2Z94A

Complex structure of sars-cov 3c-like protease with tdt
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
306
structure length
306
Chain Sequence
SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRKSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKFYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQCSGVTFQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Replicase polyprotein 1ab
publication title Structural basis of mercury- and zinc-conjugated complexes as SARS-CoV 3C-like protease inhibitors
pubmed doi rcsb
source organism Sars coronavirus
total genus 89
structure length 306
sequence length 306
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2007-09-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1840.10 Mainly Alpha Orthogonal Bundle main proteinase (3clpro) structure, domain 3 main proteinase (3clpro) structure, domain 3 2z94A03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2z94A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2z94A02
2WPKS 1F92A 4ISHH 1EAUA 1GGDC 1P01A 3E3TA 3B9FH 5J4QA 3TGIE 2QIQA 1UVSH 1AE8H 2G5NA 4IC6A 3FP7E 1LTOA 2BDYA 1K1OA 2ZDVH 3N7OA 1GHAG 3UNSA 1O2RA 1DUAA 3O8CA 1DS2E 1FNIA 3S7KB 1O3AA 1O32A 5C5OA 1F0UA 1ORFA 2HPQH 1DLEA 1GI4A 4JZFH 2F83A 3UR9A 2Z9KA 4NSVA 3E16B 1Z6EA 5DP3A 3MYWA 2AFQB 3OYPA 1ELVA 4ABGA 2ILNA 4XBDA 3GISB 2FESH 3UWIA 4ISIH 1Y59T 2NU0E 1O2UA 1O2VA 2A2XH 1Z7KA 1GHVH 3RXMA 1UTOA 1XUFA 3MO9A 4GAWA 2J92A 1GI6A 4BTTB 1AUTC 1G3EA 2HGTH 1N1LA 4RKOB 1C5UA 2B7DH 1GPZA 2ZG0H 1S6HA 2WV5A 7KMEH 3SOSA 2TIOA 3EA7A 1O5CB 1OSSA 2G8TA 1C5WB 3MTYA 3F1SB 3FAOA 3TK9A 4BANB 3GDVA 3RC4A 3AW1A 2QN5T 4Y79A 3ZZ6A 1UK2A 1WBGB 4DCDA 1LVMA 1Z71A 3QDZB 5AFZH 1ELGA 1ZMNA 1CA0C 1SGTA 3HK6B 1O5DH 1CA8B 3ZZAA 2QAAA 2C90B 2EI6A 4BNRA 6LPRA 4A6LA 5CHAC 1LHFH 2ZFPH 4B1TA 4NCYA 3S9CA 1S83A 2V3OH 1MUEB 3KGPA 3U69H 3JZ1B 1O3FA 3A7ZA 4IMZA 2G5VA 1B0EA 2CN0H 3A8AA 3IITA 4X6MA 4JZDH 5G4BA 1AN1E 5HYOA 1W0YH 3DT0H 3Q3KA 1J17T 3ATKA 4K3JA 3PMHB 2XBXA 1BRUP 1WV7H 2J4IA 3A8DA 1O5AB 3ZYDA 4NSYA 2Y5HA 2GZ7A 4JYVH 1P06A 2OLGA 1C1MA 3RXPA 1Q3XA 1CSOE 3AAVA 1YPKH 1MTNC 2BB4A 1LPZB 1GI1A 1V2NT 2PV9B 2CF8H 1UCYH 3OY5U 1K28D 1OWIA 2FOEA 4IW4E 1ZPZA 2ZFRH 1RGQA 5A0BA 5FBEA 2P95A 1OWEA 2R3YA 1Y8TA 2FLBH 1TA2A 2WPHS 5DP6A 3RXCA 4XSKU 2QGRA 2ZCLP 3H5CB 5L6NH 3BF6H 4IS5A 3STJA 1V2QT 4H42U 2DUCA 1XX9A 1C1OA 2A2QH 1TAWA 3RXKA 4FU8A 1NC6A 1TB6H 1LCYA 3SUGA 3LGUA 4F4OC 2XCFA 4KELA 1TQ7B 2QF3A 2ZFFH 2SGPE 1AKSA 2XC5A 3UR6A 4NA9H 1V2RT 7GCHF 3UY9A 3MI4A 2H2ZA 2Y6TA 1AB9C 2ZEBA 1TNJA 3RMNH 1BQYA 3SU3A 4NZQA 1ETRH 3QWCH 3MU4A 1UHBB 1MZAA 2ZU5A 1L1NA 5C3NA 3P92A 3SBKA 3SUDA 1LDTT 3UWJH 2ZHWH 3PO1C 2ZGCA 2H9HA 2BVRH 4FUEA 1QA0A 5JBCS 3UOPA 3RXEA 2Q6FA 1RTLA 9LPRA 4JZIA 2FYRA 2O8LA 3RXUA 4BOHA 1O3PB 4BAMB 1C5OH 1ANBA 1F7ZA 4LK4A 1GDUA 3HKJB 1TBZH 4ABIA 1SB1H 3BTHE 1MTVA 2G51A 1BIOA 3VGCB 3P95A 4AB8A 8GCHF 1GG6B 1W7GH 5LPEA 3A80A 1GVKB 2CHAC 1MMJN 1SGCA 1KLIH 1SQAA 3CS0A 3QZRA 2WPMS 6CHAC 2BDIA 1BBRE 4OS5A 1NFWA 3S9AA 2RCEA 3ZZDA 3EDXB 2ZDAH 2FI5E 2TRMA 4KTSA 5DO4H 1DUEA 1V6DA 4WWYA 3LOXA 4Q2KA 2SGQE 3E1XB 4X8SH 2SGEE 5JBBS 3C1KA 1O2LA 3A7WA 3LGYA 1HLTH 3IWMA 2BLOA 2W7SA 4ZHAA 2H9TH 3ATWA 2P59A 1L1JA 3BTFE 1HPGA 3HGNA 3SJ8A 4D7GA 2OC7A 3QGNB 4AFUA 1C2JA 3I78A 1IQIA 4AX9H 1C2HA 1P3EA 2ZHFH 3O8RA 1C1UH 2BQ6B 8ESTE 1AFEH 4OS4A 1EQ9A 1O2PA 1AD8H 3GICB 3PMAB 4CBNA 2Z9LA 3TITA 1MH0A 3UQVA 2K1QA 1CT0E 4X1RU 4ASHA 2PLXA 3K6ZA 4KGAA 3R0FA 1O35A 4ZKRU 1OPHB 3RXTA 3SU1A 4CH2B 3ELAH 1JIRA 4Y7BA 1WYKA 1O2KA 2ZGJA 4JZEH 3B8JA 1EB1H 1TBRH 3FVFB 3EGKH 4MPUA 1MAYA 2A32A 2CF9H 3M5MA 1ETSH 1TRMA 3MFJA 1FMGA 4TYDA 1FN8A 1NESE 2PUXB 2RG3A 1AZZA 1C5SA 1KXFA 1HAVA 1NRSH 3BN9A 1C5PA 1C1NA 1EZSC 1EJMA 3SNCA 3U1JB 4K8BA 4RSPA 3BG8A 1MTSA 3BTGE 1EXFA 1L1GA 4ISLA 3MNCA 1MZDA 2Y5GA 5HMAA 2A5KA 1KYNA 2AH4X 2FPZA 2FP7B 3PTBA 2BY9X 5GCHF 5DK1A 5EQRA 3CS7A 1GJ8B 2A4OA 2PW8H 2Z3CA 5E8EH 1CU1A 1ABIH 1FAXA 1SGDE 1ARBA 4K8YA 1ESTA 3SGQE 2BHGA 1FIZA 2ANMH 1YKTA 1A61H 4JYUH 1H8IH 2CMYA 3GY6A 1EZXC 3LPRA 1O0DH 2FI4E 3V7TA 1LVOA 1VITF 1QIXB 2ZA5A 3M3TA 1ZSLA 2RA0A 3OX7U 4WY3A 1IQKA 4B71A 1P9UA 4ZHMU 5F8ZA 1QNJA 1LQEA 3LGWA 3TK6A 3Q00A 3F68H 2C4FH 2HNTE 3LGVA 4X6OA 3A7YA 2ZZUH 2IJOB 1DE7H 4YOGA 1O2QA 3MU5A 4DJZB 5HGGA 2P93A 1O3MA 1CVWH 4CRGA 1T8OA 2BM2A 4J1YA 5E0GA 1UTJA 3TLOA 5TCCA 3A89A 3GY2A 3L6PA 1YPEH 1HDTH 2VWLA 2XWAA 3CENA 3NKKA 2DE8A 2HWLB 1D3PB 1YPJH 4CR9A 4BAKB 3S9BA 5LPRA 2BD9A 1GI2A 5DP5A 3UIRA 1W10U 3D62A 3SZNA 3U8TH 1NFUA 3ZV9A 1RXPA 1SHYA 1O2TA 1Y3VA 4MPXA 4ABDA 2LNCA 1HYLA 1YPMH 1W14U 2TGAA 5AVDA 3KEEA 1BBRK 4X8VH 1JOUB 3H7OA 4FVBA 1O2WA 5GPIB 1TNLA 2BXTH 2IN2A 1THSH 1YPHC 2GMTB 2I6SA 1BJUA 3A81A 2BLWA 4IN1A 4X2WA 5JDUB 2F91A 1SGIB 1P2QA 2VGCB 1C1QA 3UPEA 3VB6A 3URCA 5FX5A 3TNTA 3LT3A 1DVAH 4IN2A 1HRTH 3E91A 4GCHG 1FIWA 3FZDA 1HIAB 3ZZ4A 4Z0KA 1N6YA 1NTPA 1V3XA 3RMLH 1ZJDA 1K21H 1CE5A 1HAHH 3AASA 3LGTA 2R2WU 2CV3A 3PLBA 4FUBA 3SGBE 2AMPA 1WSSH 8GCHG 2VVCA 4QT8C 1ELCA 5HM9A 3QUMP 4DIIH 1SLUB 2BDBA 1ZRBA 1GI5A 2JH6D 1A46H 1UVUH 4XBCA 1HB0B 2C8ZB 1SLXB 2G81E 4NIVA 5GDSH 1PYTC 1UTLM 1B5GH 1ZYOA 3TGJE 1XUKA 2XCNA 1EPTB 1V2KT 1CBWB 2J38A 1GBDA 2ZDLA 2CXVA 1SHHB 3BEIB 3M7QA 1INCA 2FOCA 1QURH 4IGDA 1GHYH 1ZPCA 1VITH 2SGDE 3F9EA 1BDAA 2J34A 2BZAA 1H9IE 2JKHA 4DVAU 3MHWU 2FS8A 3AVZA 1BZXE 1C5MD 4A92A 1AQ7A 1ZHPA 3SHCH 1HJAB 1DWBH 1UO6A 3M37A 5EQQA 3GCTF 4RN6A 3F9GA 1TABE 3KL6A 2BD5A 5IYTA 4BXWA 1SGNE 1JWTA 1ID5H 3U8RH 2FODA 1CGHA 4TWWA 1MKXH 1P12E 3FFGA 1NRQH 1CGIE 2OUAA 1W11U 4YT6H 4K69A 4CRAA 2VU8E 2EC9H 2FXRA 3KNXA 1A3EH 2ZKSA 3ZYEA 3ZVDA 1HAZB 1TNGA 2ZPSA 4CRCA 4Y71A 5SGAE 4I33A 1CT2E 1EATA 1L4DA 2ZGBH 2ODYB 3PYHA 1JIMA 3SN8A 2YNBA 1EZQA 1ELFA 2FX6A 1VJ9U 2TPIZ 1L2EA 2ASUB 4ZROA 2UUFB 1UTMA 2W3KA 1WUNH 4YOJA 1Z1JA 2V0BA 1SSXA 1ZZZA 1EASA 1TGBA 5FCKA 2ZO3H 2LPRA 1P3CA 4CRDA 4OS7A 1C5TA 4FUJA 1IAUA 1NN6A 1TALA 4WH8A 2ZFQH 4ZKOU 1THRH 2ZCHP 1P02A 2BOHB 3LJJA 1C4U2 1ZSKA 3HKIB 3RXFA 4X2VA 4AFQA 3A7VA 1FY4A 1ZMLA 2GDEH 3TJOA 1YBWA 3PV4A 9ESTA 1QL7A 1RIWC 1QBOA 3ZVEA 1VGCB 2ZHQH 1GMHF 1GDNA 2FOGA 1VITG 3E0PB 2PGQB 3A88A 2FWWA 2ZDNA 5EOKA 2BX4A 1QGFA 1QJ7B 4U2WA 1G3CA 2RDLA 4E05H 3VGCC 3K2UA 1GG6C 1SMFE 5C5NA 4A7IB 1G3DA 1GHBG 4OGYA 1B0FA 1QR3E 1C5LH 1UK3A 4MNVA 3QTOH 4IC5A 4YT7H 4B2CA 1FV9A 2FI3E 2QCYA 1BTZA 3DHKH 1FY5A 1DANH 4ZH8A 3M5LA 1E34B 5A8ZA 2DE9A 3SW2B 2OQUA 4B2BA 1U6QA 2F9NA 3GYLB 2QXJA 1GJ6A 1P03A 2Y81A 1Y3WA 3FP8E 2P8OB 4FU7A 1V2TT 4O03A 2P16A 3KHVA 1KTSB 1WTHD 2GDDA 1LMWB 1CQQA 2D26C 2BMGB 2R3UA 4HZHA 1PPCE 2PR3A 2F9UA 1HUTH 1NPMA 2PSYA 1YCPH 4YLQH 3TIUA 1A5HA 1S0QA 2VWMA 2HOBA 1AGJA 1S5SA 2BY5X 1BMLA 2PKAB 2QXIA 1PPFE 3Q76A 1EX3A 1O5GH 4WXVA 3P8FA 1VJAU 1OP2A 2QXGA 1C5XB 2FO9A 1Y3YA 1AVGH 4MNWA 1OWKA 2GCTB 3P17H 3M5OA 2G4UA 2SFAA 1LHDH 5A8YA 4CRFA 2H5DA 1SGYE 3V3MA 1GMDF 3DA9B 2BX3A 1A4WH 2ZQ2A 3VXFH 2FOFA 1GCTB 1GBFA 3PWBA 2QXHA 4TY6A 2RA3A 4UFDH 1LHGH 1FJSA 3ZZ8A 2R0KA 1W0ZU 3MH7A 5BRRE 1W13U 1S82A 1FN6A 2XBYA 3A8BA 2GD4B 4LOYH 1G3BA 4K1TA 3TGKE 1V2OT 2UUKB 4ZXXH 1J16A 1BT7A 2Y5FA 2BD3A 1GMCF 2C8XB 1Z8IB 1C2LA 1ZHRA 3TK5A 1SGPE 4YM9A 3GY4A 2ZECA 4U01A 3RDZA 3NWUA 1S0RA 3LH1A 5EXNA 1ELDE 5ETXA 2YOLA 3VB4A 1Y5AT 1LVBA 1GBCA 4I8JA 2KAIB 4HTCH 4MTBA 2CGAA 1O2HA 3MH4A 3BTME 1N8OB 2VINA 5DKMA 1K1IA 5LGOA 1B7XB 3A84A 4A5TS 1C5NH 2ZGHA 2VNTA 5C1UA 1OYQA 1QRZA 1KXAA 4I7YH 1QJ1B 1L4ZA 1Z8JB 3D65E 2WPJS 1D3TB 1FY8E 2BOKA 1LKBA 1NZQH 2A1DB 5C1YA 3VPKA 1TBQH 4X1SU 1ZTJA 1TE0A 2B5TB 4DT7B 3RXDA 1G9IE 1QBVH 1GVLA 1ZGVA 2FYQA 3S7HB 4Q7YA 1A7SA 4U32A 3W94A 1BJVA 3GCNA 4XOJA 3TH2H 1XUGA 5BPEA 1TMBH 2ALPA 2FEQH 3L33A 3GCTG 5FPSA 5F8XA 1A0LA 5AF9H 4BTIB 2V35A 1AIXH 4UEHH 2HRVA 3SUEA 3P8OA 4VGCB 3HATH 1HAXB 3RLYH 3OTJE 2ZDKA 1VR1H 2FOBA 5I25A 3KN2A 3QTVH 3ESTA 4LXBH 3BIVH 2VIOA 1E35B 1P2OA 1ETTH 1A1RA 1W3CA 2UWPA 4KTCA 1OWHA 1EAXA 2EI7A 1MD8A 1V2JT 2WYGA 1BMMH 3MO6A 5C2ZA 3D23A 1NROH 1O3KA 2ULLA 4OS2A 1ZSJA 1K1PA 1W2KH 1PPGE 2ZCKP 1C5ZB 4H6TA 4ZXYH 2ZU4A 1YGCH 2GMTC 5FCRA 3B23B 4CRBA 1DICA 3SU0A 1LQDB 4GLYA 1XMNB 1S81A 1DX5M 1GJDB 1EKBB 1V2UT 3O8BA 3QLPH 2Q1JA 1GBMA 2VGCC 2BLQA 3FZZA 1GJ7B 1ESAA 1A0HB 3GYMA 1IQGA 1GI3A 3NK8A 4B76A 2ZWLH 1UHBA 3T2NA 1GWAA 1THPB 2FS9A 2OP9A 2OC8A 1A3BH 1O5EH 3I29A 3T27A 2P3UB 2AGGX 2BTCE 3SNEA 1GMHG 3P8NA 3MO3A 4DW2U 3LU9B 4JMYA 1TGTA 1MKWK 2Q6DA 4Y8XA 3TJVA 4A1VA 2P3TB 3MU8A 2D2DA 2Z9GA 4WH6A 1KDQB 3RM2H 2ZTXA 4X6NA 1IHTH 1BTXA 3BSQA 4FXGH 4E7NA 3SV8A 1GBIA 2BDGA 2PGBB 2ZF0H 4ZMAH 1Z8RA 1IQLA 4INKA 1PQ5A 3E8LA 3KCGH 3SJKA 2Y82A 2TBSA 1SGFG 1C1SA 4CH8B 3RMMH 1OWJA 2HVXA 3VB3A 2A45B 2ZPQA 2A4QA 2EEKA 2FOMB 1SQTA 1DXPA 1HBTH 2AYWA 4E06H 5LH8A 4X2YA 3M5NA 1ZTLA 3BTQE 1CBWC 2F3CE 1O3OA 4ABAA 4CHAB 2UWLA 5DGJA 4D76A 5EG4A 4DOQA 2PFEA 1OKXA 2XW9A 1WQVH 2SNVA 1GI0A 1C1PA 4R8TB 2Z3EA 2NU2E 1A5GH 3SQEE 2ZGXH 4O3TA 3SU5A 1FPCH 3UTUH 4TWYA 1KIGH 1LHCH 3ZZ5A 1GJ5H 1EZUC 2XRCA 7ESTE 1ZMJA 4DURA 1BCUH 1EP6A 1T7CA 1O3JA 3PB1E 1AVXA 1OWDA 4OGXA 5A09A 1HJAC 3O8DA 1O3IA 2ZQ1A 1BHXF 1RTKA 1G2MA 1BTWA 4KKDA 2NU1E 1ANEA 1GMDG 2GKVE 1H9LB 4R0IA 1FY1A 2QY0B 4NA7A 1V2MT 2GCHF 3UNQA 5EW2H 3TH4H 2ZU1A 1SG8B 2NU4E 5ESTE 1QRWA 4NG9H 1KXEA 1O34A 4X8UH 2G55A 3NCLA 6ESTA 4XFQA 2AMDA 2ZHDA 3VFEA 1J9CH 2AIPA 4UFEH 1TMUH 4F49A 1ESBA 4MLFB 1P2MA 3V12A 1CHOF 1O3BA 2FMJA 5A2MH 1GI8B 3DUXH 4HI3A 3SQHE 1BTUA 4NIXA 2J9NA 1YYY1 2GZ9A 2GV6A 3TNSA 1ANDA 4ZKSU 2EA3A 2XBVA 1P2JA 3PLPA 1PQ8A 1K22H 1NRRH 1KTTB 1NY22 4B75A 4OS1A 1Y3XA 5TCAA 1K1JA 1SOZA 1Y5BT 3QGJA 1IQFA 2GX4A 2JETB 5JB9S 1GBAA 2H1UA 5C20A 1SGQE 2A4GA 2JH5D 1IQJA 1C1RA 2H6MA 1HGTH 1UCYE 1Q2WA 2ANWA 1V2PT 4GSOA 5C1XA 3G01A 4NA8A 4NIYA 3ATMA 1O3DA 2AERH 2R9PA 1GI7B 5T3HA 3ZZBA 4UFFH 1TPSA 5FXLA 1C2DA 5PTPA 4FVDA 5FX6A 1ZGIA 3NPSA 5DJ7A 5JPMH 2G00A 3SORA 1OS8A 4YZUA 2STAE 3RXHA 4I8HA 2BD2A 1HV7A 1HCGA 4YO9A 4ISOA 3RM0H 1PQAA 1NRNH 1S85A 2FOHA 4GUXA 3LONA 1AUJA 2Z94A 1TOMH 2XXLA 1NU7B 1MAXA 4YLUA 7GCHG 1TOCB 3QO6A 4MG3A 1DDJA 2PTNA 1O37A 1OP0A 2ANKH 2Z9JA 2YNAA 4I8LA 2ZDMA 1P2NA 4HFPB 4M7GA 1T8MA 3Q3XA 5DP9A 1DSTA 1F5KU 4X8TH 2WINI 1O38A 5T6FA 1O2IA 2AEIH 2P8OC 3D49H 1IHSH 5DP8A 1HAPH 1JXPA 1MU6B 3T62A 1SI5H 3TPIZ 1KXCA 1MQ5A 3GDSA 1ZOMA 3A83A 1F5LA 1K1LA 3VXEH 4Y76A 1G32B 6CHAB 1T32A 3ZZ3A 1W8BH 1XUIA 1XVMA 3SJOA 2FTLE 2VVUA 4Y0YE 3M36A 1AU8A 3SO3A 5A8XA 1SL3A 1TPAE 1F5RA 4AB9A 1JBUH 2J2UA 1Z6JH 1P0SH 4AYYB 1GJBB 1WAYB 5EPYA 2WV4A 1P2KA 2GCTC 2ZFSA 1P04A 1E36B 1C9PA 3GOVB 1XKBC 1O3GA 1GCTC 4FUCA 3UUZA 1PPHE 1CT4E 2BQWB 1MD7A 2O9QA 4MQAA 1O2ZA 2OQ5A 1NU9A 5EGMA 3GDUA 4TY7A 1EAWA 1TPOA 1QBNA 5FPYA 3RXLA 4O97A 3E90B 1BA8B 2GZ8A 1O2NA 1MBMA 5EPNA 3SU6A 5IDKA 4Y6DA 1PFXC 1VCPA 2OBQA 1HIAA 2O8WA 3MNBA 2AGIX 2J95A 3ZZ7A 3KQCA 1O2XA 3UREA 2PWXA 1K2I1 2A7JA 1C5RA 3JZ2B 3MNSA 1FLEE 4AG2A 1L0ZA 3ZV8A 1DWDH 2OCVB 2QV1A 3ZVGA 1SVPA 3LJOA 4NFFA 1E37B 3K6YA 1DOJA 3T28A 4PROA 1OOKB 1ELTA 1S84A 1QY6A 1N8OC 4JYTA 1TWXB 1YLDA 4FUHA 5CMXH 1ZRKA 2ZC9H 4AGKA 3K65B 3C27B 1YM0A 1QQ4A 2BDHA 3I77A 3Q3YA 1FPHH 4OS6A 3RXIA 5F6MA 2C3SA 1QFKH 4JK5A 3ZVCA 1TMTH 1EOLA 4UD9H 5EXMA 2B9LA 3A86A 1DXWA 2ZFTA 3A87A 1P8VC 1GVZA 1UTQA 1P10A 3MH6A 4GVUA 3KF2A 1D6RA 2VH6A 1GJ9B 1H8DH 3KQEA 3ZVAA 1UTKA 4D9RA 4ZHLU 5HM2A 4LZ1H 2VWNA 2Y80A 2O8TA 1EAIA 2H9EH 1SBWA 3BTDE 1GJCB 3MH5A 2PTCE 2BDCA 2GCHG 3ATLA 3LC5A 3BIUH 1V2WT 5GCHG 4VGCC 4FUGA 3K9XB 2F9OA 1BBRH 3E6PH 2BD4A 5DPAA 2D8WA 4LZ4B 1C2EA 1OX1A 2PKSB 4YTAA 3EQ0H 5EXLA 5FAHA 4UONA 2QYIA 2VIQA 1OXGA 2TGDA 1O3EA 2FOAA 2OTVA 1FI8A 5GJ4B 2VIWA 4ZAEA 1QTFA 1KLJH 1WCZA 4MNXA 1O2JA 1AZ8A 4Y0ZE 1P2IA 2FM2A 1SGEE 1FUJA 1RRKA 2J94A 1K1MA 2A0QB 2FX4A 3BTWE 3UFAA 1C4Y2 2FLRH 1CO7E 4Z6AH 2HNTC 1LPGB 1ZPBA 3URDA 1ZLRA 5LPFA 4JZ1A 1LKAA 1ARCA 3M3SA 1TGNA 4K1SA 3HPTB 4NWKA 4AOQA 1AFQB 1K9OE 1PQ7A 3IG6B 2BD8A 1RJXB 1TRYA 4AFSA 1J15A 1O33A 1HNEE 1JMOH 1D6WA 1IQHA 1UVOA 5EW1H 2AS9A 2O8MA 1TX8A 3LDXH 3RU4D 5B6OA 2GT8A 3PTNA 2V3HH 1C1VH 4Q7ZA 4WJG2 3GY7A 1DITH 3RC5A 4KTUA 2ODQA 1G30B 1DT2A 3SGAE 1XVOA 2VVVA 1X7AC 2Z3DA 2FZZA 5A0CA 3NUMA 4IMQA 1GBBA 1XKAC 1T8LA 1DWCH 4I31A 4A1TA 1YPLH 3MU1A 3EA8A 1XUJA 2ZTYA 4CHAC 1O36A 4GHQA 4ABHA 3A7TA 1T31A 3SI3H 1UVTH 5JB8S 1H9HE 3GY8A 4U30A 4BTUB 1SFIA 3RXSA 4NWLA 1EJAA 2R0LA 2HLCA 5AFYH 5DG6A 1QJ6B 1TQ0B 1HAGE 3RLWH 3T5FH 1BTYA 1FONA 1RD3B 1Y3UA 3MMGA 1C2KA 1MCTA 1HJ9A 2WPLS 1UK4A 1XUHA 4WMEA 2PKAA 3GCHB 2XYAA 1O2OA 4XDEA 2G52A 4AZ2B 2SGFE 3BG4B 1LHEH 4E7RG 4WVPE 2K7XA 1TONA 2PUQH 3A82A 3U1IB 4BXSA 3BEUA 1O39A 3P8GA 3RU4T 3A85A 1AKSB 4INLA 2QC2A 1D3QB 1O2GH 5T6DA 2HPPH 4RKJB 1TLDA 4ZUHA 2O8UA 1TX6A 4DY7B 3MOCA 2ANYA 3ZZCA 2CJIA 2OC0A 3PLKA 1G36A 1PYTD 3V0XA 1HJ8A 1C5VA 2VB0A 1MU8B 4X0WU 1AO5A 1K1NA 1E38B 3RXQA 4B74A 4INHA 3SV7A 1PPZA 4Y11E 1UJ1A 3RXJA 2W5EA 3MWIU 2ZU3A 3SV2H 1ZTKA 2Z6BD 2F9VA 3H7TA 3T25A 3UOUA 4BAOB 2BLVA 3P6ZB 3RU4E 1GJAB 2QF0A 1DPOA 5L2YH 5F8TA 4J2YB 1O3NA 3L3TA 3U98H 1M9UA 5ESBA 1QL9A 3U9AH 1JRTA 3V13A 4YOIA 2GP9B 2XBWA 3MNXA 2KAIA 1TRNA 1GBHA 2JETC 3NXPA 3MU0A 2XNIA 3EA9A 1O30A 4K1EA 1C2MA 1KLTA 5HXFA 3SNBA 1QRXA 2V6NA 2BQ7B 1D9IA 1EOJA 1V2VT 1KSNA 3F6UH 4ESTE 1YPHE 2BZ6H 4ABJA 1O3HA 3RMOH 5EU8A 1C5QA 5JBAS 2WYJA 1DLKB 3UNRA 2BVXH 2VWOA 1JRSA 5ABWA 2Z9IA 2GGVB 1HAIH 2JH0D 2TGPZ 1HXFH 4D7FA 1VCWA 4UFGH 1G37A 1BMNH 1P11E 2ZTZA 1NM6A 3ZZ9A 1O31A 4H6SB 2BY7X 1O3LA 5L2ZH 2Z7FE 4WMFA 4X6PA 3GY5A 5DP7A 4ABEA 1YC0A 2ZU2A 1GGDB 1SLWB 2NU3E 1RIWB 3ZVFA 1GBLA 2R2MB 4GCHF 4THNH 2A5IA 2W7UA 5I46H 3F9HA 2PSXA 1J8AA 1ELAA 3ITIA 1P9SA 2THFB 1TYNA 2XC4A 1XXFA 2A31A 2ZNKH 1F0TA 4K60A 1BTHH 1NFYA 2TGTA 4MPWA 5FPTA 2GVFA 1NFXA 1Z1IA 3T29A 4CREA 3EBNA 3F9FA 2FDAA 2P3FH 4HGCA 1O2SA 2H5CA 1WOFA 4TPIZ 3LH3A 2AMQA 1P57B 5DP4A 3A8CA 4WF8A 5FBIA 4WXIA 4Q80A 2SGAA 1FAKH 1TFXA 2G4TA 1ZR0A 3TU7H 3A7XA 1TIOA 5FHTA 2LIZA 1VZQH 3GY3A 3LKWA 8KME2 4XE4A 2QA9E 3M7UA 1GBJA 1ACBE 3KQBA 4I8KA 1SC8U 1VCQA 3BTKE 3RXAA 1GL0E 4YESB 1HAVB 2AGEX 5GWZA 4BAHB 1EPTC 1SPJA 4NZLA 4CR5A 1C9TA 4Y7AA 2OBOA 4DGJA 1GBKA 1RFNA 4BAQB 3RC6A 1LPKB 2ZP0H 4UE7H 1DM4B 5C67A 1QCPA 2D1JA 1BRCE 2BYAX 1CA0B 2ZPRA 2OINA 2BVSH 2VIPA 1BOQA 1QB9A 4FUDA 1N6XA 4AFZA 4IBLH 2B8OH 1T4VH 5EODA 3SJIA 1TPPA 4GHTA 2VIVA 2ZIQH 1IQEA 3BV9B 5CHAB 1Z8GA 3Q77A 1KDQA 4WMDA 1F0RA 5L30H 3M61U 4SGAE 1OP8A 1QB1A 5E2OA 3W95A 1AY6H 2WUBA 3KQDA 1G2LA 2B0FA 1GHZA 1MTWA 4XBBA 1HAYB 2W26A 3EE0B 3RXOA 5GXPA 3PWCA 4H4FA 3RXVA 2ZI2H 1PJPA 3LIWA 3U8OH 1BB0B 3RXBA 2P94A 3RUOA 1GHWH 2C8WB 2IOTA 2ESTE 3BTEE 1HXEH 1FQ3A 1O5FH 2VJ1A 4JK6A 1TA6A 1MTNB 1YF4A 3LC3A 2A7HA 1ANCA 6GCHF 1A0JA 1YLCA 3WY8A 4ABFA 1GMCG 1DSUA 1SR5C 3AW0A 1IQNA 4B2AA 1SGFA 8LPRA 1GL1A 3HK3B 2SNWA 1C5YB 4K5ZA 4FUFA 1MTUA 1NS3A 3DFLA 1IOEA 2BY6X 4GPGA 1D3DB 4AYVB 2GTBA 2Y7XA 1DWEH 1S6FA 4TPYA 1GHXH 2W3IA 2BD7A 4A1XA 3SV6A 1MBQA 3GCOA 4ABBA 1TNHA 2EI8A 3RP2A 1P09A 2WPIS 1T4UH 1SQOA 1GHAF 1NRPH 1MKXK 2ZHEH 2PKSC 2WUCA 1QL8A 1LO6A 1W12U 3ZVBA 3PMJA 1D4PB 3VEQB 3PM3A 1GHBF 1O3CA 3BTTE 1VGCC 3ENSB 4FU9A 5CE1A 3ODDA 4X1QU 1ZHMA 3T26A 1AB9B 4NGAH 4SGBE 1AWFH 4X1NU 5JYIA 1IQMA 1RS0A 3OSYA 1EJNA 1QHRB 5H4IB 4ISNA 1CGJE 3PO1B 4Y10E 4JCNA 1MKWH 1PPEE 1HFDA 1SOTA 4O9VA 5T6GA 4K2YA 1AHTH 3SUFA 3TJUA 3FP6E 7LPRA 4ZKNU 1GDQA 5E2PA 3PROA 3TVJB 1ELBA 4D9QA 3ATIA 2UWOA 3SI4H 2OD3B 4I32A 1UTNA 3RXRA 3QX5H 2XTTB 1AFQC 1H1BA 4O3UA 2A5AA 1RTFB 5A0AE 5E0HA 2CHAB 5JBTA 3QN7A 1GBEA 3SU4A 3M35A 2OC1A 3M7TA 3ODFA 2BY8X 4Q7XA 1GCDA 1OYTH 1TGSZ 3SHAH 1H4WA 1BUIA 1O2MA 1FXYA 1MCVA 3R3GB 3S69A 1C2GA 1BTPA 3KIDU 1WTGH 5GIBA 1YCPM 2M5TA 1AWHB 2AIQA 2C8YB 1F0SA 3QZQA 4KP0A 3S0NA 4X1PU 1KXDA 1C4V2 5J4SA 1O5BB 1J14A 1C1WH 4NIWA 2C93B 2F9PA 3DFJA 1WQSA 2GT7A 1EUFA 5F03A 1PPBH 1P05A 2VH0A 2STBE 4UDWH 2FIRH 2FTMA 2OXSA 3STIA 4MVNA 4AG1A 2A4RA 5EQSA 1GI9B 1WU1A 1T8NA 3VB7A 2ODPA 5AHGH 4MDSA 1TNIA 2UUYA 3UQOA 1BMAA 1SFQB 4MNYA 4D8NA 1CHGA 1YP9A 1C2IA 4AGJA 3RXGA 1ABJH 1GJ4H 3SV9A 1V2ST 1AI8H 1E0FD 1A5IA 1AVWA 5TJXA 3AAUA 1YCPK 2HALA 4CBOA 2XWBI 3EAJA 1NT1A 3GCHC 2PHBA 2XC0A 3E0NB 1BRAA 1V2LT 4I8GA 3CP7A 4FUIA 3BG4C 3NZIA 2I6QA 1QQUA 5K0HA 2BXUH 1LVYA 1EP5A 1ZJKA 1FY3A 4DG4A 1UTPA 2Y7ZA 1DFPA 1DY9A 3QK1A 2GV7A 3OU0A 3SJ9A 4AN7A 5K7RA 1QA7A 1ELEE 1EPTA 3PMBB 1EB2A 1NO9H 2VIDA 3SU2A 1HAOH 3BEFB 1AE5A 1TNKA 1XXDA 3SNAA 2F9BH 1FZZA 2A7CA 1Y5UT 1KY9A 1AMHA 4MPVA 4NFEA 3TH3H 3FANA 1KXBA 1DY8A 2UUJB 4AORA 1TX7A 2ALVA 4Y8YA 1BITA 1QB6A 2NWNA 4X2XA 1UCYK 1SGRE 1O2YA 2Q6GA 1W7XH 3LGIA 3DD2H 4B73A 3P70B 2HNTF 1Q31A 1XM1A 2IPHA 1C2FA 1TGCA 1BRBE 1A2CH 3OY6U 1BHXB 3EYDA 1GBTA 1C1TA 3TJNA 6GCHG 1MQ6A 3M3VA 1F2SE 2BDAA 1CHOG 1FDPA 3HGPA 1UVPA 1UMAH 3SNDA 5E0JA 3VB5A 1SLVB 1YPGH 4Y8ZA 4DIHH
chains in the Genus database with same CATH superfamily
2WPKS 1F92A 4ISHH 4AC9A 3UB0A 1EAUA 1GGDC 1P01A 3E3TA 3B9FH 5J4QA 3TGIE 2QIQA 1UVSH 1AE8H 2G5NA 4IC6A 3FP7E 1LTOA 2BDYA 1K1OA 5IK2D 5C17A 1H8HD 2ZDVH 3N7OA 1GHAG 3UNSA 1O2RA 1DUAA 3O8CA 1DS2E 1FNIA 3S7KB 1FX0B 1O3AA 3EE7A 1O32A 5C5OA 1F0UA 1ORFA 2HPQH 1DLEA 1GI4A 4JZFH 2F83A 3UR9A 2Z9KA 4NSVA 3E16B 1Z6EA 5DP3A 3MYWA 2AFQB 3OYPA 1VKYA 1ELVA 4ABGA 2ILNA 4XBDA 3GISB 2FESH 3UWIA 4ISIH 1Y59T 2NU0E 1O2UA 1O2VA 2A2XH 1Z7KA 1GHVH 3RXMA 1UTOA 1XUFA 3MO9A 4GAWA 2J92A 1GI6A 4BTTB 1AUTC 1G3EA 2HGTH 5T1VA 1N1LA 4RKOB 2KCAA 1C5UA 2B7DH 1GPZA 2ZG0H 1S6HA 2WV5A 1WXRA 2F43B 7KMEH 3SOSA 2TIOA 3EA7A 1O5CB 1OSSA 2G8TA 1C5WB 3MTYA 3F1SB 3FAOA 3TK9A 4BANB 3GDVA 3RC4A 3AW1A 2QN5T 4Y79A 3ZZ6A 1UK2A 1WBGB 3F2HA 4DCDA 1LVMA 1Z71A 3QDZB 5AFZH 1ELGA 1ZMNA 1CA0C 1SGTA 3HK6B 1O5DH 1CA8B 1S6LA 4YXWD 3ZZAA 2QAAA 2C90B 2EI6A 4BNRA 6LPRA 4A6LA 5CHAC 1LHFH 2ZFPH 4B1TA 4NCYA 3S9CA 2KFWA 1S83A 2V3OH 5HKKD 1MUEB 3KGPA 3U69H 3JZ1B 1O3FA 3A7ZA 4IMZA 2G5VA 1B0EA 1BMFD 2CN0H 3A8AA 4B6FA 3IITA 1W0JD 4X6MA 4JZDH 5G4BA 1AN1E 5HYOA 1W0YH 3DT0H 3Q3KA 4RT0A 1J17T 3ATKA 4K3JA 3PMHB 2XBXA 1BRUP 1WV7H 2J4IA 3A8DA 1O5AB 3ZYDA 4NSYA 3UAIC 2Y5HA 2GZ7A 4JYVH 1P06A 2OLGA 1C1MA 3RXPA 1Q3XA 1CSOE 3AAVA 1YPKH 1MTNC 2BB4A 1LPZB 1GI1A 1V2NT 2PV9B 2CF8H 1UCYH 3OY5U 1K28D 1OWIA 2FOEA 4IW4E 1ZPZA 2ZFRH 1RGQA 5A0BA 5FBEA 2P95A 1OWEA 2R3YA 1Y8TA 2FLBH 1TA2A 2WPHS 5DP6A 3RXCA 4XSKU 2QGRA 2ZCLP 3H5CB 5L6NH 3BF6H 4IS5A 3STJA 1V2QT 4H42U 2DUCA 1XX9A 1C1OA 2A2QH 4P00A 1TAWA 3RXKA 2KX4A 2HVYB 4FU8A 4Z1MD 1NC6A 1TB6H 1LCYA 3SUGA 3LGUA 4F4OC 2XCFA 4KELA 1TQ7B 2QF3A 2ZFFH 2SGPE 1AKSA 2XC5A 2W6JD 3UR6A 4NA9H 1V2RT 2YMSD 7GCHF 3UY9A 3MI4A 2H2ZA 2Y6TA 1AB9C 2ZEBA 1TNJA 3RMNH 1BQYA 3SU3A 4NZQA 1ETRH 3QWCH 2WV9A 3MU4A 3SZEA 1UHBB 2KCOA 1MZAA 2ZU5A 1L1NA 5C3NA 3P92A 3SBKA 3SUDA 1LDTT 3UWJH 2ZHWH 3PO1C 2ZGCA 2H9HA 2BVRH 4FUEA 1QA0A 1YY3A 5JBCS 1YWUA 3RXEA 3UOPA 2Q6FA 1RTLA 9LPRA 4JZIA 2FYRA 2O8LA 3RXUA 4BOHA 2WSSD 1O3PB 4BAMB 1C5OH 1ANBA 1F7ZA 4LK4A 1GDUA 3HKJB 1TBZH 4ABIA 1SB1H 3BTHE 1MTVA 1BIOA 2G51A 3WW7A 3VGCB 3P95A 4AB8A 8GCHF 1GG6B 1W7GH 5LPEA 3A80A 1GVKB 2CHAC 1MMJN 1SGCA 1KLIH 2WHXA 1SQAA 3CS0A 3QZRA 2WPMS 6CHAC 2BDIA 1BBRE 4OS5A 1NFWA 2KR7A 5EJZA 3S9AA 2KZ4A 2RCEA 3ZZDA 3EDXB 2ZDAH 2FI5E 2TRMA 4KTSA 4DT4A 5DO4H 1DUEA 1V6DA 4WWYA 3LOXA 4Q2KA 2SGQE 3E1XB 4X8SH 2SGEE 5JBBS 3C1KA 1O2LA 3A7WA 3LGYA 1HLTH 3IWMA 2BLOA 2W7SA 4ZHAA 2H9TH 3ATWA 2P59A 1L1JA 3BTFE 1HPGA 3HGNA 3SJ8A 4D7GA 3PRBA 2OC7A 3QGNB 4AFUA 1C2JA 3I78A 1IQIA 4M9FA 4AX9H 1C2HA 1P3EA 2ZHFH 3O8RA 1K0HA 1C1UH 2BQ6B 8ESTE 1AFEH 4OS4A 1EQ9A 1O2PA 5CDFE 1AD8H 3GICB 3PMAB 4CBNA 2Z9LA 3TITA 1MH0A 3UQVA 2K1QA 1CT0E 4X1RU 4ASHA 2PLXA 3K6ZA 4KGAA 3R0FA 1O35A 4ZKRU 1OPHB 2QF5A 3RXTA 3SU1A 4CH2B 3ELAH 1JIRA 2CK3D 4Y7BA 1WYKA 1O2KA 2ZGJA 4JZEH 3B8JA 1EB1H 1TBRH 3FVFB 3EGKH 4MPUA 1MAYA 2A32A 2CF9H 3M5MA 3AK5A 1ETSH 1TRMA 3MFJA 3N7EA 1FMGA 4TYDA 1FN8A 1NESE 2PUXB 2RG3A 1AZZA 1C5SA 1KXFA 1HAVA 1NRSH 2QF4A 3BN9A 1C5PA 1C1NA 1EZSC 1EJMA 3SNCA 3U1JB 4K8BA 4RSPA 3BG8A 1MTSA 3BTGE 3CNRA 1EXFA 1L1GA 4ISLA 3MNCA 1MZDA 2Y5GA 5HMAA 2A5KA 1KYNA 2AH4X 2FPZA 3WWBA 2FP7B 3PTBA 2BY9X 5GCHF 5DK1A 5EQRA 3CS7A 3DCLA 1GJ8B 2A4OA 2PW8H 2Z3CA 5E8EH 1CU1A 1ABIH 1FAXA 1SGDE 1ARBA 4K8YA 1ESTA 3SGQE 2BHGA 1FIZA 2ANMH 1YKTA 2XNDD 4P02A 5EIYA 1A61H 4JYUH 1H8IH 2CMYA 3GY6A 1EZXC 3LPRA 1O0DH 2FI4E 3V7TA 1LVOA 1VITF 1QIXB 2ZA5A 3M3TA 1ZSLA 2RA0A 3OX7U 4WY3A 1IQKA 4B71A 4ASUD 1P9UA 4ZHMU 5F8ZA 1QNJA 1LQEA 3LGWA 3TK6A 3F3BA 3Q00A 3F68H 2C4FH 2HNTE 3LGVA 4X6OA 3A7YA 2ZZUH 2IJOB 1DE7H 4YOGA 1O2QA 3MU5A 4DJZB 5HGGA 2PP6A 2P93A 1O3MA 1CVWH 4CRGA 1T8OA 2BM2A 4J1YA 5E0GA 1UTJA 3TLOA 5TCCA 3A89A 3GY2A 3L6PA 1YPEH 1HDTH 2VWLA 2XWAA 3CENA 3NKKA 2J98A 2DE8A 2HWLB 1D3PB 1YPJH 5FL7D 4CR9A 4BAKB 3S9BA 5KECA 5LPRA 2BD9A 1GI2A 5DP5A 3UIRA 1W10U 3D62A 3SZNA 3U8TH 1NFUA 3ZV9A 1RXPA 1SHYA 1O2TA 1Y3VA 4MPXA 4ABDA 2LNCA 1HYLA 1YPMH 1W14U 2TGAA 5AVDA 3KEEA 1BBRK 4X8VH 1JOUB 3H7OA 4FVBA 3W1EA 1O2WA 5GPIB 1TNLA 2BXTH 2IN2A 1THSH 1YPHC 2GMTB 2I6SA 1BJUA 3A81A 2BLWA 4IN1A 4X2WA 5JDUB 4XD7D 2F91A 1SGIB 1P2QA 2VGCB 1C1QA 3UPEA 3VB6A 3URCA 5FX5A 3TNTA 3LT3A 1DVAH 2GJGA 4IN2A 1HRTH 3E91A 4GCHG 1FIWA 3FZDA 1HIAB 3ZZ4A 4Z0KA 1N6YA 1NTPA 1V3XA 3RMLH 1ZJDA 1K21H 1CE5A 1HAHH 3AASA 3LGTA 2R2WU 2CV3A 3PLBA 4FUBA 2L6OA 3SGBE 2AMPA 1WSSH 8GCHG 2VVCA 4QT8C 1ELCA 5HM9A 3QUMP 4DIIH 1SLUB 3F0PA 2WZQA 2BDBA 1ZRBA 1GI5A 2JH6D 1A46H 1UVUH 4XBCA 1HB0B 2C8ZB 1SLXB 2G81E 4NIVA 4Q4LA 5GDSH 3KYFA 1PYTC 1UTLM 1B5GH 1ZYOA 3TGJE 1XUKA 2XCNA 1EPTB 1V2KT 1CBWB 2J38A 1GBDA 2ZDLA 2CXVA 1SHHB 3BEIB 3M7QA 1INCA 2FOCA 1QURH 4IGDA 1GHYH 1ZPCA 1VITH 2SGDE 3F9EA 1BDAA 2J34A 2BZAA 1H9IE 2JKHA 4DVAU 3MHWU 2FS8A 3AVZA 1BZXE 3DSOA 1C5MD 4A92A 1AQ7A 1ZHPA 3SHCH 1HJAB 1DWBH 1UO6A 3M37A 5EQQA 3GCTF 4RN6A 3F9GA 1TABE 3KL6A 2BD5A 5IYTA 4BXWA 1SGNE 1JWTA 1ID5H 3U8RH 2FODA 1CGHA 4TWWA 1MKXH 1P12E 3FFGA 1NRQH 1CGIE 2OUAA 1W11U 4YT6H 4K69A 4CRAA 1E79D 2VU8E 2EC9H 2FXRA 3KNXA 1A3EH 2ZKSA 3ZYEA 3ZVDA 1HAZB 1TNGA 2ZPSA 4CRCA 4Y71A 5SGAE 4I33A 1CT2E 1EATA 1L4DA 2ZGBH 2ODYB 3PYHA 1JIMA 3SN8A 2YNBA 1EZQA 2HLDD 1ELFA 2FX6A 1VJ9U 2TPIZ 1L2EA 2ASUB 2K8IA 4ZROA 2UUFB 1UTMA 2W3KA 1WUNH 4YOJA 1Z1JA 3H09A 2V0BA 1SSXA 1ZZZA 4RT1A 1EASA 1TGBA 5FCKA 2ZO3H 2LPRA 1P3CA 4CRDA 5C0TA 4OS7A 1C5TA 4FUJA 1IAUA 1NN6A 1TALA 4WH8A 2ZFQH 4ZKOU 1THRH 2ZCHP 1P02A 2BOHB 3LJJA 1C4U2 1ZSKA 3HKIB 3KYGA 3RXFA 3OEED 4X2VA 4AFQA 3A7VA 1FY4A 1ZMLA 2GDEH 3TJOA 1YBWA 3PV4A 9ESTA 1QL7A 1RIWC 1QBOA 3ZVEA 1VGCB 2ZHQH 1GMHF 1GDNA 2FOGA 1VITG 3E0PB 2PGQB 3A88A 2FWWA 2ZDNA 5EOKA 2BX4A 1QGFA 1QJ7B 4U2WA 1G3CA 2RDLA 4E05H 3VGCC 3K2UA 1GG6C 1SMFE 5C5NA 4A7IB 1G3DA 1GHBG 4OGYA 1B0FA 1QR3E 2VBCA 1C5LH 1UK3A 4MNVA 3QTOH 4IC5A 4YT7H 4B2CA 1FV9A 2FI3E 2QCYA 1BTZA 3DHKH 1FY5A 1DANH 4ZH8A 3M5LA 1E34B 5A8ZA 2DE9A 3SW2B 2OQUA 4B2BA 1U6QA 2F9NA 3GYLB 2QXJA 1GJ6A 1P03A 2Y81A 1Y3WA 3FP8E 2P8OB 4FU7A 1V2TT 4O03A 2P16A 3KHVA 1KTSB 1WTHD 2GDDA 1LMWB 1CQQA 2D26C 2BMGB 2R3UA 4HZHA 1PPCE 2PR3A 2F9UA 1HUTH 1NPMA 2PSYA 1YCPH 4YLQH 3TIUA 1A5HA 1S0QA 2VWMA 2HOBA 1AGJA 1S5SA 2BY5X 1BMLA 2PKAB 2QXIA 1PPFE 3Q76A 1EX3A 1O5GH 1QZ8A 4WXVA 3P8FA 1VJAU 1OP2A 2QXGA 5F53A 1C5XB 2FO9A 3PV5A 1Y3YA 1AVGH 4MNWA 1OWKA 2GCTB 3P17H 3M5OA 2G4UA 2SFAA 1LHDH 5A8YA 4CRFA 2H5DA 1SGYE 3V3MA 1GMDF 3DA9B 2BX3A 1A4WH 2ZQ2A 3VXFH 2FOFA 1GCTB 4ACAA 1GBFA 3PWBA 2QXHA 4TY6A 2RA3A 2J5UA 4UFDH 1LHGH 1FJSA 3ZZ8A 2R0KA 1W0ZU 3MH7A 5BRRE 1W13U 5C94A 1S82A 1FN6A 2XBYA 3A8BA 2GD4B 4LOYH 1G3BA 3F0OA 4K1TA 3TGKE 1V2OT 2UUKB 4ZXXH 1J16A 1BT7A 2Y5FA 2BD3A 1GMCF 2C8XB 1Z8IB 1C2LA 1ZHRA 3TK5A 1SGPE 4YM9A 3GY4A 2ZECA 4U01A 3RDZA 3NWUA 1S0RA 3LH1A 3GS9A 1ELDE 5ETXA 5EXNA 2YOLA 3VB4A 1Y5AT 1LVBA 1GBCA 3DSPA 4I8JA 2KAIB 4HTCH 4MTBA 2CGAA 1O2HA 3MH4A 3BTME 1N8OB 2VINA 5DKMA 1K1IA 5LGOA 1B7XB 3A84A 4A5TS 1C5NH 2ZGHA 2VNTA 5C1UA 1OYQA 1QRZA 1KXAA 4I7YH 2YMSB 1QJ1B 1L4ZA 1Z8JB 3D65E 2WPJS 1D3TB 1FY8E 2BOKA 1LKBA 1NZQH 2A1DB 5C1YA 3VPKA 1TBQH 4X1SU 1ZTJA 1TE0A 2B5TB 4DT7B 3RXDA 1G9IE 1QBVH 1GVLA 1ZGVA 2FYQA 3S7HB 2W6ID 4Q7YA 1A7SA 4U32A 3W94A 1BJVA 3GCNA 4XOJA 3TH2H 1XUGA 5BPEA 1TMBH 2ALPA 2FEQH 2L74A 3GCTG 2V7QD 3L33A 5EJLA 5FPSA 5F8XA 1A0LA 5AF9H 4BTIB 2V35A 1AIXH 4UEHH 2HRVA 3SUEA 3P8OA 3OTPA 2JIZD 4VGCB 3HATH 1HAXB 3RLYH 3OTJE 2K0QA 2ZDKA 1VR1H 1W0KD 2FOBA 5I25A 3KN2A 3QTVH 3ESTA 4LXBH 3BIVH 2VIOA 1E35B 1P2OA 1ETTH 1A1RA 1W3CA 2UWPA 4KTCA 1OWHA 1EAXA 2EI7A 1MD8A 1V2JT 2WYGA 1BMMH 3MO6A 5C2ZA 3D23A 1NROH 1O3KA 2ULLA 4OS2A 1ZSJA 1K1PA 1W2KH 1PPGE 2ZCKP 1C5ZB 4H6TA 4ZXYH 2ZU4A 1YGCH 2GMTC 5FCRA 3B23B 3DSGA 4CRBA 1DICA 3SU0A 1LQDB 4GLYA 1XMNB 1S81A 1DX5M 1GJDB 1EKBB 1V2UT 3O8BA 3QLPH 2Q1JA 1GBMA 2VGCC 2BLQA 3FZZA 1GJ7B 1ESAA 1A0HB 3GYMA 1IQGA 1E1QD 3N7DA 1GI3A 3NK8A 4B76A 2ZWLH 1UHBA 3T2NA 1GWAA 1THPB 2FS9A 2OP9A 2OC8A 1A3BH 1O5EH 3I29A 3T27A 2QE7D 2P3UB 2AGGX 2BTCE 2KM0A 3SNEA 1GMHG 3P8NA 3MO3A 4DW2U 3LU9B 4JMYA 1TGTA 1MKWK 2Q6DA 4Y8XA 3TJVA 4A1VA 2P3TB 3MU8A 2D2DA 2Z9GA 4WH6A 1KDQB 3RM2H 2ZTXA 4X6NA 1IHTH 1BTXA 3BSQA 4FXGH 4E7NA 3SV8A 1GBIA 2BDGA 2PGBB 2ZF0H 4ZMAH 1Z8RA 1IQLA 4INKA 1PQ5A 3E8LA 3KCGH 3SJKA 2Y82A 2TBSA 1SGFG 1C1SA 4CH8B 3RMMH 1OWJA 2HVXA 3VB3A 2A45B 2ZPQA 2A4QA 2EEKA 2FOMB 1SQTA 1DXPA 1HBTH 2AYWA 4E06H 5LH8A 4X2YA 3M5NA 1ZTLA 3BTQE 1CBWC 2F3CE 1O3OA 4ABAA 4CHAB 2UWLA 5DGJA 4D76A 5EG4A 4DOQA 2PFEA 1OKXA 2XW9A 1WQVH 5KEDA 2SNVA 1GI0A 1C1PA 4R8TB 2Z3EA 2NU2E 1A5GH 3SQEE 2ZGXH 4O3TA 3SU5A 1FPCH 3UTUH 4TWYA 1KIGH 1LHCH 3ZZ5A 1GJ5H 1EZUC 2XRCA 7ESTE 1ZMJA 4DURA 1BCUH 1EP6A 1T7CA 1O3JA 3PB1E 1AVXA 1OWDA 4OGXA 5A09A 1HJAC 3O8DA 1O3IA 4FOUC 2ZQ1A 1BHXF 1RTKA 2JJ2D 1G2MA 1BTWA 4KKDA 2NU1E 1ANEA 1GMDG 2GKVE 1H9LB 4R0IA 1FY1A 2QY0B 4NA7A 1V2MT 2GCHF 3UNQA 5EW2H 3TH4H 2ZU1A 5DSFA 1SG8B 2NU4E 5ESTE 1QRWA 4NG9H 1KXEA 1O34A 4X8UH 2G55A 3NCLA 6ESTA 4XFQA 2AMDA 2ZHDA 3OE7D 3VFEA 1J9CH 2AIPA 4UFEH 1TMUH 4F49A 1ESBA 5B6LA 4MLFB 1P2MA 3V12A 1CHOF 1O3BA 2FMJA 5A2MH 1GI8B 2AHME 3DUXH 1EFRD 4HI3A 3SQHE 4ACBA 1BTUA 4NIXA 2J9NA 1YYY1 2GZ9A 2GV6A 3TNSA 1ANDA 4ZKSU 2EA3A 2XBVA 1P2JA 3PLPA 1PQ8A 1K22H 1NRRH 1KTTB 1NY22 4B75A 4OS1A 1Y3XA 5TCAA 1K1JA 1SOZA 1Y5BT 3QGJA 3KQ5A 1IQFA 2GX4A 2JETB 5JB9S 1GBAA 2H1UA 5C20A 1SGQE 2A4GA 2JH5D 1IQJA 1C1RA 2H6MA 1HGTH 1UCYE 1Q2WA 2ANWA 1V2PT 4GSOA 5C1XA 3G01A 4NA8A 4NIYA 3ATMA 1O3DA 2AERH 2R9PA 1GI7B 5T3HA 3ZZBA 4UFFH 1TPSA 5FXLA 1C2DA 5PTPA 4FVDA 5FX6A 1ZGIA 3NPSA 5DJ7A 5JPMH 2G00A 3SORA 1OS8A 4YZUA 2STAE 3RXHA 4I8HA 2BD2A 2XOKD 1HV7A 1HCGA 4YO9A 4ISOA 3RM0H 1PQAA 1NRNH 1S85A 2FOHA 4GUXA 3NRLA 3LONA 1AUJA 2Z94A 1TOMH 2XXLA 1NU7B 1MAXA 4YLUA 7GCHG 1TOCB 3SYJA 3QO6A 4MG3A 1DDJA 2PTNA 1YLNA 1O37A 1OP0A 2ANKH 2Z9JA 2YNAA 4I8LA 2ZDMA 1P2NA 4HFPB 4M7GA 1T8MA 2J97A 3Q3XA 5DP9A 1DSTA 1F5KU 4X8TH 2WINI 1O38A 5T6FA 1O2IA 2AEIH 2P8OC 3D49H 1IHSH 5DP8A 1HAPH 1JXPA 1MU6B 3T62A 1SI5H 3TPIZ 3U28C 1KXCA 1MQ5A 3GDSA 1ZOMA 3A83A 1F5LA 1K1LA 3VXEH 4Y76A 1G32B 6CHAB 1T32A 3ZZ3A 1W8BH 1XUIA 3MQKC 1XVMA 3SJOA 2FTLE 3F2GA 2VVUA 4Y0YE 3M36A 1AU8A 3SO3A 5A8XA 1SL3A 1TPAE 1F5RA 4AB9A 1JBUH 2J2UA 1Z6JH 1P0SH 4AYYB 1GJBB 1WAYB 5EPYA 2WV4A 1P2KA 2GCTC 2V3MA 2ZFSA 1P04A 2LP6A 1E36B 1C9PA 3GOVB 5CHBA 1XKBC 1O3GA 1GCTC 4FUCA 4B6EA 3UUZA 1PPHE 1CT4E 2BQWB 1MD7A 2O9QA 4MQAA 1O2ZA 2OQ5A 1NU9A 4Q63A 5EGMA 3GDUA 4TY7A 1EAWA 1TPOA 3ZIAD 1QBNA 5FPYA 3RXLA 4O97A 3E90B 1BA8B 2GZ8A 1O2NA 1MBMA 5EPNA 3SU6A 5IDKA 4Y6DA 1PFXC 1VCPA 2OBQA 1HIAA 2O8WA 3MNBA 2AGIX 2J95A 3ZZ7A 3KQCA 3N99A 1O2XA 3UREA 2PWXA 1K2I1 2A7JA 1C5RA 2IPQX 3JZ2B 1FLEE 3MNSA 4AG2A 1L0ZA 3ZV8A 1DWDH 2OCVB 2QV1A 3ZVGA 1SVPA 3LJOA 4NFFA 1E37B 3K6YA 2KCPA 1DOJA 3T28A 2EY4C 4PROA 1OOKB 1ELTA 1S84A 2KCYA 1QY6A 1N8OC 4JYTA 1TWXB 1YLDA 4FUHA 5CMXH 1ZRKA 2ZC9H 4AGKA 3K65B 3C27B 1YM0A 1QQ4A 2BDHA 3I77A 3Q3YA 1FPHH 4OS6A 3RXIA 2YMSC 5F6MA 2C3SA 1QFKH 4JK5A 3ZVCA 1TMTH 1EOLA 4UD9H 5EXMA 2B9LA 3A86A 1DXWA 2ZFTA 1WDIA 3A87A 1P8VC 1GVZA 1UTQA 1P10A 3MH6A 3FO8D 3KF2A 4GVUA 1D6RA 2VH6A 1GJ9B 1H8DH 3KQEA 3ZVAA 1UTKA 4D9RA 3FN8A 4ZHLU 5HM2A 4LZ1H 2VWNA 2Y80A 2O8TA 1EAIA 1UW7A 1SBWA 2H9EH 3BTDE 1GJCB 3MH5A 2PTCE 2BDCA 2GCHG 3ATLA 3LC5A 5EJ1A 3BIUH 1V2WT 3PRDA 5GCHG 4VGCC 4FUGA 3K9XB 2F9OA 1BBRH 3E6PH 2BD4A 5DPAA 2D8WA 4LZ4B 1C2EA 1OX1A 2PKSB 4YTAA 3EQ0H 5EXLA 5FAHA 4UONA 2QYIA 2VIQA 1OXGA 2TGDA 1O3EA 2FOAA 2OTVA 1FI8A 5GJ4B 2VIWA 4ZAEA 2OK5A 1QTFA 1KLJH 1NBMD 1WCZA 4MNXA 1O2JA 1AZ8A 4Y0ZE 1P2IA 2FM2A 1SGEE 5HIYA 1FUJA 1RRKA 2J94A 1K1MA 2A0QB 2FX4A 3BTWE 3UFAA 1C4Y2 2FLRH 1CO7E 4TT3D 4Z6AH 2HNTC 1LPGB 1E1RD 1ZPBA 3URDA 1ZLRA 5LPFA 4JZ1A 1LKAA 1ARCA 3M3SA 1TGNA 4K1SA 3HPTB 4XRNA 4NWKA 4AOQA 1AFQB 1K9OE 1PQ7A 3IG6B 2BD8A 2JDID 1RJXB 1TRYA 4AFSA 1J15A 1O33A 1HNEE 1JMOH 1D6WA 1IQHA 1UVOA 5EW1H 2AS9A 2O8MA 1TX8A 3LDXH 3RU4D 5B6OA 2GT8A 3PTNA 2V3HH 1C1VH 4Q7ZA 4WJG2 2EQNA 3GY7A 1DITH 3RC5A 4KTUA 2ODQA 1G30B 5DN6D 1SKYE 5C0UA 1DT2A 3SGAE 1XVOA 2VVVA 1X7AC 2Z3DA 2FZZA 5A0CA 3NUMA 4IMQA 1GBBA 1XKAC 1T8LA 1DWCH 4I31A 4A1TA 1YPLH 3MU1A 3EA8A 1XUJA 2ZTYA 4CHAC 1O36A 4GHQA 4ABHA 3A7TA 1T31A 3SI3H 1UVTH 5JB8S 1H9HE 3GY8A 4U30A 4BTUB 1SFIA 3RXSA 4NWLA 1EJAA 2R0LA 2HLCA 5AFYH 5DG6A 1H8ED 1QJ6B 1TQ0B 1HAGE 3RLWH 3T5FH 1BTYA 1FONA 1RD3B 1Y3UA 3MMGA 1C2KA 1MCTA 1HJ9A 2WPLS 1UK4A 1XUHA 1NBME 4WMEA 2PKAA 3GCHB 2XYAA 1O2OA 4XDEA 2G52A 4AZ2B 2SGFE 3BG4B 1LHEH 4E7RG 4WVPE 2K7XA 1TONA 2PUQH 3A82A 3U1IB 4BXSA 3BEUA 1O39A 3P8GA 3RU4T 3A85A 1AKSB 4INLA 2QC2A 1D3QB 1O2GH 3F2FA 5T6DA 2HPPH 4RKJB 1TLDA 4ZUHA 2O8UA 1TX6A 4DY7B 3MOCA 2ANYA 3ZZCA 2CJIA 2OC0A 3PLKA 1G36A 1PYTD 3V0XA 1HJ8A 1C5VA 2VB0A 1MU8B 4X0WU 1AO5A 1K1NA 1E38B 3RXQA 4B74A 4INHA 3SV7A 1PPZA 4Y11E 1UJ1A 3RXJA 2W5EA 3MWIU 2ZU3A 3SV2H 1ZTKA 2Z6BD 2F9VA 3H7TA 5GNDA 3T25A 3UOUA 4BAOB 2BLVA 3P6ZB 3RU4E 1GJAB 2F4LA 2QF0A 1DPOA 5L2YH 5F8TA 4J2YB 1O3NA 3L3TA 3U98H 1M9UA 5ESBA 1QL9A 3U9AH 1JRTA 3V13A 4RI0A 4YOIA 2GP9B 2XBWA 3MNXA 2KAIA 1TRNA 1GBHA 2JETC 3NXPA 3MU0A 2XNIA 3EA9A 1O30A 4K1EA 1C2MA 1KLTA 5HXFA 4ZCNA 3SNBA 1QRXA 2V6NA 2BQ7B 1D9IA 1EOJA 1V2VT 1KSNA 3F6UH 4ESTE 1YPHE 2BZ6H 4ABJA 1O3HA 3RMOH 5EU8A 1C5QA 5JBAS 2WYJA 1DLKB 3UNRA 2BVXH 2VWOA 1JRSA 4F55A 2Z9IA 5ABWA 2GGVB 1HAIH 2JH0D 2TGPZ 1HXFH 4D7FA 1VCWA 4UFGH 1G37A 1BMNH 1P11E 2ZTZA 1NM6A 3ZZ9A 1O31A 4H6SB 2BY7X 1O3LA 5L2ZH 2Z7FE 4WMFA 4X6PA 3GY5A 5DP7A 4ABEA 1YC0A 2ZU2A 1GGDB 1SLWB 2NU3E 1RIWB 3ZVFA 1GBLA 2R2MB 4GCHF 4THNH 2A5IA 2W7UA 5I46H 3F9HA 2PSXA 1J8AA 2M2AA 1ELAA 3ITIA 1P9SA 2THFB 3WWFA 1TYNA 2XC4A 1XXFA 2A31A 2ZNKH 1F0TA 4K60A 5KGOA 1BTHH 1NFYA 2TGTA 4MPWA 5FPTA 2GVFA 1NFXA 1OHHD 1Z1IA 3T29A 4CREA 3EBNA 3F9FA 2FDAA 2P3FH 4HGCA 1O2SA 2H5CA 1WOFA 4TPIZ 3LH3A 2AMQA 1P57B 5DP4A 3A8CA 4WF8A 5FBIA 4WXIA 4Q80A 2SGAA 1FAKH 1TFXA 2G4TA 1ZR0A 3TU7H 3A7XA 1TIOA 5FHTA 2LIZA 1VZQH 2JJ1D 3GY3A 3LKWA 8KME2 4XE4A 2QA9E 3M7UA 1GBJA 1ACBE 3KQBA 4I8KA 1SC8U 1VCQA 3BTKE 3RXAA 1GL0E 4YESB 1HAVB 2AGEX 5GWZA 4BAHB 1EPTC 1SPJA 4NZLA 4CR5A 1C9TA 4Y7AA 2OBOA 4DGJA 1GBKA 1RFNA 4BAQB 3RC6A 1LPKB 2ZP0H 4UE7H 1DM4B 1COWD 5C67A 1QCPA 2D1JA 1BRCE 2BYAX 1CA0B 2ZPRA 2OINA 3FKSD 2BVSH 2VIPA 1BOQA 1QB9A 4FUDA 1N6XA 4AFZA 4IBLH 2B8OH 1T4VH 5EODA 3SJIA 1TPPA 4OM9A 4GHTA 2VIVA 2ZIQH 1IQEA 3BV9B 5CHAB 1Z8GA 3Q77A 1KDQA 4WMDA 1F0RA 5L30H 3M61U 4SGAE 1OP8A 1QB1A 5E2OA 3W95A 1AY6H 2WUBA 3KQDA 1G2LA 2B0FA 1GHZA 1MTWA 4XBBA 1HAYB 2W26A 3EE0B 3RXOA 5GXPA 3PWCA 4H4FA 3RXVA 2ZI2H 1PJPA 3LIWA 5HIZA 3U8OH 1BB0B 3RXBA 2P94A 3RUOA 1GHWH 2C8WB 2IOTA 2ESTE 3BTEE 1HXEH 1FQ3A 1O5FH 2VJ1A 4JK6A 1TA6A 1MTNB 1YF4A 3LC3A 2A7HA 1ANCA 6GCHF 1A0JA 1YLCA 3WY8A 4ABFA 1GMCG 1DSUA 1SR5C 3AW0A 1IQNA 4B2AA 1SGFA 8LPRA 1GL1A 3HK3B 2SNWA 2J98B 1C5YB 4K5ZA 4FUFA 1MTUA 1NS3A 3DFLA 2RFKC 1IOEA 2BY6X 4GPGA 1D3DB 4AYVB 2GTBA 2Y7XA 1DWEH 1S6FA 4TPYA 1GHXH 2W3IA 2BD7A 4A1XA 3SV6A 1MBQA 3GCOA 4ABBA 1TNHA 2WPDD 2EI8A 3RP2A 1P09A 2WPIS 1T4UH 1SQOA 1GHAF 1NRPH 1MKXK 2ZHEH 2PKSC 2WUCA 1QL8A 1LO6A 2IJD1 1W12U 3ZVBA 3PMJA 1D4PB 3VEQB 3PM3A 1MABB 1GHBF 1O3CA 3BTTE 1VGCC 3ENSB 4FU9A 5CE1A 3ODDA 4X1QU 1ZHMA 3T26A 1AB9B 3OEHD 4NGAH 4SGBE 1AWFH 2RDEA 4X1NU 5JYIA 1IQMA 1RS0A 3OSYA 1EJNA 1QHRB 5H4IB 4ISNA 1CGJE 3PO1B 4Y10E 4JCNA 1MKWH 1PPEE 1HFDA 1SOTA 4O9VA 5T6GA 4K2YA 1AHTH 3VG8A 3SUFA 3TJUA 3FP6E 7LPRA 4ZKNU 1GDQA 5E2PA 3PROA 3TVJB 1ELBA 4D9QA 3ATIA 2UWOA 3SI4H 2OD3B 4I32A 1UTNA 3RXRA 3QX5H 2XTTB 1AFQC 1H1BA 4O3UA 2A5AA 1RTFB 5A0AE 5E0HA 2CHAB 5JBTA 3QN7A 1GBEA 3SU4A 3M35A 2OC1A 3M7TA 3ODFA 2BY8X 4Q7XA 1GCDA 1OYTH 1TGSZ 3SHAH 1H4WA 1BUIA 1O2MA 1FXYA 1MCVA 3R3GB 3S69A 1C2GA 1BTPA 3KIDU 1WTGH 5GIBA 1YCPM 2M5TA 1AWHB 2AIQA 2C8YB 1F0SA 3QZQA 4KP0A 3S0NA 4X1PU 1KXDA 1C4V2 5J4SA 1O5BB 1J14A 1C1WH 1SQRA 4NIWA 2C93B 2F9PA 3DFJA 1WQSA 2GT7A 1EUFA 5F03A 1PPBH 1P05A 2VH0A 2STBE 4UDWH 2FIRH 2FTMA 2OXSA 3STIA 4MVNA 3OFND 4AG1A 2A4RA 4FETA 5EQSA 1GI9B 1WU1A 1T8NA 3VB7A 2ODPA 3OAAD 5AHGH 4MDSA 1TNIA 2UUYA 3UQOA 1BMAA 1SFQB 4MNYA 4D8NA 1CHGA 1YP9A 3FOAA 1C2IA 4AGJA 3RXGA 1ABJH 1GJ4H 3SV9A 1V2ST 1AI8H 1E0FD 1A5IA 1AVWA 5TJXA 3AAUA 4TSFD 1YCPK 2HALA 4CBOA 2XWBI 3EAJA 1NT1A 3GCHC 2PHBA 2XC0A 3E0NB 1BRAA 1V2LT 4I8GA 3CP7A 4FUIA 3BG4C 4HG6A 3NZIA 2I6QA 1QQUA 5K0HA 2BXUH 1LVYA 1EP5A 1ZJKA 1FY3A 4DG4A 1UTPA 2Y7ZA 1DFPA 1DY9A 3QK1A 2GV7A 3OU0A 3PV2A 4I86A 3SJ9A 4AN7A 5K7RA 1QA7A 1ELEE 1EPTA 3PMBB 1EB2A 1NO9H 2VIDA 3SU2A 1KMHB 1HAOH 3BEFB 1AE5A 1TNKA 1XXDA 3SNAA 2F9BH 1FZZA 2A7CA 1Y5UT 1KY9A 1AMHA 4MPVA 4NFEA 3TH3H 3FANA 4F48B 1KXBA 1DY8A 2LELA 2UUJB 4AORA 1TX7A 2ALVA 4Y8YA 1BITA 1QB6A 2NWNA 4X2XA 1UCYK 1SGRE 1O2YA 2Q6GA 1W7XH 3LGIA 3DD2H 4B73A 3P70B 2HNTF 1Q31A 1XM1A 2IPHA 1C2FA 1TGCA 1BRBE 1A2CH 3OY6U 1BHXB 3EYDA 1GBTA 1C1TA 3TJNA 6GCHG 1MQ6A 3M3VA 1F2SE 2BDAA 1CHOG 1FDPA 3HGPA 1UVPA 1UMAH 3SNDA 5E0JA 3VB5A 1SLVB 1YPGH 4Y8ZA 4DIHH
chains in the Genus database with same CATH topology
2WPKS 1F92A 4ISHH 1EAUA 1GGDC 1P01A 3E3TA 3B9FH 5J4QA 3TGIE 2QIQA 1UVSH 1AE8H 2G5NA 4IC6A 3FP7E 1LTOA 2BDYA 1K1OA 2ZDVH 3N7OA 1GHAG 3UNSA 1O2RA 1DUAA 3O8CA 1DS2E 1FNIA 3S7KB 1O3AA 1O32A 5C5OA 1F0UA 1ORFA 2HPQH 1DLEA 1GI4A 4JZFH 2F83A 3UR9A 2Z9KA 4NSVA 3E16B 1Z6EA 5DP3A 3MYWA 2AFQB 3OYPA 1ELVA 4ABGA 2ILNA 4XBDA 3GISB 2FESH 3UWIA 4ISIH 1Y59T 2NU0E 1O2UA 1O2VA 2A2XH 1Z7KA 1GHVH 3RXMA 1UTOA 1XUFA 3MO9A 4GAWA 2J92A 1GI6A 4BTTB 1AUTC 1G3EA 2HGTH 1N1LA 4RKOB 1C5UA 2B7DH 1GPZA 2ZG0H 1S6HA 2WV5A 7KMEH 3SOSA 2TIOA 3EA7A 1O5CB 1OSSA 2G8TA 1C5WB 3MTYA 3F1SB 3FAOA 3TK9A 4BANB 3GDVA 3RC4A 3AW1A 2QN5T 4Y79A 3ZZ6A 1UK2A 1WBGB 4DCDA 1LVMA 1Z71A 3QDZB 5AFZH 1ELGA 1ZMNA 1CA0C 1SGTA 3HK6B 1O5DH 1CA8B 3ZZAA 2QAAA 2C90B 2EI6A 4BNRA 6LPRA 4A6LA 5CHAC 1LHFH 2ZFPH 4B1TA 4NCYA 3S9CA 1S83A 2V3OH 1MUEB 3KGPA 3U69H 3JZ1B 1O3FA 3A7ZA 4IMZA 2G5VA 1B0EA 2CN0H 3A8AA 3IITA 4X6MA 4JZDH 5G4BA 1AN1E 5HYOA 1W0YH 3DT0H 3Q3KA 1J17T 3ATKA 4K3JA 3PMHB 2XBXA 1BRUP 1WV7H 2J4IA 3A8DA 1O5AB 3ZYDA 4NSYA 2Y5HA 2GZ7A 4JYVH 1P06A 2OLGA 1C1MA 3RXPA 1Q3XA 1CSOE 3AAVA 1YPKH 1MTNC 2BB4A 1LPZB 1GI1A 1V2NT 2PV9B 2CF8H 1UCYH 3OY5U 1K28D 1OWIA 2FOEA 4IW4E 1ZPZA 2ZFRH 1RGQA 5A0BA 5FBEA 2P95A 1OWEA 2R3YA 1Y8TA 2FLBH 1TA2A 2WPHS 5DP6A 3RXCA 4XSKU 2QGRA 2ZCLP 3H5CB 5L6NH 3BF6H 4IS5A 3STJA 1V2QT 4H42U 2DUCA 1XX9A 1C1OA 2A2QH 1TAWA 3RXKA 4FU8A 1NC6A 1TB6H 1LCYA 3SUGA 3LGUA 4F4OC 2XCFA 4KELA 1TQ7B 2QF3A 2ZFFH 2SGPE 1AKSA 2XC5A 3UR6A 4NA9H 1V2RT 7GCHF 3UY9A 3MI4A 2H2ZA 2Y6TA 1AB9C 2ZEBA 1TNJA 3RMNH 1BQYA 3SU3A 4NZQA 1ETRH 3QWCH 3MU4A 1UHBB 1MZAA 2ZU5A 1L1NA 5C3NA 3P92A 3SBKA 3SUDA 1LDTT 3UWJH 2ZHWH 3PO1C 2ZGCA 2H9HA 2BVRH 4FUEA 1QA0A 5JBCS 3UOPA 3RXEA 2Q6FA 1RTLA 9LPRA 4JZIA 2FYRA 2O8LA 3RXUA 4BOHA 1O3PB 4BAMB 1C5OH 1ANBA 1F7ZA 4LK4A 1GDUA 3HKJB 1TBZH 4ABIA 1SB1H 3BTHE 1MTVA 2G51A 1BIOA 3VGCB 3P95A 4AB8A 8GCHF 1GG6B 1W7GH 5LPEA 3A80A 1GVKB 2CHAC 1MMJN 1SGCA 1KLIH 1SQAA 3CS0A 3QZRA 2WPMS 6CHAC 2BDIA 1BBRE 4OS5A 1NFWA 3S9AA 2RCEA 3ZZDA 3EDXB 2ZDAH 2FI5E 2TRMA 4KTSA 5DO4H 1DUEA 1V6DA 4WWYA 3LOXA 4Q2KA 2SGQE 3E1XB 4X8SH 2SGEE 5JBBS 3C1KA 1O2LA 3A7WA 3LGYA 1HLTH 3IWMA 2BLOA 2W7SA 4ZHAA 2H9TH 3ATWA 2P59A 1L1JA 3BTFE 1HPGA 3HGNA 3SJ8A 4D7GA 2OC7A 3QGNB 4AFUA 1C2JA 3I78A 1IQIA 4AX9H 1C2HA 1P3EA 2ZHFH 3O8RA 1C1UH 2BQ6B 8ESTE 1AFEH 4OS4A 1EQ9A 1O2PA 1AD8H 3GICB 3PMAB 4CBNA 2Z9LA 3TITA 1MH0A 3UQVA 2K1QA 1CT0E 4X1RU 4ASHA 2PLXA 3K6ZA 4KGAA 3R0FA 1O35A 4ZKRU 1OPHB 3RXTA 3SU1A 4CH2B 3ELAH 1JIRA 4Y7BA 1WYKA 1O2KA 2ZGJA 4JZEH 3B8JA 1EB1H 1TBRH 3FVFB 3EGKH 4MPUA 1MAYA 2A32A 2CF9H 3M5MA 1ETSH 1TRMA 3MFJA 1FMGA 4TYDA 1FN8A 1NESE 2PUXB 2RG3A 1AZZA 1C5SA 1KXFA 1HAVA 1NRSH 3BN9A 1C5PA 1C1NA 1EZSC 1EJMA 3SNCA 3U1JB 4K8BA 4RSPA 3BG8A 1MTSA 3BTGE 1EXFA 1L1GA 4ISLA 3MNCA 1MZDA 2Y5GA 5HMAA 2A5KA 1KYNA 2AH4X 2FPZA 2FP7B 3PTBA 2BY9X 5GCHF 5DK1A 5EQRA 3CS7A 1GJ8B 2A4OA 2PW8H 2Z3CA 5E8EH 1CU1A 1ABIH 1FAXA 1SGDE 1ARBA 4K8YA 1ESTA 3SGQE 2BHGA 1FIZA 2ANMH 1YKTA 1A61H 4JYUH 1H8IH 2CMYA 3GY6A 1EZXC 3LPRA 1O0DH 2FI4E 3V7TA 1LVOA 1VITF 1QIXB 2ZA5A 3M3TA 1ZSLA 2RA0A 3OX7U 4WY3A 1IQKA 4B71A 1P9UA 4ZHMU 5F8ZA 1QNJA 1LQEA 3LGWA 3TK6A 3Q00A 3F68H 2C4FH 2HNTE 3LGVA 4X6OA 3A7YA 2ZZUH 2IJOB 1DE7H 4YOGA 1O2QA 3MU5A 4DJZB 5HGGA 2P93A 1O3MA 1CVWH 4CRGA 1T8OA 2BM2A 4J1YA 5E0GA 1UTJA 3TLOA 5TCCA 3A89A 3GY2A 3L6PA 1YPEH 1HDTH 2VWLA 2XWAA 3CENA 3NKKA 2DE8A 2HWLB 1D3PB 1YPJH 4CR9A 4BAKB 3S9BA 5LPRA 2BD9A 1GI2A 5DP5A 3UIRA 1W10U 3D62A 3SZNA 3U8TH 1NFUA 3ZV9A 1RXPA 1SHYA 1O2TA 1Y3VA 4MPXA 4ABDA 2LNCA 1HYLA 1YPMH 1W14U 2TGAA 5AVDA 3KEEA 1BBRK 4X8VH 1JOUB 3H7OA 4FVBA 1O2WA 5GPIB 1TNLA 2BXTH 2IN2A 1THSH 1YPHC 2GMTB 2I6SA 1BJUA 3A81A 2BLWA 4IN1A 4X2WA 5JDUB 2F91A 1SGIB 1P2QA 2VGCB 1C1QA 3UPEA 3VB6A 3URCA 5FX5A 3TNTA 3LT3A 1DVAH 4IN2A 1HRTH 3E91A 4GCHG 1FIWA 3FZDA 1HIAB 3ZZ4A 4Z0KA 1N6YA 1NTPA 1V3XA 3RMLH 1ZJDA 1K21H 1CE5A 1HAHH 3AASA 3LGTA 2R2WU 2CV3A 3PLBA 4FUBA 3SGBE 2AMPA 1WSSH 8GCHG 2VVCA 4QT8C 1ELCA 5HM9A 3QUMP 4DIIH 1SLUB 2BDBA 1ZRBA 1GI5A 2JH6D 1A46H 1UVUH 4XBCA 1HB0B 2C8ZB 1SLXB 2G81E 4NIVA 5GDSH 1PYTC 1UTLM 1B5GH 1ZYOA 3TGJE 1XUKA 2XCNA 1EPTB 1V2KT 1CBWB 2J38A 1GBDA 2ZDLA 2CXVA 1SHHB 3BEIB 3M7QA 1INCA 2FOCA 1QURH 4IGDA 1GHYH 1ZPCA 1VITH 2SGDE 3F9EA 1BDAA 2J34A 2BZAA 1H9IE 2JKHA 4DVAU 3MHWU 2FS8A 3AVZA 1BZXE 1C5MD 4A92A 1AQ7A 1ZHPA 3SHCH 1HJAB 1DWBH 1UO6A 3M37A 5EQQA 3GCTF 4RN6A 3F9GA 1TABE 3KL6A 2BD5A 5IYTA 4BXWA 1SGNE 1JWTA 1ID5H 3U8RH 2FODA 1CGHA 4TWWA 1MKXH 1P12E 3FFGA 1NRQH 1CGIE 2OUAA 1W11U 4YT6H 4K69A 4CRAA 2VU8E 2EC9H 2FXRA 3KNXA 1A3EH 2ZKSA 3ZYEA 3ZVDA 1HAZB 1TNGA 2ZPSA 4CRCA 4Y71A 5SGAE 4I33A 1CT2E 1EATA 1L4DA 2ZGBH 2ODYB 3PYHA 1JIMA 3SN8A 2YNBA 1EZQA 1ELFA 2FX6A 1VJ9U 2TPIZ 1L2EA 2ASUB 4ZROA 2UUFB 1UTMA 2W3KA 1WUNH 4YOJA 1Z1JA 2V0BA 1SSXA 1ZZZA 1EASA 1TGBA 5FCKA 2ZO3H 2LPRA 1P3CA 4CRDA 4OS7A 1C5TA 4FUJA 1IAUA 1NN6A 1TALA 4WH8A 2ZFQH 4ZKOU 1THRH 2ZCHP 1P02A 2BOHB 3LJJA 1C4U2 1ZSKA 3HKIB 3RXFA 4X2VA 4AFQA 3A7VA 1FY4A 1ZMLA 2GDEH 3TJOA 1YBWA 3PV4A 9ESTA 1QL7A 1RIWC 1QBOA 3ZVEA 1VGCB 2ZHQH 1GMHF 1GDNA 2FOGA 1VITG 3E0PB 2PGQB 3A88A 2FWWA 2ZDNA 5EOKA 2BX4A 1QGFA 1QJ7B 4U2WA 1G3CA 2RDLA 4E05H 3VGCC 3K2UA 1GG6C 1SMFE 5C5NA 4A7IB 1G3DA 1GHBG 4OGYA 1B0FA 1QR3E 1C5LH 1UK3A 4MNVA 3QTOH 4IC5A 4YT7H 4B2CA 1FV9A 2FI3E 2QCYA 1BTZA 3DHKH 1FY5A 1DANH 4ZH8A 3M5LA 1E34B 5A8ZA 2DE9A 3SW2B 2OQUA 4B2BA 1U6QA 2F9NA 3GYLB 2QXJA 1GJ6A 1P03A 2Y81A 1Y3WA 3FP8E 2P8OB 4FU7A 1V2TT 4O03A 2P16A 3KHVA 1KTSB 1WTHD 2GDDA 1LMWB 1CQQA 2D26C 2BMGB 2R3UA 4HZHA 1PPCE 2PR3A 2F9UA 1HUTH 1NPMA 2PSYA 1YCPH 4YLQH 3TIUA 1A5HA 1S0QA 2VWMA 2HOBA 1AGJA 1S5SA 2BY5X 1BMLA 2PKAB 2QXIA 1PPFE 3Q76A 1EX3A 1O5GH 4WXVA 3P8FA 1VJAU 1OP2A 2QXGA 1C5XB 2FO9A 1Y3YA 1AVGH 4MNWA 1OWKA 2GCTB 3P17H 3M5OA 2G4UA 2SFAA 1LHDH 5A8YA 4CRFA 2H5DA 1SGYE 3V3MA 1GMDF 3DA9B 2BX3A 1A4WH 2ZQ2A 3VXFH 2FOFA 1GCTB 1GBFA 3PWBA 2QXHA 4TY6A 2RA3A 4UFDH 1LHGH 1FJSA 3ZZ8A 2R0KA 1W0ZU 3MH7A 5BRRE 1W13U 1S82A 1FN6A 2XBYA 3A8BA 2GD4B 4LOYH 1G3BA 4K1TA 3TGKE 1V2OT 2UUKB 4ZXXH 1J16A 1BT7A 2Y5FA 2BD3A 1GMCF 2C8XB 1Z8IB 1C2LA 1ZHRA 3TK5A 1SGPE 4YM9A 3GY4A 2ZECA 4U01A 3RDZA 3NWUA 1S0RA 3LH1A 5EXNA 1ELDE 5ETXA 2YOLA 3VB4A 1Y5AT 1LVBA 1GBCA 4I8JA 2KAIB 4HTCH 4MTBA 2CGAA 1O2HA 3MH4A 3BTME 1N8OB 2VINA 5DKMA 1K1IA 5LGOA 1B7XB 3A84A 4A5TS 1C5NH 2ZGHA 2VNTA 5C1UA 1OYQA 1QRZA 1KXAA 4I7YH 1QJ1B 1L4ZA 1Z8JB 3D65E 2WPJS 1D3TB 1FY8E 2BOKA 1LKBA 1NZQH 2A1DB 5C1YA 3VPKA 1TBQH 4X1SU 1ZTJA 1TE0A 2B5TB 4DT7B 3RXDA 1G9IE 1QBVH 1GVLA 1ZGVA 2FYQA 3S7HB 4Q7YA 1A7SA 4U32A 3W94A 1BJVA 3GCNA 4XOJA 3TH2H 1XUGA 5BPEA 1TMBH 2ALPA 2FEQH 3L33A 3GCTG 5FPSA 5F8XA 1A0LA 5AF9H 4BTIB 2V35A 1AIXH 4UEHH 2HRVA 3SUEA 3P8OA 4VGCB 3HATH 1HAXB 3RLYH 3OTJE 2ZDKA 1VR1H 2FOBA 5I25A 3KN2A 3QTVH 3ESTA 4LXBH 3BIVH 2VIOA 1E35B 1P2OA 1ETTH 1A1RA 1W3CA 2UWPA 4KTCA 1OWHA 1EAXA 2EI7A 1MD8A 1V2JT 2WYGA 1BMMH 3MO6A 5C2ZA 3D23A 1NROH 1O3KA 2ULLA 4OS2A 1ZSJA 1K1PA 1W2KH 1PPGE 2ZCKP 1C5ZB 4H6TA 4ZXYH 2ZU4A 1YGCH 2GMTC 5FCRA 3B23B 4CRBA 1DICA 3SU0A 1LQDB 4GLYA 1XMNB 1S81A 1DX5M 1GJDB 1EKBB 1V2UT 3O8BA 3QLPH 2Q1JA 1GBMA 2VGCC 2BLQA 3FZZA 1GJ7B 1ESAA 1A0HB 3GYMA 1IQGA 1GI3A 3NK8A 4B76A 2ZWLH 1UHBA 3T2NA 1GWAA 1THPB 2FS9A 2OP9A 2OC8A 1A3BH 1O5EH 3I29A 3T27A 2P3UB 2AGGX 2BTCE 3SNEA 1GMHG 3P8NA 3MO3A 4DW2U 3LU9B 4JMYA 1TGTA 1MKWK 2Q6DA 4Y8XA 3TJVA 4A1VA 2P3TB 3MU8A 2D2DA 2Z9GA 4WH6A 1KDQB 3RM2H 2ZTXA 4X6NA 1IHTH 1BTXA 3BSQA 4FXGH 4E7NA 3SV8A 1GBIA 2BDGA 2PGBB 2ZF0H 4ZMAH 1Z8RA 1IQLA 4INKA 1PQ5A 3E8LA 3KCGH 3SJKA 2Y82A 2TBSA 1SGFG 1C1SA 4CH8B 3RMMH 1OWJA 2HVXA 3VB3A 2A45B 2ZPQA 2A4QA 2EEKA 2FOMB 1SQTA 1DXPA 1HBTH 2AYWA 4E06H 5LH8A 4X2YA 3M5NA 1ZTLA 3BTQE 1CBWC 2F3CE 1O3OA 4ABAA 4CHAB 2UWLA 5DGJA 4D76A 5EG4A 4DOQA 2PFEA 1OKXA 2XW9A 1WQVH 2SNVA 1GI0A 1C1PA 4R8TB 2Z3EA 2NU2E 1A5GH 3SQEE 2ZGXH 4O3TA 3SU5A 1FPCH 3UTUH 4TWYA 1KIGH 1LHCH 3ZZ5A 1GJ5H 1EZUC 2XRCA 7ESTE 1ZMJA 4DURA 1BCUH