2Z94A

Complex structure of sars-cov 3c-like protease with tdt
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
306
structure length
306
Chain Sequence
SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRKSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKFYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQCSGVTFQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Replicase polyprotein 1ab
publication title Structural basis of mercury- and zinc-conjugated complexes as SARS-CoV 3C-like protease inhibitors
pubmed doi rcsb
source organism Sars coronavirus
molecule tags Hydrolase
total genus 89
structure length 306
sequence length 306
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2007-09-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1840.10 Mainly Alpha Orthogonal Bundle main proteinase (3clpro) structure, domain 3 main proteinase (3clpro) structure, domain 3 2z94A03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2z94A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2z94A02
1W2KH 2BXTH 4DCDA 2A7JA 3SN8A 1YM0A 3SU4A 1AVWA 1INCA 1RD3B 3HATH 1OWHA 4IC6A 3QX5H 3P92A 2GX4A 1DXPA 1SLXB 2V6NA 3SUFA 4JYUH 2GD4B 1CU1A 1C2HA 1HJAC 3M3TA 4CRAA 1ETTH 1G3BA 1KLTA 4KGAA 1NS3A 5LH8A 1P2NA 3AAUA 2PTCE 2VH6A 4GSOA 5F8XA 1C1SA 2M5TA 4GHQA 1NC6A 1PQ8A 3KCGH 3GY2A 1EUFA 1O2ZA 4Z6AH 4INKA 1Z1JA 2FP7B 1S6HA 3T5FH 2AIQA 1JWTA 1KTSB 3MU1A 1VITH 2ZFQH 3VPKA 1NFYA 3QDZB 1QR3E 3ZV8A 3TJVA 2VJ1A 1BZXE 3U69H 2F9VA 1ACBE 1UTKA 2G52A 1DX5M 1C2JA 2GZ9A 3HKIB 5TJXA 1P05A 3M3VA 1FIZA 4B2BA 1AE5A 1SGCA 3EE0B 1NFUA 6CHAC 1CHOF 3BTGE 3KF2A 2TGTA 2ZI2H 2P94A 3QGJA 1GHYH 2WPIS 1JIMA 1FY1A 2BDIA 1ELBA 3DA9B 1ZSLA 1GG6C 1XMNB 1O37A 1O3GA 1GHBG 4I32A 4AN7A 1PPHE 3BG4B 3FP8E 4BANB 1GGDB 3M5NA 1SB1H 4AORA 1S83A 2CXVA 1BHXF 2QA9E 3PROA 1EP6A 1TA2A 2JKHA 5JDUB 1Z7KA 2CHAB 4YTAA 1SMFE 3BTME 5JPMH 1O2NA 4RKOB 2FI5E 1LCYA 1RIWB 3MU5A 2W26A 3UPEA 1ABIH 5C1UA 5EW2H 3GY7A 2Z9KA 1O0DH 2XXLA 2STBE 4UE7H 1ANBA 3SU3A 2IJOB 1P02A 1ZTLA 4GVUA 1KIGH 2WV4A 4ZUHA 3MH7A 2WYGA 1W0ZU 3LONA 4A6LA 1D6WA 5G4BA 3P8NA 1UTOA 4FUGA 2BD8A 5A8XA 1D3QB 2QN5T 4GAWA 1CGJE 2FZZA 3NCLA 4K1EA 5A09A 3OSYA 3PLPA 1P2JA 1LQEA 5GPIB 1AFEH 1DDJA 1PPCE 1B7XB 2OC8A 1AWHB 5EQRA 2BX3A 2GCHF 2TPIZ 4WH6A 1QJ6B 5GCHF 1O3NA 1GJAB 1QQUA 1TGBA 2QF0A 3VB5A 4YOJA 2ZKSA 2NU1E 1IQHA 2B5TB 1GBFA 2QXIA 2VIQA 2J92A 3PMHB 1QQ4A 1UTQA 3BTWE 1GI5A 3LH3A 4NZQA 2BHGA 2OBQA 4ZKRU 1SR5C 3MYWA 1HLTH 1ESAA 1ZGVA 1DLEA 1TLDA 1GI9B 1NY22 1O30A 1ETSH 1TWXB 2Y81A 4X2XA 3BG8A 3RP2A 1HXFH 3LDXH 1F2SE 1HXEH 2A4RA 1GMDF 1MAXA 1VJAU 1RRKA 1V2TT 3M5OA 1FV9A 2G55A 1C4V2 2ZU1A 4MNVA 2TGAA 1BTZA 3ATMA 4SGBE 1GWAA 2GKVE 1ELEE 5EU8A 1F0RA 1EAUA 2BY8X 5TCAA 1YF4A 3Q77A 1E35B 4KTCA 1EPTA 2HVXA 2FOGA 3GCOA 2QYIA 3FAOA 4XBBA 2GDDA 2ALVA 1LVMA 2NU4E 2R3UA 1KLJH 1QTFA 1EQ9A 4UFDH 2D8WA 2ZU2A 1AO5A 2ZTZA 5AFYH 4FUCA 1IHTH 1SGPE 4A7IB 1ZRKA 1ZTKA 3WY8A 2BDGA 3GY5A 1TONA 1KXAA 3KIDU 1K1LA 3M61U 3SGAE 4YO9A 1RS0A 4B1TA 1TGSZ 3Q3XA 2H5CA 1YPMH 1T31A 1T4VH 3RXVA 2BD5A 3KQBA 3T2NA 3A7TA 1RGQA 1CVWH 1ESBA 2HNTF 1TX7A 5FX5A 3A85A 2CF8H 3URDA 1HAVA 1EJNA 2VIOA 2VIPA 5F03A 4X6NA 1C1TA 1ELCA 2BLOA 3QK1A 4MDSA 1CSOE 1C2GA 4I8KA 3TITA 4B76A 4WWYA 1Z8IB 2BZ6H 4WXVA 3KGPA 2BMGB 3SNCA 2Y7ZA 2OQ5A 1NN6A 1GBBA 2OUAA 4FUIA 2ZZUH 5ESBA 1G37A 3KHVA 4WJG2 1AMHA 3KNXA 4Y0YE 4NA9H 1C5RA 3MOCA 3F9HA 1A4WH 4U2WA 2XW9A 2PW8H 5FBEA 4JK6A 1NFWA 3ODDA 3MH6A 5AHGH 4CREA 4UDWH 5IDKA 1ZPBA 5T3HA 1O2TA 2SGDE 1BBRH 3EGKH 5DP6A 1ANCA 1BB0B 1BRAA 1O2JA 5J4SA 3ITIA 3Q3KA 3UTUH 5AF9H 2ANYA 3G01A 4BTIB 2AGEX 1SGRE 1AVXA 4AFSA 4DIIH 3ZVAA 1GCDA 1ABJH 1V2QT 1HGTH 2AMDA 1KDQA 1TNGA 3IG6B 3TIUA 4ABAA 1E36B 1DWDH 1TX8A 3ATWA 3JZ1B 1KXEA 2FOCA 4X6PA 3GDVA 1ZSKA 3SQEE 1SI5H 3O8RA 1QL8A 3BTDE 1F5RA 1SGIB 1LVYA 1S84A 1TNHA 1THSH 1O5GH 1DANH 4TWYA 1TNLA 5C1XA 3MH5A 2PSXA 4OS4A 1VGCB 5L2YH 2A4GA 2DE9A 1AFQB 5LPRA 1NT1A 2VNTA 3BTKE 4AB9A 4AOQA 4ZKNU 1LHDH 2OCVB 1UCYK 3CS7A 5HXFA 1P9UA 3BTFE 4HI3A 1HJ9A 5K0HA 2FLRH 4LK4A 1LHCH 3EDXB 3QZRA 1IOEA 2TRMA 2BOKA 3UNRA 1IQEA 2ZDVH 3E8LA 5DGJA 4GHTA 3JZ2B 1GJ8B 2FYRA 3RXKA 4AG2A 1H9LB 2YNBA 1FN6A 3A87A 1ELGA 2WUCA 2YNAA 3TNTA 3RXRA 1FY3A 5FXLA 1TOCB 1UVOA 2AGGX 2OXSA 3GCHB 1V6DA 3LOXA 5DP9A 1OYQA 5DP5A 1KTTB 1A2CH 2XYAA 4JK5A 2A4OA 2Z9LA 2AERH 4A92A 5F6MA 1FAKH 1UCYH 2SGPE 1CO7E 1TRYA 1GI3A 1B5GH 3SORA 1SBWA 1GBCA 3MO6A 2Q6GA 1GBAA 5EPYA 2GV7A 2ANWA 2FESH 3TGIE 4ZAEA 1XM1A 4BAMB 1Z8JB 4TY7A 1LMWB 4DG4A 1WCZA 1NTPA 3TU7H 4LXBH 4UD9H 1D4PB 1A7SA 3TH3H 1QFKH 2LNCA 4Z0KA 1O3KA 5GIBA 4AB8A 2B0FA 1OWEA 4ASHA 3UQVA 2H5DA 2A31A 3SUGA 2BD7A 4AYYB 3SV8A 1NRPH 1O3LA 1E38B 4K8YA 3SU0A 1WOFA 1MTVA 1C5XB 1O2XA 1O3FA 2IOTA 4IN2A 1A1RA 6GCHG 3E3TA 3UFAA 1GBMA 1WSSH 2OC7A 1C2KA 1S5SA 2PKSC 4AG1A 1NU9A 1W12U 3MHWU 3GOVB 1D3PB 1FY8E 2ZDAH 2R0KA 1TMUH 4GUXA 4NG9H 3UQOA 1TGNA 1ZMNA 1A0JA 2AH4X 2OC0A 3KN2A 4WH8A 2ZGBH 3VGCB 3RXCA 1YYY1 4Y6DA 2RCEA 1UTNA 1JBUH 1W11U 1YLCA 5DKMA 3L6PA 3BF6H 1LQDB 2ZDKA 1OWKA 5EG4A 4X1QU 5GDSH 3STJA 3RXJA 4OGYA 4Y76A 1XVOA 5BPEA 1O5CB 1H9HE 2EEKA 1QBVH 1JRSA 1SGTA 3S69A 2LPRA 1YGCH 1GBTA 1F0UA 5A0AE 1SGYE 3S7KB 1WYKA 1EPTB 2OINA 4A1VA 1BA8B 1TMTH 2F9PA 4BTUB 1VZQH 1A5IA 2ZHFH 1DPOA 3K65B 2F91A 5FPTA 1AWFH 1AI8H 4R8TB 3MFJA 1K22H 3BN9A 4K60A 2WPMS 2ODQA 3TGJE 2OLGA 4E7NA 2H2ZA 4ABFA 2Z9IA 1TAWA 2A2XH 1MU6B 1WTHD 3ZVBA 4GCHF 3R3GB 5E2OA 2P3TB 1L4DA 1BHXB 1O35A 9LPRA 1HIAA 3I78A 4BXWA 3BV9B 1GJ5H 1P2MA 3QWCH 5GJ4B 1UK3A 3E1XB 4YLQH 3SNEA 1JXPA 4KTUA 1BMAA 1DICA 4X6OA 3P8FA 3TVJB 3PTBA 3ZZBA 1TRMA 1HAVB 1UMAH 1S0RA 1Y3VA 3LJOA 2Y5GA 4ABJA 4NIXA 4Y10E 1GHWH 1L2EA 5EXMA 3UY9A 1GJ6A 3A7ZA 4DT7B 4YM9A 3KL6A 2Z3CA 4ZKOU 3RU4E 2PKAA 3LC5A 1TFXA 1F7ZA 1T8MA 2QAAA 1LTOA 1O3HA 4OS6A 2VIVA 1MBQA 4NIYA 3ZZAA 1AD8H 1GJBB 1L1JA 5C3NA 4CH8B 3HPTB 3F9GA 1MZDA 1N6YA 5T6GA 5C5NA 1QB9A 4A5TS 2FI3E 4VGCC 3A89A 5I25A 2UWLA 1DM4B 1GBKA 5JB8S 1BOQA 1XVMA 3GY6A 4AYVB 1OWJA 4E06H 1O32A 1RJXB 3RXEA 1YCPM 1E0FD 2LIZA 4A1XA 1T8LA 1C1NA 2H9EH 2BDCA 3BEUA 3RLWH 5GCHG 1LPKB 3PB1E 1MTNB 3SNAA 1QB1A 3NPSA 4D76A 4DURA 4KTSA 2ZU4A 1BITA 3RXTA 3TK5A 4X2YA 4GPGA 3ZVCA 1P3EA 4D7GA 1TRNA 1PPBH 3P8GA 4MLFB 3SV9A 1RTFB 1FONA 1K1JA 2VGCC 3RXOA 3AASA 3TK6A 2W3IA 3LC3A 2HPQH 1GJ4H 4JCNA 1KDQB 1XKBC 1MZAA 3A86A 3FZZA 5JBCS 3MH4A 2Y82A 4JZFH 4FVDA 4INLA 3FP7E 1C1WH 3L33A 1MCVA 1Q3XA 1GMDG 2FXRA 3RXHA 2J38A 3RM2H 2Y5FA 2ZFTA 3TNSA 3RLYH 2HRVA 1ELTA 2XCNA 3SJOA 5LPEA 5FHTA 2XBVA 4TPIZ 3GY4A 4FU7A 1EZXC 2R2MB 1YC0A 2BB4A 1K1PA 1T32A 2BM2A 2TIOA 1SG8B 2EI8A 4DGJA 3GY3A 2SGEE 3LGYA 1W7GH 1W8BH 1LVOA 2GCTC 4IMZA 3TPIZ 4ZH8A 2O8UA 1KLIH 1UVPA 4CRFA 5DPAA 1GHZA 3N7OA 1N8OB 4D7FA 1AGJA 1O3EA 1Z6EA 4WY3A 1TPAE 5EODA 2GTBA 3DD2H 1GJ7B 4VGCB 1HFDA 2AS9A 1CE5A 1GJ9B 1THPB 1WV7H 2P3UB 1TA6A 2BQ7B 2NU0E 3E0NB 2FOBA 1O3JA 8GCHF 1BT7A 5E2PA 4MNYA 4CR9A 1J14A 1AUTC 1IAUA 1W14U 2BVRH 5JB9S 1C1MA 2HNTE 2ZGXH 1O2HA 1W13U 1MH0A 3LGUA 1A0HB 3MO3A 5T6DA 1EAXA 3RXLA 1DFPA 2NWNA 1RTLA 5HM9A 2J34A 1O2UA 5L30H 2R9PA 5A8YA 2BLWA 3VFEA 3P95A 3V7TA 3S0NA 2AEIH 1ETRH 4OS1A 1C5PA 3S9AA 1DT2A 2FI4E 2O9QA 2Y5HA 4CRDA 1QBNA 3MNBA 4IN1A 1HJAB 2SNVA 1O5EH 1P11E 2GGVB 1HBTH 3TJOA 1ZJKA 1Y5UT 5C5OA 1V2NT 2K7XA 1MQ5A 1PQAA 1O2VA 1O3DA 4XE4A 3UWIA 1CHGA 1O2LA 5C2ZA 4MPWA 2W5EA 2ZNKH 2BY5X 1D3DB 1C5WB 4MPXA 4X1NU 1YLDA 1H1BA 2FWWA 1EASA 3NXPA 1AY6H 3FP6E 1A46H 1GHVH 3LIWA 1IQGA 2C8YB 3A8BA 4JZ1A 4O3TA 1L1NA 2GMTC 1C5QA 1SLVB 1SLWB 1IQKA 4WF8A 4NSYA 5LGOA 3ATLA 4B71A 1IQIA 2PV9B 1LDTT 1OWIA 1UHBA 2ODPA 4WMEA 2ZCKP 1O2OA 1TBQH 4QT8C 1O2IA 1GHXH 4H42U 4NA7A 5AFZH 1SQOA 3ZVDA 1B0FA 6CHAB 3RC4A 3E91A 1TBRH 3SU5A 2C90B 1TYNA 1GG6B 3TLOA 1OP2A 3O8DA 1ZPZA 2PR3A 4LZ1H 1DUAA 2XC0A 4UFGH 1ZSJA 3MU8A 5JBAS 3A7VA 4ISLA 1OWDA 2R0LA 1BTWA 2GZ8A 4AX9H 4BAOB 3CENA 1DWEH 1GBLA 1YKTA 5ETXA 3UOUA 3SQHE 3FANA 3S9BA 4SGAE 1IQMA 2BVSH 4DOQA 2G4UA 3GISB 1A5HA 2FYQA 3A7XA 5H4IB 1LPGB 2ASUB 3Q76A 3ZZDA 4B2CA 4OGXA 1Z1IA 2J9NA 2RA0A 2BD3A 1N1LA 1GBIA 5HM2A 3PMBB 3QO6A 3M7TA 4FVBA 9ESTA 3U8TH 1QL9A 1EATA 4J1YA 2W7SA 1BRBE 2Z9GA 1P8VC 1YPJH 1O5BB 3LPRA 3I77A 2VB0A 1AB9C 5HMAA 2UUKB 3FVFB 4Q80A 1OYTH 1TE0A 3FZDA 1LKBA 1TIOA 4YT6H 1O2KA 3LGTA 2G51A 1GVLA 3QLPH 2ZFSA 4X8TH 3PM3A 1K9OE 3K6YA 2GZ7A 1YPHC 3S7HB 1Y8TA 4JYVH 1HIAB 2OD3B 4NWKA 3M5MA 3M5LA 3SU6A 3A8AA 1BBRK 3D65E 2V35A 1GHAF 1OSSA 2GVFA 1F0SA 2BX4A 1ESTA 3B23B 1F5LA 1BIOA 1GCTC 3B9FH 2BLVA 4OS7A 3A81A 3GCTG 4IS5A 1GJCB 4CRCA 3RXMA 2CV3A 1XUIA 1JIRA 1DUEA 1J8AA 3GY8A 4R0IA 1QJ7B 1H8IH 8ESTE 1ZRBA 3A83A 4OS5A 5IYTA 3RXGA 2PUXB 1MBMA 2XC4A 2ZP0H 1GI1A 2H9HA 2BY9X 3F9EA 1DWCH 4HZHA 1P12E 3OY6U 1JRTA 2OQUA 3GDUA 1S82A 2J94A 2AGIX 2EI7A 4NIVA 2ZECA 1G36A 3BTHE 1ZR0A 2Z7FE 2CMYA 1A61H 2ZHWH 2XBWA 3ZYDA 4ZXXH 5T6FA 4X8UH 1FNIA 1C4Y2 3PMAB 1G3EA 1ARBA 1ZHMA 1O38A 1O3CA 3L3TA 5DP4A 4INHA 2VWOA 3T26A 3P17H 2BD9A 2OP9A 5A0CA 2XNIA 4K3JA 2D26C 2FOAA 2ZCLP 1C1VH 1OOKB 3ELAH 3SUEA 3GICB 1P0SH 1CT4E 2FOEA 1JOUB 2NU2E 5CHAC 1GBJA 4DVAU 2AMQA 1ZTJA 2JETC 1BUIA 2GT7A 1FLEE 2V0BA 1A3EH 1O5DH 4MPUA 4I7YH 3A84A 1E37B 2AIPA 3EA7A 1C5ZB 1MKWK 3NKKA 1O36A 2BZAA 4FUHA 1V2UT 3W94A 1O3IA 2EC9H 3DT0H 2R2WU 5C20A 2PTNA 3ZYEA 5HGGA 5C67A 2A1DB 3PMJA 1F92A 2WYJA 2A5IA 1UTMA 1MTSA 2PGQB 3AW1A 3E0PB 2XTTB 3PYHA 4FUFA 1UVSH 1FI8A 2ZO3H 3UWJH 1FZZA 1SGFA 1WQSA 5B6OA 4AFQA 1GDQA 1Y3UA 1CBWC 1ZGIA 3HK3B 1Y59T 1L0ZA 1LPZB 3VB3A 1AIXH 3U8OH 1MKWH 3ZZCA 1SC8U 5DJ7A 4Y11E 1Y3XA 5SGAE 3DFJA 2Z94A 3T25A 1C1RA 3NZIA 1D9IA 3BTQE 2P8OC 1GMHF 3M7QA 4GCHG 1MD7A 1XUKA 3OYPA 3PV4A 3SU1A 8KME2 1FDPA 2I6QA 3ZV9A 1GVZA 1UTLM 3ZZ7A 4JYTA 1PPEE 2FX6A 4LZ4B 3HGPA 1XXDA 4B74A 3VXFH 3MWIU 3D23A 4X1RU 2BXUH 1VCPA 2Z3EA 1DVAH 1DY8A 1O39A 3GCTF 1GI2A 3RMOH 3UIRA 1V2WT 4CBOA 1BCUH 2C8ZB 4BXSA 3PLBA 2V3OH 2ZDNA 1O3AA 3E16B 5CHAB 1G2LA 2P59A 2A5AA 2O8TA 2JETB 2J4IA 4U01A 4Q2KA 2ZQ1A 3SI3H 1O2YA 1SHHB 3ZVEA 2WPJS 5E0JA 2W3KA 2KAIA 1Z8GA 2Y6TA 1BMLA 2ZFRH 1EZUC 3T28A 2BTCE 1W0YH 4O97A 1ZLRA 1NESE 1QNJA 1MKXK 2SFAA 4AFUA 1ANDA 1D3TB 2RA3A 2QIQA 3V13A 3BSQA 1GI8B 1GMCF 1VITF 1ID5H 4TY6A 3RMNH 4B75A 1OX1A 1F5KU 2ZEBA 3ATKA 1G3CA 2BQWB 1V2OT 1NO9H 3TGKE 4NSVA 1BRCE 3RXSA 1CT2E 1EX3A 2STAE 2ULLA 3A82A 1K1OA 4GLYA 1QB6A 3OX7U 1T7CA 3VXEH 1C2MA 4JMYA 1UHBB 1GI0A 3PWBA 4E05H 3W95A 2G00A 1MKXH 2ZPSA 2O8LA 1WBGB 1HPGA 2UUJB 2QXJA 1QIXB 1P57B 1SFQB 3RUOA 1YPKH 2C93B 2A5KA 1TNJA 4FXGH 1BTYA 2QY0B 4UFEH 2ZGCA 3QTVH 3V0XA 4NGAH 1OKXA 1KSNA 1NFXA 1YBWA 1UJ1A 1QHRB 4AFZA 4Y0ZE 1HAYB 1ZHRA 4FU8A 1SHYA 3M37A 3GYMA 3MI4A 1KYNA 1ZYOA 2CGAA 2VVUA 3UUZA 1FY5A 2A7CA 3FFGA 3ODFA 3VB7A 2PUQH 5EQQA 1YCPK 3EQ0H 1SLUB 1AE8H 1NRRH 3EA9A 3KQEA 1PPZA 2QF3A 2SGFE 3RXQA 3EBNA 1Y3WA 4CH2B 4D9RA 3S9CA 2FODA 1SPJA 1MUEB 1C5NH 2ZU5A 1FN8A 3RC6A 2WUBA 4ESTE 2IN2A 8GCHG 3URCA 1HAGE 1C2LA 1F0TA 3PLKA 4OS2A 3D49H 2CN0H 2ZPQA 2ZCHP 4X6MA 3AW0A 1EJAA 1O33A 1YCPH 2FOHA 5A0BA 1BTXA 2PKSB 1EZQA 4Q7XA 1L4ZA 3SZNA 1B0EA 4IBLH 3SV6A 2G5NA 3UR9A 1EAIA 1GPZA 3V12A 3RM0H 3RMMH 1KXDA 3OU0A 4FUEA 5ESTE 3RU4T 2AMPA 2BYAX 3SO3A 2VVVA 2K1QA 3O8BA 1ZPCA 3VB6A 1QJ1B 1HCGA 2Q6DA 2A2QH 3ZZ8A 1HNEE 1NRNH 3B8JA 1MQ6A 5DP7A 1O2MA 1O3MA 1VJ9U 2ANKH 2ILNA 1MCTA 1DY9A 1EKBB 5FAHA 4MG3A 4UONA 2WV5A 2NU3E 1X7AC 1G2MA 1OPHB 1C5LH 2BD4A 4ZROA 3T29A 1CGIE 2AYWA 4UEHH 1VCQA 1C5SA 5ABWA 1QL7A 2A0QB 3SNBA 1W7XH 2ZFFH 4X2VA 4MQAA 4TPYA 1Q2WA 2ALPA 3BG4C 1BMMH 3SW2B 1GGDC 4F49A 3LT3A 1FJSA 1MTWA 5FPSA 1C2IA 3RXFA 2ZTYA 5HYOA 1ZZZA 1VR1H 2BVXH 4XFQA 3QUMP 1C1OA 5C1YA 1C5YB 1K21H 1O2QA 1RIWC 4ISHH 4ABBA 4I8LA 3SU2A 3SHCH 3BIUH 5E0GA 2FIRH 1EB1H 3RXUA 1LKAA 3GDSA 4BOHA 4X2WA 5EGMA 1T4UH 1FPCH 5L6NH 4ABHA 1S81A 1DXWA 2BY6X 2D1JA 2VIWA 1HAOH 1Y5AT 1C9PA 4CR5A 1D6RA 1V2ST 3SJKA 4WXIA 2FTMA 4I8JA 1DWBH 2BLQA 4K69A 1K1MA 2F9BH 1O2SA 1RFNA 1YPGH 2V3HH 2P93A 3H7TA 1M9UA 2DUCA 3ZVGA 1S6FA 4X1SU 5BRRE 1UCYE 2ZFPH 1TNKA 2RG3A 4YESB 1SGQE 2Z9JA 1ARCA 1C5UA 2DE8A 1P9SA 6ESTA 2ESTE 4K8BA 1ELFA 1A3BH 2Z6BD 4IMQA 4DIHH 3VB4A 4X8SH 1HAXB 3CP7A 3QN7A 1C2EA 1IHSH 1P06A 4CBNA 5LPFA 2PFEA 3MO9A 4JZDH 1SGFG 2GV6A 1W3CA 1FIWA 2VWLA 2XWAA 3DHKH 4WVPE 4D8NA 1ELDE 1O34A 5FX6A 4Y8XA 2FMJA 2FO9A 1CQQA 3E6PH 1TOMH 1C5VA 1J17T 3ZZ4A 1DITH 4BAKB 4I33A 5DP3A 3LJJA 2FOMB 1GHAG 2VGCB 1NU7B 4BAQB 1C5OH 1PQ5A 1TBZH 3U9AH 1P2OA 1FAXA 4ZHMU 4ISOA 1TGCA 1BJUA 1LHEH 2PHBA 1PPFE 5EW1H 1XUFA 4ZMAH 2HLCA 3T62A 2AFQB 3UOPA 3NWUA 2ZTXA 1GI7B 3QZQA 5EQSA 1HAZB 3EYDA 4MNWA 1CGHA 4TWWA 1FUJA 1EZSC 1V2PT 3GYLB 1MMJN 5EOKA 3ZZ5A 3LH1A 1C5TA 3BIVH 4PROA 1J15A 4YZUA 3ZZ9A 1AUJA 2HGTH 7ESTE 1DSTA 2JH5D 2KAIB 1QGFA 5EXLA 4YOGA 1LHGH 2I6SA 3KQDA 3SGBE 1BTUA 1V2JT 1H4WA 1FXYA 2GCTB 5JBTA 1AN1E 3NUMA 4THNH 3H7OA 4X8VH 1N6XA 1RXPA 1SGEE 4J2YB 2B9LA 4CRBA 4BNRA 1BRUP 1YPEH 1SQAA 1TB6H 2CF9H 3ENSB 3SGQE 2QC2A 2PLXA 2FX4A 4FUDA 1YPLH 3F68H 1MTUA 2ZHEH 4Y71A 6LPRA 2OBOA 1GI4A 1U6QA 2ZU3A 2VH0A 3KEEA 1Y3YA 2GT8A 2UWOA 2B8OH 3BTTE 1Z8RA 4KP0A 2EI6A 1WU1A 1P2KA 2ZC9H 2C8WB 3H5CB 1O3BA 1EXFA 1C1QA 4I31A 4XDEA 1TPOA 1C5MD 4ZHLU 3EA8A 1TMBH 2CJIA 3MU4A 1K28D 2VVCA 1QY6A 1FMGA 2P16A 4MVNA 1AU8A 2P3FH 2F3CE 3STIA 1IQNA 2ANMH 4YT7H 2UUFB 4X1PU 1WUNH 4IC5A 1IQFA 3MMGA 3TJUA 2J95A 3RXDA 4FU9A 3E90B 2ZHDA 1J9CH 8LPRA 3HGNA 1PYTC 1XX9A 3LKWA 3A8CA 4HGCA 4Q7YA 3TH2H 1P2IA 1MU8B 1GMHG 1H8DH 1T8OA 3BEIB 4IGDA 3A8DA 2YOLA 2FLBH 7LPRA 1ZMLA 2QCYA 2G5VA 2QGRA 1MAYA 2GMTB 4XBCA 1GHBF 1HV7A 2O8WA 3R0FA 5FPYA 3C1KA 1AKSA 1IQLA 3ZZ6A 2JH6D 1QA7A 4CHAC 1K1NA 3O8CA 4YOIA 4LOYH 2A4QA 2ZG0H 1P04A 3Q00A 3UREA 1HAPH 1Q31A 4I8GA 1QRWA 2THFB 3RXIA 1GBHA 1VGCC 4NFFA 1HYLA 2PKAB 1AFQC 1QCPA 4RSPA 1BTPA 4WMDA 1SFIA 4KKDA 3SV2H 3BTEE 1QBOA 2R3YA 1PFXC 1UVUH 5GXPA 4K2YA 1P01A 1W10U 3SUDA 1ZOMA 2WPLS 2P95A 4ZKSU 1FPHH 1BQYA 2PSYA 1JMOH 1E34B 5EXNA 3RXBA 3A88A 1SOZA 1O2GH 2XCFA 1P2QA 2H9TH 3DUXH 4JZEH 3ZZ3A 3QTOH 4Y7AA 4AGKA 5FBIA 2VWMA 3AAVA 1V2VT 3RXPA 4B2AA 1NRQH 2FS9A 3F1SB 1HAIH 1SGDE 1ZMJA 3GCHC 1CA0C 1J16A 1XUJA 1LVBA 1GMCG 1C2DA 1VITG 1AZ8A 1ZHPA 3SJ9A 2TGPZ 2OC1A 3TJNA 1BMNH 4H6TA 3MU0A 4DY7B 1TALA 2B7DH 2OTVA 2ZQ2A 1A0LA 2C3SA 1PYTD 4H6SB 1AB9B 2ZPRA 5I46H 4Y8ZA 1G9IE 2PWXA 2GP9B 2ZF0H 4Y7BA 1V2KT 1L1GA 4O9VA 1QRXA 1KXCA 1WTGH 1QA0A 1QURH 1DSUA 1BJVA 1O3OA 5CMXH 2JH0D 1ANEA 2QV1A 4Y79A 3QGNB 4K1SA 1O3PB 1UK4A 2ODYB 1NM6A 4ABIA 1SGNE 5E8EH 4A1TA 2XBXA 4ISNA 3MNXA 2VU8E 4CHAB 2FTLE 1SOTA 5A2MH 1GCTB 3RC5A 4I8HA 3EAJA 2ZGHA 4BTTB 1QRZA 2C4FH 2C8XB 2H1UA 4ABEA 1V3XA 2ZWLH 3PWCA 2FPZA 1TQ7B 2G4TA 1UTJA 1WAYB 1FQ3A 1LO6A 4NIWA 1UTPA 1SL3A 4RKJB 1HAHH 3HKJB 2HPPH 3VEQB 1YPHE 3M35A 1V2RT 5JBBS 1EOJA 3GCNA 4BAHB 4DJZB 2SGAA 1TPSA 1V2LT 1UK2A 3P70B 2XRCA 1DS2E 3I29A 2VIDA 2F9NA 3D62A 3P8OA 7KMEH 3VGCC 4MNXA 1GDUA 1TX6A 3M3SA 1CA0B 2TBSA 1HDTH 2ZDMA 3C27B 4O3UA 3K2UA 3LGWA 1PQ7A 1OS8A 3U1IB 2F9OA 1NROH 2FDAA 7GCHG 2ZHQH 2G8TA 2HOBA 2EA3A 4H4FA 2FS8A 1O2RA 3T27A 3ESTA 1O2PA 1BDAA 1XKAC 4UFFH 4HTCH 2BY7X 1OP8A 3TH4H 1TPPA 3PO1C 1Y5BT 4K5ZA 4ZXYH 3SI4H 1Z6JH 3SJ8A 5JYIA 2XC5A 3MTYA 1EPTC 2UUYA 3P6ZB 1TABE 2UWPA 1O5FH 2Z3DA 1WQVH 3TK9A 3DFLA 1GI6A 1AHTH 1S0QA 1P10A 2BOHB 2F83A 1AQ7A 1KXBA 4NZLA 3CS0A 1HUTH 1S85A 2VWNA 2FM2A 2BDBA 1TQ0B 3A80A 4IW4E 3U98H 3ATIA 3OY5U 2BDHA 4ABGA 1G3DA 4X0WU 5FCKA 3UNQA 3LU9B 5FCRA 5E0HA 1DE7H 2BDAA 1CBWB 1O31A 4DW2U 3UNSA 3Q3YA 2FOFA 1G30B 2QXGA 1EB2A 4YLUA 1EJMA 3OTJE 5TCCA 4MTBA 1TNIA 3UR6A 5GWZA 5CE1A 1CA8B 2RDLA 3A7WA 2A7HA 2P8OB 4Q7ZA 5DG6A 1P3CA 1V2MT 4MPVA 3F6UH 4K1TA 1AZZA 3SNDA 5PTPA 1GJDB 4HFPB 3RDZA 3NK8A 3BEFB 1P09A 2ZGJA 4ISIH 2SGQE 1RTKA 1A5GH 4AZ2B 3F9FA 4AGJA 1T8NA 1PJPA 5DO4H 2ZA5A 1GBDA 3K9XB 2BQ6B 5A8ZA 4M7GA 4ABDA 3V3MA 1MD8A 2SNWA 3PTNA 2VINA 4CRGA 4FUJA 4RN6A 5K7RA 1HB0B 1O2WA 1YP9A 2FEQH 4U30A 1DOJA 2WPHS 2XWBI 1ELVA 2ZIQH 5AVDA 1EAWA 1Z71A 2D2DA 2GDEH 2A32A 2F9UA 3HK6B 5DP8A 5F8TA 5L2ZH 1SQTA 3PO1B 1MTNC 1DLKB 4NWLA 2O8MA 1C1PA 2ZDLA 1SVPA 4E7RG 1XUHA 1UO6A 3RU4D 2HALA 2WPKS 5F8ZA 3RMLH 1C2FA 3SHAH 1VCWA 1CHOG 1EP5A 3SJIA 3SBKA 7GCHF 2BD2A 3M36A 1THRH 1GVKB 4NA8A 1OP0A 4NFEA 1ORFA 3LGIA 2J2UA 1BBRE 1C9TA 1K2I1 1PPGE 2WINI 4FUBA 2XBYA 3RXAA 4WMFA 1AKSB 2Y80A 2Y7XA 3LGVA 4TYDA 3IITA 4JZIA 1NRSH 1K1IA 3SOSA 4F4OC 5EPNA 1P03A 1GL1A 2HWLB 4U32A 4XBDA 1O5AB 3KQCA 1C4U2 1XUGA 2QXHA 1ELAA 2TGDA 2W7UA 2G81E 3U8RH 2PGBB 1TGTA 1NPMA 1EOLA 2HNTC 1GBEA 2Q1JA 3A7YA 1GL0E 4D9QA 1OXGA 3AVZA 1H9IE 4NCYA 1KY9A 5J4QA 1LHFH 1N8OC 3M7UA 4KELA 4Y8YA 1IQJA 1GDNA 3K6ZA 1KXFA 1G32B 4XOJA 1UVTH 2Q6FA 3SV7A 2IPHA 3ZVFA 3IWMA 1BTHH 6GCHF 4O03A 1AVGH 1NZQH 3MNCA 3U1JB 2BDYA 2H6MA 1XXFA 1ZJDA 1FY4A 1HRTH 1SSXA 3MNSA 1CT0E 4ZHAA 2GCHG 5DK1A 1HJ8A 4XSKU 1C1UH 2A45B 4B73A 2CHAC
chains in the Genus database with same CATH superfamily
1W2KH 2BXTH 4DCDA 2A7JA 3DSOA 3SN8A 1YM0A 3SU4A 3FOAA 1AVWA 1INCA 1RD3B 3HATH 1OWHA 4IC6A 3QX5H 3P92A 2GX4A 1DXPA 1SLXB 2F4LA 2V6NA 3SUFA 4JYUH 2XOKD 2L6OA 2EY4C 2GD4B 1CU1A 1C2HA 1HJAC 3M3TA 4CRAA 1ETTH 1G3BA 1KLTA 4KGAA 1NS3A 5LH8A 1P2NA 3AAUA 2PTCE 2VH6A 4GSOA 5F8XA 5CDFE 1C1SA 2M5TA 4GHQA 1NC6A 1PQ8A 3KCGH 3GY2A 1EUFA 1O2ZA 4Z6AH 4INKA 1Z1JA 2FP7B 1S6HA 3T5FH 2AIQA 3VG8A 5KECA 1JWTA 1KTSB 3MU1A 1VITH 2ZFQH 3VPKA 1NFYA 3QDZB 1QR3E 3ZV8A 3TJVA 2VJ1A 1BZXE 3U69H 2F9VA 1ACBE 1UTKA 2G52A 1DX5M 1C2JA 2GZ9A 3HKIB 2KZ4A 5TJXA 1P05A 3M3VA 1FIZA 4B2BA 1AE5A 1SGCA 3EE0B 1NFUA 6CHAC 1CHOF 3BTGE 3KF2A 2TGTA 2ZI2H 2P94A 3QGJA 1GHYH 2WPIS 1JIMA 1FY1A 2BDIA 1ELBA 3DA9B 1ZSLA 1GG6C 1XMNB 1O37A 1O3GA 1GHBG 4I32A 4AN7A 1PPHE 2JJ1D 3BG4B 3FP8E 4BANB 1GGDB 3M5NA 1SB1H 4AORA 1S83A 2CXVA 1BHXF 2QA9E 3PROA 1EP6A 1TA2A 2JKHA 5JDUB 1Z7KA 2CHAB 4YTAA 1SMFE 3BTME 5JPMH 1O2NA 4RKOB 2FI5E 1LCYA 1RIWB 3MU5A 2W26A 3UPEA 1ABIH 2RDEA 5C1UA 5EW2H 3GY7A 2Z9KA 1O0DH 2XXLA 2STBE 4UE7H 1ANBA 3SU3A 2IJOB 1P02A 1ZTLA 4GVUA 1KIGH 2WV4A 4ZUHA 3MH7A 2WYGA 1W0ZU 3LONA 4A6LA 1D6WA 5G4BA 3P8NA 1UTOA 4FUGA 2BD8A 3SZEA 5A8XA 1D3QB 2QN5T 4GAWA 1CGJE 2FZZA 3NCLA 4K1EA 5A09A 3OSYA 3PLPA 1P2JA 1LQEA 5GPIB 1AFEH 1DDJA 1PPCE 1B7XB 2OC8A 1AWHB 5EQRA 2BX3A 2GCHF 2TPIZ 4WH6A 1QJ6B 5GCHF 1O3NA 1GJAB 1QQUA 1TGBA 2QF0A 3VB5A 4YOJA 2ZKSA 5B6LA 2NU1E 1IQHA 2B5TB 1GBFA 2QXIA 2VIQA 2J92A 3PMHB 1QQ4A 1UTQA 3BTWE 1GI5A 3LH3A 4NZQA 2BHGA 2OBQA 4ZKRU 1SR5C 3MYWA 1HLTH 4FOUC 1ESAA 1ZGVA 1DLEA 1TLDA 1GI9B 1NY22 1O30A 1ETSH 1TWXB 2Y81A 4X2XA 3BG8A 3RP2A 1HXFH 3LDXH 1F2SE 1HXEH 2A4RA 1GMDF 1MAXA 1VJAU 1RRKA 1V2TT 3M5OA 1FV9A 2G55A 1C4V2 2ZU1A 4MNVA 2TGAA 1BTZA 3ATMA 4SGBE 1GWAA 2GKVE 1ELEE 5EU8A 1F0RA 1EAUA 2BY8X 5TCAA 1YF4A 3Q77A 1E35B 4KTCA 1EPTA 2HVXA 2FOGA 3GCOA 2QYIA 3FAOA 4XBBA 2GDDA 2ALVA 1LVMA 2NU4E 2R3UA 1KLJH 1QTFA 1EQ9A 4UFDH 2D8WA 2ZU2A 1AO5A 2ZTZA 5AFYH 1WXRA 4FUCA 1IHTH 1SGPE 4A7IB 1ZRKA 1ZTKA 2W6ID 3WY8A 2BDGA 3GY5A 1TONA 1KXAA 3KIDU 1K1LA 3M61U 3SGAE 4YO9A 1RS0A 4B1TA 3F2HA 1TGSZ 3Q3XA 2H5CA 1YPMH 1T31A 2YMSD 1T4VH 3RXVA 2BD5A 3KQBA 3T2NA 3A7TA 1RGQA 1CVWH 1ESBA 3F0PA 2HNTF 1TX7A 5F53A 1WDIA 5FX5A 3A85A 2CF8H 3URDA 1HAVA 1EJNA 2VIOA 2VIPA 5F03A 4X6NA 2VBCA 1C1TA 1ELCA 2BLOA 3QK1A 4MDSA 5CHBA 1CSOE 1C2GA 4I8KA 3TITA 4B76A 4WWYA 1Z8IB 2JJ2D 2BZ6H 4WXVA 3KGPA 2BMGB 3SNCA 2Y7ZA 2OQ5A 1NN6A 1GBBA 2OUAA 1QZ8A 4FUIA 2ZZUH 5ESBA 1G37A 3KHVA 4WJG2 1AMHA 3KNXA 4Y0YE 4NA9H 1C5RA 3MOCA 3F9HA 1A4WH 4U2WA 2XW9A 4RI0A 2PW8H 5FBEA 2W6JD 4JK6A 1NFWA 2IPQX 3ODDA 3MH6A 5AHGH 4CREA 4UDWH 1K0HA 5IDKA 1ZPBA 5T3HA 1O2TA 2SGDE 1BBRH 3EGKH 5DP6A 1ANCA 1BB0B 5DN6D 1BRAA 1O2JA 5J4SA 3ITIA 3Q3KA 3UTUH 5AF9H 2ANYA 1YLNA 3G01A 4BTIB 2AGEX 1SGRE 1AVXA 4YXWD 4AFSA 4DIIH 3ZVAA 1GCDA 1ABJH 1V2QT 1HGTH 2AMDA 1KDQA 1TNGA 3IG6B 3TIUA 4ABAA 1E36B 1DWDH 1TX8A 3ATWA 3JZ1B 1KXEA 2FOCA 1E1QD 4X6PA 3GDVA 1ZSKA 3SQEE 1SI5H 3O8RA 1QL8A 3BTDE 1F5RA 1SGIB 1LVYA 1S84A 1TNHA 1THSH 1O5GH 1DANH 4TWYA 1TNLA 5C1XA 3MH5A 2PSXA 4OS4A 1VGCB 5L2YH 2A4GA 2DE9A 1AFQB 5LPRA 1YWUA 1NT1A 4DT4A 2VNTA 3BTKE 4AB9A 4AOQA 4ZKNU 1LHDH 2OCVB 1UCYK 3CS7A 5HXFA 5IK2D 1P9UA 1COWD 3BTFE 4HI3A 1HJ9A 5K0HA 2FLRH 4LK4A 1LHCH 3EDXB 3QZRA 1IOEA 2TRMA 2BOKA 3UNRA 1IQEA 2ZDVH 3E8LA 5DGJA 4GHTA 3JZ2B 1GJ8B 2FYRA 3RXKA 4AG2A 1H9LB 2YNBA 1FN6A 3A87A 1ELGA 2WUCA 2YNAA 3TNTA 2J5UA 3RXRA 1FY3A 5FXLA 1TOCB 1UVOA 2AGGX 2OXSA 3GCHB 1V6DA 3LOXA 5DP9A 1OYQA 2QE7D 4TSFD 5DP5A 1KTTB 1A2CH 2XYAA 4JK5A 2A4OA 2Z9LA 2AERH 4A92A 5F6MA 1FAKH 1UCYH 2SGPE 3DSPA 1CO7E 1TRYA 1GI3A 1B5GH 3SORA 1SBWA 1GBCA 3MO6A 2Q6GA 1GBAA 5EPYA 2GV7A 2ANWA 2FESH 3OFND 3TGIE 4ZAEA 1XM1A 4BAMB 1Z8JB 4TY7A 1LMWB 4DG4A 1WCZA 1NTPA 3TU7H 4LXBH 4UD9H 1D4PB 1A7SA 3TH3H 1QFKH 2LNCA 4Z0KA 1O3KA 5GIBA 4AB8A 2B0FA 1OWEA 4ASHA 3UQVA 2H5DA 2A31A 3SUGA 2BD7A 5GNDA 4AYYB 3SV8A 1NRPH 2V7QD 1O3LA 1E38B 4K8YA 3SU0A 1WOFA 1MTVA 1C5XB 5EJLA 1O2XA 1O3FA 2IOTA 4IN2A 1A1RA 6GCHG 3E3TA 3UFAA 1GBMA 1WSSH 2OC7A 1C2KA 1S5SA 2PKSC 2K8IA 4AG1A 1NU9A 1W12U 3MHWU 3GOVB 1D3PB 1FY8E 2ZDAH 2R0KA 1TMUH 4GUXA 4NG9H 3UQOA 1TGNA 1ZMNA 1A0JA 2AH4X 2OC0A 3KN2A 4WH8A 2ZGBH 3VGCB 3RXCA 1YYY1 4Y6DA 2RCEA 1UTNA 1JBUH 1W11U 1YLCA 5DKMA 3L6PA 3BF6H 2QF5A 1LQDB 2ZDKA 1OWKA 5EG4A 4X1QU 4FETA 5GDSH 3STJA 3RXJA 4OGYA 4Y76A 1XVOA 2JDID 5BPEA 1O5CB 1H9HE 2EEKA 1QBVH 1JRSA 1SGTA 3S69A 2LPRA 1YGCH 2KCOA 1GBTA 1F0UA 3N7EA 3PV2A 5A0AE 1SGYE 3S7KB 1WYKA 1EPTB 2OINA 4A1VA 1SQRA 1BA8B 1TMTH 2F9PA 4BTUB 1VZQH 1A5IA 2ZHFH 1DPOA 3K65B 2F91A 5FPTA 1AWFH 1AI8H 4R8TB 3MFJA 1K22H 3BN9A 4K60A 2WPMS 2ODQA 3TGJE 2OLGA 4E7NA 2H2ZA 4ABFA 2Z9IA 1TAWA 2A2XH 1MU6B 1WTHD 3ZVBA 4GCHF 3R3GB 5E2OA 3CNRA 2P3TB 1L4DA 1BHXB 3PV5A 1O35A 9LPRA 1HIAA 3I78A 4BXWA 2LP6A 3BV9B 1GJ5H 1P2MA 3QWCH 5GJ4B 1UK3A 3E1XB 4YLQH 3SNEA 1JXPA 3OTPA 4KTUA 1BMAA 1DICA 4X6OA 3P8FA 3TVJB 3PTBA 3ZZBA 1TRMA 1HAVB 2KCAA 1UMAH 1S0RA 1Y3VA 3LJOA 2Y5GA 4ABJA 4NIXA 4Y10E 1GHWH 1L2EA 5EXMA 3UY9A 1GJ6A 3A7ZA 4DT7B 4YM9A 3KL6A 2Z3CA 4ZKOU 3RU4E 2PKAA 3LC5A 1TFXA 1F7ZA 1T8MA 2QAAA 1LTOA 1O3HA 4OS6A 2VIVA 1MBQA 4NIYA 3ZZAA 1AD8H 1GJBB 1L1JA 5C3NA 4CH8B 3HPTB 3F9GA 1MZDA 2IJD1 1N6YA 5T6GA 5C5NA 1QB9A 4A5TS 2FI3E 4VGCC 3A89A 5I25A 2UWLA 1NBMD 1DM4B 1GBKA 5JB8S 1BOQA 1XVMA 3GY6A 4AYVB 1OWJA 4E06H 1O32A 1RJXB 3RXEA 1YCPM 1E0FD 2LIZA 4A1XA 1T8LA 1C1NA 2H9EH 2BDCA 3BEUA 1MABB 3RLWH 5GCHG 1LPKB 3PB1E 4ASUD 1MTNB 3SNAA 1QB1A 1OHHD 3NPSA 4D76A 4DURA 4KTSA 2KFWA 2ZU4A 1BITA 3RXTA 3TK5A 4X2YA 4GPGA 3ZVCA 1P3EA 4D7GA 1TRNA 1PPBH 4TT3D 4XD7D 3P8GA 4MLFB 3SV9A 1RTFB 1FONA 1K1JA 2VGCC 3RXOA 3AASA 3TK6A 2W3IA 3LC3A 2HPQH 1GJ4H 4JCNA 1KDQB 1XKBC 1MZAA 3A86A 3FZZA 5JBCS 3MH4A 2Y82A 4I86A 4JZFH 4FVDA 2HVYB 4INLA 3FP7E 1C1WH 3L33A 1MCVA 1Q3XA 1GMDG 2FXRA 3RXHA 2J38A 3RM2H 4F55A 2Y5FA 2ZFTA 3TNSA 3RLYH 2HRVA 1ELTA 2XCNA 3SJOA 5LPEA 5FHTA 2XBVA 4TPIZ 3GY4A 4FU7A 1EZXC 2R2MB 1YC0A 2BB4A 1K1PA 1T32A 2BM2A 2TIOA 1SG8B 2EI8A 3UAIC 4DGJA 3GY3A 2SGEE 3LGYA 1W7GH 1W8BH 1LVOA 2GCTC 3GS9A 4IMZA 3TPIZ 4ZH8A 2O8UA 3FN8A 1KLIH 1UVPA 4CRFA 5DPAA 1GHZA 3N7OA 1N8OB 4D7FA 1AGJA 1O3EA 1Z6EA 4WY3A 1TPAE 5EODA 2GTBA 3DD2H 1GJ7B 4VGCB 1HFDA 2AS9A 1CE5A 1GJ9B 1THPB 1WV7H 2P3UB 1TA6A 2BQ7B 2NU0E 3E0NB 2FOBA 1O3JA 8GCHF 1BT7A 5E2PA 4MNYA 4CR9A 4B6EA 1J14A 1AUTC 2QF4A 1IAUA 1W14U 2BVRH 5JB9S 1C1MA 2HNTE 2ZGXH 1O2HA 1W13U 1MH0A 3LGUA 1A0HB 3MO3A 5T6DA 1EAXA 3RXLA 1DFPA 2NWNA 4Z1MD 1RTLA 5HM9A 2J34A 1O2UA 5L30H 2R9PA 5A8YA 2BLWA 3VFEA 3P95A 3V7TA 3S0NA 2AEIH 1ETRH 4OS1A 1C5PA 3S9AA 1DT2A 2FI4E 2O9QA 2Y5HA 4CRDA 1QBNA 3MNBA 4IN1A 1HJAB 2SNVA 1O5EH 2YMSC 1P11E 2GGVB 1HBTH 3TJOA 1ZJKA 1Y5UT 5C5OA 1V2NT 2K7XA 1MQ5A 1PQAA 1BMFD 1O2VA 1O3DA 4XE4A 3UWIA 1CHGA 1O2LA 5C2ZA 4MPWA 2W5EA 2ZNKH 2BY5X 1D3DB 1C5WB 4MPXA 4AC9A 4X1NU 1YLDA 1H1BA 2FWWA 1EASA 3NXPA 1AY6H 3FP6E 1A46H 1GHVH 3LIWA 1IQGA 2C8YB 3A8BA 4JZ1A 4O3TA 1L1NA 2GMTC 1C5QA 1SLVB 1SLWB 1IQKA 4WF8A 4NSYA 5LGOA 3ATLA 4B71A 1IQIA 2PV9B 1LDTT 1OWIA 1UHBA 2ODPA 4WMEA 2ZCKP 1O2OA 1TBQH 4QT8C 1O2IA 1GHXH 1H8HD 4H42U 4NA7A 5AFZH 1SQOA 2KR7A 3ZVDA 1B0FA 6CHAB 3RC4A 3E91A 1TBRH 3SU5A 2C90B 1TYNA 3W1EA 3WWFA 1GG6B 3TLOA 1OP2A 1SKYE 2KM0A 3O8DA 4RT0A 1ZPZA 2PR3A 4LZ1H 1DUAA 2XC0A 4UFGH 1ZSJA 3MU8A 5JBAS 3A7VA 4ISLA 1OWDA 2R0LA 1BTWA 5KGOA 2GZ8A 4AX9H 4BAOB 3CENA 1DWEH 1GBLA 1YKTA 5ETXA 3UOUA 3SQHE 3FANA 3S9BA 4SGAE 1IQMA 2BVSH 3NRLA 4DOQA 2G4UA 3GISB 5KEDA 1A5HA 2FYQA 3A7XA 5H4IB 1LPGB 2ASUB 3Q76A 3ZZDA 4B2CA 4OGXA 2KCPA 1Z1IA 2J9NA 2RA0A 2BD3A 1N1LA 1GBIA 5HM2A 3PMBB 3QO6A 3M7TA 4FVBA 9ESTA 3U8TH 1QL9A 1EATA 4J1YA 2W7SA 1BRBE 2AHME 2Z9GA 1P8VC 1YPJH 1O5BB 3LPRA 3I77A 2VB0A 1AB9C 2PP6A 5HMAA 2UUKB 3FVFB 4Q80A 1OYTH 1TE0A 3FZDA 1LKBA 1TIOA 4YT6H 3SYJA 1O2KA 3LGTA 2G51A 1GVLA 3QLPH 2ZFSA 4X8TH 3PM3A 1K9OE 3K6YA 2GZ7A 1YPHC 3S7HB 1Y8TA 2K0QA 4JYVH 1HIAB 2OD3B 4NWKA 3M5MA 3M5LA 3SU6A 3A8AA 1BBRK 1FX0B 3D65E 2V35A 1GHAF 1OSSA 2GVFA 1F0SA 2BX4A 1ESTA 3B23B 1F5LA 2J98A 1BIOA 1GCTC 3B9FH 2BLVA 4OS7A 3A81A 3GCTG 4IS5A 1GJCB 4CRCA 3RXMA 2CV3A 1XUIA 1JIRA 1DUEA 1J8AA 3F2FA 3GY8A 1QJ7B 4R0IA 1H8IH 8ESTE 1ZRBA 3A83A 4OS5A 5T1VA 5IYTA 3RXGA 2PUXB 1MBMA 2WV9A 2XC4A 2ZP0H 4XRNA 1GI1A 2H9HA 2BY9X 3F9EA 1DWCH 4HZHA 1P12E 3OY6U 1JRTA 2OQUA 3GDUA 1S82A 2J94A 1EFRD 2AGIX 2EI7A 4NIVA 2ZECA 1G36A 3BTHE 1ZR0A 2Z7FE 2CMYA 1A61H 2ZHWH 2XBWA 3ZYDA 4ZXXH 5T6FA 4X8UH 1FNIA 1C4Y2 3PMAB 1G3EA 1ARBA 1ZHMA 1O38A 1O3CA 3L3TA 5DP4A 4INHA 2VWOA 3T26A 3P17H 2BD9A 2OP9A 5A0CA 2XNIA 4K3JA 2D26C 2FOAA 2ZCLP 1C1VH 1OOKB 3ELAH 3SUEA 3GICB 1P0SH 1CT4E 2FOEA 1JOUB 2NU2E 5CHAC 1GBJA 4DVAU 3KYGA 2AMQA 1ZTJA 2JETC 1BUIA 2GT7A 1E79D 1FLEE 2V0BA 1A3EH 1O5DH 5DSFA 4MPUA 4I7YH 3A84A 1E37B 2AIPA 3EA7A 1C5ZB 1MKWK 3NKKA 1O36A 2BZAA 4FUHA 1V2UT 3W94A 1O3IA 2EC9H 3DT0H 1KMHB 2R2WU 5C20A 2PTNA 3ZYEA 5HGGA 5C67A 2A1DB 3PMJA 1F92A 2WYJA 2A5IA 1UTMA 1MTSA 2PGQB 3AW1A 3E0PB 2XTTB 3PYHA 4FUFA 1UVSH 1FI8A 2ZO3H 3UWJH 1FZZA 1SGFA 1WQSA 5B6OA 4AFQA 1GDQA 1Y3UA 1CBWC 1ZGIA 3HK3B 1Y59T 1L0ZA 5C94A 1LPZB 3VB3A 1AIXH 3U8OH 1MKWH 3ZZCA 1SC8U 5DJ7A 4Y11E 1Y3XA 5EJ1A 5SGAE 3DFJA 2Z94A 3T25A 1C1RA 3NZIA 1D9IA 3BTQE 2P8OC 1GMHF 3M7QA 4GCHG 1MD7A 1XUKA 3OYPA 3PV4A 3SU1A 8KME2 1FDPA 2I6QA 3ZV9A 1GVZA 1UTLM 3ZZ7A 4JYTA 4Q4LA 1PPEE 2FX6A 4LZ4B 3HGPA 1XXDA 1E1RD 4B74A 2JIZD 3VXFH 3MWIU 3D23A 4X1RU 2BXUH 1VCPA 2Z3EA 2J97A 1DVAH 1DY8A 1O39A 3GCTF 4B6FA 1GI2A 3RMOH 3UIRA 1V2WT 2L74A 4CBOA 1BCUH 2C8ZB 4BXSA 3PLBA 2V3OH 2ZDNA 1O3AA 3E16B 5CHAB 1G2LA 2P59A 2A5AA 2O8TA 2JETB 2J4IA 4U01A 4Q2KA 2ZQ1A 3SI3H 1O2YA 1SHHB 3ZVEA 2WPJS 5E0JA 2W3KA 3F0OA 2KAIA 1Z8GA 3F3BA 2Y6TA 1BMLA 3OEED 2ZFRH 1EZUC 3T28A 2BTCE 1W0YH 4O97A 1ZLRA 1NESE 1QNJA 1MKXK 2SFAA 4AFUA 1ANDA 1D3TB 2RA3A 2QIQA 3V13A 3BSQA 1GI8B 1GMCF 1VITF 1ID5H 4TY6A 3RMNH 4B75A 1OX1A 1F5KU 2ZEBA 3ATKA 1G3CA 2BQWB 1V2OT 1NO9H 3TGKE 4NSVA 1BRCE 3RXSA 1CT2E 1EX3A 2STAE 2ULLA 3A82A 1K1OA 3F2GA 4GLYA 1QB6A 3OX7U 1T7CA 3VXEH 1C2MA 4JMYA 1UHBB 1GI0A 3PWBA 4E05H 3W95A 3WWBA 2G00A 1MKXH 2ZPSA 2O8LA 1UW7A 1WBGB 1HPGA 2UUJB 2QXJA 1QIXB 1P57B 1SFQB 3RUOA 1YPKH 2C93B 2A5KA 1TNJA 4FXGH 1BTYA 2QY0B 4UFEH 2ZGCA 3QTVH 3V0XA 4NGAH 1OKXA 1KSNA 1NFXA 1YBWA 2GJGA 1UJ1A 1QHRB 4AFZA 4Y0ZE 1HAYB 1ZHRA 4FU8A 1SHYA 3M37A 3GYMA 3MI4A 1KYNA 1ZYOA 2CGAA 2VVUA 3UUZA 1FY5A 2A7CA 3FFGA 3ODFA 3VB7A 2PUQH 5EQQA 1YCPK 3EQ0H 1SLUB 1AE8H 1NRRH 3EA9A 3KQEA 1PPZA 3PRBA 2QF3A 2SGFE 3RXQA 3EBNA 1Y3WA 4CH2B 4D9RA 3S9CA 2FODA 1SPJA 1MUEB 1C5NH 2ZU5A 1FN8A 3RC6A 2WUBA 4ESTE 2IN2A 8GCHG 3URCA 1HAGE 2OK5A 1C2LA 1F0TA 3PLKA 4OS2A 3D49H 2CN0H 2ZPQA 2ZCHP 4X6MA 3AW0A 1EJAA 1O33A 1YCPH 2FOHA 2WHXA 5A0BA 1BTXA 2PKSB 1EZQA 4Q7XA 1L4ZA 3SZNA 3PRDA 1B0EA 4IBLH 4Q63A 3SV6A 2G5NA 3UR9A 1EAIA 1GPZA 3V12A 3RM0H 3RMMH 1KXDA 3OU0A 4FUEA 5ESTE 3RU4T 2AMPA 2BYAX 3SO3A 2VVVA 2K1QA 5C0TA 3O8BA 1ZPCA 2J98B 3VB6A 1QJ1B 1HCGA 2Q6DA 2A2QH 4ACAA 3ZZ8A 1HNEE 1NRNH 3B8JA 1MQ6A 5DP7A 1O2MA 1O3MA 1VJ9U 2ANKH 2ILNA 1MCTA 1DY9A 1EKBB 5FAHA 3EE7A 2KCYA 4MG3A 4UONA 2WV5A 2NU3E 1X7AC 1G2MA 1OPHB 1C5LH 2BD4A 4ZROA 3T29A 1CGIE 2AYWA 4UEHH 1VCQA 1C5SA 5ABWA 1QL7A 2A0QB 3SNBA 1W7XH 2ZFFH 4X2VA 4MQAA 4TPYA 1Q2WA 2ALPA 3BG4C 1BMMH 3SW2B 1GGDC 4F49A 3LT3A 1FJSA 4ACBA 1MTWA 5FPSA 1C2IA 3RXFA 1NBME 5HIYA 2ZTYA 5HYOA 1ZZZA 1VR1H 2BVXH 4XFQA 3QUMP 1C1OA 5C1YA 1C5YB 1K21H 1O2QA 1RIWC 4ISHH 4ABBA 4I8LA 3SU2A 3SHCH 3BIUH 5E0GA 2FIRH 1EB1H 3RXUA 1LKAA 3GDSA 4BOHA 4X2WA 5EGMA 1T4UH 1FPCH 5L6NH 4ABHA 1S81A 1DXWA 2BY6X 2D1JA 2VIWA 3U28C 1HAOH 1Y5AT 1C9PA 4CR5A 1D6RA 1V2ST 3SJKA 4WXIA 2FTMA 4I8JA 1DWBH 2BLQA 4K69A 1K1MA 2F9BH 1O2SA 1RFNA 1YPGH 2V3HH 2P93A 3H7TA 4OM9A 1M9UA 1W0JD 2DUCA 3ZVGA 1S6FA 2KX4A 4X1SU 5BRRE 1UCYE 2ZFPH 1TNKA 2RG3A 4YESB 1SGQE 2Z9JA 1ARCA 1C5UA 2DE8A 1P9SA 6ESTA 2ESTE 4K8BA 1ELFA 1A3BH 2Z6BD 4IMQA 4DIHH 3VB4A 4X8SH 1HAXB 3CP7A 3QN7A 1C2EA 1IHSH 1P06A 4CBNA 5LPFA 2PFEA 3MO9A 4JZDH 1SGFG 2GV6A 1W3CA 1FIWA 2VWLA 2XWAA 3DHKH 4WVPE 4D8NA 1ELDE 1O34A 5FX6A 4Y8XA 2FMJA 2FO9A 1CQQA 3E6PH 1TOMH 1C5VA 1J17T 3ZZ4A 1DITH 4BAKB 1W0KD 4I33A 5DP3A 3LJJA 2FOMB 1GHAG 2VGCB 1NU7B 4BAQB 1C5OH 1PQ5A 1TBZH 3U9AH 1P2OA 1FAXA 4ZHMU 4ISOA 1TGCA 1BJUA 1LHEH 2PHBA 1PPFE 5EW1H 5HIZA 1XUFA 4ZMAH 2HLCA 3T62A 2AFQB 3UOPA 3NWUA 2ZTXA 1GI7B 3QZQA 5EQSA 1HAZB 3EYDA 4MNWA 1CGHA 4TWWA 1FUJA 1EZSC 1V2PT 3GYLB 1MMJN 4RT1A 5EOKA 3ZZ5A 3LH1A 1C5TA 3BIVH 4PROA 1J15A 4YZUA 3ZZ9A 1AUJA 2HGTH 7ESTE 1DSTA 2JH5D 2KAIB 1QGFA 5EXLA 4YOGA 1LHGH 2I6SA 3KQDA 3SGBE 1BTUA 1V2JT 1H4WA 1FXYA 2GCTB 5JBTA 1AN1E 3NUMA 4THNH 3H7OA 4X8VH 1N6XA 1RXPA 1SGEE 3H09A 4J2YB 2B9LA 4CRBA 4BNRA 1BRUP 1YPEH 1SQAA 1TB6H 2CF9H 3ENSB 3SGQE 2QC2A 2PLXA 5FL7D 2FX4A 4FUDA 1YPLH 3F68H 1MTUA 2ZHEH 4Y71A 6LPRA 2OBOA 1GI4A 1U6QA 2ZU3A 2VH0A 5EJZA 3KEEA 1Y3YA 2GT8A 2UWOA 2B8OH 3BTTE 1Z8RA 4KP0A 2EI6A 1WU1A 3UB0A 1P2KA 2ZC9H 2C8WB 3H5CB 1O3BA 1EXFA 1C1QA 4I31A 4XDEA 1TPOA 1C5MD 4ZHLU 1H8ED 3EA8A 1TMBH 2CJIA 3MU4A 1K28D 2VVCA 1QY6A 1FMGA 2P16A 4MVNA 1AU8A 2P3FH 2F3CE 3STIA 2WZQA 1IQNA 2ANMH 4YT7H 2UUFB 4X1PU 1WUNH 4IC5A 2YMSB 3AK5A 1IQFA 3MMGA 3TJUA 2J95A 3RXDA 4FU9A 3E90B 2ZHDA 1J9CH 8LPRA 3HGNA 1PYTC 1XX9A 3LKWA 3A8CA 4HGCA 4Q7YA 3FKSD 3TH2H 1P2IA 1MU8B 1S6LA 4P02A 1GMHG 1H8DH 1T8OA 3BEIB 4IGDA 3A8DA 2YOLA 2FLBH 7LPRA 1ZMLA 2QCYA 2G5VA 2QGRA 1MAYA 3KYFA 2GMTB 4XBCA 1GHBF 1HV7A 2O8WA 3R0FA 5FPYA 3C1KA 1AKSA 1IQLA 3ZZ6A 2JH6D 1QA7A 4CHAC 1K1NA 3O8CA 4YOIA 4LOYH 2A4QA 2ZG0H 1P04A 3Q00A 3UREA 1HAPH 1Q31A 2LELA 4I8GA 1QRWA 2THFB 2CK3D 3N99A 3RXIA 1GBHA 1VGCC 4NFFA 1HYLA 2PKAB 1AFQC 1QCPA 4RSPA 1BTPA 4WMDA 1SFIA 4KKDA 3SV2H 3BTEE 1QBOA 2R3YA 1PFXC 1UVUH 5GXPA 4K2YA 1P01A 1W10U 3SUDA 1ZOMA 2WPLS 2P95A 4ZKSU 1FPHH 1BQYA 2PSYA 1JMOH 1E34B 5EXNA 2M2AA 3A88A 3RXBA 1SOZA 1O2GH 2XCFA 1P2QA 2H9TH 3DUXH 4JZEH 3ZZ3A 3QTOH 4Y7AA 4AGKA 5FBIA 2VWMA 3AAVA 3OAAD 1V2VT 3RXPA 4B2AA 1NRQH 2FS9A 3F1SB 1HAIH 1SGDE 1ZMJA 3GCHC 5HKKD 1CA0C 1J16A 1XUJA 1LVBA 1GMCG 1C2DA 1VITG 1AZ8A 1ZHPA 3SJ9A 2TGPZ 2OC1A 3TJNA 1BMNH 4H6TA 3MU0A 4DY7B 1TALA 2B7DH 2OTVA 2ZQ2A 1A0LA 2C3SA 1PYTD 4H6SB 2WSSD 1AB9B 2ZPRA 5I46H 4Y8ZA 1G9IE 2PWXA 2GP9B 2ZF0H 4Y7BA 1V2KT 1L1GA 1YY3A 4O9VA 1QRXA 1KXCA 1WTGH 1QA0A 1QURH 1DSUA 1BJVA 1O3OA 5CMXH 2JH0D 1ANEA 2QV1A 4Y79A 3QGNB 4K1SA 1O3PB 1UK4A 2ODYB 1NM6A 4ABIA 1SGNE 5E8EH 4A1TA 2XBXA 4ISNA 3MNXA 2VU8E 4CHAB 2FTLE 1SOTA 5A2MH 4HG6A 1GCTB 3RC5A 4I8HA 3EAJA 2ZGHA 4BTTB 1QRZA 2C4FH 2C8XB 2H1UA 4ABEA 1V3XA 2ZWLH 3PWCA 5C0UA 2FPZA 1TQ7B 2G4TA 1UTJA 2V3MA 1WAYB 1FQ3A 1LO6A 5EIYA 4NIWA 1UTPA 1SL3A 4RKJB 1HAHH 3HKJB 2HPPH 3VEQB 1YPHE 3M35A 1V2RT 5JBBS 1EOJA 3GCNA 4BAHB 4DJZB 2SGAA 1TPSA 1V2LT 4P00A 1UK2A 3P70B 2XRCA 1DS2E 3I29A 2VIDA 2F9NA 3D62A 3P8OA 7KMEH 3VGCC 4MNXA 1GDUA 1TX6A 3M3SA 1CA0B 2TBSA 1HDTH 1VKYA 2ZDMA 3C27B 4O3UA 3K2UA 3LGWA 1PQ7A 1OS8A 3U1IB 2F9OA 1NROH 2FDAA 7GCHG 2ZHQH 2G8TA 2HOBA 2EA3A 4H4FA 2FS8A 4F48B 1O2RA 3T27A 3ESTA 1O2PA 1BDAA 1XKAC 4UFFH 4HTCH 2BY7X 1OP8A 3TH4H 1TPPA 3PO1C 1Y5BT 4K5ZA 4ZXYH 3SI4H 1Z6JH 3SJ8A 5JYIA 2XC5A 3MTYA 1EPTC 2UUYA 3P6ZB 4M9FA 1TABE 2UWPA 1O5FH 2Z3DA 1WQVH 3TK9A 3DFLA 1GI6A 1AHTH 1S0QA 2F83A 1P10A 2BOHB 1AQ7A 1KXBA 3DSGA 3CS0A 4NZLA 5C17A 1HUTH 1S85A 2VWNA 2FM2A 2BDBA 1TQ0B 3A80A 4IW4E 3U98H 2F43B 3ATIA 2WPDD 3OY5U 2BDHA 4ABGA 1G3DA 4X0WU 5FCKA 3UNQA 3LU9B 5FCRA 5E0HA 1DE7H 2BDAA 3ZIAD 1CBWB 1O31A 4DW2U 3UNSA 3Q3YA 2FOFA 1G30B 2QXGA 1EB2A 4YLUA 1EJMA 3OTJE 5TCCA 4MTBA 1TNIA 3UR6A 5GWZA 5CE1A 1CA8B 2RDLA 3A7WA 2A7HA 2P8OB 4Q7ZA 5DG6A 1P3CA 1V2MT 4MPVA 3F6UH 4K1TA 1AZZA 3SNDA 5PTPA 1GJDB 4HFPB 3RDZA 3KQ5A 3FO8D 3NK8A 3BEFB 1P09A 2ZGJA 4ISIH 2SGQE 1RTKA 1A5GH 4AZ2B 3F9FA 4AGJA 1T8NA 1PJPA 5DO4H 2ZA5A 1GBDA 3K9XB 2BQ6B 3DCLA 5A8ZA 4M7GA 4ABDA 3V3MA 1MD8A 2SNWA 3PTNA 2VINA 4CRGA 4FUJA 4RN6A 5K7RA 1HB0B 1O2WA 1YP9A 2FEQH 4U30A 1DOJA 2WPHS 2XWBI 1ELVA 2ZIQH 5AVDA 3WW7A 1EAWA 1Z71A 2D2DA 2GDEH 2A32A 2F9UA 3HK6B 5DP8A 5F8TA 5L2ZH 1SQTA 3PO1B 1MTNC 1DLKB 4NWLA 2O8MA 1C1PA 2RFKC 2ZDLA 1SVPA 4E7RG 1XUHA 1UO6A 3RU4D 2HLDD 2HALA 2WPKS 5F8ZA 3RMLH 1C2FA 3SHAH 1VCWA 1CHOG 1EP5A 3SJIA 3SBKA 7GCHF 2BD2A 3M36A 1THRH 1GVKB 4NA8A 1OP0A 4NFEA 1ORFA 3LGIA 2XNDD 2J2UA 1BBRE 1C9TA 1K2I1 1PPGE 2WINI 4FUBA 2XBYA 3RXAA 4WMFA 1AKSB 2Y80A 2Y7XA 3LGVA 4TYDA 4ZCNA 3IITA 4JZIA 1NRSH 1K1IA 3SOSA 4F4OC 5EPNA 1P03A 1GL1A 2HWLB 4U32A 4XBDA 1O5AB 3MQKC 3KQCA 1C4U2 1XUGA 2QXHA 1ELAA 2TGDA 2W7UA 2G81E 3U8RH 2PGBB 1TGTA 1NPMA 1EOLA 2HNTC 1GBEA 2Q1JA 3A7YA 1GL0E 4D9QA 1OXGA 3AVZA 1H9IE 4NCYA 1KY9A 5J4QA 1LHFH 3OE7D 1N8OC 3M7UA 4KELA 4Y8YA 1IQJA 1GDNA 3K6ZA 1KXFA 1G32B 4XOJA 1UVTH 2Q6FA 3SV7A 2IPHA 3N7DA 3IWMA 3ZVFA 1BTHH 6GCHF 4O03A 1AVGH 1NZQH 3MNCA 3U1JB 2BDYA 2H6MA 1XXFA 1ZJDA 1FY4A 2EQNA 1HRTH 1SSXA 3MNSA 1CT0E 4ZHAA 2GCHG 5DK1A 1HJ8A 4XSKU 3OEHD 1C1UH 2A45B 4B73A 2CHAC
chains in the Genus database with same CATH topology
1W2KH 2BXTH 4DCDA 2A7JA 3SN8A 1YM0A 3SU4A 1AVWA 1INCA 1RD3B 3HATH 1OWHA 4IC6A 3QX5H 3P92A 2GX4A 1DXPA 1SLXB 2V6NA 3SUFA 4JYUH 2GD4B 1CU1A 1C2HA 1HJAC 3M3TA 4CRAA 1ETTH 1G3BA 1KLTA 4KGAA 1NS3A 5LH8A 1P2NA 3AAUA 2PTCE 2VH6A 4GSOA 5F8XA 1C1SA 2M5TA 4GHQA 1NC6A 1PQ8A 3KCGH 3GY2A 1EUFA 1O2ZA 4Z6AH 4INKA 1Z1JA 2FP7B 1S6HA 3T5FH 2AIQA 1JWTA 1KTSB 3MU1A 1VITH 2ZFQH 3VPKA 1NFYA 3QDZB 1QR3E 3ZV8A 3TJVA 2VJ1A 1BZXE 3U69H 2F9VA 1ACBE 1UTKA 2G52A 1DX5M 1C2JA 2GZ9A 3HKIB 5TJXA 1P05A 3M3VA 1FIZA 4B2BA 1AE5A 1SGCA 3EE0B 1NFUA 6CHAC 1CHOF 3BTGE 3KF2A 2TGTA 2ZI2H 2P94A 3QGJA 1GHYH 2WPIS 1JIMA 1FY1A 2BDIA 1ELBA 3DA9B 1ZSLA 1GG6C 1XMNB 1O37A 1O3GA 1GHBG 4I32A 4AN7A 1PPHE 3BG4B 3FP8E 4BANB 1GGDB 3M5NA 1SB1H 4AORA 1S83A 2CXVA 1BHXF 2QA9E 3PROA 1EP6A 1TA2A 2JKHA 5JDUB 1Z7KA 2CHAB 4YTAA 1SMFE 3BTME 5JPMH 1O2NA 4RKOB 2FI5E 1LCYA 1RIWB 3MU5A 2W26A 3UPEA 1ABIH 5C1UA 5EW2H 3GY7A 2Z9KA 1O0DH 2XXLA 2STBE 4UE7H 1ANBA 3SU3A 2IJOB 1P02A 1ZTLA 4GVUA 1KIGH 2WV4A 4ZUHA 3MH7A 2WYGA 1W0ZU 3LONA 4A6LA 1D6WA 5G4BA 3P8NA 1UTOA 4FUGA 2BD8A 5A8XA 1D3QB 2QN5T 4GAWA 1CGJE 2FZZA 3NCLA 4K1EA 5A09A 3OSYA 3PLPA 1P2JA 1LQEA 5GPIB 1AFEH 1DDJA 1PPCE 1B7XB 2OC8A 1AWHB 5EQRA 2BX3A 2GCHF 2TPIZ 4WH6A 1QJ6B 5GCHF 1O3NA 1GJAB 1QQUA 1TGBA 2QF0A 3VB5A 4YOJA 2ZKSA 2NU1E 1IQHA 2B5TB 1GBFA 2QXIA 2VIQA 2J92A 3PMHB 1QQ4A 1UTQA 3BTWE 1GI5A 3LH3A 4NZQA 2BHGA 2OBQA 4ZKRU 1SR5C 3MYWA 1HLTH 1ESAA 1ZGVA 1DLEA 1TLDA 1GI9B 1NY22 1O30A 1ETSH 1TWXB 2Y81A 4X2XA 3BG8A 3RP2A 1HXFH 3LDXH 1F2SE 1HXEH 2A4RA 1GMDF 1MAXA 1VJAU 1RRKA 1V2TT 3M5OA 1FV9A 2G55A 1C4V2 2ZU1A 4MNVA 2TGAA 1BTZA 3ATMA 4SGBE 1GWAA 2GKVE 1ELEE 5EU8A 1F0RA 1EAUA 2BY8X 5TCAA 1YF4A 3Q77A 1E35B 4KTCA 1EPTA 2HVXA 2FOGA 3GCOA 2QYIA 3FAOA 4XBBA 2GDDA 2ALVA 1LVMA 2NU4E 2R3UA 1KLJH 1QTFA 1EQ9A 4UFDH 2D8WA 2ZU2A 1AO5A 2ZTZA 5AFYH 4FUCA 1IHTH 1SGPE 4A7IB 1ZRKA 1ZTKA 3WY8A 2BDGA 3GY5A 1TONA 1KXAA 3KIDU 1K1LA 3M61U 3SGAE 4YO9A 1RS0A 4B1TA 1TGSZ 3Q3XA 2H5CA 1YPMH 1T31A 1T4VH 3RXVA 2BD5A 3KQBA 3T2NA 3A7TA 1RGQA 1CVWH 1ESBA 2HNTF 1TX7A 5FX5A 3A85A 2CF8H 3URDA 1HAVA 1EJNA 2VIOA 2VIPA 5F03A 4X6NA 1C1TA 1ELCA 2BLOA 3QK1A 4MDSA 1CSOE 1C2GA 4I8KA 3TITA 4B76A 4WWYA 1Z8IB 2BZ6H 4WXVA 3KGPA 2BMGB 3SNCA 2Y7ZA 2OQ5A 1NN6A 1GBBA 2OUAA 4FUIA 2ZZUH 5ESBA 1G37A 3KHVA 4WJG2 1AMHA 3KNXA 4Y0YE 4NA9H 1C5RA 3MOCA 3F9HA 1A4WH 4U2WA 2XW9A 2PW8H 5FBEA 4JK6A 1NFWA 3ODDA 3MH6A 5AHGH 4CREA 4UDWH 5IDKA 1ZPBA 5T3HA 1O2TA 2SGDE 1BBRH 3EGKH 5DP6A 1ANCA 1BB0B 1BRAA 1O2JA 5J4SA 3ITIA 3Q3KA 3UTUH 5AF9H 2ANYA 3G01A 4BTIB 2AGEX 1SGRE 1AVXA 4AFSA 4DIIH 3ZVAA 1GCDA 1ABJH 1V2QT 1HGTH 2AMDA 1KDQA 1TNGA 3IG6B 3TIUA 4ABAA 1E36B 1DWDH 1TX8A 3ATWA 3JZ1B 1KXEA 2FOCA 4X6PA 3GDVA 1ZSKA 3SQEE 1SI5H 3O8RA 1QL8A 3BTDE 1F5RA 1SGIB 1LVYA 1S84A 1TNHA 1THSH 1O5GH 1DANH 4TWYA 1TNLA 5C1XA 3MH5A 2PSXA 4OS4A 1VGCB 5L2YH 2A4GA 2DE9A 1AFQB 5LPRA 1NT1A 2VNTA 3BTKE 4AB9A 4AOQA 4ZKNU 1LHDH 2OCVB 1UCYK 3CS7A 5HXFA 1P9UA 3BTFE 4HI3A 1HJ9A 5K0HA 2FLRH 4LK4A 1LHCH 3EDXB 3QZRA 1IOEA 2TRMA 2BOKA 3UNRA 1IQEA 2ZDVH 3E8LA 5DGJA 4GHTA 3JZ2B 1GJ8B 2FYRA 3RXKA 4AG2A 1H9LB 2YNBA 1FN6A 3A87A 1ELGA 2WUCA 2YNAA 3TNTA 3RXRA 1FY3A 5FXLA 1TOCB 1UVOA 2AGGX 2OXSA 3GCHB 1V6DA 3LOXA 5DP9A 1OYQA 5DP5A 1KTTB 1A2CH 2XYAA 4JK5A 2A4OA 2Z9LA 2AERH 4A92A 5F6MA 1FAKH 1UCYH 2SGPE 1CO7E 1TRYA 1GI3A 1B5GH 3SORA 1SBWA 1GBCA 3MO6A 2Q6GA 1GBAA 5EPYA 2GV7A 2ANWA 2FESH 3TGIE 4ZAEA 1XM1A 4BAMB 1Z8JB 4TY7A 1LMWB 4DG4A 1WCZA 1NTPA 3TU7H 4LXBH 4UD9H 1D4PB 1A7SA 3TH3H 1QFKH 2LNCA 4Z0KA 1O3KA 5GIBA 4AB8A 2B0FA 1OWEA 4ASHA 3UQVA 2H5DA 2A31A 3SUGA 2BD7A 4AYYB 3SV8A 1NRPH 1O3LA 1E38B 4K8YA 3SU0A 1WOFA 1MTVA 1C5XB 1O2XA 1O3FA 2IOTA 4IN2A 1A1RA 6GCHG 3E3TA 3UFAA 1GBMA 1WSSH 2OC7A 1C2KA 1S5SA 2PKSC 4AG1A 1NU9A 1W12U 3MHWU 3GOVB 1D3PB 1FY8E 2ZDAH 2R0KA 1TMUH 4GUXA 4NG9H 3UQOA 1TGNA 1ZMNA 1A0JA 2AH4X 2OC0A 3KN2A 4WH8A 2ZGBH 3VGCB 3RXCA 1YYY1 4Y6DA 2RCEA 1UTNA 1JBUH 1W11U 1YLCA 5DKMA 3L6PA 3BF6H 1LQDB 2ZDKA 1OWKA 5EG4A 4X1QU 5GDSH 3STJA 3RXJA 4OGYA 4Y76A 1XVOA 5BPEA 1O5CB 1H9HE 2EEKA 1QBVH 1JRSA 1SGTA 3S69A 2LPRA 1YGCH 1GBTA 1F0UA 5A0AE 1SGYE 3S7KB 1WYKA 1EPTB 2OINA 4A1VA 1BA8B 1TMTH 2F9PA 4BTUB 1VZQH 1A5IA 2ZHFH 1DPOA 3K65B 2F91A 5FPTA 1AWFH 1AI8H 4R8TB 3MFJA 1K22H 3BN9A 4K60A 2WPMS 2ODQA 3TGJE 2OLGA 4E7NA 2H2ZA 4ABFA 2Z9IA 1TAWA 2A2XH 1MU6B 1WTHD 3ZVBA 4GCHF 3R3GB 5E2OA 2P3TB 1L4DA 1BHXB 1O35A 9LPRA 1HIAA 3I78A 4BXWA 3BV9B 1GJ5H 1P2MA 3QWCH 5GJ4B 1UK3A 3E1XB 4YLQH 3SNEA 1JXPA 4KTUA 1BMAA 1DICA 4X6OA 3P8FA 3TVJB 3PTBA 3ZZBA 1TRMA 1HAVB 1UMAH 1S0RA 1Y3VA 3LJOA 2Y5GA 4ABJA 4NIXA 4Y10E 1GHWH 1L2EA 5EXMA 3UY9A 1GJ6A 3A7ZA 4DT7B 4YM9A 3KL6A 2Z3CA 4ZKOU 3RU4E 2PKAA 3LC5A 1TFXA 1F7ZA 1T8MA 2QAAA 1LTOA 1O3HA 4OS6A 2VIVA 1MBQA 4NIYA 3ZZAA 1AD8H 1GJBB 1L1JA 5C3NA 4CH8B 3HPTB 3F9GA 1MZDA 1N6YA 5T6GA 5C5NA 1QB9A 4A5TS 2FI3E 4VGCC 3A89A 5I25A 2UWLA 1DM4B 1GBKA 5JB8S 1BOQA 1XVMA 3GY6A 4AYVB 1OWJA 4E06H 1O32A 1RJXB 3RXEA 1YCPM 1E0FD 2LIZA 4A1XA 1T8LA 1C1NA 2H9EH 2BDCA 3BEUA 3RLWH 5GCHG 1LPKB 3PB1E 1MTNB 3SNAA 1QB1A 3NPSA 4D76A 4DURA 4KTSA 2ZU4A 1BITA 3RXTA 3TK5A 4X2YA 4GPGA 3ZVCA 1P3EA 4D7GA 1TRNA 1PPBH 3P8GA 4MLFB 3SV9A 1RTFB 1FONA 1K1JA 2VGCC 3RXOA 3AASA 3TK6A 2W3IA 3LC3A 2HPQH 1GJ4H 4JCNA 1KDQB 1XKBC 1MZAA 3A86A 3FZZA 5JBCS 3MH4A 2Y82A 4JZFH 4FVDA 4INLA 3FP7E 1C1WH 3L33A 1MCVA 1Q3XA 1GMDG 2FXRA 3RXHA 2J38A 3RM2H 2Y5FA 2ZFTA 3TNSA 3RLYH 2HRVA 1ELTA 2XCNA 3SJOA 5LPEA 5FHTA 2XBVA 4TPIZ 3GY4A 4FU7A 1EZXC 2R2MB 1YC0A 2BB4A 1K1PA 1T32A 2BM2A 2TIOA 1SG8B 2EI8A 4DGJA 3GY3A 2SGEE 3LGYA 1W7GH 1W8BH 1LVOA 2GCTC 4IMZA 3TPIZ 4ZH8A 2O8UA 1KLIH 1UVPA 4CRFA 5DPAA 1GHZA 3N7OA 1N8OB 4D7FA 1AGJA 1O3EA 1Z6EA 4WY3A 1TPAE 5EODA 2GTBA 3DD2H 1GJ7B 4VGCB 1HFDA 2AS9A 1CE5A 1GJ9B 1THPB 1WV7H 2P3UB 1TA6A 2BQ7B 2NU0E 3E0NB 2FOBA 1O3JA 8GCHF 1BT7A 5E2PA 4MNYA 4CR9A 1J14A 1AUTC 1IAUA 1W14U 2BVRH 5JB9S 1C1MA 2HNTE 2ZGXH 1O2HA 1W13U 1MH0A 3LGUA 1A0HB 3MO3A 5T6DA 1EAXA 3RXLA 1DFPA 2NWNA 1RTLA 5HM9A 2J34A 1O2UA 5L30H 2R9PA 5A8YA 2BLWA 3VFEA 3P95A 3V7TA 3S0NA 2AEIH 1ETRH 4OS1A 1C5PA 3S9AA 1DT2A 2FI4E 2O9QA 2Y5HA 4CRDA 1QBNA 3MNBA 4IN1A 1HJAB 2SNVA 1O5EH 1P11E 2GGVB 1HBTH 3TJOA 1ZJKA 1Y5UT 5C5OA 1V2NT 2K7XA 1MQ5A 1PQAA 1O2VA 1O3DA 4XE4A 3UWIA 1CHGA 1O2LA 5C2ZA 4MPWA 2W5EA 2ZNKH 2BY5X 1D3DB 1C5WB 4MPXA 4X1NU 1YLDA 1H1BA 2FWWA 1EASA 3NXPA 1AY6H 3FP6E 1A46H 1GHVH 3LIWA 1IQGA 2C8YB 3A8BA 4JZ1A 4O3TA 1L1NA 2GMTC 1C5QA 1SLVB 1SLWB 1IQKA 4WF8A 4NSYA 5LGOA 3ATLA 4B71A 1IQIA 2PV9B 1LDTT 1OWIA 1UHBA 2ODPA 4WMEA 2ZCKP 1O2OA 1TBQH 4QT8C 1O2IA 1GHXH 4H42U 4NA7A 5AFZH 1SQOA 3ZVDA 1B0FA 6CHAB 3RC4A 3E91A 1TBRH 3SU5A 2C90B 1TYNA 1GG6B 3TLOA 1OP2A 3O8DA 1ZPZA 2PR3A 4LZ1H 1DUAA 2XC0A 4UFGH 1ZSJA 3MU8A 5JBAS 3A7VA 4ISLA 1OWDA 2R0LA 1BTWA 2GZ8A 4AX9H 4BAOB 3CENA 1DWEH 1GBLA 1YKTA 5ETXA 3UOUA 3SQHE 3FANA 3S9BA 4SGAE 1IQMA 2BVSH 4DOQA 2G4UA 3GISB 1A5HA 2FYQA 3A7XA 5H4IB 1LPGB 2ASUB 3Q76A 3ZZDA 4B2CA 4OGXA 1Z1IA 2J9NA 2RA0A 2BD3A 1N1LA 1GBIA 5HM2A 3PMBB 3QO6A 3M7TA 4FVBA 9ESTA 3U8TH 1QL9A 1EATA 4J1YA 2W7SA 1BRBE 2Z9GA 1P8VC 1YPJH 1O5BB 3LPRA 3I77A 2VB0A 1AB9C 5HMAA 2UUKB 3FVFB 4Q80A 1OYTH 1TE0A 3FZDA 1LKBA 1TIOA 4YT6H 1O2KA 3LGTA 2G51A 1GVLA 3QLPH 2ZFSA 4X8TH 3PM3A 1K9OE 3K6YA 2GZ7A 1YPHC 3S7HB 1Y8TA 4JYVH 1HIAB 2OD3B 4NWKA 3M5MA 3M5LA 3SU6A 3A8AA 1BBRK 3D65E 2V35A 1GHAF 1OSSA 2GVFA 1F0SA 2BX4A 1ESTA 3B23B 1F5LA 1BIOA 1GCTC 3B9FH 2BLVA 4OS7A 3A81A 3GCTG 4IS5A 1GJCB 4CRCA 3RXMA 2CV3A 1XUIA 1JIRA 1DUEA 1J8AA 3GY8A 4R0IA 1QJ7B 1H8IH 8ESTE 1ZRBA 3A83A 4OS5A 5IYTA 3RXGA 2PUXB 1MBMA 2XC4A 2ZP0H 1GI1A 2H9HA 2BY9X 3F9EA 1DWCH 4HZHA 1P12E 3OY6U 1JRTA 2OQUA 3GDUA 1S82A 2J94A 2AGIX 2EI7A 4NIVA 2ZECA 1G36A 3BTHE 1ZR0A 2Z7FE 2CMYA 1A61H 2ZHWH 2XBWA 3ZYDA 4ZXXH 5T6FA 4X8UH 1FNIA 1C4Y2 3PMAB 1G3EA 1ARBA 1ZHMA 1O38A 1O3CA 3L3TA 5DP4A 4INHA 2VWOA 3T26A 3P17H 2BD9A 2OP9A 5A0CA 2XNIA 4K3JA 2D26C 2FOAA 2ZCLP 1C1VH 1OOKB 3ELAH 3SUEA 3GICB 1P0SH