2PGQB 1Q31A 1QRXA 1FI8A 2SNVA 3A8BA 1AGJA 4MLFB 3BG8A 3F2FA 1HV7A 2J34A 1NTPA 2PFEA 2QIQA 3RXEA 1TGTA 2BTCE 1P3EA 2GDEH 3OEED 3RXPA 2K8IA 1YF4A 1XMNB 2XCFA 3BTGE 1KXBA 1GHAF 3M36A 4FUHA 4Q63A 2KZ4A 1S85A 1X7AC 3BEIB 4FOUC 2PR3A 1C2EA 2A4RA 5FXLA 3WW7A 2FTMA 4TT3D 1GBTA 1VJAU 1TONA 5EOKA 2B0FA 2BY5X 1S83A 3TK6A 3RXDA 3E90B 2C8WB 3AW0A 1NY22 2WPKS 2BY8X 4JCNA 3QZQA 5AFYH 1FLEE 3I29A 5CHAC 1M9UA 1YCPK 5HM9A 4NFFA 3PTBA 4ABIA 2P16A 1YPEH 1XUJA 4A1VA 1ESTA 1EASA 4XOJA 2ZFRH 1SC8U 3V12A 3BEUA 4JZIA 3LH1A 1O3DA 3OTPA 1HGTH 1HB0B 1VGCB 1QR3E 1SHHB 4X2WA 1EPTC 3P70B 4BANB 2KFWA 4DW2U 1S5SA 1O2KA 2HPQH 3M37A 4B6EA 8LPRA 1GJAB 2FOGA 3F0PA 3NKKA 1UJ1A 1BQYA 2ZP0H 2ZWLH 2BD4A 3CP7A 3RXCA 1QJ7B 3DHKH 3U9AH 5HIYA 5C2ZA 3GY2A 4IBLH 1A7SA 1TNJA 2FOEA 1GI9B 3GCHC 4ZKOU 1MTNB 3MNBA 1TA2A 5LGOA 4KTUA 3D49H 3RXLA 1O33A 1LMWB 1MTWA 3SGAE 1SLXB 2BQWB 5E0GA 4U01A 1AO5A 1GWAA 1MU6B 1DFPA 1QJ6B 3FAOA 2ZI2H 1BTWA 1UVOA 2J9NA 1JOUB 2BLVA 1V2WT 2NU1E 1K0HA 2EC9H 1OPHB 4ABGA 1CHOG 1GJDB 1GI3A 1KTSB 2FYQA 1SFQB 1MKXH 1WQVH 4WXVA 3U8OH 2CGAA 4MNWA 1ZJDA 5FCKA 3GY4A 4I33A 2Y7XA 1AE8H 1GBFA 2R0LA 3MWIU 2KCAA 1EP5A 1O2OA 1WCZA 5A0AE 2GKVE 3SU3A 2WV4A 5EQSA 1ELBA 1V2VT 4FU7A 1E38B 1P02A 1H9IE 3BTFE 1PPFE 3KQ5A 3RXHA 3HPTB 1QA0A 2K0QA 2VIOA 1FJSA 1O5CB 1E37B 1LKBA 2ZU5A 2BD2A 1E34B 1G2MA 1TPOA 1L2EA 1OWKA 2TGTA 3IG6B 2FLRH 1KYNA 1TRMA 4K5ZA 4NZLA 6LPRA 9LPRA 1OP8A 1UVPA 2VH0A 2A7HA 4XDEA 2Q1JA 5LPRA 2XTTB 5T6GA 2ZU4A 4NA7A 1O5EH 1O3LA 5FHTA 4J2YB 4Q80A 2TRMA 2ZDAH 3T27A 1LQEA 3DD2H 3R3GB 2Z9IA 3PYHA 4TY6A 5CHBA 4CRDA 1BMAA 3LU9B 1W14U 1GBDA 5B6OA 1O39A 3MMGA 3LONA 4E7NA 4ZKSU 3NZIA 3E1XB 1AB9C 2BDCA 3A89A 2ZCKP 3QGJA 3T26A 1O30A 3A81A 5EGMA 4D8NA 1F0UA 4B6FA 4O97A 1GHBF 4FUFA 5ESBA 1RFNA 2G00A 4INLA 3ZZ8A 4LOYH 1RIWB 3RXQA 1HLTH 3UQOA 4D7FA 1MKXK 4O3UA 1O34A 4E06H 3STIA 1C5OH 2A2XH 5GXPA 2ZDMA 1BDAA 1QL9A 3EAJA 4TPYA 2CHAB 4B76A 1YYY1 1T7CA 2GZ7A 4X6PA 1SOZA 4ABEA 1DWBH 1O36A 3PO1B 4JZFH 1KY9A 1CA0B 2BXUH 2Z3DA 3NUMA 1TQ0B 1EPTA 4AYYB 3RU4D 1C1SA 3BTTE 5C1UA 1NRPH 4CRGA 5L6NH 5E2PA 2A0QB 2J97A 2TPIZ 5A2MH 1TBZH 1DWCH 1MBQA 1NU9A 3ZZ3A 1CGJE 4AG1A 1HJAC 1ETSH 1SI5H 4X0WU 4ZAEA 1V2QT 1ZGVA 3UREA 2ZDNA 2FYRA 3F68H 1SB1H 1IQEA 3U69H 1Z6JH 3SHAH 3ZVBA 5FPSA 3W94A 1K1OA 2GZ8A 1SSXA 1BB0B 2ODPA 3T2NA 4Y11E 2WSSD 3SI3H 2V3MA 2NU4E 1G32B 3O8DA 3FVFB 1H1BA 1YPJH 3UPEA 1XXDA 4FXGH 4Y0YE 2Z7FE 1PYTD 3LKWA 2WPJS 4DURA 2A5KA 2A45B 1ZOMA 1C4Y2 1MZAA 4XRNA 1S6HA 2ZU3A 5HGGA 1GMCF 4AGJA 2ZDVH 3ENSB 5C94A 2I6SA 1JIRA 1O2QA 1QB1A 4ZXXH 1A0JA 2W6JD 2K1QA 2YOLA 3EE7A 2F43B 4D9RA 4B2CA 1P09A 4THNH 3D65E 1QTFA 4KGAA 3UY9A 3TH3H 1ANDA 1RTKA 1JRSA 3S9CA 3TPIZ 5IDKA 4FVBA 3BTKE 4IC5A 1MCTA 1V2OT 1QURH 4AFUA 2BB4A 2WPMS 1AVGH 3DUXH 1N6XA 1QY6A 3FP7E 1MZDA 1NFUA 4NWLA 2STAE 2GDDA 3I78A 3Q3KA 3BF6H 1EFRD 1TLDA 2A4OA 3RXSA 1L0ZA 3VXEH 1TAWA 3ZZDA 5DGJA 4K8BA 1S6LA 1C1OA 4CHAC 2BXTH 3MI4A 1NRSH 3RXFA 1UK3A 5GCHG 2BLOA 1UTMA 2BM2A 1A61H 4VGCC 2F9BH 3AK5A 4OGXA 2FI4E 5I46H 1QQ4A 3QDZB 7GCHF 3VXFH 1GDQA 4CR9A 1C5RA 4YZUA 1C5LH 3NPSA 4OS2A 1QRWA 1K1NA 1TMUH 1QFKH 1C5TA 5ESTE 4DOQA 2AMQA 1VKYA 3K6YA 1IAUA 1UTJA 2FOHA 1OHHD 4NIYA 4Z1MD 3SV6A 2JETB 3KNXA 2XBWA 2AERH 2GCHF 2UWOA 4INKA 5C20A 1O2RA 2SNWA 1C2MA 4OM9A 4U2WA 5F8XA 2BHGA 1UO6A 1O5AB 1LVMA 2R2WU 2W6ID 2NU2E 1UK4A 1NT1A 2O8UA 1BBRK 2J98B 1EAIA 2HVXA 1DSUA 1QB6A 1K9OE 3EA7A 3MH6A 1QZ8A 2ZHDA 1N8OC 2HPPH 5FX6A 2FI5E 2L74A 3H7TA 3RC6A 4SGAE 4FUJA 4Q7YA 4ASUD 1SFIA 4NCYA 2EQNA 2ESTE 1LDTT 3Q3XA 3TLOA 1O31A 2HNTE 1O3CA 1O32A 2A32A 2VWLA 1TX7A 2RG3A 1DANH 4UONA 1O2GH 2ANWA 1K1MA 4FVDA 4AYVB 3D62A 2C90B 4BXSA 3HATH 2KCPA 4OS1A 1O2NA 1KXCA 3M5MA 3BV9B 1UVUH 3Q77A 4K69A 1LVYA 2J4IA 2QY0B 1HBTH 2OCVB 1NU7B 4PROA 4X2YA 2B9LA 5E0HA 3ZYDA 1K1LA 3BIUH 2QXGA 1BCUH 3N7EA 1IQGA 5T6FA 1CT4E 1KTTB 1T8NA 3H09A 5E8EH 1D3PB 2PHBA 1AFQB 2BDHA 3RXBA 5EODA 5DKMA 1H4WA 1V2UT 1L1NA 3M7QA 2QC2A 5EXNA 2ZDLA 3STJA 3RU4T 1P2IA 1GVZA 3VEQB 1XUGA 2FMJA 1TOMH 1ELFA 1LVOA 1ZHMA 3ITIA 4Q7ZA 4ZKRU 1ELEE 1MBMA 3PM3A 5JB9S 2BD7A 4AZ2B 2GMTC 2O8WA 4YLQH 4DCDA 1GHZA 3F2HA 1VITG 3MU1A 3QO6A 3UAIC 4TY7A 1GMHG 3A8CA 2AYWA 4GUXA 4IMQA 3A7WA 4NSYA 3MU5A 1ZPBA 5EQRA 3T25A 5H4IB 2GT7A 2W3IA 2ZGCA 3KYGA 2R3UA 4RN6A 5EW1H 1TGBA 3RMNH 2O9QA 1C4V2 1KLJH 1LHGH 1Y8TA 2BY9X 5DP5A 1TBRH 4M7GA 1H9LB 4O03A 1EOJA 4OS6A 1WAYB 1ARBA 3S9AA 1P10A 3HK6B 1GJBB 1S0RA 3PMBB 3ZVCA 4AFQA 3GY5A 1YPMH 3W1EA 1O2SA 5FBEA 4MG3A 3F9EA 2OQUA 1GL0E 2R9PA 2FODA 2UUYA 4K1SA 3TK5A 3MQKC 2O8TA 2ZCLP 3DFLA 3S9BA 2FIRH 5EPNA 4ISOA 1QIXB 4I8JA 1FIWA 1C2IA 3DA9B 3UR9A 3RC5A 3SV2H 2G81E 2XBVA 1BTZA 5FX5A 3PV5A 5G4BA 3A84A 1C5QA 1QQUA 4WH6A 4K8YA 4X8TH 2ZPSA 4INHA 2JDID 3U28C 1BMMH 2PSYA 1D6RA 2GV6A 2EA3A 1INCA 1GJ4H 1QBNA 3ZZ4A 1MCVA 2R2MB 4BNRA 1B5GH 4X8VH 2ZQ1A 3W95A 1AVXA 3QTOH 2ZU1A 4NZQA 2ASUB 1AI8H 2BQ6B 2F83A 3LH3A 2VBCA 2HRVA 2VIWA 4DVAU 4Y8YA 1YPLH 2NWNA 3RXOA 1Z8JB 3E0NB 1F0RA 4CRBA 2W7UA 2BD3A 2KAIA 4P02A 4BAKB 4Q2KA 4Q7XA 5DJ7A 3NK8A 4XFQA 3O8BA 1YC0A 1FUJA 1ELCA 1SGQE 1CA8B 3BTME 1FX0B 2GX4A 2HNTC 4LXBH 1C9PA 3UOPA 5CHAB 1SHYA 5F8TA 1FAKH 2BX4A 5DP8A 1O3HA 2A4QA 4E05H 4D7GA 1TX8A 3SJ9A 1DXPA 1OWHA 1IQMA 3UWJH 2F9PA 1BOQA 1EAUA 4Y8XA 1G3CA 3MYWA 4OS5A 4ZXYH 2D1JA 1ACBE 1HUTH 1TALA 1YCPH 3GYMA 4GCHF 2H2ZA 3SOSA 1C5MD 2J2UA 1GBEA 2ZHQH 1O5FH 3Q76A 4I8LA 4X1PU 1P2KA 5TJXA 4YT6H 3A7ZA 3TVJB 4LZ4B 1V2ST 3T29A 3L6PA 1L1JA 4YTAA 3DFJA 3RM2H 1C5UA 5A8XA 4AFZA 1S81A 4Z6AH 3DSPA 3MO3A 1IQJA 1BIOA 1ESAA 2NU0E 3TH4H 2CMYA 3SU0A 3SU4A 1FPHH 1O2IA 1O3JA 1Z7KA 1DS2E 5A8YA 1W7GH 2WZQA 1BZXE 2B7DH 5HMAA 3AW1A 5JB8S 4H4FA 3ZZCA 1C5XB 1DVAH 2PWXA 1UHBA 1GCTC 4AOQA 3CNRA 3T28A 1C1WH 1G36A 1K1PA 2QF5A 2Q6DA 3TITA 3KIDU 1NC6A 1E0FD 1J15A 4UFFH 4WJG2 3VGCB 1ELDE 1LO6A 1XUKA 2TGPZ 1AKSA 3FZDA 1GDNA 4ZH8A 4F48B 3U8TH 3ZVGA 5A0CA 3P6ZB 4D76A 3A85A 3PLPA 3TU7H 1C5YB 4XSKU 2XW9A 1KXFA 3E0PB 2OINA 2WPDD 1A5IA 1HAIH 1H9HE 2FESH 2OC0A 5KGOA 1XVOA 2P94A 1HAZB 4Y76A 2HWLB 2L6OA 5GIBA 3LC5A 1OWDA 1D9IA 2GZ9A 2LNCA 3K2UA 2OBOA 2ZDKA 2ZGXH 1N6YA 3EQ0H 2WUBA 3ATWA 4X6MA 2XWAA 3NRLA 3A88A 1UTLM 2SGDE 2GTBA 2H6MA 1KLTA 1OSSA 1GMDF 5JDUB 1UCYH 3LPRA 1BMFD 1SGRE 2P3UB 2JH5D 3BSQA 1YM0A 2F4LA 1SGYE 1O2HA 7LPRA 4MNXA 1C1NA 1T4UH 3A8DA 3H7OA 1KMHB 1H8IH 3F9GA 3RXVA 1G3EA 2CJIA 3FO8D 1HAVA 1NRRH 2JJ2D 4AX9H 4BAQB 1BTHH 4QT8C 3ZZBA 1IOEA 3PLKA 3SORA 1O2XA 1O3BA 2J94A 2P8OC 3RMMH 3FP8E 5DP9A 1SGDE 2ZZUH 2A7JA 2FO9A 4B75A 2V7QD 1GJ5H 1EB2A 3TJVA 4O9VA 3U8RH 2CXVA 2ZHFH 5EQQA 2XC5A 2BZ6H 4BAMB 3UNQA 5DPAA 2C8XB 1KDQB 3RP2A 1YLDA 4K2YA 4BTTB 1P2MA 4I8GA 1WDIA 1O3FA 1QHRB 3M35A 3KHVA 1XKAC 3A87A 2ZECA 1GCDA 1HJ8A 1TBQH 3GDUA 4X1SU 2IOTA 2ZEBA 1ELVA 1J9CH 1C2LA 2EI7A 3LGTA 1Y5UT 3F2GA 1CQQA 3BTHE 4ABAA 1ARCA 1V2MT 2JIZD 2OP9A 4B71A 2YMSD 2AEIH 6CHAC 2QAAA 1GI6A 3URCA 3SJKA 6GCHG 1VCQA 1JWTA 2GJGA 1U6QA 1O2UA 3A7TA 3UWIA 3MNXA 1TQ7B 1GI1A 4UFEH 2QA9E 4JZDH 2GGVB 1SR5C 4X8SH 1OOKB 1GG6B 1UMAH 1GBJA 1O2YA 3TJUA 4LZ1H 2QXHA 2TGAA 2BVXH 2G4TA 1GBLA 5ABWA 4TWWA 2OXSA 3SNEA 3P8NA 4FUDA 4IN2A 3URDA 1GI7B 1CVWH 1SMFE 1UCYK 2H9TH 2VGCB 5T1VA 4FUGA 2ZNKH 4R0IA 1HIAA 5TCAA 4YM9A 1JBUH 8GCHF 2EI6A 2PKAB 3KYFA 1UTOA 2Z3CA 1TA6A 4ZMAH 1WTHD 2WINI 2RA3A 1NS3A 3HGPA 5DK1A 3U1IB 5C0TA 1SGCA 1NROH 3PV4A 1GHWH 1GI4A 4ZHLU 2PKSB 5AVDA 4JZ1A 3HKIB 5C17A 1GHXH 2RCEA 1DITH 5KECA 4FUCA 2G55A 1AY6H 5DP4A 2A5AA 1SBWA 3FKSD 1NPMA 4Y0ZE 2F9NA 4Z0KA 2Y5GA 1ANEA 4X6OA 3MOCA 4FUEA 2ZG0H 4JK6A 3V0XA 2WV9A 2YMSB 3DSGA 3K9XB 2D8WA 1ZSKA 1AUJA 1COWD 2SFAA 3M61U 4YT7H 3VPKA 1BRBE 1SLVB 2ZPQA 3VG8A 2EEKA 5F8ZA 4F55A 1O5DH 2ZKSA 4GSOA 4DGJA 4GHQA 1GVLA 1AFEH 1VGCC 1SLUB 4X1NU 3FOAA 2A5IA 1HRTH 1ZTKA 1O3GA 2ZA5A 4HG6A 1HXEH 5GPIB 2VVCA 3FN8A 3T5FH 3U98H 5L2YH 2J95A 3TGKE 1GI8B 5EJZA 6ESTA 2JH0D 2BMGB 1RRKA 1JRTA 1ZTJA 3MU0A 2ZPRA 1MAYA 5EJLA 4CHAB 1Y3UA 5DP3A 1ABJH 3ELAH 1O37A 1UTKA 2W5EA 1SPJA 1DLEA 1SGIB 3QGNB 1MTNC 4BAOB 2BVRH 1TB6H 4AGKA 1MD7A 1CSOE 1LHCH 2Z94A 3SI4H 5JPMH 2V35A 1G3DA 1KXAA 4ACBA 3GCTF 5T6DA 1GJ8B 1SGTA 1F2SE 1L1GA 3MTYA 2H5CA 3UTUH 4CREA 2H5DA 2KR7A 1Z8IB 2OC7A 1QNJA 1TABE 1YWUA 3I77A 1LHEH 1C2JA 1OS8A 1PQAA 5JBTA 2GCTB 3GISB 1GHAG 1P05A 1IQFA 1HAGE 2A31A 1SOTA 4A5TS 1SL3A 1P2JA 4MQAA 1GBBA 3ZVDA 5JYIA 4X2XA 2BD5A 1HJ9A 2ODQA 4K1EA 1ZRBA 3O8CA 1HPGA 1UW7A 3AVZA 4HZHA 4K1TA 3SNAA 1XUHA 2H9HA 1H8DH 2BDGA 4GVUA 4YOIA 4UFDH 3OY5U 1G37A 1K21H 5DN6D 1BBRH 5CE1A 2A7CA 1DWDH 5J4SA 1A3BH 1QCPA 1Y5AT 3SBKA 1ZYOA 3SNBA 5F53A 3N7OA 3BG4C 1DE7H 5HM2A 3EYDA 4FU9A 5BPEA 4ABDA 3B8JA 3GS9A 2LELA 1O3KA 4NA9H 2ZGBH 3SN8A 2G5VA 3AASA 4CRFA 1EX3A 2R0KA 1A2CH 4FUBA 3PMAB 1TE0A 3C27B 4A7IB 1BHXF 1W0JD 3ODDA 3QN7A 1AZZA 1EXFA 5PTPA 3MH5A 2FEQH 1F7ZA 2QN5T 3ZZ7A 2GP9B 1C2DA 1W3CA 4MDSA 3RM0H 3TGJE 3PTNA 1C5ZB 1VJ9U 1PJPA 4OGYA 1BTXA 2FDAA 1CT2E 1OWEA 2AIQA 2W3KA 2YNAA 1SGNE 1SLWB 2P95A 1EZSC 3S7HB 4X1RU 1WTGH 7KMEH 5FBIA 2B5TB 2FLBH 1RIWC 1FXYA 1T32A 4CH8B 3SHCH 5EU8A 1P06A 3E6PH 4YXWD 2ZFTA 1D4PB 1P9UA 1DLKB 1Z71A 1ZR0A 1K1IA 1C2GA 2J92A 2ILNA 2BOHB 5FL7D 4WY3A 2ZHEH 1FPCH 3PO1C 2G8TA 1CA0C 1UTNA 4MVNA 1C5WB 2XNDD 1EJMA 4MPXA 1O2TA 1S6FA 3H5CB 1AN1E 3LOXA 3OU0A 5E0JA 5LPFA 3G01A 2Y82A 4ASHA 1GJ6A 1V2PT 4BTUB 1FDPA 3GCOA 4X2VA 3RXRA 5GJ4B 4IGDA 1O2MA 2BDAA 2V3OH 3F3BA 2F9VA 2W7SA 3SV8A 2JH6D 1WUNH 3SUEA 2M2AA 4Y7BA 3PLBA 1H8HD 1GJCB 5F6MA 3TGIE 1SKYE 4I7YH 1THSH 4K3JA 2SGEE 1MQ6A 2OQ5A 1DUEA 1TOCB 4IC6A 1TRNA 3P8GA 1C2KA 1O35A 2BDIA 3ATLA 1E1QD 3OE7D 1SQAA 1AHTH 1E35B 1TRYA 5JBCS 3SZNA 3GOVB 4UD9H 4X8UH 4M9FA 5B6LA 1V2NT 3E8LA 3M3SA 4ABFA 2OTVA 3FANA 3MO6A 3SUFA 3RMOH 1O2VA 3PWCA 3OFND 1BHXB 1QL7A 2WYJA 3MU4A 3T62A 1CBWB 3B9FH 1TWXB 3EE0B 1AQ7A 2AMPA 2QF0A 3RLWH 2A1DB 4Q4LA 2RDEA 1HAHH 3A7XA 3E91A 2G51A 5C1XA 2LP6A 2QF3A 1YLCA 3A82A 2XWBI 1CE5A 3OY6U 3R0FA 5DP6A 2FP7B 1GI5A 1P03A 2UWPA 2B8OH 1A5GH 3CENA 4ZCNA 3LC3A 1WYKA 3N99A 2UWLA 5EXLA 1E1RD 1QGFA 3GICB 3KN2A 3OYPA 1QRZA 1VCPA 1P01A 3RXGA 3KF2A 1MMJN 1F92A 1VCWA 2Z9LA 1IQLA 5C5OA 2BD9A 4B2BA 1ZPCA 4GPGA 1GHBG 2F9UA 4GLYA 1HFDA 1TIOA 5TCCA 2KX4A 3HK3B 3BN9A 1DSTA 3BTQE 1XKBC 3QWCH 2ZTXA 1DOJA 1C1UH 5EIYA 2PUXB 1C5PA 4H42U 1LCYA 3RLYH 1GBIA 2ULLA 5ETXA 3SQHE 2IPHA 3QZRA 1NESE 1J8AA 1O3IA 4HTCH 1CT0E 3UQVA 4H6SB 5GDSH 2JETC 1Y3WA 1CHOF 1K22H 3D23A 1BUIA 1KLIH 4WMDA 4I86A 1NBME 1V2LT 2DE9A 1ELAA 3SUDA 3UNSA 1HAXB 2ZFPH 4TWYA 3ZVAA 2ANYA 1N1LA 4I8KA 5HKKD 3NWUA 3ZV9A 2Y7ZA 5SGAE 1TYNA 1YPHE 4DT4A 1P04A 2O8MA 2VINA 3PMJA 1GMCG 3GY6A 1O3EA 1T8MA 2XYAA 3UFAA 3RXMA 2AHME 3HKJB 3TJOA 1P9SA 3UIRA 3EA8A 1UVSH 3RXIA 1QA7A 3A7YA 3PMHB 3ZVFA 1EZUC 1GHVH 2QE7D 1S0QA 4B74A 1YPGH 2NU3E 3M5LA 3OEHD 2WV5A 1AFQC 1L4DA 2OLGA 4AB8A 1MKWH 4TYDA 3ESTA 3P95A 4WF8A 3ATMA 1EAWA 4HFPB 4ZUHA 1DXWA 2IN2A 3HGNA 2BX3A 3S7KB 1D3TB 2STBE 1O2JA 4X1QU 3BIVH 1NN6A 1JXPA 1AVWA 3QK1A 4E7RG 1EPTB 2P8OB 2BOKA 1C5VA 3LGIA 2Y5HA 1LQDB 3SGQE 2IJOB 2QCYA 4KKDA 5HIZA 2M5TA 1FN8A 2ZC9H 2ZO3H 2VIDA 3MFJA 2Y6TA 2FPZA 3SUGA 2XOKD 5BRRE 3A80A 3OAAD 3ZVEA 4D9QA 1RTFB 1W0KD 7GCHG 3SO3A 1ZHPA 4OS7A 2ZFQH 1ZPZA 2CV3A 3GCHB 1P2OA 3A8AA 4NG9H 3NXPA 4LK4A 1DDJA 2PW8H 2TIOA 3UR6A 1MD8A 4AFSA 1SVPA 1AMHA 2Z3EA 1LPGB 1GL1A 1EJNA 5E2OA 3K65B 1PPEE 1BRUP 3KQEA 1NO9H 1UTPA 1ZSLA 3ZZ6A 1UCYE 2GCHG 3BTWE 3Q00A 1SGPE 5FPTA 6CHAB 2HALA 3SYJA 4ABHA 1IQNA 4NA8A 1WXRA 3TIUA 1WV7H 3F1SB 5C67A 1TNGA 2XXLA 3V7TA 1A46H 2QF4A 2BLWA 1IQKA 3RMLH 2G4UA 1ID5H 2RA0A 4B73A 1RS0A 1ZHRA 3UOUA 1FIZA 4K60A 1PFXC 3BTEE 1EZQA 1OXGA 1GBHA 1JMOH 1CU1A 3TJNA 1MKWK 3ZIAD 1HYLA 1NRNH 4HI3A 3V13A 2Y81A 1Q2WA 4RSPA 3OSYA 5FAHA 1O0DH 1ANBA 3C1KA 3PRBA 1G9IE 1CO7E 1GVKB 1PPCE 5K0HA 2Z9KA 1E79D 1YCPM 4YOJA 3ATKA 1F5LA 1FY5A 2ZGJA 3IWMA 5EJ1A 2J98A 3ZYEA 1O2WA 1MTUA 3SNCA 3TK9A 1YPHC 1BTUA 5GWZA 1BTYA 1O3PB 1K2I1 2ZTZA 1J16A 2PSXA 2DUCA 4I31A 3SNDA 1ORFA 4Y7AA 1ELGA 2SGAA 2XC0A 5KEDA 1P2QA 2VIPA 1DY8A 1P3CA 1TPAE 4ABJA 1FNIA 2AS9A 3M7TA 2D2DA 4AORA 2HLDD 1AD8H 1JIMA 1Z6EA 4CBOA 1TFXA 2CF8H 4B1TA 2FX6A 2OC8A 3LJJA 3KQCA 3SJIA 4IW4E 2THFB 3A83A 1FONA 2OK5A 2VNTA 1MTSA 2QXIA 1AB9B 1TPPA 4MPVA 3M3TA 1PPGE 2VVVA 2PTCE 1XUIA 4DG4A 5GCHF 2HVYB 2ZHWH 3M7UA 4GHTA 4SGBE 5A09A 3SU1A 1OX1A 1B7XB 2CN0H 4Y8ZA 2ZFFH 3WY8A 1V2JT 4KTSA 3RXKA 1GGDC 1O3MA 4CH2B 2C8ZB 1CGHA 2VVUA 4ZHMU 1LKAA 2EY4C 3VB3A 5C5NA 1SQTA 5DG6A 1V2TT 1SQOA 4WVPE 5EXMA 3EA9A 1P0SH 3ZZ9A 2FS9A 1O5BB 3SW2B 1O3NA 1VZQH 1DUAA 1SGEE 1HCGA 1LVBA 3QTVH 4UFGH 1K28D 1Y3XA 3PV2A 1EB1H 4ISHH 3OTJE 2RFKC 2CK3D 3WWFA 4KTCA 2ZCHP 3QLPH 1ZMJA 3VGCC 4YESB 1O38A 1HJAB 1A4WH 1ZLRA 4MNVA 2BD8A 1QB9A 4Y10E 2YNBA 2BY6X 5FCRA 3RXUA 1HAPH 1GBKA 1V2RT 4RKOB 5L2ZH 2A2QH 3DSOA 3RUOA 1CHGA 1Q3XA 4KELA 4AG2A 1C4U2 1A0HB 2FI3E 4GAWA 2C3SA 2WHXA 2PGBB 1FQ3A 1G30B 2A4GA 1ZZZA 2GT8A 3F0OA 3KCGH 2HLCA 2XRCA 1C1VH 1BTPA 1TNLA 2IPQX 2Y80A 1OYTH 1C5SA 1A0LA 1FZZA 4Y79A 1AWHB 1WQSA 2BY7X 4WMEA 1YPKH 1T8LA 1KSNA 4ISIH 5C3NA 4UE7H 1DY9A 5F03A 3OX7U 3MNCA 4B2AA 1SGFG 2AMDA 4FETA 3BG4B 1SG8B 3MNSA 1G2LA 3FP6E 4XD7D 2KCOA 1Z8GA 1XX9A 1HDTH 1LHDH 3SJOA 2ZFSA 3PRDA 2AGEX 1ESBA 2WPIS 1FY8E 2FOCA 2VB0A 1RTLA 4GCHG 2UUFB 1BT7A 4RI0A 5AF9H 2FOBA 3M3VA 3FFGA 2W26A 1TMBH 3A7VA 3GY3A 4TPIZ 4R8TB 3ZZAA 4ISNA 3BTDE 1VITF 2F3CE 2R3YA 3ATIA 4O3TA 1GMHF 3P17H 4AN7A 3PWBA 1MQ5A 3SU6A 4XE4A 4A1TA 1DT2A 2O8LA 4VGCB 4F4OC 4F49A 4DIHH 5HXFA 2AFQB 3GY7A 4YLUA 3ZV8A 3LT3A 4JZEH 2ANKH 1O2LA 3GY8A 3GDVA 1TMTH 2UUKB 3IITA 2BDBA 4MPWA 1BJVA 4Y71A 3SJ8A 4WMFA 1UK2A 1RJXB 3RC4A 1D3DB 1RGQA 1W8BH 1V6DA 1BBRE 2C8YB 1O3AA 1W12U 1J14A 1QBOA 1GI0A 2KAIB 2VWNA 2VH6A 1Z1JA 2PTNA 1GG6C 5EPYA 1ZJKA 2P3TB 4JK5A 4DJZB 1DWEH 1ELTA 1YKTA 1O2ZA 1PPZA 2Z9JA 1RD3B 4NIVA 3SV7A 4MPUA 3V3MA 2VGCC 3M5NA 5EW2H 3QUMP 1Z8RA 1IQHA 1BMNH 1MUEB 1N8OB 1WSSH 2KCYA 1NM6A 1EZXC 5L30H 1DICA 1AZ8A 3E16B 2WPLS 1O2PA 4ZKNU 3LGVA 3RDZA 2G52A 3P8OA 2C4FH 1UVTH 3BEFB 3Q3YA 3RU4E 4DT7B 3P92A 1B0EA 2PKSC 1FY1A 1EKBB 2FOAA 1GBMA 4H6TA 2WYGA 2CF9H 1SQRA 1ZMLA 3SGBE 1GMDG 5HYOA 1ETRH 8ESTE 4Y6DA 1YLNA 2BDYA 3LGUA 3NCLA 3MHWU 2KM0A 2FM2A 1PPBH 2OD3B 3GDSA 1S82A 4P00A 2YMSC 3K6ZA 1PQ8A 1VR1H 1WOFA 3KL6A 1MABB 3LDXH 2H9EH 1BITA 1O3OA 3ZZ5A 3VB4A 5DP7A 4UEHH 1XVMA 3JZ1B 1BRCE 4YO9A 1P12E 1SGFA 1FY4A 5CDFE 1YP9A 1W0YH 1UHBB 4AC9A 2PUQH 4U30A 2HNTF 2QYIA 5LH8A 4ZROA 1K1JA 1VITH 2GMTB 1TX6A 1T31A 4ABBA 2V3HH 1A1RA 2FZZA 1GBCA 2J5UA 1TGCA 1FAXA 1W0ZU 2PLXA 2VIQA 1MAXA 5A8ZA 1AKSB 2VJ1A 1NFWA 2G5NA 2CHAC 1D3QB 5I25A 4ESTE 1TGSZ 3VB7A 1W2KH 1FV9A 3KQBA 5FPYA 1EQ9A 4JYTA 4MNYA 4NIWA 1DPOA 3EGKH 3MH7A 3UB0A 4A92A 2JJ1D 4HGCA 1XXFA 2V6NA 1P2NA 1AE5A 3L3TA 1NRQH 1LHFH 1TPSA 4WWYA 1ZSJA 3CS7A 4FU8A 2VWOA 1FMGA 2V0BA 2ODYB 5AHGH 3U1JB 1GDUA 1ZGIA 2EI8A 1PQ5A 1A5HA 2Q6FA 4NSVA 1KDQA 2GCTC 1P11E 2Y5FA 1EP6A 3F9HA 2Z9GA 2ALPA 7ESTE 1F5KU 2P3FH 2OUAA 1GJ9B 1HAVB 4OS4A 1EOLA 1W7XH 1WBGB 4XBDA 3SU5A 2TBSA 4NFEA 1P8VC 4RT1A 1BMLA 3JZ2B 1C9TA 8GCHG 3LIWA 4CR5A 3F9FA 4I32A 1ZTLA 4RT0A 4FUIA 1OP0A 2ZTYA 3TNSA 2HGTH 1AWFH 1PQ7A 1NFYA 1W13U 3KEEA 2QXJA 4NGAH 2OBQA 3P8FA 4UDWH 3MO9A 1F5RA 1QL8A 2AGGX 4BOHA 2BYAX 1F0SA 2ZIQH 5AFZH 4AB9A 2AH4X 5GNDA 3CS0A 2ZU2A 3LGWA 4WH8A 4IN1A 1QJ1B 2PV9B 2FWWA 4BAHB 1IQIA 2XCNA 4X6NA 5IK2D 2SGFE 5EG4A 2BQ7B 1OWJA 2PP6A 3S0NA 1TNIA 2XC4A 3E3TA 2ZQ2A 1HAYB 3UNRA 2QV1A 2SGQE 1W10U 4TSFD 2BLQA 2VWMA 2ZF0H 2ALVA 4NWKA 1LPZB 2ANMH 1GI2A 4XBBA 3AAUA 2PKAA 4ZHAA 2DE8A 2UUJB 4DIIH 4IS5A 1AIXH 3RXAA 5A0BA 1C1RA 1OP2A 1XM1A 1V3XA 1W11U
chains in the Genus database with same CATH topology
5JBBS 9ESTA 1THRH 3MU8A 1BRAA 4BXWA 1EATA 4WXIA 3M5OA 5LPEA 4JYUH 1AUTC 1HNEE 2VIVA 3DT0H 1KXDA 5IYTA 4DY7B 1PYTC 1EUFA 1C1MA 1ETTH 1Y5BT 3F6UH 1E36B 3L33A 4CRCA 3O8RA 1HIAB 1EAXA 1TNKA 1XUFA 3KGPA 1NFXA 4XBCA 1G3BA 2P59A 1BA8B 5C1YA 2I6QA 3GCTG 1C1QA 3VB6A 4I8HA 5J4QA 1YBWA 2FOMB 1THPB 6GCHF 3EDXB 3GCNA 1Y3VA 2FS8A 1Z1IA 1J17T 1GCTB 3SQEE 1MH0A 1C2FA 1C5NH 1S84A 2WPHS 2AIPA 2XBYA 4CRAA 2FTLE 1L4ZA 4ISLA 2F91A 2GVFA 1C1TA 2P93A 4J1YA 1D6WA 2SGPE 1DM4B 2Z6BD 3QX5H 2FXRA 2WUCA 3PB1E 1OWIA 2XNIA 4CBNA 2JKHA 1MU8B 2AGIX 1ABIH 1LTOA 2TGDA 4YOGA 2F9OA 1PPHE 1KIGH 1CGIE 3GYLB 3KQDA 2BZAA 1MTVA 2ZGHA 1FY3A 1ZRKA 3FZZA 2H1UA 1LPKB 1UTQA 5CMXH 1O5GH 3VB5A 2QGRA 2D26C 1A3EH 3SU2A 2HOBA 1CBWC 3LGYA 1YGCH 4IMZA 1T4VH 1OKXA 1QBVH 1V2KT 4JYVH 4JMYA 3PROA 2FX4A 1ANCA 3TNTA 1EJAA 2RDLA 4BTIB 3SV9A 1C1PA 1TGNA 4KP0A 1C2HA 2GD4B 1RXPA 8KME2 3RXTA 2BVSH 1AU8A 1B0FA 1DX5M 5T3HA 3VFEA 2OC1A 3TH2H 1Y59T 1FN6A 3AAVA 1GHYH 4NIXA 2GV7A 4A6LA 2C93B 2XBXA 3LJOA 2LPRA 2J38A 1OYQA 1WU1A 2Q6GA 4RKJB 1T8OA 1GPZA 2VU8E 1IHTH 1Y3YA 4A1XA 3A86A 3MH4A 1F0TA 3RXJA 1HXFH 1GJ7B 3S69A 1ZMNA 5K7RA 4MTBA 4U32A 1IHSH 1P57B 3UUZA 5JBAS 1HAOH 1TNHA 2FOFA 5DO4H 1BJUA 1NZQH 1GBAA 3B23B 1GGDB 1KXEA 3ODFA 2PGQB 1Q31A 1QRXA 1FI8A 2SNVA 3A8BA 1AGJA 4MLFB 3BG8A 1HV7A 2J34A 1NTPA 2PFEA 2QIQA 3RXEA 1TGTA 2BTCE 1P3EA 2GDEH 3RXPA 1YF4A 1XMNB 2XCFA 3BTGE 1KXBA 1GHAF 3M36A 4FUHA 1S85A 1X7AC 3BEIB 2PR3A 1C2EA 2A4RA 5FXLA 2FTMA 1GBTA 1VJAU 1TONA 5EOKA 2B0FA 2BY5X 1S83A 3TK6A 3RXDA 3E90B 2C8WB 3AW0A 1NY22 2WPKS 2BY8X 4JCNA 3QZQA 5AFYH 1FLEE 3I29A 5CHAC 1M9UA 1YCPK 5HM9A 4NFFA 3PTBA 4ABIA 2P16A 1YPEH 1XUJA 4A1VA 1ESTA 1EASA 4XOJA 2ZFRH 1SC8U 3V12A 3BEUA 4JZIA 3LH1A 1O3DA 1HGTH 1HB0B 1VGCB 1QR3E 1SHHB 4X2WA 1EPTC 3P70B 4BANB 4DW2U 1S5SA 1O2KA 2HPQH 3M37A 8LPRA 1GJAB 2FOGA 3NKKA 1UJ1A 1BQYA 2ZP0H 2ZWLH 2BD4A 3CP7A 3RXCA 1QJ7B 3DHKH 3U9AH 5C2ZA 3GY2A 4IBLH 1A7SA 1TNJA 2FOEA 1GI9B 3GCHC 4ZKOU 1MTNB 3MNBA 1TA2A 5LGOA 4KTUA 3D49H 3RXLA 1O33A 1LMWB 1MTWA 3SGAE 1SLXB 2BQWB 5E0GA 4U01A 1AO5A 1GWAA 1MU6B 1DFPA 1QJ6B 3FAOA 2ZI2H 1BTWA 1UVOA 2J9NA 1JOUB 2BLVA 1V2WT 2NU1E 2EC9H 1OPHB 4ABGA 1CHOG 1GJDB 1GI3A 1KTSB 2FYQA 1SFQB 1MKXH 1WQVH 4WXVA 3U8OH 2CGAA 4MNWA 1ZJDA 5FCKA 3GY4A 4I33A 2Y7XA 1AE8H 1GBFA 2R0LA 3MWIU 1EP5A 1O2OA 1WCZA 5A0AE 2GKVE 3SU3A 2WV4A 5EQSA 1ELBA 1V2VT 4FU7A 1E38B 1P02A 1H9IE 3BTFE 1PPFE 3RXHA 3HPTB 1QA0A 2VIOA 1FJSA 1O5CB 1E37B 1LKBA 2ZU5A 2BD2A 1E34B 1G2MA 1TPOA 1L2EA 1OWKA 2TGTA 3IG6B 2FLRH 1KYNA 1TRMA 4K5ZA 4NZLA 6LPRA 9LPRA 1OP8A 1UVPA 2VH0A 2A7HA 4XDEA 2Q1JA 5LPRA 2XTTB 5T6GA 2ZU4A 4NA7A 1O5EH 1O3LA 5FHTA 4J2YB 4Q80A 2TRMA 2ZDAH 3T27A 1LQEA 3DD2H 3R3GB 2Z9IA 3PYHA 4TY6A 4CRDA 1BMAA 3LU9B 1W14U 1GBDA 5B6OA 1O39A 3MMGA 3LONA 4E7NA 4ZKSU 3NZIA 3E1XB 1AB9C 2BDCA 3A89A 2ZCKP 3QGJA 3T26A 1O30A 3A81A 5EGMA 4D8NA 1F0UA 4O97A 1GHBF 4FUFA 5ESBA 1RFNA 2G00A 4INLA 3ZZ8A 4LOYH 1RIWB 3RXQA 1HLTH 3UQOA 4D7FA 1MKXK 4O3UA 1O34A 4E06H 3STIA 1C5OH 2A2XH 5GXPA 2ZDMA 1BDAA 1QL9A 3EAJA 4TPYA 2CHAB 4B76A 1YYY1 1T7CA 2GZ7A 4X6PA 1SOZA 4ABEA 1DWBH 1O36A 3PO1B 4JZFH 1KY9A 1CA0B 2BXUH 2Z3DA 3NUMA 1TQ0B 1EPTA 4AYYB 3RU4D 1C1SA 3BTTE 5C1UA 1NRPH 4CRGA 5L6NH 5E2PA 2A0QB 2TPIZ 5A2MH 1TBZH 1DWCH 1MBQA 1NU9A 3ZZ3A 1CGJE 4AG1A 1HJAC 1ETSH 1SI5H 4X0WU 4ZAEA 1V2QT 1ZGVA 3UREA 2ZDNA 2FYRA 3F68H 1SB1H 1IQEA 3U69H 1Z6JH 3SHAH 3ZVBA 5FPSA 3W94A 1K1OA 2GZ8A 1SSXA 1BB0B 2ODPA 3T2NA 4Y11E 3SI3H 2NU4E 1G32B 3O8DA 3FVFB 1H1BA 1YPJH 3UPEA 1XXDA 4FXGH 4Y0YE 2Z7FE 1PYTD 3LKWA 2WPJS 4DURA 2A5KA 2A45B 1ZOMA 1C4Y2 1MZAA 1S6HA 2ZU3A 5HGGA 1GMCF 4AGJA 2ZDVH 3ENSB 2I6SA 1JIRA 1O2QA 1QB1A 4ZXXH 1A0JA 2K1QA 2YOLA 4D9RA 4B2CA 1P09A 4THNH 3D65E 1QTFA 4KGAA 3UY9A 3TH3H 1ANDA 1RTKA 1JRSA 3S9CA 3TPIZ 5IDKA 4FVBA 3BTKE 4IC5A 1MCTA 1V2OT 1QURH 4AFUA 2BB4A 2WPMS 1AVGH 3DUXH 1N6XA 1QY6A 3FP7E 1MZDA 1NFUA 4NWLA 2STAE 2GDDA 3I78A 3Q3KA 3BF6H 1TLDA 2A4OA 3RXSA 1L0ZA 3VXEH 1TAWA 3ZZDA 5DGJA 4K8BA 1C1OA 4CHAC 2BXTH 3MI4A 1NRSH 3RXFA 1UK3A 5GCHG 2BLOA 1UTMA 2BM2A 1A61H 4VGCC 2F9BH 4OGXA 2FI4E 5I46H 1QQ4A 3QDZB 7GCHF 3VXFH 1GDQA 4CR9A 1C5RA 4YZUA 1C5LH 3NPSA 4OS2A 1QRWA 1K1NA 1TMUH 1QFKH 1C5TA 5ESTE 4DOQA 2AMQA 3K6YA 1IAUA 1UTJA 2FOHA 4NIYA 3SV6A 2JETB 3KNXA 2XBWA 2AERH 2GCHF 2UWOA 4INKA 5C20A 1O2RA 2SNWA 1C2MA 4U2WA 5F8XA 2BHGA 1UO6A 1O5AB 1LVMA 2R2WU 2NU2E 1UK4A 1NT1A 2O8UA 1BBRK 1EAIA 2HVXA 1DSUA 1QB6A 1K9OE 3EA7A 3MH6A 2ZHDA 1N8OC 2HPPH 5FX6A 2FI5E 3H7TA 3RC6A 4SGAE 4FUJA 4Q7YA 1SFIA 4NCYA 2ESTE 1LDTT 3Q3XA 3TLOA 1O31A 2HNTE 1O3CA 1O32A 2A32A 2VWLA 1TX7A 2RG3A 1DANH 4UONA 1O2GH 2ANWA 1K1MA 4FVDA 4AYVB 3D62A 2C90B 4BXSA 3HATH 4OS1A 1O2NA 1KXCA 3M5MA 3BV9B 1UVUH 3Q77A 4K69A 1LVYA 2J4IA 2QY0B 1HBTH 2OCVB 1NU7B 4PROA 4X2YA 2B9LA 5E0HA 3ZYDA 1K1LA 3BIUH 2QXGA 1BCUH 1IQGA 5T6FA 1CT4E 1KTTB 1T8NA 5E8EH 1D3PB 2PHBA 1AFQB 2BDHA 3RXBA 5EODA 5DKMA 1H4WA 1V2UT 1L1NA 3M7QA 2QC2A 5EXNA 2ZDLA 3STJA 3RU4T 1P2IA 1GVZA 3VEQB 1XUGA 2FMJA 1TOMH 1ELFA 1LVOA 1ZHMA 3ITIA 4Q7ZA 4ZKRU 1ELEE 1MBMA 3PM3A 5JB9S 2BD7A 4AZ2B 2GMTC 2O8WA 4YLQH 4DCDA 1GHZA 1VITG 3MU1A 3QO6A 4TY7A 1GMHG 3A8CA 2AYWA 4GUXA 4IMQA 3A7WA 4NSYA 3MU5A 1ZPBA 5EQRA 3T25A 5H4IB 2GT7A 2W3IA 2ZGCA 5EW1H 2R3UA 4RN6A 1TGBA 3RMNH 2O9QA 1C4V2 1KLJH 1LHGH 1Y8TA 2BY9X 5DP5A 1TBRH 4M7GA 1H9LB 4O03A 1EOJA 4OS6A 1WAYB 1ARBA 3S9AA 1P10A 3HK6B 1GJBB 1S0RA 3PMBB 3ZVCA 4AFQA 3GY5A 1YPMH 1O2SA 5FBEA 4MG3A 3F9EA 2OQUA 1GL0E 2R9PA 2FODA 2UUYA 4K1SA 3TK5A 2O8TA 2ZCLP 3DFLA 3S9BA 2FIRH 5EPNA 4ISOA 1QIXB 4I8JA 1FIWA 1C2IA 3DA9B 3UR9A 3RC5A 3SV2H 2G81E 2XBVA 1BTZA 5FX5A 5G4BA 3A84A 1C5QA 1QQUA 4WH6A 4K8YA 4X8TH 2ZPSA 4INHA 1BMMH 2PSYA 1D6RA 2GV6A 2EA3A 1INCA 1GJ4H 1QBNA 3ZZ4A 1MCVA 2R2MB 4BNRA 1B5GH 4X8VH 2ZQ1A 3W95A 1AVXA 3QTOH 2ZU1A 4NZQA 2ASUB 1AI8H 2BQ6B 2F83A 3LH3A 2HRVA 2VIWA 4DVAU 4Y8YA 1YPLH 2NWNA 3RXOA 1Z8JB 3E0NB 1F0RA 4CRBA 2W7UA 2BD3A 2KAIA 4BAKB 4Q2KA 4Q7XA 5DJ7A 3NK8A 4XFQA 3O8BA 1YC0A 1FUJA 1ELCA 1SGQE 1CA8B 3BTME 2GX4A 2HNTC 4LXBH 1C9PA 3UOPA 5CHAB 1SHYA 5F8TA 1FAKH 2BX4A 5DP8A 1O3HA 2A4QA 4E05H 4D7GA 1TX8A 3SJ9A 1DXPA 1OWHA 1IQMA 3UWJH 2F9PA 1BOQA 1EAUA 4Y8XA 1G3CA 3MYWA 4OS5A 4ZXYH 2D1JA 1ACBE 1HUTH 1TALA 1YCPH 3GYMA 4GCHF 2H2ZA 3SOSA 1C5MD 2J2UA 1GBEA 2ZHQH 1O5FH 3Q76A 4I8LA 4X1PU 1P2KA 5TJXA 4YT6H 3A7ZA 3TVJB 4LZ4B 1V2ST 3T29A 3L6PA 1L1JA 4YTAA 3DFJA 3RM2H 1C5UA 5A8XA 4AFZA 1S81A 4Z6AH 3MO3A 1IQJA 1BIOA 1ESAA 2NU0E 3TH4H 2CMYA 3SU0A 3SU4A 1FPHH 1O2IA 1O3JA 1Z7KA 1DS2E 5A8YA 1W7GH 1BZXE 2B7DH 5HMAA 3AW1A 5JB8S 4H4FA 3ZZCA 1C5XB 1DVAH 2PWXA 1UHBA 1GCTC 4AOQA 3T28A 1C1WH 1G36A 1K1PA 2Q6DA 3TITA 3KIDU 1NC6A 1E0FD 1J15A 4UFFH 4WJG2 3VGCB 1ELDE 1LO6A 1XUKA 2TGPZ 1AKSA 3FZDA 1GDNA 4ZH8A 3U8TH 3ZVGA 5A0CA 3P6ZB 4D76A 3A85A 3PLPA 3TU7H 1C5YB 4XSKU 2XW9A 1KXFA 3E0PB 2OINA 1A5IA 1HAIH 1H9HE 2FESH 2OC0A 1XVOA 2P94A 1HAZB 4Y76A 2HWLB 5GIBA 3LC5A 1OWDA 1D9IA 2GZ9A 2LNCA 3K2UA 2OBOA 2ZDKA 2ZGXH 1N6YA 3EQ0H 2WUBA 3ATWA 4X6MA 2XWAA 3A88A 1UTLM 2SGDE 2GTBA 2H6MA 1KLTA 1OSSA 1GMDF 5JDUB 1UCYH 3LPRA 1SGRE 2P3UB 2JH5D 3BSQA 1YM0A 1SGYE 1O2HA 7LPRA 4MNXA 1C1NA 1T4UH 3A8DA 3H7OA 3RXVA 1H8IH 3F9GA 1G3EA 2CJIA 1HAVA 1NRRH 4BAQB 4AX9H 1BTHH 4QT8C 3ZZBA 1IOEA 3PLKA 3SORA 1O2XA 1O3BA 2J94A 2P8OC 3RMMH 3FP8E 5DP9A 1SGDE 2ZZUH 2A7JA 2FO9A 4B75A 1GJ5H 1EB2A 3TJVA 4O9VA 3U8RH 2CXVA 2ZHFH 5EQQA 2XC5A 2BZ6H 4BAMB 3UNQA 5DPAA 2C8XB 1KDQB 3RP2A 1YLDA 4K2YA 4BTTB 1P2MA 4I8GA 1O3FA 1QHRB 3M35A 3KHVA 1XKAC 3A87A 2ZECA 1GCDA 1HJ8A 1TBQH 3GDUA 4X1SU 2IOTA 2ZEBA 1ELVA 1J9CH 1C2LA 2EI7A 3LGTA 1Y5UT 1CQQA 3BTHE 4ABAA 1ARCA 1V2MT 2OP9A 4B71A 2AEIH 6CHAC 2QAAA 1GI6A 3URCA 3SJKA 6GCHG 1VCQA 1JWTA 1U6QA 1O2UA 3A7TA 3UWIA 3MNXA 1TQ7B 1GI1A 4UFEH 2QA9E 4JZDH 2GGVB 1SR5C 4X8SH 1OOKB 1GG6B 1UMAH 1GBJA 1O2YA 3TJUA 4LZ1H 2QXHA 2TGAA 2BVXH 2G4TA 1GBLA 5ABWA 4TWWA 2OXSA 3SNEA 3P8NA 4FUDA 4IN2A 3URDA 1GI7B 1CVWH 1SMFE 1UCYK 2H9TH 2VGCB 4FUGA 2ZNKH 4R0IA 1HIAA 5TCAA 4YM9A 1JBUH 8GCHF 2EI6A 2PKAB