1TNJA

Prediction of novel serine protease inhibitors
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRYPSIN
publication title Prediction of new serine proteinase inhibitors.
pubmed doi rcsb
source organism Bos taurus
molecule tags Hydrolase/hydrolase inhibitor
total genus 53
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1994-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1tnjA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1tnjA02
1DUEA 1XKBC 1BQYA 3H7TA 1ETRH 3DFLA 3LOXA 1MAYA 4KTCA 5L2ZH 1O34A 3PWCA 3ZZ9A 3E8LA 5EPYA 1SLUB 1O3EA 2HNTE 1ZGIA 1GHYH 2Z7FE 4WH6A 1GCTC 3C1KA 1YP9A 1BDAA 2ASUB 1O3PB 2CF9H 3A7YA 1N6XA 1EPTC 1FI8A 4U2WA 5GPIB 1LPGB 1UVSH 4B76A 2VB0A 2Y7XA 4ZROA 2GTBA 1QJ6B 4SGBE 1ZHPA 2TPIZ 4JK5A 3A81A 3ITIA 5EODA 1DANH 1KTTB 3RXAA 4NIVA 3A89A 5L6NH 1YCPH 1INCA 5FAHA 1V2RT 2DE9A 3LT3A 1CVWH 4BTIB 2ANYA 4NZQA 2LNCA 4JZIA 2C8YB 5GCHG 2VIVA 1C9PA 2ILNA 1AO5A 1A3EH 1JRSA 1LDTT 1Z6EA 3MNXA 3P95A 1DWEH 4O97A 1HBTH 1EB2A 1RTFB 1O2QA 1GHXH 1QNJA 2QN5T 1C5ZB 4ABAA 2VIQA 2PTCE 3A84A 1F2SE 1GBMA 1SHHB 3VB5A 3UNRA 4AYYB 1C2IA 1HUTH 1UTMA 4X8TH 3SGQE 2GD4B 2SGFE 3TH3H 2DUCA 2J94A 5A2MH 1A5GH 1MTVA 5C2ZA 1PQAA 1QHRB 3SQEE 3K6YA 2C8WB 1QB9A 6CHAB 2AYWA 3RU4T 1FQ3A 3NPSA 3F6UH 3SI4H 1AN1E 2EI6A 1ARCA 4ISOA 3V7TA 3A7ZA 2XC0A 2J4IA 3EE0B 1KXBA 1PQ8A 4WY3A 1Z71A 1YC0A 4ZMAH 1ZRBA 1MCVA 1O3MA 3M61U 4AZ2B 1A2CH 1AGJA 1D6WA 1O2ZA 1WQVH 2BQWB 5FX5A 1HLTH 4SGAE 1YLDA 1ANDA 1EZUC 3GY3A 1JIMA 3V3MA 2SNWA 1GJ6A 1O37A 1NT1A 1T4UH 1S83A 1SGCA 2JKHA 3VFEA 1DY9A 1M9UA 2ZQ1A 1SOTA 4MQAA 3S9BA 2BDIA 1FPCH 3SNDA 1W7GH 3EYDA 6CHAC 2ZTZA 2Z9LA 1S85A 1AE8H 3MH4A 2A5IA 5A0BA 5A8YA 2QGRA 1O3GA 2BLVA 2W3IA 1QBOA 1V3XA 3BG8A 2ZTXA 3Q3XA 1BA8B 3E1XB 1N6YA 3TNSA 5E0HA 1CT4E 4FUEA 3GDVA 1AI8H 1K1JA 3KQCA 1CHOG 1EKBB 1MTWA 2W5EA 2BYAX 1UTJA 3RXKA 5E2OA 1SGFG 3LONA 2HNTC 4INHA 2OC1A 2AERH 1P01A 2J34A 1G9IE 2NU0E 4BTUB 4ABBA 2A4RA 2W3KA 3MH6A 4I31A 1DX5M 1GI6A 5DP3A 2OTVA 3BN9A 5ETXA 1UTPA 1HPGA 3M35A 5J4QA 4X1QU 3U8RH 2RDLA 3QZRA 2A5AA 1DSTA 1SGQE 3HK3B 4MNVA 1OWJA 2G51A 1GJCB 1AKSB 1S6HA 4LZ1H 1HAIH 4IN2A 2G4UA 3B23B 3QLPH 1N8OB 1IHSH 1TGNA 1TA2A 2WPMS 1ZJDA 3SI3H 4X0WU 1F92A 1ZPBA 2ZDAH 3VXFH 1RTLA 4WMFA 3TITA 1ZMNA 2GCTC 4A6LA 3PO1B 3OU0A 1WCZA 4JYVH 3Q00A 1GBJA 2QYIA 2C3SA 2SGQE 2R3YA 1XM1A 1MKXK 1WV7H 2PV9B 3A8AA 1F5LA 1O2WA 5T6FA 1TQ0B 3V13A 1TONA 1JWTA 1TX7A 1TNGA 3EQ0H 3SU2A 6LPRA 1ANEA 1BRAA 3NZIA 4O03A 1QR3E 1NRNH 2ZECA 1E35B 4UDWH 1XXFA 2A2QH 2FZZA 4DGJA 1CHGA 1BZXE 1AVWA 1P12E 3A8DA 4CRDA 1D3TB 2C93B 1GDQA 1SQOA 3BEFB 1P2MA 2A45B 1T7CA 1XKAC 2AGIX 5CMXH 1SLWB 2BD2A 3PO1C 4AGKA 2C90B 2HOBA 3TVJB 3ZVEA 1SHYA 1GVLA 1PYTC 2FIRH 2WPLS 2VWNA 4ABHA 2ZU5A 2W26A 1SGDE 3RXQA 1FZZA 4AGJA 1O3FA 1W3CA 4NZLA 1DWCH 4H6SB 5GCHF 2A0QB 3KIDU 3DFJA 2UWOA 1AZZA 1LHGH 2YOLA 1BIOA 1NRSH 4UFFH 2C4FH 1BTWA 1DUAA 3QWCH 4FU8A 1HJ9A 1GBKA 1PPEE 3UQVA 1BUIA 1T4VH 3LKWA 2H1UA 2G8TA 3KCGH 2HLCA 2ZIQH 2FLBH 1FN8A 2Y5FA 1YPHC 2XWBI 4B73A 2GZ7A 1E34B 1C2GA 3A7VA 1V2VT 2BHGA 5H4IB 5FBEA 1O32A 3M3TA 1LHDH 1J8AA 1PQ7A 2WV5A 1HAPH 2BQ7B 3ZZ3A 4E7RG 3M7TA 2OBOA 4MPVA 3UIRA 4DG4A 1DWBH 1ZRKA 1MBMA 2SGPE 3LC5A 3UQOA 1O3CA 2AGGX 5ABWA 1O2OA 1YPMH 6GCHG 2ZHQH 4BAQB 5ESBA 2XBWA 4X6OA 1V2UT 4HFPB 1EJMA 2BVXH 2FDAA 3KQEA 2J9NA 3LGYA 3MI4A 3SU3A 3S7KB 1CE5A 2XW9A 1K1PA 2Y82A 2XBYA 3U9AH 1FMGA 2HNTF 3UNQA 2TIOA 3UWJH 1V2NT 1CU1A 4MG3A 2PUXB 4B2BA 8KME2 3F9FA 1O5BB 3Q77A 2H5CA 1C1OA 1KTSB 1P8VC 3P8NA 4D9QA 2Z3DA 1G2MA 1O5AB 2BLWA 2BVRH 1C1PA 4NA8A 3TNTA 1W12U 3G01A 1AKSA 1FN6A 2ZTYA 1B0EA 2H9TH 4JK6A 4K1SA 3SZNA 2K1QA 3QGJA 1TBQH 2VGCB 3PROA 3BTWE 3SJOA 1G3CA 2J38A 1NTPA 1ELFA 1CHOF 3SUGA 1ZTKA 5K7RA 1TALA 1P3EA 2XC4A 1L0ZA 3T26A 2TGPZ 4HGCA 1PPCE 1W2KH 2GKVE 4NGAH 1SOZA 1L4DA 1Y3UA 3LGIA 4WMEA 3SNAA 1AWHB 1C1WH 1GI7B 2WUBA 3MH5A 1Y5BT 3RUOA 1H8DH 1GJ5H 1C5OH 2UWLA 1E37B 3RXEA 1ZPCA 1C2DA 1DY8A 3E90B 1AQ7A 1C1UH 2VGCC 2O8TA 4X1SU 2FTMA 1QJ7B 1O39A 2VWMA 2ZFRH 1BMAA 4XSKU 1BTHH 3AW0A 3U69H 1DS2E 2HALA 5JYIA 5K0HA 3SJIA 1KLJH 3SV7A 3ZZ6A 2G52A 2OC7A 1P2QA 1YGCH 3T62A 4X2WA 4UEHH 3SORA 1ACBE 1GI1A 1IQMA 1ZZZA 3I29A 2NU1E 4Y0ZE 9ESTA 2OLGA 1TX8A 3DT0H 3QGNB 4XE4A 3ENSB 4JZ1A 7ESTE 1S0QA 2G81E 2GCHF 1JBUH 1QQ4A 1Z7KA 1GJBB 1T31A 2WYJA 1ELBA 3LGTA 3R0FA 1B5GH 1KY9A 1YCPM 3F9GA 4ABDA 1ZHRA 1O5CB 1VJAU 2QAAA 1IHTH 1GWAA 1NRRH 4M7GA 3GCNA 1C1NA 3M5NA 1LCYA 1IQGA 2ZPQA 3PV4A 3BG4B 1G3EA 1OWHA 4RN6A 2ZGHA 9LPRA 3S9CA 4YM9A 3RXRA 1TGCA 2BY5X 1AE5A 1TBZH 1O3OA 3HGPA 1TNJA 4GCHF 1HAXB 3TJOA 1TPSA 4CR9A 2WPIS 1C5UA 2VIWA 1C2LA 4ISHH 1YPGH 1TNHA 1GBIA 1O2TA 2A2XH 3ZVFA 3OY5U 1D9IA 5J4SA 4FUBA 1DPOA 2AIPA 3ATKA 1RRKA 3VXEH 1VR1H 3CP7A 3PMJA 3K2UA 3PWBA 2GV6A 1OSSA 3T5FH 1G32B 5A8XA 4B75A 1ESAA 1C2FA 4ZHMU 3HATH 3BG4C 3V0XA 3ZYDA 3P70B 1P9SA 4D9RA 2V6NA 2RA0A 1RFNA 1AFQB 1ANBA 5AFYH 1BBRH 1HJ8A 2A4OA 1FJSA 2BZ6H 3W95A 1BTXA 1C5VA 5JB8S 1XUIA 4MLFB 1Z1JA 3U1IB 4YOGA 1H8IH 3H7OA 2A4GA 1GJ9B 4AN7A 4TY7A 1QTFA 2ODQA 1GI0A 1YPEH 1ZOMA 2WPKS 3KNXA 3KQBA 1EATA 4Y79A 2B7DH 4DW2U 1HXEH 2OC0A 1C5PA 2ZU3A 4ZXXH 4AB9A 3U8TH 1X7AC 1UTKA 5IDKA 1PQ5A 4I8JA 1AFQC 4FUFA 1UHBA 4TPIZ 3P8GA 1P11E 2HPQH 1P09A 3GCTG 3GOVB 1PPHE 1SQTA 4VGCB 3SUEA 1E36B 1TRYA 1L1NA 1DDJA 2FS8A 1FPHH 1QRXA 4CBNA 4JCNA 2QIQA 2D2DA 1AUJA 1NY22 2H6MA 5EG4A 1LHCH 2D8WA 1P57B 2ZO3H 1ZGVA 4IN1A 1UTNA 1EASA 1FUJA 1OYTH 1FAXA 1FXYA 2HGTH 3VB3A 2FI3E 1GI2A 2OP9A 1BRUP 1QCPA 1K1LA 3AW1A 2W7UA 2BOKA 3PMHB 3RU4D 1SFIA 2OC8A 5FPTA 1F7ZA 5GDSH 1C5XB 1W11U 4YESB 4VGCC 2YNBA 4AFUA 2XC5A 3SJ9A 3H5CB 3BTEE 5TCCA 4X8SH 5C1XA 2V0BA 8GCHG 5LPFA 5F8XA 3SGAE 5LGOA 1GI8B 5TCAA 4ESTE 3LGUA 2BXTH 2AFQB 2Z6BD 4Y8XA 1DLEA 1NFUA 1F5KU 2BDYA 1MD7A 4DT7B 3GISB 1C2HA 2ZZUH 1SLXB 2F9BH 4K1TA 1IQEA 3RMLH 5HMAA 2ZFSA 1W13U 1AIXH 2P8OB 1FY1A 4DURA 1ESBA 1G37A 3FP7E 4Y10E 1ARBA 4MNYA 4BOHA 2P59A 1FIZA 4K2YA 1C5YB 1O2HA 4XFQA 1O2NA 2OQUA 1MMJN 1MKWH 2ZA5A 1DWDH 1O2RA 1AHTH 1QL9A 2B0FA 1P2KA 1HGTH 5I25A 3EDXB 2BX4A 1GMCF 4AFQA 1JIRA 2BX3A 1MD8A 4Y71A 1A7SA 5LPRA 4ZUHA 4AFSA 1J14A 1AWFH 2TGDA 4UFEH 1HAHH 2Y80A 5EQSA 2R0LA 3UR9A 2WYGA 4ABIA 1P06A 3UY9A 1DT2A 4K1EA 4ISLA 5HM2A 2A5KA 1A0HB 1MQ6A 1MTNB 2D26C 1GGDB 1QRZA 3ZVCA 2P94A 4Y0YE 1SL3A 2BY7X 5L30H 3UFAA 2AMDA 2HRVA 1TMTH 3PLBA 1O3DA 3D23A 3FZZA 1TABE 3RXGA 1GJAB 2PLXA 1QGFA 1P02A 1OP8A 1P04A 4O9VA 2GV7A 1BBRE 2PHBA 2ZCLP 2FP7B 4X6MA 4Y8ZA 5EW2H 1OXGA 4E7NA 3K6ZA 4DIIH 2G00A 1LVYA 1YYY1 1DFPA 2FI5E 1HFDA 4XOJA 2OD3B 1V2PT 4K8BA 1NO9H 4NWLA 1O30A 1C5MD 2FOMB 2F3CE 4YOJA 2AIQA 2FWWA 3KGPA 1TBRH 2O8WA 2R3UA 4DOQA 3M36A 1CBWB 1GGDC 1IQFA 1ANCA 3SBKA 2FX6A 3KN2A 1Z8RA 1LHFH 1WTHD 1HAVB 1XMNB 2H2ZA 3UUZA 1ZHMA 4K60A 1TRMA 2BOHB 1G3BA 2ULLA 3ZV8A 1CGJE 2BXUH 2VH6A 3RXMA 1KYNA 4ABEA 1YPHE 1BT7A 3NCLA 4D8NA 3RMMH 4FUHA 1W8BH 2ALVA 4Y6DA 3TPIZ 4X1PU 1HIAB 3TLOA 1C5NH 2F9PA 3UPEA 1SMFE 3AAVA 4JZFH 1CSOE 4NSVA 1GBDA 5AHGH 5DO4H 1C5RA 1GMDG 1EJAA 1GBCA 1EPTA 2FPZA 3BTDE 1SG8B 3MWIU 2A7HA 5FX6A 4OS4A 4TWYA 4KP0A 1GBLA 3RXCA 3GCTF 1QL8A 1MCTA 1FY4A 3ZZBA 3SNBA 1VJ9U 5C3NA 1H1BA 2ZU2A 2GP9B 2ZPRA 4IMQA 4OS7A 1VITF 4CREA 3OTJE 1TE0A 1RIWB 1TPOA 3SV8A 1DLKB 1GHZA 4MVNA 5L2YH 1JMOH 1L4ZA 4ASHA 4O3UA 2ZPSA 1SBWA 4JMYA 1GL1A 5C1YA 2ZGCA 1ZJKA 1S82A 3GY6A 4IGDA 1YPJH 1MTUA 2P93A 1MZAA 1QA0A 1V2KT 2PTNA 4ZKNU 4Q80A 1VZQH 1K21H 1V2QT 1O2KA 3E16B 4X2VA 1V6DA 4TY6A 1OWEA 2IJOB 5FHTA 3MNSA 4AB8A 2OCVB 1IQHA 1Q3XA 1VCWA 3EA7A 1GHBG 2FM2A 2V3OH 4R8TB 2JETB 3KEEA 1UK2A 1ELGA 3PTBA 5JBTA 3LU9B 2Q1JA 3B9FH 1HDTH 2Q6DA 3PTNA 3I78A 4NA9H 1B7XB 1C5WB 1ELCA 1P2JA 2QF0A 1IQIA 3ZZ5A 2VIDA 4CRAA 3OYPA 1BTYA 3JZ1B 1N8OC 3A7XA 1GHWH 2XRCA 3TH4H 1C1MA 4TPYA 4CH2B 1NC6A 2FOBA 1Y3YA 2ANMH 1QB1A 1C1QA 1O2MA 1G2LA 5FCKA 2Z9KA 1MUEB 5DP4A 2ZG0H 1TGSZ 2VVUA 2JETC 5LH8A 1W10U 4LOYH 4AG1A 5HM9A 1C5QA 1GI3A 4NIXA 2AMPA 5A09A 2CXVA 2QC2A 2GX4A 1H9IE 1GDUA 4F49A 1LVBA 2DE8A 1CA8B 1K2I1 2ANKH 1EX3A 4A92A 1F0UA 1NZQH 1KXFA 3W94A 5F6MA 2F9VA 1C4V2 1UMAH 1ELEE 3QTOH 1A61H 1AVXA 3RC5A 1HRTH 1VITH 2GDEH 1O31A 3GDUA 2ZP0H 1HAZB 1TMBH 1Q2WA 4OS5A 1UTQA 3PMAB 4HZHA 1SPJA 1NU7B 1SGNE 5C67A 5HYOA 1LKBA 4TYDA 1NRQH 2VVVA 1V2TT 1EAUA 3ZVDA 1AY6H 3SHCH 4H42U 3S7HB 1SGYE 2O9QA 2AS9A 2GMTB 2EC9H 3TK9A 1O2VA 3RXDA 3T25A 2EEKA 2O8UA 3V12A 2XCFA 3IITA 1ELAA 3RXVA 2EI7A 4AG2A 2I6QA 5GXPA 1ZTJA 1TRNA 3MFJA 1P0SH 1GVKB 4ISIH 4FUGA 2VIPA 4RSPA 1S84A 1CO7E 1G36A 1ABIH 1O3BA 3MO9A 5CE1A 3RM0H 3GDSA 3ODFA 1H9LB 4F4OC 1SC8U 2ZFPH 4KELA 3ATIA 4UD9H 4UONA 1GJ7B 2O8LA 3DUXH 1C5LH 3TGKE 2BMGB 2H5DA 3QX5H 3UR6A 1G3DA 2G5VA 2KAIB 3FVFB 4CRCA 3MU8A 4WF8A 1SGFA 3U98H 4UE7H 3F9HA 2FX4A 4X1RU 2PSYA 4KKDA 3RC4A 3GICB 2GMTC 2A31A 1C2KA 2A32A 1UVUH 2CF8H 1WUNH 2FOHA 4H4FA 1BHXB 1IAUA 4A1VA 4B1TA 1BBRK 1QFKH 4D7GA 1TOMH 1D3QB 2XWAA 3BF6H 1A1RA 1CGHA 1W0YH 2FOCA 3M37A 1O2GH 2TGAA 4BAKB 3STJA 2F83A 2STBE 2ZGJA 1KLIH 4BXWA 1F0SA 3ZYEA 4GSOA 1WBGB 2O8MA 5SGAE 3TGIE 5E8EH 3FAOA 3DHKH 2ZCKP 4NIYA 1EAXA 1EUFA 3RXLA 3A8BA 1CA0B 1NFYA 1GMDF 1KDQB 2VWLA 4AFZA 3WY8A 1IQLA 2TBSA 2Y5HA 3T27A 1ELTA 1O2YA 1S0RA 3RP2A 1K1MA 3TU7H 2ESTE 1O2XA 1RXPA 3OY6U 1OWIA 5FPYA 4CR5A 3SNEA 1F0RA 2CMYA 4E05H 1VGCB 4HTCH 2W7SA 1CGIE 3UWIA 1TIOA 4THNH 2HPPH 3ZV9A 1XXDA 2GT8A 3LGVA 2FMJA 2ZKSA 2JH6D 1DXPA 3ZVBA 1AVGH 1BRBE 2ZU4A 3F68H 3F9EA 1QQUA 2BB4A 3QTVH 1RD3B 4CRBA 1T8NA 3IWMA 4BTTB 2CHAB 3AVZA 4LZ4B 1ORFA 5HGGA 3UOPA 4A1XA 4DJZB 2G4TA 5JB9S 1CA0C 3SU4A 3M7QA 5G4BA 2FYQA 3NK8A 2SGDE 1S81A 1SGEE 2PUQH 1GCDA 1FIWA 2Y5GA 2GGVB 1ZPZA 1VGCC 1O33A 1GHBF 2PKSB 1GPZA 3ATMA 4CH8B 1BRCE 3SN8A 1GJDB 4WH8A 1WTGH 2RCEA 1P2NA 1LO6A 1C1SA 1T8OA 3VB4A 3PMBB 5GIBA 4JYTA 3ATLA 5HXFA 1V2LT 5DP8A 1OYQA 2CHAC 1BMNH 2ZDKA 3R3GB 2PGBB 4ZKOU 5LPEA 3GYMA 4MPWA 1ZYOA 1SGPE 3E0PB 1FNIA 3LH3A 1Q31A 5DP9A 1GHVH 1PPBH 1Y3XA 5F03A 3P92A 4HI3A 1GBAA 1UK4A 1EB1H 1EP5A 2PKSC 4Q2KA 2UWPA 1J16A 3CS0A 2YNAA 1KLTA 2FYRA 2BQ6B 3RXPA 5DK1A 3TJNA 3D65E 5ESTE 1EAWA 1XUGA 3LDXH 3URDA 1A0JA 3HKJB 4CHAB 1OKXA 4XBBA 3BEIB 5T6GA 1AZ8A 1MKWK 3ESTA 5FCRA 1CT0E 3DA9B 1D3PB 2G5NA 2SGEE 3RMOH 1U6QA 3RXFA 3L6PA 3QN7A 1LVMA 1A3BH 1EP6A 3SNCA 5GWZA 1UCYE 3T2NA 4IC6A 3RXUA 1GG6B 5I46H 2CJIA 2FXRA 4J1YA 1Z8GA 2V3HH 4DVAU 1XUKA 3TH2H 2A4QA 4IMZA 4MNXA 3E0NB 2FOFA 3Q3KA 1ZR0A 4AX9H 3SU1A 2GZ8A 2ZHDA 3P6ZB 6GCHF 4XBCA 3MTYA 3K65B 2IOTA 1OP0A 4CHAC 2QXIA 4ABGA 3C27B 4CBOA 3UREA 1GVZA 2ZC9H 5EXNA 4NFFA 4INKA 3RXBA 5F8TA 2R2WU 4X1NU 1C4Y2 3E3TA 2BY9X 1TA6A 2ZGBH 1GJ4H 1O2SA 3SV6A 3SV2H 5A0AE 1C1VH 1HCGA 1GDNA 1FV9A 1LQEA 1O0DH 1MAXA 5EPNA 3IG6B 1GG6C 1GI5A 4Y11E 1TPAE 3L33A 1BHXF 5BRRE 1NRPH 1WQSA 1C5SA 2CGAA 2UUKB 1XX9A 4I8LA 4FVBA 3E6PH 2PSXA 2Z3EA 1O3KA 1AU8A 1FY3A 1KXAA 1V2ST 2R9PA 4XBDA 3FP8E 3SJKA 3KF2A 4FXGH 3HPTB 4BANB 4XDEA 2IPHA 3TJVA 1P03A 1KXEA 3ZZ8A 1ID5H 2XYAA 1TGTA 3ODDA 1MQ5A 3GY5A 1PFXC 3MO6A 1QBNA 2OUAA 1EZSC 4IW4E 1NPMA 1SQAA 3Q76A 2BD7A 1O2UA 4O3TA 1SI5H 1P2OA 4X6PA 3QUMP 3SJ8A 1HNEE 1W7XH 4IBLH 4I7YH 1Y5UT 4Y7BA 1HB0B 2XXLA 1TLDA 3A85A 4JYUH 2BTCE 2F91A 4AOQA 1N1LA 1L2EA 2P3TB 1HAGE 1IQKA 1UTLM 1TQ7B 2SNVA 4A1TA 1TGBA 1PPZA 2QF3A 4FU9A 2VNTA 1LVOA 4LXBH 3RMNH 1FY5A 2WINI 1OP2A 3URCA 3Q3YA 4D7FA 1MU6B 3A88A 4A5TS 4B71A 5FBIA 2GZ9A 4RKOB 3RC6A 2BD3A 5DG6A 2ZGXH 3M5OA 1GL0E 3HKIB 1H9HE 4Q7YA 4BAHB 3A8CA 1ELDE 3A7TA 4KGAA 1AD8H 1TAWA 5DP5A 2UUJB 5JDUB 1A4WH 1AUTC 3MO3A 2AH4X 3MU5A 4X6NA 1HAYB 2FTLE 1GI9B 1O3IA 2IN2A 1YPKH 1BTUA 1D3DB 2SGAA 3BIUH 4X2YA 3TJUA 3ZZ4A 5JPMH 2ZNKH 3MH7A 1MH0A 2P95A 3JZ2B 1O36A 4X8VH 4ZHAA 4FUDA 4GAWA 3D49H 1TX6A 3HGNA 2BD9A 3ZZAA 4QT8C 2ZEBA 1UJ1A 1HV7A 4NCYA 2QA9E 4YO9A 3QZQA 4H6TA 5DKMA 3L3TA 1QJ1B 2VVCA 1RTKA 2Z3CA 2P8OC 3AASA 4B2AA 4CRGA 3O8CA 1JOUB 5C5NA 3GY8A 4TWWA 2ZDMA 1UVPA 1GBFA 1E38B 1OOKB 1V2OT 1O5EH 5EGMA 1P3CA 2AMQA 3A7WA 4AORA 4WXIA 3CS7A 3NKKA 5A8ZA 1EOLA 1LQDB 3TGJE 1WAYB 2ZHWH 3A82A 4GLYA 1ETSH 3SU6A 2BDGA 2Q6GA 3VEQB 1QURH 3PB1E 1KSNA 1C2MA 4ABJA 3KL6A 1ZMLA 1UTOA 3UOUA 1PPGE 1F5RA 2ZWLH 5E0JA 1DXWA 1TWXB 1IOEA 4I32A 1ESTA 3ZZ7A 1ZSKA 3RU4E 2STAE 1GMHG 5FPSA 2ZQ2A 2OINA 4K8YA 2Y7ZA 3B8JA 4A7IB 1Y59T 4Z6AH 1ETTH 3P17H 1MBQA 4DY7B 3M3SA 4J2YB 1MTNC 5AF9H 1DSUA 1K1IA 2VIOA 1MU8B 3BV9B 1UVOA 3LC3A 2ZDLA 4WWYA 1TYNA 3SOSA 1O38A 1K1NA 2QXGA 1SGIB 2CN0H 4X2XA 4MTBA 3E91A 1HAOH 1EXFA 1K1OA 1IQJA 3RXHA 1DITH 2BZAA 3FP6E 1LHEH 1DVAH 4YLUA 3SUDA 2ZFFH 3GY7A 1NS3A 1UCYK 4E06H 3LIWA 3SO3A 1XVOA 1C4U2 3SW2B 2A1DB 4GVUA 1JRTA 1NESE 3MMGA 4NWKA 3BSQA 1A0LA 1O3NA 1CBWC 4YT6H 2VWOA 3SHAH 4MNWA 1Z8IB 1BITA 1O3JA 1RJXB 4Z0KA 4BAOB 4DIHH 1V2WT 2BLQA 4IC5A 3RXSA 3EA9A 2BY6X 4FU7A 2VJ1A 3U1JB 1VCQA 1QRWA 3ZVGA 1KXDA 5JBCS 1QBVH 3GCHB 2QV1A 2GCTB 1YF4A 5EQQA 2F9NA 1SGTA 4U30A 7LPRA 2EA3A 4I33A 1C5TA 1A5HA 2H9HA 1P9UA 1QB6A 3MYWA 2D1JA 4NIWA 2AGEX 8ESTE 1EZQA 1O3LA 2FEQH 1B0FA 3K9XB 2RA3A 5DJ7A 2OXSA 5C5OA 5PTPA 3UNSA 1Z8JB 1LPZB 4OS1A 1KIGH 3FANA 4OGYA 4GUXA 3P8FA 3RLWH 2BD8A 1TNIA 1O5DH 2FLRH 8GCHF 3I77A 1RIWC 1ZTLA 1G30B 1ZLRA 5C1UA 3GCHC 3RM2H 1FAKH 1GBHA 4K69A 1FONA 3RXIA 2BDBA 1SR5C 1ZSJA 1WSSH 1THRH 1UO6A 1WYKA 4ISNA 3LH1A 2GVFA 1BJUA 1O2JA 2ALPA 2GCHG 3ELAH 2THFB 1SLVB 3BTME 4MPXA 1MTSA 3BEUA 2F9UA 1J9CH 2VU8E 4YZUA 1SGRE 2FOEA 4OS2A 5EXLA 3LPRA 5EXMA 1RGQA 2P3UB 1OWDA 3MU4A 4CRFA 1AMHA 3BTHE 3RLYH 1MZDA 1TFXA 3LJOA 4NG9H 1O5FH 2B8OH 2WUCA 1OS8A 2BY8X 3A86A 3DD2H 3T28A 3O8RA 1EJNA 1XUJA 3BTQE 3U8OH 1A5IA 4GHTA 4GCHG 3EA8A 3S0NA 3AAUA 1C9TA 1BCUH 3MHWU 3O8DA 4I8GA 1QL7A 1XUFA 2J92A 3RXTA 3STIA 1C2JA 2FOGA 4ZAEA 3VB6A 1L1GA 2V35A 3PM3A 2PGQB 3MU1A 4YOIA 1DM4B 4WMDA 3LGWA 1PPFE 5AFZH 3UTUH 1P05A 1TNKA 4ZXYH 1HAVA 1W0ZU 3HK6B 1UCYH 1A46H 3NXPA 1GBEA 3SV9A 2ZU1A 2UUYA 2XTTB 4I8KA 1TB6H 4FUCA 1K28D 1W14U 2JH5D 1HIAA 4WXVA 3GCOA 3NUMA 1XUHA 1LPKB 2XBVA 3SU0A 1J17T 1D6RA 1XVMA 1DICA 1TNLA 1GMHF 1DE7H 1K9OE 3S9AA 3BTGE 1T32A 3BTFE 2VINA 3PLPA 2XNIA 5FXLA 3TK6A 1S5SA 3GY2A 4K3JA 1GJ8B 4ZHLU 1V2MT 3SU5A 3OX7U 2ZFTA 4FUIA 3GYLB 4WVPE 1D4PB 1SB1H 3VGCB 8LPRA 2NWNA 1V2JT 3SQHE 4ZKRU 1J15A 2BDAA 4YTAA 1F0TA 2Q6FA 3GY4A 3T29A 2ODPA 4K5ZA 1DOJA 1EZXC 4NSYA 1GHAG 5EOKA 2A7JA 2QCYA 2ZHFH 1NFXA 1Z1IA 2M5TA 1LMWB 3SUFA 5A0CA 1C1TA 2TRMA 7GCHG 1HJAB 2TGTA 2J2UA 1Y3VA 3QK1A 2I6SA 4Y8YA 5DPAA 2RG3A 4AYVB 3SGBE 2PR3A 3VGCC 2B9LA 2CV3A 3ZVAA 4WJG2 1QY6A 1MKXH 4GPGA 2P16A 3M7UA 5TJXA 1BOQA 1UHBB 3FZDA 1O5GH 5C20A 2ZDNA 2XCNA 3TIUA 4LK4A 4U32A 1FY8E 1WOFA 1OX1A 2Z9JA 1EAIA 4MPUA 1THPB 3D62A 2ZF0H 4NA7A 4YT7H 1O2PA 1E0FD 1UVTH 1NU9A 1CT2E 1HJAC 2GDDA 1SSXA 4B74A 2BDHA 2WPHS 5JBBS 1BTZA 2HWLB 4IS5A 3P8OA 2FO9A 7KMEH 1AB9B 4KTUA 1QIXB 1BTPA 4MDSA 5T3HA 4I8HA 5EW1H 3A83A 1THSH 2PKAB 3MNCA 2Y6TA 3PLKA 3RDZA 1AFEH 2Z9IA 1LTOA 4UFGH 2QXHA 3M5MA 1C1RA 4YLQH 3OSYA 1HXFH 3BTKE 1ELVA 2ANWA 3ZZDA 2PWXA 3O8BA 1GMCG 5F8ZA 1YBWA 5E2PA 4D76A 5DP6A 3PYHA 1O3AA 2FESH 3A87A 3CENA 2ZDVH 5AVDA 1AB9C 1NM6A 1TMUH 1OWKA 5E0GA 2FI4E 4JZEH 1Z6JH 2R2MB 4ABFA 1ABJH 3A80A 2Z9GA 1S6FA 2BM2A 1BMMH 2BVSH 4KTSA 1RS0A 2EI8A 1LKAA 5CHAB 4PROA 2SFAA 2BLOA 3RXJA 1C2EA 4FVDA 3ZZCA 1BMLA 2GT7A 5T6DA 3ATWA 4U01A 1BJVA 1JXPA 1ZSLA 1O3HA 1YCPK 3N7OA 4BXSA 3F1SB 1FDPA 3M3VA 1YPLH 4ZKSU 2KAIA 2OBQA 3VB7A 4Y7AA 4JZDH 1QA7A 2JH0D 5DP7A 2C8XB 4R0IA 2FODA 5DGJA 1K22H 1Y5AT 1EOJA 2FOAA 2R0KA 2ZI2H 1H4WA 2WPJS 1T8LA 2QXJA 5JBAS 1Y8TA 5EQRA 2P3FH 2ODYB 2PFEA 3NWUA 4NFEA 5CHAC 5B6OA 3EAJA 4UFDH 1UK3A 1FLEE 1O2IA 2BDCA 3MOCA 1NROH 2F9OA 4GHQA 3TK5A 1BB0B 5EU8A 2NU3E 3FFGA 2BD5A 3BTTE 4DCDA 5IYTA 1KDQA 5BPEA 1SFQB 3RXOA 1PJPA 4OGXA 3MNBA 3VPKA 2XBXA 2PW8H 4FUJA 1VCPA 1CQQA 1NN6A 1TPPA 5GJ4B 3M5LA 2NU2E 2ZFQH 2Y81A 1EQ9A 3MU0A 1GBTA 1YM0A 1Y3WA 1YKTA 2HVXA 1P2IA 2OQ5A 1GI4A 1WU1A 2G55A 3EGKH 4BNRA 2Z94A 1GHAF 1T8MA 3KQDA 1YLCA 1SVPA 1OPHB 1TOCB 1VITG 2NU4E 1L1JA 2A7CA 2B5TB 2BD4A 4X8UH 4Y76A 4ZH8A 2LPRA 4Q7ZA 3LJJA 1ZMJA 3QO6A 4Q7XA 4RKJB 1HYLA 7GCHF 2WV4A 6ESTA 1GCTB 2AEIH 1KXCA 2UUFB 2ZHEH 1PYTD 1EPTB 1O2LA 2C8ZB 1O35A 2ZCHP 2VH0A 1GBBA 2QY0B 3QDZB 2PKAA 3S69A 3BIVH 2FS9A 4B2CA 4OS6A 4INLA 2H9EH 4BAMB 1P10A 2J95A 3KHVA 1NFWA 1IQNA
chains in the Genus database with same CATH superfamily
1DUEA 1XKBC 1BQYA 3H7TA 1ETRH 3DFLA 3LOXA 1MAYA 4KTCA 5L2ZH 1O34A 3PWCA 3ZZ9A 3E8LA 5EPYA 1SLUB 1O3EA 2HNTE 1ZGIA 1GHYH 2Z7FE 4WH6A 1GCTC 3ZIAD 3C1KA 1YP9A 1BDAA 2ASUB 1O3PB 2CF9H 2IJD1 1N6XA 3A7YA 1EPTC 1FI8A 4U2WA 5GPIB 1LPGB 1UVSH 4B76A 2JIZD 2VB0A 2Y7XA 4ZROA 2GTBA 1QJ6B 4SGBE 1ZHPA 2TPIZ 4JK5A 3A81A 3ITIA 5EODA 1DANH 1KTTB 3RXAA 4NIVA 3A89A 5L6NH 1YCPH 1INCA 5FAHA 1V2RT 2DE9A 3LT3A 1CVWH 4BTIB 2ANYA 4NZQA 2LNCA 4JZIA 2C8YB 5GCHG 2VIVA 1C9PA 2ILNA 1AO5A 3CNRA 1A3EH 1JRSA 1LDTT 1Z6EA 2W6JD 3MNXA 3P95A 1DWEH 4O97A 1HBTH 1EB2A 1RTFB 1O2QA 1GHXH 1QNJA 2QN5T 1C5ZB 4ABAA 2VIQA 3NRLA 2PTCE 3OE7D 5B6LA 3A84A 1F2SE 1GBMA 1SHHB 3VB5A 3UNRA 4AYYB 1C2IA 1HUTH 1UTMA 4X8TH 3SGQE 2GD4B 2SGFE 3TH3H 2DUCA 2J94A 5A2MH 1A5GH 1MTVA 5C2ZA 1PQAA 1QHRB 3SQEE 3K6YA 2C8WB 1QB9A 6CHAB 2AYWA 3RU4T 1FQ3A 3NPSA 3F6UH 3SI4H 1AN1E 2EI6A 1ARCA 4ISOA 3V7TA 3A7ZA 2XC0A 2J4IA 3EE0B 1KXBA 1PQ8A 4WY3A 1Z71A 1YC0A 4ZMAH 1ZRBA 1MCVA 1O3MA 3M61U 4AZ2B 1A2CH 1AGJA 1D6WA 1O2ZA 1WQVH 2BQWB 5FX5A 1HLTH 4SGAE 1YLDA 1ANDA 1EZUC 3GY3A 1JIMA 3V3MA 2SNWA 1GJ6A 4M9FA 1O37A 2K8IA 3PRDA 1NT1A 1T4UH 1S83A 1SGCA 2JKHA 3VFEA 1DY9A 1M9UA 2ZQ1A 1SOTA 4MQAA 3S9BA 2BDIA 1FPCH 3DSOA 1W7GH 3SNDA 3EYDA 6CHAC 2ZTZA 2Z9LA 1S85A 1AE8H 3MH4A 2A5IA 2YMSD 5A0BA 5A8YA 2QGRA 1O3GA 2BLVA 3WWBA 2W3IA 1QBOA 1V3XA 3BG8A 2ZTXA 3Q3XA 3SZEA 1BA8B 3E1XB 1N6YA 3TNSA 5E0HA 1CT4E 4FUEA 3GDVA 1AI8H 1K1JA 2L6OA 3KQCA 1CHOG 1EKBB 1MTWA 2W5EA 2BYAX 1UTJA 3RXKA 5E2OA 1SGFG 3LONA 2HNTC 4INHA 2OC1A 2AERH 1P01A 2J34A 1G9IE 2NU0E 4BTUB 4ABBA 5EJ1A 2A4RA 2W3KA 3MH6A 4I31A 1DX5M 1GI6A 5DP3A 2OTVA 3BN9A 5ETXA 1UTPA 1HPGA 4RT0A 3M35A 5J4QA 4X1QU 3U8RH 2RDLA 3QZRA 2A5AA 1DSTA 5F53A 1SGQE 3HK3B 4MNVA 1OWJA 2G51A 1GJCB 1AKSB 2AHME 1S6HA 4LZ1H 1HAIH 4IN2A 2G4UA 3B23B 3QLPH 1N8OB 1IHSH 1TGNA 1TA2A 2WPMS 1ZJDA 3SI3H 4X0WU 1F92A 1ZPBA 2ZDAH 3VXFH 1RTLA 4WMFA 3TITA 1ZMNA 2GCTC 4A6LA 3PO1B 3OU0A 1WCZA 4JYVH 3Q00A 1GBJA 2QYIA 2C3SA 2SGQE 2R3YA 1XM1A 1MKXK 1WV7H 2PV9B 3A8AA 1F5LA 1O2WA 5T6FA 4TSFD 1TQ0B 3V13A 2XNDD 1TONA 1JWTA 1TX7A 1TNGA 3EQ0H 3SU2A 6LPRA 1ANEA 1BRAA 3NZIA 4O03A 1QR3E 1NRNH 2ZECA 1E35B 4UDWH 1XXFA 2A2QH 2FZZA 4DGJA 1CHGA 1BZXE 1AVWA 1P12E 3A8DA 4CRDA 1D3TB 2C93B 1GDQA 1SQOA 3BEFB 1P2MA 2A45B 1T7CA 1XKAC 2AGIX 5CMXH 1SLWB 4P00A 2BD2A 3PO1C 4AGKA 2C90B 2HOBA 3TVJB 3ZVEA 1SHYA 1GVLA 1PYTC 2FIRH 2WPLS 2VWNA 4ABHA 2ZU5A 2W26A 1SGDE 3RXQA 1FZZA 4AGJA 4F48B 1O3FA 1W3CA 4NZLA 1DWCH 4H6SB 5GCHF 2A0QB 3KIDU 3DFJA 2UWOA 1AZZA 1LHGH 2YOLA 1BIOA 1NRSH 4UFFH 2C4FH 1BTWA 1DUAA 3QWCH 4FU8A 1HJ9A 1GBKA 1PPEE 3UQVA 1BUIA 1T4VH 3LKWA 2H1UA 2G8TA 3KCGH 2HLCA 2ZIQH 2FLBH 1FN8A 4ZCNA 2Y5FA 1YPHC 2XWBI 4B73A 2GZ7A 1E34B 1C2GA 3A7VA 1V2VT 2BHGA 5H4IB 5FBEA 1O32A 3M3TA 1LHDH 1J8AA 1PQ7A 2WV5A 1HAPH 2BQ7B 3ZZ3A 4E7RG 3M7TA 2OBOA 4MPVA 3UIRA 4DG4A 1DWBH 1ZRKA 1MBMA 2SGPE 3LC5A 3UQOA 1O3CA 2AGGX 5ABWA 1O2OA 1YPMH 6GCHG 2ZHQH 4BAQB 5ESBA 2XBWA 4X6OA 1V2UT 4HFPB 1EJMA 2BVXH 2FDAA 3KQEA 2J9NA 3LGYA 2V7QD 3MI4A 3SU3A 3S7KB 1CE5A 2XW9A 1K1PA 2Y82A 2XBYA 3U9AH 1FMGA 2HNTF 3UNQA 2TIOA 3UWJH 1V2NT 1CU1A 4MG3A 2PUXB 4B2BA 1MABB 8KME2 3F9FA 1O5BB 3Q77A 2H5CA 1C1OA 1KTSB 1P8VC 3P8NA 4B6EA 4D9QA 2Z3DA 1G2MA 1O5AB 2BLWA 2BVRH 1C1PA 4NA8A 3TNTA 1W12U 3G01A 1AKSA 1FN6A 2YMSB 1B0EA 2ZTYA 2H9TH 3EE7A 4JK6A 4K1SA 3SZNA 2K1QA 3QGJA 1TBQH 2VGCB 1QZ8A 3PROA 3BTWE 3SJOA 1G3CA 5HKKD 2J38A 1NTPA 1ELFA 1CHOF 3SUGA 1ZTKA 5K7RA 1TALA 1P3EA 2XC4A 3F3BA 1L0ZA 3T26A 2TGPZ 4HGCA 1PPCE 1W2KH 2GKVE 4NGAH 2J5UA 1SOZA 1L4DA 1Y3UA 3LGIA 4WMEA 3SNAA 1AWHB 3WWFA 1C1WH 1GI7B 2WUBA 3MH5A 1Y5BT 2RFKC 4XD7D 3RUOA 1H8DH 1GJ5H 1C5OH 2UWLA 2YMSC 1E37B 3SYJA 3RXEA 1ZPCA 1C2DA 1DY8A 3E90B 1AQ7A 1C1UH 2VGCC 2O8TA 4X1SU 2FTMA 1QJ7B 1O39A 2VWMA 2ZFRH 1BMAA 4XSKU 1BTHH 3AW0A 3U69H 1DS2E 2HALA 5JYIA 5K0HA 3SJIA 1KLJH 3SV7A 3ZZ6A 2G52A 2OC7A 1P2QA 1YGCH 3T62A 4X2WA 4UEHH 3SORA 1ACBE 1GI1A 1IQMA 1ZZZA 3I29A 2NU1E 4Y0ZE 9ESTA 2OLGA 1TX8A 2QF5A 3DT0H 3QGNB 4XE4A 3ENSB 4JZ1A 7ESTE 1S0QA 2G81E 2GCHF 1JBUH 1QQ4A 1Z7KA 1GJBB 1T31A 2WYJA 1ELBA 3LGTA 3R0FA 1B5GH 1KY9A 1YCPM 3F9GA 4ABDA 1ZHRA 1O5CB 1VJAU 5EJLA 2QAAA 1IHTH 1GWAA 1NRRH 4M7GA 3GCNA 1C1NA 3M5NA 1LCYA 1IQGA 2ZPQA 3PV4A 3BG4B 4OM9A 1G3EA 1OWHA 4RN6A 2ZGHA 9LPRA 3S9CA 4YM9A 3RXRA 1TGCA 2BY5X 1AE5A 3F2FA 1TBZH 1O3OA 3HGPA 3PV2A 1TNJA 4GCHF 1HAXB 3TJOA 1TPSA 4CR9A 2WPIS 1C5UA 2VIWA 1C2LA 4ISHH 1YPGH 1TNHA 1GBIA 1O2TA 2A2XH 3ZVFA 3OY5U 1D9IA 2GJGA 5J4SA 4FUBA 2WHXA 1DPOA 2AIPA 3ATKA 1RRKA 3VXEH 1VR1H 3CP7A 3PMJA 3K2UA 3PWBA 2GV6A 1OSSA 3T5FH 1G32B 5A8XA 4B75A 1ESAA 1C2FA 4ZHMU 3HATH 3BG4C 3V0XA 2WZQA 5HIZA 3ZYDA 3P70B 1P9SA 4D9RA 2V6NA 2RA0A 5DN6D 1RFNA 1AFQB 1ANBA 5AFYH 1BBRH 1HJ8A 2A4OA 1FJSA 2BZ6H 3W95A 1BTXA 1C5VA 5JB8S 1XUIA 4MLFB 1Z1JA 3U1IB 1COWD 4YOGA 1H8IH 3UB0A 3H7OA 2A4GA 1GJ9B 4AN7A 4TY7A 1QTFA 2ODQA 1GI0A 2EY4C 1YPEH 1ZOMA 2WPKS 3KNXA 3KQBA 1EATA 4Y79A 2B7DH 4DW2U 1HXEH 2OC0A 1C5PA 2ZU3A 4ZXXH 4AB9A 3U8TH 1X7AC 1UTKA 5IDKA 1PQ5A 4I8JA 1AFQC 4FUFA 1UHBA 4TPIZ 3P8GA 1P11E 2HPQH 1P09A 3GCTG 3GOVB 1PPHE 1SQTA 4ACAA 4VGCB 3SUEA 1E36B 1TRYA 1L1NA 1DDJA 3F2GA 2FS8A 1FPHH 1QRXA 4CBNA 4JCNA 2QIQA 2D2DA 1AUJA 1NY22 2H6MA 5EG4A 1LHCH 2D8WA 1P57B 4HG6A 3DSGA 2ZO3H 1ZGVA 4IN1A 1UTNA 1EASA 1FUJA 1OYTH 1FAXA 1FXYA 2HGTH 3VB3A 2FI3E 1GI2A 2OP9A 1BRUP 1QCPA 1K1LA 3AW1A 2W7UA 2BOKA 3PMHB 3RU4D 1SFIA 2OC8A 5FPTA 1F7ZA 5GDSH 1C5XB 1W11U 4YESB 4VGCC 2YNBA 4AFUA 2XC5A 3SJ9A 3H5CB 3BTEE 5TCCA 4X8SH 5C1XA 2V0BA 8GCHG 5LPFA 5F8XA 3SGAE 5LGOA 1GI8B 5TCAA 4ESTE 3LGUA 2BXTH 2AFQB 2Z6BD 4Y8XA 1DLEA 1NFUA 1F5KU 1K0HA 2QF4A 2BDYA 1MD7A 4DT7B 3GISB 1C2HA 2ZZUH 1SLXB 1SKYE 2F9BH 4K1TA 1IQEA 3RMLH 5HMAA 2ZFSA 1W13U 1AIXH 2P8OB 1FY1A 4DURA 1ESBA 1G37A 3FP7E 4Y10E 1ARBA 4MNYA 4BOHA 2P59A 1FIZA 4K2YA 1C5YB 1O2HA 1YLNA 1O2NA 4XFQA 2OQUA 1MMJN 2QE7D 1MKWH 2ZA5A 1DWDH 1O2RA 1AHTH 1QL9A 2B0FA 1P2KA 2LELA 2VBCA 1HGTH 5I25A 3EDXB 2BX4A 1GMCF 4AFQA 1JIRA 2BX3A 1MD8A 4Y71A 1A7SA 5LPRA 4ZUHA 4AFSA 1J14A 1AWFH 2TGDA 4UFEH 1HAHH 2Y80A 5EQSA 2R0LA 3UR9A 2WYGA 5HIYA 4ABIA 1P06A 3UY9A 1DT2A 4K1EA 4ISLA 5HM2A 2A5KA 1A0HB 1MQ6A 1MTNB 2D26C 1GGDB 1QRZA 3ZVCA 2P94A 4Y0YE 1SL3A 2BY7X 5L30H 1NBMD 3UFAA 2AMDA 2HRVA 1TMTH 3PLBA 1O3DA 3D23A 3FZZA 4FOUC 1TABE 3RXGA 1GJAB 2PLXA 3KYGA 1QGFA 1P02A 1OP8A 1P04A 4O9VA 2GV7A 1BBRE 2PHBA 2ZCLP 2FP7B 4X6MA 4Y8ZA 5EW2H 1OXGA 4E7NA 3K6ZA 4DIIH 2G00A 2F43B 1LVYA 1YYY1 4AC9A 1DFPA 2FI5E 1HFDA 4XOJA 2OD3B 1V2PT 4K8BA 1NO9H 4NWLA 1O30A 1C5MD 2FOMB 2F3CE 4YOJA 2AIQA 2FWWA 3KGPA 1TBRH 2O8WA 2R3UA 4DOQA 3M36A 1CBWB 1GGDC 1IQFA 1ANCA 3SBKA 1YY3A 2FX6A 3KN2A 1Z8RA 1LHFH 1WTHD 1HAVB 1XMNB 2H2ZA 2KZ4A 3UUZA 1ZHMA 4K60A 1TRMA 2BOHB 1G3BA 2ULLA 3ZV8A 1CGJE 2BXUH 2VH6A 3RXMA 1KYNA 4ABEA 1YPHE 1BT7A 3NCLA 4D8NA 3RMMH 4FUHA 1W8BH 2ALVA 4Y6DA 3TPIZ 4X1PU 1HIAB 3TLOA 1C5NH 2F9PA 3UPEA 1SMFE 3AAVA 4JZFH 1CSOE 4NSVA 1GBDA 5AHGH 5DO4H 1C5RA 1GMDG 1EJAA 1GBCA 1EPTA 2FPZA 3BTDE 1SG8B 3MWIU 2A7HA 5FX6A 4OS4A 4TWYA 1W0KD 4KP0A 1GBLA 3RXCA 3GCTF 1QL8A 1MCTA 1FY4A 5FL7D 3ZZBA 3SNBA 1VJ9U 5C3NA 1H1BA 2ZU2A 2GP9B 2ZPRA 4IMQA 4OS7A 1VITF 3FO8D 4CREA 3OTJE 1TE0A 1RIWB 1TPOA 3SV8A 1DLKB 1GHZA 4MVNA 5L2YH 2PP6A 1JMOH 1L4ZA 4ASHA 4O3UA 2L74A 2ZPSA 1SBWA 4JMYA 1GL1A 5C1YA 2ZGCA 1ZJKA 1S82A 3GY6A 4IGDA 1YPJH 1MTUA 2P93A 1MZAA 1QA0A 1V2KT 2PTNA 4ZKNU 4Q80A 1VZQH 1K21H 1V2QT 1O2KA 3E16B 4X2VA 1V6DA 4TY6A 1OWEA 2IJOB 5FHTA 3MNSA 4AB8A 2OCVB 1IQHA 1Q3XA 1VCWA 3EA7A 1GHBG 2FM2A 2V3OH 4R8TB 2JETB 3KEEA 1UK2A 1ELGA 3PTBA 5JBTA 3LU9B 4F55A 4RT1A 2Q1JA 3B9FH 1HDTH 1NBME 2Q6DA 3I78A 3PTNA 4NA9H 1B7XB 1C5WB 1ELCA 1P2JA 2QF0A 2XOKD 1IQIA 3ZZ5A 2VIDA 4CRAA 3OYPA 1BTYA 3JZ1B 1N8OC 3A7XA 1GHWH 2XRCA 3TH4H 1C1MA 4TPYA 4CH2B 1NC6A 2FOBA 1Y3YA 2ANMH 1QB1A 1C1QA 1O2MA 1G2LA 5FCKA 2Z9KA 1MUEB 5DP4A 3N7EA 2ZG0H 1TGSZ 2VVUA 2JETC 5LH8A 1W10U 4LOYH 4AG1A 5HM9A 1C5QA 1GI3A 4NIXA 2AMPA 4XRNA 5A09A 1E1QD 2CXVA 2QC2A 2GX4A 1H9IE 1GDUA 4F49A 1LVBA 2DE8A 1CA8B 2KCAA 1K2I1 2ANKH 5IK2D 1EX3A 4A92A 1F0UA 1NZQH 1KXFA 3W94A 5F6MA 2F9VA 1C4V2 1UMAH 1ELEE 3QTOH 1A61H 1AVXA 3RC5A 1HRTH 1VITH 2GDEH 2KCYA 1O31A 3GDUA 2ZP0H 1HAZB 1TMBH 1Q2WA 4OS5A 2K0QA 1UTQA 3PMAB 4HZHA 1SPJA 1NU7B 1SGNE 5C67A 5HYOA 1LKBA 4TYDA 1NRQH 2VVVA 1V2TT 1EAUA 3ZVDA 1AY6H 3SHCH 4H42U 3S7HB 1SGYE 2O9QA 2AS9A 1E1RD 2EC9H 2GMTB 4ACBA 3TK9A 1O2VA 3RXDA 3T25A 2EEKA 2O8UA 3V12A 2XCFA 3IITA 1ELAA 3RXVA 2EI7A 4AG2A 2I6QA 5GXPA 1ZTJA 1TRNA 3MFJA 1P0SH 2HVYB 2J98B 1GVKB 4FUGA 4ISIH 2VIPA 4RSPA 1S84A 1CO7E 1G36A 1ABIH 1O3BA 3MO9A 5CE1A 3RM0H 3GDSA 3ODFA 1H9LB 4F4OC 1SC8U 2ZFPH 4KELA 3ATIA 4UD9H 4UONA 1GJ7B 2O8LA 3DUXH 1C5LH 3WW7A 3TGKE 2BMGB 2H5DA 3QX5H 1WXRA 3UR6A 1G3DA 2G5VA 2KAIB 3FVFB 4CRCA 3MU8A 4WF8A 1SGFA 3U98H 4UE7H 3F9HA 2FX4A 4X1RU 2PSYA 4KKDA 3RC4A 3GICB 2GMTC 2A31A 1C2KA 2A32A 1UVUH 2CF8H 1WUNH 2FOHA 4H4FA 1BHXB 1IAUA 4A1VA 3OEED 4B1TA 1BBRK 1QFKH 4D7GA 1TOMH 1D3QB 2XWAA 3BF6H 1A1RA 1CGHA 1W0YH 2FOCA 3M37A 1O2GH 2TGAA 2KR7A 4BAKB 3STJA 2F83A 2STBE 2ZGJA 1KLIH 4BXWA 1F0SA 3ZYEA 4GSOA 1WBGB 2O8MA 5SGAE 3TGIE 5E8EH 3FAOA 3DHKH 2ZCKP 4NIYA 1EAXA 1EUFA 3RXLA 3A8BA 1CA0B 1NFYA 1GMDF 1KDQB 2VWLA 4AFZA 3WY8A 1IQLA 2TBSA 2Y5HA 3T27A 1ELTA 1O2YA 1S0RA 3RP2A 1K1MA 3TU7H 2ESTE 1O2XA 1RXPA 3OY6U 1OWIA 4RI0A 5FPYA 4CR5A 3SNEA 1F0RA 2CMYA 4E05H 1VGCB 4HTCH 2W7SA 1CGIE 3UWIA 1TIOA 4THNH 2HPPH 3ZV9A 1XXDA 2GT8A 3LGVA 2FMJA 2ZKSA 2JH6D 1DXPA 3ZVBA 1AVGH 1BRBE 2ZU4A 3F68H 3F9EA 1QQUA 2BB4A 3QTVH 1RD3B 4CRBA 1H8ED 1T8NA 3IWMA 4BTTB 2CHAB 3AVZA 4LZ4B 3F0PA 1ORFA 1SQRA 5HGGA 3UOPA 4A1XA 4DJZB 2G4TA 1W0JD 5EJZA 5JB9S 1CA0C 3SU4A 3M7QA 5G4BA 2FYQA 3NK8A 2SGDE 2KCOA 1S81A 1SGEE 2PUQH 1GCDA 1FIWA 2Y5GA 2GGVB 1ZPZA 1VGCC 1O33A 1GHBF 2PKSB 1GPZA 3ATMA 4CH8B 1BRCE 3SN8A 1GJDB 4WH8A 1WTGH 2RCEA 1P2NA 1LO6A 1C1SA 1T8OA 3VB4A 3PMBB 5GIBA 4JYTA 3ATLA 5HXFA 1V2LT 5DP8A 1OYQA 2CHAC 1BMNH 2ZDKA 3R3GB 2PGBB 4ZKOU 5LPEA 3GYMA 4MPWA 1ZYOA 1SGPE 3E0PB 1FNIA 3LH3A 1Q31A 5DP9A 1GHVH 1PPBH 1Y3XA 5F03A 3P92A 4HI3A 1GBAA 1UK4A 1BMFD 1EB1H 1EP5A 2PKSC 4Q2KA 2UWPA 1J16A 3CS0A 2YNAA 1KLTA 2FYRA 2BQ6B 3RXPA 2F4LA 5DK1A 3TJNA 3D65E 5ESTE 1EAWA 1XUGA 3LDXH 3URDA 1A0JA 3OTPA 3HKJB 4CHAB 1OKXA 4XBBA 3BEIB 5T6GA 1AZ8A 1MKWK 3ESTA 5FCRA 3U28C 1CT0E 3DA9B 1D3PB 2G5NA 2SGEE 3RMOH 1U6QA 3RXFA 3L6PA 3QN7A 1LVMA 1A3BH 1EP6A 5C17A 3SNCA 5GWZA 1UCYE 3T2NA 4IC6A 3RXUA 1GG6B 5I46H 2CJIA 2FXRA 4J1YA 1Z8GA 2V3HH 4DVAU 1XUKA 3TH2H 2A4QA 4IMZA 4MNXA 3E0NB 2FOFA 3Q3KA 1ZR0A 4AX9H 3SU1A 2GZ8A 2ZHDA 3P6ZB 6GCHF 4XBCA 3MTYA 2HLDD 2IOTA 3K65B 1OP0A 4CHAC 2QXIA 4ABGA 3C27B 2WPDD 4CBOA 3UREA 1GVZA 2KCPA 2ZC9H 5EXNA 4NFFA 4INKA 3RXBA 5F8TA 2R2WU 4X1NU 1C4Y2 3E3TA 2BY9X 2JDID 1TA6A 2ZGBH 1GJ4H 1O2SA 3SV6A 3SV2H 5A0AE 1C1VH 1HCGA 1GDNA 1FV9A 1LQEA 1O0DH 1MAXA 5EPNA 3IG6B 1GG6C 1GI5A 4Y11E 3F0OA 1TPAE 3L33A 1BHXF 5BRRE 1NRPH 1WQSA 1C5SA 2CGAA 2UUKB 1XX9A 4I8LA 4FVBA 1S6LA 3E6PH 2PSXA 2Z3EA 3FKSD 1O3KA 1YWUA 1AU8A 1FY3A 1KXAA 1V2ST 2R9PA 4XBDA 3FP8E 3SJKA 3KF2A 4FXGH 3HPTB 4BANB 4XDEA 2IPHA 3TJVA 1P03A 1KXEA 3ZZ8A 1ID5H 2XYAA 1TGTA 3ODDA 5KECA 1MQ5A 3GY5A 1PFXC 3MO6A 1QBNA 2OUAA 1EZSC 4IW4E 1NPMA 1SQAA 3Q76A 2BD7A 1O2UA 4O3TA 1SI5H 1P2OA 4X6PA 3QUMP 3SJ8A 1HNEE 1W7XH 4IBLH 4I7YH 1Y5UT 4Y7BA 2RDEA 1HB0B 2XXLA 1TLDA 3A85A 4JYUH 2BTCE 2F91A 4AOQA 1N1LA 1L2EA 2P3TB 1HAGE 1IQKA 1UTLM 1TQ7B 2SNVA 4A1TA 1TGBA 1PPZA 1E79D 2QF3A 4FU9A 2VNTA 1LVOA 4LXBH 3RMNH 1FY5A 2WINI 1OP2A 3URCA 3Q3YA 4D7FA 1MU6B 3A88A 4A5TS 4B71A 5FBIA 2GZ9A 4RKOB 3RC6A 2BD3A 5DG6A 2ZGXH 3W1EA 3M5OA 1GL0E 3HKIB 1H9HE 4Q7YA 4BAHB 3A8CA 1ELDE 3A7TA 4KGAA 1AD8H 1TAWA 5DP5A 2UUJB 5JDUB 1A4WH 3FN8A 1AUTC 3MO3A 2AH4X 3MU5A 4X6NA 1HAYB 2FTLE 5C0UA 1GI9B 1O3IA 2IN2A 1YPKH 1BTUA 1D3DB 2SGAA 3BIUH 4X2YA 2OK5A 3TJUA 3ZZ4A 5JPMH 2ZNKH 3MH7A 4TT3D 1MH0A 2P95A 3JZ2B 1O36A 4X8VH 4ZHAA 4ASUD 4FUDA 4GAWA 1KMHB 3D49H 1TX6A 3HGNA 2BD9A 3ZZAA 4QT8C 2ZEBA 1UJ1A 1HV7A 4NCYA 2QA9E 4YO9A 5CDFE 3QZQA 4H6TA 5DKMA 3L3TA 1QJ1B 2VVCA 1RTKA 2Z3CA 2P8OC 3AASA 4B2AA 4CRGA 3O8CA 1JOUB 5C5NA 3GY8A 4TWWA 2ZDMA 1UVPA 1GBFA 1E38B 1OOKB 1V2OT 1O5EH 5EGMA 1P3CA 2AMQA 2JJ2D 3A7WA 4AORA 4WXIA 1H8HD 3CS7A 3NKKA 5A8ZA 1EOLA 1LQDB 3TGJE 1WAYB 2ZHWH 3A82A 4GLYA 1ETSH 3SU6A 2BDGA 2Q6GA 3VEQB 1QURH 3PB1E 1KSNA 1C2MA 4ABJA 3KL6A 1ZMLA 1UTOA 3UOUA 1PPGE 1F5RA 2ZWLH 5E0JA 1DXWA 1TWXB 1IOEA 4I32A 1ESTA 3ZZ7A 1ZSKA 3RU4E 2STAE 1GMHG 5FPSA 2ZQ2A 2OINA 4K8YA 2Y7ZA 3B8JA 4A7IB 3PRBA 1Y59T 4Z6AH 1ETTH 3P17H 1MBQA 4DY7B 3M3SA 4J2YB 1MTNC 5AF9H 1DSUA 1K1IA 2VIOA 1MU8B 3BV9B 1UVOA 3LC3A 2ZDLA 4WWYA 1TYNA 3SOSA 1O38A 1K1NA 2QXGA 1SGIB 2CN0H 4X2XA 4MTBA 3E91A 1HAOH 1EXFA 1K1OA 1IQJA 3RXHA 1DITH 2BZAA 3DSPA 3FP6E 1LHEH 1DVAH 4YLUA 3SUDA 2ZFFH 3GY7A 1NS3A 1UCYK 4Q63A 4E06H 3LIWA 3SO3A 1XVOA 1C4U2 3SW2B 2A1DB 4GVUA 1JRTA 1NESE 3MMGA 4NWKA 3BSQA 1A0LA 1O3NA 1CBWC 4YT6H 2VWOA 3SHAH 4MNWA 1Z8IB 1BITA 5GNDA 1O3JA 1RJXB 4Z0KA 4BAOB 4DIHH 1V2WT 2BLQA 4IC5A 5T1VA 3RXSA 3EA9A 2BY6X 4FU7A 2VJ1A 3N99A 3U1JB 1VCQA 1QRWA 3KQ5A 3ZVGA 1KXDA 5JBCS 1QBVH 3GCHB 2QV1A 2GCTB 1YF4A 5EQQA 2F9NA 1SGTA 2KX4A 4U30A 7LPRA 2EA3A 4I33A 1C5TA 1A5HA 2H9HA 1P9UA 1QB6A 3MYWA 2D1JA 4NIWA 2AGEX 8ESTE 1EZQA 1O3LA 2FEQH 2WSSD 1B0FA 3K9XB 2RA3A 5DJ7A 2OXSA 5C5OA 2KFWA 5PTPA 2WV9A 3UNSA 1Z8JB 1LPZB 4OS1A 1KIGH 3FANA 4OGYA 4GUXA 3P8FA 3RLWH 2BD8A 1TNIA 1O5DH 2FLRH 8GCHF 3I77A 1RIWC 1ZTLA 1G30B 1ZLRA 5C1UA 3GCHC 3RM2H 1FAKH 1GBHA 4K69A 1FONA 3RXIA 2BDBA 1SR5C 1ZSJA 1WSSH 1THRH 1UO6A 1WYKA 4ISNA 3LH1A 2GVFA 1BJUA 3H09A 2M2AA 1O2JA 2ALPA 2GCHG 3ELAH 2THFB 1SLVB 3BTME 4MPXA 1MTSA 3BEUA 2F9UA 1J9CH 2VU8E 4YZUA 1SGRE 2FOEA 4OS2A 5EXLA 3LPRA 5EXMA 5C0TA 1RGQA 2P3UB 1OWDA 3MU4A 4CRFA 1AMHA 3BTHE 4FETA 3RLYH 1MZDA 1TFXA 3LJOA 4NG9H 2EQNA 1O5FH 2B8OH 2WUCA 1OS8A 2BY8X 3A86A 4I86A 3DD2H 3T28A 3O8RA 1EJNA 1XUJA 3BTQE 5C94A 3U8OH 1A5IA 4GHTA 5EIYA 4GCHG 3EA8A 3S0NA 3AAUA 1C9TA 1BCUH 3MHWU 3O8DA 1VKYA 4I8GA 1QL7A 3MQKC 1XUFA 2J92A 3RXTA 3STIA 1C2JA 2FOGA 4ZAEA 3VB6A 1L1GA 2V35A 3PM3A 3KYFA 3UAIC 2PGQB 3MU1A 4YOIA 5KGOA 1DM4B 4WMDA 3LGWA 1PPFE 5AFZH 3UTUH 1P05A 1TNKA 4ZXYH 1HAVA 1W0ZU 3HK6B 1UCYH 1A46H 3NXPA 1GBEA 3SV9A 2ZU1A 2UUYA 2XTTB 4I8KA 1TB6H 4FUCA 1K28D 1W14U 2J97A 2JH5D 1HIAA 4WXVA 3GCOA 3NUMA 1XUHA 1LPKB 2XBVA 3SU0A 1J17T 1D6RA 1XVMA 1DICA 1TNLA 1GMHF 1DE7H 1K9OE 3S9AA 3BTGE 1T32A 3BTFE 2VINA 3PLPA 2XNIA 5FXLA 3TK6A 1S5SA 3GY2A 4K3JA 1GJ8B 4ZHLU 1V2MT 3SU5A 3OX7U 2ZFTA 4Z1MD 4FUIA 3GYLB 4WVPE 1D4PB 1SB1H 3VGCB 8LPRA 2NWNA 1V2JT 3SQHE 3GS9A 4ZKRU 1J15A 2BDAA 4YTAA 1F0TA 2Q6FA 3GY4A 3T29A 2ODPA 4K5ZA 1DOJA 1EZXC 4NSYA 5CHBA 1GHAG 5EOKA 2IPQX 2A7JA 2QCYA 2ZHFH 1NFXA 1Z1IA 2M5TA 2CK3D 1LMWB 3SUFA 5A0CA 1C1TA 2TRMA 3N7DA 7GCHG 2LP6A 1HJAB 2TGTA 2J2UA 1Y3VA 3QK1A 2I6SA 4Y8YA 5DPAA 2RG3A 4AYVB 3SGBE 4P02A 2PR3A 3VGCC 2B9LA 2CV3A 3ZVAA 4WJG2 1QY6A 1MKXH 4GPGA 2P16A 3M7UA 5TJXA 1BOQA 1UHBB 3FZDA 1O5GH 5C20A 2ZDNA 2XCNA 3TIUA 4LK4A 3FOAA 4U32A 1FY8E 1WOFA 1OX1A 2Z9JA 1EAIA 4MPUA 1THPB 3D62A 2ZF0H 4NA7A 4YT7H 1O2PA 1E0FD 1UVTH 1NU9A 1CT2E 1HJAC 2GDDA 4B6FA 1SSXA 4B74A 2BDHA 2WPHS 5JBBS 1BTZA 2HWLB 4IS5A 3P8OA 2FO9A 7KMEH 1AB9B 4KTUA 1QIXB 1BTPA 4MDSA 5T3HA 4I8HA 5EW1H 3A83A 1THSH 2PKAB 3MNCA 2Y6TA 3PLKA 3RDZA 3OEHD 1AFEH 2Z9IA 1LTOA 5DSFA 4UFGH 2QXHA 3M5MA 3AK5A 1C1RA 4YLQH 3OSYA 1HXFH 3F2HA 3BTKE 1ELVA 2ANWA 3ZZDA 2PWXA 3O8BA 2JJ1D 1GMCG 3DCLA 5F8ZA 1YBWA 5E2PA 4D76A 5DP6A 3PYHA 1O3AA 2FESH 3A87A 4Q4LA 3CENA 2ZDVH 5AVDA 1AB9C 1NM6A 1TMUH 1OWKA 5E0GA 2FI4E 4JZEH 1Z6JH 2R2MB 4ABFA 1ABJH 3A80A 2Z9GA 1S6FA 2BM2A 1BMMH 2BVSH 4KTSA 1RS0A 2EI8A 1LKAA 5CHAB 4PROA 2J98A 2SFAA 2BLOA 4DT4A 3RXJA 1EFRD 1C2EA 4FVDA 3ZZCA 1BMLA 2GT7A 5T6DA 5KEDA 3ATWA 4U01A 1BJVA 1UW7A 1JXPA 1ZSLA 1O3HA 1YCPK 3N7OA 4BXSA 3F1SB 1FDPA 3M3VA 1YPLH 4ZKSU 2KAIA 2OBQA 3VB7A 4Y7AA 4JZDH 1QA7A 2JH0D 5DP7A 2C8XB 4R0IA 2FODA 5DGJA 1K22H 1Y5AT 1EOJA 2FOAA 2R0KA 2ZI2H 1H4WA 2WPJS 1T8LA 2QXJA 5JBAS 1Y8TA 5EQRA 2P3FH 2ODYB 2PFEA 3NWUA 4NFEA 5CHAC 5B6OA 3EAJA 4UFDH 1UK3A 1FLEE 1O2IA 2BDCA 3MOCA 1NROH 2F9OA 4GHQA 3TK5A 1BB0B 5EU8A 2NU3E 3FFGA 2BD5A 3BTTE 4DCDA 5IYTA 1KDQA 3OAAD 5BPEA 1SFQB 3RXOA 1PJPA 4OGXA 3MNBA 1WDIA 3VPKA 2XBXA 2PW8H 2KM0A 4FUJA 1VCPA 1CQQA 1NN6A 1TPPA 5GJ4B 3M5LA 2NU2E 2ZFQH 2Y81A 1EQ9A 2W6ID 3MU0A 1GBTA 1YM0A 1Y3WA 1YKTA 2HVXA 1P2IA 1GI4A 2OQ5A 1WU1A 2G55A 3EGKH 4BNRA 2Z94A 1GHAF 1T8MA 3KQDA 1YLCA 1SVPA 1OPHB 1TOCB 1VITG 2A7CA 1L1JA 2B5TB 2BD4A 2NU4E 4X8UH 4Y76A 4YXWD 4ZH8A 1OHHD 2LPRA 4Q7ZA 3LJJA 1ZMJA 3QO6A 1FX0B 4Q7XA 4RKJB 1HYLA 7GCHF 2WV4A 6ESTA 1GCTB 2AEIH 1KXCA 2UUFB 2V3MA 2ZHEH 3VG8A 1PYTD 1EPTB 3PV5A 1O2LA 2C8ZB 1O35A 2ZCHP 2VH0A 1GBBA 2QY0B 3QDZB 2PKAA 3S69A 3BIVH 2FS9A 4B2CA 4OS6A 4INLA 2H9EH 4BAMB 1P10A 3OFND 2J95A 3KHVA 1NFWA 1IQNA
chains in the Genus database with same CATH topology
1DUEA 1XKBC 1BQYA 3H7TA 1ETRH 3DFLA 3LOXA 1MAYA 4KTCA 5L2ZH 1O34A 3PWCA 3ZZ9A 3E8LA 5EPYA 1SLUB 1O3EA 2HNTE 1ZGIA 1GHYH 2Z7FE 4WH6A 1GCTC 3C1KA 1YP9A 1BDAA 2ASUB 1O3PB 2CF9H 3A7YA 1N6XA 1EPTC 1FI8A 4U2WA 5GPIB 1LPGB 1UVSH 4B76A 2VB0A 2Y7XA 4ZROA 2GTBA 1QJ6B 4SGBE 1ZHPA 2TPIZ 4JK5A 3A81A 3ITIA 5EODA 1DANH 1KTTB 3RXAA 4NIVA 3A89A 5L6NH 1YCPH 1INCA 5FAHA 1V2RT 2DE9A 3LT3A 1CVWH 4BTIB 2ANYA 4NZQA 2LNCA 4JZIA 2C8YB 5GCHG 2VIVA 1C9PA 2ILNA 1AO5A 1A3EH 1JRSA 1LDTT 1Z6EA 3MNXA 3P95A 1DWEH 4O97A 1HBTH 1EB2A 1RTFB 1O2QA 1GHXH 1QNJA 2QN5T 1C5ZB 4ABAA 2VIQA 2PTCE 3A84A 1F2SE 1GBMA 1SHHB 3VB5A 3UNRA 4AYYB 1C2IA 1HUTH 1UTMA 4X8TH 3SGQE 2GD4B 2SGFE 3TH3H 2DUCA 2J94A 5A2MH 1A5GH 1MTVA 5C2ZA 1PQAA 1QHRB 3SQEE 3K6YA 2C8WB 1QB9A 6CHAB 2AYWA 3RU4T 1FQ3A 3NPSA 3F6UH 3SI4H 1AN1E 2EI6A 1ARCA 4ISOA 3V7TA 3A7ZA 2XC0A 2J4IA 3EE0B 1KXBA 1PQ8A 4WY3A 1Z71A 1YC0A 4ZMAH 1ZRBA 1MCVA 1O3MA 3M61U 4AZ2B 1A2CH 1AGJA 1D6WA 1O2ZA 1WQVH 2BQWB 5FX5A 1HLTH 4SGAE 1YLDA 1ANDA 1EZUC 3GY3A 1JIMA 3V3MA 2SNWA 1GJ6A 1O37A 1NT1A 1T4UH 1S83A 1SGCA 2JKHA 3VFEA 1DY9A 1M9UA 2ZQ1A 1SOTA 4MQAA 3S9BA 2BDIA 1FPCH 3SNDA 1W7GH 3EYDA 6CHAC 2ZTZA 2Z9LA 1S85A 1AE8H 3MH4A 2A5IA 5A0BA 5A8YA 2QGRA 1O3GA 2BLVA 2W3IA 1QBOA 1V3XA 3BG8A 2ZTXA 3Q3XA 1BA8B 3E1XB 1N6YA 3TNSA 5E0HA 1CT4E 4FUEA 3GDVA 1AI8H 1K1JA 3KQCA 1CHOG 1EKBB 1MTWA 2W5EA 2BYAX 1UTJA 3RXKA 5E2OA 1SGFG 3LONA 2HNTC 4INHA 2OC1A 2AERH 1P01A 2J34A 1G9IE 2NU0E 4BTUB 4ABBA 2A4RA 2W3KA 3MH6A 4I31A 1DX5M 1GI6A 5DP3A 2OTVA 3BN9A 5ETXA 1UTPA 1HPGA 3M35A 5J4QA 4X1QU 3U8RH 2RDLA 3QZRA 2A5AA 1DSTA 1SGQE 3HK3B 4MNVA 1OWJA 2G51A 1GJCB 1AKSB 1S6HA 4LZ1H 1HAIH 4IN2A 2G4UA 3B23B 3QLPH 1N8OB 1IHSH 1TGNA 1TA2A 2WPMS 1ZJDA 3SI3H 4X0WU 1F92A 1ZPBA 2ZDAH 3VXFH 1RTLA 4WMFA 3TITA 1ZMNA 2GCTC 4A6LA 3PO1B 3OU0A 1WCZA 4JYVH 3Q00A 1GBJA 2QYIA 2C3SA 2SGQE 2R3YA 1XM1A 1MKXK 1WV7H 2PV9B 3A8AA 1F5LA 1O2WA 5T6FA 1TQ0B 3V13A 1TONA 1JWTA 1TX7A 1TNGA 3EQ0H 3SU2A 6LPRA 1ANEA 1BRAA 3NZIA 4O03A 1QR3E 1NRNH 2ZECA 1E35B 4UDWH 1XXFA 2A2QH 2FZZA 4DGJA 1CHGA 1BZXE 1AVWA 1P12E 3A8DA 4CRDA 1D3TB 2C93B 1GDQA 1SQOA 3BEFB 1P2MA 2A45B 1T7CA 1XKAC 2AGIX 5CMXH 1SLWB 2BD2A 3PO1C 4AGKA 2C90B 2HOBA 3TVJB 3ZVEA 1SHYA 1GVLA 1PYTC 2FIRH 2WPLS 2VWNA 4ABHA 2ZU5A 2W26A 1SGDE 3RXQA 1FZZA 4AGJA 1O3FA 1W3CA 4NZLA 1DWCH 4H6SB 5GCHF 2A0QB 3KIDU 3DFJA 2UWOA 1AZZA 1LHGH 2YOLA 1BIOA 1NRSH 4UFFH 2C4FH 1BTWA 1DUAA 3QWCH 4FU8A 1HJ9A 1GBKA 1PPEE 3UQVA 1BUIA 1T4VH 3LKWA 2H1UA 2G8TA 3KCGH 2HLCA 2ZIQH 2FLBH 1FN8A 2Y5FA 1YPHC 2XWBI 4B73A 2GZ7A 1E34B 1C2GA 3A7VA 1V2VT 2BHGA 5H4IB 5FBEA 1O32A 3M3TA 1LHDH 1J8AA 1PQ7A 2WV5A 1HAPH 2BQ7B 3ZZ3A 4E7RG 3M7TA 2OBOA 4MPVA 3UIRA 4DG4A 1DWBH 1ZRKA 1MBMA 2SGPE 3LC5A 3UQOA 1O3CA 2AGGX 5ABWA 1O2OA 1YPMH 6GCHG 2ZHQH 4BAQB 5ESBA 2XBWA 4X6OA 1V2UT 4HFPB 1EJMA 2BVXH 2FDAA 3KQEA 2J9NA 3LGYA 3MI4A 3SU3A 3S7KB 1CE5A 2XW9A 1K1PA 2Y82A 2XBYA 3U9AH 1FMGA 2HNTF 3UNQA 2TIOA 3UWJH 1V2NT 1CU1A 4MG3A 2PUXB 4B2BA 8KME2 3F9FA 1O5BB 3Q77A 2H5CA 1C1OA 1KTSB 1P8VC 3P8NA 4D9QA 2Z3DA 1G2MA 1O5AB 2BLWA 2BVRH 1C1PA 4NA8A 3TNTA 1W12U 3G01A 1AKSA 1FN6A 2ZTYA 1B0EA 2H9TH 4JK6A 4K1SA 3SZNA 2K1QA 3QGJA 1TBQH 2VGCB 3PROA 3BTWE 3SJOA 1G3CA 2J38A 1NTPA 1ELFA 1CHOF 3SUGA 1ZTKA 5K7RA 1TALA 1P3EA 2XC4A 1L0ZA 3T26A 2TGPZ 4HGCA 1PPCE 1W2KH 2GKVE 4NGAH 1SOZA 1L4DA 1Y3UA 3LGIA 4WMEA 3SNAA 1AWHB 1C1WH 1GI7B 2WUBA 3MH5A 1Y5BT 3RUOA 1H8DH 1GJ5H 1C5OH 2UWLA 1E37B 3RXEA 1ZPCA 1C2DA 1DY8A 3E90B 1AQ7A 1C1UH 2VGCC 2O8TA 4X1SU 2FTMA 1QJ7B 1O39A 2VWMA 2ZFRH 1BMAA 4XSKU 1BTHH 3AW0A 3U69H 1DS2E 2HALA 5JYIA 5K0HA 3SJIA 1KLJH 3SV7A 3ZZ6A 2G52A 2OC7A 1P2QA 1YGCH 3T62A 4X2WA 4UEHH 3SORA 1ACBE 1GI1A 1IQMA 1ZZZA 3I29A 2NU1E 4Y0ZE 9ESTA 2OLGA 1TX8A 3DT0H 3QGNB 4XE4A 3ENSB 4JZ1A 7ESTE 1S0QA 2G81E 2GCHF 1JBUH 1QQ4A 1Z7KA 1GJBB 1T31A 2WYJA 1ELBA 3LGTA 3R0FA 1B5GH 1KY9A 1YCPM 3F9GA 4ABDA 1ZHRA 1O5CB 1VJAU 2QAAA 1IHTH 1GWAA 1NRRH 4M7GA 3GCNA 1C1NA 3M5NA 1LCYA 1IQGA 2ZPQA 3PV4A 3BG4B 1G3EA 1OWHA 4RN6A 2ZGHA 9LPRA 3S9CA 4YM9A 3RXRA 1TGCA 2BY5X 1AE5A 1TBZH 1O3OA 3HGPA 1TNJA 4GCHF 1HAXB 3TJOA 1TPSA 4CR9A 2WPIS 1C5UA 2VIWA 1C2LA 4ISHH 1YPGH 1TNHA 1GBIA 1O2TA 2A2XH 3ZVFA 3OY5U 1D9IA 5J4SA 4FUBA 1DPOA 2AIPA 3ATKA 1RRKA 3VXEH 1VR1H 3CP7A 3PMJA 3K2UA 3PWBA 2GV6A 1OSSA 3T5FH 1G32B 5A8XA 4B75A 1ESAA 1C2FA 4ZHMU 3HATH 3BG4C 3V0XA 3ZYDA 3P70B 1P9SA 4D9RA 2V6NA 2RA0A 1RFNA 1AFQB 1ANBA 5AFYH 1BBRH 1HJ8A 2A4OA 1FJSA 2BZ6H 3W95A 1BTXA 1C5VA 5JB8S 1XUIA 4MLFB 1Z1JA 3U1IB 4YOGA 1H8IH 3H7OA 2A4GA 1GJ9B 4AN7A 4TY7A 1QTFA 2ODQA 1GI0A 1YPEH 1ZOMA 2WPKS 3KNXA 3KQBA 1EATA 4Y79A 2B7DH 4DW2U 1HXEH 2OC0A 1C5PA 2ZU3A 4ZXXH 4AB9A 3U8TH 1X7AC 1UTKA 5IDKA 1PQ5A 4I8JA 1AFQC 4FUFA 1UHBA 4TPIZ 3P8GA 1P11E 2HPQH 1P09A 3GCTG 3GOVB 1PPHE 1SQTA 4VGCB 3SUEA 1E36B 1TRYA 1L1NA 1DDJA 2FS8A 1FPHH 1QRXA 4CBNA 4JCNA 2QIQA 2D2DA 1AUJA 1NY22 2H6MA 5EG4A 1LHCH 2D8WA 1P57B 2ZO3H 1ZGVA 4IN1A 1UTNA 1EASA 1FUJA 1OYTH 1FAXA 1FXYA 2HGTH 3VB3A 2FI3E 1GI2A 2OP9A 1BRUP 1QCPA 1K1LA 3AW1A 2W7UA 2BOKA 3PMHB 3RU4D 1SFIA 2OC8A 5FPTA 1F7ZA 5GDSH 1C5XB 1W11U 4YESB 4VGCC 2YNBA 4AFUA 2XC5A 3SJ9A 3H5CB 3BTEE 5TCCA 4X8SH 5C1XA 2V0BA 8GCHG 5LPFA 5F8XA 3SGAE 5LGOA 1GI8B 5TCAA 4ESTE 3LGUA 2BXTH 2AFQB 2Z6BD 4Y8XA 1DLEA 1NFUA 1F5KU 2BDYA 1MD7A 4DT7B 3GISB 1C2HA 2ZZUH 1SLXB 2F9BH 4K1TA 1IQEA 3RMLH 5HMAA 2ZFSA 1W13U 1AIXH 2P8OB 1FY1A 4DURA 1ESBA 1G37A 3FP7E 4Y10E 1ARBA 4MNYA 4BOHA 2P59A 1FIZA 4K2YA 1C5YB 1O2HA 4XFQA 1O2NA 2OQUA 1MMJN 1MKWH 2ZA5A 1DWDH 1O2RA 1AHTH 1QL9A 2B0FA 1P2KA 1HGTH 5I25A 3EDXB 2BX4A 1GMCF 4AFQA 1JIRA 2BX3A 1MD8A 4Y71A 1A7SA 5LPRA 4ZUHA 4AFSA 1J14A 1AWFH 2TGDA 4UFEH 1HAHH 2Y80A 5EQSA 2R0LA 3UR9A 2WYGA 4ABIA 1P06A 3UY9A 1DT2A 4K1EA 4ISLA 5HM2A 2A5KA 1A0HB 1MQ6A 1MTNB 2D26C 1GGDB 1QRZA 3ZVCA 2P94A 4Y0YE 1SL3A 2BY7X 5L30H 3UFAA 2AMDA 2HRVA 1TMTH 3PLBA 1O3DA 3D23A 3FZZA 1TABE 3RXGA 1GJAB 2PLXA 1QGFA 1P02A 1OP8A 1P04A 4O9VA 2GV7A 1BBRE 2PHBA 2ZCLP 2FP7B 4X6MA 4Y8ZA 5EW2H 1OXGA 4E7NA 3K6ZA 4DIIH 2G00A 1LVYA 1YYY1 1DFPA 2FI5E 1HFDA 4XOJA 2OD3B 1V2PT 4K8BA 1NO9H 4NWLA 1O30A 1C5MD 2FOMB 2F3CE 4YOJA 2AIQA 2FWWA 3KGPA 1TBRH 2O8WA 2R3UA 4DOQA 3M36A 1CBWB 1GGDC 1IQFA 1ANCA 3SBKA 2FX6A 3KN2A 1Z8RA 1LHFH 1WTHD 1HAVB 1XMNB 2H2ZA 3UUZA 1ZHMA 4K60A 1TRMA 2BOHB 1G3BA 2ULLA 3ZV8A 1CGJE 2BXUH 2VH6A 3RXMA 1KYNA 4ABEA 1YPHE 1BT7A 3NCLA 4D8NA 3RMMH 4FUHA 1W8BH 2ALVA 4Y6DA 3TPIZ 4X1PU 1HIAB 3TLOA 1C5NH 2F9PA 3UPEA 1SMFE 3AAVA 4JZFH 1CSOE 4NSVA 1GBDA 5AHGH 5DO4H 1C5RA 1GMDG 1EJAA 1GBCA 1EPTA 2FPZA 3BTDE 1SG8B 3MWIU 2A7HA 5FX6A 4OS4A 4TWYA 4KP0A 1GBLA 3RXCA 3GCTF 1QL8A 1MCTA 1FY4A 3ZZBA 3SNBA 1VJ9U 5C3NA 1H1BA 2ZU2A 2GP9B 2ZPRA 4IMQA 4OS7A 1VITF 4CREA 3OTJE 1TE0A 1RIWB 1TPOA 3SV8A 1DLKB 1GHZA 4MVNA 5L2YH 1JMOH 1L4ZA 4ASHA 4O3UA 2ZPSA 1SBWA 4JMYA 1GL1A 5C1YA 2ZGCA 1ZJKA 1S82A 3GY6A 4IGDA 1YPJH 1MTUA 2P93A 1MZAA 1QA0A 1V2KT 2PTNA 4ZKNU 4Q80A 1VZQH 1K21H 1V2QT 1O2KA 3E16B 4X2VA 1V6DA 4TY6A 1OWEA 2IJOB 5FHTA 3MNSA 4AB8A 2OCVB 1IQHA 1Q3XA 1VCWA 3EA7A 1GHBG 2FM2A 2V3OH 4R8TB 2JETB 3KEEA 1UK2A 1ELGA 3PTBA 5JBTA 3LU9B 2Q1JA 3B9FH 1HDTH 2Q6DA 3PTNA 3I78A 4NA9H 1B7XB 1C5WB 1ELCA 1P2JA 2QF0A 1IQIA 3ZZ5A 2VIDA 4CRAA 3OYPA 1BTYA 3JZ1B 1N8OC 3A7XA 1GHWH 2XRCA 3TH4H 1C1MA 4TPYA 4CH2B 1NC6A 2FOBA 1Y3YA 2ANMH 1QB1A 1C1QA 1O2MA 1G2LA 5FCKA 2Z9KA 1MUEB 5DP4A 2ZG0H 1TGSZ 2VVUA 2JETC 5LH8A 1W10U 4LOYH 4AG1A 5HM9A 1C5QA 1GI3A 4NIXA 2AMPA 5A09A 2CXVA 2QC2A 2GX4A 1H9IE 1GDUA 4F49A 1LVBA 2DE8A 1CA8B 1K2I1 2ANKH 1EX3A 4A92A 1F0UA 1NZQH 1KXFA 3W94A 5F6MA 2F9VA 1C4V2 1UMAH 1ELEE 3QTOH 1A61H 1AVXA 3RC5A 1HRTH 1VITH 2GDEH 1O31A 3GDUA 2ZP0H 1HAZB 1TMBH 1Q2WA 4OS5A 1UTQA 3PMAB 4HZHA 1SPJA 1NU7B 1SGNE 5C67A 5HYOA 1LKBA 4TYDA 1NRQH 2VVVA 1V2TT 1EAUA 3ZVDA 1AY6H 3SHCH 4H42U 3S7HB 1SGYE 2O9QA 2AS9A 2GMTB 2EC9H 3TK9A 1O2VA 3RXDA 3T25A 2EEKA 2O8UA 3V12A 2XCFA 3IITA 1ELAA 3RXVA 2EI7A 4AG2A 2I6QA 5GXPA 1ZTJA 1TRNA 3MFJA 1P0SH 1GVKB 4ISIH 4FUGA 2VIPA 4RSPA 1S84A 1CO7E 1G36A 1ABIH