1TNJA

Prediction of novel serine protease inhibitors
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords TRYPSIN
publication title Prediction of new serine proteinase inhibitors.
pubmed doi rcsb
source organism Bos taurus
total genus 53
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1994-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1tnjA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1tnjA02
3IG6B 1C2KA 3GCNA 1GJ4H 3CP7A 2AYWA 1U6QA 1NT1A 3GYMA 1S82A 1C1VH 3TH4H 3T29A 4NGAH 1CHOG 2BDYA 1ESBA 1ETTH 3AW1A 1IQEA 1T4UH 1O2RA 2GKVE 3ITIA 5FPYA 5H4IB 4ESTE 1GBTA 4ABBA 1DANH 1SGRE 3N7OA 1ZYOA 1A5GH 4ZUHA 1HJ8A 2QA9E 3SGQE 2FMJA 3VGCC 4CRBA 2P93A 1CT0E 3URCA 1AFEH 2O8LA 2ANWA 2VJ1A 3GCTF 4UE7H 1TGNA 3C1KA 3BTTE 1D9IA 2H2ZA 1NC6A 2UUYA 1C9PA 3SV6A 2R9PA 2WV4A 2OP9A 1C2DA 1O34A 2ZO3H 1GI1A 2Y5GA 1RD3B 1V2PT 5FX6A 4BAOB 4O3TA 1OWDA 1DVAH 3FAOA 1BJUA 1ZPBA 3RXHA 2SGEE 1AO5A 1Y3XA 1V2ST 3LOXA 5C5NA 3SUFA 3RP2A 1E37B 1YP9A 2AIPA 2WPKS 3SI4H 3VB6A 2HNTC 1P02A 1Y8TA 1YF4A 2Y5HA 1W11U 1FN6A 4B2BA 1XKAC 3E1XB 1JOUB 1GHBF 1A46H 4BAKB 2XRCA 2QN5T 1O32A 2HNTF 4MG3A 1P2QA 1T4VH 1YGCH 2M5TA 4H4FA 1LHCH 1FNIA 3TH3H 2QGRA 3TITA 1AZ8A 6GCHF 1MBQA 2JH5D 4GVUA 3VXEH 5FAHA 8GCHF 1BA8B 2GZ9A 3BTDE 3RXQA 4DCDA 1PPCE 1UK3A 2VGCC 3STIA 3VB3A 1PQAA 1KLTA 4B76A 1OP0A 1VJ9U 1L4ZA 1UK4A 2ZTYA 1WQSA 5GCHG 5E2OA 3RXVA 4Q2KA 1H1BA 1AE5A 1D6RA 3S9BA 2AIQA 4FUHA 3SU3A 2HALA 3ODFA 1UTLM 1W10U 4X0WU 3VEQB 2OD3B 2O8MA 1CSOE 1ELAA 1NU7B 1A4WH 1BMNH 1MZDA 4D7FA 3KL6A 3VXFH 1AFQC 4CHAC 1C1WH 3EAJA 1K1MA 3ATMA 4IC6A 2ZFTA 2G00A 1EATA 2RCEA 4PROA 6LPRA 3GY7A 3ESTA 4JZDH 1O5GH 3P8NA 1EX3A 4I8KA 5DPAA 2Z9LA 1DWDH 2GD4B 1FQ3A 3VB7A 2OBOA 2WUCA 2QF0A 2ZU5A 3TGJE 1MCVA 1NRQH 1SHYA 2QXIA 5HM2A 3KQEA 4WVPE 2PKAB 4AN7A 1TOMH 1BT7A 3LT3A 1QL7A 2RA3A 1VGCC 3PMHB 3ZZ3A 2XWAA 5DJ7A 4GUXA 1P2JA 2BQ6B 4DIHH 4GHQA 2FTLE 4X6OA 3RXFA 4ZAEA 1PPGE 1Y5BT 4FU9A 1FIZA 3K65B 2ZKSA 2J95A 1UCYH 1HAXB 1GL1A 1X7AC 1IQKA 3URDA 5A8ZA 1W8BH 4NZLA 3U98H 2QC2A 4R0IA 2FWWA 1VCPA 4BXWA 3UR9A 1A1RA 4UONA 1NFXA 4KGAA 4VGCB 3U8TH 4IS5A 3LDXH 3OY6U 4YOJA 4SGAE 1MKWH 1AN1E 3I78A 4INLA 1A2CH 1S6HA 2PW8H 2XCNA 2ZHEH 1ELDE 1CQQA 1LVYA 3GCTG 3F68H 4E7NA 1SFQB 1W3CA 1GVKB 4H6SB 4NCYA 2PKAA 1E35B 7KMEH 1ANEA 2BY5X 2ZDKA 5E2PA 3A8DA 1PJPA 4JYVH 1GI4A 1C2IA 1T8NA 4UEHH 3UNSA 3P8FA 5EU8A 4MPVA 2PSYA 3F6UH 1MUEB 1Z7KA 3SU6A 2R3UA 4DURA 1LHDH 1EP6A 1P12E 4FVDA 3NPSA 1GJAB 3GY4A 1MQ5A 3BIVH 2O8UA 3E91A 4K60A 4U30A 2GGVB 3QTOH 5A2MH 3M36A 1AUTC 1THSH 3GY8A 1O3EA 1W7XH 5F6MA 1AGJA 1G3DA 1O5FH 1GHBG 4JZ1A 3MNSA 1FDPA 2BZ6H 1K1NA 2FDAA 1VR1H 2VIPA 5GIBA 2FM2A 3V3MA 3FP8E 5CE1A 5JBBS 1F0TA 1TGTA 1V2VT 3LPRA 2QYIA 3SW2B 1P2IA 2OCVB 3SN8A 2WINI 3B9FH 1BRAA 1OP2A 4UFEH 1QB1A 1OWJA 2SGPE 3SJIA 2OC1A 4B2CA 4KP0A 1H9LB 2WPLS 1IQJA 2G55A 1DY9A 4MNYA 1GMCF 1G3EA 1XKBC 3ZYEA 1IHSH 1CGIE 2ZDMA 3OY5U 3RXJA 2DE9A 3K9XB 1EJNA 5J4SA 2A2QH 1C1TA 1HNEE 5K0HA 3LGUA 1A3BH 1BMAA 1V2UT 3SU4A 2H6MA 1C1UH 1ZTKA 3MO3A 2P3TB 3SJOA 3BG4C 5F03A 3BTQE 1KTTB 2PGQB 5JDUB 1J8AA 4X1RU 1GJDB 3A7VA 2NU2E 4B74A 1Y3UA 3NCLA 1HAZB 4B2AA 1HRTH 4WF8A 1Y59T 2BDCA 1IOEA 2SNVA 2H9HA 1N6YA 1W0ZU 4A1VA 1N6XA 1WU1A 2HLCA 3F1SB 4MPXA 3RXRA 1HJ9A 1YCPM 1P0SH 2BXTH 5AF9H 3F9GA 4AX9H 1O3MA 1BTWA 4YLUA 4CH8B 4K2YA 4FXGH 4MLFB 3E90B 1FPHH 1DICA 3MYWA 1P2NA 1AZZA 2BY9X 1P2KA 1F2SE 3DFLA 2F9UA 2BQ7B 2LPRA 2Y7XA 3U1IB 3BF6H 3BTHE 1AU8A 1ABIH 2BB4A 2R0LA 4ZKSU 1CBWC 2OQ5A 1TNKA 5A8YA 2VU8E 2A32A 3GY3A 4TYDA 5I25A 3HPTB 1LQDB 1KDQB 3Q3YA 3M35A 2ODQA 1GI2A 1JMOH 1OSSA 1XXFA 4K1SA 2FOHA 4FVBA 4Q80A 4YESB 5FBIA 3UREA 2WYJA 2VVVA 4Y0ZE 3LU9B 3A7XA 4B1TA 1K1IA 1O3JA 3PV4A 4AORA 5HXFA 5EXNA 1QRZA 3FP6E 1TWXB 2ZEBA 3DT0H 4YZUA 1O36A 2NU4E 5DP5A 5L30H 1DX5M 1GI5A 1KYNA 3SZNA 2FIRH 1LVBA 3BTKE 1L1NA 2ASUB 4NWKA 1NPMA 1EB2A 3M5NA 1FUJA 4BTUB 1HB0B 1EP5A 2H5CA 1RFNA 5GPIB 2K1QA 1NFUA 2Z3CA 5EQRA 5TJXA 2R2WU 1W7GH 3H7TA 4I8GA 4DY7B 1RTKA 1BBRH 4BAQB 3OYPA 3V7TA 3MMGA 5T3HA 3ZV9A 1HBTH 5LGOA 1VCQA 3RC6A 4IMQA 1YBWA 1YPMH 1O38A 1O5CB 3EYDA 3NUMA 3QLPH 1XVOA 3M7QA 1F5KU 4ISLA 1D4PB 2TPIZ 1FPCH 5CMXH 3OTJE 1MTWA 3A85A 5DK1A 1MQ6A 1B5GH 2ZU2A 1IQGA 1SHHB 5A8XA 1MTVA 1ELFA 5FCRA 1AWFH 1SOZA 2FLRH 2FLBH 1SMFE 4TY7A 2BZAA 1KXEA 2J34A 1QL8A 3Q00A 3K6YA 4FUIA 4AYYB 4I8HA 2FI3E 4Y8XA 1T8MA 3S0NA 1ESTA 5C67A 3OSYA 3T5FH 2CGAA 3MH7A 6CHAB 3D23A 4GHTA 1TONA 5E0HA 2Z9KA 2FZZA 3FANA 1VITF 3PWCA 2PWXA 1O35A 9ESTA 1GI7B 2GP9B 3BG8A 3BEIB 1GCDA 2ZDVH 2W3IA 3M3VA 1XXDA 3SU0A 1NU9A 3SUDA 5C2ZA 2GVFA 4K1EA 1BIOA 2BLVA 4CRAA 1J14A 4VGCC 1O2SA 3A8CA 2SGAA 5TCAA 3ZZ6A 4F49A 1SLWB 4ZROA 2Q6FA 4WY3A 5FXLA 1V2OT 1AUJA 4K3JA 3MNBA 3FFGA 4A7IB 3A7WA 5EQQA 5LPEA 2Z9JA 9LPRA 2TGAA 1BRCE 1Z8GA 2NU1E 4I8JA 4IBLH 3GDVA 1SGEE 3TJNA 1TALA 3GOVB 3I29A 1C2HA 2XTTB 1P57B 3UOUA 1C4V2 2A4GA 1SPJA 3ZYDA 1HFDA 1RXPA 2SNWA 4X8TH 2ZFRH 3RU4E 3SNAA 1DWEH 2F83A 3MWIU 7GCHF 2OLGA 1MTNB 3LH1A 1SC8U 2H9EH 3AW0A 3KN2A 2ZG0H 1D3TB 3SNCA 1DE7H 1EJMA 4ABGA 1SQOA 1AIXH 1DT2A 4NA9H 1SLUB 2H5DA 4HFPB 5E0JA 1DS2E 2VIDA 5EXLA 4AFQA 2PTCE 2A7JA 3UWIA 1EQ9A 1T32A 2C8ZB 2NU3E 1E38B 1GDQA 1BQYA 3RM2H 1B0FA 3OX7U 3TJVA 1TBZH 4O03A 1PYTC 3PO1C 1P09A 1FJSA 2G51A 1WYKA 1SGCA 2A4RA 1QQ4A 2R2MB 1TIOA 1TNGA 5LPFA 1ELCA 1S0QA 1T7CA 4A5TS 5JPMH 4NFFA 3EE0B 1H8IH 1EAIA 2GX4A 1A5HA 3BSQA 3KGPA 5ESTE 1O2TA 1QHRB 2BDBA 2B7DH 2BDAA 4B73A 1D3QB 1BTXA 1GBAA 1QBNA 1O5AB 1NRRH 3FZDA 5K7RA 1C5YB 1S5SA 2JH0D 1MCTA 2VH0A 3F9FA 1KY9A 2VVCA 1IAUA 2ZFSA 4GLYA 4MDSA 3RM0H 3AVZA 4NSYA 1V2WT 5JYIA 4A1TA 3ATIA 2ZGBH 1C5LH 1O37A 4TPIZ 2QCYA 1O3FA 2P3FH 2ZHDA 4ABEA 5FPSA 3U69H 1CA0C 5EGMA 3QK1A 4BANB 8ESTE 1JBUH 4K8BA 3RU4T 4OS7A 1K1PA 2SGFE 4ISIH 1DOJA 1UHBA 4THNH 1O5DH 1CGJE 1WOFA 1YPHC 1WV7H 2BTCE 4NIWA 1V3XA 1XUHA 1KIGH 3NZIA 2C8XB 5T6DA 5C3NA 1ZPZA 4KTCA 1P3CA 5JB9S 1K9OE 4NSVA 4B71A 4ZHAA 1O2HA 2P16A 4JYUH 1WTGH 4X1PU 3ZZAA 2A45B 3MU8A 1GVLA 2NU0E 1QFKH 2OUAA 1H8DH 2B0FA 1Z8RA 1JIMA 1G9IE 3O8RA 1KTSB 1SGFA 4WXIA 1VITG 3T25A 1JWTA 5B6OA 1ANCA 1PPBH 3S9AA 2VWLA 1GJ5H 2ZFQH 3RXSA 2D2DA 1WSSH 1GI8B 1DLKB 4DIIH 1ZOMA 3HGPA 2VH6A 1NY22 2VIQA 2YNAA 4HTCH 1SG8B 2VINA 1O2PA 3RMLH 1HIAB 1LKAA 2SGDE 1MU6B 1SR5C 1A0HB 1ZHPA 1MBMA 3CS0A 2LNCA 1BTYA 1TA2A 1S6FA 2Z94A 4GSOA 4IN1A 1WQVH 3ZV8A 2BXUH 1QQUA 1C5SA 1FN8A 2F9NA 2Q6GA 2AH4X 1BTZA 3ATLA 2GCTC 1EZXC 2XW9A 2ESTE 1C2FA 1O2NA 1GBHA 4ABDA 3FZZA 3TNTA 1HAHH 1NZQH 2FTMA 3V12A 4FUFA 3ZZ7A 7GCHG 4ABHA 3M7UA 1EOJA 3RMOH 1G2LA 1Z1IA 1MTSA 2GDEH 3ZZDA 2AMDA 3JZ1B 1QJ1B 1O2OA 2F3CE 3ZZ8A 3PROA 2VIWA 5E0GA 1DUAA 3GICB 2OC0A 3LGVA 1GG6C 1EPTB 1DY8A 2C3SA 3MI4A 1C5UA 2GMTB 1PPEE 2EI8A 2WUBA 5EPYA 1C2JA 2ZQ1A 1C5RA 3TIUA 4ZXYH 3UNRA 1O5BB 4DJZB 3LC5A 3TK6A 1UVPA 3PWBA 3SQEE 2HNTE 1O3BA 1GHZA 1ZSLA 2A5IA 2W7SA 3ZZCA 5L2YH 1PPFE 1SGIB 1SGPE 2TBSA 3ZVAA 2QIQA 1TBRH 3MU4A 2VWMA 1XUJA 1JXPA 4RKJB 2ZGHA 1O3KA 1P04A 2FYRA 1C5MD 1RIWC 1O2LA 3RXCA 3RXMA 5EW2H 3RLWH 4OS4A 3B8JA 4INKA 4JYTA 2AMPA 1C4Y2 1DDJA 1Y5UT 2GV6A 3D49H 3E0NB 1BTHH 4IMZA 3E6PH 1CVWH 3SQHE 3TPIZ 1O2JA 2FOBA 5JB8S 1AD8H 1HAVB 1AKSB 1O2GH 1WAYB 5C5OA 4DG4A 1UTOA 2W5EA 1W2KH 3BN9A 5AFZH 4AB9A 4TWYA 1OPHB 1V6DA 3ZVFA 1IHTH 1BHXF 2Z3DA 4ZMAH 1P10A 1O2MA 3PMJA 4DOQA 3PLKA 1TNLA 4U2WA 2BDHA 2WPIS 1S81A 4D9QA 1ZJDA 2H9TH 3HK3B 1TFXA 2ILNA 4BNRA 1CU1A 1ZMJA 2ZDLA 4DW2U 1ZRBA 1HJAB 1GCTB 2BY8X 4HI3A 4XSKU 2EC9H 4FUDA 1MAYA 4Y7BA 3S7KB 2BOKA 5DP9A 3A8BA 1Z6EA 1DXPA 5EXMA 1E34B 1ELEE 1LMWB 2OINA 2G5NA 1DFPA 1RGQA 1C1MA 4MVNA 4AGKA 1AVXA 3K2UA 5SGAE 1PYTD 2PKSB 3VPKA 1ZTLA 1O0DH 3P8GA 2AERH 1UJ1A 1QIXB 1ETSH 2GTBA 1AKSA 1YCPH 5PTPA 2G81E 3PLBA 3TK9A 2QF3A 4YOGA 3ELAH 2XBWA 1K21H 2FODA 2ZC9H 1HAGE 1V2KT 6GCHG 2GZ7A 3UNQA 1V2MT 1TYNA 1EASA 3RXDA 8GCHG 1O3NA 5CHAB 5E8EH 2V3OH 1W12U 1TRNA 5F8TA 3GCHB 2W26A 5ESBA 1DXWA 3SHCH 5F8XA 1KXBA 4WWYA 1TPSA 4JK6A 3ZVGA 4AG1A 2V3HH 2BX3A 2ZGCA 3KNXA 2CHAB 1A0LA 1Z6JH 3MTYA 2XXLA 1F0UA 1ZRKA 4O3UA 1THRH 3MFJA 2ZCLP 1ETRH 1FAXA 1C5TA 3RUOA 1MZAA 2V35A 2VIVA 4YM9A 3LGIA 4INHA 2WPJS 1CA8B 1JIRA 4JZFH 4UFFH 1ZPCA 4CRDA 3A7TA 5TCCA 1PQ5A 1V2QT 2PFEA 1HAOH 1YM0A 3RXTA 3SNBA 1NROH 1UTKA 1EAWA 1LHFH 2XC4A 1QGFA 1TNHA 1TGSZ 2Z6BD 1UTQA 2O8WA 1ZMLA 2J9NA 4XBBA 3JZ2B 2RG3A 2Y81A 2VWOA 4AB8A 3PYHA 3LGTA 3BEUA 3BTFE 1O3HA 1GWAA 2ZHQH 1RJXB 4X1NU 1DUEA 3SI3H 3Q76A 3PMBB 5EW1H 3CS7A 2XNIA 4X6MA 3G01A 4Q7XA 3BTME 1O30A 2A0QB 4Y7AA 4WMDA 3VGCB 2OBQA 4Z0KA 1J16A 3DD2H 2A5KA 1WCZA 1XX9A 1Z8IB 1OOKB 2PHBA 1SGYE 3S69A 1O3LA 4AFZA 3PMAB 1PQ8A 4RN6A 2HPQH 3GY6A 4X1QU 5L6NH 1IQFA 1BRUP 1EZUC 4FUEA 4WH6A 4DGJA 3SHAH 3M5OA 1CHGA 1SLVB 1NFWA 2AS9A 2PSXA 3MU0A 2HPPH 3R0FA 1FIWA 3UTUH 1WUNH 3UUZA 1GJCB 2BOHB 1AI8H 1BTUA 1RTLA 1CGHA 3EGKH 1C5PA 1KLIH 2VB0A 3ZVDA 2QXHA 1K28D 1EAXA 5DP4A 2ZHWH 3SV8A 5DP7A 1UCYK 4NFEA 5I46H 2ODYB 1W13U 4CBNA 1GHXH 2THFB 1FY4A 2ZFFH 1C5QA 4HZHA 2A31A 2EI6A 1IQMA 3PB1E 1QR3E 1LKBA 4Y11E 3SGBE 5A09A 1K1JA 2VGCB 3ZVBA 1KDQA 1OWKA 3PLPA 1MKWK 1N1LA 1AMHA 1TPOA 3TGKE 2G4UA 3ZZ4A 4GCHF 1QB6A 3KCGH 1BMMH 4CH2B 4XE4A 2PGBB 1ZMNA 3ZZBA 1VITH 1AB9B 1CHOF 1GL0E 2PTNA 3PTBA 4R8TB 4UFDH 4YOIA 1XM1A 1ELGA 3QUMP 3RXLA 4RSPA 4ABFA 1EJAA 1GMCG 4I32A 2ZHFH 2WPHS 1TNIA 3A87A 1QBOA 1MD7A 5EODA 1IQIA 3KQDA 2FP7B 3UFAA 2ANMH 3GY2A 4X2YA 4XOJA 4A1XA 4ABIA 1SGFG 2FPZA 1FY5A 4NZQA 1DWCH 2XWBI 3P92A 1GMHF 2KAIB 2H1UA 1KXAA 1AVWA 1NRPH 3EA8A 1EKBB 4Q7ZA 3TVJB 1Z71A 2XBXA 3LC3A 2UWPA 4IW4E 4NWLA 2PLXA 1VGCB 4I31A 1NFYA 1O3GA 2J2UA 4FUGA 2OXSA 3FP7E 1GBLA 4CR5A 1TLDA 1Y3YA 3W94A 4OGYA 1LQEA 1ACBE 1K22H 1HUTH 1FY8E 1P11E 2BD8A 3K6ZA 3RXUA 1HJAC 3SV7A 1F7ZA 1BMLA 3DFJA 4Y8ZA 3UIRA 3BIUH 1SQTA 3UR6A 1GHAF 2A2XH 2D8WA 4NIXA 3EDXB 1QCPA 4AGJA 3KQBA 3A81A 5FHTA 5IDKA 1ORFA 3M5LA 2PV9B 3T26A 2XCFA 2BD7A 2F9BH 1BTPA 4CRCA 2BVXH 2PKSC 1LHEH 2FX4A 3F9EA 3MHWU 4Y8YA 1HAYB 3RC5A 2A7CA 4IGDA 1PFXC 1C5ZB 4RKOB 2FOCA 2PUQH 4MNVA 2A5AA 4WJG2 1KLJH 1O2YA 3MNXA 1QL9A 4BTTB 5A0AE 1LO6A 2CN0H 3SV2H 3QO6A 2B9LA 3PTNA 1YKTA 2XC0A 1PPZA 1UK2A 1C5XB 2BHGA 2C93B 4CREA 1YPEH 1GMDF 2B8OH 1LCYA 2FO9A 1V2RT 4OS2A 1DITH 2ZTZA 1EB1H 2UUKB 4O9VA 3BV9B 1A61H 3RXPA 2OQUA 2J92A 1AHTH 4TY6A 1IQNA 1LHGH 1Y3WA 3P17H 2G8TA 3M3TA 5T6FA 3GCHC 1GGDB 1ID5H 1MD8A 1SSXA 3OU0A 1BITA 4MPUA 1O2IA 1ANDA 1GBEA 1A0JA 2Z9GA 5A0BA 1NO9H 2J4IA 1OYTH 3DUXH 1OXGA 4YLQH 1UVTH 1ZJKA 1TAWA 3A8AA 2YNBA 1XUIA 3SV9A 2BQWB 4LOYH 3A80A 3ZZ9A 4YT7H 3D65E 1LPKB 4JZEH 1GJBB 1ZHRA 1P06A 3S9CA 1P01A 2P94A 3SO3A 1D6WA 1NS3A 1C1OA 1UTPA 4ZKOU 3MU5A 1KXCA 1O2WA 1GHYH 2FEQH 1P9SA 2R3YA 3DHKH 2JETB 1P2OA 3KF2A 3UY9A 1UMAH 5HYOA 1YPLH 3T27A 2BVRH 4OS1A 1MKXH 4UDWH 3MH5A 1C1RA 1VCWA 4GCHG 1TE0A 4WXVA 4ISHH 4Z6AH 1YC0A 4ZHLU 1V2NT 2OC8A 3H5CB 1P8VC 3UOPA 3MO9A 1GJ8B 1HAIH 3GISB 2BX4A 2I6QA 1L4DA 2FS8A 2HVXA 3R3GB 1MAXA 4X6PA 3M7TA 3HKIB 2ZP0H 1C5NH 4M7GA 1C9TA 2I6SA 2BD2A 2A7HA 2QXJA 1T8OA 3SGAE 1YYY1 1QRXA 3BG4B 4IC5A 1GI3A 5C1XA 3MH6A 1G30B 4SGBE 3V0XA 2ZZUH 2V6NA 3P8OA 1H9HE 1O2VA 2Q1JA 1BBRK 1FY3A 3C27B 1YLDA 3DA9B 1TX8A 4YO9A 2FI5E 1GMHG 2GDDA 3KHVA 4CR9A 2Y80A 1TX7A 1SI5H 3L6PA 1C5VA 3A7YA 2VIOA 4TWWA 2P8OB 1O3OA 2ZIQH 2STBE 3KQCA 1HXFH 4AZ2B 4JCNA 5FPTA 3TJOA 1H9IE 2Z7FE 4I8LA 5ABWA 1BZXE 2ANYA 3QGJA 1OWIA 1K1LA 4Y79A 1GVZA 1GBBA 4AOQA 1W14U 2Z9IA 2ZPSA 2BLQA 2IPHA 1FMGA 1OYQA 2FESH 1CT2E 3CENA 1N8OB 2ZCHP 1KXDA 3WY8A 1GHAG 3QWCH 4LZ4B 2GT8A 1HYLA 1PPHE 2IN2A 2ZA5A 1CBWB 4XDEA 4AFUA 1JRSA 1TRYA 1GJ6A 2QAAA 1SVPA 2PUXB 1ZZZA 3SU2A 1AQ7A 1F5RA 1O31A 1THPB 2ZCKP 3BTEE 1G3CA 1GDNA 1YPHE 3ODDA 1RS0A 3S7HB 1GHVH 2G5VA 2SGQE 4A92A 3M61U 4UFGH 1GI0A 1GBDA 3GDSA 3QN7A 2P95A 1DSTA 1L0ZA 3LKWA 3KEEA 2JH6D 3RXAA 3M3SA 4YT6H 2R0KA 2VWNA 4E05H 3RXEA 1D3DB 1E0FD 1ZSKA 2ZU3A 2FX6A 1L2EA 4X2XA 3TK5A 1QB9A 1HIAA 1O3CA 2BD3A 3A7ZA 4HGCA 5AHGH 4QT8C 1GMDG 4J1YA 4KTUA 3SBKA 1SL3A 1ZHMA 2UUJB 3F9HA 1JRTA 4WMEA 2ODPA 1AB9C 2IOTA 3SNEA 3QZRA 3T2NA 2EA3A 2OC7A 4WMFA 4ISNA 4AG2A 4FU8A 1OKXA 3P70B 1O2QA 3PM3A 1SB1H 1SGQE 2HRVA 3RU4D 4D8NA 2J94A 2F9OA 3GCOA 4FUJA 1O2KA 2W3KA 4FU7A 1BRBE 1Z8JB 2C8WB 3EA9A 4OGXA 5T6GA 1FXYA 4KTSA 1ELTA 3W95A 6CHAC 4I33A 2CXVA 3IWMA 1AE8H 2BM2A 4FUBA 3TJUA 2TGTA 3BEFB 1O3DA 5J4QA 1FI8A 1A3EH 1QURH 1HAPH 5G4BA 1EZSC 1CE5A 3TU7H 4D7GA 3RDZA 4WH8A 1OS8A 2VVUA 2AGGX 4JMYA 3A84A 3MNCA 4GPGA 2ZFPH 4OS6A 4ZH8A 1TABE 3UQOA 1SGTA 5JBTA 5LH8A 2ZGXH 1EPTA 4Y0YE 5DG6A 1SLXB 2W7UA 1QNJA 1GI6A 1C5OH 4ASHA 1ZTJA 2GCHF 4DT7B 4K1TA 1ESAA 3GY5A 4NG9H 1SBWA 4Y6DA 2FOFA 3O8CA 5FX5A 1LDTT 1NTPA 1NRNH 1G36A 2ZPRA 4DVAU 1OX1A 3AAVA 1HPGA 3L33A 2O8TA 4F4OC 1O2ZA 1J9CH 4NA7A 2BD9A 2BY6X 3H7OA 1H4WA 1WBGB 2GV7A 1DWBH 2Y6TA 5BRRE 1MTNC 1GI9B 5DGJA 1J15A 1ZGVA 3ZVCA 4CRGA 3EQ0H 4A6LA 3NXPA 3HKJB 2ZTXA 1YPKH 2DE8A 1YLCA 2EEKA 3E16B 5HGGA 3RMNH 5C20A 1ZR0A 1LPZB 1UVUH 1ZSJA 2C8YB 4X8SH 5FBEA 1G3BA 2QV1A 2G52A 2WYGA 2Y82A 3RXBA 2BMGB 3HATH 3NK8A 1INCA 1V2TT 1TPPA 1LPGB 3QDZB 2ZECA 1MKXK 3RXOA 3Q3XA 1P9UA 1SQAA 4U32A 4ABAA 1HAVA 2B5TB 3LGWA 3U1JB 1F0RA 2BVSH 5L2ZH 1L1JA 3AASA 2XYAA 3UPEA 3E0PB 1GGDC 1M9UA 4Y10E 2EI7A 1G37A 3A89A 2TRMA 1B0EA 2AFQB 4X2WA 2Q6DA 2HGTH 3T62A 1AWHB 3TNSA 1DLEA 3B23B 4TPYA 5EOKA 3UQVA 1TX6A 1TGCA 1FAKH 1T8LA 1EUFA 2BD4A 1FZZA 1KSNA 4Y71A 4UD9H 1XMNB 4MNWA 4NA8A 3VFEA 3U8OH 1S0RA 1TMUH 1C2MA 2D26C 3ZVEA 3PO1B 1OWHA 1J17T 2XBYA 2HOBA 3D62A 1VJAU 3SNDA 2PR3A 2ZU1A 1NN6A 4X8VH 4CRFA 2JETC 1C1QA 1P2MA 3VB4A 5DO4H 1UCYE 3L3TA 2GZ8A 2D1JA 1YPJH 4MTBA 2XBVA 3EA7A 1ARCA 4AFSA 4BTIB 1GBFA 1Q2WA 3P95A 1ABJH 6ESTA 2F9VA 2AMQA 1SGDE 4X2VA 4XFQA 4K69A 1TQ0B 2ULLA 3RXKA 3P6ZB 4K5ZA 3E8LA 3KIDU 1KXFA 1NESE 5BPEA 1C4U2 2A4OA 2V0BA 3STJA 3O8DA 1HV7A 3LJJA 4BAMB 2GT7A 1TBQH 3ATKA 5JBCS 3HGNA 1CA0B 3SUEA 2BY7X 3QX5H 1W0YH 2BLWA 5GDSH 2RA0A 2J38A 4Q7YA 1TA6A 3LIWA 4XBCA 4ZKRU 1UO6A 4ISOA 1XUKA 1DSUA 2P8OC 2BLOA 2ZI2H 2G4TA 4X6NA 2ZNKH 4OS5A 1UTJA 1TPAE 1V2JT 2AGEX 2STAE 4E06H 2GCHG 1A5IA 1HLTH 4MQAA 1O2UA 4YTAA 1CO7E 1NRSH 1T31A 1P03A 1K1OA 2DUCA 2ALPA 3M5MA 1QJ6B 1TRMA 4X1SU 2WV5A 3A86A 3TH2H 1GJ9B 1GPZA 1N8OC 3BTWE 1BCUH 1LVMA 1TMTH 2P3UB 2ZPQA 1CT4E 5AVDA 4ZHMU 1ELBA 3SJKA 1TMBH 1EZQA 3MU1A 3MOCA 1XVMA 1FV9A 3QTVH 3Q3KA 2F91A 1HDTH 2ANKH 1QA7A 1SGNE 2BYAX 1DPOA 2RDLA 5DP3A 1EAUA 2JKHA 2AEIH 5GWZA 1S85A 3RXIA 4BAHB 5EPNA 3SUGA 1EPTC 3NKKA 5IYTA 3I77A 5DP8A 1EOLA 2TIOA 3RC4A 1Y5AT 5EQSA 2GMTC 1L1GA 1TB6H 1RRKA 2GCTB 4NIYA 3A82A 3MH4A 1C1PA 4BXSA 3SJ9A 3AAUA 3E3TA 1AY6H 1GBCA 4U01A 4B75A 5LPRA 1XUFA 4MPWA 5A0CA 4XBDA 4KKDA 2QY0B 2CV3A 1O3AA 2UWOA 1O2XA 1MU8B 2UUFB 3QZQA 2O9QA 3TGIE 3Q77A 2ZF0H 1O33A 1BOQA 1HCGA 2P59A 5DKMA 1QBVH 3QGNB 1C2EA 8LPRA 4MNXA 2C90B 2WPMS 1DM4B 1E36B 5FCKA 1A7SA 4LXBH 4E7RG 8KME2 1C5WB 1HGTH 1GHWH 1TNJA 3BTGE 1GG6B 2ZGJA 1RTFB 3LH3A 2CF8H 2XC5A 4O97A 2FI4E 2CJIA 1AFQB 2FS9A 4ZKNU 4CHAB 2A4QA 4ABJA 2Z3EA 1IQHA 5JBAS 1PQ7A 1G2MA 1C2GA 1LVOA 4AYVB 3SJ8A 4FUCA 1ZGIA 3UWJH 1O39A 1MMJN 1YCPK 3TLOA 1GDUA 1O3IA 3GDUA 1FLEE 1S83A 3SU1A 1QJ7B 4CBOA 2VNTA 2QXGA 4LZ1H 3RLYH 3A83A 4IN2A 1BDAA 1D3PB 1S84A 4D9RA 1RIWB 3FVFB 5DP6A 2Y5FA 1F0SA 1TQ7B 2YOLA 1OP8A 1F92A 2AGIX 3IITA 7LPRA 4K8YA 1GCTC 1Z1JA 3HK6B 2UWLA 1O5EH 1BUIA 1GBIA 1ELVA 1BHXB 3ATWA 4H42U 1YPGH 1WTHD 3O8BA 1C1NA 1GJ7B 1XUGA 1MTUA 5GXPA 1QY6A 1UTMA 5AFYH 1V2LT 2KAIA 3ENSB 5HM9A 3GYLB 5C1YA 5HMAA 3ZZ5A 1BBRE 4D76A 1SOTA 4JK5A 3LONA 2FOEA 5GCHF 1C1SA 4X8UH 2C4FH 2BDIA 1GBJA 1QTFA 1GBMA 4I7YH 1F5LA 2F9PA 3NWUA 2TGDA 3M37A 2FOAA 1P3EA 2ZU4A 1UVOA 5CHAC 3RMMH 3U8RH 1GBKA 3T28A 2BDGA 1BB0B 4LK4A 4Y76A 2OTVA 1B7XB 2A1DB 3VB5A 1ZLRA 1LTOA 1SFIA 5EG4A 2ZDAH 4BOHA 4NIVA 2CHAC 3RXGA 2ZQ2A 3SORA 1VZQH 2CMYA 1C2LA 1TGBA 2HWLB 1OWEA 7ESTE 2FXRA 1G32B 5GJ4B 1ARBA 1Y3VA 2FOMB 2TGPZ 1EXFA 2CF9H 1UHBB 2Y7ZA 4JZIA 1AVGH 3MO6A 1UVSH 2SFAA 4GAWA 4H6TA 1Q3XA 3SOSA 2ZDNA 1FY1A 1Q31A 4ZXXH 3LJOA 4J2YB 1QA0A 5ETXA 2ZWLH 5F8ZA 3U9AH 2ALVA 1K2I1 1FONA 1P05A 1NM6A 1IQLA 2FYQA 1BJVA 3V13A 2BD5A 3SU5A 2IJOB 1TOCB 5C1UA 1UTNA 1QRWA 1ANBA 3LGYA 2FOGA 3A88A 1MH0A 4KELA 1HXEH 1O3PB 2NWNA
chains in the Genus database with same CATH superfamily
3IG6B 1C2KA 3GCNA 1GJ4H 3CP7A 2AYWA 1U6QA 1NT1A 3GYMA 1S82A 1C1VH 3TH4H 3T29A 4NGAH 1CHOG 2BDYA 1ESBA 1ETTH 3AW1A 1IQEA 1T4UH 1O2RA 2GKVE 3ITIA 5FPYA 5H4IB 4ESTE 1GBTA 4ABBA 1DANH 3FN8A 1SGRE 3N7OA 1ZYOA 1A5GH 4ZUHA 1HJ8A 2QA9E 3SGQE 2FMJA 3VGCC 4CRBA 2P93A 1CT0E 3URCA 1AFEH 2O8LA 2ANWA 2VJ1A 3GCTF 4UE7H 1TGNA 3C1KA 3BTTE 1D9IA 2H2ZA 1NC6A 2UUYA 1C9PA 3SV6A 2R9PA 2WV4A 2OP9A 1C2DA 1O34A 2ZO3H 1GI1A 2Y5GA 1RD3B 1V2PT 5FX6A 4BAOB 4O3TA 1OWDA 1DVAH 3FAOA 1BJUA 1ZPBA 3RXHA 2SGEE 1AO5A 1Y3XA 1V2ST 3LOXA 5C5NA 3SUFA 3RP2A 5IK2D 1E37B 1YP9A 2AIPA 2WPKS 3SI4H 3VB6A 1QZ8A 2HNTC 1P02A 1Y8TA 1YF4A 2Y5HA 1W11U 1FN6A 4B2BA 1XKAC 3E1XB 1JOUB 1GHBF 1A46H 4BAKB 2XRCA 2QN5T 1O32A 1VKYA 2HNTF 4MG3A 1P2QA 1T4VH 1YGCH 2M5TA 4H4FA 1LHCH 2WV9A 1FNIA 3TH3H 2QGRA 3TITA 1AZ8A 6GCHF 1MBQA 2JH5D 4GVUA 3VXEH 5FAHA 8GCHF 1BA8B 2GZ9A 3BTDE 3RXQA 4DCDA 1PPCE 1UK3A 2VGCC 3STIA 3VB3A 1PQAA 1KLTA 4B76A 1OP0A 1VJ9U 1L4ZA 1UK4A 2ZTYA 1WQSA 5GCHG 5E2OA 3RXVA 4Q2KA 1H1BA 1AE5A 1D6RA 3S9BA 2AIQA 4FUHA 3SU3A 2HALA 3ODFA 1UTLM 3DCLA 1W10U 4X0WU 3VEQB 2OD3B 2O8MA 1CSOE 1ELAA 1NU7B 1A4WH 1BMNH 2HVYB 1MZDA 4D7FA 3KL6A 3VXFH 1AFQC 4CHAC 1C1WH 3EAJA 1K1MA 4ASUD 3ATMA 4IC6A 2ZFTA 1H8HD 2G00A 1EATA 2RCEA 4PROA 6LPRA 3GY7A 3ESTA 4JZDH 1O5GH 3P8NA 1EX3A 4I8KA 5DPAA 2Z9LA 1DWDH 2L6OA 2GD4B 1FQ3A 3VB7A 2OBOA 2WUCA 2QF0A 2ZU5A 3TGJE 1MCVA 1NRQH 1SHYA 2QXIA 5HM2A 3KQEA 4WVPE 2PKAB 4ACBA 1TOMH 4AN7A 1BT7A 3OFND 3LT3A 1QL7A 2RA3A 1VGCC 3PMHB 3KYGA 3ZZ3A 2XWAA 5DJ7A 4GUXA 1P2JA 2BQ6B 4DIHH 4GHQA 1FX0B 2FTLE 4X6OA 3RXFA 4ZAEA 1PPGE 1Y5BT 4FU9A 1FIZA 3K65B 2ZKSA 2J95A 2CK3D 1UCYH 1HAXB 1GL1A 1X7AC 1IQKA 3URDA 5A8ZA 1W8BH 4NZLA 3U98H 2QC2A 4R0IA 2FWWA 1VCPA 4BXWA 3UR9A 1A1RA 4UONA 1NFXA 4KGAA 4VGCB 3U8TH 4IS5A 3LDXH 3OY6U 4YOJA 4SGAE 1MKWH 1AN1E 3I78A 4INLA 1A2CH 1S6HA 2PW8H 2XCNA 2ZHEH 1ELDE 1CQQA 1LVYA 3GCTG 3F68H 4E7NA 1SFQB 1W3CA 1GVKB 4H6SB 4NCYA 2PKAA 1E35B 7KMEH 1ANEA 2BY5X 2ZDKA 5E2PA 3A8DA 1PJPA 4JYVH 4TSFD 1GI4A 1C2IA 1E1QD 1T8NA 4UEHH 3UNSA 3P8FA 5EU8A 4MPVA 2PSYA 3F6UH 1MUEB 1Z7KA 3SU6A 2R3UA 4DURA 1LHDH 1EP6A 1P12E 4FVDA 3NPSA 4M9FA 1GJAB 3GY4A 1MQ5A 5KGOA 4ACAA 3BIVH 2O8UA 3E91A 4K60A 4U30A 2GGVB 3QTOH 5A2MH 3M36A 1AUTC 1THSH 3GY8A 1O3EA 2K0QA 1W7XH 5F6MA 1AGJA 1G3DA 1O5FH 1GHBG 4JZ1A 3MNSA 1FDPA 2BZ6H 1K1NA 2FDAA 1VR1H 2VIPA 5GIBA 2FM2A 3V3MA 3FP8E 5CE1A 5JBBS 1F0TA 1TGTA 1V2VT 3LPRA 2QYIA 1W0JD 2GJGA 3SW2B 1P2IA 2OCVB 3SN8A 2WINI 3B9FH 1BRAA 1OP2A 4UFEH 1QB1A 1OWJA 2SGPE 3SJIA 2OC1A 4B2CA 4KP0A 1H9LB 2WPLS 1IQJA 2G55A 1DY9A 4MNYA 1GMCF 1G3EA 1XKBC 3ZYEA 1IHSH 1CGIE 2ZDMA 3OY5U 3RXJA 2DE9A 3K9XB 1EJNA 5J4SA 2A2QH 1C1TA 3N99A 1HNEE 5K0HA 3LGUA 1A3BH 1BMAA 1V2UT 2QF4A 3OEED 3SU4A 2H6MA 1C1UH 1ZTKA 3MO3A 2P3TB 3SJOA 3BG4C 5F03A 3BTQE 1KTTB 2PGQB 5JDUB 1J8AA 4X1RU 1GJDB 1E1RD 3A7VA 2NU2E 4B74A 1COWD 1Y3UA 3NCLA 1HAZB 4B2AA 1HRTH 4WF8A 1Y59T 2BDCA 1IOEA 2SNVA 2H9HA 1N6YA 1W0ZU 4A1VA 2HLDD 1N6XA 1WU1A 2HLCA 3F1SB 4MPXA 3RXRA 1HJ9A 1YCPM 1P0SH 2BXTH 5AF9H 3F9GA 4AX9H 1O3MA 1BTWA 4YLUA 4CH8B 2YMSB 4K2YA 4FXGH 4MLFB 3WWFA 3E90B 1FPHH 1DICA 3MYWA 1P2NA 1AZZA 2BY9X 1P2KA 1F2SE 3DFLA 2F9UA 2BQ7B 2LPRA 2Y7XA 3N7EA 3U1IB 3BF6H 3BTHE 1AU8A 1ABIH 2BB4A 2R0LA 4ZKSU 1CBWC 2OQ5A 5HIZA 1E79D 1TNKA 5A8YA 2VU8E 2A32A 3GY3A 4TYDA 5I25A 3UB0A 3HPTB 1LQDB 1KDQB 3Q3YA 3M35A 3VG8A 1GI2A 1JMOH 1OSSA 2ODQA 1XXFA 4K1SA 2FOHA 4FVBA 4Q80A 4YESB 5FBIA 3UREA 2WYJA 2VVVA 4Y0ZE 3LU9B 4Z1MD 3A7XA 4B1TA 1K1IA 1O3JA 3PV4A 4AORA 5HXFA 5EXNA 1QRZA 3FP6E 1TWXB 2ZEBA 3DT0H 4YZUA 1O36A 2NU4E 5DP5A 5L30H 1DX5M 1GI5A 1KYNA 3N7DA 3SZNA 2FIRH 1LVBA 3BTKE 1L1NA 2JJ2D 2ASUB 4NWKA 1NPMA 1EB2A 3M5NA 1FUJA 4BTUB 1HB0B 1EP5A 2H5CA 1RFNA 5GPIB 2K1QA 1NFUA 2Z3CA 5EQRA 5TJXA 2R2WU 1W7GH 3H7TA 4I8GA 4DY7B 1RTKA 2M2AA 1BBRH 4BAQB 3OYPA 3V7TA 3MMGA 5T3HA 3ZV9A 1HBTH 5LGOA 1VCQA 3PRBA 3RC6A 4IMQA 1YBWA 1YPMH 1O38A 1O5CB 3EE7A 3EYDA 3NUMA 3QLPH 1XVOA 3M7QA 1F5KU 4ISLA 1D4PB 2TPIZ 1FPCH 5CMXH 3OTJE 5C17A 1MTWA 3A85A 5DK1A 1MQ6A 1B5GH 2ZU2A 1IQGA 1SHHB 5A8XA 1MTVA 1ELFA 5FCRA 1AWFH 3CNRA 1SOZA 2FLRH 2FLBH 1SMFE 4TY7A 2BZAA 1KXEA 2J34A 1QL8A 3Q00A 3K6YA 4FUIA 4AYYB 4I8HA 2FI3E 4Y8XA 1T8MA 3S0NA 1ESTA 5C67A 3OSYA 3T5FH 2CGAA 3MH7A 6CHAB 3D23A 4GHTA 1TONA 5E0HA 5FL7D 2Z9KA 2FZZA 3FANA 1VITF 2KCAA 3PWCA 2PWXA 1O35A 9ESTA 1GI7B 2GP9B 1S6LA 3BG8A 3BEIB 1GCDA 2ZDVH 2W3IA 3M3VA 1XXDA 3SU0A 1NU9A 3SUDA 5C2ZA 2GVFA 5DN6D 4K1EA 1BIOA 2BLVA 4CRAA 1J14A 2JJ1D 4VGCC 1O2SA 3A8CA 2SGAA 5TCAA 1NBME 3ZZ6A 4F49A 1SLWB 4ZROA 2Q6FA 4WY3A 5FXLA 1V2OT 1AUJA 4K3JA 3MNBA 3FFGA 4A7IB 3A7WA 5EQQA 5LPEA 2Z9JA 9LPRA 2TGAA 1BRCE 1Z8GA 3FOAA 2NU1E 4I8JA 4IBLH 3GDVA 1SGEE 3TJNA 1TALA 3GOVB 3I29A 1C2HA 2XTTB 1P57B 3FO8D 3UOUA 1C4V2 2A4GA 1SPJA 4I86A 3ZYDA 1HFDA 1RXPA 4AC9A 2SNWA 2W6ID 4X8TH 2ZFRH 3RU4E 3SNAA 1DWEH 2F83A 3MWIU 7GCHF 2OLGA 1MTNB 3KQ5A 3LH1A 1SC8U 2H9EH 3AW0A 3KN2A 2ZG0H 1D3TB 3SNCA 1DE7H 1EJMA 4ABGA 1SQOA 1AIXH 1DT2A 3FKSD 4NA9H 1SLUB 2H5DA 4HFPB 5E0JA 1DS2E 2VIDA 5EXLA 3WWBA 4AFQA 2PTCE 2A7JA 3UWIA 1EQ9A 1T32A 2C8ZB 2NU3E 1E38B 1GDQA 1BQYA 3RM2H 1B0FA 2WHXA 3OX7U 3TJVA 1TBZH 4O03A 1PYTC 1YWUA 3PO1C 1P09A 1FJSA 2G51A 1WYKA 1SGCA 3SYJA 2A4RA 1QQ4A 2R2MB 1TIOA 1TNGA 5LPFA 1ELCA 1S0QA 1T7CA 4A5TS 5JPMH 4NFFA 3EE0B 1H8IH 1EAIA 2GX4A 1A5HA 3BSQA 3KGPA 5ESTE 1O2TA 1QHRB 2BDBA 2B7DH 2BDAA 4B73A 1D3QB 1BTXA 3DSOA 1GBAA 1QBNA 3SZEA 1O5AB 1NRRH 3FZDA 5K7RA 1C5YB 1S5SA 2JH0D 1MCTA 2VH0A 3F9FA 1KY9A 2VVCA 1IAUA 2ZFSA 4GLYA 4MDSA 4Q4LA 3RM0H 3AVZA 4NSYA 1V2WT 5JYIA 4A1TA 3ATIA 2ZGBH 1C5LH 1O37A 4TPIZ 2QCYA 1O3FA 2P3FH 2ZHDA 4ABEA 5FPSA 3U69H 1CA0C 5EGMA 3QK1A 4BANB 8ESTE 3GS9A 1K0HA 1JBUH 4K8BA 3RU4T 4OS7A 1K1PA 2SGFE 4ISIH 1DOJA 1UHBA 4THNH 1O5DH 1CGJE 1WOFA 1YPHC 1WV7H 2BTCE 4NIWA 1V3XA 1XUHA 1KIGH 3NZIA 2C8XB 5T6DA 5C3NA 1ZPZA 4KTCA 1P3CA 5JB9S 1K9OE 4NSVA 4B71A 4ZHAA 1O2HA 2P16A 4JYUH 1WTGH 4X1PU 4F48B 3ZZAA 2A45B 2YMSC 3MU8A 1GVLA 2NU0E 1QFKH 2OUAA 1H8DH 2B0FA 1Z8RA 1JIMA 1G9IE 3O8RA 1KTSB 1SGFA 4WXIA 1VITG 3T25A 1JWTA 5B6OA 1ANCA 1PPBH 3S9AA 2VWLA 1SKYE 1GJ5H 2ZFQH 3RXSA 2D2DA 1WSSH 1GI8B 1DLKB 4DIIH 1ZOMA 3HGPA 2VH6A 1NY22 2VIQA 2YNAA 4HTCH 5HKKD 1SG8B 2VINA 1O2PA 3RMLH 1HIAB 1LKAA 2SGDE 1MU6B 1SR5C 1A0HB 3OAAD 2XNDD 1ZHPA 1MBMA 3CS0A 2LNCA 1BTYA 1TA2A 1S6FA 2Z94A 4GSOA 4IN1A 1WQVH 3ZV8A 2BXUH 1QQUA 1C5SA 3KYFA 1FN8A 2F9NA 2Q6GA 2AH4X 5CDFE 1BTZA 3ATLA 2GCTC 1EZXC 2XW9A 2ESTE 1C2FA 1O2NA 1GBHA 4ABDA 2VBCA 3FZZA 3TNTA 1HAHH 1NZQH 2FTMA 3V12A 4FUFA 3ZZ7A 7GCHG 4ABHA 3M7UA 1EOJA 3RMOH 1G2LA 1Z1IA 1MTSA 2GDEH 2QF5A 3ZZDA 2AMDA 3JZ1B 1QJ1B 1O2OA 2F3CE 3ZZ8A 3PROA 2VIWA 5E0GA 1DUAA 3GICB 5KECA 2OC0A 3LGVA 1GG6C 1EPTB 1DY8A 2C3SA 3MI4A 1C5UA 2GMTB 1PPEE 2EI8A 2WUBA 5EPYA 1C2JA 2ZQ1A 1C5RA 3TIUA 4ZXYH 3UNRA 1O5BB 4DJZB 3LC5A 3TK6A 1UVPA 3PWBA 3SQEE 2HNTE 1O3BA 1GHZA 1ZSLA 2A5IA 4HG6A 2W7SA 3ZZCA 5L2YH 1PPFE 1SGIB 1SGPE 2TBSA 3ZVAA 2QIQA 1TBRH 3MU4A 2VWMA 1XUJA 3W1EA 1JXPA 4RKJB 2ZGHA 1O3KA 4P00A 1P04A 2FYRA 1C5MD 1RIWC 1O2LA 3RXCA 3RXMA 5EW2H 3RLWH 4OS4A 3B8JA 4INKA 4JYTA 2AMPA 1C4Y2 1DDJA 1Y5UT 2GV6A 3D49H 3E0NB 1BTHH 4IMZA 3E6PH 1CVWH 3SQHE 3F3BA 3TPIZ 5B6LA 1O2JA 2FOBA 5JB8S 3F2HA 1AD8H 1HAVB 1AKSB 1O2GH 1WAYB 5C5OA 4DG4A 1UTOA 2W5EA 1W2KH 3BN9A 2WPDD 5AFZH 3WW7A 4AB9A 4TWYA 1OPHB 1V6DA 3ZVFA 1IHTH 1BHXF 2Z3DA 4ZMAH 1P10A 1O2MA 3PMJA 4DOQA 3PLKA 5T1VA 1TNLA 4U2WA 2BDHA 2WPIS 1S81A 4D9QA 1ZJDA 2H9TH 3HK3B 1TFXA 1WDIA 2ILNA 4BNRA 1CU1A 1ZMJA 2ZDLA 4DW2U 1ZRBA 1HJAB 1GCTB 2BY8X 4HI3A 4XSKU 2EC9H 4FUDA 2OK5A 2KFWA 1MAYA 4Y7BA 3S7KB 2BOKA 5DP9A 3A8BA 1Z6EA 1DXPA 5EXMA 1E34B 1ELEE 1LMWB 2OINA 2G5NA 1DFPA 1RGQA 1C1MA 4MVNA 4AGKA 1AVXA 3K2UA 5SGAE 1PYTD 2PKSB 3VPKA 1ZTLA 1O0DH 3P8GA 2AERH 1UJ1A 1QIXB 3AK5A 2IJD1 2KCPA 1ETSH 2GTBA 1AKSA 1YCPH 5PTPA 2G81E 3PLBA 3TK9A 2QF3A 4YOGA 3ELAH 2XBWA 1K21H 2FODA 2ZC9H 1HAGE 1V2KT 6GCHG 2JDID 2GZ7A 3UNQA 1V2MT 1TYNA 1EASA 3RXDA 8GCHG 1O3NA 5CHAB 5E8EH 2V3OH 1W12U 1TRNA 5F8TA 3GCHB 2W26A 5ESBA 1DXWA 3SHCH 5F8XA 1KXBA 4WWYA 1TPSA 4JK6A 3ZVGA 4AG1A 2V3HH 2BX3A 2ZGCA 3KNXA 2CHAB 1A0LA 1Z6JH 3MTYA 2XXLA 1F0UA 1ZRKA 4O3UA 1THRH 3MFJA 2ZCLP 1ETRH 1FAXA 1C5TA 3DSGA 2J98B 3RUOA 1MZAA 2V35A 2VIVA 4YM9A 3LGIA 4INHA 2WPJS 1CA8B 1JIRA 4JZFH 1H8ED 4UFFH 1ZPCA 4CRDA 3A7TA 5TCCA 1PQ5A 1V2QT 2PFEA 1HAOH 1YM0A 3RXTA 3SNBA 1NROH 1UTKA 1EAWA 1LHFH 2XC4A 1QGFA 1OHHD 1TNHA 1TGSZ 2Z6BD 2YMSD 1UTQA 2O8WA 1ZMLA 2J9NA 4XBBA 3JZ2B 2RG3A 2Y81A 2VWOA 4AB8A 3PYHA 3LGTA 3BEUA 3BTFE 1O3HA 1GWAA 2ZHQH 1RJXB 4X1NU 1DUEA 3SI3H 3Q76A 3PMBB 1SQRA 5EW1H 3CS7A 2XNIA 4X6MA 3G01A 4Q7XA 3BTME 1O30A 2A0QB 4Y7AA 4WMDA 3VGCB 2OBQA 4Z0KA 1J16A 3DD2H 2A5KA 1WCZA 3F0OA 4OM9A 1XX9A 1Z8IB 1OOKB 2PHBA 1SGYE 3S69A 3MQKC 1O3LA 4AFZA 3PMAB 1PQ8A 4RN6A 2HPQH 3GY6A 4X1QU 5L6NH 1IQFA 1BRUP 1EZUC 4FUEA 4WH6A 4DGJA 3SHAH 5HIYA 4YXWD 3M5OA 1CHGA 1SLVB 1NFWA 2AS9A 2PSXA 3MU0A 3F2GA 2HPPH 4RT1A 3R0FA 1FIWA 2IPQX 3UTUH 1WUNH 3UUZA 1GJCB 2BOHB 1AI8H 1BTUA 1RTLA 5C0UA 1CGHA 3EGKH 1C5PA 2K8IA 1KLIH 2VB0A 3ZVDA 2QXHA 1K28D 1EAXA 5DP4A 2ZHWH 3SV8A 5DP7A 1UCYK 4NFEA 5I46H 2EY4C 2ODYB 3OTPA 1W13U 4CBNA 1GHXH 2THFB 1FY4A 2ZFFH 1C5QA 4HZHA 2A31A 2EI6A 1IQMA 3PB1E 1QR3E 1LKBA 4Y11E 3SGBE 5A09A 1K1JA 2VGCB 3ZVBA 1KDQA 1OWKA 3PLPA 1MKWK 1N1LA 1AMHA 1TPOA 3TGKE 2G4UA 3ZZ4A 4GCHF 1QB6A 3KCGH 1BMMH 4CH2B 4XE4A 1BMFD 2PGBB 1ZMNA 3ZZBA 1VITH 1AB9B 1CHOF 1GL0E 2PTNA 3PTBA 4R8TB 4UFDH 4YOIA 1XM1A 1ELGA 3QUMP 3RXLA 4RSPA 4ABFA 1EJAA 1GMCG 4I32A 4P02A 2ZHFH 2WPHS 1TNIA 4DT4A 3A87A 1QBOA 1MD7A 5EODA 1IQIA 3KQDA 2FP7B 3UFAA 2ANMH 3GY2A 4X2YA 4XOJA 4A1XA 4ABIA 1SGFG 2FPZA 1FY5A 4NZQA 1DWCH 2XWBI 3P92A 1GMHF 3DSPA 2KAIB 2H1UA 1KXAA 2JIZD 1AVWA 1NRPH 2KM0A 3EA8A 1EKBB 4Q7ZA 3TVJB 1Z71A 2XBXA 3LC3A 2UWPA 4IW4E 4NWLA 2PLXA 1VGCB 4I31A 1NFYA 2PP6A 1O3GA 5KEDA 2J2UA 4FUGA 2OXSA 3FP7E 1GBLA 4CR5A 1TLDA 1Y3YA 3W94A 4OGYA 1LQEA 1ACBE 1K22H 1HUTH 1FY8E 1P11E 2BD8A 3K6ZA 3RXUA 1HJAC 3SV7A 1F7ZA 1BMLA 3DFJA 4Y8ZA 3UIRA 3BIUH 1SQTA 3UR6A 1GHAF 2A2XH 2D8WA 4NIXA 3EDXB 1QCPA 4AGJA 3KQBA 3A81A 5FHTA 2KZ4A 5IDKA 1ORFA 3M5LA 2PV9B 3T26A 2XCFA 2BD7A 2F9BH 1BTPA 1KMHB 4CRCA 2BVXH 2PKSC 1LHEH 2FX4A 3F9EA 3MHWU 4Y8YA 1HAYB 3RC5A 2A7CA 4IGDA 1PFXC 1C5ZB 4RKOB 2FOCA 2PUQH 4MNVA 2A5AA 4WJG2 1KLJH 1O2YA 3MNXA 1QL9A 4BTTB 5A0AE 1LO6A 2CN0H 5CHBA 3SV2H 3QO6A 2B9LA 3PTNA 1YKTA 2XC0A 1PPZA 1UK2A 1C5XB 2BHGA 2C93B 4CREA 1YPEH 1GMDF 2B8OH 1LCYA 2FO9A 1V2RT 4OS2A 1DITH 2ZTZA 1EB1H 2UUKB 4O9VA 3BV9B 1A61H 3RXPA 2OQUA 2J92A 1AHTH 4TY6A 1IQNA 1LHGH 1Y3WA 3P17H 2G8TA 3M3TA 5T6FA 3GCHC 4FOUC 1GGDB 1ID5H 1MD8A 1SSXA 3OU0A 1BITA 4MPUA 1O2IA 1ANDA 1GBEA 1A0JA 2Z9GA 5A0BA 1NO9H 2J4IA 1OYTH 3DUXH 1OXGA 4YLQH 1UVTH 1ZJKA 1TAWA 2L74A 3A8AA 2YNBA 1XUIA 3SV9A 2BQWB 4LOYH 3A80A 3ZZ9A 4YT7H 3D65E 1LPKB 4JZEH 4RI0A 1GJBB 1ZHRA 1P06A 3S9CA 2F43B 1P01A 5C0TA 2P94A 3SO3A 1D6WA 1NS3A 1C1OA 1UTPA 4ZKOU 3MU5A 1KXCA 1O2WA 1GHYH 2FEQH 1P9SA 2R3YA 3DHKH 2JETB 1P2OA 3KF2A 3UY9A 1UMAH 5HYOA 1YPLH 3T27A 2BVRH 1MABB 4OS1A 1MKXH 4UDWH 3MH5A 1C1RA 1VCWA 4GCHG 1TE0A 4WXVA 5GNDA 4ISHH 4Z6AH 1YC0A 4ZHLU 1V2NT 2OC8A 3H5CB 1P8VC 3UOPA 3MO9A 1GJ8B 1HAIH 3GISB 2BX4A 2I6QA 1L4DA 2FS8A 2HVXA 3R3GB 1MAXA 4X6PA 3M7TA 3HKIB 2ZP0H 1C5NH 4M7GA 2LP6A 1C9TA 2I6SA 2BD2A 2A7HA 2QXJA 1T8OA 3SGAE 1YYY1 1QRXA 3BG4B 4IC5A 1GI3A 5C1XA 3MH6A 1G30B 4SGBE 3V0XA 2ZZUH 2V7QD 2V6NA 5F53A 3P8OA 2KCOA 1H9HE 1O2VA 2Q1JA 1BBRK 1FY3A 3C27B 1YLDA 3DA9B 1TX8A 4YO9A 2FI5E 1GMHG 2GDDA 2KX4A 3KHVA 4CR9A 2Y80A 1TX7A 1SI5H 1W0KD 3L6PA 1C5VA 3A7YA 2VIOA 4TWWA 2P8OB 1O3OA 1UW7A 2ZIQH 3OE7D 2STBE 3KQCA 1HXFH 4AZ2B 4JCNA 5FPTA 3TJOA 2V3MA 1H9IE 1WXRA 2Z7FE 4I8LA 5ABWA 1BZXE 3ZIAD 2ANYA 3QGJA 1OWIA 1K1LA 4Y79A 1GVZA 1GBBA 4AOQA 1W14U 2Z9IA 2ZPSA 2BLQA 2IPHA 1FMGA 1OYQA 2FESH 1CT2E 3CENA 1N8OB 2ZCHP 1KXDA 3WY8A 1GHAG 3QWCH 4LZ4B 2GT8A 1HYLA 1PPHE 2IN2A 2ZA5A 1CBWB 4XDEA 4AFUA 2F4LA 1JRSA 1TRYA 1GJ6A 2QAAA 1SVPA 2PUXB 1ZZZA 3SU2A 1AQ7A 1F5RA 1O31A 1THPB 2ZCKP 3BTEE 1G3CA 1GDNA 1YPHE 3ODDA 1RS0A 3S7HB 1GHVH 2G5VA 2SGQE 4A92A 3M61U 4UFGH 1GI0A 1GBDA 3GDSA 3QN7A 2P95A 1DSTA 1L0ZA 3LKWA 3H09A 3KEEA 2JH6D 1NBMD 1YLNA 2W6JD 3RXAA 3M3SA 4YT6H 2R0KA 2VWNA 4E05H 3RXEA 1D3DB 1E0FD 1ZSKA 2ZU3A 2FX6A 1L2EA 4X2XA 3TK5A 1QB9A 1HIAA 1O3CA 2BD3A 3A7ZA 4HGCA 5AHGH 4QT8C 1GMDG 4J1YA 4KTUA 3SBKA 1SL3A 1ZHMA 2UUJB 3F9HA 1JRTA 4WMEA 2ODPA 1AB9C 2IOTA 3SNEA 3QZRA 3T2NA 2EA3A 2OC7A 4WMFA 4ISNA 4AG2A 4FU8A 1OKXA 3P70B 1O2QA 3PM3A 1SB1H 1SGQE 2HRVA 3RU4D 4D8NA 2J94A 2F9OA 3GCOA 4FUJA 1O2KA 2W3KA 4FU7A 1BRBE 1Z8JB 2C8WB 3EA9A 4OGXA 5T6GA 1FXYA 4KTSA 1ELTA 2KCYA 3W95A 6CHAC 4I33A 2CXVA 3IWMA 1AE8H 2BM2A 4FUBA 3TJUA 5EIYA 2TGTA 3BEFB 1O3DA 5J4QA 1FI8A 1A3EH 1QURH 1HAPH 5G4BA 2QE7D 1EZSC 1CE5A 3TU7H 4D7GA 3RDZA 4TT3D 4WH8A 1OS8A 2VVUA 2AGGX 4JMYA 3A84A 3MNCA 4GPGA 2ZFPH 4OS6A 4ZH8A 1TABE 3UQOA 1SGTA 5JBTA 5LH8A 2ZGXH 1EPTA 4Y0YE 5DG6A 1SLXB 2W7UA 1QNJA 1GI6A 1C5OH 4ASHA 5EJ1A 1ZTJA 2GCHF 4DT7B 4K1TA 1ESAA 4B6FA 3GY5A 4NG9H 1SBWA 4Y6DA 2FOFA 3O8CA 5FX5A 4FETA 1LDTT 1NTPA 1NRNH 1G36A 2ZPRA 4DVAU 1OX1A 3AAVA 1HPGA 3L33A 2O8TA 4F4OC 1O2ZA 1J9CH 3U28C 4NA7A 2BD9A 2BY6X 3H7OA 1H4WA 1WBGB 2GV7A 1DWBH 2Y6TA 5BRRE 3F2FA 3NRLA 1MTNC 1GI9B 5DGJA 1J15A 1ZGVA 2WSSD 3ZVCA 4CRGA 3EQ0H 4A6LA 3NXPA 3HKJB 2ZTXA 1YPKH 2DE8A 1YLCA 2EEKA 3E16B 5HGGA 3RMNH 5C20A 1ZR0A 1LPZB 1UVUH 1ZSJA 2C8YB 4X8SH 5FBEA 1G3BA 2QV1A 2G52A 2WYGA 2Y82A 3RXBA 2BMGB 3HATH 3NK8A 1INCA 1V2TT 1TPPA 1LPGB 3QDZB 2ZECA 1MKXK 3RXOA 3Q3XA 1P9UA 1SQAA 4U32A 4ABAA 1HAVA 2B5TB 3LGWA 3U1JB 1F0RA 2BVSH 5L2ZH 1L1JA 3AASA 2KR7A 2XYAA 3UPEA 3E0PB 1GGDC 1M9UA 4Y10E 4Q63A 4F55A 3PRDA 2EI7A 1G37A 3A89A 2TRMA 1B0EA 2AFQB 4X2WA 2Q6DA 2HGTH 3T62A 1AWHB 3TNSA 1DLEA 3B23B 4TPYA 5EOKA 3UQVA 1TX6A 1TGCA 1FAKH 1T8LA 1EUFA 2BD4A 1FZZA 1KSNA 2J5UA 4Y71A 4UD9H 1XMNB 4MNWA 4NA8A 3VFEA 3U8OH 1S0RA 1TMUH 1C2MA 2D26C 3ZVEA 4B6EA 3PO1B 1OWHA 1J17T 2XBYA 2HOBA 3D62A 1VJAU 3SNDA 2PR3A 2ZU1A 1NN6A 4X8VH 4CRFA 2JETC 1C1QA 1P2MA 3VB4A 5DO4H 1UCYE 3L3TA 2GZ8A 2D1JA 1YPJH 4MTBA 2J97A 2XBVA 3EA7A 1ARCA 5EJLA 4AFSA 4BTIB 1GBFA 1Q2WA 3P95A 1ABJH 6ESTA 2F9VA 2AMQA 1SGDE 4X2VA 4XFQA 4K69A 1TQ0B 2ULLA 3RXKA 3P6ZB 4K5ZA 3E8LA 3KIDU 1KXFA 1NESE 5BPEA 1C4U2 2A4OA 2V0BA 3STJA 3O8DA 1HV7A 3PV5A 3LJJA 4BAMB 2GT7A 1TBQH 3ATKA 5JBCS 3HGNA 1CA0B 3SUEA 2BY7X 3QX5H 1W0YH 1EFRD 2BLWA 5GDSH 2RA0A 2J38A 4Q7YA 1TA6A 3LIWA 2J98A 4XBCA 4ZKRU 1UO6A 4ISOA 1XUKA 1DSUA 2P8OC 2BLOA 2ZI2H 2G4TA 4X6NA 2RFKC 2ZNKH 1YY3A 2WZQA 4OS5A 1UTJA 1TPAE 1V2JT 2AGEX 2STAE 4E06H 2GCHG 1A5IA 1HLTH 4MQAA 1O2UA 4YTAA 1CO7E 1NRSH 1T31A 1P03A 1K1OA 2DUCA 2ALPA 3M5MA 1QJ6B 1TRMA 4X1SU 2WV5A 3A86A 3TH2H 1GJ9B 1GPZA 1N8OC 3BTWE 3OEHD 1BCUH 1LVMA 1TMTH 2P3UB 4ZCNA 2ZPQA 1CT4E 5AVDA 4ZHMU 1ELBA 3SJKA 1TMBH 1EZQA 3MU1A 3MOCA 1XVMA 1FV9A 3QTVH 3Q3KA 2F91A 1HDTH 2ANKH 1QA7A 1SGNE 2BYAX 1DPOA 2RDLA 5DP3A 1EAUA 2JKHA 2AEIH 5GWZA 1S85A 3RXIA 4BAHB 5EPNA 3SUGA 1EPTC 3NKKA 5IYTA 3I77A 5DP8A 1EOLA 2TIOA 3RC4A 1Y5AT 5EQSA 2LELA 2GMTC 1L1GA 1TB6H 1RRKA 2GCTB 4NIYA 3A82A 3MH4A 1C1PA 4BXSA 3SJ9A 3AAUA 3E3TA 1AY6H 1GBCA 4U01A 4B75A 5LPRA 1XUFA 4MPWA 5A0CA 4XBDA 4KKDA 2QY0B 4XRNA 2CV3A 1O3AA 2UWOA 1O2XA 1MU8B 2UUFB 3QZQA 2O9QA 3TGIE 3Q77A 2ZF0H 1O33A 1BOQA 1HCGA 2P59A 5DKMA 1QBVH 3QGNB 1C2EA 8LPRA 4MNXA 2C90B 2WPMS 1DM4B 1E36B 5FCKA 1A7SA 4LXBH 4E7RG 8KME2 1C5WB 1HGTH 1GHWH 1TNJA 3BTGE 1GG6B 2ZGJA 1RTFB 3LH3A 2CF8H 2XC5A 4O97A 2FI4E 2CJIA 1AFQB 2FS9A 4ZKNU 4CHAB 2A4QA 4ABJA 2Z3EA 1IQHA 5JBAS 1PQ7A 1G2MA 1C2GA 1LVOA 4AYVB 3SJ8A 4FUCA 1ZGIA 3UWJH 1O39A 1MMJN 1YCPK 5EJZA 3TLOA 1GDUA 1O3IA 3GDUA 1FLEE 1S83A 3SU1A 1QJ7B 4CBOA 2VNTA 2QXGA 4LZ1H 3RLYH 3A83A 4IN2A 1BDAA 1D3PB 1S84A 4D9RA 1RIWB 3FVFB 5DP6A 2Y5FA 1F0SA 1TQ7B 2YOLA 1OP8A 1F92A 2AGIX 3IITA 7LPRA 4K8YA 1GCTC 1Z1JA 3HK6B 2UWLA 1O5EH 1BUIA 1GBIA 1ELVA 1BHXB 3ATWA 4H42U 1YPGH 2RDEA 1WTHD 3O8BA 3F0PA 1C1NA 1GJ7B 1XUGA 1MTUA 5GXPA 1QY6A 1UTMA 5AFYH 2AHME 1V2LT 2KAIA 3ENSB 5HM9A 3GYLB 5C1YA 5HMAA 3ZZ5A 1BBRE 4XD7D 5DSFA 4D76A 1SOTA 4JK5A 3LONA 2FOEA 5GCHF 1C1SA 2XOKD 4X8UH 2C4FH 2BDIA 1GBJA 1QTFA 1GBMA 4I7YH 1F5LA 2F9PA 3NWUA 2TGDA 3M37A 2FOAA 1P3EA 2ZU4A 1UVOA 5CHAC 3RMMH 3U8RH 1GBKA 3T28A 2BDGA 1BB0B 4LK4A 4Y76A 3PV2A 2OTVA 1B7XB 2A1DB 3VB5A 1ZLRA 1LTOA 1SFIA 5EG4A 2ZDAH 4BOHA 4NIVA 2CHAC 3RXGA 2ZQ2A 3SORA 1VZQH 2CMYA 1C2LA 1TGBA 2HWLB 1OWEA 4RT0A 5C94A 2FXRA 7ESTE 1G32B 5GJ4B 1ARBA 1Y3VA 2FOMB 2TGPZ 1EXFA 2CF9H 1UHBB 2Y7ZA 4JZIA 1AVGH 3MO6A 1UVSH 2SFAA 4GAWA 4H6TA 1Q3XA 3SOSA 2ZDNA 1FY1A 1Q31A 4ZXXH 3LJOA 4J2YB 1QA0A 5ETXA 2ZWLH 5F8ZA 3U9AH 2ALVA 1K2I1 1FONA 1P05A 1NM6A 1IQLA 2FYQA 1BJVA 3V13A 2BD5A 3SU5A 2IJOB 1TOCB 5C1UA 1UTNA 3UAIC 2EQNA 1QRWA 1ANBA 3LGYA 2FOGA 3A88A 1MH0A 4KELA 1HXEH 1O3PB 2NWNA
chains in the Genus database with same CATH topology
3IG6B 1C2KA 3GCNA 1GJ4H 3CP7A 2AYWA 1U6QA 1NT1A 3GYMA 1S82A 1C1VH 3TH4H 3T29A 4NGAH 1CHOG 2BDYA 1ESBA 1ETTH 3AW1A 1IQEA 1T4UH 1O2RA 2GKVE 3ITIA 5FPYA 5H4IB 4ESTE 1GBTA 4ABBA 1DANH 1SGRE 3N7OA 1ZYOA 1A5GH 4ZUHA 1HJ8A 2QA9E 3SGQE 2FMJA 3VGCC 4CRBA 2P93A 1CT0E 3URCA 1AFEH 2O8LA 2ANWA 2VJ1A 3GCTF 4UE7H 1TGNA 3C1KA 3BTTE 1D9IA 2H2ZA 1NC6A 2UUYA 1C9PA 3SV6A 2R9PA 2WV4A 2OP9A 1C2DA 1O34A 2ZO3H 1GI1A 2Y5GA 1RD3B 1V2PT 5FX6A 4BAOB 4O3TA 1OWDA 1DVAH 3FAOA 1BJUA 1ZPBA 3RXHA 2SGEE 1AO5A 1Y3XA 1V2ST 3LOXA 5C5NA 3SUFA 3RP2A 1E37B 1YP9A 2AIPA 2WPKS 3SI4H 3VB6A 2HNTC 1P02A 1Y8TA 1YF4A 2Y5HA 1W11U 1FN6A 4B2BA 1XKAC 3E1XB 1JOUB 1GHBF 1A46H 4BAKB 2XRCA 2QN5T 1O32A 2HNTF 4MG3A 1P2QA 1T4VH 1YGCH 2M5TA 4H4FA 1LHCH 1FNIA 3TH3H 2QGRA 3TITA 1AZ8A 6GCHF 1MBQA 2JH5D 4GVUA 3VXEH 5FAHA 8GCHF 1BA8B 2GZ9A 3BTDE 3RXQA 4DCDA 1PPCE 1UK3A 2VGCC 3STIA 3VB3A 1PQAA 1KLTA 4B76A 1OP0A 1VJ9U 1L4ZA 1UK4A 2ZTYA 1WQSA 5GCHG 5E2OA 3RXVA 4Q2KA 1H1BA 1AE5A 1D6RA 3S9BA 2AIQA 4FUHA 3SU3A 2HALA 3ODFA 1UTLM 1W10U 4X0WU 3VEQB 2OD3B 2O8MA 1CSOE 1ELAA 1NU7B 1A4WH 1BMNH 1MZDA 4D7FA 3KL6A 3VXFH 1AFQC 4CHAC 1C1WH 3EAJA 1K1MA 3ATMA 4IC6A 2ZFTA 2G00A 1EATA 2RCEA 4PROA 6LPRA 3GY7A 3ESTA 4JZDH 1O5GH 3P8NA 1EX3A 4I8KA 5DPAA 2Z9LA 1DWDH 2GD4B 1FQ3A 3VB7A 2OBOA 2WUCA 2QF0A 2ZU5A 3TGJE 1MCVA 1NRQH 1SHYA 2QXIA 5HM2A 3KQEA 4WVPE 2PKAB 4AN7A 1TOMH 1BT7A 3LT3A 1QL7A 2RA3A 1VGCC 3PMHB 3ZZ3A 2XWAA 5DJ7A 4GUXA 1P2JA 2BQ6B 4DIHH 4GHQA 2FTLE 4X6OA 3RXFA 4ZAEA 1PPGE 1Y5BT 4FU9A 1FIZA 3K65B 2ZKSA 2J95A 1UCYH 1HAXB 1GL1A 1X7AC 1IQKA 3URDA 5A8ZA 1W8BH 4NZLA 3U98H 2QC2A 4R0IA 2FWWA 1VCPA 4BXWA 3UR9A 1A1RA 4UONA 1NFXA 4KGAA 4VGCB 3U8TH 4IS5A 3LDXH 3OY6U 4YOJA 4SGAE 1MKWH 1AN1E 3I78A 4INLA 1A2CH 1S6HA 2PW8H 2XCNA 2ZHEH 1ELDE 1CQQA 1LVYA 3GCTG 3F68H 4E7NA 1SFQB 1W3CA 1GVKB 4H6SB 4NCYA 2PKAA 1E35B 7KMEH 1ANEA 2BY5X 2ZDKA 5E2PA 3A8DA 1PJPA 4JYVH 1GI4A 1C2IA 1T8NA 4UEHH 3UNSA 3P8FA 5EU8A 4MPVA 2PSYA 3F6UH 1MUEB 1Z7KA 3SU6A 2R3UA 4DURA 1LHDH 1EP6A 1P12E 4FVDA 3NPSA 1GJAB 3GY4A 1MQ5A 3BIVH 2O8UA 3E91A 4K60A 4U30A 2GGVB 3QTOH 5A2MH 3M36A 1AUTC 1THSH 3GY8A 1O3EA 1W7XH 5F6MA 1AGJA 1G3DA 1O5FH 1GHBG 4JZ1A 3MNSA 1FDPA 2BZ6H 1K1NA 2FDAA 1VR1H 2VIPA 5GIBA 2FM2A 3V3MA 3FP8E 5CE1A 5JBBS 1F0TA 1TGTA 1V2VT 3LPRA 2QYIA 3SW2B 1P2IA 2OCVB 3SN8A 2WINI 3B9FH 1BRAA 1OP2A 4UFEH 1QB1A 1OWJA 2SGPE 3SJIA 2OC1A 4B2CA 4KP0A 1H9LB 2WPLS 1IQJA 2G55A 1DY9A 4MNYA 1GMCF 1G3EA 1XKBC 3ZYEA 1IHSH 1CGIE 2ZDMA 3OY5U 3RXJA 2DE9A 3K9XB 1EJNA 5J4SA 2A2QH 1C1TA 1HNEE 5K0HA 3LGUA 1A3BH 1BMAA 1V2UT 3SU4A 2H6MA 1C1UH 1ZTKA 3MO3A 2P3TB 3SJOA 3BG4C 5F03A 3BTQE 1KTTB 2PGQB 5JDUB 1J8AA 4X1RU 1GJDB 3A7VA 2NU2E 4B74A 1Y3UA 3NCLA 1HAZB 4B2AA 1HRTH 4WF8A 1Y59T 2BDCA 1IOEA 2SNVA 2H9HA 1N6YA 1W0ZU 4A1VA 1N6XA 1WU1A 2HLCA 3F1SB 4MPXA 3RXRA 1HJ9A 1YCPM 1P0SH 2BXTH 5AF9H 3F9GA 4AX9H 1O3MA 1BTWA 4YLUA 4CH8B 4K2YA 4FXGH 4MLFB 3E90B 1FPHH 1DICA 3MYWA 1P2NA 1AZZA 2BY9X 1P2KA 1F2SE 3DFLA 2F9UA 2BQ7B 2LPRA 2Y7XA 3U1IB 3BF6H 3BTHE 1AU8A 1ABIH 2BB4A 2R0LA 4ZKSU 1CBWC 2OQ5A 1TNKA 5A8YA 2VU8E 2A32A 3GY3A 4TYDA 5I25A 3HPTB 1LQDB 1KDQB 3Q3YA 3M35A 2ODQA 1GI2A 1JMOH 1OSSA 1XXFA 4K1SA 2FOHA 4FVBA 4Q80A 4YESB 5FBIA 3UREA 2WYJA 2VVVA 4Y0ZE 3LU9B 3A7XA 4B1TA 1K1IA 1O3JA 3PV4A 4AORA 5HXFA 5EXNA 1QRZA 3FP6E 1TWXB 2ZEBA 3DT0H 4YZUA 1O36A 2NU4E 5DP5A 5L30H 1DX5M 1GI5A 1KYNA 3SZNA 2FIRH 1LVBA 3BTKE 1L1NA 2ASUB 4NWKA 1NPMA 1EB2A 3M5NA 1FUJA 4BTUB 1HB0B 1EP5A 2H5CA 1RFNA 5GPIB 2K1QA 1NFUA 2Z3CA 5EQRA 5TJXA 2R2WU 1W7GH 3H7TA 4I8GA 4DY7B 1RTKA 1BBRH 4BAQB 3OYPA 3V7TA 3MMGA 5T3HA 3ZV9A 1HBTH 5LGOA 1VCQA 3RC6A 4IMQA 1YBWA 1YPMH 1O38A 1O5CB 3EYDA 3NUMA 3QLPH 1XVOA 3M7QA 1F5KU 4ISLA 1D4PB 2TPIZ 1FPCH 5CMXH 3OTJE 1MTWA 3A85A 5DK1A 1MQ6A 1B5GH 2ZU2A 1IQGA 1SHHB 5A8XA 1MTVA 1ELFA 5FCRA 1AWFH 1SOZA 2FLRH 2FLBH 1SMFE 4TY7A 2BZAA 1KXEA 2J34A 1QL8A 3Q00A 3K6YA 4FUIA 4AYYB 4I8HA 2FI3E 4Y8XA 1T8MA 3S0NA 1ESTA 5C67A 3OSYA 3T5FH 2CGAA 3MH7A 6CHAB 3D23A 4GHTA 1TONA 5E0HA 2Z9KA 2FZZA 3FANA 1VITF 3PWCA 2PWXA 1O35A 9ESTA 1GI7B 2GP9B 3BG8A 3BEIB 1GCDA 2ZDVH 2W3IA 3M3VA 1XXDA 3SU0A 1NU9A 3SUDA 5C2ZA 2GVFA 4K1EA 1BIOA 2BLVA 4CRAA 1J14A 4VGCC 1O2SA 3A8CA 2SGAA 5TCAA 3ZZ6A 4F49A 1SLWB 4ZROA 2Q6FA 4WY3A 5FXLA 1V2OT 1AUJA 4K3JA 3MNBA 3FFGA 4A7IB 3A7WA 5EQQA 5LPEA 2Z9JA 9LPRA 2TGAA 1BRCE 1Z8GA 2NU1E 4I8JA 4IBLH 3GDVA 1SGEE 3TJNA 1TALA 3GOVB 3I29A 1C2HA 2XTTB 1P57B 3UOUA 1C4V2 2A4GA 1SPJA 3ZYDA 1HFDA 1RXPA 2SNWA 4X8TH 2ZFRH 3RU4E 3SNAA 1DWEH 2F83A 3MWIU 7GCHF 2OLGA 1MTNB 3LH1A 1SC8U 2H9EH 3AW0A 3KN2A 2ZG0H 1D3TB 3SNCA 1DE7H 1EJMA 4ABGA 1SQOA 1AIXH 1DT2A 4NA9H 1SLUB 2H5DA 4HFPB 5E0JA 1DS2E 2VIDA 5EXLA 4AFQA 2PTCE 2A7JA 3UWIA 1EQ9A 1T32A 2C8ZB 2NU3E 1E38B 1GDQA 1BQYA 3RM2H 1B0FA 3OX7U 3TJVA 1TBZH 4O03A 1PYTC 3PO1C 1P09A 1FJSA 2G51A 1WYKA 1SGCA 2A4RA 1QQ4A 2R2MB 1TIOA 1TNGA 5LPFA 1ELCA 1S0QA 1T7CA 4A5TS 5JPMH 4NFFA 3EE0B 1H8IH 1EAIA 2GX4A 1A5HA 3BSQA 3KGPA 5ESTE 1O2TA 1QHRB 2BDBA 2B7DH 2BDAA 4B73A 1D3QB 1BTXA 1GBAA 1QBNA 1O5AB 1NRRH 3FZDA 5K7RA 1C5YB 1S5SA 2JH0D 1MCTA 2VH0A 3F9FA 1KY9A 2VVCA 1IAUA 2ZFSA 4GLYA 4MDSA 3RM0H 3AVZA 4NSYA 1V2WT 5JYIA 4A1TA 3ATIA 2ZGBH 1C5LH 1O37A 4TPIZ 2QCYA 1O3FA 2P3FH 2ZHDA 4ABEA 5FPSA 3U69H 1CA0C 5EGMA 3QK1A 4BANB 8ESTE 1JBUH 4K8BA 3RU4T 4OS7A 1K1PA 2SGFE 4ISIH 1DOJA 1UHBA 4THNH 1O5DH 1CGJE 1WOFA 1YPHC 1WV7H 2BTCE 4NIWA 1V3XA 1XUHA 1KIGH 3NZIA 2C8XB 5T6DA 5C3NA 1ZPZA 4KTCA 1P3CA 5JB9S 1K9OE 4NSVA 4B71A 4ZHAA 1O2HA 2P16A 4JYUH 1WTGH 4X1PU 3ZZAA 2A45B 3MU8A 1GVLA 2NU0E 1QFKH 2OUAA 1H8DH 2B0FA 1Z8RA 1JIMA 1G9IE 3O8RA 1KTSB 1SGFA 4WXIA 1VITG 3T25A 1JWTA 5B6OA 1ANCA 1PPBH 3S9AA 2VWLA 1GJ5H 2ZFQH 3RXSA 2D2DA 1WSSH 1GI8B 1DLKB 4DIIH 1ZOMA 3HGPA 2VH6A 1NY22 2VIQA 2YNAA 4HTCH 1SG8B 2VINA 1O2PA 3RMLH 1HIAB 1LKAA 2SGDE 1MU6B 1SR5C 1A0HB 1ZHPA 1MBMA 3CS0A 2LNCA 1BTYA 1TA2A 1S6FA 2Z94A 4GSOA 4IN1A 1WQVH 3ZV8A 2BXUH 1QQUA 1C5SA 1FN8A 2F9NA 2Q6GA 2AH4X 1BTZA 3ATLA 2GCTC 1EZXC 2XW9A 2ESTE 1C2FA 1O2NA 1GBHA 4ABDA 3FZZA 3TNTA 1HAHH 1NZQH 2FTMA 3V12A 4FUFA 3ZZ7A 7GCHG 4ABHA 3M7UA 1EOJA 3RMOH 1G2LA 1Z1IA 1MTSA 2GDEH 3ZZDA 2AMDA 3JZ1B 1QJ1B 1O2OA 2F3CE 3ZZ8A 3PROA 2VIWA 5E0GA 1DUAA 3GICB 2OC0A 3LGVA 1GG6C 1EPTB 1DY8A 2C3SA 3MI4A 1C5UA 2GMTB 1PPEE 2EI8A 2WUBA 5EPYA 1C2JA 2ZQ1A 1C5RA 3TIUA 4ZXYH 3UNRA 1O5BB 4DJZB 3LC5A 3TK6A 1UVPA 3PWBA 3SQEE 2HNTE 1O3BA 1GHZA 1ZSLA 2A5IA 2W7SA 3ZZCA 5L2YH 1PPFE 1SGIB 1SGPE 2TBSA 3ZVAA 2QIQA 1TBRH 3MU4A 2VWMA 1XUJA 1JXPA 4RKJB 2ZGHA 1O3KA 1P04A 2FYRA 1C5MD 1RIWC 1O2LA 3RXCA 3RXMA 5EW2H 3RLWH 4OS4A 3B8JA 4INKA 4JYTA 2AMPA 1C4Y2 1DDJA 1Y5UT 2GV6A 3D49H 3E0NB 1BTHH 4IMZA 3E6PH 1CVWH 3SQHE 3TPIZ 1O2JA 2FOBA 5JB8S 1AD8H 1HAVB 1AKSB 1O2GH 1WAYB 5C5OA 4DG4A 1UTOA 2W5EA 1W2KH 3BN9A 5AFZH 4AB9A 4TWYA 1OPHB 1V6DA 3ZVFA 1IHTH 1BHXF 2Z3DA 4ZMAH 1P10A 1O2MA 3PMJA 4DOQA 3PLKA 1TNLA 4U2WA 2BDHA 2WPIS 1S81A 4D9QA 1ZJDA 2H9TH 3HK3B 1TFXA 2ILNA 4BNRA 1CU1A 1ZMJA 2ZDLA 4DW2U 1ZRBA 1HJAB 1GCTB 2BY8X 4HI3A 4XSKU 2EC9H 4FUDA 1MAYA 4Y7BA 3S7KB 2BOKA 5DP9A 3A8BA 1Z6EA 1DXPA 5EXMA 1E34B 1ELEE 1LMWB 2OINA 2G5NA 1DFPA 1RGQA 1C1MA 4MVNA 4AGKA 1AVXA 3K2UA 5SGAE 1PYTD 2PKSB 3VPKA 1ZTLA 1O0DH 3P8GA 2AERH 1UJ1A 1QIXB 1ETSH 2GTBA 1AKSA 1YCPH 5PTPA 2G81E 3PLBA 3TK9A 2QF3A 4YOGA 3ELAH 2XBWA 1K21H 2FODA 2ZC9H 1HAGE 1V2KT 6GCHG 2GZ7A 3UNQA 1V2MT 1TYNA 1EASA 3RXDA 8GCHG 1O3NA 5CHAB 5E8EH 2V3OH 1W12U 1TRNA 5F8TA 3GCHB 2W26A 5ESBA 1DXWA 3SHCH 5F8XA 1KXBA 4WWYA 1TPSA 4JK6A 3ZVGA 4AG1A 2V3HH 2BX3A 2ZGCA 3KNXA 2CHAB 1A0LA 1Z6JH 3MTYA 2XXLA 1F0UA 1ZRKA 4O3UA 1THRH 3MFJA 2ZCLP 1ETRH 1FAXA 1C5TA 3RUOA 1MZAA 2V35A 2VIVA 4YM9A 3LGIA 4INHA 2WPJS 1CA8B 1JIRA 4JZFH 4UFFH 1ZPCA 4CRDA 3A7TA 5TCCA 1PQ5A 1V2QT 2PFEA 1HAOH 1YM0A 3RXTA 3SNBA 1NROH 1UTKA 1EAWA 1LHFH 2XC4A 1QGFA 1TNHA 1TGSZ 2Z6BD 1UTQA 2O8WA 1ZMLA 2J9NA 4XBBA 3JZ2B 2RG3A 2Y81A 2VWOA 4AB8A 3PYHA 3LGTA 3BEUA 3BTFE 1O3HA 1GWAA 2ZHQH 1RJXB 4X1NU 1DUEA 3SI3H 3Q76A 3PMBB 5EW1H 3CS7A 2XNIA 4X6MA 3G01A