3FP8E

Anionic trypsin variant s195a in complex with bovine pancreatic trypsin inhibitor (bpti) determined to the 1.46 a resolution limit
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
223
structure length
223
Chain Sequence
IVGGYTCQENSVPYQVSLNSGYHFCGGSLINDQWVVSAAHCYKSRIQVRLGEHNINVLEGNEQFVNAAKIIKHPNFDRKTLNNDIMLIKLSSPVKLNARVATVALPSSCAPAGTQCLISGWGNTLSSGVNEPDLLQCLDAPLLPQADCEASYPGKITDNMVCVGFLEGGKDSCQGDAGGPVVCNGELQGIVSWGYGCALPDNPGVYTKVCNYVDWIQDTIAAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a serine protease poised to resynthesize a peptide bond.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Anionic trypsin-2
total genus 60
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2009-01-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3fp8E01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3fp8E02
3OYPA 1RTKA 1CVWH 4WH6A 2M5TA 5HMAA 1KDQA 2QY0B 3Q76A 1NO9H 4ABGA 1G3EA 1D9IA 1C1OA 2Z94A 3CS0A 2ANMH 3T2NA 2PTNA 1G3DA 4B1TA 1O3LA 1C2GA 2ZCLP 2DE8A 1O3MA 3A87A 1YPHC 2VVVA 3VGCC 1P02A 1GBTA 1AU8A 2FOHA 1C5WB 1SGQE 2W3KA 1CT0E 1MAYA 1XVMA 3ATKA 3K6ZA 5H4IB 3E0NB 1S6HA 5AHGH 3I29A 2J92A 1YPKH 2VIQA 2FYQA 1LCYA 5HYOA 4FU7A 3A80A 1CBWB 4IGDA 1YPGH 2VB0A 3ZZ6A 1MH0A 1FIWA 1DM4B 1EUFA 5LGOA 1HAOH 2G4TA 1YKTA 4MG3A 5BRRE 4B75A 5CMXH 1YC0A 3BEUA 1KXFA 3JZ1B 1D6WA 2YNBA 5JBTA 2SGPE 2F91A 1WTGH 1O3CA 2D2DA 3SJOA 3QWCH 2A4OA 1A3BH 3NK8A 2OP9A 2RA3A 1O5CB 2RCEA 3V3MA 4D9RA 1BMAA 2EEKA 2O8TA 1V2VT 5EG4A 3A83A 4JYTA 1O3DA 1NROH 4RKOB 3Q3YA 5DJ7A 1YLCA 1QIXB 1GJ4H 2EC9H 3MH7A 4FUBA 1ABIH 3KL6A 2Q6DA 8GCHF 2NU3E 2QCYA 1P09A 2BY6X 4BAMB 3E6PH 1Q31A 5DPAA 1J16A 1IHTH 2UUJB 2TGTA 1H1BA 2QXGA 2ULLA 4Y7AA 3QGJA 3LGVA 1UTLM 1LQEA 3E1XB 9LPRA 1ETTH 1AB9B 1PPEE 2PLXA 3VXEH 1BOQA 1Z8JB 5F03A 1MKXK 4NSVA 3LPRA 1ZHPA 3RLWH 3RXRA 2P93A 1W12U 2PKAA 3TLOA 3BG8A 1GHYH 1AGJA 2F9OA 5E0HA 1UHBB 1ZRKA 1B0FA 3E90B 1BRUP 1GHWH 3GDSA 2XXLA 5EPNA 3ELAH 4O97A 1EAWA 5HM9A 8KME2 1C2EA 3UNQA 3BF6H 3BTHE 1AI8H 4MTBA 3K6YA 4X8VH 2AEIH 2Y82A 1WUNH 3GICB 6CHAB 1JOUB 1KY9A 1GI5A 3MO6A 1A46H 4MDSA 1SGDE 1M9UA 3MTYA 2ALVA 2FI4E 1C1QA 3Q3XA 5IDKA 1TONA 1YCPK 2J94A 3VB4A 2CHAB 1C9PA 1OWKA 1YPJH 4H4FA 1Y5BT 2BDIA 5DGJA 1CA0B 1ZJKA 1NFUA 2BD9A 2OCVB 3TPIZ 2ZKSA 1NRQH 1RD3B 2BB4A 4CRAA 1YF4A 1WQSA 1BQYA 3M3SA 4UFFH 3PV4A 5EQQA 1DWCH 4X2VA 4Y79A 5C1YA 1O2HA 4YOGA 3P8FA 1THSH 2Z3DA 1GBKA 1O5DH 1GBBA 3K2UA 1F0SA 2ZGXH 1FN8A 4U30A 2R9PA 4D8NA 1QA0A 4JK6A 1ANEA 1P2QA 4XBDA 1CU1A 1EZQA 5HM2A 4CBNA 1IQFA 1BRCE 1RFNA 3ZYDA 2C8YB 1EZSC 2GDEH 5I25A 3HGNA 2TPIZ 1GBCA 1KTSB 2ZHFH 1WTHD 1QB6A 1C1SA 4I8GA 4A1TA 3QLPH 4FUIA 4KTUA 4HTCH 4J2YB 2GZ7A 1OWEA 1GI1A 4RKJB 1HJ9A 4NIVA 1TNIA 4XOJA 1VITG 1HGTH 2BX4A 3SI4H 1CSOE 4XE4A 1A2CH 1BRAA 1UVSH 2GCTC 3F68H 1GMDG 2WYGA 1HIAB 2XWBI 5EXMA 1GHBG 3MNXA 4BAKB 1BBRE 2WPMS 2IN2A 1SLVB 2VH6A 4E05H 1LHDH 5A8XA 3S0NA 2NU1E 4Y8YA 1CQQA 1E0FD 3TK9A 1ETSH 4A1XA 2G52A 1QL9A 1VJ9U 1UVOA 5DO4H 1G36A 2ALPA 3ZZBA 1DY9A 3SGBE 1Y3WA 1S81A 1T31A 1SGNE 4NA9H 1ORFA 2AIPA 1ZMNA 2Z3EA 1C5MD 3FAOA 4WMDA 1SFQB 2WV4A 1DSUA 1XVOA 1SGEE 2EI7A 3TJUA 5I46H 2BDHA 3T26A 1E36B 5TCAA 2ZPQA 4XBBA 1V2QT 3LH1A 3LDXH 1MQ5A 1V2OT 1P2MA 3PO1B 4NGAH 1GCTC 1A3EH 1O5GH 2D26C 1Y3VA 1C5VA 1AWFH 2J38A 2NU0E 3QUMP 2RA0A 1UK4A 3BIVH 1KIGH 2ZGHA 2QXJA 2ZIQH 1BTPA 3AVZA 4BTIB 2VGCB 2ODPA 1BTWA 2BY7X 1MTNB 4A5TS 2QXHA 2ZU3A 4FU9A 2FX6A 2WPIS 1SI5H 4NIWA 2BX3A 4OS2A 2UUFB 5LPEA 4KTCA 1AFQB 1BUIA 1GGDC 2WYJA 4TPIZ 3SGAE 3SUFA 4JYUH 3NPSA 3ZZAA 1T8NA 1O2TA 4Y0ZE 3TU7H 2UUYA 2PWXA 1K1JA 1O2YA 2FZZA 1ETRH 1O2LA 1CT4E 1CGHA 1GBIA 1AZZA 1LKAA 1RXPA 1QB9A 3HGPA 4FUJA 1P2JA 1ELCA 1P11E 4NWKA 1O32A 3OSYA 3SNAA 2FOGA 3PMHB 3A7ZA 1NM6A 1L4DA 1TBQH 1V2NT 1ZZZA 1DUAA 3RXSA 3V12A 4WF8A 2GV6A 4AX9H 1O3BA 2J4IA 3K65B 1C1WH 1ZTLA 1DPOA 5EOKA 1C2JA 4JYVH 1MKWH 2ZWLH 5C1XA 4ZXXH 3RU4T 1NN6A 1GI0A 5DP9A 2QIQA 3CENA 1MCVA 4I8LA 1BMNH 3RMOH 1IQGA 1ACBE 1TQ7B 2J2UA 2FI3E 3DHKH 2UWOA 1KXBA 3KNXA 5C20A 4IW4E 1T4UH 2O9QA 1ZSJA 5K7RA 4TY6A 1NRRH 3U98H 4GUXA 3TVJB 1K1PA 3RXDA 2TBSA 1MCTA 4GCHF 1K2I1 2PFEA 5GCHF 3SHCH 1CA8B 5HXFA 1VZQH 4IC6A 1SVPA 2GV7A 3S9AA 1AFEH 1GBMA 3FP7E 2FTMA 1Z71A 3QN7A 2ZECA 1MD7A 1O2RA 4X6MA 1C5TA 2BLWA 3TNTA 1TNHA 1V2RT 2BOHB 5EW2H 1OWHA 1HUTH 1DUEA 2IOTA 1ELBA 1O2IA 4H6SB 4VGCB 1UVPA 1LVOA 5LPRA 5FX6A 4ABDA 3C27B 2FOCA 1TA6A 3MWIU 5FHTA 2C8ZB 2B8OH 1OP8A 1C2IA 2HLCA 1AHTH 3M3TA 4YTAA 4DOQA 1GBLA 3F6UH 1QURH 2I6QA 2XC4A 1YCPM 1CHOG 4RSPA 4MNWA 3ZVCA 1O5AB 1LHEH 3W94A 1C2LA 1UTPA 1C1UH 4ZHMU 2CF8H 1MD8A 1P57B 4UFGH 2WINI 2NU2E 1XUGA 4DW2U 2ESTE 1AVWA 3RU4E 3I77A 1GJ8B 1S82A 2PUXB 5GPIB 3ENSB 4BTUB 4K1EA 2FODA 3LJOA 4IBLH 1EOLA 2A4RA 1XUKA 2AYWA 1WU1A 9ESTA 2LNCA 2BOKA 2FESH 1BTZA 1PPGE 3DFJA 1IOEA 1GMCG 1KYNA 1MZDA 3HKIB 3E91A 3KGPA 4E06H 4Y0YE 2A32A 2BY9X 2ZHWH 2SGEE 3SJ9A 1GHVH 1GBEA 3M5OA 3MU0A 3RXCA 2SGAA 1O3HA 2CJIA 4AFSA 2A0QB 3BEIB 3S9CA 3SBKA 1BBRK 1Y5UT 1FY4A 2F83A 3P8NA 4IC5A 2ANYA 1JIMA 4NWLA 3UNRA 1V2TT 3SV7A 2VVCA 1O3NA 2FXRA 4ZAEA 3GY4A 4R0IA 3SU1A 2D8WA 2TIOA 3NUMA 1S6FA 3UPEA 1QFKH 1TMUH 4ABEA 1TIOA 1GBDA 1TGNA 1Z7KA 5EODA 2VIPA 2JKHA 4XDEA 2OTVA 2H6MA 1SSXA 4GLYA 2GDDA 2FDAA 1HAGE 1W10U 3VGCB 2ZFSA 4AOQA 4D76A 4HGCA 1GMHG 1OOKB 4AYYB 5J4QA 1V3XA 2JETC 5T6GA 1SLXB 5A2MH 3M3VA 4FUFA 2CV3A 1QRXA 5F8TA 3D23A 1ZHRA 1QCPA 2ZNKH 1GJ6A 2F3CE 1NU7B 1P9SA 2RG3A 1S85A 1Z1JA 2ASUB 5IYTA 4JZIA 1L4ZA 3HATH 1BTHH 1BIOA 1GG6B 1PQ5A 1KXCA 1O2GH 1CHOF 3CS7A 4SGAE 4TWYA 1FDPA 1HDTH 1HAXB 2F9NA 1BZXE 4UFDH 2GX4A 4B71A 3NKKA 1QJ6B 1H9LB 1HXFH 3A86A 3U69H 1QB1A 1P06A 3BTME 2F9BH 4CR9A 1Y3XA 2YOLA 4LOYH 1G32B 3GY3A 3O8DA 8ESTE 1F0UA 2HGTH 3NWUA 3ZVEA 1FUJA 4O03A 1QBNA 1U6QA 5DKMA 1OYTH 3AAUA 1SL3A 3KF2A 3ZZ5A 1MZAA 2Y81A 1LVYA 3IWMA 4ZUHA 2BD4A 4A92A 1OP2A 1MBQA 3ZVFA 1C5YB 1GHZA 3ITIA 4MVNA 4CH8B 3D62A 4MNYA 1C2KA 3PMAB 3M37A 3TH2H 1FLEE 2WPJS 2C8XB 4AORA 3SJKA 1GJCB 1J14A 3H7TA 4ZHLU 2ZG0H 4QT8C 1O3IA 3HKJB 2IPHA 1GI3A 2F9UA 1GJ5H 3RXAA 4CR5A 2ZFFH 5B6OA 1TBZH 3PMJA 3NCLA 4NSYA 1V2LT 2FOEA 1DANH 2HWLB 2PHBA 4ISIH 2ZFPH 4BTTB 3ZVBA 1DX5M 1TMBH 2JETB 3KCGH 4MPUA 2ZHQH 1BTXA 6CHAC 8LPRA 2XWAA 1B5GH 2BLVA 1FAXA 1FNIA 3EDXB 2GMTB 3FZZA 3MNCA 4Y8ZA 1G9IE 3GY7A 4MQAA 3UTUH 1F0TA 1O3PB 3RXJA 1O3GA 1O5EH 1GWAA 2ZTYA 3BTFE 3UQOA 1SHHB 1DSTA 3OY6U 1GMDF 3BTGE 4I7YH 1K1IA 3SU6A 1J17T 3A85A 2BXTH 1W3CA 4HFPB 3MFJA 3QZRA 1C5LH 4ISHH 1A7SA 5T6DA 4E7RG 7GCHG 1LPZB 2BDBA 4Y10E 1TGBA 1TBRH 2R2WU 4Z6AH 2BM2A 1N1LA 4CHAB 2XBYA 3WY8A 1DS2E 5F8XA 3RM2H 4ISLA 4MPXA 4TY7A 4X2XA 1Y8TA 2OQ5A 1T8MA 2WPLS 1ANCA 3TIUA 1NPMA 1P0SH 3U1IB 3MU8A 4X6PA 2P8OB 5GJ4B 5DP7A 1GI4A 1AKSA 1PPHE 2ZTZA 1QL7A 3TJVA 1EZUC 1ARCA 3AAVA 1HCGA 2Z9LA 2J9NA 3V7TA 2J34A 2PUQH 2ZTXA 1V2JT 3RXBA 2QXIA 4X0WU 2FWWA 4HI3A 3SJIA 3PROA 1XM1A 1BTUA 4FVDA 1ANDA 3VEQB 1LKBA 4X8UH 2Y5HA 1V2ST 4RN6A 1NRNH 2VWMA 2HPPH 4AN7A 1SGYE 3GCOA 1TPOA 4MNVA 4XFQA 4LXBH 1UJ1A 1GI7B 3ZYEA 1BMLA 1UHBA 3VB5A 1LMWB 3VB3A 3BTTE 2AGIX 4ZHAA 1K1MA 1AN1E 1GMCF 2VNTA 2H9HA 1EJAA 2BLOA 4GPGA 4YOIA 4ZMAH 3BTQE 2DE9A 2G81E 2P95A 3MHWU 7ESTE 2P94A 1CE5A 3SNDA 1ZGVA 2WPHS 1TPPA 5EXNA 2BD7A 2GMTC 4WH8A 1PJPA 5E0JA 2A5AA 2BDCA 2GT7A 1AWHB 2KAIB 4F4OC 3E0PB 4FUCA 2VIDA 4Y76A 5JB9S 2RDLA 5JPMH 3T29A 3PWBA 3KEEA 1HAHH 5TCCA 3P70B 3SQHE 1TNKA 3QO6A 4IMQA 1BITA 1DWEH 3DA9B 1C4Y2 4UEHH 1BT7A 3EE0B 3VFEA 1MKXH 1C1TA 3UOPA 1P10A 1O2XA 3ZZ7A 1OP0A 1HB0B 4X1RU 1C1VH 5DP3A 1D3PB 1SPJA 3A84A 2FLRH 4AGJA 1DLKB 3EAJA 2SFAA 1O3KA 3ODFA 4DURA 5CHAC 4BAOB 5DK1A 2FS9A 2SNWA 2VVUA 1GI6A 1QRWA 3E8LA 1EKBB 2Y5GA 1Z8GA 2XBVA 4H42U 6ESTA 2C4FH 1UTMA 3RXUA 2W7UA 1H8IH 1N6XA 4TYDA 3O8BA 3BG4C 1E34B 4BXWA 2BY5X 1SBWA 2ZU2A 1W11U 5L6NH 3EGKH 4BAQB 1TRYA 2D1JA 3RC6A 1O31A 1V2PT 1GHAF 7LPRA 2Z9JA 4NFFA 5GIBA 2Q1JA 1A5IA 4Y8XA 1O35A 2ANKH 2GCHF 1OKXA 1T4VH 2DUCA 4UE7H 1HAVB 2XNIA 2THFB 3LGIA 5FPTA 2J95A 5L2ZH 1SGFG 4TWWA 1LPKB 1MAXA 3GCNA 3FFGA 1K1NA 2HRVA 2OLGA 1NRPH 3KIDU 1YPEH 1O3JA 1FV9A 1MU8B 3P17H 1UCYH 2ZCKP 3D65E 3S9BA 4WVPE 1MQ6A 2JH5D 5EXLA 3BV9B 2CN0H 1G37A 4BXSA 1NFWA 3BTKE 1ZHMA 3RXIA 1BHXF 3BTDE 2CF9H 2NWNA 3SOSA 3SUDA 1PYTC 2W3IA 2BXUH 2FOBA 3LU9B 2FI5E 1LTOA 2CHAC 3LIWA 2P16A 3SZNA 1V2WT 4B2CA 1F5LA 4KP0A 2ZFRH 1ELAA 2A4GA 1SFIA 5JBAS 3ZZ9A 2ILNA 1ANBA 1Y5AT 2VIVA 1WSSH 2ODYB 4B2BA 4GSOA 1W0ZU 4F49A 4E7NA 3QGNB 4YO9A 3ESTA 4X1QU 1A0HB 3GYLB 1JXPA 2V3OH 4LZ4B 1UVTH 2G5VA 2FO9A 2ZFTA 1FPCH 3ZZ8A 1RIWC 1MUEB 2SGDE 5K0HA 2TRMA 1F0RA 2QAAA 4MLFB 2P8OC 3TGIE 1OSSA 3RXVA 2Y7XA 1O5BB 4ISNA 2AGGX 4CRGA 3FP8E 1V6DA 2P3TB 1C5QA 1C5SA 1SC8U 3TGKE 1G2MA 1QJ7B 2BMGB 1ABJH 2BDAA 4CRBA 1A5HA 4U2WA 3GDVA 2VWNA 4BOHA 2V0BA 1J9CH 1RTLA 4X1PU 5JBCS 3V13A 1C4V2 2ZDNA 1ELEE 1SGFA 1ZTKA 3PTNA 2A2XH 3RM0H 1GL0E 1L1JA 4FU8A 1V2KT 1Z8IB 2R3UA 1FY5A 1PPFE 3LGYA 4U01A 3EA7A 4AB9A 1DLEA 1UO6A 2H1UA 3RC5A 1C5UA 2FLBH 1YPHE 5GCHG 5HGGA 2WUBA 1ELTA 3KQBA 3T28A 3ATLA 4X1NU 1SOTA 5J4SA 3ZVDA 3EA8A 1NESE 3CP7A 4YM9A 1WQVH 5C2ZA 1RJXB 3LT3A 1XXDA 1NFXA 2QN5T 2FS8A 1O3OA 1XUIA 1UCYK 1ZPCA 3LONA 2R2MB 1UK3A 4D9QA 3UIRA 2ZGCA 1ELGA 1ZMLA 1SMFE 1K1LA 1VR1H 2ZDAH 4DJZB 3QTOH 2XYAA 4A7IB 2VIOA 3SN8A 2ZDVH 3MI4A 2PV9B 2K1QA 3GY6A 2JH6D 3Q77A 1FPHH 1TRNA 4AG1A 1V2MT 2GZ9A 2BDGA 3P92A 1K22H 5FCKA 1FONA 1DY8A 1GJ7B 1FMGA 2EI8A 4AFQA 3NXPA 4U32A 1EPTB 1O2JA 1P04A 2AH4X 3G01A 1NU9A 1HJAB 1V2UT 1AUJA 3B8JA 3A81A 2ZU1A 2P3UB 4VGCC 1OYQA 2HALA 3SUEA 1EAUA 2AIQA 2Q6FA 1N6YA 4R8TB 3N7OA 1E38B 1S83A 1AZ8A 2CXVA 1WYKA 4JZDH 1CHGA 5FCRA 1Q3XA 1W13U 1SOZA 2Y80A 1O39A 4I8JA 5F8ZA 4DGJA 2ZDMA 1LVBA 1PPCE 3SW2B 3MO9A 2BYAX 3PLPA 5E8EH 4D7GA 4CHAC 2BVRH 2A1DB 1HXEH 1PFXC 3L6PA 3GY8A 1P01A 1BCUH 1XUHA 1SHYA 1B0EA 4DT7B 4OS7A 1WV7H 1VITH 2OQUA 1S5SA 7KMEH 2G5NA 1O2SA 4X8TH 3PLBA 2BDYA 3NZIA 1Z6EA 3ZV9A 3RXKA 1QQ4A 2GT8A 1SQTA 2B7DH 2TGPZ 3M7UA 1E37B 1TGSZ 3P8GA 2FM2A 4K1SA 3H7OA 4A6LA 2PTCE 2W5EA 3KQDA 2AERH 4AGKA 1OXGA 2VINA 4A1VA 3HK3B 4NCYA 4IMZA 3TJNA 2BQWB 1O2NA 1H9HE 2BTCE 1C1NA 4ASHA 3MOCA 7GCHF 3W95A 4BAHB 1O2KA 3MO3A 2OC0A 4X2WA 4FUEA 4I8KA 1SR5C 3OY5U 1XKBC 4WY3A 1FZZA 4MPVA 3IITA 2P3FH 4ZKNU 2ODQA 1TE0A 1W7GH 2HOBA 1QL8A 1BBRH 1F5RA 1O3FA 3A8AA 3S7HB 1UK2A 1FY1A 5EU8A 5AFYH 1HAYB 3A7YA 4AYVB 4IN2A 3UNSA 5F6MA 4DIIH 1C1PA 2XCFA 1ZOMA 5E0GA 1AE8H 3M35A 4I8HA 5FAHA 4CRCA 2FOAA 4MNXA 1WCZA 1MBMA 1D3TB 2CGAA 2XRCA 3PMBB 1PQ8A 2V3HH 1QTFA 1FIZA 4CREA 1ZLRA 3F9FA 2O8LA 1UTOA 4O3UA 2NU4E 1GCDA 1GDNA 2A5KA 2ZQ1A 4X6OA 1SGIB 1GVKB 1QY6A 1YM0A 1XUFA 1TNGA 1G3CA 2SGQE 3BTWE 1THPB 1HYLA 5E2OA 2H9EH 3U8RH 4GCHG 1TX6A 2BD8A 2B5TB 2FP7B 3RDZA 1JRSA 2FPZA 2W7SA 3A8DA 3MH4A 4X1SU 1EP6A 2I6SA 1GDQA 1O38A 2C8WB 1P05A 1SGTA 1C2MA 3SJ8A 1K1OA 3F9HA 1JBUH 3BTEE 5L2YH 1ZYOA 1K9OE 3A7WA 5L30H 4Q2KA 1C9TA 5JYIA 4B73A 2XBWA 5BPEA 3C1KA 1QJ1B 1CT2E 4ZROA 1DVAH 1W14U 1YCPH 2HNTF 2ZP0H 1KLTA 4NA8A 2A7JA 1C5OH 4CH2B 3UREA 2FIRH 5A0BA 4LK4A 3TNSA 4GHQA 1YGCH 1L0ZA 1EJMA 2ZHDA 3DT0H 3SORA 4B76A 2ZA5A 3SU2A 2Q6GA 4Q7ZA 2AFQB 3F9EA 3PWCA 4Y71A 1H4WA 1XXFA 2PR3A 3M36A 4FUGA 1EASA 2UWLA 1G2LA 3MH6A 3GCTF 3K9XB 1CGJE 3FANA 1VCPA 4DCDA 1RRKA 3DFLA 2VJ1A 4O3TA 4NG9H 3TH3H 5GWZA 2G8TA 3SNEA 3T5FH 1RGQA 1FQ3A 2VGCC 4JZ1A 3LGTA 1GI8B 3M61U 4ABBA 3UY9A 5ABWA 1H9IE 1ZSKA 2ZHEH 1QRZA 3BIUH 4GAWA 1EPTA 3DUXH 4KTSA 4YLQH 1SQAA 1HAVA 2ZPSA 2TGAA 1TFXA 1KSNA 2A7CA 1PQ7A 2FTLE 1H8DH 3A8CA 4INHA 1XX9A 3KN2A 2G55A 3UR6A 1BDAA 4K2YA 2R0LA 3GY5A 4ZKOU 1O2WA 1TPSA 4OS6A 3LKWA 4DVAU 3STJA 5EW1H 1MTUA 2V35A 1Q2WA 1VGCC 1GBHA 2ZGBH 1ZJDA 1A0JA 1KLJH 4Q80A 5DP4A 3AW0A 1EAIA 1XMNB 2PGQB 2H5CA 1ELVA 1TWXB 3ATWA 3PO1C 4FXGH 1P9UA 1T8OA 1SGPE 1O2MA 3QZQA 3MU4A 4NFEA 2AMDA 2BQ7B 1D6RA 3SV8A 2P59A 1TX8A 1NT1A 1ELDE 1MTNC 1X7AC 3QTVH 3ZV8A 1GJ9B 2GKVE 3VB7A 4INKA 1UTJA 4X6NA 1AD8H 4Y11E 3GY2A 3L33A 4LZ1H 2R0KA 2JH0D 2ZF0H 1P2NA 2GCHG 3RC4A 1W0YH 2QF3A 4UD9H 4Z0KA 1MTSA 4DIHH 2VWLA 5C67A 1AQ7A 5FPYA 1IQIA 1HIAA 4CRDA 3A89A 4ISOA 1ARBA 1HJ8A 3SI3H 3TITA 3LC3A 5C3NA 2KAIA 2Y7ZA 3PM3A 2QGRA 1IAUA 3TJOA 1FXYA 5C5NA 1C5RA 2R3YA 1UTNA 2ZDKA 1AMHA 3GCTG 2CMYA 3P8OA 3PB1E 1DICA 3M7QA 2Y6TA 1FY3A 1KXAA 5EQRA 1O37A 3Q3KA 3SV9A 1IQLA 1CBWC 4ESTE 3RXEA 4ABHA 3PLKA 1D3DB 2BD5A 4B74A 1F2SE 3A7TA 2IJOB 1ZSLA 4K60A 4NZQA 4SGBE 2PW8H 2WV5A 3B9FH 3A88A 2OC8A 1PPBH 5FPSA 3RUOA 2BZAA 1EP5A 1FN6A 1OS8A 1YLDA 3AASA 2OC7A 1XUJA 1QBOA 1HV7A 1KLIH 1QHRB 4AG2A 4YZUA 1TQ0B 1OX1A 3UQVA 5T6FA 1BHXB 3MU1A 3OU0A 1P3EA 4K8BA 1QBVH 5AVDA 1DWDH 2BVXH 1C5NH 1UTKA 2QV1A 2ZU4A 2BD3A 2Z6BD 3ATMA 4XSKU 4XBCA 1C5ZB 1YP9A 1NZQH 5CE1A 5C5OA 1ID5H 4ABFA 1O0DH 3F1SB 1TGCA 3GDUA 1GHAG 5E2PA 4Q7YA 5EPYA 1C1MA 1GCTB 1OWDA 1EPTC 1SGCA 1TLDA 4I31A 1AKSB 5LH8A 1PPZA 1IQHA 2AGEX 1HBTH 1CGIE 5AF9H 1NC6A 5FBEA 1LPGB 3O8RA 3SHAH 1AY6H 1P2OA 5GDSH 3U8OH 3MYWA 4D7FA 4K5ZA 4DG4A 4UONA 3U1JB 1UCYE 4J1YA 4AZ2B 3SU4A 4CBOA 1TOCB 2QC2A 1EZXC 4Y6DA 1TNJA 2ANWA 2FEQH 1N8OC 2ZDLA 1C5PA 3R0FA 2FOMB 4B2AA 1ESBA 1VITF 2A45B 1HPGA 1JIRA 2AS9A 1P8VC 3HPTB 3RMNH 1W7XH 2PGBB 3V0XA 3QK1A 2VH0A 3ZZCA 1O2UA 3I78A 5ESTE 2FOFA 3TH4H 1O2OA 3LOXA 3SQEE 1WAYB 1VGCB 1D3QB 1YPMH 2FMJA 2QYIA 2G00A 4H6TA 1TOMH 1QNJA 4M7GA 1O33A 4OGXA 2A2QH 2BY8X 3SU5A 5ETXA 1S0RA 4GVUA 4I33A 2AMQA 4JCNA 1TA2A 2ZU5A 1C2FA 1PYTD 3MH5A 8GCHG 1GL1A 2ZQ2A 3SU0A 1HFDA 1HRTH 1EX3A 1LHCH 4BANB 2ZGJA 2PKSB 3P95A 3UWJH 4MPWA 2H5DA 1LO6A 1SQOA 1ELFA 5FX5A 5A8YA 1K21H 1INCA 2BVSH 1P3CA 4AB8A 1GHXH 1BRBE 1A4WH 1T7CA 2SNVA 4YT6H 1KDQB 1QQUA 3KHVA 1Z6JH 2PKAB 1NFYA 2VIWA 3M7TA 1A1RA 2V6NA 3DD2H 3JZ2B 4HZHA 1NS3A 4Y7BA 2HNTE 3A7XA 1ZPZA 1QR3E 4WMFA 4IN1A 5EQSA 1FI8A 1F7ZA 1IHSH 1GBAA 3ZZDA 1OWIA 3UFAA 1C2HA 1NTPA 1RS0A 3L3TA 2EI6A 1DDJA 3OX7U 1KTTB 1TALA 2Z3CA 2VU8E 2BLQA 3SUGA 2YNAA 3GOVB 3MNBA 4KKDA 1O2VA 2A31A 1GJAB 1DXWA 1C5XB 1J8AA 2B9LA 1B7XB 1OPHB 2G51A 4K1TA 1TPAE 3STIA 1LVMA 1GGDB 1UVUH 3OTJE 4TPYA 1HLTH 1GHBF 2QF0A 1JWTA 3RXGA 3TK6A 3SGQE 3RLYH 1P2KA 1VCWA 1FAKH 1DITH 1EOJA 1W2KH 1L1GA 1ESTA 1G30B 3M5NA 4ZKSU 4ABIA 2XCNA 1EJNA 1SLUB 3S69A 5G4BA 4X8SH 4AFUA 1A61H 1MU6B 1EB2A 2ZZUH 1O2QA 3HK6B 1P2IA 3UUZA 5LPFA 2HPQH 2WUCA 4OGYA 1Y3UA 3QX5H 4ZH8A 3P6ZB 4OS5A 4CRFA 2XC5A 3E16B 5JDUB 3AW1A 3LGUA 5A0CA 4I32A 4WMEA 4Q7XA 1T32A 3RXHA 4YT7H 1TYNA 1RIWB 1WOFA 2BHGA 1O3EA 4BNRA 1W8BH 1HAIH 3LH3A 2OUAA 1BB0B 3BN9A 4NIXA 5C1UA 2G4UA 3QDZB 1YPLH 1ZTJA 5SGAE 4IS5A 5JB8S 2Z9GA 2GCTB 1F5KU 3BEFB 4GHTA 3T25A 1O3AA 1T8LA 3EYDA 1S84A 1O2PA 1GBJA 1G3BA 1KXEA 1EB1H 2Z9IA 4WXVA 3M5LA 5FXLA 1GDUA 1KXDA 3RU4D 1EATA 3SV2H 4NIYA 1SB1H 1GBFA 3ZVAA 3RXTA 2GTBA 5A8ZA 2F9PA 4ZXYH 1L1NA 1LHFH 3RXMA 1BA8B 3S7KB 5A0AE 1HAZB 1BJUA 1NRSH 1QA7A 2OBOA 1EXFA 3RP2A 3RXPA 3UOUA 4DY7B 2GP9B 1THRH 6GCHF 5PTPA 1IQJA 2GVFA 3SNBA 4NA7A 4K3JA 2OXSA 1AO5A 1P12E 1F92A 3B23B 1LQDB 3GISB 1GI2A 1GJDB 1ZGIA 1ZPBA 5DP5A 1C2DA 2C93B 2C90B 3FP6E 2PSYA 5A09A 3UWIA 1AE5A 1LHGH 2A7HA 2OC1A 2Y5FA 2O8WA 5AFZH 2PKSC 3ODDA 2WPKS 1JMOH 1UMAH 1GI9B 1UTQA 2UUKB 1RTFB 1AB9C 1S0QA 3T62A 3ZZ4A 2XW9A 3O8CA 1CA0C 5JBBS 3EA9A 3KQCA 3Q00A 1GG6C 4OS4A 1IQEA 1DXPA 3U8TH 2A5IA 2STAE 2H2ZA 2HVXA 1NY22 3A82A 1D4PB 1GJBB 1AVGH 4INLA 3ZVGA 1E35B 2ZC9H 1VJAU 5T3HA 1XKAC 3URCA 4X2YA 1CO7E 2OBQA 2XC0A 1A0LA 1TAWA 1HAPH 1FJSA 2ZI2H 3BSQA 4ZKRU 2GD4B 1MTVA 3RXQA 2BD2A 1MMJN 4UFEH 6GCHG 4JMYA 3GCHC 3RXOA 3TGJE 1SG8B 1TNLA 4K8YA 4FUDA 2XTTB 4YOJA 1DWBH 1C4U2 3EQ0H 1AUTC 1Z8RA 2AMPA 4JZFH 3RXLA 4ABJA 5GXPA 1Y59T 1TMTH 1DE7H 4NZLA 4YESB 1YBWA 1GMHF 1EAXA 3RMMH 2ZCHP 2H9TH 1J15A 3ATIA 3SNCA 6LPRA 2LPRA 3GYMA 3URDA 3PYHA 2C3SA 4WWYA 3T27A 3PTBA 4ABAA 3SU3A 2ZFQH 4KGAA 5EGMA 1AVXA 1ZMJA 1AFQC 3KQEA 2B0FA 3FZDA 3LGWA 3TK5A 1DFPA 2GGVB 1GVZA 4AFZA 1BMMH 2ZO3H 3UR9A 3A8BA 3VXFH 3R3GB 1O5FH 1OWJA 1Z1IA 2OINA 2ZEBA 2QA9E 1MTWA 2XBXA 1BJVA 1PQAA 1VCQA 5DP6A 1GPZA 3MNSA 1BTYA 1L2EA 1YYY1 3MU5A 2BZ6H 3IG6B 2ZPRA 4PROA 1Y3YA 4WJG2 3MMGA 4JZEH 1IQKA 5FBIA 1N8OB 3E3TA 4K69A 1IQNA 1ESAA 1IQMA 5TJXA 3U9AH 3RXFA 5ESBA 1JRTA 1EQ9A 3LC5A 3BG4B 3F9GA 1DT2A 2Z7FE 1GVLA 1MKWK 1O2ZA 1WBGB 1O34A 3RMLH 3A7VA 2FYRA 4WXIA 1FY8E 1O30A 1O36A 3ZZ3A 4FUHA 1C1RA 2BQ6B 2FX4A 2EA3A 3VPKA 1ZR0A 2Z9KA 4FVBA 4OS1A 4YLUA 2GZ8A 4KELA 2UWPA 4THNH 3GCHB 3SO3A 5DG6A 1ZRBA 2O8MA 2TGDA 1K28D 1HNEE 3FVFB 3D49H 1SGRE 2SGFE 3SV6A 2VWOA 5CHAB 1A5GH 2A4QA 1HJAC 1TRMA 2HNTC 2W26A 1LDTT 1SLWB 2STBE 2OD3B 1DOJA 4O9VA 1AIXH 1TB6H 4JK5A 1TABE 1P03A 1TX7A 3M5MA 2PSXA 3LJJA 3H5CB 3VB6A 4UDWH 1QGFA 2F9VA 5DP8A 1TGTA 2O8UA
chains in the Genus database with same CATH superfamily
3OYPA 2WZQA 1RTKA 1CVWH 3SYJA 4WH6A 2M5TA 5HMAA 1KDQA 5HIZA 2QY0B 3Q76A 1NO9H 4ABGA 1G3EA 1D9IA 1C1OA 2Z94A 3CS0A 2ANMH 3T2NA 2PTNA 1G3DA 4B1TA 1O3LA 1C2GA 2ZCLP 2DE8A 1O3MA 3A87A 1YPHC 2VVVA 3VGCC 1P02A 1GBTA 1AU8A 2FOHA 1C5WB 1SGQE 2W3KA 1CT0E 1MAYA 1XVMA 3ATKA 3K6ZA 5H4IB 3E0NB 1S6HA 5AHGH 3I29A 2J92A 1YPKH 2VIQA 2FYQA 1LCYA 5HYOA 4FU7A 3A80A 1CBWB 4IGDA 1YPGH 2VB0A 3ZZ6A 1MH0A 1FX0B 1FIWA 1DM4B 1EUFA 5LGOA 1HAOH 2G4TA 1YKTA 4MG3A 5BRRE 4B75A 5CMXH 1YC0A 3BEUA 2WPDD 1KXFA 3JZ1B 1D6WA 2YNBA 5JBTA 2SGPE 2F91A 1WTGH 1O3CA 2D2DA 3SJOA 2HVYB 3QWCH 2A4OA 1A3BH 3UAIC 3NK8A 2OP9A 2RA3A 1O5CB 2RCEA 3V3MA 4D9RA 3F3BA 1BMAA 2EEKA 2O8TA 1V2VT 5EG4A 3A83A 4JYTA 1O3DA 1NROH 4RKOB 3Q3YA 5DJ7A 1YLCA 1QIXB 1GJ4H 2EC9H 3FN8A 3MH7A 4FUBA 1ABIH 3KL6A 2Q6DA 8GCHF 2NU3E 2QCYA 1P09A 2BY6X 4BAMB 2HLDD 1Q31A 3E6PH 1J16A 5DPAA 1IHTH 2UUJB 2TGTA 1H1BA 2QXGA 2ULLA 4Y7AA 3QGJA 3LGVA 1UTLM 1LQEA 3E1XB 9LPRA 1ETTH 1AB9B 1PPEE 2PLXA 3VXEH 1BOQA 1Z8JB 5F03A 1MKXK 4NSVA 3LPRA 1ZHPA 3RLWH 3RXRA 2P93A 1W12U 2PKAA 3TLOA 3BG8A 5EJLA 1GHYH 1AGJA 2F9OA 5E0HA 1UHBB 1ZRKA 1B0FA 3E90B 1BRUP 1GHWH 3GDSA 2XXLA 5CHBA 5EPNA 3ELAH 4O97A 1EAWA 5HM9A 8KME2 1C2EA 3UNQA 3BF6H 3BTHE 1AI8H 4MTBA 3K6YA 4X8VH 2AEIH 2Y82A 1WUNH 3GICB 6CHAB 1JOUB 1KY9A 3CNRA 1GI5A 3MO6A 1A46H 4MDSA 2KCOA 1SGDE 1M9UA 3GS9A 3MTYA 2ALVA 2FI4E 1C1QA 3Q3XA 3PRDA 1TONA 5IDKA 1YCPK 2J94A 3VB4A 2CHAB 1C9PA 1OWKA 1YPJH 4H4FA 1Y5BT 2BDIA 5DGJA 1CA0B 1ZJKA 1NFUA 2BD9A 2OCVB 3TPIZ 2ZKSA 1NRQH 1RD3B 2BB4A 4CRAA 3F2FA 1YF4A 1WQSA 1BQYA 3M3SA 4UFFH 2V3MA 3PV4A 5EQQA 1DWCH 4X2VA 4Y79A 2F4LA 5C1YA 1O2HA 4YOGA 3P8FA 1THSH 2XOKD 2Z3DA 1GBKA 1O5DH 1GBBA 3K2UA 1F0SA 2ZGXH 1FN8A 4U30A 2R9PA 4D8NA 1QA0A 4JK6A 1ANEA 1P2QA 4XBDA 1CU1A 1EZQA 5HM2A 4CBNA 1IQFA 1BRCE 1RFNA 3ZYDA 2C8YB 1EZSC 2GDEH 5I25A 3HGNA 2TPIZ 3N99A 1GBCA 1KTSB 2ZHFH 1WTHD 1QB6A 1C1SA 4I8GA 4A1TA 3QLPH 3NRLA 4FUIA 4KTUA 2QE7D 4HTCH 4J2YB 2GZ7A 1OWEA 1GI1A 4RKJB 1HJ9A 4NIVA 1TNIA 4XOJA 1VITG 1HGTH 2BX4A 4P02A 3SI4H 1CSOE 4XE4A 1A2CH 1BRAA 1UVSH 2GCTC 3F68H 4AC9A 1GMDG 2WYGA 1HIAB 2XWBI 5EXMA 1GHBG 3MNXA 4BAKB 1BBRE 2WPMS 2IN2A 1SLVB 2VH6A 4E05H 1LHDH 5A8XA 3S0NA 2NU1E 4Y8YA 1CQQA 1E0FD 3TK9A 1ETSH 4A1XA 2G52A 1QL9A 1VJ9U 1UVOA 1OHHD 5DO4H 1G36A 2ALPA 3ZZBA 1DY9A 3SGBE 1Y3WA 1S81A 1T31A 1SGNE 4NA9H 1ORFA 2AIPA 1ZMNA 2Z3EA 1C5MD 3FAOA 4WMDA 1SFQB 2WV4A 1DSUA 1XVOA 2J98B 1SGEE 2EI7A 3TJUA 5I46H 2BDHA 3T26A 2KX4A 1E36B 5TCAA 2ZPQA 4XBBA 1V2QT 3LH1A 3LDXH 1MQ5A 1V2OT 1P2MA 3PO1B 4NGAH 1GCTC 1A3EH 1O5GH 2D26C 1Y3VA 1C5VA 1AWFH 2J38A 2NU0E 3QUMP 2RA0A 1UK4A 3BIVH 1KIGH 2ZGHA 2QXJA 2ZIQH 1BTPA 3AVZA 4BTIB 4ASUD 2VGCB 2ODPA 1BTWA 2BY7X 1MTNB 4A5TS 3MQKC 2QXHA 2ZU3A 4FU9A 2CK3D 2FX6A 2WPIS 1SI5H 4NIWA 2BX3A 4OS2A 2UUFB 5LPEA 4KTCA 1AFQB 1BUIA 1GGDC 2WYJA 4TPIZ 3SGAE 3SUFA 4JYUH 3NPSA 3ZZAA 1T8NA 1O2TA 1SKYE 4Y0ZE 3TU7H 2UUYA 2PWXA 1K1JA 1O2YA 2FZZA 1ETRH 1O2LA 1CT4E 1CGHA 1GBIA 1AZZA 1LKAA 1RXPA 1QB9A 3HGPA 4FUJA 1P2JA 1ELCA 1P11E 4NWKA 1E79D 2KR7A 1O32A 3OSYA 3SNAA 2FOGA 3PMHB 3A7ZA 1NM6A 1L4DA 1TBQH 1V2NT 1ZZZA 1DUAA 3RXSA 3V12A 4WF8A 2GV6A 4AX9H 1O3BA 2J4IA 3K65B 1C1WH 1ZTLA 1DPOA 5EOKA 1C2JA 4JYVH 1MKWH 2ZWLH 5C1XA 4ZXXH 3RU4T 1NN6A 1GI0A 5DP9A 2QIQA 3CENA 1MCVA 4I8LA 1BMNH 3RMOH 1IQGA 1ACBE 1TQ7B 2J2UA 2FI3E 3DHKH 1COWD 2UWOA 1KXBA 3KNXA 5C20A 4IW4E 1T4UH 2O9QA 1ZSJA 5K7RA 4TY6A 1NRRH 3U98H 4GUXA 3TVJB 1K1PA 3RXDA 2TBSA 1MCTA 4GCHF 1K2I1 2PFEA 2KZ4A 5GCHF 3SHCH 1CA8B 5HXFA 1VZQH 4IC6A 3DCLA 1SVPA 2GV7A 3S9AA 1AFEH 1GBMA 3N7DA 5CDFE 3FP7E 2FTMA 1Z71A 3QN7A 2ZECA 1MD7A 1O2RA 4X6MA 1C5TA 2BLWA 3TNTA 1TNHA 1V2RT 2BOHB 1BMFD 5EW2H 1OWHA 1HUTH 2KCPA 1DUEA 2IOTA 5GNDA 1ELBA 1O2IA 4H6SB 4VGCB 1UVPA 1LVOA 5LPRA 5FX6A 3OFND 4ABDA 3C27B 2FOCA 1TA6A 3MWIU 5FHTA 2C8ZB 2B8OH 1OP8A 5KECA 1C2IA 2HLCA 1AHTH 3M3TA 4YTAA 4DOQA 1GBLA 3F6UH 1QURH 2I6QA 2XC4A 1YCPM 1CHOG 4RSPA 4MNWA 3ZVCA 1O5AB 1LHEH 3W94A 1C2LA 1UTPA 1C1UH 4ZHMU 2CF8H 1MD8A 1P57B 4UFGH 2WINI 2NU2E 1XUGA 4DW2U 2ESTE 1AVWA 3RU4E 3I77A 1GJ8B 1S82A 2PUXB 5GPIB 3ENSB 4BTUB 4K1EA 2FODA 3LJOA 4IBLH 1EOLA 2A4RA 1XUKA 2AYWA 1WU1A 9ESTA 1MABB 2LNCA 2BOKA 2FESH 1BTZA 1PPGE 3DFJA 1IOEA 1GMCG 1KYNA 1MZDA 3HKIB 3E91A 3KGPA 4E06H 4Y0YE 2IJD1 2A32A 2BY9X 2ZHWH 2SGEE 3SJ9A 1GHVH 1GBEA 3M5OA 3MU0A 3RXCA 2SGAA 1O3HA 2CJIA 4AFSA 2A0QB 3BEIB 3S9CA 3SBKA 1BBRK 1Y5UT 1FY4A 2F83A 3P8NA 4IC5A 2ANYA 1JIMA 4NWLA 3UNRA 1V2TT 5C17A 3SV7A 2VVCA 1O3NA 2FXRA 4ZAEA 3GY4A 4R0IA 3SU1A 3WW7A 2D8WA 2TIOA 4FOUC 3NUMA 1S6FA 3UPEA 1QFKH 1TMUH 2KFWA 1TIOA 4ABEA 1GBDA 1TGNA 1Z7KA 5EODA 2VIPA 2JKHA 4XDEA 2OTVA 2H6MA 1SSXA 4GLYA 2GDDA 2FDAA 1HAGE 1W10U 3VGCB 2ZFSA 4AOQA 4D76A 4HGCA 1GMHG 1OOKB 4AYYB 5J4QA 1V3XA 2JETC 5T6GA 1SLXB 5A2MH 3M3VA 4FUFA 2CV3A 1QRXA 5F8TA 3D23A 1ZHRA 1QCPA 2ZNKH 1GJ6A 4XD7D 2F3CE 1NU7B 1P9SA 3AK5A 2RG3A 1S85A 1Z1JA 2ASUB 5IYTA 4JZIA 1L4ZA 3HATH 1BTHH 1BIOA 1GG6B 2L74A 1PQ5A 1KXCA 1O2GH 1CHOF 3CS7A 4SGAE 4TWYA 1FDPA 1HDTH 1HAXB 2F9NA 1BZXE 4UFDH 2GX4A 4B71A 3NKKA 3UB0A 1QJ6B 1H9LB 1HXFH 3A86A 3U69H 1QB1A 1P06A 3BTME 2F9BH 4CR9A 1Y3XA 2YOLA 4LOYH 1G32B 3GY3A 3F2HA 3O8DA 8ESTE 1F0UA 2HGTH 3NWUA 3ZVEA 1FUJA 4O03A 1QBNA 1U6QA 5DKMA 3F0PA 1OYTH 3AAUA 1SL3A 3KF2A 3ZZ5A 1WDIA 1MZAA 2Y81A 1LVYA 3IWMA 4ZUHA 2BD4A 4A92A 1OP2A 3FOAA 1MBQA 3ZVFA 1C5YB 1GHZA 3ITIA 4MVNA 4CH8B 3D62A 4MNYA 1C2KA 3PMAB 3M37A 3TH2H 1FLEE 2WPJS 2C8XB 4AORA 3SJKA 1GJCB 1J14A 3H7TA 4ZHLU 2ZG0H 4QT8C 1O3IA 3HKJB 2IPHA 1GI3A 2F9UA 1GJ5H 4P00A 4M9FA 3RXAA 4CR5A 2ZFFH 5B6OA 1TBZH 3PMJA 2M2AA 3NCLA 4NSYA 1V2LT 2FOEA 1DANH 2HWLB 2PHBA 4ISIH 2ZFPH 4BTTB 3ZVBA 1DX5M 1TMBH 2JETB 3KCGH 4MPUA 2ZHQH 1BTXA 6CHAC 8LPRA 2XWAA 1B5GH 2BLVA 1FAXA 1FNIA 3EDXB 2GMTB 3FZZA 3MNCA 4Y8ZA 1G9IE 3GY7A 4MQAA 3UTUH 1F0TA 1O3PB 3RXJA 1O3GA 1O5EH 1GWAA 2ZTYA 3BTFE 3UQOA 1SHHB 1DSTA 3OY6U 1GMDF 3BTGE 4I7YH 1K1IA 3F2GA 3SU6A 1J17T 2LELA 2BXTH 3A85A 1W3CA 4HFPB 3MFJA 3QZRA 1C5LH 4ISHH 1A7SA 5T6DA 4E7RG 7GCHG 1YWUA 1LPZB 2BDBA 4Y10E 1TGBA 1TBRH 2R2WU 4Z6AH 2BM2A 1N1LA 2W6JD 4CHAB 2XBYA 3WY8A 1DS2E 5F8XA 1H8HD 3RM2H 4ISLA 4MPXA 4TY7A 4X2XA 1Y8TA 2OQ5A 1T8MA 2WPLS 1ANCA 3TIUA 1NPMA 1P0SH 3U1IB 3MU8A 4OM9A 4X6PA 1VKYA 1YLNA 2P8OB 5GJ4B 5DP7A 1GI4A 1AKSA 1PPHE 2ZTZA 1QL7A 3TJVA 1EZUC 1ARCA 3AAVA 5HIYA 1HCGA 2Z9LA 2J9NA 3V7TA 2J34A 2PUQH 2ZTXA 1V2JT 3RXBA 2QXIA 4X0WU 2FWWA 4HI3A 3SJIA 3PROA 1XM1A 1BTUA 4FVDA 1ANDA 3VEQB 1LKBA 4X8UH 3PRBA 2Y5HA 1V2ST 4RN6A 1NRNH 2VWMA 2HPPH 4AN7A 1SGYE 3GCOA 1K0HA 2KCYA 1TPOA 4MNVA 4XFQA 2EY4C 4LXBH 1UJ1A 1GI7B 3ZYEA 1BMLA 1UHBA 3VB5A 1LMWB 3VB3A 3BTTE 2AGIX 4ZHAA 1K1MA 1AN1E 1GMCF 2VNTA 2H9HA 1EJAA 2BLOA 4GPGA 4YOIA 4ZMAH 3BTQE 2DE9A 2G81E 2P95A 3MHWU 7ESTE 2P94A 3PV2A 1CE5A 3SNDA 1ZGVA 2WPHS 1TPPA 5EXNA 2BD7A 2GMTC 4WH8A 1PJPA 5E0JA 2A5AA 2BDCA 2GT7A 1AWHB 2KAIB 4F4OC 3E0PB 4FUCA 2VIDA 4Y76A 5JB9S 2RDLA 5JPMH 3T29A 3PWBA 4F55A 3KEEA 2VBCA 1HAHH 5TCCA 3P70B 3SQHE 1TNKA 3QO6A 4IMQA 1BITA 1DWEH 3DA9B 1C4Y2 4UEHH 1BT7A 3WWFA 2K8IA 3EE0B 3VFEA 1MKXH 1C1TA 3UOPA 1P10A 1O2XA 3ZZ7A 1OP0A 1HB0B 4X1RU 1C1VH 5DP3A 1D3PB 1SPJA 2OK5A 2PP6A 2FLRH 3A84A 4AGJA 1DLKB 3EAJA 2SFAA 1O3KA 3ODFA 4DURA 5CHAC 4BAOB 5DK1A 2FS9A 2SNWA 2VVUA 1GI6A 1QRWA 3E8LA 1EKBB 2Y5GA 1Z8GA 2XBVA 4H42U 6ESTA 2C4FH 1UTMA 3RXUA 2W7UA 1H8IH 1N6XA 4TYDA 3O8BA 3BG4C 1E34B 2K0QA 4BXWA 2BY5X 1SBWA 2ZU2A 1W11U 5L6NH 3EGKH 4BAQB 1TRYA 2D1JA 3RC6A 1O31A 1V2PT 1GHAF 7LPRA 2Z9JA 4NFFA 5GIBA 2Q1JA 1A5IA 4Y8XA 1O35A 2ANKH 2GCHF 1OKXA 1T4VH 2DUCA 4UE7H 1HAVB 2XNIA 2THFB 3LGIA 5FPTA 2J95A 5L2ZH 1SGFG 4TWWA 1LPKB 1MAXA 3GCNA 3FFGA 1K1NA 2HRVA 2OLGA 1NRPH 3KIDU 1YPEH 1O3JA 1FV9A 1MU8B 3P17H 1UCYH 2ZCKP 1EFRD 3D65E 3S9BA 4WVPE 1MQ6A 2JH5D 5EXLA 3BV9B 2CN0H 1G37A 4BXSA 1NFWA 3BTKE 1ZHMA 3RXIA 1BHXF 3BTDE 2CF9H 2NWNA 3SOSA 3SUDA 1PYTC 2W3IA 2BXUH 2FOBA 3LU9B 2FI5E 1LTOA 2CHAC 3LIWA 2P16A 3SZNA 1V2WT 4B2CA 1F5LA 4KP0A 2ZFRH 1ELAA 2A4GA 1SFIA 5JBAS 3ZZ9A 2ILNA 1ANBA 1Y5AT 2VIVA 1WSSH 2ODYB 4B2BA 4GSOA 1W0ZU 4F49A 4E7NA 3QGNB 4I86A 4YO9A 3ESTA 4X1QU 1A0HB 3GYLB 1JXPA 2V3OH 4LZ4B 1UVTH 2G5VA 2FO9A 2ZFTA 1FPCH 3ZZ8A 2KCAA 1RIWC 1MUEB 2SGDE 5K0HA 2TRMA 1F0RA 2QAAA 4MLFB 2P8OC 3TGIE 1OSSA 1W0JD 3RXVA 2Y7XA 1O5BB 4ISNA 2AGGX 4CRGA 3FP8E 1V6DA 2QF5A 1H8ED 2P3TB 1C5QA 1C5SA 1SC8U 3TGKE 1G2MA 3OEED 1QJ7B 2BMGB 1ABJH 2BDAA 4CRBA 1A5HA 4U2WA 3GDVA 2VWNA 4BOHA 2V0BA 2WHXA 1J9CH 1RTLA 4X1PU 5JBCS 3V13A 1C4V2 2ZDNA 1ELEE 1SGFA 1ZTKA 3PTNA 2A2XH 3RM0H 1GL0E 1L1JA 4TSFD 4FU8A 1V2KT 1Z8IB 2R3UA 2L6OA 1FY5A 1KMHB 1PPFE 3LGYA 4U01A 3EA7A 4AB9A 1DLEA 1UO6A 2H1UA 3RC5A 1C5UA 2FLBH 1YPHE 5GCHG 5HGGA 2WUBA 1ELTA 3KQBA 3T28A 3ATLA 4X1NU 1SOTA 5J4SA 3ZVDA 3EA8A 1NESE 3CP7A 4YM9A 1WQVH 5C2ZA 1RJXB 3LT3A 1XXDA 3OAAD 1NFXA 2QN5T 2FS8A 1O3OA 1XUIA 1YY3A 1UCYK 1ZPCA 3LONA 1SQRA 2R2MB 1UK3A 4D9QA 3UIRA 2ZGCA 1ELGA 1ZMLA 1SMFE 1K1LA 1VR1H 2ZDAH 4DJZB 3QTOH 2XYAA 4A7IB 2VIOA 3SN8A 2ZDVH 3MI4A 2PV9B 3ZIAD 2K1QA 3GY6A 2JH6D 3Q77A 1FPHH 1TRNA 4RT0A 4AG1A 1V2MT 2GZ9A 3EE7A 2BDGA 3P92A 2J97A 1K22H 5FCKA 1FONA 1DY8A 1GJ7B 1FMGA 2EI8A 4AFQA 3NXPA 4U32A 1EPTB 1O2JA 1P04A 2AH4X 3G01A 1NU9A 1HJAB 1V2UT 1AUJA 3B8JA 3A81A 2ZU1A 2P3UB 4VGCC 1OYQA 2HALA 3SUEA 1EAUA 2AIQA 2Q6FA 1N6YA 4R8TB 3N7OA 1E38B 1S83A 5T1VA 1AZ8A 2CXVA 1WYKA 4JZDH 1CHGA 5FCRA 1Q3XA 1W13U 1SOZA 2Y80A 1QZ8A 1O39A 4I8JA 5F8ZA 4Q4LA 4DGJA 2ZDMA 1LVBA 1PPCE 4YXWD 3SW2B 3MO9A 2BYAX 3PLPA 5E8EH 4D7GA 4CHAC 2BVRH 2A1DB 1HXEH 1PFXC 3L6PA 3GY8A 1P01A 1BCUH 1XUHA 1SHYA 1B0EA 4DT7B 4OS7A 1WV7H 1VITH 2OQUA 1S5SA 7KMEH 2G5NA 1O2SA 4X8TH 3PLBA 2BDYA 3NZIA 1Z6EA 3ZV9A 3RXKA 1QQ4A 2GT8A 1SQTA 2B7DH 2TGPZ 3M7UA 1E37B 1TGSZ 3N7EA 3P8GA 2FM2A 3FKSD 4K1SA 3H7OA 4A6LA 2PTCE 2W5EA 3KQDA 2AERH 4AGKA 1OXGA 2VINA 4A1VA 3HK3B 4NCYA 4IMZA 3TJNA 2BQWB 1O2NA 1H9HE 2BTCE 1C1NA 4ASHA 3MOCA 7GCHF 3W95A 4BAHB 5C0TA 1O2KA 2YMSD 2OC0A 3MO3A 4F48B 4X2WA 4FUEA 4I8KA 1SR5C 3H09A 3OY5U 1XKBC 4WY3A 1FZZA 4MPVA 3IITA 2P3FH 4ZKNU 2ODQA 1TE0A 1W7GH 2HOBA 1QL8A 1BBRH 1F5RA 1O3FA 3A8AA 3S7HB 1UK2A 1FY1A 5EU8A 5AFYH 1HAYB 3A7YA 4AYVB 4IN2A 3UNSA 5F6MA 4DIIH 1C1PA 2XCFA 1ZOMA 2J98A 5E0GA 1AE8H 3M35A 4I8HA 5FAHA 4CRCA 2FOAA 4MNXA 1WCZA 1MBMA 1D3TB 2CGAA 2XRCA 3PMBB 1PQ8A 2V3HH 4Q63A 1QTFA 1FIZA 5F53A 4CREA 1ZLRA 2RFKC 3F9FA 2O8LA 1UTOA 4O3UA 2NU4E 1GCDA 1GDNA 2A5KA 5FL7D 2ZQ1A 4X6OA 1SGIB 1GVKB 1QY6A 1YM0A 1XUFA 1TNGA 1G3CA 2JIZD 2SGQE 3BTWE 1THPB 1HYLA 5E2OA 2H9EH 3U8RH 4GCHG 1TX6A 2BD8A 2B5TB 2FP7B 3RDZA 1JRSA 2FPZA 2W7SA 3A8DA 3MH4A 4X1SU 1EP6A 2I6SA 1GDQA 1O38A 2V7QD 2C8WB 1P05A 1SGTA 1C2MA 3OE7D 3SJ8A 1K1OA 3F9HA 1JBUH 3BTEE 5L2YH 1ZYOA 1K9OE 3A7WA 5L30H 4Q2KA 1C9TA 5JYIA 4B73A 3F0OA 2XBWA 5BPEA 3C1KA 1QJ1B 1CT2E 4ZROA 1DVAH 1W14U 1YCPH 2HNTF 2ZP0H 1KLTA 4NA8A 4TT3D 2A7JA 1C5OH 4CH2B 3UREA 2FIRH 3U28C 5A0BA 2EQNA 1WXRA 4LK4A 3TNSA 4GHQA 1YGCH 1L0ZA 1EJMA 2ZHDA 3DT0H 3SORA 4B76A 2ZA5A 3SU2A 2Q6GA 4Q7ZA 2AFQB 3F9EA 3PWCA 4Y71A 1H4WA 1XXFA 2PR3A 3M36A 4FUGA 1EASA 2UWLA 1G2LA 3MH6A 3GCTF 3K9XB 1CGJE 3FANA 1VCPA 4DCDA 1RRKA 2YMSB 3DFLA 2VJ1A 4O3TA 4NG9H 3TH3H 5GWZA 2G8TA 3SNEA 3T5FH 1RGQA 1FQ3A 2VGCC 4JZ1A 3LGTA 1GI8B 3M61U 4ABBA 3UY9A 5ABWA 1H9IE 1ZSKA 2ZHEH 1QRZA 3BIUH 4GAWA 1EPTA 3DUXH 4KTSA 4YLQH 1SQAA 1HAVA 2ZPSA 2TGAA 1TFXA 1KSNA 2QF4A 1PQ7A 2A7CA 1H8DH 2FTLE 3A8CA 4INHA 5KGOA 1XX9A 3KN2A 2G55A 3UR6A 1BDAA 4K2YA 2R0LA 2WV9A 3GY5A 4ZKOU 1O2WA 1TPSA 4OS6A 3LKWA 4DVAU 3STJA 5EW1H 4B6FA 1MTUA 2V35A 1Q2WA 1VGCC 1GBHA 2ZGBH 1ZJDA 1A0JA 1KLJH 1UW7A 4Q80A 5DP4A 3PV5A 3AW0A 1EAIA 1XMNB 2PGQB 2H5CA 1ELVA 1TWXB 3ATWA 3PO1C 4FXGH 1P9UA 1T8OA 1SGPE 1O2MA 3QZQA 3MU4A 4NFEA 2AMDA 2BQ7B 1D6RA 3SV8A 2P59A 1TX8A 1NT1A 1ELDE 1MTNC 1X7AC 2WSSD 3QTVH 3ZV8A 1GJ9B 2GKVE 3VB7A 4INKA 1UTJA 4X6NA 1AD8H 4Y11E 3GY2A 3L33A 4LZ1H 2R0KA 2JH0D 2ZF0H 1P2NA 2GCHG 3RC4A 1W0YH 2QF3A 4UD9H 4Z0KA 1MTSA 4DIHH 2VWLA 5C67A 1AQ7A 5FPYA 1IQIA 1HIAA 4CRDA 3A89A 4ISOA 1ARBA 1HJ8A 3SI3H 3TITA 3LC3A 5C3NA 2KAIA 2Y7ZA 3PM3A 2QGRA 1IAUA 3TJOA 4XRNA 1FXYA 5C5NA 1C5RA 2R3YA 1UTNA 2ZDKA 1AMHA 3GCTG 2CMYA 3P8OA 3PB1E 1DICA 3M7QA 2Y6TA 1FY3A 1KXAA 5EQRA 1O37A 3Q3KA 3SV9A 2AHME 1IQLA 1CBWC 4ESTE 3RXEA 4ABHA 3PLKA 1D3DB 2BD5A 4B74A 1F2SE 3A7TA 2IJOB 1ZSLA 4K60A 4NZQA 4SGBE 2PW8H 2WV5A 3B9FH 3A88A 2OC8A 1PPBH 5FPSA 3RUOA 4Z1MD 2BZAA 1EP5A 1FN6A 1OS8A 1YLDA 3AASA 2OC7A 1XUJA 1QBOA 1HV7A 1KLIH 1QHRB 4AG2A 4YZUA 1TQ0B 1OX1A 3UQVA 5T6FA 1BHXB 3MU1A 3OU0A 1P3EA 4K8BA 1QBVH 5AVDA 1DWDH 2BVXH 1C5NH 1UTKA 2QV1A 2ZU4A 2BD3A 2Z6BD 3ATMA 4XSKU 4XBCA 4RI0A 1C5ZB 1YP9A 1NZQH 5CE1A 5C5OA 1ID5H 4ABFA 1O0DH 3F1SB 1TGCA 3GDUA 1GHAG 5E2PA 3FO8D 4Q7YA 5EPYA 1C1MA 1GCTB 1OWDA 3VG8A 1EPTC 1SGCA 1TLDA 4I31A 1AKSB 5LH8A 1PPZA 3SZEA 1IQHA 2AGEX 1HBTH 1CGIE 2F43B 2YMSC 1NC6A 5FBEA 1LPGB 5AF9H 3O8RA 3SHAH 1AY6H 1P2OA 5GDSH 3U8OH 3MYWA 4D7FA 4K5ZA 3OEHD 4DG4A 4UONA 3U1JB 1UCYE 4J1YA 4AZ2B 3SU4A 4CBOA 1TOCB 2QC2A 1EZXC 4Y6DA 1TNJA 2ANWA 2FEQH 1N8OC 2ZDLA 1C5PA 3R0FA 2FOMB 4B2AA 1ESBA 1VITF 2A45B 1HPGA 1JIRA 2AS9A 1P8VC 3HPTB 3RMNH 1W7XH 2PGBB 3V0XA 3QK1A 2VH0A 3ZZCA 1O2UA 1S6LA 1W0KD 3I78A 5ESTE 2FOFA 3TH4H 5EIYA 1O2OA 3LOXA 3SQEE 1WAYB 1VGCB 1D3QB 1YPMH 2FMJA 2QYIA 2G00A 4H6TA 1TOMH 1QNJA 2JJ2D 4M7GA 1O33A 4OGXA 2A2QH 2BY8X 3SU5A 5ETXA 1S0RA 5C94A 4GVUA 4I33A 2AMQA 4JCNA 1TA2A 2ZU5A 1C2FA 1PYTD 3MH5A 8GCHG 1GL1A 2ZQ2A 3SU0A 1NBME 1HFDA 1HRTH 1EX3A 1LHCH 4BANB 2ZGJA 2PKSB 3P95A 3UWJH 4ZCNA 2LP6A 4MPWA 2H5DA 1LO6A 1SQOA 1ELFA 5FX5A 5A8YA 1K21H 1INCA 2BVSH 1P3CA 4AB8A 1GHXH 1BRBE 1A4WH 1T7CA 5DN6D 2SNVA 4YT6H 1E1QD 1KDQB 1QQUA 3KHVA 1Z6JH 2PKAB 3KYGA 1NFYA 2VIWA 3M7TA 1A1RA 2V6NA 3DD2H 3JZ2B 4HZHA 1NS3A 4Y7BA 2HNTE 3A7XA 1ZPZA 5EJZA 1QR3E 4WMFA 4IN1A 5EQSA 1FI8A 1F7ZA 1IHSH 1GBAA 3ZZDA 1OWIA 3UFAA 1C2HA 1NTPA 1RS0A 3L3TA 2EI6A 1DDJA 3OX7U 1KTTB 1TALA 2Z3CA 2VU8E 2BLQA 3SUGA 2YNAA 4ACAA 2JJ1D 3GOVB 3MNBA 4KKDA 1O2VA 2A31A 1GJAB 1DXWA 1C5XB 1J8AA 2B9LA 2GJGA 1B7XB 1OPHB 2G51A 4K1TA 1TPAE 2J5UA 3STIA 1LVMA 1GGDB 1UVUH 3OTJE 4TPYA 1HLTH 1GHBF 2QF0A 1JWTA 3RXGA 3TK6A 3SGQE 3RLYH 1P2KA 1VCWA 1FAKH 1DITH 1EOJA 1W2KH 1L1GA 1ESTA 1G30B 3M5NA 4ZKSU 4ABIA 2XCNA 1EJNA 5C0UA 1SLUB 3S69A 3DSGA 5G4BA 4X8SH 4AFUA 1A61H 1MU6B 1EB2A 2ZZUH 1O2QA 3HK6B 1P2IA 3UUZA 5LPFA 2HPQH 4ACBA 2WUCA 4OGYA 1Y3UA 3QX5H 4ZH8A 3P6ZB 4OS5A 4CRFA 2XC5A 5HKKD 3E16B 5JDUB 3AW1A 3LGUA 5A0CA 2RDEA 4I32A 4WMEA 4Q7XA 1T32A 3RXHA 4YT7H 1TYNA 1RIWB 1WOFA 3DSPA 2BHGA 1O3EA 4RT1A 4BNRA 1W8BH 1HAIH 3LH3A 2OUAA 1BB0B 3BN9A 4NIXA 5C1UA 2G4UA 3QDZB 1YPLH 1ZTJA 5SGAE 4IS5A 5JB8S 2Z9GA 2GCTB 1F5KU 3BEFB 4GHTA 3T25A 1O3AA 1T8LA 3EYDA 1S84A 1O2PA 1GBJA 1G3BA 1KXEA 1EB1H 2Z9IA 4WXVA 3M5LA 5FXLA 1GDUA 1KXDA 3RU4D 1EATA 3SV2H 4NIYA 1SB1H 1GBFA 3WWBA 3ZVAA 3RXTA 2GTBA 5A8ZA 2F9PA 4ZXYH 1L1NA 1LHFH 3RXMA 1BA8B 3S7KB 5A0AE 1HAZB 1BJUA 1NRSH 1QA7A 5IK2D 2OBOA 1EXFA 3RP2A 3RXPA 3UOUA 4DY7B 2GP9B 1THRH 6GCHF 5PTPA 1IQJA 2GVFA 3SNBA 4NA7A 4K3JA 2OXSA 1AO5A 1P12E 1F92A 3B23B 1LQDB 3GISB 1GI2A 2KM0A 1GJDB 1ZGIA 1ZPBA 5DP5A 1C2DA 2C93B 2C90B 3FP6E 2PSYA 5A09A 3UWIA 1AE5A 1LHGH 2A7HA 2OC1A 2Y5FA 2O8WA 5AFZH 2PKSC 3ODDA 2WPKS 1JMOH 1UMAH 1GI9B 1UTQA 2UUKB 1RTFB 1AB9C 1S0QA 3T62A 3ZZ4A 2XW9A 3O8CA 1CA0C 5JBBS 3EA9A 3KQCA 3Q00A 1GG6C 4OS4A 1IQEA 1DXPA 3U8TH 2A5IA 2STAE 2IPQX 2H2ZA 2HVXA 1NY22 3A82A 1D4PB 1GJBB 1AVGH 4INLA 3ZVGA 1E35B 2ZC9H 1VJAU 5T3HA 1XKAC 3URCA 4X2YA 1CO7E 2OBQA 2XC0A 1A0LA 1TAWA 1HAPH 1FJSA 2ZI2H 3BSQA 4ZKRU 2GD4B 1MTVA 3RXQA 2BD2A 1MMJN 4UFEH 6GCHG 4JMYA 3GCHC 3RXOA 3TGJE 1SG8B 1TNLA 3KQ5A 4K8YA 2JDID 2XTTB 4FUDA 1DWBH 4YOJA 1C4U2 3EQ0H 1AUTC 1Z8RA 2AMPA 4JZFH 3RXLA 4ABJA 5GXPA 1Y59T 1TMTH 4FETA 1DE7H 4NZLA 4YESB 1YBWA 1GMHF 1EAXA 3RMMH 2ZCHP 2H9TH 1J15A 3ATIA 3SNCA 6LPRA 2LPRA 3GYMA 4DT4A 3URDA 3PYHA 2C3SA 4WWYA 3T27A 3PTBA 4ABAA 3SU3A 2ZFQH 4KGAA 5EGMA 1AVXA 1ZMJA 1AFQC 3KQEA 2B0FA 3FZDA 3LGWA 3TK5A 1DFPA 2GGVB 1GVZA 4AFZA 1BMMH 2ZO3H 3UR9A 3A8BA 3VXFH 3R3GB 1O5FH 5EJ1A 1OWJA 1Z1IA 2OINA 2ZEBA 2QA9E 1MTWA 2XBXA 1BJVA 1E1RD 1PQAA 1VCQA 5DP6A 1GPZA 3MNSA 1BTYA 1L2EA 1YYY1 3MU5A 2BZ6H 3IG6B 2ZPRA 4PROA 1Y3YA 4WJG2 3MMGA 4JZEH 1IQKA 5FBIA 1N8OB 3E3TA 4K69A 1IQNA 1ESAA 1IQMA 5TJXA 3U9AH 3RXFA 5ESBA 1JRTA 1EQ9A 1NBMD 3LC5A 3BG4B 3F9GA 2W6ID 1DT2A 2Z7FE 1GVLA 1MKWK 1O2ZA 3W1EA 1WBGB 1O34A 3RMLH 3A7VA 2FYRA 4WXIA 1FY8E 1O30A 1O36A 4HG6A 3ZZ3A 4FUHA 1C1RA 5DSFA 2BQ6B 2FX4A 2EA3A 3VPKA 1ZR0A 2Z9KA 4FVBA 4OS1A 4YLUA 2GZ8A 4KELA 5KEDA 2UWPA 4THNH 3GCHB 3SO3A 5DG6A 3DSOA 1ZRBA 2O8MA 2TGDA 4B6EA 1K28D 1HNEE 3FVFB 3D49H 1SGRE 2SGFE 3SV6A 2VWOA 5CHAB 1A5GH 2A4QA 1HJAC 1TRMA 2HNTC 2W26A 1LDTT 1SLWB 2STBE 2OD3B 1DOJA 4O9VA 1AIXH 1TB6H 4JK5A 1TABE 1P03A 1TX7A 3M5MA 2PSXA 3OTPA 3KYFA 3LJJA 2XNDD 3H5CB 3VB6A 4UDWH 1QGFA 5B6LA 2F9VA 5DP8A 1TGTA 2O8UA
chains in the Genus database with same CATH topology
3OYPA 1RTKA 1CVWH 4WH6A 2M5TA 5HMAA 1KDQA 2QY0B 3Q76A 1NO9H 4ABGA 1G3EA 1D9IA 1C1OA 2Z94A 3CS0A 2ANMH 3T2NA 2PTNA 1G3DA 4B1TA 1O3LA 1C2GA 2ZCLP 2DE8A 1O3MA 3A87A 1YPHC 2VVVA 3VGCC 1P02A 1GBTA 1AU8A 2FOHA 1C5WB 1SGQE 2W3KA 1CT0E 1MAYA 1XVMA 3ATKA 3K6ZA 5H4IB 3E0NB 1S6HA 5AHGH 3I29A 2J92A 1YPKH 2VIQA 2FYQA 1LCYA 5HYOA 4FU7A 3A80A 1CBWB 4IGDA 1YPGH 2VB0A 3ZZ6A 1MH0A 1FIWA 1DM4B 1EUFA 5LGOA 1HAOH 2G4TA 1YKTA 4MG3A 5BRRE 4B75A 5CMXH 1YC0A 3BEUA 1KXFA 3JZ1B 1D6WA 2YNBA 5JBTA 2SGPE 2F91A 1WTGH 1O3CA 2D2DA 3SJOA 3QWCH 2A4OA 1A3BH 3NK8A 2OP9A 2RA3A 1O5CB 2RCEA 3V3MA 4D9RA 1BMAA 2EEKA 2O8TA 1V2VT 5EG4A 3A83A 4JYTA 1O3DA 1NROH 4RKOB 3Q3YA 5DJ7A 1YLCA 1QIXB 1GJ4H 2EC9H 3MH7A 4FUBA 1ABIH 3KL6A 2Q6DA 8GCHF 2NU3E 2QCYA 1P09A 2BY6X 4BAMB 3E6PH 1Q31A 5DPAA 1J16A 1IHTH 2UUJB 2TGTA 1H1BA 2QXGA 2ULLA 4Y7AA 3QGJA 3LGVA 1UTLM 1LQEA 3E1XB 9LPRA 1ETTH 1AB9B 1PPEE 2PLXA 3VXEH 1BOQA 1Z8JB 5F03A 1MKXK 4NSVA 3LPRA 1ZHPA 3RLWH 3RXRA 2P93A 1W12U 2PKAA 3TLOA 3BG8A 1GHYH 1AGJA 2F9OA 5E0HA 1UHBB 1ZRKA 1B0FA 3E90B 1BRUP 1GHWH 3GDSA 2XXLA 5EPNA 3ELAH 4O97A 1EAWA 5HM9A 8KME2 1C2EA 3UNQA 3BF6H 3BTHE 1AI8H 4MTBA 3K6YA 4X8VH 2AEIH 2Y82A 1WUNH 3GICB 6CHAB 1JOUB 1KY9A 1GI5A 3MO6A 1A46H 4MDSA 1SGDE 1M9UA 3MTYA 2ALVA 2FI4E 1C1QA 3Q3XA 5IDKA 1TONA 1YCPK 2J94A 3VB4A 2CHAB 1C9PA 1OWKA 1YPJH 4H4FA 1Y5BT 2BDIA 5DGJA 1CA0B 1ZJKA 1NFUA 2BD9A 2OCVB 3TPIZ 2ZKSA 1NRQH 1RD3B 2BB4A 4CRAA 1YF4A 1WQSA 1BQYA 3M3SA 4UFFH 3PV4A 5EQQA 1DWCH 4X2VA 4Y79A 5C1YA 1O2HA 4YOGA 3P8FA 1THSH 2Z3DA 1GBKA 1O5DH 1GBBA 3K2UA 1F0SA 2ZGXH 1FN8A 4U30A 2R9PA 4D8NA 1QA0A 4JK6A 1ANEA 1P2QA 4XBDA 1CU1A 1EZQA 5HM2A 4CBNA 1IQFA 1BRCE 1RFNA 3ZYDA 2C8YB 1EZSC 2GDEH 5I25A 3HGNA 2TPIZ 1GBCA 1KTSB 2ZHFH 1WTHD 1QB6A 1C1SA 4I8GA 4A1TA 3QLPH 4FUIA 4KTUA 4HTCH 4J2YB 2GZ7A 1OWEA 1GI1A 4RKJB 1HJ9A 4NIVA 1TNIA 4XOJA 1VITG 1HGTH 2BX4A 3SI4H 1CSOE 4XE4A 1A2CH 1BRAA 1UVSH 2GCTC 3F68H 1GMDG 2WYGA 1HIAB 2XWBI 5EXMA 1GHBG 3MNXA 4BAKB 1BBRE 2WPMS 2IN2A 1SLVB 2VH6A 4E05H 1LHDH 5A8XA 3S0NA 2NU1E 4Y8YA 1CQQA 1E0FD 3TK9A 1ETSH 4A1XA 2G52A 1QL9A 1VJ9U 1UVOA 5DO4H 1G36A 2ALPA 3ZZBA 1DY9A 3SGBE 1Y3WA 1S81A 1T31A 1SGNE 4NA9H 1ORFA 2AIPA 1ZMNA 2Z3EA 1C5MD 3FAOA 4WMDA 1SFQB 2WV4A 1DSUA 1XVOA 1SGEE 2EI7A 3TJUA 5I46H 2BDHA 3T26A 1E36B 5TCAA 2ZPQA 4XBBA 1V2QT 3LH1A 3LDXH 1MQ5A 1V2OT 1P2MA 3PO1B 4NGAH 1GCTC 1A3EH 1O5GH 2D26C 1Y3VA 1C5VA 1AWFH 2J38A 2NU0E 3QUMP 2RA0A 1UK4A 3BIVH 1KIGH 2ZGHA 2QXJA 2ZIQH 1BTPA 3AVZA 4BTIB 2VGCB 2ODPA 1BTWA 2BY7X 1MTNB 4A5TS 2QXHA 2ZU3A 4FU9A 2FX6A 2WPIS 1SI5H 4NIWA 2BX3A 4OS2A 2UUFB 5LPEA 4KTCA 1AFQB 1BUIA 1GGDC 2WYJA 4TPIZ 3SGAE 3SUFA 4JYUH 3NPSA 3ZZAA 1T8NA 1O2TA 4Y0ZE 3TU7H 2UUYA 2PWXA 1K1JA 1O2YA 2FZZA 1ETRH 1O2LA 1CT4E 1CGHA 1GBIA 1AZZA 1LKAA 1RXPA 1QB9A 3HGPA 4FUJA 1P2JA 1ELCA 1P11E 4NWKA 1O32A 3OSYA 3SNAA 2FOGA 3PMHB 3A7ZA 1NM6A 1L4DA 1TBQH 1V2NT 1ZZZA 1DUAA 3RXSA 3V12A 4WF8A 2GV6A 4AX9H 1O3BA 2J4IA 3K65B 1C1WH 1ZTLA 1DPOA 5EOKA 1C2JA 4JYVH 1MKWH 2ZWLH 5C1XA 4ZXXH 3RU4T 1NN6A 1GI0A 5DP9A 2QIQA 3CENA 1MCVA 4I8LA 1BMNH 3RMOH 1IQGA 1ACBE 1TQ7B 2J2UA 2FI3E 3DHKH 2UWOA 1KXBA 3KNXA 5C20A 4IW4E 1T4UH 2O9QA 1ZSJA 5K7RA 4TY6A 1NRRH 3U98H 4GUXA 3TVJB 1K1PA 3RXDA 2TBSA 1MCTA 4GCHF 1K2I1 2PFEA 5GCHF 3SHCH 1CA8B 5HXFA 1VZQH 4IC6A 1SVPA 2GV7A 3S9AA 1AFEH 1GBMA 3FP7E 2FTMA 1Z71A 3QN7A 2ZECA 1MD7A 1O2RA 4X6MA 1C5TA 2BLWA 3TNTA 1TNHA 1V2RT 2BOHB 5EW2H 1OWHA 1HUTH 1DUEA 2IOTA 1ELBA 1O2IA 4H6SB 4VGCB 1UVPA 1LVOA 5LPRA 5FX6A 4ABDA 3C27B 2FOCA 1TA6A 3MWIU 5FHTA 2C8ZB 2B8OH 1OP8A 1C2IA 2HLCA 1AHTH 3M3TA 4YTAA 4DOQA 1GBLA 3F6UH 1QURH 2I6QA 2XC4A 1YCPM 1CHOG 4RSPA 4MNWA 3ZVCA 1O5AB 1LHEH 3W94A 1C2LA 1UTPA 1C1UH 4ZHMU 2CF8H 1MD8A 1P57B 4UFGH 2WINI 2NU2E 1XUGA 4DW2U 2ESTE 1AVWA 3RU4E 3I77A 1GJ8B 1S82A 2PUXB 5GPIB 3ENSB 4BTUB 4K1EA 2FODA 3LJOA 4IBLH 1EOLA 2A4RA 1XUKA 2AYWA 1WU1A 9ESTA 2LNCA 2BOKA 2FESH 1BTZA 1PPGE 3DFJA 1IOEA 1GMCG 1KYNA 1MZDA 3HKIB 3E91A 3KGPA 4E06H 4Y0YE 2A32A 2BY9X 2ZHWH 2SGEE 3SJ9A 1GHVH 1GBEA 3M5OA 3MU0A 3RXCA 2SGAA 1O3HA 2CJIA 4AFSA 2A0QB 3BEIB 3S9CA 3SBKA 1BBRK 1Y5UT 1FY4A 2F83A 3P8NA 4IC5A 2ANYA 1JIMA 4NWLA 3UNRA 1V2TT 3SV7A 2VVCA 1O3NA 2FXRA 4ZAEA 3GY4A 4R0IA 3SU1A 2D8WA 2TIOA 3NUMA 1S6FA 3UPEA 1QFKH 1TMUH 4ABEA 1TIOA 1GBDA 1TGNA 1Z7KA 5EODA 2VIPA 2JKHA 4XDEA 2OTVA 2H6MA 1SSXA 4GLYA 2GDDA 2FDAA 1HAGE 1W10U 3VGCB 2ZFSA 4AOQA 4D76A 4HGCA 1GMHG 1OOKB 4AYYB 5J4QA 1V3XA 2JETC 5T6GA 1SLXB 5A2MH 3M3VA 4FUFA 2CV3A 1QRXA 5F8TA 3D23A 1ZHRA 1QCPA 2ZNKH 1GJ6A 2F3CE 1NU7B 1P9SA 2RG3A 1S85A 1Z1JA 2ASUB 5IYTA 4JZIA 1L4ZA 3HATH 1BTHH 1BIOA 1GG6B 1PQ5A 1KXCA 1O2GH 1CHOF 3CS7A 4SGAE 4TWYA 1FDPA 1HDTH 1HAXB 2F9NA 1BZXE 4UFDH 2GX4A 4B71A 3NKKA 1QJ6B 1H9LB 1HXFH 3A86A 3U69H 1QB1A 1P06A 3BTME 2F9BH 4CR9A 1Y3XA 2YOLA 4LOYH 1G32B 3GY3A 3O8DA 8ESTE 1F0UA 2HGTH 3NWUA 3ZVEA 1FUJA 4O03A 1QBNA 1U6QA 5DKMA 1OYTH 3AAUA 1SL3A 3KF2A 3ZZ5A 1MZAA 2Y81A 1LVYA 3IWMA 4ZUHA 2BD4A 4A92A 1OP2A 1MBQA 3ZVFA 1C5YB 1GHZA 3ITIA 4MVNA 4CH8B 3D62A 4MNYA 1C2KA 3PMAB 3M37A 3TH2H 1FLEE 2WPJS 2C8XB 4AORA 3SJKA 1GJCB 1J14A 3H7TA 4ZHLU 2ZG0H 4QT8C 1O3IA 3HKJB 2IPHA 1GI3A 2F9UA 1GJ5H 3RXAA 4CR5A 2ZFFH 5B6OA 1TBZH 3PMJA 3NCLA 4NSYA 1V2LT 2FOEA 1DANH 2HWLB 2PHBA 4ISIH 2ZFPH 4BTTB 3ZVBA 1DX5M 1TMBH 2JETB 3KCGH 4MPUA 2ZHQH 1BTXA 6CHAC 8LPRA 2XWAA 1B5GH 2BLVA 1FAXA 1FNIA 3EDXB 2GMTB 3FZZA 3MNCA 4Y8ZA 1G9IE 3GY7A 4MQAA 3UTUH 1F0TA 1O3PB 3RXJA 1O3GA 1O5EH 1GWAA 2ZTYA 3BTFE 3UQOA 1SHHB 1DSTA 3OY6U 1GMDF 3BTGE 4I7YH 1K1IA 3SU6A 1J17T 3A85A 2BXTH 1W3CA 4HFPB 3MFJA 3QZRA 1C5LH 4ISHH 1A7SA 5T6DA 4E7RG 7GCHG 1LPZB 2BDBA 4Y10E 1TGBA 1TBRH 2R2WU 4Z6AH 2BM2A 1N1LA 4CHAB 2XBYA 3WY8A 1DS2E 5F8XA 3RM2H 4ISLA 4MPXA 4TY7A 4X2XA 1Y8TA 2OQ5A 1T8MA 2WPLS 1ANCA 3TIUA 1NPMA 1P0SH 3U1IB 3MU8A 4X6PA 2P8OB 5GJ4B 5DP7A 1GI4A 1AKSA 1PPHE 2ZTZA 1QL7A 3TJVA 1EZUC 1ARCA 3AAVA 1HCGA 2Z9LA 2J9NA 3V7TA 2J34A 2PUQH 2ZTXA 1V2JT 3RXBA 2QXIA 4X0WU 2FWWA 4HI3A 3SJIA 3PROA 1XM1A 1BTUA 4FVDA 1ANDA 3VEQB 1LKBA 4X8UH 2Y5HA 1V2ST 4RN6A 1NRNH 2VWMA 2HPPH 4AN7A 1SGYE 3GCOA 1TPOA 4MNVA 4XFQA 4LXBH 1UJ1A 1GI7B 3ZYEA 1BMLA 1UHBA 3VB5A 1LMWB 3VB3A 3BTTE 2AGIX 4ZHAA 1K1MA 1AN1E 1GMCF 2VNTA 2H9HA 1EJAA 2BLOA 4GPGA 4YOIA 4ZMAH 3BTQE 2DE9A 2G81E 2P95A 3MHWU 7ESTE 2P94A 1CE5A 3SNDA 1ZGVA 2WPHS 1TPPA 5EXNA 2BD7A 2GMTC 4WH8A 1PJPA 5E0JA 2A5AA 2BDCA 2GT7A 1AWHB 2KAIB 4F4OC 3E0PB 4FUCA 2VIDA 4Y76A 5JB9S 2RDLA 5JPMH 3T29A 3PWBA 3KEEA 1HAHH 5TCCA 3P70B 3SQHE 1TNKA 3QO6A 4IMQA 1BITA 1DWEH 3DA9B 1C4Y2 4UEHH 1BT7A 3EE0B 3VFEA 1MKXH 1C1TA 3UOPA 1P10A 1O2XA 3ZZ7A 1OP0A 1HB0B 4X1RU 1C1VH 5DP3A 1D3PB 1SPJA 3A84A 2FLRH 4AGJA 1DLKB 3EAJA 2SFAA 1O3KA 3ODFA 4DURA 5CHAC 4BAOB 5DK1A 2FS9A 2SNWA 2VVUA 1GI6A 1QRWA 3E8LA 1EKBB 2Y5GA 1Z8GA 2XBVA 4H42U 6ESTA 2C4FH 1UTMA 3RXUA 2W7UA 1H8IH 1N6XA 4TYDA 3O8BA 3BG4C 1E34B 4BXWA 2BY5X 1SBWA 2ZU2A 1W11U 5L6NH 3EGKH 4BAQB 1TRYA 2D1JA 3RC6A 1O31A 1V2PT 1GHAF 7LPRA 2Z9JA 4NFFA 5GIBA 2Q1JA 1A5IA 4Y8XA 1O35A 2ANKH 2GCHF 1OKXA 1T4VH 2DUCA 4UE7H 1HAVB 2XNIA 2THFB 3LGIA 5FPTA 2J95A 5L2ZH 1SGFG 4TWWA 1LPKB 1MAXA 3GCNA 3FFGA 1K1NA 2HRVA 2OLGA 1NRPH 3KIDU 1YPEH 1O3JA 1FV9A 1MU8B 3P17H 1UCYH 2ZCKP 3D65E 3S9BA 4WVPE 1MQ6A 2JH5D 5EXLA 3BV9B 2CN0H 1G37A 4BXSA 1NFWA 3BTKE 1ZHMA 3RXIA 1BHXF 3BTDE 2CF9H 2NWNA 3SOSA 3SUDA 1PYTC 2W3IA 2BXUH 2FOBA 3LU9B 2FI5E 1LTOA 2CHAC 3LIWA 2P16A 3SZNA 1V2WT 4B2CA 1F5LA 4KP0A 2ZFRH 1ELAA 2A4GA 1SFIA 5JBAS 3ZZ9A 2ILNA 1ANBA 1Y5AT 2VIVA 1WSSH 2ODYB 4B2BA 4GSOA 1W0ZU 4F49A 4E7NA 3QGNB 4YO9A 3ESTA 4X1QU 1A0HB 3GYLB 1JXPA 2V3OH 4LZ4B 1UVTH 2G5VA 2FO9A 2ZFTA 1FPCH 3ZZ8A 1RIWC 1MUEB 2SGDE 5K0HA 2TRMA 1F0RA 2QAAA 4MLFB 2P8OC 3TGIE 1OSSA 3RXVA 2Y7XA 1O5BB 4ISNA 2AGGX 4CRGA 3FP8E 1V6DA 2P3TB 1C5QA 1C5SA 1SC8U 3TGKE 1G2MA 1QJ7B 2BMGB 1ABJH 2BDAA 4CRBA 1A5HA 4U2WA 3GDVA 2VWNA 4BOHA 2V0BA 1J9CH 1RTLA 4X1PU 5JBCS 3V13A 1C4V2 2ZDNA 1ELEE 1SGFA 1ZTKA 3PTNA 2A2XH 3RM0H 1GL0E 1L1JA 4FU8A 1V2KT 1Z8IB 2R3UA 1FY5A 1PPFE