4A1TA

Co-complex of the of ns3-4a protease with the inhibitory peptide cp5- 46-a (in-house data)
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
197
structure length
193
Chain Sequence
GSVVIVGRIILSPITAYSQQTRGLLGCIITSLTGRDRNQVEGEVQVVSTATQSFLATCVNGVCWTVYHGAGSKTLAGPKGPITQMYTNVDQDLVGWQAPPGARSLTPCTCGSSDLYLVTRHADVIPVRRRGDSRGSLLSPRPVSYLKGSSGGPLLCPSGHAVGIFRAAVCTRGVAKAVDFVPVESMETTMRGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/peptide
molecule keywords NONSTRUCTURAL PROTEIN 4A, SERINE PROTEASE NS3
publication title High Affinity Peptide Inhibitors of the Hepatitis C Virus Ns3-4A Protease Refractory to Common Resistant Mutants.
pubmed doi rcsb
source organism Hepatitis c virus
total genus 51
structure length 193
sequence length 197
chains with identical sequence B
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2011-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02907 Peptidase_S29 Hepatitis C virus NS3 protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4a1tA02
2.40.10.120 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 4a1tA01
3Q00A 4GHTA 1E34B 4K1EA 2HRVA 4B1TA 1UO6A 1YCPH 4AN7A 1NFXA 4X8VH 2QF3A 2FOCA 2ZCKP 1C1TA 2FZZA 4Q2KA 1IQEA 4NIXA 2D2DA 1C5SA 1FY3A 2BQWB 3TIUA 4INHA 4KGAA 2HVXA 3ZYDA 1QCPA 3FP8E 4D76A 3Q76A 3AK5A 3D65E 3R3GB 4O97A 1KXBA 1Y3XA 1ZPZA 1ETSH 5ESTE 4RKJB 1HDTH 3Q3KA 4ZAEA 5LH8A 2J34A 1A0HB 1XM1A 2WPHS 1TX8A 2FYQA 4JK5A 1WQVH 1WYKA 5A8ZA 1D6RA 3JZ2B 2GMTC 4U32A 4GVUA 3CP7A 3UOUA 1GI5A 4MNYA 1C5UA 4IW4E 1EZUC 1V2VT 3BG8A 1EATA 3A7TA 2P3UB 3BG4B 2BD8A 4LOYH 1ABIH 5EW1H 1N6XA 1CHGA 1SGIB 3M61U 3OTPA 1BJUA 1J17T 5FX5A 2BY9X 8LPRA 1Y3WA 4XDEA 1GMCF 5TCCA 1FPCH 1XXDA 1TBZH 1VJAU 4Y8ZA 4GHQA 3M7UA 1AD8H 2FOFA 1N8OC 2BD4A 1O5EH 2A31A 3T2NA 2VIOA 4K5ZA 2Z9JA 2Z94A 1V2RT 4ZHAA 2YNAA 1HUTH 3LPRA 4CR5A 3ODFA 1GJBB 1YPHE 1QB1A 2BDBA 1EASA 1MBMA 1SBWA 5E0JA 3UNSA 4MPWA 4DJZB 3HGNA 2BD7A 3PWCA 1B0FA 1QBNA 3OY5U 3NZIA 1S6HA 1THRH 3ZZDA 5T6DA 5JB9S 5JBTA 3P6ZB 1C5MD 3ATIA 3PO1B 1O3PB 4FUDA 3ZZ3A 2UWOA 1C2KA 1C5QA 1QL8A 4AGJA 3SNAA 2HGTH 2PKSB 1CHOF 4VGCC 2Z9GA 3AW0A 3QGJA 5FHTA 4JYTA 1QRXA 2DE8A 1IQKA 2VIDA 1Y3UA 4GCHG 1FPHH 1SGPE 4WMDA 3QGNB 5GWZA 4UONA 2ZP0H 3PWBA 4UE7H 1O2OA 3KQBA 1HXFH 1FN8A 2PGBB 3OYPA 4TPYA 2AMDA 1YPKH 1DICA 1VITG 2G4TA 2HPPH 4AFZA 3U1IB 1ELFA 2BXUH 2WUCA 3GYMA 4NCYA 1W7XH 1QA7A 3AW1A 2XCFA 2PLXA 2WPIS 4MTBA 4WH6A 1EUFA 4Q7YA 3T27A 2LPRA 1JWTA 1Z8GA 1JXPA 5I25A 3LGWA 5TJXA 1FXYA 1IQFA 3RXHA 3RXJA 1O37A 1HAVA 2G51A 1C4U2 1Q3XA 3JZ1B 3N7OA 2DE9A 1ESTA 4TYDA 1EX3A 1KXFA 1O5CB 1DUEA 4XBDA 5EG4A 3MFJA 1CGJE 2WPLS 1ZPBA 2WUBA 1AIXH 3M7TA 3KQCA 3HPTB 1HV7A 4BTTB 1O3BA 3SNBA 2TRMA 7GCHF 2TPIZ 4HTCH 2VWNA 4X2YA 1HJAB 4YT6H 4X6PA 3RXGA 1P04A 1DT2A 4Y10E 1XUJA 2BXTH 1O3CA 2OC8A 1UVOA 3O8RA 3GDUA 3NCLA 2C8WB 4CRFA 5HXFA 4ABFA 3OX7U 3F1SB 3BIUH 3A7XA 5TCAA 1BMMH 2BY6X 5CHAB 2ZDKA 4CRGA 3S9CA 3MNCA 4JMYA 1F2SE 4GSOA 1V2ST 2Z9LA 4CHAC 3UIRA 1D3TB 1GI3A 3UPEA 1GBKA 1PQ5A 2J38A 4FUEA 3EA8A 1SGCA 6CHAC 1EB1H 2PTNA 4AG1A 1FIWA 2Z3CA 3LGTA 1O2XA 1VGCB 2GP9B 1MTUA 2AMPA 2FP7B 4UD9H 3H09A 5F8ZA 2GCHF 3SQEE 1C2JA 4KTUA 3BEFB 3TVJB 1E36B 5C1UA 3S9AA 3SGBE 1BOQA 2BOHB 2ZA5A 4IMQA 4IN1A 3WY8A 3AAUA 1BBRK 4KELA 1P2OA 2STAE 4QT8C 3SNDA 4X8UH 1ZGIA 1GJDB 2A4OA 1O5FH 2SGAA 2J95A 7ESTE 1XUFA 1O3MA 1JRSA 2ZFSA 3DT0H 1GHAG 4J2YB 3UNRA 2BX3A 1AZZA 2A7HA 2W7SA 1EJNA 1A4WH 1OWDA 2PKAB 3PLKA 3GY2A 3SHAH 1ELVA 3AAVA 1CBWB 1MKWK 1BTPA 5IDKA 1ZSKA 3VGCB 1YYY1 1O3KA 4ISOA 4WF8A 1O3JA 4RI0A 3T25A 3PV2A 4O3UA 3RXQA 4A92A 3PV4A 1O5DH 2J94A 3W94A 3ZVCA 2O8WA 2UUFB 1C2GA 2KAIA 2D8WA 1CO7E 1DXWA 2QXGA 1BHXB 2EI6A 3GDSA 5JYIA 3C27B 4Y0ZE 1T4VH 4K60A 1A2CH 1KXCA 2GMTB 4JZIA 1TNKA 5E0GA 3B9FH 1K1PA 1OP0A 2PR3A 5DG6A 1D6WA 1BBRE 3QZQA 2XBYA 3Q3YA 1CU1A 2OXSA 3FVFB 1OWJA 1ZTJA 3P8FA 4BAQB 3KL6A 2F3CE 3UNQA 1GJ8B 4X1RU 1O2KA 1MQ6A 2BLVA 5FCKA 2FM2A 3UTUH 1C5VA 1YCPK 3NUMA 3O8BA 1AGJA 1F5LA 4DIHH 3VB4A 2W3IA 2FX4A 3PMBB 1O3OA 1FY4A 5E2PA 4IGDA 3BTFE 1K1MA 1VCWA 3IWMA 3MO3A 1GL0E 4B6FA 3TNSA 1MAYA 2G81E 1P10A 3RXSA 5EODA 1DDJA 2B7DH 4INLA 1TOCB 2GD4B 3RLYH 4NIVA 5T3HA 2W7UA 1P2IA 1V2NT 2GZ9A 1HLTH 1UHBA 5CMXH 3LJOA 5DKMA 1J15A 3TITA 4AFUA 5EQSA 3GCTG 3MU5A 1NRSH 2C8XB 3CS7A 4BTIB 2SNVA 4Q7XA 1CA0C 1IQMA 1H1BA 1NU9A 2ZU1A 3RC6A 4PROA 1NFWA 3U8OH 2FOHA 4ABDA 2PGQB 2I6SA 2OC0A 1SGDE 1P06A 1O2LA 2W26A 2H9HA 1AMHA 2TGTA 1D4PB 3A7VA 2XBXA 4NZLA 1DY9A 1KIGH 3OSYA 1YCPM 3UREA 2Q1JA 4FU7A 1INCA 1PPFE 3LJJA 1E0FD 1LPKB 2Z9KA 1C5YB 1LHEH 3PM3A 1QGFA 3A88A 1K28D 3RXOA 1F5RA 1FONA 3RC4A 3LGYA 3B8JA 3I78A 1HAPH 1P11E 4FU9A 2A4QA 1AWFH 1G37A 3EGKH 1CT0E 1IQNA 1SGYE 1GVZA 1ZR0A 2GCTB 4WXIA 2BX4A 1FMGA 3VB5A 5T6GA 1O2MA 1AFQC 4WY3A 1DOJA 2A2XH 4KTSA 1ZSJA 6ESTA 1O32A 1BRBE 4GCHF 1BT7A 1A0LA 1P2NA 3HKJB 2H5CA 1KDQB 5GPIB 2ZHQH 2WYJA 2HNTC 4MDSA 1C5LH 3R0FA 1CT4E 2XBVA 1C4Y2 1GJ9B 2ZU2A 2ZTXA 2JH5D 3K6ZA 1Y59T 5J4SA 4X6OA 1CGHA 2G8TA 2NU3E 4MPUA 2FPZA 1UCYH 1XX9A 8KME2 2P93A 1FIZA 2ZNKH 1NO9H 2C3SA 2VIWA 1GJ6A 3RXRA 3RMMH 1C9TA 2ZZUH 1EQ9A 1P57B 5E8EH 2FO9A 1GJ5H 4I8LA 1GBAA 5HM9A 3QK1A 5EQRA 4AORA 3ZVEA 2WINI 1Z1IA 2P8OC 1TAWA 1LKBA 2AFQB 1C5WB 3ATMA 5BRRE 3AVZA 3LIWA 1XUGA 1JOUB 2RCEA 1YLCA 1EP5A 2BY7X 1T4UH 3PMJA 3KQDA 1O2TA 5AFYH 1C1WH 3P8GA 5A09A 1GHYH 2F9OA 3V13A 3SU3A 4X6MA 1PPCE 3LDXH 3SW2B 2FODA 5GJ4B 1MBQA 2W3KA 1UTKA 1Z7KA 1L1JA 1Z6JH 1ELBA 4CHAB 4GAWA 2PKAA 2WHXA 2CV3A 3UWIA 2BDAA 8ESTE 1JRTA 2ZDVH 2FI3E 2FMJA 1TMBH 2YNBA 2VNTA 3G01A 1ELGA 3MH4A 1A1RA 1ACBE 1ESAA 3M5LA 6CHAB 1HAOH 4NIWA 1YC0A 1O3FA 2A7CA 4X2VA 3SZEA 4Y0YE 1DUAA 1GGDC 1ZTKA 2GDDA 3E91A 1MTNC 9ESTA 2CXVA 5JBBS 3SORA 1NTPA 2V3HH 3GY6A 2ANWA 1GBIA 4U01A 3SU6A 4JYUH 4BOHA 1C1RA 1O2QA 4M7GA 2JETC 3TLOA 4MPVA 1ANDA 1TONA 2C8YB 1UK3A 1W0ZU 1IQHA 2H9EH 3QDZB 4LXBH 1HAXB 5ABWA 1UVUH 2OK5A 1EZSC 1EZXC 1RFNA 3HK3B 2AH4X 2R0LA 5HGGA 3OU0A 1QIXB 3MHWU 1BTXA 1UTOA 1N1LA 4H6TA 3Q3XA 3O8CA 1ZPCA 5EU8A 3SZNA 1GPZA 1O2HA 4IMZA 2AGIX 4TY6A 1HNEE 1N6YA 1L1NA 2A4RA 1W7GH 2FI5E 2IJD1 3LKWA 1LVOA 1FQ3A 2OC1A 3RXCA 1ZRBA 2CMYA 3T28A 1G2LA 2VIPA 2P59A 4B6EA 3AASA 1OX1A 4H6SB 4WMFA 3ZZ9A 4GUXA 2C4FH 1A3BH 2ZTYA 4K1TA 1P03A 2Z9IA 2PFEA 1ORFA 2BD5A 1AE8H 4I8JA 4D7GA 4NSYA 3BF6H 1TRYA 4E05H 2ZHDA 1GI6A 2O8TA 1F0RA 3MTYA 3SBKA 3SU4A 3GYLB 3M7QA 4KKDA 3A85A 2XNIA 3QUMP 1SR5C 2JH0D 1HGTH 1S82A 2SGQE 1MZAA 1EPTB 3VXFH 4AX9H 1GG6C 1LQDB 2XTTB 2B8OH 2Z3DA 1EOLA 3H7OA 1LHCH 3M3SA 3LU9B 1SGFG 5AVDA 3RXKA 2J4IA 2OINA 4I7YH 3ZV8A 1KLIH 3T26A 4I8HA 4FUBA 1LVYA 1MTVA 5EOKA 1AHTH 1TNJA 5E2OA 2A2QH 2VU8E 3P92A 3PTNA 1C2EA 1BHXF 1F0SA 1YP9A 1HBTH 2CHAC 2ZU3A 1SPJA 5H4IB 3MU0A 1CA0B 4FXGH 1T31A 1QURH 1HCGA 4DIIH 1C1OA 2OTVA 1LO6A 1TWXB 1SLVB 1NFUA 1HJ9A 3SJOA 4X1PU 1E35B 2BOKA 3GICB 4E7NA 2RA0A 1BMNH 1TMTH 1RTKA 1MD8A 3M5OA 3LONA 2XYAA 4INKA 3ZZ5A 1CE5A 2FIRH 1SFIA 2C8ZB 2BTCE 3E3TA 4MLFB 2XBWA 1AN1E 3MNSA 4LZ1H 1DY8A 1SL3A 2D26C 3GCTF 4BTUB 1UMAH 3L6PA 2H6MA 4NGAH 1FDPA 4ABGA 1O3HA 3D23A 4OS4A 2OBOA 3GY4A 1W0YH 1B5GH 1GHVH 3W95A 3PB1E 2HLCA 5EGMA 1GI1A 3EQ0H 4I32A 1Z8JB 1SLUB 2A7JA 2HALA 3SJKA 1LPGB 1W11U 1A5GH 4WVPE 3S7KB 2VVVA 5FPSA 4JZEH 4DURA 2BD9A 3GCOA 3LGIA 4A1XA 1TRMA 1KSNA 1QQ4A 1TOMH 1D3QB 1AWHB 1EXFA 1O3DA 3FFGA 2V6NA 3RU4E 4HI3A 3ZZCA 1EAXA 3A7YA 5FBEA 1OP8A 2TGPZ 4UEHH 1GVLA 2VWMA 1OPHB 1PQ8A 3SI4H 1GL1A 1XMNB 3BTDE 2ODYB 2BDCA 3ZZ6A 1SVPA 4B2AA 1ELEE 3TH3H 3ZVAA 5C67A 2CJIA 1NS3A 2R0KA 1GI7B 1S0QA 4YESB 4E7RG 1AKSB 3SNEA 1O3GA 1WSSH 3IG6B 2P8OB 1ETTH 1XUIA 4TY7A 4CRCA 3VEQB 2G5NA 1F92A 4ZROA 4CBNA 2O8LA 4BAOB 1OSSA 3BTWE 3RUOA 2ODQA 3STIA 5DK1A 5A2MH 3SV7A 1P02A 4NIYA 2ANYA 3A87A 2ZPSA 1B0EA 1M9UA 1GWAA 4ABEA 3A7WA 1V2MT 4IC5A 4FUCA 3E0PB 3L33A 4ZKOU 1OYTH 1NRNH 2Y81A 4AOQA 1UCYK 2F9BH 2ZECA 2OP9A 1DFPA 4OS5A 2ZO3H 3PMHB 3TGKE 3CS0A 2EI7A 3DA9B 1AVWA 5FPYA 3GCHC 1Y3YA 2BZAA 3P95A 1AU8A 1TQ7B 5B6OA 1YM0A 5C1XA 2BB4A 1TNHA 2B5TB 3H5CB 4I8GA 1GBDA 1VCPA 2Q6FA 1K1JA 1F0TA 1SHHB 3HGPA 5GIBA 1ZHPA 1HIAB 1NROH 4XFQA 2F91A 5I46H 1O38A 1O5AB 1RXPA 5ESBA 1O34A 1TGNA 2XW9A 1IQJA 4UFGH 2G52A 2FOMB 1T7CA 1O31A 2ANMH 3RXEA 2ZC9H 1BMLA 2G00A 4FUIA 1ZRKA 1O2RA 1CVWH 3STJA 1QL7A 1RTFB 1XKBC 2SNWA 4ESTE 3MU8A 1LPZB 1O33A 1P0SH 2RA3A 1LQEA 1SGRE 5EW2H 2WPJS 4ABJA 1JIMA 1UCYE 3MI4A 1V2QT 4A1VA 1V2LT 2F83A 1UK2A 1TGTA 1YPLH 4YOGA 1C5TA 2P16A 2A1DB 4AFQA 3LC5A 1ZJKA 1P8VC 2A5IA 3ENSB 1DLKB 3ATKA 3GY7A 1GDUA 2IOTA 1PYTD 1AFEH 2BLWA 3SUEA 3ZVDA 3FP7E 3VB7A 3QZRA 2GZ8A 3SQHE 2ZPRA 3VXEH 2R2WU 1XUHA 1T32A 1C1NA 2WV4A 1QRZA 2A4GA 4OS1A 3B23B 2CF9H 4ZUHA 4DVAU 1AI8H 1HJ8A 1MTWA 1TBRH 3SUFA 2I6QA 1P3CA 2GV7A 1TMUH 2WV9A 1O2ZA 2GZ7A 2AMQA 1EJMA 1P2KA 3E0NB 4J1YA 2F4LA 2VB0A 3EDXB 2SGFE 1S5SA 3A8CA 1MU8B 3VFEA 4DT7B 3MOCA 1FAKH 2EA3A 1NRQH 1EJAA 1QJ7B 1GMDG 5GDSH 1OP2A 4BXSA 1W13U 4NZQA 2VGCC 1W2KH 2FS8A 1P01A 2JH6D 3MO9A 1BTYA 4D8NA 1L4DA 1LKAA 4OM9A 2BVXH 2QV1A 3ZVFA 3A86A 3SJ8A 2F9NA 1K2I1 3U98H 3A8DA 4XSKU 1K9OE 1G36A 4X1SU 4LZ4B 1GBHA 2HNTE 1YPGH 1S84A 1GI2A 1TLDA 1BTWA 4ISNA 1P3EA 4A6LA 1SGNE 3E90B 3H7TA 2AERH 4DCDA 1NU7B 2FDAA 2Q6GA 1DE7H 5DO4H 1THSH 1AKSA 2OD3B 2V3OH 1KXAA 1C5OH 1N8OB 5EXLA 1L4ZA 1TNGA 3L3TA 5A8XA 1O2YA 1XVOA 1SFQB 1WAYB 3QWCH 1BTUA 4CREA 1HAHH 1IHTH 2ZDAH 2UWLA 3RXLA 1THPB 1O2WA 4MQAA 3QN7A 1OS8A 4DGJA 4AYYB 6GCHG 1YLDA 4CR9A 2R2MB 4YM9A 3URCA 1BUIA 4D9QA 4WMEA 1K1NA 2Y7XA 4NG9H 1TB6H 4K1SA 2QC2A 1JBUH 3PYHA 4R0IA 2G5VA 2HPQH 3F9EA 4NWLA 1BITA 2HOBA 1OWKA 1TQ0B 1WV7H 1MQ5A 1EKBB 1CSOE 4VGCB 2H1UA 3FZDA 3MU4A 3MWIU 1ZLRA 3S7HB 2BDYA 3U9AH 1GJ4H 5DP4A 5LPEA 1GDNA 1QB6A 1LVMA 2BQ6B 3A82A 1ARBA 1BTZA 3ZZ7A 1OOKB 8GCHG 1AVXA 2ZU4A 1NZQH 3QX5H 2BQ7B 1RD3B 2FX6A 1E37B 1NN6A 1D3PB 1G9IE 2W5EA 3SU0A 3NK8A 2BVSH 1GCTC 1TFXA 4ISHH 2UUYA 2P3FH 3BG4C 4ABBA 1VCQA 2FOBA 1QL9A 4NWKA 4B71A 4NA8A 5DGJA 4I8KA 2XWBI 1G32B 1C1UH 1UTPA 5K7RA 3K2UA 3F9FA 1QBVH 3ESTA 4NSVA 1SMFE 2QA9E 1C1PA 2ZQ1A 3SV6A 4ABIA 3NKKA 1GBFA 1DX5M 1U6QA 5HM2A 1SC8U 1LHGH 4JZDH 3KGPA 3OY6U 1CT2E 1NC6A 5JB8S 1EAUA 1V2UT 3SNCA 2QYIA 2V35A 7KMEH 1KLTA 1O2JA 1UVPA 1P2QA 3GCNA 3OTJE 4UFFH 5A0AE 3GY8A 1A0JA 3SU2A 2OQ5A 3QTOH 2SGPE 4CBOA 1C2IA 1DWDH 1H8IH 1LHDH 1SOTA 1TBQH 3M5MA 3RXVA 1DVAH 3PO1C 1UTLM 3PLPA 1TPOA 7LPRA 1TA6A 1EAIA 3GY5A 4FUFA 5K0HA 1GBBA 5PTPA 1OWHA 4BAMB 4X2WA 1WXRA 2PKSC 1SHYA 4OGYA 5C20A 2Y5GA 1DLEA 1P12E 2C93B 4B76A 2QXJA 4KP0A 2BM2A 1ZMNA 1ZYOA 4YLUA 1MCVA 3UQVA 1GCDA 3T62A 4DW2U 3U1JB 4AYVB 2CGAA 2OCVB 3FANA 3U69H 5B6LA 4Y7AA 2FOGA 1GDQA 1SGEE 1VZQH 2P3TB 3MNXA 2A32A 2ZI2H 4ZXYH 1SI5H 1ZOMA 2QAAA 1LDTT 5EPNA 3QO6A 1EB2A 2THFB 3GOVB 3PV5A 4YOJA 2Y80A 1ZGVA 3P8NA 2M5TA 4Y71A 4Y6DA 1BA8B 1EP6A 1B7XB 1DSTA 1W12U 1UTJA 1TE0A 3RU4T 1SB1H 1TPSA 5J4QA 1FNIA 1C2MA 1DPOA 2XCNA 3TK9A 1NY22 5JPMH 5DPAA 1S0RA 2WPKS 1ELDE 5JBAS 4TWYA 1ETRH 1HAZB 1H9HE 1AE5A 2BHGA 4K69A 2ZPQA 5FBIA 3E16B 1IQLA 3NPSA 3S69A 1A7SA 1GVKB 2ALVA 1A5HA 3F6UH 4NA7A 5L30H 4AB8A 2V0BA 1TX6A 1MZDA 1LTOA 2BY8X 2OQUA 4GLYA 3S9BA 1HJAC 4CRBA 4LK4A 4A1TA 1ZZZA 3M3VA 3UOPA 3V3MA 1NESE 1S83A 2FLRH 3SYJA 1XKAC 5DP8A 1K21H 1QBOA 2STBE 1QJ6B 1ZHRA 5LPFA 1DS2E 2BVRH 2PSXA 1HAVB 1RJXB 1C5ZB 1O3NA 3NWUA 5CHAC 4XBCA 2NU2E 2RDLA 1O2UA 5F8XA 3A81A 3MH6A 1H8DH 1BCUH 5DP9A 3SGAE 1A5IA 3BTME 3ZZ4A 3RP2A 1J9CH 1VITH 2ZHFH 3GDVA 4AG2A 3TJVA 2WZQA 1GMDF 4B73A 5DP6A 4WXVA 1CGIE 2F9UA 2ZFTA 2ZCHP 1ELTA 1VGCC 2SGDE 4B2BA 3E8LA 1C5XB 2NU0E 1V2JT 2GT7A 1AQ7A 4AB9A 1GBEA 3LH3A 5BPEA 3SJIA 1BDAA 3KHVA 3TH2H 2ZDNA 2A5AA 1VR1H 5EXMA 1PYTC 1GI0A 1S81A 4ZKSU 1G3EA 4ZKRU 1V2PT 3SOSA 1O2PA 3SU1A 5T1VA 1Z71A 1RTLA 2Z3EA 1H4WA 5JBCS 2Z6BD 1RRKA 1G3DA 1CA8B 4K3JA 1HXEH 2EEKA 2UUKB 4XE4A 1SSXA 3PMAB 2SFAA 1SGTA 3FZZA 1AVGH 4O3TA 3FP6E 1FAXA 4JCNA 2GKVE 1CBWC 2BMGB 1GHZA 4MNVA 1BMAA 1SOZA 4CH2B 3VGCC 1LVBA 2A45B 3ZVGA 1QNJA 3D49H 1DXPA 5DP7A 4HZHA 1HFDA 3LC3A 1YF4A 2ZFPH 3ATLA 4U2WA 4TWWA 4ZKNU 5F8TA 1Y5AT 1KDQA 1YPMH 1MTSA 3ELAH 1PPBH 4AZ2B 3RXAA 3LH1A 1NFYA 4HFPB 5C5NA 1BB0B 1GHXH 2BYAX 2XWAA 4X1QU 6GCHF 1G3BA 4X8TH 2SGEE 1KTSB 1QR3E 1YBWA 1EOJA 4THNH 1T8OA 4MG3A 4X2XA 5L2ZH 2G4UA 1J8AA 2ZHWH 1C2LA 1Z8RA 2R3YA 3DHKH 3IITA 4OS2A 1QRWA 3RXDA 2WYGA 1NRRH 1K22H 1ELAA 1FY8E 2VIVA 3BTGE 5SGAE 5A8YA 1OYQA 1DM4B 1SGQE 1GCTB 1AO5A 3EAJA 3P70B 4I31A 1GBTA 5IYTA 4I33A 4AFSA 1AFQB 3KCGH 1DWCH 1W10U 5C2ZA 4NA9H 2Y6TA 5FCRA 1SQTA 5FX6A 2KAIB 2FYRA 8GCHF 1AUTC 1AB9C 1GJ7B 1Y3VA 1SQAA 5F6MA 3TGIE 2XC0A 1GBLA 4X6NA 1C5RA 3C1KA 1C1MA 1P2MA 1BRCE 3PROA 1C2FA 3RXIA 4K2YA 1C4V2 3MH5A 2FWWA 1BRAA 2BLOA 4CRDA 1IQIA 1H9LB 1HAYB 3UR9A 1W8BH 1O5BB 2FOAA 2HWLB 4DY7B 1SQOA 1DANH 1V2TT 1C5NH 1BJVA 4YLQH 3HK6B 4IN2A 2R9PA 1QHRB 4UFEH 4R8TB 3SV8A 1W3CA 1T8NA 2R3UA 2P94A 3A80A 3ZVBA 2Y7ZA 2TBSA 1TNIA 1PJPA 3ZZ8A 3BSQA 1BZXE 4XOJA 1MD7A 1HAIH 4ISIH 1EZQA 3RDZA 1V2KT 1GBCA 1J14A 1O2VA 1KY9A 2AS9A 3TK6A 2UUJB 1ZMJA 2GT8A 3TH4H 3BV9B 1TGSZ 1T8LA 3KQEA 3GISB 1FY1A 2GGVB 3QLPH 3BEUA 1UHBB 3DD2H 5L6NH 4O03A 4CH8B 1JMOH 1ABJH 1TGBA 1YPJH 2PWXA 1P2JA 4JK6A 1GGDB 2ZFQH 2GCTC 2VBCA 4RKOB 3ZZBA 1F5KU 1FZZA 1MTNB 4K8BA 4YTAA 1KXDA 5C5OA 2ODPA 4HGCA 4WWYA 2QXHA 1BTHH 2C90B 3M3TA 1GMHG 1MUEB 4Y79A 1ARCA 2QXIA 2BD3A 1NRPH 2JETB 1P09A 2NWNA 4BAHB 1TGCA 3EE0B 1TPPA 1ZMLA 2ZDLA 4ZHLU 2QIQA 1KYNA 1S6FA 3DUXH 3RMLH 1HPGA 1SGFA 1O36A 1MMJN 3UWJH 1K1IA 1A3EH 3VB6A 5ETXA 4Z0KA 1GI8B 1SLWB 1FY5A 2FS9A 4UFDH 4WJG2 3SI3H 2BZ6H 1K1LA 1P05A 1O2GH 2IJOB 1WCZA 1EPTA 1ZHMA 1XXFA 2ILNA 1YPHC 3F68H 4D9RA 3KF2A 1YPEH 1GHWH 1UTMA 1YGCH 5L2YH 1IOEA 1QJ1B 4WH8A 1PPGE 1TIOA 1O2IA 3MU1A 3O8DA 2BDGA 3P17H 5DP5A 2GX4A 3MNBA 4NFEA 5F03A 4M9FA 1ELCA 3T29A 5FAHA 3KEEA 1BIOA 1HB0B 6LPRA 1JIRA 1Z8IB 5GCHF 3HATH 3HKIB 3U8RH 4IS5A 1DSUA 4DOQA 1A46H 3T5FH 2ZGXH 1BRUP 2BY5X 2FESH 3K65B 1LCYA 3A84A 2PUXB 4FVBA 4H4FA 2Y82A 1MKXH 1QB9A 2VH0A 3SV2H 1J16A 5E0HA 3KN2A 5AHGH 1QA0A 9LPRA 1GG6B 3TGJE 1C1SA 3RC5A 2O8MA 1GJCB 3RMOH 1UVTH 3ITIA 3F9GA 2DUCA 3BTKE 1WOFA 5HMAA 1IAUA 1TPAE 2XRCA 2VVUA 2D1JA 1GHBG 1IHSH 2QF0A 4MPXA 1HAGE 3SU5A 1GI4A 3ZZAA 3S0NA 1NM6A 1HRTH 3M37A 2NU1E 3MO6A 1RIWC 4CRAA 2TIOA 1PFXC 1Q31A 3RXUA 3RXMA 2CHAB 2WPMS 2PTCE 1O3IA 2A0QB 3ZV9A 1G30B 1D9IA 4Q7ZA 4OS7A 1ANEA 3LGVA 2H5DA 1P9UA 3SO3A 2FOEA 3UFAA 3RM0H 1IQGA 5C1YA 1PPHE 1KTTB 1LMWB 2QGRA 1O3AA 2AIQA 2ESTE 1O3LA 4BANB 3RM2H 3E1XB 1ZTLA 2FLBH 1TRNA 2AYWA 2PHBA 2EI8A 1ESBA 1TABE 5C3NA 5HYOA 2TGDA 5LGOA 1OKXA 3I29A 3RXFA 4F4OC 4KTCA 4RSPA 2QCYA 4XBBA 2AIPA 4UDWH 1OXGA 2GDEH 3V12A 2A5KA 3A89A 3TNTA 1WBGB 2ZTZA 3RXTA 3I77A 5G4BA 3PLBA 4B2CA 1FV9A 1FN6A 1UVSH 2VVCA 4F49A 1C9PA 1EPTC 3EA9A 1EAWA 3DFJA 2VH6A 4YZUA 2ALPA 2ZHEH 3M35A 3SJ9A 2ASUB 2Q6DA 1H9IE 4MNXA 1AB9B 5LPRA 3RXPA 1TA2A 2BDHA 1WU1A 4IBLH 4U30A 5DP3A 3A7ZA 3A8BA 2B0FA 3SN8A 2IN2A 3U8TH 4Z6AH 2IPHA 1S85A 1FJSA 4AGKA 4ABHA 3VPKA 2ZGHA 4Y11E 3FAOA 4GPGA 3SHCH 2VIQA 3RLWH 1SG8B 2OUAA 1GMCG 2F9VA 3ATWA 1SLXB 4RN6A 4D7FA 1Z1JA 3RMNH 3TU7H 5A0CA 1NPMA 1Z6EA 1PPEE 2BD2A 3TJUA 1HIAA 2WV5A 2BLQA 2J92A 2Z7FE 1O39A 2H9TH 1E38B 1O35A 1LHFH 1OWEA 1TALA 2ZKSA 4JZFH 1WTGH 2F9PA 2FXRA 1DWEH 3MMGA 3MH7A 1MAXA 1V3XA 3V0XA 5FXLA 2CN0H 4A7IB 2O9QA 2CF8H 1ANBA 1Y5BT 2HNTF 4BXWA 3NXPA 3TJOA 4ASHA 2EC9H 1C1VH 3TK5A 1PQ7A 2G55A 4BNRA 2ZEBA 3E6PH 5EQQA 5EPYA 3GCHB 1CHOG 2ZDMA 4FUJA 4Q80A 1MH0A 2VJ1A 4A5TS 1YKTA 1MU6B 4B75A 2ZWLH 1GBJA 1O2NA 2ZGBH 5T6FA 4Y76A 1FLEE 4MNWA 2OC7A 3LT3A 1P9SA 1WQSA 2PW8H 1DWBH 2ZF0H 1HYLA 3UR6A 1VITF 5CE1A 2NU4E 3RU4D 1QFKH 1FI8A 4DG4A 1C5PA 3TJNA 1QTFA 3URDA 2QY0B 4FUGA 4TPIZ 1W14U 4SGAE 4YO9A 1OWIA 3V7TA 2QN5T 4ABAA 2YOLA 2ZU5A 1GMHF 3UY9A 4IC6A 1GI9B 2OBQA 2FTLE 1L2EA 1VJ9U 4X8SH 4ZHMU 2LNCA 3BIVH 3KIDU 1UTQA 2ZIQH 2OLGA 4FUHA 3SUGA 4ZXXH 1GJAB 1ANCA 3TPIZ 2J2UA 1A61H 4H42U 4X0WU 4E06H 2TGAA 3BTHE 2P95A 2XXLA 2ZGCA 1K1OA 5AFZH 1AZ8A 1ZJDA 2H2ZA 3F9HA 3LGUA 2FI4E 3K6YA 2VWOA 1TX7A 3MYWA 2FTMA 7GCHG 3GY3A 3ODDA 1AUJA 2ULLA 1NT1A 1GBMA 5GXPA 4OS6A 1MCTA 1T8MA 1XVMA 2UWPA 2PUQH 3Q77A 5FPTA 3LOXA 3EA7A 4JZ1A 1CQQA 1O2SA 4Y8YA 1O30A 1Y8TA 1C2HA 1X7AC 3A8AA 1AY6H 3CENA 3PTBA 4FVDA 2FEQH 3M5NA 2AEIH 1KLJH 5JDUB 5AF9H 4OGXA 5DJ7A 5GCHG 1L1GA 3KNXA 2PSYA 2GVFA 2BDIA 2ZFFH 4BAKB 3VB3A 1QQUA 2VWLA 1O3EA 2AGGX 3P8OA 2ZG0H 2VINA 1ZSLA 1WTHD 3M36A 1D3DB 1BQYA 4YOIA 3RXBA 1UTNA 3SGQE 2ANKH 5A0BA 3BN9A 1RIWB 2VGCB 2XC5A 1BBRH 1TNLA 5EXNA 2PV9B 4YT7H 4NFFA 2GCHG 1FUJA 2GV6A 1TYNA 1RS0A 1XUKA 2JKHA 2Y5FA 4B74A 3A83A 1V2OT 1C2DA 5GNDA 4JYVH 4FU8A 3SV9A 3ZYEA 1L0ZA 3UUZA 1MKXK 2AGEX 3BTTE 3BEIB 1MKWH 2K1QA 4X1NU 1GHBF 1F7ZA 1QY6A 1UK4A 4SGBE 1O0DH 3D62A 1KXEA 1Y5UT 3EYDA 1GHAF 2ZCLP 2Y5HA 2B9LA 4ZMAH 1C1QA 1G2MA 1ID5H 1DITH 1PQAA 2ZGJA 4Y7BA 3DFLA 4O9VA 4K8YA 2J9NA 4Y8XA 1F0UA 4ZH8A 2ZQ2A 1V6DA 1RGQA 1G3CA 3SUDA 4ISLA 1O5GH 3K9XB 1WUNH 3BTQE 1Q2WA 3BTEE 1V2WT 1UJ1A 1PPZA 2GTBA 3QTVH 3UQOA 2RG3A 2XC4A 4MVNA 2ZFRH 2O8UA
chains in the Genus database with same CATH superfamily
3Q00A 4GHTA 1E34B 4K1EA 2HRVA 4B1TA 1UO6A 1YCPH 4AN7A 1NFXA 4X8VH 2QF3A 2FOCA 2ZCKP 4ZCNA 1C1TA 2FZZA 4Q2KA 1IQEA 4NIXA 2D2DA 1C5SA 1FY3A 2BQWB 3TIUA 4INHA 4KGAA 2HVXA 3ZYDA 1QCPA 3FP8E 4D76A 3Q76A 1W0JD 3AK5A 3D65E 3R3GB 4O97A 1KXBA 1Y3XA 1ZPZA 1ETSH 5ESTE 4RKJB 1HDTH 3Q3KA 4ZAEA 5LH8A 2J34A 1A0HB 1XM1A 2WPHS 1TX8A 2FYQA 4JK5A 1WQVH 1WYKA 5A8ZA 1D6RA 3JZ2B 2GMTC 4U32A 4GVUA 3CP7A 3UOUA 1GI5A 4MNYA 1C5UA 4IW4E 1EZUC 5DN6D 1V2VT 3BG8A 1EATA 3A7TA 2P3UB 3BG4B 2BD8A 4LOYH 1ABIH 5EW1H 1N6XA 1CHGA 1SGIB 2V3MA 3M61U 3OTPA 1BJUA 1J17T 2CK3D 1E1RD 5FX5A 2BY9X 8LPRA 1Y3WA 4XDEA 1GMCF 5TCCA 1FPCH 1XXDA 1TBZH 1VJAU 4Y8ZA 4GHQA 4ACAA 3M7UA 1AD8H 2FOFA 1N8OC 2BD4A 1O5EH 2A31A 3T2NA 2VIOA 4K5ZA 2Z9JA 2Z94A 1V2RT 4ZHAA 2YNAA 3OE7D 1HUTH 3LPRA 4CR5A 3ODFA 1GJBB 1YPHE 1QB1A 2BDBA 3F2HA 1EASA 1MBMA 1SBWA 5E0JA 3UNSA 4MPWA 4DJZB 3HGNA 2BD7A 1WDIA 3PWCA 1B0FA 1QBNA 3OY5U 3NZIA 1S6HA 1THRH 3ZZDA 5T6DA 5JB9S 5JBTA 3P6ZB 1C5MD 3ATIA 3PO1B 1O3PB 4FUDA 3ZZ3A 2UWOA 1C2KA 1C5QA 1QL8A 4AGJA 3SNAA 2HGTH 2PKSB 1CHOF 4VGCC 2Z9GA 3AW0A 3QGJA 5FHTA 4JYTA 1QRXA 2DE8A 1IQKA 2K0QA 2VIDA 1Y3UA 4GCHG 1FPHH 1SGPE 4WMDA 3QGNB 5GWZA 4UONA 2ZP0H 3PWBA 4UE7H 1O2OA 3KQBA 1HXFH 1FN8A 2PGBB 3OYPA 4TPYA 2AMDA 1YPKH 1DICA 1VITG 2G4TA 2HPPH 4AFZA 3U1IB 1ELFA 2BXUH 2WUCA 3GYMA 4NCYA 1W7XH 1QA7A 3AW1A 2XCFA 2PLXA 2WPIS 4MTBA 5IK2D 4WH6A 1EUFA 4Q7YA 3T27A 2LPRA 1JWTA 1Z8GA 1JXPA 5I25A 3LGWA 5TJXA 1FXYA 1IQFA 3RXHA 3RXJA 1O37A 1HAVA 2G51A 1C4U2 1Q3XA 3JZ1B 3N7OA 2DE9A 1ESTA 4TYDA 1EX3A 5CDFE 1KXFA 1O5CB 1DUEA 4XBDA 5EG4A 3MFJA 1CGJE 2WPLS 1ZPBA 2WUBA 1AIXH 3M7TA 3KQCA 3HPTB 1HV7A 4BTTB 4HG6A 1O3BA 3SNBA 1UW7A 2TRMA 7GCHF 2TPIZ 4HTCH 2VWNA 4X2YA 1HJAB 4YT6H 4X6PA 3RXGA 1P04A 1DT2A 2F43B 4Y10E 1XUJA 2BXTH 1O3CA 2OC8A 1UVOA 3O8RA 3GDUA 3NCLA 2C8WB 4CRFA 5HXFA 4ABFA 3OX7U 3F1SB 3BIUH 3A7XA 5TCAA 1BMMH 2BY6X 5CHAB 2ZDKA 4CRGA 3S9CA 3MNCA 4JMYA 1F2SE 4GSOA 1V2ST 2Z9LA 4CHAC 3UIRA 1D3TB 1GI3A 3UPEA 1GBKA 1PQ5A 2J38A 4FUEA 3EA8A 1SGCA 6CHAC 1EB1H 2PTNA 4AG1A 1FIWA 2Z3CA 3LGTA 1O2XA 1VGCB 2GP9B 1MTUA 2AMPA 2FP7B 3H09A 4UD9H 5F8ZA 2GCHF 3SQEE 1C2JA 4KTUA 3BEFB 3TVJB 1E36B 5C1UA 3S9AA 3SGBE 1BOQA 2BOHB 2ZA5A 4IMQA 4IN1A 3WY8A 3AAUA 1BBRK 4KELA 1P2OA 2STAE 4QT8C 3SNDA 4X8UH 1ZGIA 1COWD 1GJDB 2KCAA 2A4OA 1O5FH 2SGAA 2J95A 7ESTE 1XUFA 1O3MA 1JRSA 2ZFSA 3DT0H 1GHAG 4J2YB 3UNRA 2BX3A 1AZZA 2A7HA 2W7SA 1EJNA 1A4WH 1OWDA 2PKAB 3PLKA 3GY2A 3SHAH 1ELVA 3AAVA 1CBWB 1MKWK 1BTPA 5IDKA 1ZSKA 3VGCB 1YYY1 1O3KA 3UB0A 4ISOA 4WF8A 1O3JA 4RI0A 3T25A 3PV2A 4O3UA 3RXQA 4A92A 3PV4A 1O5DH 2J94A 3W94A 3ZVCA 2O8WA 2UUFB 1C2GA 2KAIA 2D8WA 1CO7E 5KEDA 1DXWA 2QXGA 1BHXB 2EI6A 3GDSA 5JYIA 3C27B 4Y0ZE 1T4VH 4K60A 1A2CH 1KXCA 2GMTB 4JZIA 1TNKA 5E0GA 3B9FH 1K1PA 1OP0A 2PR3A 4TT3D 5DG6A 1D6WA 1BBRE 3QZQA 2XBYA 3Q3YA 1CU1A 2OXSA 3FVFB 1OWJA 1ZTJA 3P8FA 4BAQB 3KL6A 2F3CE 3UNQA 1GJ8B 4X1RU 1O2KA 2JDID 1MQ6A 2BLVA 5FCKA 2FM2A 2LELA 3UTUH 1C5VA 1YCPK 3NUMA 3O8BA 1AGJA 1F5LA 2KZ4A 4DIHH 3VB4A 2W3IA 2FX4A 3PMBB 1O3OA 1FY4A 5E2PA 4IGDA 3BTFE 1K1MA 1VCWA 3IWMA 3MO3A 1GL0E 1YLNA 4B6FA 3TNSA 1MAYA 2G81E 1P10A 3RXSA 5EODA 1DDJA 2B7DH 4INLA 1TOCB 3KYGA 2GD4B 3RLYH 4NIVA 5T3HA 2W7UA 1P2IA 1V2NT 2GZ9A 1HLTH 1UHBA 5CMXH 2WPDD 3LJOA 5DKMA 1J15A 3TITA 4AFUA 5EQSA 3GCTG 3MU5A 1NRSH 3GS9A 2C8XB 3CS7A 4BTIB 2SNVA 4Q7XA 4FETA 1CA0C 1IQMA 1H1BA 1NU9A 2ZU1A 3RC6A 4PROA 1NFWA 3U8OH 2FOHA 4ABDA 2PGQB 4ACBA 2I6SA 2OC0A 1SGDE 1P06A 1O2LA 2W26A 2H9HA 1AMHA 2TGTA 1SKYE 1D4PB 3A7VA 2XBXA 4NZLA 1DY9A 1KIGH 3OSYA 1YCPM 3UREA 2Q1JA 4FU7A 1INCA 1PPFE 3LJJA 3UAIC 1E0FD 1LPKB 2Z9KA 1C5YB 1LHEH 3PM3A 1QGFA 3A88A 1K28D 3RXOA 1F5RA 1FONA 3RC4A 3LGYA 3B8JA 3I78A 1HAPH 1P11E 4FU9A 2A4QA 1AWFH 1G37A 3EGKH 1CT0E 1IQNA 1SGYE 1H8HD 1GVZA 1ZR0A 2GCTB 4WXIA 2BX4A 1FMGA 3VB5A 5T6GA 1O2MA 1AFQC 4WY3A 1DOJA 2A2XH 2QF4A 4KTSA 1ZSJA 6ESTA 1O32A 1BRBE 4GCHF 1W0KD 1BT7A 1A0LA 1P2NA 3HKJB 2H5CA 1KDQB 5GPIB 2ZHQH 2WYJA 2HNTC 4MDSA 1C5LH 3R0FA 1CT4E 2XBVA 1C4Y2 1GJ9B 2ZU2A 2ZTXA 2JH5D 3K6ZA 2HVYB 1Y59T 2JJ2D 5J4SA 4X6OA 1CGHA 2G8TA 2NU3E 4MPUA 2FPZA 1UCYH 1XX9A 8KME2 2P93A 1FIZA 2ZNKH 2GJGA 1NO9H 2C3SA 2VIWA 1GJ6A 3RXRA 3RMMH 1C9TA 2ZZUH 4Z1MD 1EQ9A 1P57B 5E8EH 3DSPA 2FO9A 1GJ5H 4I8LA 1GBAA 5HM9A 3QK1A 5EQRA 4AORA 3ZVEA 2WINI 1Z1IA 2P8OC 1TAWA 1LKBA 2AFQB 3OEHD 1C5WB 3ATMA 5BRRE 3AVZA 3LIWA 1XUGA 1JOUB 2RCEA 1YLCA 1EP5A 2BY7X 1T4UH 3PMJA 3KQDA 1O2TA 5AFYH 1C1WH 3U28C 3P8GA 5A09A 1GHYH 2F9OA 3OFND 3V13A 3SU3A 4X6MA 1PPCE 3LDXH 3SW2B 2FODA 5GJ4B 1MBQA 2W3KA 1UTKA 1Z7KA 1L1JA 1Z6JH 1ELBA 4CHAB 4GAWA 2PKAA 2WHXA 2CV3A 3UWIA 2BDAA 8ESTE 1JRTA 2ZDVH 1NBMD 2FI3E 2FMJA 1TMBH 2YNBA 2VNTA 3G01A 1ELGA 3MH4A 1A1RA 1ACBE 1ESAA 3M5LA 6CHAB 1HAOH 4NIWA 1YC0A 1O3FA 2A7CA 4X2VA 3SZEA 4Y0YE 1DUAA 1GGDC 1ZTKA 2GDDA 3E91A 1MTNC 9ESTA 2CXVA 5JBBS 3SORA 1NTPA 2V3HH 3GY6A 2ANWA 1GBIA 3OEED 4U01A 3SU6A 4JYUH 4BOHA 1C1RA 1O2QA 4M7GA 2JETC 3TLOA 4MPVA 1ANDA 1TONA 2C8YB 1UK3A 1W0ZU 1IQHA 2H9EH 3QDZB 4LXBH 1HAXB 5ABWA 1UVUH 2OK5A 1EZSC 1EZXC 1RFNA 3HK3B 2AH4X 2R0LA 5HGGA 3OU0A 1QIXB 3MHWU 1BTXA 1UTOA 1N1LA 4H6TA 3Q3XA 3O8CA 1ZPCA 5EU8A 3SZNA 1GPZA 1O2HA 4IMZA 2AGIX 4TY6A 1HNEE 1N6YA 1L1NA 2A4RA 1W7GH 2FI5E 2IJD1 3LKWA 1LVOA 1FQ3A 2OC1A 3RXCA 1ZRBA 2CMYA 3T28A 1G2LA 2VIPA 2P59A 4B6EA 3AASA 1OX1A 4H6SB 4WMFA 3ZZ9A 4GUXA 2C4FH 1A3BH 2ZTYA 4K1TA 1P03A 2Z9IA 2PFEA 1ORFA 2BD5A 1AE8H 4I8JA 4D7GA 4NSYA 3BF6H 2RDEA 1TRYA 4E05H 2ZHDA 1GI6A 2O8TA 1F0RA 3MTYA 3SBKA 3SU4A 3GYLB 4ASUD 3M7QA 4KKDA 3A85A 2XNIA 3QUMP 1SR5C 2JH0D 1HGTH 5KECA 1S82A 2SGQE 1MZAA 1EPTB 3VXFH 4AX9H 1GG6C 1LQDB 2XTTB 2B8OH 2Z3DA 1EOLA 3H7OA 1LHCH 3M3SA 3LU9B 1SGFG 5AVDA 3RXKA 2J4IA 2OINA 4I7YH 3ZV8A 1KLIH 3T26A 4I8HA 4FUBA 1LVYA 1MTVA 5EOKA 1AHTH 1TNJA 5E2OA 2A2QH 2VU8E 3P92A 3PTNA 1C2EA 1BHXF 2HLDD 1F0SA 1YP9A 1HBTH 2CHAC 2ZU3A 1SPJA 5H4IB 3MU0A 1CA0B 4FXGH 1T31A 1QURH 1HCGA 4DIIH 1C1OA 2OTVA 1LO6A 1TWXB 1SLVB 1NFUA 1HJ9A 3SJOA 4X1PU 1E35B 2BOKA 3GICB 4E7NA 2RA0A 1BMNH 1TMTH 1RTKA 1MD8A 3M5OA 3LONA 2XYAA 4INKA 3ZZ5A 1CE5A 2FIRH 1SFIA 2C8ZB 2BTCE 3E3TA 3WW7A 4MLFB 2XBWA 1AN1E 3MNSA 4LZ1H 1DY8A 1SL3A 2D26C 3GCTF 4BTUB 1UMAH 3L6PA 1SQRA 2H6MA 4NGAH 1FDPA 4ABGA 1O3HA 3D23A 4OS4A 2OBOA 3GY4A 1W0YH 1B5GH 1GHVH 3W95A 3PB1E 2HLCA 5EGMA 1GI1A 3EQ0H 4I32A 1Z8JB 1SLUB 2A7JA 2HALA 3SJKA 1LPGB 1W11U 1A5GH 4WVPE 3S7KB 2VVVA 5FPSA 4JZEH 4DURA 2BD9A 3GCOA 3LGIA 4A1XA 1TRMA 1KSNA 1QQ4A 1TOMH 1D3QB 1AWHB 1EXFA 1O3DA 2JJ1D 3FFGA 2V6NA 3RU4E 4HI3A 3ZZCA 1EAXA 3A7YA 5FBEA 1OP8A 2TGPZ 4UEHH 1GVLA 2VWMA 5CHBA 1OPHB 1PQ8A 3SI4H 1GL1A 1XMNB 3BTDE 2ODYB 2BDCA 3ZZ6A 1SVPA 4B2AA 2IPQX 3ZIAD 1ELEE 3TH3H 2KM0A 3ZVAA 5C67A 2CJIA 1NS3A 2R0KA 1GI7B 1S0QA 4YESB 5HIZA 4E7RG 1AKSB 3SNEA 1O3GA 1WSSH 3IG6B 2P8OB 1ETTH 1XUIA 4TY7A 4CRCA 3VEQB 2G5NA 1F92A 4ZROA 4CBNA 2O8LA 4BAOB 1OSSA 3BTWE 3RUOA 2ODQA 3STIA 5DK1A 5A2MH 3SV7A 1P02A 4NIYA 2ANYA 3A87A 2ZPSA 1B0EA 1M9UA 2J98B 1GWAA 4ABEA 3A7WA 1V2MT 4IC5A 4FUCA 3E0PB 3L33A 4ZKOU 5HKKD 1OYTH 1NRNH 2Y81A 4AOQA 1UCYK 2F9BH 3PRDA 2ZECA 2OP9A 1DFPA 4OS5A 2ZO3H 3PMHB 3TGKE 3CS0A 2EI7A 3DA9B 2AHME 1AVWA 5FPYA 3GCHC 1Y3YA 2BZAA 3P95A 1AU8A 1TQ7B 5B6OA 1YM0A 5C1XA 2BB4A 1TNHA 2B5TB 3H5CB 4I8GA 1GBDA 1VCPA 2Q6FA 1K1JA 1F0TA 1SHHB 3HGPA 5GIBA 1ZHPA 1HIAB 1NROH 4XFQA 2F91A 5I46H 1O38A 1O5AB 1RXPA 5ESBA 1O34A 2J97A 1TGNA 2XW9A 1IQJA 4UFGH 2G52A 4RT1A 2FOMB 1T7CA 1O31A 2ANMH 3RXEA 2ZC9H 1BMLA 2G00A 4FUIA 1ZRKA 1O2RA 1CVWH 3STJA 1QL7A 1RTFB 1XKBC 2SNWA 4ESTE 3MU8A 1LPZB 1O33A 1P0SH 2RA3A 1LQEA 1SGRE 5EW2H 2WPJS 4ABJA 1JIMA 1EFRD 1UCYE 3MI4A 1V2QT 1BMFD 4A1VA 1V2LT 2F83A 1UK2A 1TGTA 1YPLH 2L74A 1C5TA 4YOGA 2P16A 2A1DB 4AFQA 3LC5A 1ZJKA 1P8VC 2A5IA 3ENSB 1DLKB 3ATKA 3GY7A 1GDUA 5EJ1A 2IOTA 1PYTD 1VKYA 1AFEH 2BLWA 3SUEA 3ZVDA 3FP7E 3EE7A 3VB7A 3QZRA 2GZ8A 3SQHE 2ZPRA 3VXEH 2R2WU 1XUHA 1T32A 1C1NA 2WV4A 1QRZA 2A4GA 4OS1A 3B23B 2CF9H 4ZUHA 4DVAU 1AI8H 1HJ8A 1E79D 1MTWA 1TBRH 3SUFA 2I6QA 1P3CA 2GV7A 2KX4A 1TMUH 2WV9A 1O2ZA 2GZ7A 2AMQA 1EJMA 1P2KA 3E0NB 4J1YA 2F4LA 2VB0A 3EDXB 2SGFE 1S5SA 3A8CA 1MU8B 3VFEA 4DT7B 3MOCA 1FAKH 2EA3A 1NRQH 1EJAA 1QJ7B 1GMDG 5GDSH 1OP2A 4BXSA 1W13U 4NZQA 2VGCC 1W2KH 2FS8A 1P01A 2JH6D 3MO9A 1BTYA 4D8NA 1L4DA 1LKAA 3DSOA 4OM9A 2YMSD 2BVXH 2QV1A 3ZVFA 3A86A 3SJ8A 2F9NA 1K2I1 3U98H 3A8DA 4XSKU 1K9OE 1G36A 4X1SU 4LZ4B 1GBHA 2HNTE 1YPGH 1S84A 1GI2A 1TLDA 1BTWA 4ISNA 1P3EA 5EJZA 1SGNE 3E90B 4A6LA 3H7TA 2AERH 4DCDA 2QE7D 3MQKC 1NU7B 2FDAA 2Q6GA 1DE7H 5DO4H 2KFWA 1THSH 1AKSA 2OD3B 2V3OH 1KXAA 1C5OH 1N8OB 5EXLA 1L4ZA 1TNGA 3L3TA 5A8XA 3F3BA 1O2YA 1XVOA 1SFQB 1WAYB 3QWCH 1BTUA 4CREA 1HAHH 1IHTH 2ZDAH 2UWLA 3RXLA 1THPB 1O2WA 4MQAA 3QN7A 1OS8A 4DGJA 4AYYB 6GCHG 1YLDA 4CR9A 2R2MB 4YM9A 2L6OA 3URCA 1BUIA 4D9QA 4WMEA 1K1NA 2J98A 2Y7XA 4NG9H 1TB6H 4K1SA 2QC2A 1JBUH 3PYHA 3F0OA 2G5VA 4R0IA 2HPQH 4F55A 3F9EA 4NWLA 1BITA 2HOBA 1OWKA 1TQ0B 1WV7H 1MQ5A 1EKBB 1CSOE 4VGCB 2H1UA 3FZDA 3MU4A 3MWIU 1ZLRA 3S7HB 2BDYA 2W6JD 3U9AH 1GJ4H 5DP4A 5LPEA 1GDNA 1QB6A 1LVMA 2BQ6B 3A82A 1ARBA 1BTZA 3ZZ7A 1OOKB 8GCHG 1AVXA 2ZU4A 1NZQH 3QX5H 2BQ7B 1RD3B 2FX6A 1E37B 1NN6A 1D3PB 1G9IE 2W5EA 3SU0A 3NK8A 2BVSH 1GCTC 1TFXA 1S6LA 4ISHH 2UUYA 2P3FH 3BG4C 4ABBA 1VCQA 2FOBA 1QL9A 4NWKA 4B71A 4NA8A 5DGJA 4I8KA 2XWBI 1G32B 1C1UH 1UTPA 5K7RA 3K2UA 3F9FA 1QBVH 3ESTA 4NSVA 1SMFE 2QA9E 1C1PA 2ZQ1A 3SV6A 4ABIA 3NKKA 1GBFA 1DX5M 1U6QA 5HM2A 1SC8U 1LHGH 4JZDH 3KGPA 3OY6U 1CT2E 1NC6A 5JB8S 1EAUA 1V2UT 3SNCA 2QYIA 2V35A 7KMEH 1KLTA 1O2JA 1UVPA 1P2QA 3GCNA 2EY4C 3OTJE 4UFFH 5A0AE 3GY8A 1A0JA 3SU2A 2OQ5A 3QTOH 2SGPE 4CBOA 1C2IA 1DWDH 2K8IA 1H8IH 1LHDH 1SOTA 1TBQH 3M5MA 3RXVA 1DVAH 3PO1C 1UTLM 5C94A 3PLPA 1TPOA 7LPRA 4P02A 1TA6A 1EAIA 3GY5A 4FUFA 4DT4A 5K0HA 1GBBA 5PTPA 1OWHA 4BAMB 4X2WA 1WXRA 2PKSC 1SHYA 3W1EA 4OGYA 5C20A 2Y5GA 1DLEA 1P12E 2C93B 4B76A 2J5UA 2QXJA 4KP0A 2BM2A 3KYFA 1ZMNA 1ZYOA 4YLUA 1MCVA 3UQVA 1GCDA 3T62A 4DW2U 3U1JB 4AYVB 2CGAA 2OCVB 3FANA 3U69H 5B6LA 4Y7AA 2FOGA 1GDQA 1SGEE 1VZQH 2P3TB 3MNXA 2A32A 2ZI2H 4ZXYH 1SI5H 1ZOMA 2QAAA 1LDTT 3OAAD 5EPNA 3PV5A 1EB2A 2THFB 3GOVB 3QO6A 4YOJA 2Y80A 1ZGVA 3P8NA 2M5TA 4Y71A 4Y6DA 1BA8B 1EP6A 1B7XB 1DSTA 1W12U 1UTJA 1TE0A 2W6ID 3RU4T 1SB1H 1TPSA 5J4QA 1FNIA 1C2MA 1DPOA 2XCNA 3TK9A 1NY22 5JPMH 5DPAA 1S0RA 2WPKS 1ELDE 5JBAS 4TWYA 1ETRH 1HAZB 1H9HE 1AE5A 2BHGA 4K69A 2ZPQA 5FBIA 3E16B 1IQLA 3NPSA 3S69A 1A7SA 1GVKB 2ALVA 1A5HA 3F6UH 4NA7A 5L30H 4AB8A 2V0BA 1TX6A 1MZDA 1LTOA 2BY8X 2OQUA 4GLYA 3S9BA 1HJAC 4CRBA 4LK4A 4A1TA 1ZZZA 3M3VA 3F2FA 3UOPA 3V3MA 1NESE 1S83A 2FLRH 3SYJA 1XKAC 5DP8A 1K21H 1QBOA 2STBE 1QJ6B 1ZHRA 5LPFA 1DS2E 2BVRH 2PSXA 1HAVB 1RJXB 1C5ZB 1O3NA 3NWUA 5CHAC 4XBCA 4F48B 2NU2E 2RDLA 1O2UA 5F8XA 3A81A 3MH6A 1H8DH 1BCUH 5DP9A 3SGAE 1A5IA 3BTME 3ZZ4A 3RP2A 1J9CH 1VITH 2ZHFH 3GDVA 2LP6A 4AG2A 3TJVA 2WZQA 4XRNA 1GMDF 4B73A 5DP6A 4WXVA 1CGIE 2F9UA 2ZFTA 2ZCHP 1ELTA 3FN8A 1VGCC 2SGDE 4B2BA 3E8LA 1C5XB 1KMHB 2NU0E 1V2JT 2GT7A 1AQ7A 4AB9A 1GBEA 3LH3A 5BPEA 3SJIA 1BDAA 3KHVA 3TH2H 2ZDNA 2A5AA 1VR1H 5EXMA 1PYTC 2RFKC 1GI0A 1S81A 1FX0B 4ZKSU 1G3EA 4ZKRU 1V2PT 3SOSA 1O2PA 3SU1A 5T1VA 1Z71A 1RTLA 2Z3EA 1H4WA 5JBCS 2Z6BD 1RRKA 1G3DA 1CA8B 4K3JA 1HXEH 2EEKA 2UUKB 4XE4A 1SSXA 3PMAB 2SFAA 1SGTA 3FZZA 1AVGH 4O3TA 3FP6E 1FAXA 4JCNA 2M2AA 2GKVE 1CBWC 2BMGB 1GHZA 4MNVA 1BMAA 1SOZA 4CH2B 3VGCC 1LVBA 2A45B 3ZVGA 1QNJA 3D49H 1DXPA 5DP7A 4HZHA 1HFDA 3LC3A 1YF4A 2ZFPH 3ATLA 4U2WA 4TWWA 4ZKNU 5F8TA 1Y5AT 1KDQA 1YPMH 1MTSA 3ELAH 1PPBH 4AZ2B 3RXAA 3LH1A 1NFYA 4HFPB 5C5NA 1BB0B 1GHXH 2BYAX 2XWAA 4X1QU 6GCHF 1G3BA 4X8TH 2SGEE 1KTSB 1QR3E 1YBWA 2YMSC 1EOJA 4THNH 1T8OA 4MG3A 4X2XA 5L2ZH 2G4UA 1J8AA 2ZHWH 1C2LA 1Z8RA 2R3YA 3DHKH 3IITA 4OS2A 1QRWA 3RXDA 2WYGA 1NRRH 1K22H 1ELAA 1FY8E 2VIVA 3BTGE 5SGAE 5A8YA 1OYQA 1DM4B 1SGQE 1GCTB 1AO5A 3EAJA 3P70B 4I31A 1GBTA 5IYTA 4I33A 4AFSA 1AFQB 3KCGH 1DWCH 1W10U 5C2ZA 4NA9H 2Y6TA 5FCRA 1SQTA 5FX6A 4YXWD 2KAIB 2FYRA 8GCHF 1AUTC 1AB9C 1GJ7B 1Y3VA 1SQAA 5F6MA 3TGIE 3VG8A 2XC0A 1GBLA 4X6NA 1C5RA 3C1KA 1C1MA 1P2MA 1BRCE 3PROA 1C2FA 3RXIA 4K2YA 1C4V2 3MH5A 2FWWA 1BRAA 2BLOA 4CRDA 1IQIA 1H9LB 1HAYB 3UR9A 1W8BH 1O5BB 5DSFA 2FOAA 2HWLB 4DY7B 1SQOA 1DANH 1V2TT 1C5NH 2KCYA 5C17A 3FO8D 1BJVA 4YLQH 3HK6B 4IN2A 2R9PA 1QHRB 4XD7D 4UFEH 3DCLA 4R8TB 3SV8A 1W3CA 1T8NA 2R3UA 2P94A 3A80A 3ZVBA 2Y7ZA 3FKSD 2TBSA 1TNIA 1PJPA 1NBME 3ZZ8A 3BSQA 1BZXE 4XOJA 1MD7A 1HAIH 4ISIH 1EZQA 3RDZA 1V2KT 1GBCA 1J14A 1O2VA 1KY9A 2AS9A 3TK6A 2UUJB 1ZMJA 2GT8A 3TH4H 3BV9B 1TGSZ 1T8LA 3KQEA 5C0TA 3GISB 1FY1A 2GGVB 3QLPH 3BEUA 1UHBB 3DD2H 5L6NH 4O03A 4CH8B 1JMOH 1ABJH 1TGBA 1YPJH 2PWXA 1P2JA 4JK6A 1GGDB 2ZFQH 2GCTC 2VBCA 4RKOB 3ZZBA 1F5KU 1FZZA 1MTNB 4K8BA 4YTAA 1KXDA 5C5OA 2ODPA 4HGCA 4WWYA 2QXHA 1BTHH 2C90B 3M3TA 4P00A 1GMHG 1MUEB 4Y79A 1ARCA 2QXIA 2BD3A 1NRPH 2JETB 1P09A 3FOAA 2NWNA 4BAHB 1TGCA 3EE0B 1TPPA 1ZMLA 2ZDLA 3N7EA 2QIQA 4ZHLU 1KYNA 1S6FA 3DUXH 3RMLH 1HPGA 1SGFA 1O36A 1MMJN 3UWJH 1K1IA 1A3EH 3VB6A 5ETXA 4Z0KA 1GI8B 1SLWB 1FY5A 2FS9A 4UFDH 4WJG2 3SI3H 2BZ6H 1K1LA 1P05A 1O2GH 2IJOB 1WCZA 1EPTA 1ZHMA 1XXFA 2ILNA 1YPHC 3F68H 4D9RA 3KF2A 1YPEH 1GHWH 1UTMA 1YGCH 5L2YH 1IOEA 1QJ1B 4WH8A 1PPGE 1TIOA 1O2IA 3MU1A 3O8DA 2XOKD 2BDGA 3P17H 5DP5A 2GX4A 3MNBA 4NFEA 5F03A 4M9FA 1ELCA 3T29A 5FAHA 3KEEA 1BIOA 1HB0B 6LPRA 1JIRA 1Z8IB 5GCHF 3HATH 3HKIB 3U8RH 4IS5A 1DSUA 4DOQA 1A46H 3T5FH 2ZGXH 1BRUP 2BY5X 2FESH 3K65B 4Q4LA 1LCYA 3A84A 2PUXB 4FVBA 2QF5A 4H4FA 2Y82A 1MKXH 4I86A 1QB9A 2VH0A 1K0HA 3SV2H 1J16A 5E0HA 3KN2A 5AHGH 1QA0A 9LPRA 1GG6B 3TGJE 1C1SA 2KR7A 3RC5A 2O8MA 1YY3A 1GJCB 3RMOH 1UVTH 3ITIA 3WWBA 3F9GA 2DUCA 3BTKE 1WOFA 3CNRA 5HMAA 1IAUA 1TPAE 2XRCA 2VVUA 2D1JA 1GHBG 1IHSH 2QF0A 4MPXA 1HAGE 3SU5A 1GI4A 3ZZAA 3S0NA 1NM6A 1HRTH 3M37A 2NU1E 3MO6A 1RIWC 4CRAA 2TIOA 1PFXC 1Q31A 3RXUA 3RXMA 2CHAB 3WWFA 2WPMS 2PTCE 1O3IA 2A0QB 3ZV9A 1G30B 1D9IA 4Q7ZA 4OS7A 1ANEA 3LGVA 2H5DA 1P9UA 3SO3A 2FOEA 3UFAA 3RM0H 1IQGA 5C1YA 1PPHE 1KTTB 1LMWB 2QGRA 1O3AA 2AIQA 2ESTE 1O3LA 4BANB 3RM2H 3E1XB 1ZTLA 2FLBH 1TRNA 2AYWA 2PHBA 2EI8A 1ESBA 1H8ED 1TABE 5C3NA 5HYOA 2TGDA 5LGOA 2JIZD 1OKXA 3I29A 3RXFA 4F4OC 4KTCA 4RSPA 2QCYA 2YMSB 3KQ5A 4XBBA 2AIPA 4UDWH 1OXGA 2GDEH 3V12A 2A5KA 3A89A 3TNTA 4FOUC 1WBGB 2ZTZA 3RXTA 3I77A 5G4BA 3PLBA 4Q63A 4B2CA 1FV9A 1FN6A 1UVSH 2VVCA 4F49A 1C9PA 1EPTC 4TSFD 3EA9A 1EAWA 3DFJA 2VH6A 4YZUA 2ALPA 2ZHEH 3M35A 3N99A 3SJ9A 2ASUB 2Q6DA 1H9IE 4MNXA 1AB9B 5LPRA 3RXPA 1TA2A 2BDHA 1WU1A 4IBLH 4U30A 5DP3A 3A7ZA 3A8BA 2B0FA 3SN8A 2IN2A 3U8TH 4Z6AH 2IPHA 2V7QD 1S85A 1FJSA 4AGKA 4ABHA 3VPKA 2ZGHA 4Y11E 3FAOA 4GPGA 3NRLA 3SHCH 2VIQA 3DSGA 1SG8B 2OUAA 1GMCG 3RLWH 2F9VA 3ATWA 1SLXB 4RN6A 4D7FA 1Z1JA 3RMNH 3TU7H 5A0CA 1NPMA 1Z6EA 1PPEE 2BD2A 3TJUA 1E1QD 1HIAA 2WV5A 2BLQA 2J92A 2Z7FE 1O39A 2H9TH 1E38B 1O35A 1LHFH 1OWEA 1TALA 2ZKSA 5HIYA 4JZFH 1WTGH 2F9PA 2FXRA 1DWEH 2PP6A 3MMGA 3MH7A 1MAXA 1V3XA 3V0XA 5FXLA 2CN0H 4A7IB 2O9QA 2CF8H 1ANBA 1Y5BT 2HNTF 4BXWA 3NXPA 3TJOA 4ASHA 2EC9H 1C1VH 3TK5A 1PQ7A 2G55A 4BNRA 2ZEBA 3E6PH 5EQQA 5EPYA 3GCHB 1CHOG 2ZDMA 4FUJA 4Q80A 1MH0A 2VJ1A 4A5TS 1YKTA 1MU6B 4B75A 2ZWLH 1YWUA 1GBJA 1O2NA 2ZGBH 5T6FA 4Y76A 1FLEE 5FL7D 4MNWA 2EQNA 2OC7A 3LT3A 1P9SA 1WQSA 2PW8H 1DWBH 5F53A 2ZF0H 1HYLA 3UR6A 1VITF 5CE1A 2NU4E 3RU4D 1QFKH 1FI8A 4DG4A 5EJLA 1C5PA 3TJNA 1QTFA 3URDA 2QY0B 4FUGA 4TPIZ 1W14U 4SGAE 4YO9A 1OWIA 3V7TA 2QN5T 4ABAA 2YOLA 2ZU5A 1GMHF 3UY9A 4IC6A 1GI9B 2OBQA 2KCOA 2FTLE 1L2EA 1VJ9U 4X8SH 4ZHMU 2LNCA 3BIVH 3KIDU 1UTQA 2ZIQH 2OLGA 4FUHA 3SUGA 4ZXXH 1GJAB 1ANCA 3TPIZ 2J2UA 1A61H 4H42U 4X0WU 4E06H 5EIYA 2TGAA 3BTHE 2P95A 2XXLA 2ZGCA 4AC9A 1K1OA 5AFZH 1AZ8A 1ZJDA 2H2ZA 3F9HA 3LGUA 2FI4E 3K6YA 2VWOA 3PRBA 1TX7A 3MYWA 2FTMA 7GCHG 3GY3A 2KCPA 3ODDA 1AUJA 2ULLA 1NT1A 3F2GA 1GBMA 5GXPA 1OHHD 1MCTA 4OS6A 1T8MA 1XVMA 2UWPA 2PUQH 3Q77A 5FPTA 3LOXA 3N7DA 3EA7A 4JZ1A 1CQQA 1QZ8A 1O2SA 4Y8YA 1O30A 1Y8TA 1C2HA 1X7AC 2XNDD 1AY6H 3A8AA 3CENA 3PTBA 2FEQH 3M5NA 2AEIH 4FVDA 1KLJH 5JDUB 5AF9H 4OGXA 5DJ7A 5GCHG 1L1GA 3KNXA 2PSYA 2GVFA 5C0UA 2BDIA 2ZFFH 4BAKB 3VB3A 1QQUA 2VWLA 1O3EA 2AGGX 3P8OA 2ZG0H 2VINA 1ZSLA 1WTHD 3M36A 1D3DB 1BQYA 4YOIA 3RXBA 1UTNA 3SGQE 2ANKH 5KGOA 5A0BA 3BN9A 1RIWB 2VGCB 2XC5A 1BBRH 1TNLA 4RT0A 5EXNA 2PV9B 3F0PA 4YT7H 4NFFA 2GCHG 1FUJA 2GV6A 1TYNA 1RS0A 1XUKA 2JKHA 2Y5FA 4B74A 3A83A 1V2OT 1C2DA 5GNDA 4JYVH 4FU8A 3SV9A 3ZYEA 1L0ZA 3UUZA 1MKXK 2AGEX 3BTTE 3BEIB 1MKWH 2K1QA 4X1NU 1GHBF 1F7ZA 1QY6A 1UK4A 4SGBE 1O0DH 3D62A 1KXEA 1Y5UT 3EYDA 1MABB 1GHAF 2ZCLP 2Y5HA 2B9LA 4ZMAH 1C1QA 1G2MA 1ID5H 1DITH 1PQAA 2ZGJA 4Y7BA 3DFLA 4O9VA 4K8YA 2J9NA 4Y8XA 1F0UA 4ZH8A 2ZQ2A 1V6DA 1RGQA 2WSSD 1G3CA 3SUDA 4ISLA 1O5GH 3K9XB 1WUNH 3BTQE 1Q2WA 3BTEE 1V2WT 1UJ1A 1PPZA 2GTBA 3QTVH 3UQOA 2RG3A 2XC4A 4MVNA 2ZFRH 2O8UA
chains in the Genus database with same CATH topology
3Q00A 4GHTA 1E34B 4K1EA 2HRVA 4B1TA 1UO6A 1YCPH 4AN7A 1NFXA 4X8VH 2QF3A 2FOCA 2ZCKP 4ZCNA 1C1TA 2FZZA 4Q2KA 1IQEA 4NIXA 2D2DA 1C5SA 1FY3A 2BQWB 3TIUA 4INHA 4KGAA 2HVXA 3ZYDA 1QCPA 3FP8E 4D76A 3Q76A 1W0JD 3AK5A 3D65E 3R3GB 4O97A 1KXBA 1Y3XA 1ZPZA 1ETSH 5ESTE 4RKJB 1HDTH 3Q3KA 4ZAEA 5LH8A 2J34A 1A0HB 1XM1A 2WPHS 1TX8A 2FYQA 4JK5A 1WQVH 1WYKA 5A8ZA 1D6RA 3JZ2B 2GMTC 4U32A 4GVUA 3CP7A 3UOUA 1GI5A 4MNYA 1C5UA 4IW4E 1EZUC 5DN6D 1V2VT 3BG8A 1EATA 3A7TA 2P3UB 3BG4B 2BD8A 4LOYH 1ABIH 5EW1H 1N6XA 1CHGA 1SGIB 3M61U 3OTPA 1BJUA 1J17T 2CK3D 1E1RD 5FX5A 2BY9X 8LPRA 1Y3WA 4XDEA 1GMCF 5TCCA 1FPCH 1XXDA 1TBZH 1VJAU 4Y8ZA 4GHQA 3M7UA 1AD8H 2FOFA 1N8OC 2BD4A 1O5EH 2A31A 3T2NA 2VIOA 4K5ZA 2Z9JA 2Z94A 1V2RT 4ZHAA 2YNAA 1HUTH 3OE7D 3LPRA 4CR5A 3ODFA 1GJBB 1YPHE 1QB1A 2BDBA 3F2HA 1EASA 1MBMA 1SBWA 5E0JA 3UNSA 4MPWA 4DJZB 3HGNA 2BD7A 3PWCA 1B0FA 1QBNA 3OY5U 3NZIA 1S6HA 1THRH 3ZZDA 5T6DA 5JB9S 5JBTA 3P6ZB 1C5MD 3ATIA 3PO1B 1O3PB 4FUDA 3ZZ3A 2UWOA 1C2KA 1C5QA 1QL8A 4AGJA 3SNAA 2HGTH 2PKSB 1CHOF 4VGCC 2Z9GA 3AW0A 3QGJA 5FHTA 4JYTA 1QRXA 2DE8A 1IQKA 2VIDA 2K0QA 1Y3UA 4GCHG 1FPHH 1SGPE 4WMDA 3QGNB 5GWZA 4UONA 2ZP0H 3PWBA 4UE7H 1O2OA 3KQBA 1HXFH 1FN8A 2PGBB 3OYPA 4TPYA 2AMDA 1YPKH 1DICA 1VITG 2G4TA 2HPPH 4AFZA 3U1IB 1ELFA 2BXUH 2WUCA 3GYMA 4NCYA 1W7XH 1QA7A 3AW1A 2XCFA 2PLXA 2WPIS 4MTBA 5IK2D 4WH6A 1EUFA 4Q7YA 3T27A 2LPRA 1JWTA 1Z8GA 1JXPA 5I25A 3LGWA 5TJXA 1FXYA 1IQFA 3RXHA 3RXJA 1O37A 1HAVA 2G51A 1C4U2 1Q3XA 3JZ1B 3N7OA 2DE9A 1ESTA 4TYDA 1EX3A 5CDFE 1KXFA 1O5CB 1DUEA 4XBDA 5EG4A 3MFJA 1CGJE 2WPLS 1ZPBA 2WUBA 1AIXH 3M7TA 3KQCA 3HPTB 1HV7A 4BTTB 1O3BA 3SNBA 2TRMA 7GCHF 2TPIZ 4HTCH 2VWNA 4X2YA 1HJAB 4YT6H 4X6PA 3RXGA 1P04A 1DT2A 4Y10E 2F43B 1XUJA 2BXTH 1O3CA 2OC8A 1UVOA 3O8RA 3GDUA 3NCLA 2C8WB 4CRFA 5HXFA 4ABFA 3OX7U 3F1SB 3BIUH 3A7XA 5TCAA 1BMMH 2BY6X 5CHAB 2ZDKA 4CRGA 3S9CA 3MNCA 4JMYA 1F2SE 4GSOA 1V2ST 2Z9LA 4CHAC 3UIRA 1D3TB 1GI3A 3UPEA 1GBKA 1PQ5A 2J38A 4FUEA 3EA8A 1SGCA 6CHAC 1EB1H 2PTNA 4AG1A 1FIWA 2Z3CA 3LGTA 1O2XA 1VGCB 2GP9B 1MTUA 2AMPA 2FP7B 4UD9H 3H09A 5F8ZA 2GCHF 3SQEE 1C2JA 4KTUA 3BEFB 3TVJB 1E36B 5C1UA 3S9AA 3SGBE 1BOQA 2BOHB 2ZA5A 4IMQA 4IN1A 3WY8A 3AAUA 1BBRK 4KELA 1P2OA 2STAE 4QT8C 3SNDA 4X8UH 1ZGIA 1COWD 1GJDB 2KCAA 2A4OA 1O5FH 2SGAA 2J95A 7ESTE 1XUFA 1O3MA 1JRSA 2ZFSA 3DT0H 1GHAG 4J2YB 3UNRA 2BX3A 1AZZA 2A7HA 2W7SA 1EJNA 1A4WH 1OWDA 2PKAB 3PLKA 3GY2A 3SHAH 1ELVA 3AAVA 1CBWB 1MKWK 1BTPA 5IDKA 1ZSKA 3VGCB 1YYY1 1O3KA 3UB0A 4ISOA 4WF8A 1O3JA 4RI0A 3T25A 3PV2A 4O3UA 3RXQA 4A92A 3PV4A 1O5DH 2J94A 3W94A 3ZVCA 2O8WA 2UUFB 1C2GA 2KAIA 2D8WA 1CO7E 1DXWA 2QXGA 1BHXB 2EI6A 3GDSA 5JYIA 3C27B 4Y0ZE 1T4VH 4K60A 1A2CH 1KXCA 2GMTB 4JZIA 1TNKA 5E0GA 3B9FH 1K1PA 1OP0A 2PR3A 5DG6A 4TT3D 1D6WA 1BBRE 3QZQA 2XBYA 3Q3YA 1CU1A 2OXSA 3FVFB 1OWJA 1ZTJA 3P8FA 4BAQB 3KL6A 2F3CE 3UNQA 1GJ8B 4X1RU 1O2KA 2JDID 1MQ6A 2BLVA 5FCKA 2FM2A 3UTUH 2LELA 1C5VA 1YCPK 3NUMA 3O8BA 1AGJA 1F5LA 2KZ4A 4DIHH 3VB4A 2W3IA 2FX4A 3PMBB 1O3OA 1FY4A 5E2PA 4IGDA 3BTFE 1K1MA 1VCWA 3IWMA 3MO3A 1GL0E 4B6FA 3TNSA 1MAYA 2G81E 1P10A 3RXSA 5EODA 1DDJA 2B7DH 4INLA 1TOCB 2GD4B 3RLYH 4NIVA 5T3HA 2W7UA 1P2IA 1V2NT 2GZ9A 1HLTH 1UHBA 5CMXH 2WPDD 3LJOA 5DKMA 1J15A 3TITA 4AFUA 5EQSA 3GCTG 3MU5A 1NRSH 3GS9A 2C8XB 3CS7A 4BTIB 2SNVA 4Q7XA 4FETA 1CA0C 1IQMA 1H1BA 1NU9A 2ZU1A 3RC6A 4PROA 1NFWA 3U8OH 2FOHA 4ABDA 2PGQB 2I6SA 2OC0A 1SGDE 1P06A 1O2LA 2W26A 2H9HA 1AMHA 2TGTA 1SKYE 1D4PB 3A7VA 2XBXA 4NZLA 1DY9A 1KIGH 3OSYA 1YCPM 3UREA 2Q1JA 4FU7A 1INCA 1PPFE 3LJJA 1E0FD 1LPKB 2Z9KA 1C5YB 1LHEH 3PM3A 1QGFA 3A88A 1K28D 3RXOA 1F5RA 1FONA 3RC4A 3LGYA 3B8JA 3I78A 1HAPH 1P11E 4FU9A 2A4QA 1AWFH 1G37A 3EGKH 1CT0E 1IQNA 1SGYE 1H8HD 1GVZA 1ZR0A 2GCTB 4WXIA 2BX4A 1FMGA 3VB5A 5T6GA 1O2MA 1AFQC 4WY3A 1DOJA 2A2XH 4KTSA 2QF4A 1ZSJA 6ESTA 1O32A 1BRBE 4GCHF 1W0KD 1BT7A 1A0LA 1P2NA 3HKJB 2H5CA 1KDQB 5GPIB 2ZHQH 2WYJA 2HNTC 4MDSA 1C5LH 3R0FA 1CT4E 2XBVA 1C4Y2 1GJ9B 2ZU2A 2ZTXA 2JH5D 3K6ZA 1Y59T 5J4SA 2JJ2D 4X6OA 1CGHA 2G8TA 2NU3E 4MPUA 2FPZA 1UCYH 1XX9A 8KME2 2P93A 1FIZA 2ZNKH 1NO9H 2C3SA 2VIWA 1GJ6A 3RXRA 3RMMH 1C9TA 2ZZUH 4Z1MD 1EQ9A 1P57B 5E8EH 3DSPA 2FO9A 1GJ5H 4I8LA 1GBAA 5HM9A 3QK1A 5EQRA 4AORA 3ZVEA 2WINI 1Z1IA 2P8OC 1TAWA 1LKBA 2AFQB 3OEHD 1C5WB 3ATMA 5BRRE 3AVZA 3LIWA 1XUGA 1JOUB 2RCEA 1YLCA 1EP5A 2BY7X 1T4UH 3PMJA 3KQDA 1O2TA 5AFYH 1C1WH 3P8GA 5A09A 1GHYH 2F9OA 3V13A 3OFND 3SU3A 4X6MA 1PPCE 3LDXH 3SW2B 2FODA 5GJ4B 1MBQA 2W3KA 1UTKA 1Z7KA 1L1JA 1Z6JH 1ELBA 4CHAB 4GAWA 2PKAA 2WHXA 2CV3A 3UWIA 2BDAA 8ESTE 1JRTA 2ZDVH 1NBMD 2FI3E 2FMJA 1TMBH 2YNBA 2VNTA 3G01A 1ELGA 3MH4A 1A1RA 1ACBE 1ESAA 3M5LA 6CHAB 1HAOH 4NIWA 1YC0A 1O3FA 2A7CA 4X2VA 3SZEA 4Y0YE 1DUAA 1GGDC 1ZTKA 2GDDA 3E91A 1MTNC 9ESTA 2CXVA 5JBBS 3SORA 1NTPA 2V3HH 3GY6A 2ANWA 1GBIA 4U01A 3SU6A 3OEED 4JYUH 4BOHA 1C1RA 1O2QA 4M7GA 2JETC 3TLOA 4MPVA 1ANDA 1TONA 2C8YB 1UK3A 1W0ZU 1IQHA 2H9EH 3QDZB 4LXBH 1HAXB 5ABWA 1UVUH 2OK5A 1EZSC 1EZXC 1RFNA 3HK3B 2AH4X 2R0LA 5HGGA 3OU0A 1QIXB 3MHWU 1BTXA 1UTOA 1N1LA 4H6TA 3Q3XA 3O8CA 1ZPCA 5EU8A 3SZNA 1GPZA 1O2HA 4IMZA 2AGIX 4TY6A 1HNEE 1N6YA 1L1NA 2A4RA 1W7GH 2FI5E 2IJD1 3LKWA 1LVOA 1FQ3A 2OC1A 3RXCA 1ZRBA 2CMYA 3T28A 1G2LA 2VIPA 2P59A 4B6EA 3AASA 1OX1A 4H6SB 4WMFA 3ZZ9A 4GUXA 2C4FH 1A3BH 2ZTYA 4K1TA 1P03A 2Z9IA 2PFEA 1ORFA 2BD5A 1AE8H 4I8JA 4D7GA 4NSYA 3BF6H 1TRYA 4E05H 2ZHDA 1GI6A 2O8TA 1F0RA 3MTYA 3SBKA 3SU4A 3GYLB 4ASUD 3M7QA 4KKDA 3A85A 2XNIA 3QUMP 1SR5C 2JH0D 1HGTH 1S82A 2SGQE 1MZAA 1EPTB 3VXFH 4AX9H 1GG6C 1LQDB 2XTTB 2B8OH 2Z3DA 1EOLA 3H7OA 1LHCH 3M3SA 3LU9B 1SGFG 5AVDA 3RXKA 2J4IA 2OINA 4I7YH 3ZV8A 1KLIH 3T26A 4I8HA 4FUBA 1LVYA 1MTVA 5EOKA 1AHTH 1TNJA 5E2OA 2A2QH 2VU8E 3P92A 3PTNA 1C2EA 1BHXF 2HLDD 1F0SA 1YP9A 1HBTH 2CHAC 2ZU3A 1SPJA 5H4IB 3MU0A 1CA0B 4FXGH 1T31A 1QURH 1HCGA 4DIIH 1C1OA 2OTVA 1LO6A 1TWXB 1SLVB 1NFUA 1HJ9A 3SJOA 4X1PU 1E35B 2BOKA 3GICB 4E7NA 2RA0A 1BMNH 1TMTH 1RTKA 1MD8A 3M5OA 3LONA 2XYAA 4INKA 3ZZ5A 1CE5A 2FIRH 1SFIA 2C8ZB 2BTCE 3E3TA 3WW7A 4MLFB 2XBWA 1AN1E 3MNSA 4LZ1H 1DY8A 1SL3A 2D26C 3GCTF 4BTUB 1UMAH 3L6PA 2H6MA 4NGAH 1FDPA 4ABGA 1O3HA 3D23A 4OS4A 2OBOA 3GY4A 1W0YH 1B5GH 1GHVH 3W95A 3PB1E 2HLCA 5EGMA 1GI1A 3EQ0H 4I32A 1Z8JB 1SLUB 2A7JA 2HALA 3SJKA 1LPGB 1W11U 1A5GH 4WVPE 3S7KB 2VVVA 5FPSA 4JZEH 4DURA 2BD9A 3GCOA 3LGIA 4A1XA 1TRMA 1KSNA 1QQ4A 1TOMH 1D3QB 1AWHB 1EXFA 1O3DA 2JJ1D 3FFGA 2V6NA 3RU4E 4HI3A 3ZZCA 1EAXA 3A7YA 5FBEA 1OP8A 2TGPZ 4UEHH 1GVLA 2VWMA 5CHBA 1OPHB 1PQ8A 3SI4H 1GL1A 1XMNB 3BTDE 2ODYB 2BDCA 3ZZ6A 1SVPA 4B2AA 3ZIAD 1ELEE 3TH3H 3ZVAA 5C67A 2KM0A 2CJIA 1NS3A 2R0KA 1GI7B 1S0QA 4YESB 4E7RG 1AKSB 3SNEA 1O3GA 1WSSH 3IG6B 2P8OB 1ETTH 1XUIA 4TY7A 4CRCA 3VEQB 2G5NA 1F92A 4ZROA 4CBNA 2O8LA 4BAOB 1OSSA 3BTWE 3RUOA 2ODQA 3STIA 5DK1A 5A2MH 3SV7A 1P02A 4NIYA 2ANYA 3A87A 2ZPSA 1B0EA 1M9UA 1GWAA 4ABEA 3A7WA 1V2MT 4IC5A 4FUCA 3E0PB 3L33A 4ZKOU 5HKKD 1OYTH 1NRNH 2Y81A 4AOQA 1UCYK 2F9BH 3PRDA 2ZECA 2OP9A 1DFPA 4OS5A 2ZO3H 3PMHB 3TGKE 3CS0A 2EI7A 3DA9B 2AHME 1AVWA 5FPYA 3GCHC 1Y3YA 2BZAA 3P95A 1AU8A 1TQ7B 5B6OA 1YM0A 5C1XA 2BB4A 1TNHA 2B5TB 3H5CB 4I8GA 1GBDA 1VCPA 2Q6FA 1K1JA 1F0TA 1SHHB 3HGPA 5GIBA 1ZHPA 1HIAB 1NROH 4XFQA 2F91A 5I46H 1O38A 1O5AB 1RXPA 5ESBA 1O34A 1TGNA 2XW9A 1IQJA 4UFGH 2G52A 2FOMB 1T7CA 1O31A 2ANMH 3RXEA 2ZC9H 1BMLA 2G00A 4FUIA 1ZRKA 1O2RA 1CVWH 3STJA 1QL7A 1RTFB 1XKBC 2SNWA 4ESTE 3MU8A 1LPZB 1O33A 1P0SH 2RA3A 1LQEA 1SGRE 5EW2H 2WPJS 4ABJA 1JIMA 1EFRD 1UCYE 3MI4A 1V2QT 1BMFD 4A1VA 1V2LT 2F83A 1UK2A 1TGTA 1YPLH 4YOGA 1C5TA 2P16A 2A1DB 4AFQA 3LC5A 1ZJKA 1P8VC 2A5IA 3ENSB 1DLKB 3ATKA 3GY7A 1GDUA 2IOTA 1PYTD 1AFEH 2BLWA 3SUEA 3ZVDA 3FP7E 3VB7A 3QZRA 2GZ8A 3SQHE 2ZPRA 3VXEH 2R2WU 1XUHA 1T32A 1C1NA 2WV4A 1QRZA 2A4GA 4OS1A 3B23B 2CF9H 4ZUHA 4DVAU 1AI8H 1HJ8A 1E79D 1MTWA