2Z94A

Complex structure of sars-cov 3c-like protease with tdt
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
306
structure length
306
Chain Sequence
b'SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRKSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKFYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQCSGVTFQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Replicase polyprotein 1ab
publication title Structural basis of mercury- and zinc-conjugated complexes as SARS-CoV 3C-like protease inhibitors
pubmed doi rcsb
source organism Sars coronavirus
molecule tags Hydrolase
total genus 89
structure length 306
sequence length 306
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2007-09-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1840.10 Mainly Alpha Orthogonal Bundle main proteinase (3clpro) structure, domain 3 main proteinase (3clpro) structure, domain 3 2z94A03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2z94A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2z94A02
1RFNA 2FOHA 5HXFA 2Z94A 3Q3YA 4Z6AH 2Q6GA 1SGYE 5JB9S 1IQHA 2VGCB 2ZU2A 4K60A 2C8ZB 4MG3A 2XBVA 3T5FH 3HKJB 1MBQA 2P95A 5J4QA 1O2QA 1PQ7A 2FO9A 3BV9B 2BY7X 2NU0E 2BQ6B 1O5EH 3SJ8A 3LC5A 5FHTA 1TNLA 4XBBA 5I46H 3RMMH 3SHAH 5GDSH 2ZGJA 1DM4B 1DWEH 2W5EA 4WMEA 3L6PA 1S5SA 2O8TA 4XBDA 1EASA 2XC5A 1TGBA 1JXPA 3ZV8A 1TNHA 1DY8A 2VIWA 2FMJA 1JRSA 1SLWB 1N1LA 1EZSC 1ORFA 1C1TA 5FBEA 1YPLH 1O2ZA 3UNSA 1DLKB 1KIGH 5EU8A 1CT4E 1GBJA 3KNXA 4BTTB 1J15A 3PLKA 3EYDA 2HWLB 4JYVH 2GZ8A 3M3TA 1CVWH 4FUFA 4MPXA 4LZ1H 1DE7H 1SGCA 2ODQA 1HDTH 1KLJH 3ZZDA 2STBE 2GZ9A 4JK5A 3ODFA 4AFQA 2P3FH 3Q3XA 5E2PA 3QWCH 4BAHB 1K1JA 2BLVA 3ODDA 3RM2H 3RXVA 1ETTH 1HAPH 4IBLH 4CBNA 4FUGA 1BRUP 1O3OA 2ZFSA 1B7XB 4WH6A 3KGPA 4WJG2 1C2JA 1G2MA 5A0CA 3EGKH 2OTVA 4Y8ZA 1AMHA 8LPRA 1PPGE 5DP8A 3F9GA 3SUGA 3RXCA 1ZPZA 2ANMH 1GPZA 1HNEE 4A5TS 3BTKE 1ZMNA 1FNIA 5AHGH 2UUYA 2B9LA 1K22H 3E6PH 4DIHH 2ZO3H 4AB8A 2BDCA 1J8AA 3KQDA 3TJVA 1EAWA 2J4IA 1TGTA 3PO1B 3MO9A 1YCPH 3T2NA 1UVSH 3F6UH 6CHAB 1K1PA 3RXMA 1Z7KA 3LH1A 3DFLA 3ATMA 1K1MA 2CF8H 1CA8B 2XCFA 5FBIA 4RSPA 1DT2A 2HGTH 1BB0B 1V2VT 3QGJA 2QGRA 5T3HA 4Y8XA 4AN7A 3RXEA 4AFSA 1O32A 4HFPB 4X8TH 3WY8A 3LGUA 2O8WA 1O2JA 1P3EA 1GVKB 1TRNA 3EAJA 1G32B 1MTVA 4Y79A 2AIPA 3A7YA 1MZDA 1ESTA 1KY9A 2V35A 1T8LA 1PJPA 1DX5M 1EP6A 2WPLS 3OU0A 3LJOA 2ESTE 4CREA 3LPRA 4INLA 4JK6A 2V6NA 2FYQA 2M5TA 1FN8A 1O2MA 4IMQA 3PWCA 3EE0B 4NWLA 1BMMH 4O3TA 2JH5D 1GHAF 2EC9H 1P06A 5JBCS 1BRCE 1O36A 1UHBB 5GXPA 1LPKB 1YPHE 3RXDA 2D2DA 2FI3E 1LCYA 1Z6JH 3E1XB 4DVAU 4CHAC 1T31A 1ELAA 3MO6A 2VU8E 5C20A 2J2UA 3EBNA 4YOIA 1UVUH 3V7TA 4CRFA 2VVUA 4IN1A 2BDYA 3PLPA 5EXLA 2PV9B 3VB4A 4NGAH 3SZNA 2Y7XA 1C5WB 2FEQH 5K7RA 4BTIB 3RU4T 4Q7YA 2SFAA 3QK1A 4ZKRU 2LIZA 1EPTA 3BTTE 4NCYA 3TJNA 1WBGB 1DXPA 1NC6A 1FY4A 3E8LA 5JBAS 2F9BH 5DPAA 4Q7XA 1SGQE 4KGAA 3A87A 1BZXE 2Q1JA 2AERH 1EZUC 4KKDA 3JZ1B 1EXFA 1Y59T 1XM1A 1YPMH 2BVRH 4D9RA 2Q6DA 1GMDF 3A82A 5AVDA 1MZAA 1NPMA 3IITA 1A0LA 1CGHA 1MD8A 1ELFA 1Z71A 2ALPA 3SU4A 1A4WH 1VJ9U 2ZWLH 1Y3YA 2VH0A 3TGJE 4NIVA 1O3NA 5TCCA 2BD7A 4UONA 2D26C 8GCHG 1DUEA 5HYOA 1AWHB 1ZRKA 1O3FA 1GJDB 1BTYA 4GUXA 2JETC 1SLUB 2Y80A 4X1QU 4FUBA 4Y0YE 5EQRA 3M5MA 1AVXA 3ZVEA 4BAOB 1TX8A 2Z9LA 4LXBH 1CHGA 1Z8GA 4JYTA 3B8JA 3GY8A 2GVFA 3ITIA 1ZJDA 1XKAC 3VB3A 1HAXB 2ZF0H 4NSYA 1OX1A 2FODA 2BX4A 1TBQH 4MVNA 1P2IA 2VH6A 1GCDA 4MPWA 4A1TA 1LHDH 2GGVB 2ZCHP 3FFGA 4YZUA 3GCHC 6LPRA 2OBOA 1PYTC 1SL3A 3UOPA 2JH0D 1G3BA 1HGTH 4Y8YA 3UFAA 3SBKA 1DOJA 1Z8JB 2ZDKA 3VEQB 4YOJA 2RG3A 5EG4A 1TNKA 1DUAA 1TIOA 1W2KH 4GCHG 2ANWA 1EUFA 1TNIA 3A7VA 4H42U 1UTPA 4CR5A 1QB9A 1A7SA 4WVPE 1O3IA 1GJ5H 2GD4B 4E7NA 1SPJA 1JIRA 1OWHA 1QB6A 3H7OA 1JIMA 2TGDA 1FIZA 2ODYB 4I8HA 1TPSA 1EATA 2FIRH 3ZYEA 1OWEA 1QBNA 1VGCB 4MPVA 5DGJA 1MTNC 1VZQH 2G81E 1ZMJA 3GOVB 1C9TA 4GLYA 1P0SH 2BY5X 1TNJA 3H7TA 1G36A 1NT1A 2VWMA 1OYQA 4SGAE 1XMNB 4O03A 2O8MA 1ACBE 2G4UA 3HPTB 1G3EA 1TYNA 2OD3B 3GY5A 4NSVA 1BITA 1HAVA 1O5FH 1P9SA 3MHWU 4ABJA 3RDZA 4I8KA 3W94A 3ZZ5A 1GBFA 3MU1A 1HLTH 1THSH 1UTJA 1G3DA 2GCHG 1O33A 1UMAH 2PKSB 4KELA 3BTFE 1HFDA 1X7AC 4B73A 2QN5T 2C8XB 1FN6A 1G3CA 1P01A 1J9CH 2D1JA 3BEIB 2NU1E 3B9FH 1B0EA 3AVZA 2YOLA 1RTLA 1Y3VA 1WU1A 3SNCA 1RGQA 3BG4B 3TK5A 3AAUA 4WMDA 1AVWA 1LKAA 2Y6TA 2PKAA 2VIDA 1GHYH 4FUEA 2A7JA 5A0BA 4RKOB 4CRAA 1GG6C 1ANEA 3LOXA 1RXPA 2EI8A 2LPRA 4GHTA 4CBOA 3LKWA 2P8OB 1F0RA 1GHBF 3UWIA 3D49H 1Y8TA 4DIIH 2FZZA 3VGCC 2H5CA 1EJMA 2VIQA 4D8NA 1NY22 2FS8A 1P12E 2ZFRH 1CE5A 3UNQA 4B75A 3IWMA 1KXFA 1V2LT 4JZIA 1A0HB 3KIDU 3TITA 2F9UA 3A7ZA 3MU0A 3PMHB 1UJ1A 3BTWE 1CGJE 1YM0A 3U69H 5ESTE 3VB5A 3TU7H 1GVLA 3M61U 1H9IE 2ZTYA 3IG6B 3PTNA 4DGJA 4BNRA 3L33A 3I78A 1C1RA 4X2WA 3EQ0H 1OWJA 3T62A 4ABFA 2VIVA 2QCYA 1GBAA 4D76A 4HGCA 1QR3E 3GDSA 3OY6U 1O2WA 4Y10E 1MD7A 3OY5U 5AFZH 4VGCB 2G52A 1SB1H 5JBTA 3SJIA 4CRDA 2GCTC 3SI4H 1LQDB 1QHRB 2UUFB 2G55A 3KN2A 1HB0B 2PTCE 3MWIU 4KTSA 3M5NA 2QY0B 2VNTA 3SI3H 4MPUA 1C5UA 1B0FA 1C5RA 2OQUA 5JB8S 1FJSA 2EI6A 2BX3A 1LVBA 3RXBA 1NO9H 2PGQB 1ZHPA 4K69A 2TBSA 2EI7A 1NU7B 1BTHH 1NFWA 1P2QA 1C5XB 4AFUA 1KTTB 1Q3XA 2PGBB 3NZIA 1KXCA 3M35A 1GHZA 1O2IA 1DWCH 1ELVA 4YT7H 2A5AA 1TPOA 4Q80A 1LHEH 2BD9A 2QA9E 4I31A 1SFQB 3SJ9A 3M36A 4NIYA 2ZGBH 3BIVH 3RXQA 1L1NA 1LHFH 5CHAB 1GMHF 3PB1E 2ALVA 2FYRA 5EQSA 1H4WA 4Q7ZA 3URDA 3GYMA 1KXAA 2FOCA 2OC7A 1WUNH 1B5GH 1P03A 2CMYA 1SC8U 2ZPRA 1HYLA 2H5DA 4MNYA 4X1RU 3E0NB 2VIOA 3SUDA 3F1SB 3HGNA 1FAXA 2PKAB 2BD2A 2ZZUH 1P09A 1TNGA 1D3QB 2W26A 1SQTA 4OS2A 2Z3CA 2D8WA 2BQWB 7ESTE 4K3JA 3M7UA 1OKXA 2BZAA 2P94A 3D65E 3DD2H 2NU3E 1BRAA 3GCTF 1O2PA 1FY3A 4CH8B 5E2OA 2CGAA 1EP5A 3UY9A 2ZGCA 2Y5HA 1L4ZA 3B23B 2QV1A 1YCPM 3NPSA 1OP0A 3RC4A 1HV7A 4KTUA 3S9CA 1NFYA 1ZLRA 1D4PB 2PTNA 4X6OA 3ZV9A 5AF9H 1IQKA 1BJUA 1AI8H 2PW8H 3PM3A 2V3HH 5JBBS 1Y3UA 2XRCA 4ZHMU 1S6FA 1TOCB 1UVOA 1GDQA 3UNRA 4WXVA 3DFJA 3RXPA 1EZQA 1W13U 1ZGVA 3BN9A 1ZR0A 3MNBA 1BMNH 3M5LA 5CE1A 4MQAA 1F0SA 3SUEA 4UFEH 2FPZA 3O8BA 4B2BA 3JZ2B 2C8WB 2C3SA 3HK6B 3GCNA 4TY7A 2BVXH 2PSXA 1MUEB 2ZIQH 3V13A 4MLFB 1TBZH 3VPKA 1BMLA 5DP3A 2FTMA 1U6QA 4B2AA 1LVYA 1AIXH 1LMWB 2ZQ2A 3NKKA 2Y5FA 2GKVE 1A46H 3A85A 3STIA 4FU7A 2XBYA 2XYAA 5GIBA 2RDLA 2WPMS 4WY3A 1TALA 1WQVH 2AYWA 1RIWB 2HPPH 3RLYH 4IGDA 1QIXB 1DITH 3VFEA 3GICB 1C5SA 2GMTB 1V2WT 3ZZCA 4K1SA 2BDAA 4CH2B 3FP7E 1SG8B 2BZ6H 1G9IE 2TIOA 2Y7ZA 2BDGA 3A84A 2A4RA 4R0IA 3U8TH 2BY6X 3V3MA 1UHBA 3SGBE 3M7QA 1AFQC 2IN2A 4J2YB 1BHXB 2VVCA 3QO6A 4ASHA 1T7CA 3ZZ7A 1HPGA 3MNSA 3MNCA 4XSKU 3MFJA 2VVVA 3N7OA 2ZU4A 5C67A 1GHVH 3SHCH 2ZDVH 2WUBA 3HKIB 1EAIA 1QGFA 1DSUA 1FPHH 6ESTA 4X2VA 4A6LA 1P11E 2PR3A 4K2YA 6CHAC 1CGIE 4NFEA 1PPEE 2H9TH 2CV3A 1ZSLA 5F8XA 3U8RH 1XXDA 2FESH 4NG9H 1ZJKA 3MU4A 1HJAB 1EAXA 3LGVA 3SN8A 1AHTH 1LPZB 1O2SA 2ZFFH 1S6HA 5L2ZH 1NU9A 5L2YH 3U8OH 2QXJA 1MU8B 4BTUB 5B6OA 1O2YA 1C2HA 1XUKA 3KQBA 4AYYB 1AZZA 4ZH8A 3SNBA 1QL8A 1SLVB 1QNJA 4LK4A 3PTBA 2P3TB 1W7XH 4YOGA 4RN6A 5DK1A 4I32A 2G4TA 4YTAA 2Y82A 1O3LA 3C27B 7KMEH 3PYHA 1ELDE 3RXKA 1S0QA 2FOFA 1K1LA 3T27A 3C1KA 1YYY1 3BIUH 2WV5A 2XTTB 3PMJA 4YM9A 3P8OA 4IS5A 2UWPA 1GBHA 1GVZA 3MH6A 2ZDLA 1AU8A 3TH4H 4B1TA 1SHYA 2HNTC 4UDWH 3FP8E 1O5AB 1O39A 1FXYA 4MTBA 4D7GA 3R0FA 2BYAX 1AZ8A 3Q00A 4ABAA 1M9UA 3OX7U 1K1IA 2ZFTA 2QYIA 3Q3KA 4U2WA 3F9FA 1NZQH 4B2CA 1HXFH 4ISLA 1DICA 1IQFA 1SQOA 1PPFE 3LDXH 4XE4A 3ZVFA 1UTOA 3QUMP 3A7XA 2LNCA 1MCTA 2B8OH 1GHWH 3GY3A 1KXDA 5BPEA 3SOSA 1IQGA 3ZZ9A 2A5KA 4X6MA 1C5MD 1FMGA 2GV6A 1P05A 5GCHG 5E8EH 1V6DA 1GBTA 5EOKA 1OWIA 1LO6A 1GI0A 1E0FD 4K1TA 1TWXB 2HALA 4NZQA 3SJOA 1HXEH 4X8UH 2A32A 2NU4E 1GHAG 3SNDA 3SNEA 1C2KA 1ETRH 1IHTH 2UUJB 5H4IB 1LQEA 1V2MT 4UFDH 1L1GA 1DY9A 4ISHH 3S69A 3L3TA 4KP0A 1YPKH 1TRMA 2BB4A 1UTNA 4IC6A 2A31A 4GPGA 1AQ7A 2VWNA 3FZDA 3LJJA 1BBRE 1AVGH 1IAUA 1ABIH 5FX6A 1UCYK 1V2PT 4NFFA 1TGCA 2G8TA 1YF4A 1YBWA 3O8DA 1SBWA 3P8GA 1Z6EA 1SGFA 1CA0C 1ANDA 1HAYB 5GPIB 1H9HE 2R2MB 2BD5A 2G5VA 3ATLA 2BDIA 3LIWA 2OUAA 3SO3A 2BD8A 4X6NA 1O3GA 1QRWA 1FPCH 1O2KA 5A8YA 1GMDG 3QGNB 2DE9A 1C1MA 5HGGA 1P10A 4Z0KA 2Z9GA 1SGTA 4SGBE 1UCYE 2ANYA 4NA9H 2XBWA 4U30A 4CR9A 4MNWA 4U32A 2FS9A 1TMUH 3NXPA 3ZVAA 1TABE 4NA7A 1A5GH 3ZYDA 1W7GH 4AB9A 1MTWA 1LHCH 1XUGA 5AFYH 3UOUA 3AW1A 1SGEE 1O31A 4X8VH 5FPTA 1KLIH 1SVPA 1QJ6B 1ZTLA 2FWWA 1GI1A 2UUKB 1A5HA 1P57B 1SGPE 2H9EH 4I8GA 3U9AH 1VCPA 5C1UA 3M7TA 3RXSA 1GI3A 1HAHH 1NFXA 2P59A 3QZRA 4FU9A 3SU1A 3ATKA 1VGCC 2AGEX 3LT3A 1YPHC 3A86A 1SMFE 2CHAC 4UD9H 2FOGA 3GYLB 1ELTA 5ABWA 4A92A 1A2CH 1FZZA 3RXGA 1S0RA 2BVSH 1ESAA 3ELAH 1V2JT 1XUHA 3U1IB 3MTYA 1MTUA 1TPPA 1EPTC 4CHAB 3M5OA 1YKTA 3CENA 2ZA5A 5FX5A 3RXUA 1P9UA 4X1SU 1O3PB 2GTBA 1UCYH 3BG8A 1TBRH 2NWNA 3PLBA 1ELBA 2ILNA 2W3KA 4DG4A 5DO4H 1C5VA 2TPIZ 1ID5H 3TVJB 4OGXA 5TCAA 4AGKA 1O2OA 1G2LA 1DS2E 1XKBC 4I8LA 5F03A 2QXGA 3LC3A 4D9QA 2QC2A 1TX6A 2XWAA 1D6RA 1J14A 2ZECA 2GT7A 1UK3A 1PQAA 4DT7B 2ZHWH 3BTHE 1SI5H 1QBOA 5EODA 2BMGB 4B74A 2W3IA 1H9LB 2QIQA 2Y81A 4O3UA 4YESB 5K0HA 1OWDA 5FPSA 5JYIA 2CXVA 4FUCA 1FONA 1LVMA 1V2RT 5C3NA 4DJZB 1O30A 4OS5A 3UREA 1QJ1B 4X2YA 2ZPSA 3QTVH 4HZHA 1HCGA 2G00A 1HAZB 3PMBB 2P8OC 1DANH 2XBXA 2ZHQH 1UVTH 4DCDA 1TRYA 1O3CA 5CMXH 2TGPZ 5A09A 1GJCB 2ULLA 3VB7A 1UVPA 3KL6A 1AKSA 4JZDH 2JETB 4X1PU 3E0PB 5A2MH 3O8RA 2WUCA 4XBCA 4ZHLU 1HAGE 3URCA 3RUOA 4Y11E 1K1OA 3MH4A 4E05H 1Q2WA 4YO9A 2RCEA 3SU2A 1ZYOA 1WV7H 1VITF 1N8OC 3UPEA 3ESTA 3QLPH 1NRRH 4TPYA 4ZROA 3A81A 1GBDA 3GCHB 4FU8A 2GV7A 1PQ8A 1A0JA 1Y5AT 1MAYA 2BDHA 5EW1H 2F3CE 1ZZZA 1GHBG 1MQ5A 1ANCA 1BTUA 4VGCC 2XCNA 3RMLH 4IW4E 4ZKOU 1GBKA 2ZQ1A 3NK8A 3LGIA 2O9QA 1C2IA 1V3XA 1T8NA 4Y7BA 1D3PB 1O3KA 2F83A 3VB6A 4B76A 1FY8E 5E0JA 1C4U2 1BTXA 4I33A 1D6WA 1C1VH 1YLDA 1F5RA 2BOHB 4A1VA 3KCGH 1O34A 4Y71A 1W12U 1PQ5A 1GCTC 5PTPA 1NRNH 2BOKA 1MTNB 1C1NA 3RXTA 1KYNA 4UFGH 3GISB 4E7RG 4FUIA 1T8MA 5F6MA 1GGDC 5C1YA 5E0GA 4AG2A 5C1XA 2Q6FA 3LH3A 2B7DH 3A80A 1GI5A 4XFQA 1CBWB 4X6PA 5CHAC 2UWOA 2DUCA 1ZHRA 3U98H 2ZU5A 1GBLA 2OXSA 3LGTA 5DP6A 3HGPA 2I6QA 1C5OH 1YC0A 3GDUA 3UTUH 2B0FA 2J92A 3SORA 4GVUA 1O3JA 1W14U 3TIUA 1ANBA 1WAYB 3A8DA 3KQEA 1WYKA 1LVOA 4LZ4B 1GL1A 1KDQB 1IQMA 1QQUA 2XC4A 3SUFA 1H8DH 4WH8A 2TRMA 2C90B 4E06H 1C5QA 2BLWA 2PLXA 3S7KB 2ZU3A 2BTCE 3I77A 2XXLA 3BSQA 3CS0A 2ZCKP 2VIPA 1ZOMA 1TX7A 1O37A 4GHQA 2K7XA 4Y7AA 7GCHF 1ZTJA 1AKSB 3GY7A 1KLTA 1UTKA 1GMHG 1GBBA 1UO6A 1GG6B 1UTLM 4ABHA 1IQJA 3Q76A 3DUXH 2H9HA 2OP9A 1QB1A 1BJVA 1O2VA 2THFB 1QURH 4JMYA 4UFFH 5FCRA 3A8CA 3F9EA 3D62A 4AGJA 4NWKA 4PROA 6GCHF 3VGCB 1V2UT 1IQIA 1LHGH 4I8JA 1MTSA 3NCLA 1H8IH 4THNH 9LPRA 5L6NH 3KEEA 1LTOA 4FVBA 1TB6H 1Z8IB 1F5KU 1P04A 4FUJA 4OS7A 1AO5A 2G51A 2GT8A 3QX5H 1SOZA 2WPKS 1ETSH 2H6MA 4CRCA 1D9IA 2R0KA 2I6SA 5TJXA 5JDUB 1QJ7B 2VGCC 3K6ZA 4INHA 1TGNA 3GCTG 2Z9JA 1ZSKA 3MYWA 1A5IA 2SGAA 1RD3B 3RC6A 4NZLA 1O3MA 2FLBH 4IN2A 3A8BA 2QXIA 1O5BB 2KAIA 2TGTA 4AORA 2QAAA 5LPEA 1DSTA 3E91A 3H5CB 3EA7A 3T26A 3SGAE 3AASA 3P8NA 2B5TB 3TK6A 5FAHA 1INCA 1J17T 1SR5C 3OTJE 1RIWC 1O3BA 3GY2A 2QF0A 3VXFH 1L2EA 1FIWA 3ZZ3A 1CHOF 3Q77A 1F2SE 1NROH 1QY6A 1QA0A 2GMTC 3RP2A 3ZVGA 2A7HA 1BCUH 1C4Y2 1GMCF 3A83A 1YPGH 1BTZA 2XC0A 4Y6DA 2PWXA 3SV6A 1N6YA 4JYUH 1V2NT 1THPB 2XW9A 2YNAA 1FQ3A 1O5DH 1RTKA 5LH8A 2OINA 2H1UA 1E36B 2QXHA 2VB0A 4J1YA 2OQ5A 2FXRA 4BOHA 1AB9B 2V0BA 1PPCE 1GBEA 5GJ4B 3KF2A 2CN0H 4OS4A 2HVXA 2BXTH 1KTSB 3MU8A 4JZFH 3SV7A 2ZTZA 4BAQB 5EXMA 3SQHE 1JMOH 1TOMH 1W8BH 4MNXA 1XUIA 4MDSA 1HJAC 3FZZA 3PROA 2O8UA 1EOJA 1Y3WA 3RU4E 4X0WU 3UIRA 4ABIA 2FOEA 3S0NA 3CP7A 3KQCA 2R3YA 1GJ7B 2BM2A 3TLOA 3RMNH 1C5NH 7LPRA 3K65B 2AEIH 1C5LH 3MI4A 1C5YB 4UE7H 1FLEE 4TY6A 1YGCH 1C5ZB 2F91A 1WCZA 3RU4D 2GZ7A 1HAIH 1T4VH 2C4FH 4FUDA 5HMAA 3R3GB 5T6FA 3EA9A 3S7HB 1AE8H 4ISNA 2ODPA 1IHSH 3TGIE 4XDEA 1GJ6A 4JZEH 1EJNA 1GJBB 1MCVA 1ABJH 3UR9A 2IJOB 1Z1IA 2ZHEH 1AUJA 2WYGA 1YCPK 8ESTE 1EB1H 4JCNA 2BLQA 1Y5UT 1A3EH 1H1BA 1ZHMA 1HRTH 1KSNA 2HNTE 1SGIB 1SOTA 5DG6A 3TJUA 3PO1C 2ZU1A 5LPRA 1GBIA 4AFZA 1P2OA 1SGRE 1Z8RA 1HIAA 5DP4A 4OS1A 3T29A 1OXGA 4ZXYH 1C2GA 2J34A 2SGEE 1O2TA 1E38B 1OWKA 1V2QT 4ZKNU 1YP9A 5DJ7A 1BIOA 3RXHA 1C2DA 1GI9B 1EB2A 1C1OA 2OC0A 1AGJA 2A4GA 2KAIB 3ZZAA 1CSOE 3M3SA 2BLOA 1BHXF 1XUFA 2PUXB 4AX9H 3D23A 3SNAA 1JRTA 2J95A 3P6ZB 1C2LA 1BT7A 2BD4A 2WPJS 3ZZ4A 4AOQA 4DOQA 2ZI2H 5HM9A 1P2NA 2J94A 5SGAE 4KTCA 1C1QA 2A1DB 4GAWA 2EEKA 1FDPA 1E35B 1AWFH 1P2KA 4GSOA 1QFKH 1G37A 1SLXB 3AAVA 4ABEA 1A1RA 2AMDA 2FOBA 1QA7A 3DA9B 3TK9A 1WTHD 3UR6A 1DXWA 5EXNA 2VINA 3RLWH 3RXIA 3DT0H 4O97A 3TH2H 2SGDE 1ZRBA 1GI2A 1V2KT 1NESE 2FOMB 3CS7A 1AFQB 2CF9H 3FP6E 3SW2B 1ARBA 4NIXA 5C5NA 1C1UH 1A61H 4OGYA 1FV9A 5I25A 2YNBA 3PV4A 5EPNA 3UWJH 1QCPA 4LOYH 1BBRK 2J38A 5BRRE 4TPIZ 1O3EA 1DVAH 1TQ0B 5IDKA 1TMBH 2W7SA 1WOFA 5T6DA 2Z6BD 4WWYA 1ELCA 2G5NA 1ELEE 2ZG0H 3BTEE 4X2XA 1O3HA 4H6TA 4BAKB 2BD3A 1Z1JA 1QL7A 1GWAA 1OPHB 2SGFE 1JWTA 4CRGA 2VJ1A 1GI8B 3F68H 3MH5A 3LGYA 1SGDE 1EAUA 3RXRA 1MBMA 1VR1H 2QF3A 3STJA 1PPHE 2J9NA 1DDJA 3BEFB 1FY1A 5GCHF 1QBVH 2AH4X 3NUMA 3K2UA 1HAOH 5DP7A 1Y5BT 3I29A 2Z9KA 1O3AA 2AGGX 1DWBH 5A8XA 3BEUA 1BMAA 3VXEH 3A89A 4ABDA 5GWZA 1HIAB 1LKBA 1LDTT 1BOQA 3SV9A 5DKMA 2SGPE 2OLGA 3OYPA 3TGKE 1A3BH 5LGOA 1F7ZA 4ZAEA 2WV4A 3SU0A 2UWLA 1GHXH 3BTME 4FUHA 3M3VA 3GY6A 4IMZA 4AZ2B 1S82A 2PUQH 4WMFA 1RRKA 2A2XH 1TA2A 1GI4A 2HRVA 1C1PA 3ZZ6A 2ZDMA 1TE0A 2FLRH 4X8SH 1W3CA 2R2WU 1RJXB 2ZDAH 4ISOA 4HI3A 1W11U 2C8YB 5EGMA 3SU6A 4F4OC 1OS8A 2FI5E 2AGIX 2HNTF 1MMJN 2FOAA 1LPGB 2ZNKH 2AS9A 1P2MA 2P3UB 2DE8A 3MH7A 5IYTA 3RXFA 4BXSA 1O5CB 2FP7B 1TMTH 2ZP0H 1DLEA 4FVDA 4F49A 4FXGH 1FY5A 1BBRH 3QZQA 2A45B 2A5IA 1PYTD 3QTOH 3A7TA 1VITH 3RC5A 2SGQE 1VCWA 2OCVB 1TGSZ 3MNXA 1ELGA 4XOJA 1BA8B 1O0DH 3MMGA 1HJ8A 1KXBA 3KHVA 3MO3A 2BXUH 5DP5A 1MU6B 4YT6H 1C5PA 1HJ9A 1NS3A 2K1QA 1BUIA 3SGQE 1W0ZU 5C2ZA 1GDUA 2HLCA 1OYTH 1TA6A 1TONA 1NTPA 2P16A 1K2I1 1PPZA 1CA0B 1UTMA 2FI4E 2WPHS 1XX9A 1GI6A 3E16B 2F9OA 3MU5A 1QTFA 3BTGE 3GY4A 1S84A 1FI8A 8GCHF 4HTCH 2PKSC 1QRXA 2R0LA 3RXOA 1FAKH 5G4BA 1DPOA 4Y76A 2BY8X 1O2GH 1QRZA 3E3TA 4QT8C 2TGAA 1AFEH 1BRBE 1NM6A 1TLDA 2FX4A 3A8AA 1SQAA 1C1WH 3MOCA 1QL9A 3BG4C 1NFUA 2Z3EA 1GDNA 1F0TA 2F9NA 4JZ1A 3W95A 5DP9A 9ESTA 1GBMA 2GDEH 1KDQA 1SFIA 4RKJB 2ZTXA 1E34B 1FUJA 1IQNA 1EKBB 2ZCLP 2F9PA 1MKWK 3A88A 2R3UA 1O2LA 1EQ9A 3GCOA 1TQ7B 3QN7A 2CJIA 3GDVA 2GX4A 1QQ4A 3RXJA 5A8ZA 1K21H 2BDBA 4GCHF 1WSSH 1VITG 1PPBH 2JH6D 4NIWA 3SQEE 4TWYA 1SGFG 1WTGH 1DWDH 1C9PA 2CHAB 4ESTE 2HOBA 4DY7B 1GI7B 1V2ST 1YPEH 1C2EA 1DFPA 1IQEA 3BF6H 1C2FA 2STAE 4MNVA 3HK3B 1UK2A 1O38A 1XVMA 4O9VA 1F0UA 2OC8A 4WXIA 2JKHA 2AMPA 1XXFA 2VWOA 3FVFB 4A7IB 3SJKA 1WQSA 1F92A 1SGNE 3U1JB 5EQQA 1EPTB 8KME2 1K28D 1CBWC 2HPQH 4U01A 1GL0E 3O8CA 2ZEBA 3K6YA 3P8FA 5J4SA 2WINI 2IPHA 4DW2U 3ZVDA 4YLQH 3S9BA 4OS6A 2C93B 2EA3A 3TNSA 2WPIS 2ZPQA 1W0YH 5ESBA 3ZZBA 1N6XA 2A2QH 3P92A 2A4OA 1BDAA 1O5GH 3V0XA 2PFEA 2Z7FE 3TNTA 2P93A 1O2UA 1BTWA 3ZVCA 3FANA 2WYJA 4R8TB 2GCHF 3HATH 4Y0ZE 3TPIZ 3M37A 1T8OA 5LPFA 3LGWA 1EJAA 4K5ZA 1TAWA 1TPAE 2Y5GA 2FM2A 1Y3XA 1P8VC 1AN1E 1ARCA 3P70B 4ZXXH 2XWBI 4BXWA 1MKWH 2R9PA 2W7UA 2GP9B 4X1NU 4DURA 1YLCA 1ZSJA 3LU9B 4NA8A 2Z9IA 3PMAB 4BANB 4TYDA 1ESBA 5ETXA 1T4UH 3TJOA 2XNIA 1PFXC 4ZMAH 1MKXK 3SV8A 4K8YA 1MH0A 1CU1A 3BTQE 3G01A 4K8BA 1TFXA 3NWUA 4AG1A 1N8OB 1ZMLA 4ABBA 1HUTH 4ZHAA 2IOTA 1OOKB 7GCHG 1JBUH 1L4DA 1UK4A 1J16A 1O35A 1CT0E 5EW2H 2ZHFH 2F9VA 1O2RA 5E0HA 1EX3A 4ISIH 2SNWA 2A4QA 6GCHG 4I7YH 2ZGXH 4H4FA 3TH3H 2VWLA 1EZXC 1S81A 3AW0A 1XVOA 2ZC9H 2BQ7B 1W10U 4Q2KA 1K9OE 3EDXB 4D7FA 2V3OH 1JOUB 1OP8A 4B71A 1SHHB 2H2ZA 1VCQA 1GCTB 3DHKH 3QDZB 3ZZ8A 2FX6A 1HAVB 1SSXA 2A0QB 2AFQB 2PSYA 2OBQA 1AE5A 2BHGA 2GDDA 1AB9C 1CQQA 1GGDB 1NRPH 4WF8A 1E37B 1KXEA 2NU2E 4ABGA 4H6SB 3SU5A 1T32A 1EOLA 4A1XA 2ZFPH 3RXAA 1GBCA 3BTDE 2BY9X 1AD8H 2FDAA 4INKA 3T25A 4BAMB 2OC1A 5F8TA 3ATWA 1CHOG 4YLUA 3F9HA 2SNVA 1ZTKA 1S85A 1ZGIA 4IC5A 3ZVBA 1L1JA 1P02A 1VJAU 3RXLA 3UQOA 1GMCG 1Q31A 2ZGHA 2AIQA 1HBTH 2RA3A 1ZPCA 3P95A 3S9AA 1G30B 1GJ8B 2GCTB 1AUTC 2PHBA 1V2TT 1O3DA 1RS0A 3SV2H 3SU3A 1XUJA 1MKXH 3FAOA 4AYVB 1C5TA 3ATIA 4K1EA 2ASUB 3UUZA 4ZUHA 2ZKSA 5C5OA 1YPJH 2A7CA 3A7WA 1F5LA 1C4V2 1CO7E 1O2XA 5T6GA 5FPYA 1C1SA 1O2HA 1ZPBA 3EA8A 3E90B 5EPYA 5L30H 1D3TB 2ANKH 1OP2A 5FXLA 4M7GA 5A0AE 1O2NA 1IQLA 1P3CA 2ZHDA 5FCKA 3K9XB 1V2OT 3V12A 4ZKSU 1AY6H 3UQVA 2AMQA 1BQYA 1UTQA 1C2MA 2Z3DA 3PWBA 3RMOH 1P2JA 5HM2A 1MAXA 1GJAB 3OSYA 1THRH 1D3DB 1NN6A 1NRQH 2RA0A 3RM0H 1CT2E 2FTLE 2O8LA 1K1NA 3P17H 1NRSH 1BTPA 1OSSA 5JPMH 4UEHH 1GJ4H 1IOEA 2ZFQH 1RTFB 5F8ZA 4TWWA 1L0ZA 3LONA 4CRBA 2ZDNA 1S83A 1MQ6A 3ENSB 1GJ9B 3T28A
chains in the Genus database with same CATH superfamily
1RFNA 2FOHA 5HXFA 1K0HA 2Z94A 3Q3YA 4Z6AH 2Q6GA 1SGYE 5JB9S 1IQHA 2VGCB 2ZU2A 4K60A 2C8ZB 4MG3A 2XBVA 3T5FH 3HKJB 1MBQA 2P95A 5J4QA 1O2QA 1PQ7A 2FO9A 3BV9B 2BY7X 2NU0E 2BQ6B 3KYGA 1O5EH 3SJ8A 3LC5A 5FHTA 1TNLA 4XBBA 5I46H 3RMMH 4M9FA 3SHAH 5GDSH 2ZGJA 1DM4B 1DWEH 2W5EA 4WMEA 3L6PA 1S5SA 2O8TA 4XBDA 1EASA 2XC5A 1TGBA 1JXPA 3ZV8A 1TNHA 2WSSD 1DY8A 2VIWA 2FMJA 3F2FA 1JRSA 1SLWB 1N1LA 3N7EA 4B6EA 1EZSC 1ORFA 1C1TA 5FBEA 1YPLH 1O2ZA 3UNSA 1DLKB 1KIGH 5EU8A 1CT4E 1GBJA 3KNXA 4BTTB 1J15A 3PLKA 3EYDA 2HWLB 4JYVH 2GZ8A 3M3TA 1CVWH 4FUFA 4MPXA 4LZ1H 1DE7H 4RT1A 1SGCA 2ODQA 1HDTH 1KLJH 3ZZDA 2STBE 2GZ9A 4JK5A 3ODFA 4AFQA 2IJD1 2P3FH 3Q3XA 5E2PA 3QWCH 4BAHB 1K1JA 2BLVA 3ODDA 3RM2H 3RXVA 1ETTH 1HAPH 4IBLH 4CBNA 4FUGA 1BRUP 1O3OA 2ZFSA 1B7XB 4WH6A 3KGPA 4WJG2 1C2JA 1G2MA 5A0CA 3EGKH 2OTVA 4Y8ZA 1AMHA 8LPRA 5C94A 1PPGE 5DP8A 3F9GA 3SUGA 3RXCA 1ZPZA 3SYJA 2ANMH 1GPZA 1HNEE 4A5TS 2RDEA 3BTKE 1ZMNA 1FNIA 5AHGH 2YMSD 2UUYA 2B9LA 1K22H 3F2GA 3E6PH 4DIHH 2ZO3H 4AB8A 2BDCA 1J8AA 3KQDA 3TJVA 1EAWA 2J4IA 1TGTA 3PO1B 3MO9A 1YCPH 3T2NA 1UVSH 3F6UH 3UB0A 2JJ1D 6CHAB 1K1PA 3RXMA 1Z7KA 3LH1A 3DFLA 3ATMA 3FKSD 1K1MA 2CF8H 1CA8B 2XCFA 5FBIA 4RSPA 1DT2A 2HGTH 1BB0B 1V2VT 3QGJA 2QGRA 5T3HA 4Y8XA 4AN7A 3RXEA 4AFSA 1O32A 4HFPB 4X8TH 3WY8A 3LGUA 2O8WA 1O2JA 1P3EA 1GVKB 1TRNA 3EAJA 1G32B 1MTVA 4Y79A 2AIPA 3A7YA 1MZDA 1ESTA 1KY9A 2V35A 1T8LA 1PJPA 1DX5M 1EP6A 2WPLS 3OU0A 3LJOA 2ESTE 4CREA 3LPRA 4INLA 4JK6A 2V6NA 2FYQA 2M5TA 1FN8A 1O2MA 4IMQA 3PWCA 3EE0B 4NWLA 1BMMH 4O3TA 2KCAA 2JH5D 1GHAF 2EC9H 1P06A 5JBCS 1BRCE 1O36A 1UHBB 5GXPA 1LPKB 1YPHE 3RXDA 2D2DA 2FI3E 1LCYA 1Z6JH 3E1XB 3GS9A 4DVAU 1T31A 4CHAC 1ELAA 3MO6A 2VU8E 5C20A 2J2UA 3EBNA 4YOIA 1UVUH 3V7TA 4CRFA 2VVUA 4IN1A 2BDYA 3PLPA 5EXLA 2PV9B 3VB4A 4NGAH 3SZNA 1SQRA 2Y7XA 1C5WB 2FEQH 5K7RA 4BTIB 3RU4T 4Q7YA 2SFAA 3QK1A 4ZKRU 2LIZA 1EPTA 3BTTE 4NCYA 3TJNA 1WBGB 1DXPA 1NC6A 1FY4A 3E8LA 5JBAS 2F9BH 5DPAA 4Q7XA 1SGQE 4KGAA 3A87A 1BZXE 2Q1JA 2AERH 1EZUC 2L74A 4KKDA 3JZ1B 1EXFA 1Y59T 1XM1A 1YPMH 2BVRH 4D9RA 2Q6DA 1GMDF 3A82A 5AVDA 1MZAA 1NPMA 2YMSB 3IITA 1A0LA 1CGHA 1MD8A 1ELFA 1Z71A 2ALPA 2F4LA 3SU4A 1A4WH 1VJ9U 2ZWLH 1Y3YA 2VH0A 3TGJE 4NIVA 1O3NA 5TCCA 2BD7A 4UONA 5GNDA 2D26C 8GCHG 1DUEA 5HYOA 1AWHB 1ZRKA 1O3FA 1GJDB 1BTYA 4GUXA 2JETC 1SLUB 2Y80A 4X1QU 4FUBA 4Y0YE 5EQRA 3M5MA 1AVXA 3ZVEA 4BAOB 1TX8A 2Z9LA 4LXBH 1CHGA 1Z8GA 4JYTA 3B8JA 3GY8A 2GVFA 3ITIA 1ZJDA 1XKAC 3VB3A 1HAXB 2ZF0H 4NSYA 1OX1A 2FODA 2BX4A 1TBQH 1VKYA 4MVNA 1P2IA 2VH6A 1GCDA 4MPWA 4A1TA 1LHDH 2GGVB 2ZCHP 3FFGA 5CHBA 3GCHC 4YZUA 6LPRA 2OBOA 1PYTC 1SL3A 2LELA 3UOPA 2JH0D 3WWFA 1G3BA 1HGTH 4Y8YA 5C0TA 3UFAA 3SBKA 1DOJA 1Z8JB 5EIYA 2ZDKA 3VEQB 4YOJA 2RG3A 5EG4A 1TNKA 1DUAA 1TIOA 1W2KH 4GCHG 2ANWA 1EUFA 1TNIA 3A7VA 4H42U 1UTPA 4TT3D 4CR5A 1QB9A 1A7SA 4WVPE 1O3IA 1GJ5H 2GD4B 4E7NA 1SPJA 1JIRA 1OWHA 1QB6A 3H7OA 1JIMA 2TGDA 1FIZA 2ODYB 4I8HA 1TPSA 1EATA 2FIRH 3ZYEA 1OWEA 1QBNA 1VGCB 4MPVA 5DGJA 1MTNC 1VZQH 2CK3D 2G81E 1ZMJA 3GOVB 1C9TA 4GLYA 1P0SH 2BY5X 1YWUA 1TNJA 3H7TA 1G36A 1NT1A 2VWMA 1OYQA 4SGAE 1XMNB 4O03A 4FOUC 2O8MA 1ACBE 1H8ED 2G4UA 3HPTB 1G3EA 1TYNA 2OD3B 3GY5A 4NSVA 1BITA 1HAVA 1O5FH 1P9SA 3MHWU 4ABJA 3RDZA 4I8KA 3W94A 3ZZ5A 5DSFA 1GBFA 3MU1A 1HLTH 1THSH 1UTJA 1G3DA 2GCHG 1O33A 5EJLA 2LP6A 1UMAH 2PKSB 4KELA 3BTFE 1HFDA 1X7AC 4Q63A 4B73A 2QN5T 2C8XB 1FN6A 1G3CA 1P01A 1J9CH 2D1JA 3BEIB 2NU1E 3B9FH 1B0EA 3AVZA 2YOLA 1RTLA 1Y3VA 1WU1A 3SNCA 1RGQA 3BG4B 3TK5A 2V3MA 3AAUA 4WMDA 1AVWA 1LKAA 2Y6TA 2PKAA 2VIDA 1GHYH 4FUEA 2A7JA 5A0BA 4RKOB 4CRAA 1GG6C 1ANEA 3LOXA 4ACBA 1RXPA 2EI8A 2LPRA 4GHTA 4CBOA 3LKWA 2P8OB 1F0RA 4XRNA 1GHBF 3UWIA 3D49H 1Y8TA 4DIIH 2FZZA 3VGCC 2H5CA 1EJMA 2VIQA 4D8NA 1NY22 2FS8A 1P12E 2ZFRH 1CE5A 3UNQA 4B75A 3IWMA 1KXFA 1V2LT 4JZIA 1A0HB 3KIDU 3TITA 2F9UA 3A7ZA 3MU0A 3PMHB 1UJ1A 3BTWE 1CGJE 1YM0A 3U69H 5ESTE 3VB5A 3TU7H 1GVLA 3M61U 1H9IE 2ZTYA 3IG6B 3PTNA 4DGJA 4BNRA 3L33A 3I78A 1C1RA 4X2WA 3EQ0H 4DT4A 1OWJA 3T62A 4ABFA 2VIVA 2QCYA 1GBAA 4D76A 4HGCA 1QR3E 3GDSA 3OY6U 1O2WA 4Y10E 1MD7A 3OY5U 5AFZH 4VGCB 2G52A 1SB1H 5JBTA 3SJIA 4CRDA 2GCTC 3SI4H 1LQDB 1QHRB 2UUFB 2G55A 3KN2A 1HB0B 2PTCE 3MWIU 4KTSA 3M5NA 2QY0B 2VNTA 3FOAA 4MPUA 3SI3H 1C5UA 1B0FA 1C5RA 2OQUA 5JB8S 1FJSA 2EI6A 2BX3A 1LVBA 3RXBA 1NO9H 2PGQB 1ZHPA 4K69A 2TBSA 2EI7A 1NU7B 1BTHH 1NFWA 1P2QA 1C5XB 4AFUA 1KTTB 1Q3XA 4ZCNA 2PGBB 3NZIA 1KXCA 3M35A 1GHZA 1O2IA 1DWCH 1ELVA 4YT7H 2A5AA 1TPOA 4Q80A 1LHEH 2BD9A 2QA9E 4I31A 1SFQB 3SJ9A 3M36A 4NIYA 2ZGBH 3BIVH 3RXQA 1L1NA 1LHFH 5CHAB 1GMHF 3PB1E 2ALVA 2FYRA 5EQSA 1H4WA 4Q7ZA 3URDA 2J97A 1KXAA 3GYMA 2EQNA 2FOCA 2OC7A 1WUNH 1B5GH 1P03A 2CMYA 1SC8U 2ZPRA 1HYLA 2H5DA 4MNYA 3PRDA 4X1RU 3E0NB 2VIOA 3SUDA 3F1SB 3HGNA 1FAXA 2PKAB 2BD2A 2ZZUH 1P09A 1TNGA 2W6ID 1D3QB 2W26A 1SQTA 4OS2A 2Z3CA 2D8WA 2BQWB 7ESTE 4K3JA 3M7UA 1OKXA 2BZAA 2P94A 3D65E 3DD2H 2NU3E 1BRAA 3GCTF 1O2PA 1FY3A 4CH8B 5E2OA 2CGAA 1EP5A 3UY9A 2ZGCA 2Y5HA 1L4ZA 3B23B 2QV1A 1YCPM 3NPSA 1OP0A 3RC4A 1HV7A 4KTUA 3S9CA 1NFYA 1ZLRA 1D4PB 2PTNA 4X6OA 3ZV9A 5AF9H 1IQKA 1BJUA 1AI8H 2PW8H 3PM3A 2V3HH 5JBBS 1Y3UA 2XRCA 4ZHMU 1S6FA 1TOCB 1UVOA 1GDQA 3UNRA 4WXVA 3DFJA 3RXPA 1EZQA 1W13U 1ZGVA 3BN9A 4F48B 1ZR0A 3MNBA 1BMNH 3M5LA 5CE1A 4MQAA 1F0SA 3SUEA 4UFEH 2FPZA 3O8BA 4B2BA 3JZ2B 2C8WB 2C3SA 3HK6B 3GCNA 4TY7A 2BVXH 2PSXA 1MUEB 2ZIQH 3V13A 4MLFB 1TBZH 3VPKA 2HVYB 1BMLA 5DP3A 2FTMA 1U6QA 4B2AA 1LVYA 1AIXH 1LMWB 2ZQ2A 3NKKA 2Y5FA 2GKVE 1A46H 3A85A 3STIA 4FU7A 2RFKC 2XBYA 2XYAA 5GIBA 2RDLA 2WPMS 4WY3A 1TALA 1WQVH 2AYWA 1RIWB 2HPPH 3RLYH 4IGDA 1QIXB 1WDIA 1DITH 3VFEA 3GICB 1C5SA 2GMTB 1V2WT 3ZZCA 4K1SA 2BDAA 4CH2B 3FP7E 1SG8B 2BZ6H 1G9IE 2TIOA 2Y7ZA 2BDGA 3A84A 2A4RA 4R0IA 3U8TH 2BY6X 3V3MA 3N7DA 1UHBA 3SGBE 3M7QA 1AFQC 2IN2A 4J2YB 1BHXB 2VVCA 3QO6A 4ASHA 1T7CA 3ZZ7A 1HPGA 2V7QD 3MNSA 3MNCA 4RT0A 4XSKU 3MFJA 2VVVA 3N7OA 2ZU4A 5C67A 1GHVH 3SHCH 2ZDVH 2WUBA 3HKIB 1EAIA 1QGFA 1DSUA 1FPHH 6ESTA 4X2VA 4A6LA 1P11E 2PR3A 4K2YA 6CHAC 1CGIE 4NFEA 1PPEE 2H9TH 2CV3A 1ZSLA 5F8XA 3U8RH 1XXDA 2FESH 4NG9H 1ZJKA 3F0PA 3MU4A 1HJAB 1EAXA 3LGVA 3SN8A 1AHTH 1LPZB 1O2SA 2ZFFH 1S6HA 5L2ZH 1NU9A 5L2YH 3U8OH 2QXJA 1MU8B 4BTUB 5B6OA 1O2YA 1C2HA 1XUKA 3KQBA 4AYYB 1AZZA 4ZH8A 3SNBA 1QL8A 1SLVB 1QNJA 4LK4A 3PTBA 2P3TB 1W7XH 4YOGA 4RN6A 5DK1A 4I32A 2G4TA 4YTAA 2Y82A 1O3LA 3C27B 7KMEH 3PYHA 1ELDE 3RXKA 1S0QA 2FOFA 1K1LA 3T27A 3C1KA 1YYY1 3BIUH 2WV5A 2XTTB 3PMJA 4YM9A 3P8OA 4IS5A 2UWPA 1GBHA 1GVZA 3MH6A 2ZDLA 1AU8A 3TH4H 4B1TA 1SHYA 2HNTC 4UDWH 3FP8E 1O5AB 2QF5A 5FL7D 1O39A 1FXYA 4MTBA 4D7GA 3R0FA 2BYAX 1AZ8A 2JIZD 3Q00A 4ABAA 1M9UA 3OX7U 1K1IA 2ZFTA 1WXRA 2QYIA 3Q3KA 4U2WA 3F9FA 1NZQH 3F2HA 4B2CA 1HXFH 4ISLA 1DICA 1IQFA 1SQOA 1PPFE 3LDXH 4XE4A 3ZVFA 1UTOA 3QUMP 3A7XA 2LNCA 1MCTA 2B8OH 1GHWH 3GY3A 1KXDA 5BPEA 3SOSA 1IQGA 3ZZ9A 2A5KA 4X6MA 1C5MD 1FMGA 2GV6A 1P05A 5GCHG 5E8EH 1V6DA 1GBTA 5EOKA 1OWIA 1LO6A 1GI0A 4Z1MD 1E0FD 4K1TA 1TWXB 2HALA 4NZQA 3SJOA 1HXEH 1MABB 4X8UH 2A32A 2NU4E 1GHAG 3SNDA 3SNEA 1C2KA 1ETRH 1IHTH 2UUJB 5H4IB 1LQEA 1NBME 1V2MT 4UFDH 1L1GA 1DY9A 4ISHH 3S69A 3L3TA 2YMSC 4KP0A 1YPKH 1TRMA 2BB4A 1UTNA 4IC6A 2A31A 4GPGA 1AQ7A 1W0JD 2WHXA 2VWNA 3FZDA 3LJJA 1BBRE 1NBMD 1AVGH 1IAUA 1ABIH 5FX6A 1UCYK 1V2PT 3WWBA 4NFFA 1TGCA 2G8TA 1YF4A 1YBWA 3O8DA 1SBWA 3P8GA 1Z6EA 1SGFA 1CA0C 1ANDA 1HAYB 4F55A 5GPIB 1H9HE 2R2MB 2BD5A 2G5VA 3ATLA 2BDIA 3LIWA 2OUAA 3SO3A 2BD8A 4X6NA 1O3GA 1QRWA 1FPCH 1O2KA 5A8YA 1GMDG 3QGNB 2DE9A 1C1MA 5HGGA 1P10A 4Z0KA 2Z9GA 1SGTA 4SGBE 1UCYE 2ANYA 4NA9H 2XBWA 4U30A 4CR9A 4MNWA 4U32A 2FS9A 1TMUH 3NXPA 3ZVAA 1TABE 2KCOA 1A5GH 2XOKD 4NA7A 1W7GH 3ZYDA 5HIYA 4AB9A 1MTWA 1LHCH 1XUGA 5AFYH 3UOUA 3AW1A 1SGEE 1O31A 4X8VH 5FPTA 1KLIH 1SVPA 1QJ6B 1ZTLA 2FWWA 1GI1A 2UUKB 1A5HA 1P57B 1SGPE 2H9EH 4I8GA 3U9AH 1VCPA 5C1UA 3M7TA 3RXSA 1GI3A 1HAHH 1NFXA 2P59A 3QZRA 4FU9A 3SU1A 3ATKA 1VGCC 2AGEX 2J98A 3LT3A 1YPHC 3A86A 2KCPA 1SMFE 2CHAC 4UD9H 2FOGA 3GYLB 1ELTA 5ABWA 4A92A 1A2CH 1FZZA 3RXGA 1S0RA 2BVSH 1ESAA 3ELAH 1V2JT 5KECA 1XUHA 3U1IB 3MTYA 1MTUA 1TPPA 1EPTC 4CHAB 3M5OA 1YKTA 3CENA 2ZA5A 5FX5A 3RXUA 1P9UA 4X1SU 1O3PB 2GTBA 1UCYH 3BG8A 1TBRH 2NWNA 3PLBA 1ELBA 2ILNA 2W3KA 4DG4A 5DO4H 1C5VA 2TPIZ 1ID5H 3TVJB 4OGXA 3U28C 5TCAA 4AGKA 1O2OA 1G2LA 1DS2E 1XKBC 4I8LA 5F03A 2QXGA 2KX4A 3LC3A 4D9QA 2QC2A 1TX6A 2W6JD 2XWAA 1D6RA 1J14A 2ZECA 2GT7A 1UK3A 1PQAA 4DT7B 2ZHWH 3BTHE 1SI5H 1QBOA 2WZQA 5EODA 2BMGB 4RI0A 4B74A 2W3IA 1H9LB 2QIQA 2Y81A 4O3UA 4YESB 5K0HA 1OWDA 5FPSA 5JYIA 2CXVA 4FUCA 1FONA 1LVMA 3OEED 1V2RT 5C3NA 4DJZB 1O30A 4OS5A 3UREA 3FO8D 1QJ1B 4X2YA 2ZPSA 3QTVH 4HZHA 1HCGA 2G00A 1HAZB 3PMBB 2P8OC 1DANH 2XBXA 2ZHQH 1UVTH 5DN6D 4DCDA 1TRYA 1O3CA 2OK5A 5CMXH 2TGPZ 5A09A 1GJCB 2ULLA 3VB7A 1UVPA 3KL6A 1AKSA 4JZDH 2JETB 4X1PU 3E0PB 5A2MH 3O8RA 2WUCA 4XBCA 4ZHLU 1HAGE 3URCA 3RUOA 4Y11E 1K1OA 3MH4A 4E05H 1Q2WA 4YO9A 2RCEA 3SU2A 1ZYOA 1WV7H 1VITF 1N8OC 3UPEA 3ESTA 5C17A 3QLPH 1NRRH 4TPYA 4ZROA 3A81A 1GBDA 3GCHB 4FU8A 2GV7A 1PQ8A 1A0JA 1Y5AT 2JDID 2KM0A 1MAYA 2BDHA 5EW1H 2F3CE 1ZZZA 1GHBG 1MQ5A 1ANCA 1BTUA 4VGCC 2XCNA 3RMLH 4IW4E 4ZKOU 1GBKA 2J98B 2ZQ1A 3NK8A 3LGIA 2O9QA 1C2IA 1V3XA 1T8NA 4Y7BA 1D3PB 1O3KA 2F83A 3VB6A 4B76A 1FY8E 5E0JA 1C4U2 5EJZA 1BTXA 4I33A 1D6WA 1C1VH 1YLDA 3FN8A 1F5RA 2BOHB 4A1VA 3KCGH 3ZIAD 1O34A 4Y71A 1W12U 1PQ5A 1GCTC 5PTPA 1NRNH 2BOKA 1MTNB 1C1NA 3RXTA 1KYNA 4UFGH 3GISB 4E7RG 4FUIA 1T8MA 1E1RD 5F6MA 1GGDC 5C1YA 3DSOA 5E0GA 4AG2A 5C1XA 2Q6FA 2K8IA 3LH3A 2B7DH 3A80A 1GI5A 4XFQA 1CBWB 1S6LA 4X6PA 5CHAC 2UWOA 2DUCA 1ZHRA 3U98H 4TSFD 2ZU5A 1GBLA 2OXSA 3LGTA 5DP6A 3HGPA 2I6QA 1C5OH 1YC0A 3GDUA 3UTUH 2B0FA 2J92A 3SORA 4GVUA 1O3JA 1W14U 3TIUA 1ANBA 1WAYB 3A8DA 3KQEA 1WYKA 1LVOA 4LZ4B 1YY3A 1GL1A 1KDQB 1IQMA 1QQUA 2XC4A 4XD7D 3SUFA 1H8DH 4WH8A 2TRMA 2C90B 3W1EA 1C5QA 2BLWA 2PLXA 4E06H 3S7KB 2ZU3A 2BTCE 2L6OA 3I77A 2XXLA 3BSQA 3CS0A 2ZCKP 2VIPA 1ZOMA 1TX7A 1O37A 4GHQA 2K7XA 4Y7AA 7GCHF 1ZTJA 1AKSB 3GY7A 1KLTA 1UTKA 1GMHG 1GBBA 1UO6A 3PRBA 1GG6B 1UTLM 4FETA 4ABHA 1IQJA 3Q76A 3DUXH 2H9HA 2OP9A 3F3BA 1QB1A 1BJVA 1O2VA 2THFB 1QURH 4JMYA 4UFFH 5FCRA 3A8CA 3F9EA 3D62A 4AGJA 4NWKA 4PROA 6GCHF 3VGCB 1V2UT 1IQIA 1LHGH 4I8JA 1MTSA 3NCLA 1H8IH 4THNH 9LPRA 5L6NH 3KEEA 1LTOA 1W0KD 4FVBA 1TB6H 1Z8IB 1F5KU 1P04A 4FUJA 4OS7A 1AO5A 2G51A 2GT8A 3QX5H 1SOZA 2WPKS 1ETSH 2H6MA 4CRCA 1D9IA 2R0KA 2I6SA 5TJXA 5JDUB 1QJ7B 2VGCC 3K6ZA 4INHA 1TGNA 3GCTG 2Z9JA 1ZSKA 3MYWA 1A5IA 2SGAA 1RD3B 3OE7D 3RC6A 4NZLA 1O3MA 2FLBH 4IN2A 3A8BA 2QXIA 1O5BB 2KAIA 2TGTA 1SKYE 4AORA 2QAAA 5LPEA 1DSTA 3E91A 3H5CB 3EA7A 3T26A 3SGAE 3AASA 3P8NA 2B5TB 3TK6A 5FAHA 1INCA 1J17T 1SR5C 3OTJE 1RIWC 1O3BA 3GY2A 2QF0A 3VXFH 1L2EA 4YXWD 1FIWA 3ZZ3A 1CHOF 3Q77A 1F2SE 1NROH 1QY6A 4ACAA 1QA0A 2GMTC 3RP2A 4I86A 3ZVGA 2KZ4A 2A7HA 1BCUH 1C4Y2 1GMCF 3A83A 1YPGH 1BTZA 2XC0A 4Y6DA 3MQKC 2PWXA 3SV6A 1N6YA 4JYUH 1V2NT 1THPB 2XW9A 2YNAA 1FQ3A 1E79D 1O5DH 1RTKA 5LH8A 2OINA 2H1UA 1E36B 2QXHA 2VB0A 4J1YA 2OQ5A 2FXRA 4BOHA 3H09A 1AB9B 2V0BA 1PPCE 1GBEA 5GJ4B 3KF2A 2CN0H 4OS4A 2HVXA 2BXTH 1UW7A 1KTSB 3MU8A 4JZFH 3SV7A 2ZTZA 4BAQB 5EXMA 3SQHE 1JMOH 1TOMH 1W8BH 4MNXA 1XUIA 4MDSA 1HJAC 3FZZA 3PROA 2O8UA 1EOJA 1Y3WA 3RU4E 4X0WU 3UIRA 4ABIA 2FOEA 3S0NA 3CP7A 3KQCA 2R3YA 1GJ7B 2BM2A 3TLOA 3RMNH 1C5NH 7LPRA 3K65B 2AEIH 1C5LH 3MI4A 1C5YB 4UE7H 1FLEE 4TY6A 1YGCH 1C5ZB 2F91A 1WCZA 3RU4D 2GZ7A 1HAIH 4P00A 1T4VH 2C4FH 4FUDA 5HMAA 3R3GB 5T6FA 3EA9A 3S7HB 1AE8H 4ISNA 2ODPA 1IHSH 3TGIE 4XDEA 1GJ6A 5F53A 4JZEH 1EJNA 1GJBB 1MCVA 1ABJH 3UR9A 2IJOB 1Z1IA 2ZHEH 1AUJA 2WYGA 1YCPK 8ESTE 1EB1H 4JCNA 5B6LA 2BLQA 1Y5UT 1A3EH 1H1BA 1ZHMA 1HRTH 1KSNA 2HNTE 1SGIB 1SOTA 5DG6A 3TJUA 3PO1C 2ZU1A 5LPRA 1GBIA 4AFZA 1P2OA 1SGRE 1Z8RA 1HIAA 5DP4A 4OS1A 3T29A 1OXGA 4ZXYH 1C2GA 2J34A 2SGEE 1O2TA 1E38B 1OWKA 1V2QT 4ZKNU 1YP9A 5DJ7A 1BIOA 3RXHA 1C2DA 3UAIC 1GI9B 1EB2A 1C1OA 2OC0A 1AGJA 2A4GA 2KAIB 3SZEA 3ZZAA 1CSOE 3M3SA 2BLOA 4P02A 1BHXF 1XUFA 2PUXB 4AX9H 3D23A 3SNAA 1JRTA 2J95A 3P6ZB 1C2LA 1BT7A 2BD4A 2WPJS 3ZZ4A 4AOQA 4DOQA 2ZI2H 5HM9A 1P2NA 2J94A 5SGAE 4KTCA 1C1QA 2A1DB 4GAWA 2EEKA 1FDPA 1E35B 1AWFH 1P2KA 4GSOA 1QFKH 1G37A 1SLXB 3AAVA 4ABEA 1A1RA 2AMDA 2FOBA 1QA7A 3DA9B 3TK9A 1WTHD 3UR6A 1DXWA 5EXNA 2VINA 3RLWH 3RXIA 3DT0H 4O97A 3TH2H 2SGDE 1ZRBA 1GI2A 1V2KT 1NESE 2FOMB 2KCYA 3CS7A 1AFQB 2CF9H 3FP6E 3SW2B 1ARBA 4NIXA 5C5NA 1C1UH 1A61H 4OGYA 1FV9A 5I25A 2YNBA 3PV4A 5EPNA 3UWJH 1QCPA 4LOYH 1BBRK 2J38A 5BRRE 4TPIZ 2GJGA 1O3EA 1DVAH 1TQ0B 5IDKA 1TMBH 2W7SA 1WOFA 5T6DA 2Z6BD 4WWYA 1ELCA 2G5NA 1ELEE 2HLDD 2ZG0H 3BTEE 4X2XA 1O3HA 4AC9A 4H6TA 4BAKB 2BD3A 1Z1JA 1QL7A 1GWAA 1OPHB 2SGFE 5EJ1A 1JWTA 5CDFE 4CRGA 3EE7A 2VJ1A 1GI8B 3F68H 3MH5A 3LGYA 1SGDE 1EAUA 3RXRA 1MBMA 1VR1H 3OEHD 2QF3A 3STJA 1PPHE 3VG8A 2J9NA 1DDJA 3BEFB 1FY1A 5GCHF 1QBVH 2AH4X 3NUMA 3K2UA 1HAOH 5DP7A 1Y5BT 3I29A 2Z9KA 1O3AA 2AGGX 1DWBH 5A8XA 3BEUA 1BMAA 3VXEH 3A89A 4ABDA 5GWZA 1HIAB 1LKBA 1LDTT 1BOQA 3SV9A 5DKMA 2SGPE 2OLGA 3OYPA 3CNRA 3TGKE 1A3BH 5LGOA 1F7ZA 2EY4C 4ZAEA 2WV4A 3SU0A 2UWLA 1GHXH 3BTME 4FUHA 3M3VA 2QE7D 1BMFD 3GY6A 4IMZA 4AZ2B 1S82A 2PUQH 4WMFA 1RRKA 2A2XH 1TA2A 1GI4A 2HRVA 1C1PA 3ZZ6A 2ZDMA 1TE0A 2FLRH 4X8SH 1W3CA 2R2WU 1RJXB 2ZDAH 4ISOA 4HI3A 1W11U 2C8YB 5EGMA 3SU6A 4F4OC 1OS8A 2FI5E 2AGIX 2HNTF 1MMJN 3PV2A 2FOAA 3DSPA 1LPGB 2ZNKH 2AS9A 1P2MA 2P3UB 2DE8A 3MH7A 5IYTA 3RXFA 4BXSA 1O5CB 2FP7B 1TMTH 2ZP0H 1DLEA 4FVDA 4F49A 4FXGH 1FY5A 1BBRH 3QZQA 2A45B 2A5IA 1PYTD 3QTOH 3A7TA 1VITH 3RC5A 2SGQE 1VCWA 2OCVB 1TGSZ 3MNXA 1ELGA 4XOJA 1BA8B 1O0DH 3MMGA 1HJ8A 1KXBA 3KHVA 3MO3A 2BXUH 5DP5A 1MU6B 4YT6H 1C5PA 1HJ9A 1NS3A 3DSGA 2K1QA 1BUIA 3SGQE 1W0ZU 5C2ZA 1GDUA 2HLCA 1OYTH 1TA6A 1TONA 1NTPA 2P16A 1K2I1 1PPZA 3NRLA 1CA0B 1EFRD 1UTMA 2FI4E 2WPHS 1XX9A 1GI6A 5HIZA 3E16B 2F9OA 3MU5A 1QTFA 3BTGE 3GY4A 1S84A 1FI8A 8GCHF 4HTCH 2PKSC 1QRXA 2R0LA 3OAAD 3RXOA 1FAKH 5G4BA 1DPOA 4Y76A 4B6FA 2BY8X 1O2GH 1QRZA 3E3TA 4QT8C 4HG6A 1KMHB 2TGAA 1AFEH 1BRBE 1NM6A 1TLDA 2FX4A 3A8AA 3KQ5A 1SQAA 1C1WH 5KGOA 2VBCA 3MOCA 1QL9A 3BG4C 1NFUA 2Z3EA 1GDNA 1F0TA 2F9NA 4JZ1A 3W95A 5DP9A 9ESTA 1GBMA 2GDEH 1KDQA 1SFIA 4RKJB 2ZTXA 2WPDD 1E34B 1FUJA 1IQNA 1EKBB 2ZCLP 2F9PA 4OM9A 1MKWK 1E1QD 3A88A 2R3UA 1O2LA 1EQ9A 3GCOA 1TQ7B 3OTPA 3QN7A 2CJIA 3WW7A 3GDVA 2GX4A 1QQ4A 3RXJA 5A8ZA 1K21H 2BDBA 4GCHF 1WSSH 1VITG 1PPBH 2JH6D 4NIWA 3SQEE 4TWYA 1SGFG 1WTGH 2PP6A 1DWDH 1C9PA 2CHAB 4ESTE 2HOBA 4DY7B 1GI7B 1V2ST 1YPEH 1C2EA 1DFPA 1IQEA 3BF6H 1C2FA 2STAE 4MNVA 3HK3B 1UK2A 2QF4A 1O38A 1XVMA 4O9VA 1F0UA 2OC8A 4WXIA 2JKHA 3F0OA 2AMPA 1XXFA 2VWOA 3FVFB 5T1VA 4A7IB 3SJKA 1WQSA 1F92A 1SGNE 3U1JB 3PV5A 5EQQA 1EPTB 8KME2 1K28D 1CBWC 2HPQH 4U01A 1GL0E 3O8CA 2ZEBA 3K6YA 3P8FA 5J4SA 2WINI 2IPQX 2IPHA 4DW2U 3ZVDA 4YLQH 3S9BA 4OS6A 2C93B 2EA3A 3TNSA 2WPIS 2ZPQA 1W0YH 5ESBA 3ZZBA 1N6XA 2A2QH 3P92A 2A4OA 1BDAA 5KEDA 1O5GH 3V0XA 2PFEA 2Z7FE 3TNTA 2P93A 1O2UA 1BTWA 3KYFA 3ZVCA 3FANA 2WYJA 4R8TB 2GCHF 3HATH 4Y0ZE 3TPIZ 3M37A 1T8OA 2M2AA 5LPFA 2KR7A 3LGWA 1EJAA 4K5ZA 1TAWA 1TPAE 2Y5GA 2FM2A 1Y3XA 1COWD 1P8VC 1AN1E 1ARCA 1FX0B 3P70B 5C0UA 4ZXXH 2XWBI 4BXWA 1MKWH 2R9PA 2W7UA 2GP9B 4X1NU 4DURA 1QZ8A 1YLCA 1ZSJA 1YLNA 1OHHD 4ASUD 3LU9B 4NA8A 2Z9IA 3PMAB 4BANB 4TYDA 1ESBA 5ETXA 1T4UH 3TJOA 3DCLA 2XNIA 1PFXC 4ZMAH 2AHME 1MKXK 3SV8A 4K8YA 1MH0A 4Q4LA 1CU1A 3BTQE 3G01A 3OFND 4K8BA 1TFXA 3NWUA 4AG1A 1N8OB 1ZMLA 4ABBA 1HUTH 4ZHAA 2IOTA 1OOKB 7GCHG 1JBUH 1L4DA 1UK4A 1J16A 1O35A 1CT0E 5EW2H 2ZHFH 2F9VA 1O2RA 5E0HA 1EX3A 2F43B 4ISIH 2SNWA 2A4QA 6GCHG 4I7YH 2JJ2D 2ZGXH 2J5UA 4H4FA 3TH3H 2VWLA 1EZXC 1S81A 3AW0A 1XVOA 2ZC9H 2BQ7B 2WV9A 1W10U 4Q2KA 1K9OE 3EDXB 4D7FA 2V3OH 1JOUB 1OP8A 4B71A 1SHHB 2H2ZA 1VCQA 1GCTB 3DHKH 3QDZB 3ZZ8A 2FX6A 1HAVB 1SSXA 2A0QB 2AFQB 2PSYA 2OBQA 1AE5A 2BHGA 2GDDA 1AB9C 1CQQA 1GGDB 1NRPH 4WF8A 1E37B 1KXEA 3N99A 2NU2E 4ABGA 4H6SB 3SU5A 1T32A 1EOLA 4A1XA 2ZFPH 3RXAA 1GBCA 3BTDE 2BY9X 1AD8H 2FDAA 4INKA 3T25A 4BAMB 2OC1A 5F8TA 3ATWA 1CHOG 4YLUA 3F9HA 2SNVA 1ZTKA 1S85A 1ZGIA 4IC5A 3ZVBA 1L1JA 1P02A 1VJAU 3RXLA 3UQOA 1GMCG 1Q31A 2ZGHA 2AIQA 1HBTH 2RA3A 1ZPCA 3P95A 2K0QA 3S9AA 1G30B 1GJ8B 2GCTB 1AUTC 2PHBA 1V2TT 1O3DA 1RS0A 3SV2H 3SU3A 1XUJA 1MKXH 3FAOA 4AYVB 1C5TA 3ATIA 4K1EA 5HKKD 2ASUB 3UUZA 4ZUHA 2ZKSA 5C5OA 1YPJH 2A7CA 3A7WA 1F5LA 3AK5A 1C4V2 1CO7E 1O2XA 5T6GA 5FPYA 1C1SA 1O2HA 2XNDD 1ZPBA 3EA8A 3E90B 5EPYA 5L30H 1D3TB 2ANKH 1OP2A 2KFWA 5FXLA 4M7GA 5A0AE 1O2NA 1IQLA 1P3CA 2ZHDA 5FCKA 3K9XB 1V2OT 3V12A 4ZKSU 1AY6H 3UQVA 2AMQA 1BQYA 1UTQA 1C2MA 2Z3DA 3PWBA 3RMOH 1P2JA 5HM2A 1MAXA 1GJAB 3OSYA 1THRH 1D3DB 1NN6A 1NRQH 2RA0A 3RM0H 1CT2E 2FTLE 2O8LA 5IK2D 1K1NA 3P17H 1NRSH 1BTPA 1OSSA 5JPMH 4UEHH 1GJ4H 1IOEA 2ZFQH 1RTFB 5F8ZA 4TWWA 1L0ZA 3LONA 4CRBA 2ZDNA 1S83A 1MQ6A 3ENSB 1GJ9B 3T28A 1H8HD
chains in the Genus database with same CATH topology
1RFNA 2FOHA 5HXFA 2Z94A 3Q3YA 4Z6AH 2Q6GA 1SGYE 5JB9S 1IQHA 2VGCB 2ZU2A 4K60A 2C8ZB 4MG3A 2XBVA 3T5FH 3HKJB 1MBQA 2P95A 5J4QA 1O2QA 1PQ7A 2FO9A 3BV9B 2BY7X 2NU0E 2BQ6B 1O5EH 3SJ8A 3LC5A 5FHTA 1TNLA 4XBBA 5I46H 3RMMH 3SHAH 5GDSH 2ZGJA 1DM4B 1DWEH 2W5EA 4WMEA 3L6PA 1S5SA 2O8TA 4XBDA 1EASA 2XC5A 1TGBA 1JXPA 3ZV8A 1TNHA 1DY8A 2VIWA 2FMJA 1JRSA 1SLWB 1N1LA 1EZSC 1ORFA 1C1TA 5FBEA 1YPLH 1O2ZA 3UNSA 1DLKB 1KIGH 5EU8A 1CT4E 1GBJA 3KNXA 4BTTB 1J15A 3PLKA 3EYDA 2HWLB 4JYVH 2GZ8A 3M3TA 1CVWH 4FUFA 4MPXA 4LZ1H 1DE7H 1SGCA 2ODQA 1HDTH 1KLJH 3ZZDA 2STBE 2GZ9A 4JK5A 3ODFA 4AFQA 2P3FH 3Q3XA 5E2PA 3QWCH 4BAHB 1K1JA 2BLVA 3ODDA 3RM2H 3RXVA 1ETTH 1HAPH 4IBLH 4CBNA 4FUGA 1BRUP 1O3OA 2ZFSA 1B7XB 4WH6A 3KGPA 4WJG2 1C2JA 1G2MA 5A0CA 3EGKH 2OTVA 4Y8ZA 1AMHA 8LPRA 1PPGE 5DP8A 3F9GA 3SUGA 3RXCA 1ZPZA 2ANMH 1GPZA 1HNEE 4A5TS 3BTKE 1ZMNA 1FNIA 5AHGH 2UUYA 2B9LA 1K22H 3E6PH 4DIHH 2ZO3H 4AB8A 2BDCA 1J8AA 3KQDA 3TJVA 1EAWA 2J4IA 1TGTA 3PO1B 3MO9A 1YCPH 3T2NA 1UVSH 3F6UH 6CHAB 1K1PA 3RXMA 1Z7KA 3LH1A 3DFLA 3ATMA 1K1MA 2CF8H 1CA8B 2XCFA 5FBIA 4RSPA 1DT2A 2HGTH 1BB0B 1V2VT 3QGJA 2QGRA 5T3HA 4Y8XA 4AN7A 3RXEA 4AFSA 1O32A 4HFPB 4X8TH 3WY8A 3LGUA 2O8WA 1O2JA 1P3EA 1GVKB 1TRNA 3EAJA 1G32B 1MTVA 4Y79A 2AIPA 3A7YA 1MZDA 1ESTA 1KY9A 2V35A 1T8LA 1PJPA 1DX5M 1EP6A 2WPLS 3OU0A 3LJOA 2ESTE 4CREA 3LPRA 4INLA 4JK6A 2V6NA 2FYQA 2M5TA 1FN8A 1O2MA 4IMQA 3PWCA 3EE0B 4NWLA 1BMMH 4O3TA 2JH5D 1GHAF 2EC9H 1P06A 5JBCS 1BRCE 1O36A 1UHBB 5GXPA 1LPKB 1YPHE 3RXDA 2D2DA 2FI3E 1LCYA 1Z6JH 3E1XB 4DVAU 4CHAC 1T31A 1ELAA 3MO6A 2VU8E 5C20A 2J2UA 3EBNA 4YOIA 1UVUH 3V7TA 4CRFA 2VVUA 4IN1A 2BDYA 3PLPA 5EXLA 2PV9B 3VB4A 4NGAH 3SZNA 2Y7XA 1C5WB 2FEQH 5K7RA 4BTIB 3RU4T 4Q7YA 2SFAA 3QK1A 4ZKRU 2LIZA 1EPTA 3BTTE 4NCYA 3TJNA 1WBGB 1DXPA 1NC6A 1FY4A 3E8LA 5JBAS 2F9BH 5DPAA 4Q7XA 1SGQE 4KGAA 3A87A 1BZXE 2Q1JA 2AERH 1EZUC 4KKDA 3JZ1B 1EXFA 1Y59T 1XM1A 1YPMH 2BVRH 4D9RA 2Q6DA 1GMDF 3A82A 5AVDA 1MZAA 1NPMA 3IITA 1A0LA 1CGHA 1MD8A 1ELFA 1Z71A 2ALPA 3SU4A 1A4WH 1VJ9U 2ZWLH 1Y3YA 2VH0A 3TGJE 4NIVA 1O3NA 5TCCA 2BD7A 4UONA 2D26C 8GCHG 1DUEA 5HYOA 1AWHB 1ZRKA 1O3FA 1GJDB 1BTYA 4GUXA 2JETC 1SLUB 2Y80A 4X1QU 4FUBA 4Y0YE 5EQRA 3M5MA 1AVXA 3ZVEA 4BAOB 1TX8A 2Z9LA 4LXBH 1CHGA 1Z8GA 4JYTA 3B8JA 3GY8A 2GVFA 3ITIA 1ZJDA 1XKAC 3VB3A 1HAXB 2ZF0H 4NSYA 1OX1A 2FODA 2BX4A 1TBQH 4MVNA 1P2IA 2VH6A 1GCDA 4MPWA 4A1TA 1LHDH 2GGVB 2ZCHP 3FFGA 4YZUA 3GCHC 6LPRA 2OBOA 1PYTC 1SL3A 3UOPA 2JH0D 1G3BA 1HGTH 4Y8YA 3UFAA 3SBKA 1DOJA 1Z8JB 2ZDKA 3VEQB 4YOJA 2RG3A 5EG4A 1TNKA 1DUAA 1TIOA 1W2KH 4GCHG 2ANWA 1EUFA 1TNIA 3A7VA 4H42U 1UTPA 4CR5A 1QB9A 1A7SA 4WVPE 1O3IA 1GJ5H 2GD4B 4E7NA 1SPJA 1JIRA 1OWHA 1QB6A 3H7OA 1JIMA 2TGDA 1FIZA 2ODYB 4I8HA 1TPSA 1EATA 2FIRH 3ZYEA 1OWEA 1QBNA 1VGCB 4MPVA 5DGJA 1MTNC 1VZQH 2G81E 1ZMJA 3GOVB 1C9TA 4GLYA 1P0SH 2BY5X 1TNJA 3H7TA 1G36A 1NT1A 2VWMA 1OYQA 4SGAE 1XMNB 4O03A 2O8MA 1ACBE 2G4UA 3HPTB 1G3EA 1TYNA 2OD3B 3GY5A 4NSVA 1BITA 1HAVA 1O5FH 1P9SA 3MHWU 4ABJA 3RDZA 4I8KA 3W94A 3ZZ5A 1GBFA 3MU1A 1HLTH 1THSH 1UTJA 1G3DA 2GCHG 1O33A 1UMAH 2PKSB 4KELA 3BTFE 1HFDA 1X7AC 4B73A 2QN5T 2C8XB 1FN6A 1G3CA 1P01A 1J9CH 2D1JA 3BEIB 2NU1E 3B9FH 1B0EA 3AVZA 2YOLA 1RTLA 1Y3VA 1WU1A 3SNCA 1RGQA 3BG4B 3TK5A 3AAUA 4WMDA 1AVWA 1LKAA 2Y6TA 2PKAA 2VIDA 1GHYH 4FUEA 2A7JA 5A0BA 4RKOB 4CRAA 1GG6C 1ANEA 3LOXA 1RXPA 2EI8A 2LPRA 4GHTA 4CBOA 3LKWA 2P8OB 1F0RA 1GHBF 3UWIA 3D49H 1Y8TA 4DIIH 2FZZA 3VGCC 2H5CA 1EJMA 2VIQA 4D8NA 1NY22 2FS8A 1P12E 2ZFRH 1CE5A 3UNQA 4B75A 3IWMA 1KXFA 1V2LT 4JZIA 1A0HB 3KIDU 3TITA 2F9UA 3A7ZA 3MU0A 3PMHB 1UJ1A 3BTWE 1CGJE 1YM0A 3U69H 5ESTE 3VB5A 3TU7H 1GVLA 3M61U 1H9IE 2ZTYA 3IG6B 3PTNA 4DGJA 4BNRA 3L33A 3I78A 1C1RA 4X2WA 3EQ0H 1OWJA 3T62A 4ABFA 2VIVA 2QCYA 1GBAA 4D76A 4HGCA 1QR3E 3GDSA 3OY6U 1O2WA 4Y10E 1MD7A 3OY5U 5AFZH 4VGCB 2G52A 1SB1H 5JBTA 3SJIA 4CRDA 2GCTC 3SI4H 1LQDB 1QHRB 2UUFB 2G55A 3KN2A 1HB0B 2PTCE 3MWIU 4KTSA 3M5NA 2QY0B 2VNTA 3SI3H 4MPUA 1C5UA 1B0FA 1C5RA 2OQUA 5JB8S 1FJSA 2EI6A 2BX3A 1LVBA 3RXBA 1NO9H 2PGQB 1ZHPA 4K69A 2TBSA 2EI7A 1NU7B 1BTHH 1NFWA 1P2QA 1C5XB 4AFUA 1KTTB 1Q3XA 2PGBB 3NZIA 1KXCA 3M35A 1GHZA 1O2IA 1DWCH 1ELVA 4YT7H 2A5AA 1TPOA 4Q80A 1LHEH 2BD9A 2QA9E 4I31A 1SFQB 3SJ9A 3M36A 4NIYA 2ZGBH 3BIVH 3RXQA 1L1NA 1LHFH 5CHAB 1GMHF 3PB1E 2ALVA 2FYRA 5EQSA 1H4WA 4Q7ZA 3URDA 3GYMA 1KXAA 2FOCA 2OC7A 1WUNH 1B5GH 1P03A 2CMYA 1SC8U 2ZPRA 1HYLA 2H5DA 4MNYA 4X1RU 3E0NB 2VIOA 3SUDA 3F1SB 3HGNA 1FAXA 2PKAB 2BD2A 2ZZUH 1P09A 1TNGA 1D3QB 2W26A 1SQTA 4OS2A 2Z3CA 2D8WA 2BQWB 7ESTE 4K3JA 3M7UA 1OKXA 2BZAA 2P94A 3D65E 3DD2H 2NU3E 1BRAA 3GCTF 1O2PA 1FY3A 4CH8B 5E2OA 2CGAA 1EP5A 3UY9A 2ZGCA 2Y5HA 1L4ZA 3B23B 2QV1A 1YCPM 3NPSA 1OP0A 3RC4A 1HV7A 4KTUA 3S9CA 1NFYA 1ZLRA 1D4PB 2PTNA 4X6OA 3ZV9A 5AF9H 1IQKA 1BJUA 1AI8H 2PW8H 3PM3A 2V3HH 5JBBS 1Y3UA 2XRCA 4ZHMU 1S6FA 1TOCB 1UVOA 1GDQA 3UNRA 4WXVA 3DFJA 3RXPA 1EZQA 1W13U 1ZGVA 3BN9A 1ZR0A 3MNBA 1BMNH 3M5LA 5CE1A 4MQAA 1F0SA 3SUEA 4UFEH 2FPZA 3O8BA 4B2BA 3JZ2B 2C8WB 2C3SA 3HK6B 3GCNA 4TY7A 2BVXH 2PSXA 1MUEB 2ZIQH 3V13A 4MLFB 1TBZH 3VPKA 1BMLA 5DP3A 2FTMA 1U6QA 4B2AA 1LVYA 1AIXH 1LMWB 2ZQ2A 3NKKA 2Y5FA 2GKVE 1A46H 3A85A 3STIA 4FU7A 2XBYA 2XYAA 5GIBA 2RDLA 2WPMS 4WY3A 1TALA 1WQVH 2AYWA 1RIWB 2HPPH 3RLYH 4IGDA 1QIXB 1DITH 3VFEA 3GICB 1C5SA 2GMTB 1V2WT 3ZZCA 4K1SA 2BDAA 4CH2B 3FP7E 1SG8B 2BZ6H 1G9IE 2TIOA 2Y7ZA 2BDGA 3A84A 2A4RA 4R0IA 3U8TH 2BY6X 3V3MA 1UHBA 3SGBE 3M7QA 1AFQC 2IN2A 4J2YB 1BHXB 2VVCA 3QO6A 4ASHA 1T7CA 3ZZ7A 1HPGA 3MNSA 3MNCA 4XSKU 3MFJA 2VVVA 3N7OA 2ZU4A 5C67A 1GHVH 3SHCH 2ZDVH 2WUBA 3HKIB 1EAIA 1QGFA 1DSUA 1FPHH 6ESTA 4X2VA 4A6LA 1P11E 2PR3A 4K2YA 6CHAC 1CGIE 4NFEA 1PPEE 2H9TH 2CV3A 1ZSLA 5F8XA 3U8RH 1XXDA 2FESH 4NG9H 1ZJKA 3MU4A 1HJAB 1EAXA 3LGVA 3SN8A 1AHTH 1LPZB 1O2SA 2ZFFH 1S6HA 5L2ZH 1NU9A 5L2YH 3U8OH 2QXJA 1MU8B 4BTUB 5B6OA 1O2YA 1C2HA 1XUKA 3KQBA 4AYYB 1AZZA 4ZH8A 3SNBA 1QL8A 1SLVB 1QNJA 4LK4A 3PTBA 2P3TB 1W7XH 4YOGA 4RN6A 5DK1A 4I32A 2G4TA 4YTAA 2Y82A 1O3LA 3C27B 7KMEH 3PYHA 1ELDE 3RXKA 1S0QA 2FOFA 1K1LA 3T27A 3C1KA 1YYY1 3BIUH 2WV5A 2XTTB 3PMJA 4YM9A 3P8OA 4IS5A 2UWPA 1GBHA 1GVZA 3MH6A 2ZDLA 1AU8A 3TH4H 4B1TA 1SHYA 2HNTC 4UDWH 3FP8E 1O5AB 1O39A 1FXYA 4MTBA 4D7GA 3R0FA 2BYAX 1AZ8A 3Q00A 4ABAA 1M9UA 3OX7U 1K1IA 2ZFTA 2QYIA 3Q3KA 4U2WA 3F9FA 1NZQH 4B2CA 1HXFH 4ISLA 1DICA 1IQFA 1SQOA 1PPFE 3LDXH 4XE4A 3ZVFA 1UTOA 3QUMP 3A7XA 2LNCA 1MCTA 2B8OH 1GHWH 3GY3A 1KXDA 5BPEA 3SOSA 1IQGA 3ZZ9A 2A5KA 4X6MA 1C5MD 1FMGA 2GV6A 1P05A 5GCHG 5E8EH 1V6DA 1GBTA 5EOKA 1OWIA 1LO6A 1GI0A 1E0FD 4K1TA 1TWXB 2HALA 4NZQA 3SJOA 1HXEH 4X8UH 2A32A 2NU4E 1GHAG 3SNDA 3SNEA 1C2KA 1ETRH 1IHTH 2UUJB 5H4IB 1LQEA 1V2MT 4UFDH 1L1GA 1DY9A 4ISHH 3S69A 3L3TA 4KP0A 1YPKH 1TRMA 2BB4A 1UTNA 4IC6A 2A31A 4GPGA 1AQ7A 2VWNA 3FZDA 3LJJA 1BBRE 1AVGH 1IAUA 1ABIH 5FX6A 1UCYK 1V2PT 4NFFA 1TGCA 2G8TA 1YF4A 1YBWA 3O8DA 1SBWA 3P8GA 1Z6EA 1SGFA 1CA0C 1ANDA 1HAYB 5GPIB 1H9HE 2R2MB 2BD5A 2G5VA 3ATLA 2BDIA 3LIWA 2OUAA 3SO3A 2BD8A 4X6NA 1O3GA 1QRWA 1FPCH 1O2KA 5A8YA 1GMDG 3QGNB 2DE9A 1C1MA 5HGGA 1P10A 4Z0KA 2Z9GA 1SGTA 4SGBE 1UCYE 2ANYA 4NA9H 2XBWA 4U30A 4CR9A 4MNWA 4U32A 2FS9A 1TMUH 3NXPA 3ZVAA 1TABE 4NA7A 1A5GH 3ZYDA 1W7GH 4AB9A 1MTWA 1LHCH 1XUGA 5AFYH 3UOUA 3AW1A 1SGEE 1O31A 4X8VH 5FPTA 1KLIH 1SVPA 1QJ6B 1ZTLA 2FWWA 1GI1A 2UUKB 1A5HA 1P57B 1SGPE 2H9EH 4I8GA 3U9AH 1VCPA 5C1UA 3M7TA 3RXSA 1GI3A 1HAHH 1NFXA 2P59A 3QZRA 4FU9A 3SU1A 3ATKA 1VGCC 2AGEX 3LT3A 1YPHC 3A86A 1SMFE 2CHAC 4UD9H 2FOGA 3GYLB 1ELTA 5ABWA 4A92A 1A2CH 1FZZA 3RXGA 1S0RA 2BVSH 1ESAA 3ELAH 1V2JT 1XUHA 3U1IB 3MTYA 1MTUA 1TPPA 1EPTC 4CHAB 3M5OA 1YKTA 3CENA 2ZA5A 5FX5A 3RXUA 1P9UA 4X1SU 1O3PB 2GTBA 1UCYH 3BG8A 1TBRH 2NWNA 3PLBA 1ELBA 2ILNA 2W3KA 4DG4A 5DO4H 1C5VA 2TPIZ 1ID5H 3TVJB 4OGXA 5TCAA 4AGKA 1O2OA 1G2LA 1DS2E 1XKBC 4I8LA 5F03A 2QXGA 3LC3A 4D9QA 2QC2A 1TX6A 2XWAA 1D6RA 1J14A 2ZECA 2GT7A 1UK3A 1PQAA 4DT7B 2ZHWH 3BTHE 1SI5H 1QBOA 5EODA