3FP8E

Anionic trypsin variant s195a in complex with bovine pancreatic trypsin inhibitor (bpti) determined to the 1.46 a resolution limit
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
223
structure length
223
Chain Sequence
b'IVGGYTCQENSVPYQVSLNSGYHFCGGSLINDQWVVSAAHCYKSRIQVRLGEHNINVLEGNEQFVNAAKIIKHPNFDRKTLNNDIMLIKLSSPVKLNARVATVALPSSCAPAGTQCLISGWGNTLSSGVNEPDLLQCLDAPLLPQADCEASYPGKITDNMVCVGFLEGGKDSCQGDAGGPVVCNGELQGIVSWGYGCALPDNPGVYTKVCNYVDWIQDTIAAN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Anionic trypsin-2
publication title Structure of a serine protease poised to resynthesize a peptide bond.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Hydrolase/hydrolase inhibitor
total genus 60
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2009-01-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3fp8E01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3fp8E02
4F4OC 1MTNC 1V2WT 1SLVB 1C1SA 2BD2A 5FBEA 3PTBA 1IQFA 1GGDC 1J14A 3K2UA 4CRBA 2WPLS 4OS2A 5EW2H 2HALA 3A7YA 1HDTH 1W7GH 3LGTA 2GCTB 3F9FA 4O97A 3RP2A 3K6ZA 3GCOA 4JZDH 4YOIA 1V2MT 3ZZ7A 1MBMA 3Q3KA 1DWBH 4RKOB 5L2YH 3P70B 4K1TA 1AKSA 3URDA 1GI7B 2FTLE 2R2MB 3A7WA 5K7RA 1T4VH 2W26A 5AF9H 2ALPA 1GBHA 2ZHEH 2FLRH 2WPMS 4Y8XA 2GZ9A 4ABFA 1O2TA 1A1RA 3V3MA 3SQHE 1HAYB 2FOHA 3FAOA 3A81A 2F9VA 4BOHA 5E2OA 2ANWA 1KSNA 2FO9A 1FIZA 1FXYA 2ODPA 4B2AA 2Y81A 1FN6A 4Z0KA 1ELVA 1E38B 1QRXA 2P93A 1D6WA 2Y6TA 1C5RA 5EODA 4ZXYH 5AHGH 1EASA 3A7VA 3KQCA 3ZZDA 1GHBF 1TBRH 3T2NA 4WJG2 3LC3A 3ZVGA 2J92A 2XCFA 3NKKA 2J95A 1JMOH 2OP9A 4WWYA 2EI7A 1C1NA 3DT0H 1HGTH 1C5LH 1YYY1 4THNH 2GKVE 1FPHH 3UY9A 1O2QA 5FX5A 1GBMA 2ANKH 1DDJA 4YTAA 1C1RA 1HAIH 2Y82A 1TNHA 3EA8A 2FWWA 3MH7A 1DFPA 1HJ8A 1YLCA 2ZPQA 2WPHS 1PPZA 1ZMLA 2V3OH 1F2SE 1V2VT 1YPLH 1K9OE 2DUCA 5G4BA 2GDEH 5DPAA 4NFFA 3Q77A 2P3UB 4TY7A 3ZZ9A 3GOVB 1QGFA 1T7CA 3SU0A 4XBCA 2BY8X 1GJDB 1O2ZA 3ITIA 2Z3CA 1HPGA 2C3SA 8GCHF 3OX7U 4I8KA 2A4RA 5GXPA 1SSXA 5E2PA 1RIWB 4MLFB 1JWTA 2XBYA 2VIPA 3GCHB 3ZZBA 4MNVA 3TJOA 1BTZA 3P8NA 2CN0H 4MNWA 1YM0A 1ZPZA 3U8RH 2H9HA 3FFGA 4WXVA 1L1JA 2Q6GA 3SNEA 4DURA 5T6DA 4CHAB 1AWFH 1GJ8B 1LCYA 3MH5A 3SGBE 1BTHH 1BQYA 2P8OC 1GMCG 3UFAA 1ELFA 5FHTA 3ATLA 3PLBA 4NCYA 4BNRA 1BB0B 1CT0E 5AFYH 2QF0A 2QXHA 1QA0A 2K1QA 3STJA 4JZEH 2ZECA 3KN2A 3M35A 3RXFA 2XWBI 3FP6E 3LIWA 1VITH 4LXBH 1O3FA 1MTNB 4UFFH 1SL3A 2ILNA 1GGDB 4UFEH 3PMHB 1O5CB 5T3HA 2IPHA 1D9IA 2C8WB 2Q6FA 1MD7A 2GP9B 1TPSA 3M7QA 3RXJA 4A1XA 1BCUH 2CF8H 1YLDA 1G3BA 2ZIQH 4ASHA 5TJXA 4UONA 3A87A 2BLQA 1HB0B 1ESTA 3LPRA 2PLXA 3BEIB 3S9CA 1X7AC 1SOZA 1WU1A 4K8BA 4NZLA 1TNIA 1GJBB 3PMJA 5LPRA 3ZZ3A 2ZGBH 1G32B 1LMWB 1QFKH 1O39A 1V2LT 5H4IB 1PPEE 2FYRA 2VU8E 3TK9A 4HFPB 1FZZA 1O36A 1P0SH 2P95A 4DJZB 1Y5UT 1O5FH 5PTPA 2GMTC 1OWEA 4X8UH 1BZXE 1O3JA 1SGTA 2FOMB 2RCEA 2PR3A 4AX9H 3NWUA 1Y3WA 6LPRA 4MPXA 3RXOA 5JBCS 4MTBA 3TGKE 3CS0A 1BMMH 1XUGA 1O2SA 1W13U 2H5DA 3O8BA 1ZGIA 5DP6A 1QY6A 1SC8U 1EZXC 4ZHLU 1IQKA 1IHTH 4ZUHA 5HYOA 1UK2A 2GZ8A 1FI8A 2B0FA 1A3BH 1NRPH 4DVAU 3RU4E 4FVBA 2ZGHA 3F6UH 1GHBG 1GI4A 4ISIH 1E35B 3RC6A 1HYLA 4NSYA 1IHSH 2VH6A 4YLUA 3UOUA 1SGNE 1G36A 1GBEA 3SBKA 1N1LA 3GY8A 2ZKSA 2GV7A 4INKA 3QZQA 4XE4A 1GCTC 4BXWA 1O2PA 2CV3A 3BF6H 2BD7A 2CGAA 4NWLA 3BTWE 6GCHF 5A0CA 1K1JA 1QR3E 1LVOA 1UTMA 1QTFA 1KIGH 4OGYA 1QBVH 1UTJA 2QXJA 5K0HA 4BANB 1S6HA 1W0YH 1HAPH 1BTWA 8GCHG 1F0RA 1BA8B 1BMLA 4ABIA 1MBQA 4YLQH 1C5UA 5C20A 1O3GA 2SFAA 2P8OB 2AFQB 5ETXA 2GGVB 1V2KT 2PW8H 1UVSH 1YCPK 1SGPE 4KKDA 2Z94A 1O5BB 4XFQA 2YOLA 2G4UA 1WBGB 2ODQA 1H4WA 2R3UA 1EZUC 1SGCA 1MH0A 1C2JA 3S7HB 1MAYA 1ETTH 1QJ1B 2A5IA 5EQRA 3RM2H 1UHBB 1BRCE 3BEFB 1MTUA 1D4PB 2V35A 3ZZCA 2AS9A 3RXQA 1M9UA 1O2RA 1CBWC 3FZDA 1GI1A 2VIDA 2J2UA 2CHAC 4UE7H 2BY6X 4IN2A 3MNBA 1MTVA 3BSQA 4A1VA 3EE0B 2BQ6B 1UO6A 1TNKA 1TA2A 3UIRA 1Z1JA 1LHDH 1DOJA 3QGNB 2G55A 1F0TA 3QLPH 1P04A 3A88A 1UTLM 4YOJA 1LPZB 4XDEA 1F5LA 1TMBH 1SLUB 1A0JA 2ESTE 5BRRE 2NU3E 2FI4E 4WH6A 4OS6A 4KTUA 1C9PA 2IN2A 2HLCA 1DT2A 4WMEA 2R0KA 2Z9JA 1TAWA 1Z8GA 1J17T 1KLIH 3LC5A 3M5LA 5DP9A 1BTXA 1Y3UA 1AVXA 1QNJA 1TABE 2O8MA 4X1SU 4R8TB 2FX6A 4CREA 4I31A 1D3PB 2OQUA 1NROH 2PSYA 4A7IB 1O2HA 2BOKA 3TJUA 4YT7H 3SI3H 3SORA 4K1SA 3GCNA 3IG6B 4FVDA 2G8TA 1NPMA 1QRWA 2F91A 2ZZUH 1OKXA 2PKAA 1AB9B 1CA0B 4BAQB 3E0NB 2QYIA 4X8TH 1SLXB 1ZSLA 1IQJA 2BYAX 3LOXA 4LZ4B 3MTYA 1EJAA 1W11U 2TRMA 1Z6JH 1HAOH 1OYQA 1HJ9A 2OC7A 2QGRA 2Z9LA 3ODFA 1YPEH 2O8UA 4H6TA 1DWDH 2A2QH 1SG8B 2NU1E 1A0LA 1J8AA 1EKBB 1PPCE 1UTKA 1OWIA 1CGIE 2F9PA 4FUCA 1PFXC 2A1DB 3P17H 1DPOA 1FPCH 4AFZA 4H4FA 2C8ZB 2OLGA 1RFNA 4X8SH 4K5ZA 1EOJA 1P57B 1C2MA 5FCRA 3P6ZB 2PUXB 2G51A 3ODDA 1GJ5H 2W7UA 3U1IB 1ZPBA 1F5RA 1GDQA 2TIOA 4IN1A 2XTTB 4FU9A 4MPVA 4HTCH 3GY4A 2FI5E 4ZKOU 1W14U 5DP4A 4J2YB 1P09A 5JB8S 1UCYK 6GCHG 4X6OA 5L2ZH 4Y8ZA 3CS7A 4JYTA 1GBBA 1FUJA 3NCLA 5LPEA 4MQAA 3RXUA 1TLDA 2A2XH 2A4OA 4ZHMU 5EXNA 1GJAB 3M5MA 1ETRH 3ENSB 4UEHH 1L2EA 2ZHFH 4X6PA 3ATIA 3QTOH 3KEEA 1SR5C 2BY7X 3HKIB 1ELDE 3BEUA 4GPGA 3SO3A 4JZFH 1XX9A 3OYPA 4AYYB 8LPRA 4Q2KA 3BN9A 2VVVA 4DW2U 1BBRH 2WINI 2CHAB 3BTFE 1SGIB 1UK4A 1H9LB 4MNYA 1L4DA 4MPWA 2BX4A 1MUEB 1N8OC 1LVYA 2EC9H 3PO1C 3MNSA 3CENA 5GWZA 1AFQC 5A09A 3EAJA 1YPKH 1WV7H 1GHXH 3RXMA 1IQHA 1TX7A 1C5QA 1GI9B 1TMUH 1DY8A 3S9AA 1FY1A 5FAHA 4YESB 3RXTA 1E34B 3AAUA 3NXPA 2F9NA 1VGCC 2FP7B 1O2YA 1N6XA 1T8OA 2UWLA 1KXFA 4RSPA 5C5OA 2FOAA 2VVUA 1ZR0A 1XUKA 5JYIA 3KQBA 4SGBE 3RXSA 3VB7A 1LPKB 2RDLA 2V0BA 4XOJA 3D62A 4Y0ZE 3ZYDA 1GDNA 4ESTE 1QRZA 4ABEA 4I8JA 3T28A 4D8NA 4DG4A 3RC5A 3RM0H 4NA8A 3UOPA 1THSH 1ZTKA 2PSXA 2ZFFH 2XBWA 1RIWC 1AU8A 1CSOE 1CHGA 3RC4A 3SUDA 3F1SB 4HGCA 3KGPA 1BIOA 2FEQH 2HRVA 4I7YH 5JBBS 3NUMA 2BD8A 4J1YA 2ZCKP 4BAMB 1C5NH 4IC5A 1MU6B 3PMAB 4X6MA 1WTHD 3AW1A 3MYWA 3EYDA 3HK6B 1UK3A 1MKWH 2FYQA 4A92A 2UUJB 3TVJB 1SBWA 1NRNH 1O3KA 2D2DA 1P9SA 2AGEX 3S69A 1NN6A 1HCGA 1O32A 4KTCA 3TK5A 1L1NA 2XYAA 5EXLA 4Z6AH 1QJ6B 1IQGA 1O5DH 3MNCA 4U01A 2YNAA 5DP3A 4TYDA 5DKMA 1UVUH 1C5TA 3LJOA 3A7ZA 1TGTA 5HM2A 1MQ5A 1GL1A 5LPFA 1FN8A 1XXFA 4NWKA 3RXDA 9LPRA 1FY8E 1PQ8A 1QBNA 1C9TA 1OX1A 1P2KA 4CRAA 1OWDA 4ABGA 4D9RA 5IDKA 3ZV8A 1YPGH 1ANBA 3A86A 1DVAH 1RTLA 3FP8E 4NIWA 4D7FA 1S84A 1NU9A 4X2XA 1Y59T 5DGJA 2UWPA 1CQQA 4TY6A 1ZTJA 2BLVA 3DUXH 5A0BA 1FJSA 4OS5A 1INCA 2VGCB 4OS4A 1O3NA 1G37A 3BV9B 2EEKA 3M5OA 5E0JA 2P3FH 1PPFE 1RTFB 3GDVA 3I77A 1GHZA 1DX5M 2FESH 2SGPE 1SGDE 1TYNA 1A5HA 1ZYOA 3WY8A 3BTDE 1DXPA 4BTUB 2P59A 1N8OB 1NTPA 2BVXH 2Y5HA 3PO1B 1HIAB 4X0WU 1G3DA 1J15A 1UTQA 2WYJA 1AFQB 3LJJA 3KCGH 5F8XA 1C2IA 1GVZA 3ZVBA 1GBFA 1LO6A 3I29A 2Y5FA 4TWYA 1NRRH 3GY2A 1CVWH 1ZRBA 2TGDA 1SMFE 2NU0E 1VGCB 1UCYE 2D1JA 4KTSA 5CE1A 2J38A 1A4WH 1KYNA 1TPOA 2ZCLP 1T31A 3SJIA 1GI8B 4OS1A 2J34A 3A7XA 3BG4B 2VVCA 5JDUB 4U2WA 1H9IE 2BTCE 5EU8A 1IQMA 2QC2A 3TJNA 3MO6A 2AYWA 3R3GB 2JETB 3SQEE 5C1UA 1P9UA 1K1IA 5J4SA 1IQLA 2TBSA 4WXIA 4ZKSU 2W5EA 1S0QA 1KY9A 4ABDA 1K28D 5EXMA 4F49A 2QV1A 2F9UA 4Y11E 3LGWA 1O35A 1G30B 3ZVAA 2XC5A 1EUFA 5E8EH 5F6MA 3M61U 3SUGA 2CJIA 2BQWB 1ZGVA 1P2OA 1G2MA 1BDAA 1MCTA 1P2JA 3GY3A 1A61H 3BTKE 2F9BH 1IQNA 2A4GA 1HAVA 1LPGB 4WVPE 3SV7A 2HNTC 1J16A 2C93B 3RXVA 2ZQ2A 4WMDA 4Y10E 1ZZZA 3UUZA 2Z9GA 1BTPA 2VIQA 1IQEA 1C1VH 1TX8A 2ZA5A 3TJVA 5T6FA 3ATMA 2H9EH 1V2ST 1HXEH 3E6PH 3DFLA 4GAWA 2XNIA 1TOCB 2XC0A 2BVRH 3N7OA 4IMZA 1EJNA 3PWBA 1L4ZA 3LH3A 3QZRA 1F92A 1P05A 3BTQE 2XBVA 4AORA 1Q2WA 1O3IA 5FPYA 5DK1A 1W12U 2GZ7A 1WAYB 3TGJE 1QBOA 3A80A 5ESTE 2ZGXH 1TALA 2I6QA 2ZWLH 3GCTF 2FOEA 3GY5A 1GDUA 3SV9A 1JIRA 2GD4B 1QURH 1HXFH 7LPRA 1KXCA 1VJ9U 3M5NA 1HAHH 2AIQA 2ZU3A 4VGCC 3IITA 1QQ4A 3UWIA 1ZMNA 3RXPA 2Z3DA 3PLKA 3SJKA 5HXFA 4NFEA 1P11E 1A5IA 1ANCA 3HKJB 1O31A 5GCHF 4ZH8A 3UTUH 5B6OA 3ZZ5A 1LHEH 2BHGA 4B75A 3E16B 3H5CB 4B2CA 1A3EH 2FODA 3K65B 4X2WA 5GJ4B 4JZIA 3QUMP 1GG6B 2PKSB 4YM9A 3M3SA 3MU8A 2AEIH 2C8XB 3L33A 1O2VA 2A7CA 1JXPA 3Q76A 1Q3XA 1ELGA 3U8OH 5I46H 1P02A 1TMTH 5A2MH 1AB9C 1CA0C 3OU0A 5JB9S 1S83A 1HLTH 5J4QA 3HGNA 3UREA 3G01A 4CRDA 2PGQB 1WOFA 5A8YA 1GPZA 4ZROA 2Z3EA 5A8XA 1TPPA 3LONA 3AAVA 1EB1H 1HNEE 3VPKA 1FLEE 4MVNA 5DJ7A 2QA9E 1UTOA 3H7TA 1LTOA 2ZI2H 5HGGA 4K69A 1QL9A 4Y79A 1S5SA 4BTTB 3P95A 2JKHA 1MKXH 1VCPA 2A7HA 3SU5A 7GCHF 2BZAA 1S82A 4OGXA 2GT8A 1FDPA 2SNVA 2VIOA 5C1YA 1TGBA 3SU1A 1DXWA 1BBRK 4INLA 1F5KU 3CP7A 2GVFA 4MPUA 5EQQA 3BIVH 5C1XA 2P16A 1LDTT 2XW9A 1KDQA 3QK1A 1EAIA 3URCA 1HRTH 1MCVA 1BT7A 1TPAE 3A8CA 4ZMAH 3STIA 1YPJH 3PLPA 3Q3XA 3RXEA 3T29A 1A5GH 1GHVH 4X2VA 1SB1H 1LHCH 2HOBA 1GBKA 1TFXA 2UUYA 1BJUA 2D26C 3UNRA 2UWOA 2OC8A 2J4IA 2B5TB 5HMAA 1WUNH 1SHHB 5LGOA 2C90B 2ANYA 3E0PB 2ZP0H 1F0UA 3B9FH 2DE8A 2D8WA 1EB2A 1NESE 2A0QB 1SGFA 1C1WH 1EXFA 1CT4E 1P06A 1CO7E 2F83A 2M5TA 1TBZH 1GI2A 3NPSA 1C1OA 2Q6DA 3A83A 4UFDH 5C2ZA 1Z7KA 3ZZ8A 2VJ1A 1V2JT 1MAXA 1EQ9A 1EPTC 1OPHB 1GBJA 3ZVEA 4FUGA 5BPEA 3SU3A 2ZFRH 3MO9A 1QL8A 2ZU5A 2B8OH 1T8NA 2V6NA 4VGCB 6CHAC 2A5KA 4TWWA 2WV5A 1SGQE 1V2PT 2Z9KA 1K22H 1PYTD 1TRMA 2JH5D 3MWIU 3DHKH 1C1TA 2ZFTA 5DO4H 5GPIB 3GCTG 3M37A 4I8HA 1MKWK 4A1TA 1XKBC 4JYUH 2BDGA 2ZPRA 3RLWH 4BAHB 2ZFPH 1O3AA 1XUFA 1C2LA 3SU6A 4M7GA 3KNXA 1MMJN 2V3HH 3MNXA 3S9BA 5HM9A 5TCCA 3KHVA 4ISLA 3SI4H 4GHQA 1DWEH 1RJXB 2ZTXA 3RMMH 3T27A 6ESTA 3R0FA 1DY9A 3JZ2B 5GCHG 3FP7E 1BMAA 1Z8IB 1UVTH 1ZSJA 2C8YB 3ZZ4A 4NIVA 1P10A 3P92A 2QN5T 1GI6A 1TQ0B 2ZNKH 4XBBA 1EAXA 4CH8B 2PV9B 1TONA 4K60A 2FX4A 4GUXA 1SVPA 3RMOH 1C2KA 4TPYA 1C5PA 3MI4A 5L30H 2VIVA 1XVMA 4X6NA 1EZQA 1UMAH 1YPMH 1AUTC 2ZHDA 1AGJA 3T5FH 5L6NH 3U1JB 4AOQA 1W8BH 1PQ5A 2F3CE 1HJAC 3ESTA 3TU7H 1O2KA 4WMFA 1DE7H 1DS2E 3ATKA 1EOLA 4ABAA 1O2UA 3GDSA 1GMDF 2SGQE 3K9XB 1QB9A 1AO5A 4JZ1A 5FBIA 1AZ8A 4Q7YA 1OWHA 3DA9B 5IYTA 4K2YA 4UD9H 1B5GH 3PB1E 5C3NA 1C5VA 1AVGH 1DLEA 3H7OA 4WH8A 2BDCA 2DE9A 3ZZAA 1JOUB 1UVPA 5TCAA 3O8DA 3FVFB 4R0IA 1Y3VA 3SNAA 7GCHG 2BDYA 2FIRH 2P94A 1BHXB 4Y76A 3LU9B 1KLJH 1O3HA 2SGEE 1GBAA 3HATH 5T6GA 1VR1H 3E3TA 3MHWU 4B74A 4E7NA 1AMHA 3ZVFA 2A32A 3MMGA 2W3KA 3LT3A 1AFEH 1CA8B 2G00A 1AUJA 4CBOA 1C5MD 3MU0A 1ETSH 3A8DA 2VGCC 3U8TH 1VCWA 3A89A 2GDDA 3PMBB 5GDSH 1K2I1 3UWJH 4WF8A 3TNTA 3E91A 2TPIZ 5C5NA 4D76A 2OQ5A 3RXAA 1T32A 1C1QA 4D9QA 1C4Y2 1NFXA 4IGDA 2WPIS 4GVUA 2FTMA 1FIWA 3QDZB 1NFWA 4O3UA 1BBRE 3M7UA 1QCPA 2Y7ZA 1SQAA 4K1EA 1EPTB 1O0DH 2SNWA 1ANEA 2QXIA 4GSOA 5ESBA 3PTNA 4DT7B 1W3CA 1AVWA 4GCHF 2AH4X 1WQSA 1C5SA 2R3YA 3RU4T 6CHAB 2ZU4A 4Y7AA 1U6QA 4O9VA 2J9NA 3A7TA 3KL6A 1ZJKA 2Z6BD 3SGQE 3U69H 2FOCA 3BG8A 2IJOB 2A45B 1RGQA 1UJ1A 1LQDB 4IBLH 1EATA 2FXRA 1CT2E 1YCPM 2YNBA 4B71A 1A0HB 2CXVA 1SQOA 1S81A 3MH6A 3BG4C 3RU4D 2BDBA 1OSSA 3F9HA 3S7KB 1Y3XA 3U98H 1YPHC 1V2QT 2GT7A 1EP5A 3K6YA 1XUJA 4B2BA 2FM2A 4IMQA 1VITG 2JETC 2VWMA 3RMLH 3A84A 3VB4A 2CMYA 1LHFH 1K1OA 1ELTA 3SN8A 1YF4A 1UTPA 3W94A 1G3CA 1H1BA 3FANA 2BM2A 1P2QA 1SHYA 2W3IA 1HAGE 4B1TA 1L1GA 3UR6A 1VZQH 3JZ1B 1JBUH 2BD5A 2XBXA 3VB6A 2B7DH 3QX5H 1SGFG 4FU7A 3RUOA 1TRYA 1E37B 3RXHA 1ELCA 4U30A 3D65E 4X1QU 4Q7XA 1WSSH 1BRUP 2BQ7B 3TH3H 1MQ6A 1AHTH 2O8TA 3SU4A 1FQ3A 1HJAB 2BY9X 1AN1E 2BVSH 1SOTA 4FUBA 5GIBA 4YO9A 2BLWA 2BD9A 3PYHA 4D7GA 1E36B 1K21H 4Y7BA 1GJ7B 5ABWA 1B0FA 3BTEE 5CHAC 3RXBA 4BTIB 4NA7A 2OD3B 1D3QB 1TNGA 4O03A 1Y5BT 1Y8TA 3QO6A 4ABHA 1W10U 1GMDG 1A2CH 2SGAA 4AFUA 1C5WB 3SHAH 2BD4A 1O3PB 1C5ZB 3KQEA 3FZZA 3F68H 3T26A 1P8VC 3UQVA 1P2NA 4E05H 3TITA 4IS5A 1C2EA 1GI5A 2ZTYA 1GJ4H 1XMNB 3BTME 3RXIA 2G4TA 1O3EA 1V6DA 3SUFA 1THPB 5FXLA 3B23B 3I78A 1GI0A 2HNTE 4DGJA 3PROA 2EI6A 5SGAE 4DY7B 4I32A 1XXDA 5AVDA 2H5CA 2FOFA 2HWLB 4FXGH 1YGCH 1MKXK 2PHBA 1KLTA 1RS0A 1FMGA 1GG6C 2PKSC 3LGUA 1EX3A 3TGIE 3V13A 1Z8RA 4X1PU 1HBTH 1PQAA 2ZTZA 1GVKB 4FUHA 1D3DB 2UUFB 1NS3A 4ABBA 2AMDA 2ZGCA 1SLWB 2ANMH 3C27B 4Q7ZA 3ATWA 1LVBA 4CR9A 2OC1A 2WUBA 3ZV9A 4B73A 1F7ZA 1D3TB 5A0AE 4AN7A 3A82A 2OUAA 3RXRA 1MZDA 4ISNA 3U9AH 1ZMJA 4GCHG 1QB6A 1TIOA 2GX4A 3BIUH 3DFJA 1RD3B 1UCYH 2AGGX 2QXGA 1FY4A 4U32A 1NRSH 1TGSZ 1QB1A 1XM1A 1BUIA 1BRBE 4ISOA 2XC4A 2CF9H 5AFZH 1GJ9B 1O37A 2HPPH 2BX3A 2FDAA 2ZDVH 3D49H 3DD2H 4GLYA 1ELEE 3HGPA 1RXPA 3LGIA 1EJMA 2Z9IA 2KAIB 4JCNA 2A7JA 2C4FH 5DP5A 1LHGH 1F0SA 1G2LA 1DUAA 1EAWA 5FX6A 1XUIA 2B9LA 3OSYA 3SW2B 1O30A 1Q31A 1BMNH 1E0FD 3E90B 2ZDLA 2AGIX 1GHWH 1LVMA 1KXBA 1FY5A 3SZNA 2FZZA 4ISHH 2STAE 2ZPSA 4ZKNU 1P3EA 1FV9A 4MNXA 1BJVA 1SFQB 1C5YB 4I33A 3RXKA 3PV4A 2GV6A 1ZHPA 3SNBA 4Y6DA 3TH2H 1JRTA 2BDIA 5EQSA 1G9IE 4Q80A 1YKTA 3BTTE 2VINA 2STBE 1NO9H 4QT8C 5CHAB 3SJOA 1ZLRA 3C1KA 3ZYEA 4BXSA 4LZ1H 1GCDA 1MTSA 1MTWA 2AIPA 1JIMA 4Y71A 1GHAF 2QAAA 3KIDU 4UDWH 3RXLA 3VGCC 5F8ZA 3HK3B 2ALVA 4AFSA 4CBNA 3RXCA 2BDHA 4JYVH 2OC0A 1V2RT 1YC0A 2O8LA 2LNCA 1DLKB 1GBDA 4FUFA 1H9HE 3SNDA 4ABJA 1O2LA 1AKSB 2RG3A 1UHBA 1PYTC 3M36A 4SGAE 1AE8H 2VWNA 4AB9A 1ZJDA 2FPZA 1ZOMA 1QA7A 1C5XB 3NZIA 4KP0A 2FOBA 4X2YA 3ZVDA 2ZDMA 1O38A 3LDXH 3UQOA 1O2JA 1O2OA 2SGDE 1AY6H 2QY0B 3GY6A 3E1XB 2Y5GA 1GBLA 1O2XA 1T8MA 4NG9H 2H1UA 2VH0A 1DM4B 1BTUA 1K1PA 1TA6A 1OWJA 3SV6A 1ABIH 4XSKU 1OWKA 4DOQA 2HNTF 3A85A 2OCVB 3T62A 4AB8A 2O9QA 4CRFA 3ZZ6A 2PUQH 2F9OA 2G81E 1TB6H 4AG1A 2ASUB 4NA9H 3UNQA 5EG4A 2H6MA 1WTGH 1MD8A 4XBDA 1TGNA 4UFGH 3QWCH 1ESBA 1H8DH 2FMJA 4NIYA 4MDSA 2ODYB 3LGYA 2Q1JA 1DANH 3GYLB 3P8OA 2O8WA 1V2TT 1IOEA 1C5OH 3A8AA 2FOGA 4E7RG 1Z6EA 5C67A 3GY7A 1P3CA 1DUEA 4RKJB 5JBAS 1O34A 2BD3A 1OOKB 4AFQA 2BOHB 2G5VA 3VXFH 1LQEA 1SGRE 1V2NT 3F9GA 1Z71A 4INHA 1KXDA 1BITA 1ELAA 3A8BA 1O2IA 3L6PA 5I25A 2OINA 1ACBE 1VJAU 1HAVB 1OP0A 1O3OA 1PJPA 1O2NA 5E0HA 4ZXXH 4CH2B 1ARCA 2BMGB 1AQ7A 3ELAH 4I8GA 1C4U2 1GJCB 3EDXB 2AMQA 3EA7A 5JBTA 3AW0A 1TBQH 2BY5X 3AASA 4RN6A 2ZG0H 2A4QA 4A6LA 1BRAA 1O5AB 2OBOA 3SOSA 3SV2H 1NC6A 2XCNA 1C2FA 1ZHMA 1O2MA 2XWAA 1Y3YA 5EPYA 1Y5AT 1DWCH 1XVOA 3SJ8A 8KME2 1GWAA 1UVOA 2A31A 1O3BA 3MU5A 3VGCB 2ZO3H 3PWCA 3VB5A 1OS8A 1QIXB 2ZFQH 1QQUA 3ZVCA 1UTNA 2PTNA 1NM6A 1HAZB 4CRCA 1O5GH 2WV4A 1N6YA 1C2HA 1O3MA 3SU2A 3W95A 1PPBH 4JMYA 1SGEE 4PROA 1C1UH 2NWNA 3TK6A 1GHAG 2FI3E 4I8LA 1HV7A 3UPEA 2H2ZA 3EQ0H 3LKWA 5DG6A 3MU1A 1O33A 1ZTLA 1C2GA 4YOGA 1VITF 1IAUA 3RLYH 5E0GA 2EA3A 1EPTA 1CGHA 2VWLA 2XXLA 1GBTA 4NGAH 1QJ7B 4YT6H 1GBIA 4FUDA 3MFJA 1C4V2 3M3TA 4AGKA 1OP2A 1PPGE 2BXUH 1C2DA 3P8FA 1EP6A 2GCHF 1GL0E 2LPRA 1BHXF 1NT1A 1V2OT 3OY6U 4BAKB 2XRCA 2ZGJA 1FNIA 5JPMH 3MO3A 1EZSC 1MZAA 2R0LA 1DSTA 2OTVA 3UNSA 4IW4E 1GHYH 3L3TA 3PM3A 3OTJE 3LGVA 4LK4A 2J94A 3B8JA 1S6FA 2HPQH 2GMTB 1OP8A 3BTHE 2SGFE 1TX6A 4AG2A 1PQ7A 1SPJA 1ZHRA 2ZDNA 1GVLA 1HFDA 1T4UH 2ZU2A 2PTCE 1ANDA 1CHOF 1HAXB 4A5TS 1KXAA 1NFYA 2TGAA 3BTGE 2GTBA 1AE5A 1G3EA 2R2WU 2RA3A 7ESTE 1XKAC 4DIHH 2I6SA 1O3LA 5FPSA 4Y0YE 2BLOA 4FU8A 2ZQ1A 2AERH 1WYKA 8ESTE 1GMHF 1O3DA 2ZHWH 2ZHQH 4O3TA 3SUEA 1NU7B 2ZDKA 2ZCHP 2H9TH 1FAKH 1W2KH 1KDQB 1YPHE 2HGTH 1NY22 3V12A 3LH1A 1AD8H 1P12E 2Y7XA 3VEQB 1SQTA 4ZAEA 1A46H 1QHRB 2JH0D 2UUKB 2OXSA 2WPKS 4LOYH 2IOTA 5A8ZA 4WY3A 5EGMA 2PGBB 5FCKA 3O8CA 1D6RA 1PPHE 2RA0A 4HI3A 3F9EA 1GCTB 4TPIZ 1TNJA 4BAOB 1RTKA 3MOCA 2QF3A 1AWHB 1Z1IA 4KGAA 1ZPCA 1LKBA 4NZQA 5CMXH 2ZFSA 2PWXA 1O3CA 1TQ7B 2ZDAH 4X1RU 3TLOA 2GCTC 5F03A 4JK6A 1ORFA 1AIXH 4Y8YA 1B0EA 5EW1H 4AZ2B 1V2UT 4ZKRU 1CU1A 1ID5H 1S85A 3QGJA 1C1PA 2A5AA 3QTVH 1OYTH 1VCQA 3E8LA 3P8GA 4ZHAA 1DSUA 1L0ZA 1O2WA 3GYMA 1FY3A 3VXEH 1BOQA 1FAXA 1T8LA 4OS7A 4X1NU 2Y80A 1K1MA 1CBWB 4HZHA 2G52A 1B7XB 1CE5A 2BB4A 1NFUA 3TH4H 1QL7A 1P2IA 1K1LA 1KXEA 5DP7A 1K1NA 4CR5A 4E06H 1AI8H 1W0ZU 4K8YA 2ZF0H 3OY5U 1HIAA 1V3XA 2G5NA 3SV8A 4MG3A 1ABJH 1LKAA 1TWXB 1BTYA 3TNSA 1NZQH 4KELA 1S0RA 2WUCA 3VB3A 2BDAA 3RDZA 3S0NA 1YCPH 3D23A 1TNLA 2FLBH 1WQVH 4H6SB 5FPTA 3UR9A 4DCDA 2QCYA 7KMEH 4FUEA 5DP8A 3IWMA 4X8VH 2ZU1A 9ESTA 2PKAB 4H42U 3SNCA 3V7TA 2THFB 3SJ9A 3GDUA 4GHTA 3O8RA 1KTTB 2Z7FE 1C1MA 3SGAE 1ZSKA 4FUJA 2TGPZ 2TGTA 2GCHG 1JRSA 4K3JA 1DITH 1AZZA 3VFEA 1NRQH 1RRKA 5EPNA 2VB0A 4DIIH 3HPTB 1H8IH 1MU8B 4YZUA 3M3VA 1SFIA 3RXGA 4NSVA 2WYGA 1P01A 2QIQA 1GBCA 2ZEBA 2PFEA 4JK5A 2NU2E 1YP9A 1TE0A 2BZ6H 1SI5H 1CGJE 2KAIA 2VWOA 1GMCF 2ULLA 5EOKA 2P3TB 3GCHC 2EI8A 1O5EH 1O2GH 3RMNH 3M7TA 3NK8A 3QN7A 4FUIA 3SHCH 1ELBA 2FS9A 4CRGA 2VNTA 1OXGA 3AVZA 1P03A 4IC6A 1TOMH 1TGCA 1CHOG 1HUTH 3TPIZ 3EA9A 4CHAC 4AGJA 1TRNA 1ZRKA 2HVXA 3Q3YA 2BXTH 1ARBA 2FS8A 5LH8A 2ZC9H 2R9PA 2W7SA 1P2MA 3KQDA 1FONA 1EAUA 3EGKH 1W7XH 1SGYE 2WPJS 2VIWA 4B76A 2JH6D 1GI3A 3GICB 3V0XA 4AYVB 3MH4A 3T25A 2AMPA 1IQIA 1J9CH 1A7SA 1GJ6A 1GMHG 3GISB 3KF2A 3TIUA 1ESAA 1XUHA 4NIXA 1KTSB 5F8TA 1YBWA 1Z8JB 1WCZA 1THRH 1DICA 2NU4E 2OBQA 3Q00A 3MU4A
chains in the Genus database with same CATH superfamily
4F4OC 1MTNC 1V2WT 1SLVB 1C1SA 2BD2A 5FBEA 3PTBA 1IQFA 1GGDC 2JJ1D 1J14A 3K2UA 4CRBA 2WPLS 4OS2A 1EFRD 5EW2H 2HALA 3A7YA 1HDTH 1W7GH 3LGTA 1UW7A 2GCTB 3F9FA 3DSPA 4O97A 1COWD 3RP2A 3FOAA 3K6ZA 3GCOA 4JZDH 4YOIA 1V2MT 3ZZ7A 1MBMA 3Q3KA 1DWBH 4RKOB 5L2YH 3P70B 4K1TA 1AKSA 3URDA 1GI7B 2FTLE 2R2MB 3A7WA 5K7RA 1T4VH 2W26A 5AF9H 2ALPA 1GBHA 2ZHEH 5HKKD 2FLRH 2WPMS 4Y8XA 2GZ9A 4ABFA 1O2TA 1A1RA 3V3MA 3SQHE 1HAYB 2FOHA 3FAOA 3A81A 2F9VA 4BOHA 5E2OA 2ANWA 1KSNA 1OHHD 2FO9A 1FIZA 1FXYA 2ODPA 4B2AA 2Y81A 1FN6A 4Z0KA 1ELVA 1E38B 1QRXA 2P93A 1D6WA 2Y6TA 1C5RA 5EODA 4ZXYH 5AHGH 1EASA 3A7VA 3KQCA 3ZZDA 2KR7A 1GHBF 1TBRH 3T2NA 4WJG2 3LC3A 3ZVGA 2J92A 2XCFA 3NKKA 2J95A 2YMSB 1JMOH 2OP9A 4WWYA 2EI7A 2YMSD 1C1NA 3DT0H 1HGTH 1C5LH 1YYY1 4THNH 2GKVE 1FPHH 3UY9A 1O2QA 5FX5A 1GBMA 2ANKH 1DDJA 4YTAA 1C1RA 1HAIH 2Y82A 1TNHA 3EA8A 2FWWA 3MH7A 1DFPA 1HJ8A 1YLCA 2ZPQA 2WPHS 1PPZA 1ZMLA 2V3OH 1F2SE 1V2VT 1YPLH 1K9OE 2DUCA 5G4BA 3EE7A 2GDEH 5DPAA 4NFFA 3Q77A 2P3UB 3GS9A 4TY7A 3UAIC 3ZZ9A 3GOVB 1QGFA 1T7CA 3SU0A 4XBCA 2BY8X 1GJDB 1O2ZA 2W6JD 3ITIA 2Z3CA 1HPGA 2C3SA 8GCHF 3OX7U 4I8KA 2A4RA 1BMFD 5GXPA 1SSXA 5E2PA 1RIWB 4MLFB 1JWTA 2XBYA 2VIPA 3GCHB 3ZZBA 4MNVA 3TJOA 1BTZA 3P8NA 2CN0H 4MNWA 1YM0A 1ZPZA 3U8RH 2H9HA 3FFGA 4WXVA 1L1JA 2Q6GA 3SNEA 4DURA 5T6DA 4CHAB 1AWFH 1GJ8B 1LCYA 3MH5A 3SGBE 1BTHH 1BQYA 3ZIAD 2P8OC 1GMCG 3UFAA 1ELFA 5FHTA 5HIZA 4ASUD 3ATLA 3PLBA 5CDFE 4NCYA 4BNRA 1BB0B 1CT0E 5AFYH 2QF0A 2QXHA 1QA0A 2K1QA 3STJA 4JZEH 2ZECA 3KN2A 3M35A 3RXFA 2XWBI 3FP6E 3LIWA 1VITH 4LXBH 1NBMD 1O3FA 1MTNB 4UFFH 1SL3A 2ILNA 1GGDB 4UFEH 3PMHB 1O5CB 5T3HA 2IPHA 1D9IA 2C8WB 2Q6FA 1MD7A 2GP9B 1TPSA 3M7QA 3RXJA 4A1XA 1BCUH 2CF8H 1YLDA 1G3BA 2ZIQH 4ASHA 5TJXA 3PV5A 4UONA 3A87A 2BLQA 1HB0B 1ESTA 3LPRA 2PLXA 3BEIB 3S9CA 1X7AC 1SOZA 1WU1A 4K8BA 4NZLA 1TNIA 1GJBB 3PMJA 5LPRA 3ZZ3A 2ZGBH 1G32B 1LMWB 1QFKH 1O39A 1V2LT 5H4IB 1PPEE 2FYRA 2VU8E 3TK9A 4FETA 4HFPB 1FZZA 1O36A 1P0SH 2P95A 4DJZB 1Y5UT 1O5FH 5PTPA 2GMTC 1OWEA 5IK2D 3N99A 4X8UH 1BZXE 1O3JA 1SGTA 2FOMB 2RCEA 2PR3A 4AX9H 3NWUA 1Y3WA 6LPRA 5C17A 4MPXA 3RXOA 5JBCS 4MTBA 3TGKE 3CS0A 1BMMH 1XUGA 1O2SA 1W13U 2H5DA 3O8BA 1ZGIA 5DP6A 1QY6A 1SC8U 1EZXC 4ZHLU 1IQKA 1IHTH 4ZUHA 5HYOA 1UK2A 2GZ8A 1FI8A 2B0FA 1E79D 1A3BH 1NRPH 4DVAU 3RU4E 4FVBA 2ZGHA 3F6UH 1GHBG 1GI4A 4ISIH 1E35B 3RC6A 1HYLA 4NSYA 1IHSH 2VH6A 4YLUA 3UOUA 1SGNE 1G36A 1GBEA 2J98B 2KZ4A 1N1LA 3SBKA 3GY8A 2ZKSA 2GV7A 1W0JD 4INKA 3QZQA 4XE4A 1GCTC 4BXWA 1O2PA 2CV3A 3BF6H 2BD7A 2CGAA 4NWLA 3BTWE 6GCHF 5A0CA 1K1JA 1QR3E 1LVOA 1UTMA 1QTFA 1KIGH 4OGYA 1QBVH 1UTJA 2QXJA 5K0HA 4BANB 1S6HA 1W0YH 1HAPH 1BTWA 8GCHG 1F0RA 1BA8B 1BMLA 4ABIA 1MBQA 4YLQH 1C5UA 5C20A 1O3GA 2SFAA 2P8OB 2AFQB 5ETXA 2GGVB 1V2KT 5EIYA 2PW8H 1UVSH 1YCPK 1SGPE 4KKDA 2Z94A 1O5BB 4XFQA 2YOLA 2G4UA 1WBGB 2ODQA 1H4WA 2R3UA 1EZUC 1SGCA 1MH0A 1C2JA 3S7HB 1MAYA 1ETTH 1QJ1B 2A5IA 5EQRA 3RM2H 1UHBB 1BRCE 3BEFB 1MTUA 1D4PB 2V35A 3ZZCA 2AS9A 3RXQA 1M9UA 1O2RA 1CBWC 3FZDA 1GI1A 2VIDA 2J2UA 2CHAC 4UE7H 2BY6X 4IN2A 3MNBA 1MTVA 3BSQA 4A1VA 3EE0B 2BQ6B 1UO6A 4RT1A 1TNKA 1TA2A 3UIRA 1Z1JA 1LHDH 1DOJA 3QGNB 2G55A 1F0TA 3QLPH 1P04A 3A88A 1UTLM 4YOJA 1LPZB 4XDEA 1F5LA 1TMBH 1SLUB 1A0JA 2ESTE 5BRRE 2NU3E 2FI4E 4WH6A 4OS6A 5KEDA 4KTUA 2HLDD 1C9PA 2IN2A 2HLCA 1DT2A 4M9FA 4WMEA 2R0KA 2Z9JA 1TAWA 1Z8GA 1J17T 1KLIH 3LC5A 3M5LA 5DP9A 1BTXA 1Y3UA 1AVXA 1QNJA 1TABE 2O8MA 4X1SU 4R8TB 2FX6A 4CREA 4I31A 1W0KD 1D3PB 2OQUA 1NROH 2PSYA 4A7IB 1O2HA 2BOKA 3TJUA 4YT7H 3SI3H 3SORA 4K1SA 3GCNA 3IG6B 4FVDA 2G8TA 1NPMA 1QRWA 2F91A 3PRDA 2ZZUH 1OKXA 2PKAA 1AB9B 1CA0B 4BAQB 3E0NB 2QYIA 4X8TH 1SLXB 5HIYA 1ZSLA 1IQJA 2BYAX 2WSSD 3LOXA 4LZ4B 3MTYA 1H8ED 1EJAA 1W11U 2TRMA 1Z6JH 1HAOH 1OYQA 1HJ9A 2OC7A 2QGRA 2Z9LA 3ODFA 1YPEH 2O8UA 4H6TA 1DWDH 2A2QH 1SG8B 1A0LA 1J8AA 1EKBB 2NU1E 1PPCE 1UTKA 1OWIA 1CGIE 2F9PA 4FUCA 1PFXC 2A1DB 3P17H 1DPOA 1FPCH 4AFZA 4P02A 4H4FA 1SKYE 2C8ZB 2OLGA 1RFNA 4X8SH 4K5ZA 1EOJA 1P57B 1C2MA 5FCRA 3P6ZB 2PUXB 2G51A 3ODDA 1GJ5H 2W7UA 3U1IB 1ZPBA 1F5RA 1GDQA 2TIOA 4IN1A 2XTTB 4FU9A 4MPVA 3OAAD 4HTCH 3GY4A 2FI5E 4ZKOU 1W14U 5DP4A 4J2YB 1P09A 5JB8S 1UCYK 6GCHG 4X6OA 5L2ZH 4Y8ZA 3CS7A 4JYTA 1GBBA 1FUJA 3NCLA 5LPEA 3OTPA 4MQAA 3RXUA 1TLDA 2A2XH 2A4OA 4ZHMU 5EXNA 1GJAB 3M5MA 1ETRH 3ENSB 4UEHH 1L2EA 2ZHFH 4X6PA 3ATIA 3QTOH 3KEEA 1SR5C 2BY7X 3HKIB 1ELDE 3BEUA 4GPGA 3SO3A 4JZFH 1XX9A 3OYPA 4AYYB 8LPRA 4Q2KA 3BN9A 2VVVA 4DW2U 1BBRH 2WINI 2CHAB 3BTFE 1SGIB 1UK4A 4I86A 2M2AA 1H9LB 4MNYA 1L4DA 4MPWA 2BX4A 1MUEB 1N8OC 1LVYA 2EC9H 3PO1C 3MNSA 3CENA 5GWZA 1AFQC 5A09A 3EAJA 1YPKH 1WV7H 1GHXH 3RXMA 1IQHA 1TX7A 1C5QA 1GI9B 1E1QD 1TMUH 1DY8A 2YMSC 3S9AA 1FY1A 5FAHA 4YESB 3RXTA 1E34B 3AAUA 3NXPA 2F9NA 1VGCC 2FP7B 1O2YA 1N6XA 1T8OA 2UWLA 1KXFA 4RSPA 5C5OA 2FOAA 2VVUA 1ZR0A 1XUKA 5JYIA 3KQBA 4SGBE 3RXSA 3VB7A 1LPKB 2RDLA 2V0BA 4XOJA 3D62A 4Y0ZE 3ZYDA 1GDNA 4ESTE 1QRZA 4ABEA 4I8JA 3T28A 4D8NA 4DG4A 3RC5A 3RM0H 4NA8A 3UOPA 1THSH 1ZTKA 2PSXA 2ZFFH 2XBWA 1RIWC 1AU8A 1CSOE 1CHGA 4Q63A 5B6LA 3RC4A 3SUDA 3F1SB 4HGCA 3KGPA 1BIOA 2FEQH 2HRVA 4I7YH 5JBBS 3NUMA 2BD8A 4J1YA 2ZCKP 4BAMB 1C5NH 4IC5A 1MU6B 3PMAB 4X6MA 1WTHD 3AW1A 3MYWA 3EYDA 3HK6B 1UK3A 1MKWH 2FYQA 4A92A 2UUJB 3TVJB 1SBWA 1NRNH 1O3KA 2D2DA 1P9SA 2AGEX 3S69A 1NN6A 1HCGA 1O32A 4KTCA 3TK5A 1L1NA 2V3MA 2XYAA 5EXLA 3F2HA 4Z6AH 1QJ6B 3FO8D 1IQGA 1O5DH 3MNCA 4U01A 2YNAA 5DP3A 4TYDA 5DKMA 1UVUH 1C5TA 3LJOA 3A7ZA 1TGTA 5HM2A 1YWUA 4B6FA 1MQ5A 1GL1A 5LPFA 2LP6A 1FN8A 1XXFA 4NWKA 3RXDA 9LPRA 1FY8E 1PQ8A 3FN8A 1QBNA 1C9TA 1OX1A 1P2KA 4CRAA 1OWDA 4ABGA 4D9RA 5IDKA 3ZV8A 1YPGH 3F0PA 1ANBA 3A86A 1DVAH 1RTLA 3FP8E 4NIWA 4D7FA 1S84A 1NU9A 4X2XA 1Y59T 4RT0A 5DGJA 2UWPA 1CQQA 4TY6A 1ZTJA 2BLVA 3DUXH 5A0BA 1FJSA 4OS5A 1INCA 2VGCB 1WDIA 4OS4A 1O3NA 1G37A 3BV9B 2EEKA 3M5OA 5E0JA 2P3FH 1PPFE 1RTFB 3OEHD 3GDVA 3I77A 1GHZA 3PRBA 1DX5M 2FESH 2SGPE 1SGDE 1TYNA 1A5HA 1ZYOA 3WY8A 3BTDE 1DXPA 4BTUB 2P59A 1N8OB 1NTPA 2BVXH 2Y5HA 3PO1B 1HIAB 4X0WU 4ZCNA 1G3DA 1J15A 1UTQA 2WYJA 1AFQB 3LJJA 5EJLA 3KCGH 5F8XA 1C2IA 1GVZA 3ZVBA 1GBFA 1LO6A 3I29A 4F55A 2WZQA 2Y5FA 4TWYA 1NRRH 3GY2A 1CVWH 1ZRBA 2TGDA 1SMFE 2NU0E 1VGCB 1UCYE 2D1JA 4KTSA 5CE1A 2J38A 1A4WH 1KYNA 1TPOA 2JDID 2ZCLP 1T31A 2OK5A 3SJIA 2HVYB 1GI8B 4OS1A 5F53A 2J34A 3A7XA 3BG4B 2VVCA 5JDUB 4U2WA 1H9IE 2BTCE 5EU8A 1IQMA 2QC2A 3TJNA 3MO6A 2AYWA 3R3GB 2JETB 3SQEE 5C1UA 1P9UA 1K1IA 2L6OA 3FKSD 2AHME 5J4SA 2XNDD 1IQLA 2TBSA 4WXIA 4ZKSU 2W5EA 1S0QA 1KY9A 4ABDA 3KQ5A 1K28D 5EXMA 4F49A 2QV1A 2EQNA 2F9UA 4Y11E 3LGWA 1O35A 1G30B 3ZVAA 2XC5A 1EUFA 5E8EH 5F6MA 3M61U 3SUGA 3WWBA 2CJIA 2BQWB 1ZGVA 1P2OA 2J98A 1G2MA 1BDAA 1MCTA 1P2JA 3GY3A 1A61H 3BTKE 4XD7D 2F9BH 1IQNA 2A4GA 1HAVA 1LPGB 4WVPE 3SV7A 2HNTC 1J16A 2KX4A 2C93B 3RXVA 2ZQ2A 4WMDA 4Y10E 1ZZZA 3UUZA 2Z9GA 1BTPA 2VIQA 1IQEA 1C1VH 1TX8A 2ZA5A 3TJVA 5T6FA 3ATMA 2H9EH 1V2ST 1HXEH 3E6PH 3DFLA 4GAWA 2XNIA 2F4LA 1TOCB 2XC0A 2BVRH 3N7OA 4IMZA 1EJNA 3PWBA 1L4ZA 3LH3A 3QZRA 1F92A 1P05A 3BTQE 2XBVA 4AORA 1Q2WA 1O3IA 2V7QD 5DK1A 5FPYA 1W12U 2GZ7A 1WAYB 3TGJE 1QBOA 3A80A 5ESTE 2ZGXH 1TALA 2I6QA 2ZWLH 3GCTF 2FOEA 3GY5A 1GDUA 3SV9A 1JIRA 2GD4B 1QURH 1HXFH 7LPRA 1KXCA 1VJ9U 3M5NA 1HAHH 2AIQA 2ZU3A 4VGCC 3IITA 1QQ4A 3UWIA 1ZMNA 3RXPA 2Z3DA 3PLKA 3SJKA 5HXFA 4NFEA 1P11E 1A5IA 1ANCA 3HKJB 1O31A 5GCHF 4ZH8A 3UTUH 5B6OA 3ZZ5A 1LHEH 2BHGA 4B75A 3E16B 3H5CB 4B2CA 1A3EH 2F43B 2FODA 3K65B 4X2WA 5GJ4B 4JZIA 3QUMP 1GG6B 2PKSB 4YM9A 3M3SA 3MU8A 2AEIH 2C8XB 3L33A 1O2VA 2A7CA 1JXPA 3Q76A 3N7DA 1Q3XA 1ELGA 3U8OH 5I46H 1P02A 1TMTH 5A2MH 1AB9C 1CA0C 3OU0A 5JB9S 1S83A 1HLTH 5J4QA 3HGNA 3UREA 3G01A 4CRDA 1YLNA 1WOFA 2PGQB 3OE7D 5A8YA 1FX0B 1GPZA 4ZROA 2Z3EA 3KYFA 5A8XA 1TPPA 3LONA 3AAVA 1EB1H 1HNEE 3VPKA 1FLEE 4MVNA 5DJ7A 2QA9E 1UTOA 3H7TA 1LTOA 2ZI2H 5HGGA 4K69A 1QL9A 4Y79A 1S5SA 4BTTB 3P95A 2JKHA 1MKXH 1VCPA 2A7HA 3SU5A 4AC9A 7GCHF 2BZAA 1S82A 4OGXA 2GT8A 1FDPA 2SNVA 2VIOA 5C1YA 1TGBA 3SU1A 1DXWA 1BBRK 4INLA 1F5KU 3CP7A 2GVFA 4MPUA 5EQQA 3BIVH 5C1XA 1LDTT 2P16A 2XW9A 1KDQA 2EY4C 3QK1A 1EAIA 3URCA 1HRTH 1MCVA 1BT7A 1TPAE 3A8CA 4ZMAH 3STIA 1YPJH 3PLPA 3Q3XA 3RXEA 3T29A 1A5GH 1GHVH 4X2VA 1SB1H 4FOUC 1LHCH 2HOBA 1GBKA 1TFXA 2UUYA 1BJUA 2D26C 3UNRA 2UWOA 5DN6D 2OC8A 2J4IA 2B5TB 2VBCA 5HMAA 1WUNH 1SHHB 5LGOA 2C90B 2ANYA 3E0PB 2ZP0H 1F0UA 3B9FH 2DE8A 2D8WA 1EB2A 1NESE 2A0QB 1SGFA 1C1WH 1EXFA 1CT4E 1P06A 1CO7E 2F83A 2M5TA 1TBZH 1GI2A 3NPSA 1C1OA 2Q6DA 3A83A 4UFDH 5C2ZA 1Z7KA 3ZZ8A 2VJ1A 1V2JT 1MAXA 1EQ9A 1EPTC 1OPHB 1GBJA 3ZVEA 4FUGA 5BPEA 3SU3A 2KCOA 2ZFRH 3MO9A 1QL8A 2ZU5A 2B8OH 1T8NA 2V6NA 4VGCB 6CHAC 2A5KA 4TWWA 2WV5A 1SGQE 1V2PT 2Z9KA 1K22H 1PYTD 1TRMA 2JH5D 3MWIU 3DHKH 1C1TA 2ZFTA 5DO4H 5GPIB 3GCTG 3M37A 4I8HA 1MKWK 4A1TA 1XKBC 4JYUH 2BDGA 2ZPRA 3RLWH 3F0OA 4BAHB 2ZFPH 1O3AA 1XUFA 1C2LA 2IPQX 3SU6A 4M7GA 3KNXA 1MMJN 2V3HH 3MNXA 3S9BA 5HM9A 5TCCA 3KHVA 4ISLA 3SI4H 4GHQA 1DWEH 1RJXB 2ZTXA 3RMMH 3T27A 6ESTA 3R0FA 1DY9A 3JZ2B 5GCHG 3FP7E 1BMAA 1Z8IB 1UVTH 1ZSJA 2C8YB 3ZZ4A 4NIVA 1P10A 3P92A 2QN5T 5DSFA 1GI6A 1TQ0B 2ZNKH 4XBBA 1EAXA 4CH8B 2PV9B 1TONA 4K60A 2FX4A 4GUXA 1SVPA 3RMOH 1C2KA 4TPYA 1C5PA 3MI4A 5L30H 2VIVA 1XVMA 4X6NA 1EZQA 1UMAH 4P00A 1YPMH 1AUTC 2IJD1 2ZHDA 1AGJA 2JJ2D 3T5FH 5L6NH 3U1JB 4AOQA 1W8BH 1PQ5A 2F3CE 1HJAC 3ESTA 3TU7H 4Q4LA 1O2KA 4WMFA 1DE7H 1DS2E 3ATKA 1EOLA 4ABAA 1O2UA 3GDSA 1GMDF 2SGQE 3K9XB 1QB9A 1AO5A 4JZ1A 5FBIA 1AZ8A 4Q7YA 1OWHA 3DA9B 2K8IA 4K2YA 5IYTA 4UD9H 1B5GH 3PB1E 5C3NA 1C5VA 1AVGH 1DLEA 3H7OA 4WH8A 2BDCA 2DE9A 3ZZAA 1JOUB 1UVPA 5TCAA 3O8DA 3FVFB 4R0IA 1Y3VA 3SNAA 7GCHG 2BDYA 2FIRH 2P94A 1BHXB 4Y76A 3LU9B 1KLJH 1O3HA 2SGEE 1GBAA 3HATH 5T6GA 1VR1H 3E3TA 3MHWU 4B74A 4E7NA 5EJ1A 1AMHA 3ZVFA 2A32A 3MMGA 2W3KA 3LT3A 1AFEH 1CA8B 2G00A 1AUJA 4CBOA 1C5MD 3MU0A 1ETSH 3A8DA 2PP6A 2VGCC 3U8TH 1VCWA 3A89A 2CK3D 2GDDA 3PMBB 5GDSH 1K2I1 3UWJH 4WF8A 3TNTA 4RI0A 3E91A 5CHBA 2TPIZ 5C5NA 4D76A 2OQ5A 3RXAA 1T32A 1C1QA 4D9QA 1C4Y2 1NFXA 4IGDA 2WPIS 4GVUA 2FTMA 1FIWA 3QDZB 1NFWA 4O3UA 1BBRE 3M7UA 1QCPA 2Y7ZA 1SQAA 4K1EA 1EPTB 1O0DH 2SNWA 1ANEA 2QXIA 3SYJA 1NBME 4GSOA 5ESBA 3PTNA 4DT7B 1W3CA 1AVWA 4GCHF 2AH4X 1WQSA 1C5SA 2R3YA 3RU4T 6CHAB 2QE7D 2ZU4A 4Y7AA 1U6QA 4O9VA 2J9NA 3A7TA 3KL6A 1ZJKA 2Z6BD 3SGQE 3U69H 3WWFA 2FOCA 3BG8A 3NRLA 2IJOB 2A45B 1RGQA 1UJ1A 1LQDB 4IBLH 1EATA 2FXRA 1CT2E 1YCPM 2YNBA 4B71A 1A0HB 2CXVA 1SQOA 1S81A 3MH6A 3BG4C 3RU4D 2BDBA 2J5UA 1OSSA 3F9HA 3S7KB 1Y3XA 3U98H 3F2GA 1YPHC 4TSFD 1V2QT 2GT7A 1EP5A 3K6YA 1XUJA 4B2BA 2FM2A 4IMQA 1VITG 2JETC 2VWMA 3RMLH 3A84A 3VB4A 2CMYA 1LHFH 1K1OA 1ELTA 3SN8A 1YF4A 1UTPA 3W94A 1G3CA 1H1BA 3FANA 2BM2A 1P2QA 1SHYA 2W3IA 1HAGE 4B1TA 1L1GA 3UR6A 5C0UA 1VZQH 3JZ1B 1JBUH 2BD5A 2XBXA 3VB6A 2B7DH 3QX5H 1SGFG 4FU7A 3RUOA 2K0QA 4HG6A 1TRYA 1E37B 3RXHA 1ELCA 4U30A 3D65E 4X1QU 4Q7XA 1WSSH 1BRUP 2BQ7B 3TH3H 3N7EA 1MQ6A 1AHTH 2O8TA 3SU4A 1FQ3A 1HJAB 2BY9X 1AN1E 4XRNA 2BVSH 1SOTA 4FUBA 5GIBA 4YO9A 2BLWA 3DSGA 2BD9A 3PYHA 4D7GA 1E36B 1K21H 4Y7BA 1GJ7B 5ABWA 1B0FA 3BTEE 5CHAC 3RXBA 4BTIB 4NA7A 2OD3B 1D3QB 1TNGA 4O03A 1Y5BT 1Y8TA 3QO6A 4ABHA 1W10U 1GMDG 1A2CH 2SGAA 4AFUA 1C5WB 3SHAH 2BD4A 1O3PB 1C5ZB 3KQEA 3FZZA 3F68H 3T26A 1P8VC 3UQVA 4ACAA 1P2NA 4E05H 3TITA 2L74A 4IS5A 1C2EA 1GI5A 2ZTYA 1GJ4H 1XMNB 1SQRA 3BTME 3RXIA 2G4TA 1O3EA 1V6DA 3SUFA 1THPB 5FXLA 3B23B 3I78A 1GI0A 2HNTE 4DGJA 3PROA 2EI6A 5SGAE 4DY7B 4I32A 1XXDA 5AVDA 2H5CA 2FOFA 2HWLB 4FXGH 1YGCH 1MKXK 2PHBA 1KLTA 1RS0A 1FMGA 1GG6C 2PKSC 3LGUA 1EX3A 3TGIE 3V13A 1Z8RA 4X1PU 1HBTH 1PQAA 2ZTZA 1GVKB 4FUHA 1D3DB 2UUFB 2KM0A 1NS3A 4ABBA 2AMDA 2ZGCA 1SLWB 2ANMH 3C27B 4Q7ZA 3ATWA 4Z1MD 1LVBA 2RDEA 4CR9A 2OC1A 2WUBA 3ZV9A 4B73A 1F7ZA 1D3TB 3VG8A 5A0AE 4AN7A 3A82A 2OUAA 3RXRA 1MZDA 4ISNA 3F3BA 1ZMJA 3U9AH 4GCHG 1QB6A 1TIOA 2GX4A 3H09A 3BIUH 3DFJA 1RD3B 1UCYH 2AGGX 2QXGA 1FY4A 4U32A 1NRSH 1TGSZ 1QB1A 1XM1A 1BUIA 1BRBE 4ISOA 2XC4A 2CF9H 5AFZH 1GJ9B 1O37A 2HPPH 2BX3A 2FDAA 2ZDVH 3D49H 3DD2H 4GLYA 1ELEE 3HGPA 1RXPA 3LGIA 1EJMA 2Z9IA 2KAIB 4JCNA 2A7JA 5FL7D 2C4FH 5DP5A 1LHGH 1F0SA 1G2LA 1DUAA 1EAWA 5FX6A 1XUIA 2B9LA 3OSYA 3SW2B 1O30A 1Q31A 1BMNH 1E0FD 3E90B 2ZDLA 2AGIX 1GHWH 1LVMA 1KXBA 1FY5A 3SZNA 2FZZA 4TT3D 4ISHH 2STAE 2ZPSA 4ZKNU 1P3EA 1FV9A 4MNXA 1BJVA 1SFQB 1C5YB 4I33A 3RXKA 3PV4A 2GV6A 1ZHPA 3SNBA 4Y6DA 3TH2H 1JRTA 2BDIA 5EQSA 1G9IE 4Q80A 1YKTA 3BTTE 2VINA 2STBE 1NO9H 4QT8C 3UB0A 5CHAB 3SJOA 1ZLRA 3C1KA 3ZYEA 4BXSA 4LZ1H 1GCDA 1MTSA 1MTWA 2AIPA 1JIMA 4Y71A 1GHAF 2QAAA 3KIDU 4UDWH 3RXLA 3VGCC 5F8ZA 3HK3B 2ALVA 4AFSA 4CBNA 3RXCA 2BDHA 4JYVH 2OC0A 1V2RT 1YC0A 2O8LA 2GJGA 2LNCA 1DLKB 1GBDA 4FUFA 1H9HE 3SNDA 4ABJA 1O2LA 1AKSB 2RG3A 1UHBA 1PYTC 3M36A 4SGAE 1AE8H 2VWNA 4AB9A 1ZJDA 2FPZA 1ZOMA 1QA7A 1C5XB 3NZIA 4KP0A 2FOBA 5C0TA 4X2YA 3ZVDA 2ZDMA 1O38A 3LDXH 3UQOA 1O2JA 1O2OA 2SGDE 1AY6H 2QY0B 3GY6A 3E1XB 2Y5GA 1GBLA 1O2XA 1T8MA 4NG9H 2WV9A 2H1UA 2VH0A 1DM4B 1BTUA 1K1PA 1TA6A 1OWJA 3SV6A 1ABIH 4XSKU 1OWKA 4DOQA 2HNTF 3A85A 2OCVB 2JIZD 3T62A 4AB8A 2O9QA 4CRFA 3ZZ6A 4YXWD 2PUQH 2F9OA 2G81E 1TB6H 4AG1A 2ASUB 4NA9H 3UNQA 5EG4A 2H6MA 1WTGH 1MD8A 4XBDA 1TGNA 4UFGH 3QWCH 1ESBA 1H8DH 2FMJA 4NIYA 4MDSA 2ODYB 2W6ID 3LGYA 2Q1JA 1DANH 3GYLB 3P8OA 2O8WA 1V2TT 1IOEA 1C5OH 3A8AA 2FOGA 4E7RG 1Z6EA 5C67A 3GY7A 1P3CA 2WPDD 2RFKC 1DUEA 4RKJB 5JBAS 1O34A 2BD3A 1OOKB 4AFQA 2BOHB 2G5VA 3VXFH 1LQEA 1SGRE 1V2NT 3F9GA 1Z71A 4INHA 1KXDA 1BITA 1ELAA 3A8BA 4B6EA 1O2IA 3L6PA 2J97A 5I25A 2OINA 1ACBE 1VJAU 3U28C 1HAVB 1OP0A 1O3OA 1E1RD 1PJPA 1O2NA 5E0HA 4ZXXH 4CH2B 1ARCA 2BMGB 1AQ7A 3ELAH 4I8GA 1C4U2 1GJCB 3EDXB 2AMQA 3EA7A 5EJZA 3AW0A 5JBTA 1TBQH 2BY5X 3AASA 4RN6A 2ZG0H 2A4QA 4A6LA 1BRAA 1O5AB 3SZEA 2OBOA 3SOSA 3SV2H 3KYGA 1NC6A 2XCNA 1C2FA 1ZHMA 1O2MA 2XWAA 1Y3YA 5EPYA 1Y5AT 1DWCH 1H8HD 1XVOA 3SJ8A 8KME2 1GWAA 1UVOA 2A31A 1O3BA 3MU5A 3VGCB 5KECA 2ZO3H 3PWCA 3VB5A 1OS8A 1QIXB 2ZFQH 1QQUA 3ZVCA 1UTNA 2PTNA 1NM6A 1HAZB 4CRCA 1O5GH 2WV4A 1N6YA 1C2HA 1O3MA 2WHXA 3SU2A 3W95A 1PPBH 4JMYA 1SGEE 4PROA 1C1UH 2NWNA 3TK6A 1GHAG 2FI3E 4I8LA 1HV7A 3UPEA 2H2ZA 3EQ0H 3LKWA 5DG6A 3MU1A 1O33A 3AK5A 1ZTLA 1C2GA 4YOGA 1VITF 1IAUA 3DSOA 3RLYH 5E0GA 2EA3A 1EPTA 1CGHA 2VWLA 2XXLA 1KMHB 5C94A 1GBTA 4NGAH 1QJ7B 2KCPA 4YT6H 1GBIA 4FUDA 3MFJA 1C4V2 3M3TA 4AGKA 1OP2A 1PPGE 2BXUH 1C2DA 3P8FA 1EP6A 2GCHF 1GL0E 2LPRA 1BHXF 1NT1A 1S6LA 1V2OT 3OY6U 4BAKB 2XRCA 2ZGJA 1WXRA 1FNIA 5JPMH 3MO3A 1EZSC 1MZAA 2R0LA 1DSTA 2OTVA 3UNSA 4IW4E 1GHYH 3L3TA 3PM3A 3OTJE 3LGVA 4LK4A 2J94A 3B8JA 1S6FA 2HPQH 2GMTB 2QF4A 1OP8A 3BTHE 2SGFE 1TX6A 4AG2A 1PQ7A 1SPJA 1ZHRA 2ZDNA 1GVLA 1HFDA 1T4UH 2ZU2A 2PTCE 4ACBA 1ANDA 1CHOF 1HAXB 4A5TS 1KXAA 1NFYA 2TGAA 3BTGE 2GTBA 1AE5A 1G3EA 2R2WU 2RA3A 7ESTE 1XKAC 4DIHH 2I6SA 1O3LA 5FPSA 2QF5A 4Y0YE 2BLOA 4FU8A 2ZQ1A 2AERH 1WYKA 8ESTE 1GMHF 1O3DA 2ZHWH 2ZHQH 4O3TA 3SUEA 1NU7B 2KCYA 2ZDKA 2ZCHP 2H9TH 1QZ8A 1FAKH 1W2KH 1KDQB 1YPHE 2HGTH 1NY22 3V12A 1VKYA 3LH1A 1AD8H 1P12E 2Y7XA 3VEQB 1SQTA 4ZAEA 1A46H 1QHRB 2JH0D 2UUKB 2OXSA 2WPKS 4LOYH 2IOTA 5A8ZA 4WY3A 5EGMA 2PGBB 5FCKA 3O8CA 1K0HA 1D6RA 1PPHE 2RA0A 4HI3A 3F9EA 1GCTB 4TPIZ 1TNJA 4BAOB 1RTKA 3MOCA 2QF3A 1AWHB 1Z1IA 5T1VA 4KGAA 1ZPCA 1LKBA 4NZQA 5CMXH 2ZFSA 2PWXA 1O3CA 1TQ7B 2ZDAH 4X1RU 3TLOA 2GCTC 5F03A 4JK6A 1ORFA 1AIXH 4Y8YA 1B0EA 3OEED 5EW1H 4AZ2B 1V2UT 4ZKRU 1CU1A 1ID5H 1S85A 3QGJA 1C1PA 2A5AA 3QTVH 1OYTH 1VCQA 3E8LA 1YY3A 3P8GA 4ZHAA 3MQKC 1DSUA 1L0ZA 1O2WA 3GYMA 1FY3A 3VXEH 1BOQA 1FAXA 1T8LA 4OS7A 4X1NU 5GNDA 2Y80A 1K1MA 1CBWB 4HZHA 2G52A 1B7XB 1CE5A 2BB4A 1NFUA 3TH4H 1QL7A 1MABB 1P2IA 1K1LA 1KXEA 5DP7A 1K1NA 4CR5A 4E06H 1AI8H 1W0ZU 4OM9A 4K8YA 4DT4A 2ZF0H 3OY5U 1HIAA 1V3XA 2G5NA 3SV8A 4MG3A 1ABJH 5KGOA 1LKAA 1TWXB 1BTYA 3TNSA 1NZQH 4KELA 1S0RA 2WUCA 2LELA 3VB3A 2BDAA 3RDZA 3S0NA 1YCPH 3D23A 1TNLA 2FLBH 1WQVH 4H6SB 5FPTA 3UR9A 4DCDA 2QCYA 7KMEH 4FUEA 5DP8A 3IWMA 4X8VH 3WW7A 3W1EA 3DCLA 2ZU1A 9ESTA 2KFWA 2PKAB 4H42U 3SNCA 3V7TA 2THFB 3SJ9A 3GDUA 4GHTA 3O8RA 1KTTB 2Z7FE 1C1MA 3SGAE 1ZSKA 4FUJA 2TGPZ 2TGTA 2GCHG 1JRSA 4K3JA 1DITH 1AZZA 3VFEA 1NRQH 1RRKA 5EPNA 2VB0A 4DIIH 3HPTB 1H8IH 1MU8B 4YZUA 3M3VA 1SFIA 3RXGA 4NSVA 2WYGA 1P01A 2QIQA 1GBCA 2ZEBA 2PFEA 4JK5A 2NU2E 1YP9A 1TE0A 2BZ6H 1SI5H 1CGJE 2KAIA 2VWOA 1GMCF 2ULLA 5EOKA 2P3TB 3GCHC 2EI8A 1O5EH 1O2GH 3RMNH 3M7TA 3NK8A 3QN7A 4FUIA 3SHCH 1ELBA 2FS9A 4CRGA 3OFND 2VNTA 1OXGA 3AVZA 3PV2A 1P03A 4IC6A 1TOMH 1TGCA 1CHOG 1HUTH 3TPIZ 3EA9A 4CHAC 4AGJA 1TRNA 1ZRKA 2HVXA 3Q3YA 2BXTH 1ARBA 2FS8A 5LH8A 2ZC9H 2R9PA 2W7SA 1P2MA 3KQDA 1FONA 1EAUA 3EGKH 1W7XH 3F2FA 1SGYE 2WPJS 2VIWA 2KCAA 4B76A 2JH6D 1GI3A 3GICB 3V0XA 4AYVB 3MH4A 3T25A 2AMPA 1IQIA 4F48B 1J9CH 1A7SA 1GJ6A 1GMHG 2XOKD 3GISB 3KF2A 3TIUA 1ESAA 1XUHA 4NIXA 1KTSB 5F8TA 3CNRA 1YBWA 1Z8JB 1WCZA 1THRH 1DICA 2NU4E 2OBQA 3Q00A 3MU4A
chains in the Genus database with same CATH topology
4F4OC 1MTNC 1V2WT 1SLVB 1C1SA 2BD2A 5FBEA 3PTBA 1IQFA 1GGDC 1J14A 3K2UA 4CRBA 2WPLS 4OS2A 5EW2H 2HALA 3A7YA 1HDTH 1W7GH 3LGTA 2GCTB 3F9FA 4O97A 3RP2A 3K6ZA 3GCOA 4JZDH 4YOIA 1V2MT 3ZZ7A 1MBMA 3Q3KA 1DWBH 4RKOB 5L2YH 3P70B 4K1TA 1AKSA 3URDA 1GI7B 2FTLE 2R2MB 3A7WA 5K7RA 1T4VH 2W26A 5AF9H 2ALPA 1GBHA 2ZHEH 2FLRH 2WPMS 4Y8XA 2GZ9A 4ABFA 1O2TA 1A1RA 3V3MA 3SQHE 1HAYB 2FOHA 3FAOA 3A81A 2F9VA 4BOHA 5E2OA 2ANWA 1KSNA 2FO9A 1FIZA 1FXYA 2ODPA 4B2AA 2Y81A 1FN6A 4Z0KA 1ELVA 1E38B 1QRXA 2P93A 1D6WA 2Y6TA 1C5RA 5EODA 4ZXYH 5AHGH 1EASA 3A7VA 3KQCA 3ZZDA 1GHBF 1TBRH 3T2NA 4WJG2 3LC3A 3ZVGA 2J92A 2XCFA 3NKKA 2J95A 1JMOH 2OP9A 4WWYA 2EI7A 1C1NA 3DT0H 1HGTH 1C5LH 1YYY1 4THNH 2GKVE 1FPHH 3UY9A 1O2QA 5FX5A 1GBMA 2ANKH 1DDJA 4YTAA 1C1RA 1HAIH 2Y82A 1TNHA 3EA8A 2FWWA 3MH7A 1DFPA 1HJ8A 1YLCA 2ZPQA 2WPHS 1PPZA 1ZMLA 2V3OH 1F2SE 1V2VT 1YPLH 1K9OE 2DUCA 5G4BA 2GDEH 5DPAA 4NFFA 3Q77A 2P3UB 4TY7A 3ZZ9A 3GOVB 1QGFA 1T7CA 3SU0A 4XBCA 2BY8X 1GJDB 1O2ZA 3ITIA 2Z3CA 1HPGA 2C3SA 8GCHF 3OX7U 4I8KA 2A4RA 5GXPA 1SSXA 5E2PA 1RIWB 4MLFB 1JWTA 2XBYA 2VIPA 3GCHB 3ZZBA 4MNVA 3TJOA 1BTZA 3P8NA 2CN0H 4MNWA 1YM0A 1ZPZA 3U8RH 2H9HA 3FFGA 4WXVA 1L1JA 2Q6GA 3SNEA 4DURA 5T6DA 4CHAB 1AWFH 1GJ8B 1LCYA 3MH5A 3SGBE 1BTHH 1BQYA 2P8OC 1GMCG 3UFAA 1ELFA 5FHTA 3ATLA 3PLBA 4NCYA 4BNRA 1BB0B 1CT0E 5AFYH 2QF0A 2QXHA 1QA0A 2K1QA 3STJA 4JZEH 2ZECA 3KN2A 3M35A 3RXFA 2XWBI 3FP6E 3LIWA 1VITH 4LXBH 1O3FA 1MTNB 4UFFH 1SL3A 2ILNA 1GGDB 4UFEH 3PMHB 1O5CB 5T3HA 2IPHA 1D9IA 2C8WB 2Q6FA 1MD7A 2GP9B 1TPSA 3M7QA 3RXJA 4A1XA 1BCUH 2CF8H 1YLDA 1G3BA 2ZIQH 4ASHA 5TJXA 4UONA 3A87A 2BLQA 1HB0B 1ESTA 3LPRA 2PLXA 3BEIB 3S9CA 1X7AC 1SOZA 1WU1A 4K8BA 4NZLA 1TNIA 1GJBB 3PMJA 5LPRA 3ZZ3A 2ZGBH 1G32B 1LMWB 1QFKH 1O39A 1V2LT 5H4IB 1PPEE 2FYRA 2VU8E 3TK9A 4HFPB 1FZZA 1O36A 1P0SH 2P95A 4DJZB 1Y5UT 1O5FH 5PTPA 2GMTC 1OWEA 4X8UH 1BZXE 1O3JA 1SGTA 2FOMB 2RCEA 2PR3A 4AX9H 3NWUA 1Y3WA 6LPRA 4MPXA 3RXOA 5JBCS 4MTBA 3TGKE 3CS0A 1BMMH 1XUGA 1O2SA 1W13U 2H5DA 3O8BA 1ZGIA 5DP6A 1QY6A 1SC8U 1EZXC 4ZHLU 1IQKA 1IHTH 4ZUHA 5HYOA 1UK2A 2GZ8A 1FI8A 2B0FA 1A3BH 1NRPH 4DVAU 3RU4E 4FVBA 2ZGHA 3F6UH 1GHBG 1GI4A 4ISIH 1E35B 3RC6A 1HYLA 4NSYA 1IHSH 2VH6A 4YLUA 3UOUA 1SGNE 1G36A 1GBEA 3SBKA 1N1LA 3GY8A 2ZKSA 2GV7A 4INKA 3QZQA 4XE4A 1GCTC 4BXWA 1O2PA 2CV3A 3BF6H 2BD7A 2CGAA 4NWLA 3BTWE 6GCHF 5A0CA 1K1JA 1QR3E 1LVOA 1UTMA 1QTFA 1KIGH 4OGYA 1QBVH 1UTJA 2QXJA 5K0HA 4BANB 1S6HA 1W0YH 1HAPH 1BTWA 8GCHG 1F0RA 1BA8B 1BMLA 4ABIA 1MBQA 4YLQH 1C5UA 5C20A 1O3GA 2SFAA 2P8OB 2AFQB 5ETXA 2GGVB 1V2KT 2PW8H 1UVSH 1YCPK 1SGPE 4KKDA 2Z94A 1O5BB 4XFQA 2YOLA 2G4UA 1WBGB 2ODQA 1H4WA 2R3UA 1EZUC 1SGCA 1MH0A 1C2JA 3S7HB 1MAYA 1ETTH 1QJ1B 2A5IA 5EQRA 3RM2H 1UHBB 1BRCE 3BEFB 1MTUA 1D4PB 2V35A 3ZZCA 2AS9A 3RXQA 1M9UA 1O2RA 1CBWC 3FZDA 1GI1A 2VIDA 2J2UA 2CHAC 4UE7H 2BY6X 4IN2A 3MNBA 1MTVA 3BSQA 4A1VA 3EE0B 2BQ6B 1UO6A 1TNKA 1TA2A 3UIRA 1Z1JA 1LHDH 1DOJA 3QGNB 2G55A 1F0TA 3QLPH 1P04A 3A88A 1UTLM 4YOJA 1LPZB 4XDEA 1F5LA 1TMBH 1SLUB 1A0JA 2ESTE 5BRRE 2NU3E 2FI4E 4WH6A 4OS6A 4KTUA 1C9PA 2IN2A 2HLCA 1DT2A 4WMEA 2R0KA 2Z9JA 1TAWA 1Z8GA 1J17T 1KLIH 3LC5A 3M5LA 5DP9A 1BTXA 1Y3UA 1AVXA 1QNJA 1TABE 2O8MA 4X1SU 4R8TB 2FX6A 4CREA 4I31A 1D3PB 2OQUA 1NROH 2PSYA 4A7IB 1O2HA 2BOKA 3TJUA 4YT7H 3SI3H 3SORA 4K1SA 3GCNA 3IG6B 4FVDA 2G8TA 1NPMA 1QRWA 2F91A 2ZZUH 1OKXA 2PKAA 1AB9B 1CA0B 4BAQB 3E0NB 2QYIA 4X8TH 1SLXB 1ZSLA 1IQJA 2BYAX 3LOXA 4LZ4B 3MTYA 1EJAA 1W11U 2TRMA 1Z6JH 1HAOH 1OYQA 1HJ9A 2OC7A 2QGRA 2Z9LA 3ODFA 1YPEH 2O8UA 4H6TA 1DWDH 2A2QH 1SG8B 2NU1E 1A0LA 1J8AA 1EKBB 1PPCE 1UTKA 1OWIA 1CGIE 2F9PA 4FUCA 1PFXC 2A1DB 3P17H 1DPOA 1FPCH 4AFZA 4H4FA 2C8ZB 2OLGA 1RFNA 4X8SH 4K5ZA 1EOJA 1P57B 1C2MA 5FCRA 3P6ZB 2PUXB 2G51A 3ODDA 1GJ5H 2W7UA 3U1IB 1ZPBA 1F5RA 1GDQA 2TIOA 4IN1A 2XTTB 4FU9A 4MPVA 4HTCH 3GY4A 2FI5E 4ZKOU 1W14U 5DP4A 4J2YB 1P09A 5JB8S 1UCYK 6GCHG 4X6OA 5L2ZH 4Y8ZA 3CS7A 4JYTA 1GBBA 1FUJA 3NCLA 5LPEA 4MQAA 3RXUA 1TLDA 2A2XH 2A4OA 4ZHMU 5EXNA 1GJAB 3M5MA 1ETRH 3ENSB 4UEHH 1L2EA 2ZHFH 4X6PA 3ATIA 3QTOH 3KEEA 1SR5C 2BY7X 3HKIB 1ELDE 3BEUA 4GPGA 3SO3A 4JZFH 1XX9A 3OYPA 4AYYB 8LPRA 4Q2KA 3BN9A 2VVVA 4DW2U 1BBRH 2WINI 2CHAB 3BTFE 1SGIB 1UK4A 1H9LB 4MNYA 1L4DA 4MPWA 2BX4A 1MUEB 1N8OC 1LVYA 2EC9H 3PO1C 3MNSA 3CENA 5GWZA 1AFQC 5A09A 3EAJA 1YPKH 1WV7H 1GHXH 3RXMA 1IQHA 1TX7A 1C5QA 1GI9B 1TMUH 1DY8A 3S9AA 1FY1A 5FAHA 4YESB 3RXTA 1E34B 3AAUA 3NXPA 2F9NA 1VGCC 2FP7B 1O2YA 1N6XA 1T8OA 2UWLA 1KXFA 4RSPA 5C5OA 2FOAA 2VVUA 1ZR0A 1XUKA 5JYIA 3KQBA 4SGBE 3RXSA 3VB7A 1LPKB 2RDLA 2V0BA 4XOJA 3D62A 4Y0ZE 3ZYDA 1GDNA 4ESTE 1QRZA 4ABEA 4I8JA 3T28A 4D8NA 4DG4A 3RC5A 3RM0H 4NA8A 3UOPA 1THSH 1ZTKA 2PSXA 2ZFFH 2XBWA 1RIWC 1AU8A 1CSOE 1CHGA 3RC4A 3SUDA 3F1SB 4HGCA 3KGPA 1BIOA 2FEQH 2HRVA 4I7YH 5JBBS 3NUMA 2BD8A 4J1YA 2ZCKP 4BAMB 1C5NH 4IC5A 1MU6B 3PMAB 4X6MA 1WTHD 3AW1A 3MYWA 3EYDA 3HK6B 1UK3A 1MKWH 2FYQA 4A92A 2UUJB 3TVJB 1SBWA 1NRNH 1O3KA 2D2DA 1P9SA 2AGEX 3S69A 1NN6A 1HCGA 1O32A 4KTCA 3TK5A 1L1NA 2XYAA 5EXLA 4Z6AH 1QJ6B 1IQGA 1O5DH 3MNCA 4U01A 2YNAA 5DP3A 4TYDA 5DKMA 1UVUH 1C5TA 3LJOA 3A7ZA 1TGTA 5HM2A 1MQ5A 1GL1A 5LPFA 1FN8A 1XXFA 4NWKA 3RXDA 9LPRA 1FY8E 1PQ8A 1QBNA 1C9TA 1OX1A 1P2KA 4CRAA 1OWDA 4ABGA 4D9RA 5IDKA 3ZV8A 1YPGH 1ANBA 3A86A 1DVAH 1RTLA 3FP8E 4NIWA 4D7FA 1S84A 1NU9A 4X2XA 1Y59T 5DGJA 2UWPA 1CQQA 4TY6A 1ZTJA 2BLVA 3DUXH 5A0BA 1FJSA 4OS5A 1INCA 2VGCB 4OS4A 1O3NA 1G37A 3BV9B 2EEKA 3M5OA 5E0JA 2P3FH 1PPFE 1RTFB 3GDVA 3I77A 1GHZA 1DX5M 2FESH 2SGPE 1SGDE 1TYNA 1A5HA 1ZYOA 3WY8A 3BTDE 1DXPA 4BTUB 2P59A 1N8OB 1NTPA 2BVXH 2Y5HA 3PO1B 1HIAB 4X0WU 1G3DA 1J15A 1UTQA 2WYJA 1AFQB 3LJJA 3KCGH 5F8XA 1C2IA 1GVZA 3ZVBA 1GBFA 1LO6A 3I29A 2Y5FA 4TWYA 1NRRH 3GY2A 1CVWH 1ZRBA 2TGDA 1SMFE 2NU0E 1VGCB 1UCYE 2D1JA 4KTSA 5CE1A 2J38A 1A4WH 1KYNA 1TPOA 2ZCLP 1T31A 3SJIA 1GI8B 4OS1A 2J34A 3A7XA 3BG4B 2VVCA 5JDUB 4U2WA 1H9IE 2BTCE 5EU8A 1IQMA 2QC2A 3TJNA 3MO6A 2AYWA 3R3GB 2JETB 3SQEE 5C1UA 1P9UA 1K1IA 5J4SA 1IQLA 2TBSA 4WXIA 4ZKSU 2W5EA 1S0QA 1KY9A 4ABDA 1K28D 5EXMA 4F49A 2QV1A 2F9UA 4Y11E 3LGWA 1O35A 1G30B 3ZVAA 2XC5A 1EUFA 5E8EH 5F6MA 3M61U 3SUGA 2CJIA 2BQWB 1ZGVA 1P2OA 1G2MA 1BDAA 1MCTA 1P2JA 3GY3A 1A61H 3BTKE 2F9BH 1IQNA 2A4GA 1HAVA 1LPGB 4WVPE 3SV7A 2HNTC 1J16A 2C93B 3RXVA 2ZQ2A 4WMDA 4Y10E 1ZZZA 3UUZA 2Z9GA 1BTPA 2VIQA 1IQEA 1C1VH 1TX8A 2ZA5A 3TJVA 5T6FA 3ATMA 2H9EH 1V2ST 1HXEH 3E6PH 3DFLA 4GAWA 2XNIA 1TOCB 2XC0A 2BVRH 3N7OA 4IMZA 1EJNA 3PWBA 1L4ZA 3LH3A 3QZRA 1F92A 1P05A 3BTQE 2XBVA 4AORA 1Q2WA 1O3IA 5FPYA 5DK1A 1W12U 2GZ7A 1WAYB 3TGJE 1QBOA 3A80A 5ESTE 2ZGXH 1TALA 2I6QA 2ZWLH 3GCTF 2FOEA 3GY5A 1GDUA 3SV9A 1JIRA 2GD4B 1QURH 1HXFH 7LPRA 1KXCA 1VJ9U 3M5NA 1HAHH 2AIQA 2ZU3A 4VGCC 3IITA 1QQ4A 3UWIA 1ZMNA 3RXPA 2Z3DA 3PLKA 3SJKA 5HXFA 4NFEA 1P11E 1A5IA 1ANCA 3HKJB 1O31A 5GCHF 4ZH8A 3UTUH 5B6OA 3ZZ5A 1LHEH 2BHGA 4B75A 3E16B 3H5CB 4B2CA 1A3EH 2FODA 3K65B 4X2WA 5GJ4B 4JZIA 3QUMP 1GG6B 2PKSB 4YM9A 3M3SA 3MU8A 2AEIH 2C8XB 3L33A 1O2VA 2A7CA 1JXPA 3Q76A 1Q3XA 1ELGA 3U8OH 5I46H 1P02A 1TMTH 5A2MH 1AB9C 1CA0C 3OU0A 5JB9S 1S83A 1HLTH 5J4QA 3HGNA 3UREA 3G01A 4CRDA 2PGQB 1WOFA 5A8YA 1GPZA 4ZROA 2Z3EA 5A8XA 1TPPA 3LONA 3AAVA 1EB1H 1HNEE 3VPKA 1FLEE 4MVNA 5DJ7A 2QA9E 1UTOA 3H7TA 1LTOA 2ZI2H 5HGGA 4K69A 1QL9A 4Y79A 1S5SA 4BTTB 3P95A 2JKHA 1MKXH 1VCPA 2A7HA 3SU5A 7GCHF 2BZAA 1S82A 4OGXA 2GT8A 1FDPA 2SNVA 2VIOA 5C1YA 1TGBA 3SU1A 1DXWA 1BBRK 4INLA 1F5KU 3CP7A 2GVFA 4MPUA 5EQQA 3BIVH 5C1XA 2P16A 1LDTT 2XW9A 1KDQA 3QK1A 1EAIA 3URCA 1HRTH 1MCVA 1BT7A 1TPAE 3A8CA 4ZMAH 3STIA 1YPJH 3PLPA 3Q3XA 3RXEA 3T29A 1A5GH 1GHVH 4X2VA 1SB1H 1LHCH 2HOBA 1GBKA 1TFXA 2UUYA 1BJUA 2D26C 3UNRA 2UWOA 2OC8A 2J4IA 2B5TB 5HMAA 1WUNH 1SHHB 5LGOA 2C90B 2ANYA 3E0PB 2ZP0H 1F0UA 3B9FH 2DE8A 2D8WA 1EB2A 1NESE 2A0QB 1SGFA 1C1WH 1EXFA 1CT4E 1P06A 1CO7E 2F83A 2M5TA 1TBZH 1GI2A 3NPSA 1C1OA 2Q6DA 3A83A 4UFDH 5C2ZA 1Z7KA 3ZZ8A 2VJ1A 1V2JT 1MAXA 1EQ9A 1EPTC 1OPHB 1GBJA 3ZVEA 4FUGA 5BPEA 3SU3A